08Pi'&<  'iphP''`'&. &.i'&P@@<@T 08Pi'&<  'iphP''`'&. &.i'&P@@<@TU i`'&.yAiiiQ$f iiiRAiiiVAiiiWAiiiAiiiAiiiAiiiAiiiAiiimK2%iiiX`hpx$iii (08@HPS$qiiiX`hpxP$iiiSQ$(iii (08TJAiiiCiiiAiiiAiiimiii@HPX`hpx\$iii$iii$>iii$iii$siii$iiiAiiim iii$iii $iiiAiiiAiiiAiiiAiii$`aiii (08@H$iii$iii$iii$iii$iii$iii$iiiAiiiAiiiAiiiAiiiAiiiAiiicLLZRp +5SUsDAl#BHBVM.6PMm,X~5Xcz \N/tt޼4d6 {;º!N |UL>~5"qMa&. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4/%4 (JJ`"`"zz]$22$ TTT,,]$22Ptd(QtdNetBSDAPaXU SR ffffUSWVP[/.t$$ujPjjj~jr 0F $u & Q/tuXuk;(s(9rD$t Pi PZ ;s9rHP+ $06v@ PKUSWV [È..A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]USWV[û,.; s' ~*u.UE9r^_[]1SWV[l,.;s9r^_[f$SW&,.5u1ƃ5 tЃ th$k_[SW+.4uYƃ4$t|$h<$kt$?t<$ktЃ_[WVD$0tP>tKj/Vt@Ƹ!a"܁&PV@t&uVh`"h`"hlf3+#^_`SWVh`"h`"hlf3# 1۸!a"܁&P CPrFhlf3j 2whg%hlf3" uhlf3j g2j-D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5n3Y u$1^_[Vhc"Vhc"v/ 5n3hc"jLwVhc"j USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S& tutD$D$$D$% D$t$@N D$l$h n3h"$D$ @l$0tD$Phe$j D$  |$\$4t$,s$L$)L >QPhe"c D$  L$s()@L$L bQPhe"5L$ D$  s D t 4T&he" L$ D dtPh f"D$(@9XU辿\$D$T$T$9tt$N9BD$4T&5n3h*e" 1h^_[]t$|hd"&%WS$h>e"h[e"jUU45n3hye"jjt$|hc"5n3hnd"3$he"jhc 5n3 u15n3h-f"jSWVPD$Hw#t$>4&WOt ub8&$h"c"W*t N1AQhc5n3q u 1^_[5n3hBf"jUSWVP|$t$78h>c"WV fu <n3u _3)u n3uhAc"Ic"t n3hjQoi n3u 5n3hRc"Ihu3$(&SUt uUh{c"jqh[c"j蕚$NPVS& P| Vlf3PhVf"V Vjjhf"C&&hf"hlf3 uj! 5n3fiWVοVt&]tuVhc"j贙x&^_VPΉj PQ x $9u^Vhd"j{WVοV&tuVhd"jMt&^_USWV\$$1n3 n3ho3 do3sV肞j=P x<$hjjh<&U  n3H F H n3VP3un3t;#=t%{ n3##=uthRg""n3tttzut!tcun3X o3^_[] n3zVhf"W Whg"4$hf"4$h"g"jŗhlg"hg"D$L$0161PjPjt$h>j$茂n3n3ho3do31PjPjt$hg"\o3o3hg"jA1hjPPt$hh"(o3o3 tj91PjPPt$hh",2tZj n3u$1PjPjt$h)h"輁ho3do3ËD$po3h:h"j藖1hjPPt$hPh"~|o3xo3h\h"jcn3u$1PjPjt$hsh"Dn3n3ËD$n3hh"j1hjPPt$hh"n3n31hjPPt$hh"ހn3n3fSWVo3t/ `o3\o3 t5Po3)փ>8F uPo3n3To3 Xo3 n3n3;n3 n3r*jZn3Po3n3 n3 Xo3To3^_[áXo3 To3 t n3n3hN&h"$jhN&h"$jhL&h"$jhL&h"$jԔUSWVt$|$6Q2$b#SjUSVW薜 u=_3PMpo3u,po3$to3o3d&Ahh"jUo3d&1QQPb to3y 5po3Lo3 Lo3 =,2rlo3uhNi"롡n3u#n3n3i"n3d&1n3Hn3d& hQPCb n3yJ1n3H n3 hP5n3Q n3 n3y 5n3n3n3n3utS1V do3o3o39ho3r_ Lo3t= o3 n3E n3t# Lo3) do3I n3" Lo3ujln3 Po3n3xo3 |o3t n3 n3t n3h`u;5n3 n3=n3 n35n3VP5n3W n31Vh@o3膣hjhj5n35n35n3n3h-,2e=n3o3 o3 to3o3 o3o39ss$Po3 do3tQj QjPS o35do35Po35to3P$ xd5ho3-do31‰1 \o3 `o3To3 Xo3o3o3To3 Xo3n3 po3xPh"$;+lo3u6o3j5ho35do35to3P  t5po3h"$n3 ho3do3 `o3\o3To3 Xo3o3To3 Xo3o3Cn3s `o3\o3To3 Xo3o3To3 Xo3 o3u@s)t(o3,o3H Po3PQQI \o3Po3o3n3 n3j1Xo3To31`o3\o3hzi"j~Ph"$jqWVo3=t=X=zu 7n3n3 n3t;n39щ5n3s))Rj5n3 n3 n3n3 n3 u\5n3=n3 tJ5n3j5n3 n3 n3n3 n3n3ʉn3)Ɖ=n35n3 t jY=n3un3jPu 8u*n35n3Pt^_h_#j>hi"USWVn3|$,tn3n3(p‰D$l$|$,u n3 xT$ n3n3 t!n3jQP5n3R !ƒ~t$VShn3 $~ D$ `18D$ Z n3n3 ʋ-5n35n3QP0o34o3o3o31n3n3T$<$t$ 8o3-X$^_[]5n3h/i"5n3hh"5n3hh"j5n3h"$jUSWVt$(|$,\$$Uhn3j6X C4WVs(P( N8jUjX :8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hi"jpV΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu{8u F ́Ĵ^v$h"$j҉VP9v VVPQ t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWVn3 n3t/jh"#j~U n3 n3tjh"#j`U 1t$PV蠙FȺMb׋ Ho3-։+@o3D$H Do3iى tL$ 1FD$|$ 5o35o35o35o35 o35o35o35o3hi"jdW ,W3PWjwT ,o3(o3 t?ƒ ʺ%tϕ#RQPhi"jd|$4WWPWj'T $o3 o3 t?ƒ ʺ%tϕ#RQPhi"jd|$4WlWPWjS t$ 4o30o3 t?ƒ ʺ%tϕ#RQPhj"jd|$4WW?PWjS =o3u =M=o3ui $Phn"hlf3 jSWVPΉjP]t4ÿ<$VWLt Ku1^_[hk"jzWV=o3t+t΃j PV= tuo3 o34^_USWVtՉ΀=o3u)t L$jPh l"h QL$jh PQ̇ =o3L$jvvQPhl"v$v vvvvhAl"vxvÉ(=o3u=o3pvX0貭Ph#hlf3s hn"'t0艭Ph#hlf3J hn"N^_[?0TPh#hlf3 h:&hN q3uáq3u tjwGjFUSWVj虂Ƌ|$11K< @u=p3t?jj5 p34 5 p3p3p3p35 p3UjWѝ A)߉np3 p3N F5r3q0s3r3-p3F p30Ph#hlf3 h:&Mrho"]1Hp3p30Ph#hlf3 ho"'0蘫Ph#hlf3Y hn"LV舑1^_[]Vt$5r3q0Fs3r3^WVL$ q35$p39})=s379}>p3829~vRO9G9~-82p3~Zp3΋Nu#82)Ou9~82RN982 $p3u q3uu82^_É1jDjDVT$p3t=p31p36p3t@9uхtp3uh%hK1^SWV1pq3s3j?h"3o"tWt|8/uWh9o"WhEo"h(p3 (p3tLPt$hlo"P p31ۅu@W@<5(p3h"$-hoo"jhRo"PJV~^_[V p3tAPxG p3(p3t!P'5(p3(p31p3p3p3;5(p30ӨPVhqw&hlf3ho"I^Vt$ p3t3PX(p3t!P5(p3荎(p3Vjhs3he3y "x p3p3p31,p3@=ujuSVL$D$ T$t$,q3,p35,q3,p3~A2,p3BI^[fV10q34q3D uho"h"$$EGuȿ|w WjP 1T L ш @uPq3hjV P41Ftho"h"$De^_[]Ã?w )QjPo 1L$ 1 Gu@w ۃЃ6w1$P& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVPs3 t uhEp"XC^_[]eC$ts38u@s35r3Nj-r31;-r3M1WtÃ=s3tj jwSVVVSt$1Ʌ;L$uWwZ?E;-r3|1MVq315hq35lq35\q35`q35dq3V5dq3 q3u q3uu ^j:jq;V5`q395\q3}dq3Iq3P5dq3btC5`q3dq3 q3u q3urufL$\q3r5\q3 1^u0芠Ph#hlf3K h:&A q3u‹ q3u tj:j9USWV l$ D$fD$p 1P \q3lq319dq3@u 9ulq3Skr3 t$$PPh,  $ r3| t %e3ڃuh"#Q:Uuhvp"QjD$P 4Ë $Xq39}=Tq3]q39|A‰T$R5Tq3NjD$Xq3=Tq3 q3uq32$@PSW =s3?5ƅtr3VPP,+ s38uK=Tq3뜣lq3Gh"#5s3t:jPDž_p"x Q:? ^_[]Í|$0Ph#hlf3 h:&> q3uq3utj8yp"j&7WV \q35lq319}'dq3FىDuw9@u1=lq3^_USWVD$L$9tV\q3r=dq3~=hq39 t9|1Chq3Mu9|1Chq3=dq3 9u^_[]fUSWVl$}!uEh3"#PP UT1h3"#PÅt*t$Sǀ}!u?S9=b0wPUhqw&hlf37hp"=eS x(=q3uWh(f"hlf3 5r3+t$00 PUhqw&hlf3hp"=^_[]USWV |$$Wơpq3$s3D$s31-pq3-s39-q3t\$=r3t$ gDž~w11q35tq3Y6tsr3PPjJ Å q3uq3t$ Dž|$$\$9t$utt p"<$u=pq3t!p"9u s3 uhlf3P'M9¡s3Ƌ pq3Ӏu1A9|$t $ pq3 s3q3t )) q3u q3ut j4 ^_[]j3USWV1|$=q3t WrGHOHt uG `-xq39}tq3Vq39rFU5tq3z-xq3tq3 q3u q30u s3F8WZ<1ۍF-xq39~Nq3 tq39wUQyt7-xq3tq3 q3uq3uhtktq30 F謽0Ph#hlf3 h:&9 q3q3j2G @utLtq30 Fpq3800EPh#hlf3 hp"Y9-1tq30=s3=pq3  )Ɖ^_[]js1USWV|$?!uGh"PIt$WI,VPÅt2l$t$ US NjD$8!u?S* =S0hPWhqw&hlf3(hp"{8mSx-=q3uWh(f"hlf3 t D$ )@ʼn30Pt$hqw&hlf3hq"8^_[]USWVPl$Uƃ=q3t1ۅtf;l$ `1V$th~;-s3u=s3t =pq3u8 GWPt$ F x4EEs @6;l$ |=q3tt$$$^_[]USWV|$\$l$19t[=q33t UPrUPsFy趺0˕Ph#hlf3 h(q"61^_[]USWVP\$5s3FEx @u}|~PVq6tjq39~lq3|q39SPugƉq3|q3 q3u.q3_tO5s3;^_[]Ë5|q3W5s3V . ,1xщǃ|$uEr3| /5q39$~Zq39V5|q3tcÉ5q3|q3 q3uq3t |q3W5r3Ue ,$+HPS5|q3D( |$tM1BDžh_p"4蜸0豓Ph#hlf3r h:&41 q3q35q39} |q3|$Nq3|q39͋|$|MVPst05q3|q3 q3u q3umua(/ ݷ0Ph#hlf3 h:&4 q3t1q3uj-j/,SWV11e3H e37he3荨u8e3@%fe39ue3H e3ÍF=s39~Yq39wW5r3r=s3r3 q3u q3t r30u s3F r3C舶0蝑Ph:q"hlf3^ hEq"2%e31t r30r3s3^_[,0APh#hlf3 h:&U2 q3uq3u tj_+j*USWV\$ D$1tt$hWq" D$ l$1uHD5f3J f3;,f3у  f3Qf3;=D2|hf3hp%B1GD5 | <\t<f3H f3;,f3hf3j\yf3H f3\\5tjj Sh\q"m tVG\q")Ȋeq"f3J f3;,f3Vу J f3Qf3\$ !0f3H f3;,f3hf3Pf3H f3D50 f3Qf3ɋ\$ ; ,f3hf3Pu f3Qf3D50 f3Qf3; ,f3hf3P. f3Qf3Dhf3Q4 f3Qf3; ,f3~;ȃ t3 f3Qf3D$F9hf3Qhf3P똡f3H f3~f3H f3 hf3j t1^_[]fWVD$L$L$$$0| $ |r1q3hnq"t$t$ X ot9EtzSq3ǃxtostypf<r3먡_3  $)D$|$ta$8-uWq3D$|<_3bq3S q3Dq35$L$jjՍthj1FhBVѮVjƮhcj跮hr3ƅux'q3|$t$8t$0|$t[hlf3hvq">$8u hq"_-ju$hlf3huq"z>hyq"--y =q3ths3h#hlf3 r3tPh"$hf3e xt` r3| r3x51gr3QPP M=r3=q3hlf3hvq"=hq":,j%e3r3h_p",%e3΃t0hlf3hvq"=j}515r3hlf3hvq"<hq"+VKQ=q3ths35r3hq"hlf3jrjk肭Ph&hlf3 jX=q3jԊunhs35r3hq"hlf3f$j0yj蔊t$8!$h0hq3Z uhs3h#hlf3+ jL$ ɸ!q3Phht@j\ x#$r@2D$ rD2ËL$=q3t1@ q3Ql"L$=q3t1@ q3Q#WV1F=q3t9|$ ?!t!h2#WZtj/Wxthr")1^_r3r3r3r3x>r3 r3 r3r3 s3;t,uQs39;ur3빋 r3| r3r3t9tr31Ƀ USWVP\m3s3DJ@t t@s3@DJ@t uHH s3~Ã=w$,&=r3!h@r"  !=r3" s3A1Qptntl  Ӊ s3A˃=r3FP”^ U s3@߈\$ ̀1ۈL$QuH s3H1KDB@,Aǡs3 r3  Pj  5s3j$1  ˣs3@̃=r3t=q3y=r36DB@jLǡs3@1Hptntl   ˣs3@̃=r3DB@8!h,r"=r31Hptntl  ˣs3@̋ r31PptntlN  ӣs3@̡r3HQPN"s3@1Hptntl%  ˣs3@̍H s3 r3 p1Pptntl   ӣs3@̡r3PPv s3A1Qptntl  Љ s3Aˡr3PPH-r3r3=r3=r3 9=s3 -r3r39 9w hqr" r3PP s3A1Qptntl  Љ s3Aˡr3PPl@ s3A1Qptntl  Љ s3ADB@;hq" 1ЍrЃ sO*j hs35s3? s3w8"%s3 s3:o t!gc ptrP  A s3< b= s3Ho1r3PP9 r3-r3 =r3=r3 9=s3r3-r3s3@1Hptntl  ˣs3@̃=r3F1Hptntl  ˣs3@̃=r3hq" 1@r3 r3AQP2 s3<Dj hs35s3= @28"hq"N@2 s3x w =r3s3tr30h%& s3x A =r3u;.5r3O1@r3 r3AQP@ r3jPP>s3x  1q1ۃ=q3Ƀ=r3 ˃h% s3x  =r3u-5r35r3 5r3g s3x ? =r3uL-5r35r3: r3@;s3?7r3-s3x =r3u , r3IQ Ts3x =r3u,r3 r39QPns3x QVP s3y F( s3y 1 s3y P5r35r3g s3A1Qptnt lu  Љ s3Aω s3y  r3s3=@29|PRQ 1=r3u s3r3 ǡs3@1Hptntl  ˣs3@̉s3z !r3SPhAs3x  1@+q3q3uF%s3x <u<2=r3t1r3s3x =s3hs3h#hlf3 s3x }*x1Hptntlu  ˣs3@Уs3x 'q3G1r3r3s3@Hptnt lu  ˣs3Уs3x =q3q3u2#|$Wt"5r35r3QP';s3r3s3x ==r3uJ)=q3q3u5r3Q5;s3)r3h\r"hr"hq"s3h%s31< *5 s3y qts3@P*s3@P=q3h%+s3x )5s3j 6'(Y$i*tEEp $A8GMi r391r3)@أr3=r3t W6Ur31 q3u q3u u^_[]jjSWV=q3uj貽L$ɸ!q3s3Pjh"hr"Hy|h;#AtkP {=Yà P;tGWP7|3/tf/Vzed.hDhup5s3jh"Vj=q3ujL$ɸ!q3jhr3製USWVPl$5r3'Ƌ=r3r3-r39ʼn) u)E1u1$q3E@q3V}tzP蘹t_r3PPj DžtOr3q3Hq3u q3u[uE6Mr3@Pi1,$l& q3u q3ut j1^_[]jUSWV$q3 q3thr"ckjP~s3L$F$ ,s39} (s3Vq3(s39|BVPID5,s3(s3 q3u q3! s3 u1C1E҃!%=q3hq3PAxƉ$ ,s39Vq39V5(s3C5,s3(s3 q3" q37 09L$]9q39|WPC=,s3(s3 q3]9~[q39V5(s3B/5,s3(s3 q3u q3yt v(s3 s3 (E s3Qs39\u=Qs3I ( (s3G (E,$s s3L$A s3 s3y 0s3)9~_q39VPAI5,s3(s3 q3u q3 0s3(s3| s3A(EAs30s39r s3L$A s37 q33/ s3Qs3 ( s3݀ (54s39}s3Rq3s39|KVP@t]54s3s3 q3u q3S5(s3PpX s30s3D$1!P0_Ph#hlf3輟 h:& q3 q3u!u#^_[]hr"qhyp"gj'jVj5tL$Qq p PIH1E0Z_Ph#hlf3 h:&n1^Vs3t.L$19 @s3u@s3Hs3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'hs3SXWV s3 td< uhEp"1 Qs3I t;8t7P1ǡt3t?=s3u6Pet395t3hr"R5t3j3t3tVs35q3WP` t3t.h'hs3QP85t3Ct33/膂0]Ph#hlf3\ h:&^_USWV=s3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-t39}=t3Mq3t39|KUPg=tYlj-t3t3 q3uq3uyS5s3WT 5s3=s3tsj jSWmed0y\Ph#hlf3: h:&1 q3u*q3u(tjh$hs"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17us3 ut3E#ts3 uE1^_[]8uPs3HЉʀπwRj hs35s3 1w8"uhq"1gu@s3ErUSWVs3H s3H%u,8Xu's3t3hr"t18u=t39 t3L1}5t39~[q39V5t3:#5t3t3 q3u q3\t Yt3 s3Qs3 u (\t u^s38uTs3H s3 t31< u0=r3u't r3| t %e3ىs38q3t39|NWP9t8=t3t3 q3u q3uuuw5t30t3M1I}0XPh#hlf3諘 h:&1 q3u q3uu^_[]Hs3,j'jUSWVPL$r3r319r3}%r3ȃ Ehr"Kl$ r3PUVPt$$KǸ1$r3PPt3q31S̪ár3tP芬EPPjM Ņtl9u q3l$ uq3ue$r3r3+r39}yFr3@r3P%Ut$ Pt$$hDž+9 q3u1q3uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=s3tj jvS肮vލD$jPjSu}t1t$ED$$D$1E $A9T$ 4u39Ɖ $T$~cq3t$ 9V5t36\5u3t3 q3t$ T$uq3=s3tjj RS藭T$=t3RSWM 4$D$D$ u3 $9~bt$ q3$9V5t355u3t3 q3t$ uq3=s3tjj t$(S=t3t$SW2M Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu{&D$)D$u39~Vq3 t39SQ4u3t3 q3uq3|$~#D$$ D$ ud$ths"$=s3\$tjj SV賫t3SVPL t3f |$%C<{x0SPh#hlf3Q h:& q3t e^_[]Ë q3u tjjUSWVPt$ =t3T$-t3E<\<&I,$D$h)u39~Yq39W5t3G3=u3t3 q3T$uq3%$9C t31F9uEEπ;D$$,$L$l)u39~Yq39W5t32>=u3t3 q3T$uq3ml9}C t31F9u,$y^=u39}t3_q39|W5t32=u3t3 q3tT$ q3T$M 0E+t3;t35u39}t3Jq3t39|KVPv1t)5u3t3 q3u q3u^u`Iu0PPh#hlf3y h:& q3u q3uu؃^_[]jjfWV u3 u39|ld u3j Qhu3 tJP,PPh#hlf3 h:&@5u361u3u3k u3L$t$T$ =u3@Q葤 u3 u3RDVuu35 u3@LF5 u3u3^_SWV u3 u3r9 u3@<u|L19tWWS59u u3r3H2s3L2^_[USWV=H2=L2= u3t r3r3$s3D$j荣q3 u3 u3ÍS4R4nr@44v\1L1 [ u3\1l1sRt6,lmL)1 u3t)|?wt)LI1 u3t~l)}L1 u3,u44vL1Y u3l1}w4R4Ӆ HA9~Ru34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=r3t׫H2r3$H2L2s3D$L21 q3u) q3u&tj\h5s"$^_[]jlUSWVL\$d3芭hEs"'Js"tNjt$`hUs"SV fttu=<߃u _3r|$L$ D$1<&s"D$PJaƋO9rPSt$ /b tu;_Յuͅu t$h~s"-|$dD$ Du$$1Fl$?uSt$ hZs"jL$j QPP  $;Fl$|1ƋD$8u&1zPUy!Uh"$jD$ ths"jNjC=m@!sHQPW xs{QPW x4$Uhs"A =muqB dut\$fCShmW^ HefD$t$Shmh=m8@u֍D$Phm8@W y?60Phs"ӍL$fqQhmW 3Uh:'#D$ukD$Ph"hrt"g T$"hu"T$t"hu"f3H f3~f3H f3 PhUt"khf3j -t$8t$8t$8t$8t$4ht"܆t$Ht$Ht$Ht$Ht$8ht"軆t$ht"誆t$ ht"虆j}lPh/u"hlf3 j}SWV֋|$t #u"?t)u"VQPL JB8f3H f3;,f3hf3j<9f3H f3=f3H f3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hVu"f"thhu"P^uu3hlu"<"thhu"P]u hvu"艔jhhu"hlu"EE P9u hu"j 0D$ u hu"j$ t$,)݉\$D$$D$11D$$hu"SU c7~+Hr߃8tlH w&$Č&<$뼃4t6맃dtket/1@D$7=<umWt$\Xhu"5<KD$71@D$$+L$ _3 _3T$uA_3$T$uȋ$D$,jj@R5l$L$ $tL$ $L$,1ۋD$P"ZCEu S)St$PʼnD$$ UYl$$T$DtIL$ىL$$U$E L$)QPR 4$YEuED$ushu"h%[u]hu"bhu"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vhu3t$ t$,QPRQCt$ )yjx=u3y hu"|$$tQt$(jVjhSGKy hv"&jVjh5u3Ky h'v"hu"Zǽt$(1CUVSwD$PJUVSw5u3Jt$,1L$XAAA @D$HPQS =u3u'l$hD$h 8jU&f ul$uYDžy hS"#1O~fVS5u3I VSt$VI |$h5u3l$0fE<u1gu@hWj uf8f18tƉjjU tD$68Ztf8tEVSt$ x )brf8#Th%|$l$8fE=u3ul$0fE9EjD$LPj |$@f9fGfGu3G$jVU tQf|$<tٺtf|$4t?u3L$0u+fD$<=u3ufD$4 e8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h9v"jt$jth#ych}v"Ph>v"hlf3jtPD$L$jQ5u3W XUSWVA1K8uSt<։dhU7[ ~WUV  ~)u1d1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSVƅu]jjtqƉx jPS ǀ;t$8u<d8"u(G=w(rfljF^_[ÍG=rhhv"jhu"jCfD$0蕟j&sfP=u3tD$L$ $QPj? XWVt$|$ t8Phv"j> 4{$ u3A9tL u3^_SWV\t$lt8|$jYPWY6 GY\&Ӄ(Ӄ,P6B60#4#8#WVd^_[USWV $8 $4 5 u3VvRPV0W5L&1WWPփ (JWWSփ _ƍ Wh PT& WjjWX& TV\&h l<Ƹ jPPV(`& hVU4 V"E=a==hD$\jPSP& 1Nxr$ S=QǃW0t^SWP* tg0$8 hv"j1<0h w"j< 1N ^_[]þhv"j;۾Shv"j; ¾h4w"V!=bt =buk $}u+Zt$WSVL$ , FYD$t8Shbw"#ShVw"WVP+ 1QQt[0( Lt5$u3tQP!0,tt|@PƉ4P8tg04@tt| r>1A8Љ4DAtt;L5rShw"j9 10hzw"WV|$x$t,WDWHDWDW4Dx uW:jtw\wXM=29}5PBt852WVhw"#|^_USWVT$C6D$L$,$D$ >!ChD$L$,$D$ >@F ^_[]USWVt$V tT$ ut D$@D$0t1 uƋ$Չ$u \ 1 D$¸ u9ljD$ r|$ t$$t$@t$0utL4֋|$ 13t$ tB&$uD$ T$$ t|$ ut 1 uЉ$$,u \ WQV. =(u3$V tut T$0tT$@ 1 uƉ$$,u\1O WQVv/ h`#5(u3.uƅt9$ tVj$4S& VfIPu3Tu3$ t@u3FD$HDu3F D$X<D$DD$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W$>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPPL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PUI D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RPX$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph{",hz"%|$PQt$t$RhQ{"j(C$t&8$\T$XT$H|$RQt$t$Vh{"jQ($L$l$8h|"h |"hhz"9FUSWV u|$W1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu hw"j}'NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPz:l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hSj,PSGD$HPhT& |$0hSj,6S tND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWhx"j%^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh4x" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ 0u30u38u38u3Hu35Lu3D$D$TH Qq T$T$ t$t$QSha}"j 11KL$0t.BSPhy"jV5u3[Su34u3t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP8u8H H;1D$8<9u38D$D$ tD$tD$$u3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP~"PD$tD$t$t$8WSP~"PjtD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhX~"D$8Phu3Vt$,V'~GD$D$8D$HD$L$PD$LPhu3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L @u3Du3tt94 S.8$u3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph~""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh~"D$8Phu3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh}" Qh}"j $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;D$DT$@D$(4t$8t$t$t$0|$(WVh}" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhv}"je1gD$4$DŽ$߬$D$D$D$@$߬$ h&a111CƋD$|$8D$|$H|$LjD$LPhu3VL$HL$8t/u3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh~"b11ҋt$  t<=Hu3Lu3$T$p$1߬$$$߬$0u30u38u38u3DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=u3$t1J8D$<D$ۋL$؋u3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh "W $PhD$(T& yN6L$ L$tL$L$8]:u*t$ tD$Phd"j ,uh("j uhE"j M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PKD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RPw3D$ t(Gdt;<r61@ht 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RWƷNJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP94$]0hVP> ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhW"jT$$BRt RP葶RPVWjt$$Vh("t$$bk,PD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j D$,|$D$T|$XD$TPhT& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =u3yh "je11t$ t$$k,t$D(D$L(L$(}tTt  t1L$(VWt$Q](`&[$t$ D$L$9Éʋ|$S=u3tQPjWhU"j]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh T& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$Q;D$XD$TPh]T& |$t$t$kL$,9 $ ?t$B0WPVh2"jD$,]|$t$t$t$L$$Q7tXt$|9|$11k,D(t P;|$}L$֋L$]t$Qt$D$,TD$, m4$yD$,`14tPP2hC&j,u׋$e^_[]USWVu3tWjjPg u39u u34t0jQ.x!=u3h"j:t$護u3xi8tPWh߁"QV`tPSh"Wj+t8VhŁ"j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 21u3Iu顀2Pu3 2~ t1@u3@9uUSWVD$921A9|G2SƉ<$~ SjV2 2D$~Q1ɡu3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5u35u3$2^_[]V$u3 u3D$D$ l&T$ t$ 25u3t$T$L$D$\$ $n"i2$^Vt$FtN H N tNHNfr v V  u3^VD$`sH) u3u3 u3HtP4BPQ@@1ҋu3v9tu3u3rh"j请tp4F@u3^USWVD$T$#25u3tC=u311-u39| n-u39t%9P4uH$3L$X(3\$ t Fu1^_[]h "h"hhƃ"CUSWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv sF V>u3 u3 29|[5u3tFNu u35u3t5FNHNFy F4VPVu3@u31@j@P莽U1@PF ~4D$F(^$F0^,n#2^8u3 u3t q4u3^G FtH 7~ F^_[]É u3=h"h"hh7"h"hhƃ"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP u3Hu3N^,H u3u3u3H@u3P u3 u3Hu3H4Iu3H89t;tprpu340u3t4F u3H^hX"hQ"h4hƃ"USWV}]uuu W@t u31@u31HCSuu WW KN0F,xNF4VPe^_[]vjv @ fUSWVP|$gd&s`&G4$O,52w0VPww D$0^_[]USWVPt$ffd&s`&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j蒹8p u3HtƒQ u3@ u3^_WVt$ u3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFwhjvp vZ^_PUSWVPT$|$:%4u3\$ u3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=u3| t Pt3u31t 98t@^_[]Ã^_[]`V15u353hVhu3Q 5u3^ft$ t$ Wjm!SWVt$frLN4F,=2~0WPvv 1d&t\fv4V1AN4F,=2~0WPvv 1`&1;NuN^_[h"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR艠׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS跟$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h hz"mUSWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP豛3T$3D$M u1^_[]USWV(t$F(F}F F F$|$0tfhjȬljPLtLXt uB\I\$$|$ C$|$4Nhӈ"R<1ɺPt`tLtt l$,\$(|$0uej蚫ttPrttPHA 芇t u_4u_4_HoL_HoLUS6jjW'hjW>q$ 1=2lj2l$1 UPQSWVhjϪË}Pw SX P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhjNjl$hu P P E1PUtA|$4t h"^PS:W"1^_[]u C4CHKL1}Mt|$4t7hi"Ot$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhʇ":$  $ V 19tQRh "3 1@^USWV |$,\$$t$ tCPPt Ttt4RQhq"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"hf3D$(u KHKpStURQPt$DljT$t h "Mu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"b 3VRh"K T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPht" D$L$9tQP$$h"t$Ht$nL$tI9ȋt$ tPQ$$hĆ"襋1t$p\^_[]h-"h"hh:"h-"h"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|tt|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$8"nu0|$ r]@hD$D$D$,$D$ h,[D$ p D$D$D$,$D$ :,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$R"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW?{ƋD$0T$UW#{ƋD$0 u$$$UWzljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP{zERPkz$GW #RPVzERPFz$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWuNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP{ut$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPtT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP=t|$FV D$t RP t|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RPs t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP r|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPq$ D$TBL$?ttXLT$BtJ J T$$T$ QPqL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP}pي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVenD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$lL$ #t$ !QVWu D$,M|$tJ1@KU9TL$(H0L$H,&HH4PQ@0@,t$0t>uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h~" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hK"h h"h"h h"hZ"h"hz"LUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ5 ^_[]USWVL$T$ B3ulF1G&Uh#,$f3H f3~f3H f3 hf3j u q1^_[]Vlf3PPh"VVjjhʎ"胤"@&Ph2#hlf3&uj[USWV׉΋*h"U&tCt[PUjhh3s 53j3t233WVS530E^_[]Uh{c"ju53h"$juUSWV$:$D$VuP7 9$j uP 1ɉ\$QSuw Ƌ88"u11F9Ή$<$p1ɉQSu Z ËD$8ՉG8"u !t$$Vhyd53U tbVh"B^_[]jh"7jh".uh"$h0"hJ"$p hd"h|"js$053h:'#jtUSWV}E ph:%V6Fh"V hz$V SD$(P53oZ#D$0= M$L$A1yyy D$Phwd53  D$tG\$ D$ L$|$j @ljL$ NjL$IuɉNjD$ D$|$uhj踎D$v1111O w+Ow?u$L$A1AAA D$Phwd53!  \$tmt$ NL$,D$(3D$FD$FD$ FD$$~D$(PnPWt$,t$t$t$hĊ" KuD$1D$|$Ynhxd 53zR531111VQRP53h6"Ehxd 532 3LQhg"ww ww53h"w_G|$9w  jPQ53մ!¡3tNSVPh"Wt$ 53> $9tR"Qjhf3ݣSVPh"kكT$;r ZƉ[|$?e^_[]jj;p53h"lh?"h "h"hlf3~ jQh"WV$u>$jvW} s'Wh{dЀ53荳 t^_jh"jio653h:'#joVPPhtd@53@ $t%t53h"$("u"53Q3$$m"m"s$b#QPhF" 3$$ m"s$b#QPhr" 3$$m"s$b#QPh" 3$$m"s$b#QPh"^ 3$$s$b#VPh">^53h"jWnWV$u^Vhzd@53 tH$D$PWVh,"$PwwwwVh:"^_%53h"jmUSWV}D$Phd@53u tzD$Phd@53R u53hn"h3$|$\$ t$jVSWVRPSWt$h"e^_[]f53h]"jmSWVP|$uX|$_ha#STƅthw"S@u+1Qhwd53荰 t ^_[753h:'#jlUSWV|$0t$,1@ <_3$1ۉ؉D$h"WVt qt\$te+$95_31|$7wWh|d53 D$ ;D$t-i9l$sUt$ƉD$l$묅h.hPV_3L$ $b#tH#RQPh "W|$ t\ư1P`VvvvvQPh"  G;|$ ru53h"$t1^_[]W53h"jk53h"jjjP|$u1Phd@53螮 3tQhD"XD$ 0Qh:'#jjSWVP|$t$^h#S̽tDh3"#S躽t@h"S訽ttT$da3 D$dD$ tTj/S/tF1;tٍT$d#3D$dD$,t>\$:t$1\$(X@&<&h" u1\^_[]hv"hO"z_3=3uj= 33333 3Yh'"5<h"Ph"jb3=3u th"0"3 3t uhݏ"t=2uh")ǃ|u D2j= 3|$\G1PPL$lQPjW|t2t$dtt"1PPD$lPVjWPt52= 3u4$P52>u#$=u 33  3 3 3=D3 ɡ2= 3t&jQP=0 2u[52h##jhhT3QPx2y" 8hT3h "2T3= 3u'L$dQP152h;"hP3hrdAP 52hx"Y\hP3hedA52 52h"hT3h("\$$t(hQP52hE"$$ƒ 3>s1@![Vs ) ȣ33x3|3? 3 333H33L35x352=|3=P3?w 33=3L[V3?3) 3>r$r$ 3 H3L3D3u 22]u1hQP- 2u25D3h"$gZ52Y.2j52|VqH3u Vh!"8 11hL3t1A1A1ۉL$@1hL33 3h3=3u#,3 3033433 t$\F|$LSSWSjV!t$LGpD3n 1QQWPjVy5D3蚀D352j/Vet@UUUU)ʹ3333!!сis<313t!tt 3J3cԋ3 3 313‰ $3(3031 ,31AhQh3+B i-3=,3 / 3ً 3P+==w !r%1H$D$ ʀŸw1D$ $}ȹ3yt3t  u,31I $L$9 311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$ 3-3=3 3D$3t T$$T$3=3uu 2; ,37=3l3_hM""ED381uh"9D3L8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRSPSt$@t$,t$4t$31K1Kޅ`1PPPPPP =28h1"1 38LFu=3uRh"%tajhӬ"1"WjWWWP+h"t҉J3u  3=3u3u 31g=3D3D$tD$|D$h"ޫ31N=t 蹵@ 1k"WhVVWP+9tigfff։f5ޫ3,3L$ȃjPmD$ u h"jQh"Q1HL$ Ajh"61۾3D$N3tB?t=kWUhq" R3L$ DD 3$ D$tD$D$ uݫ3 ,313|(.tq<(tk{PWhq" 333t (BD$,T(2D$ TL 3$3L$ щtT$ ,3T$D$,F9u߃|$~O1l$GVWh" T$ L D3$3L$ tT$FЉT$9uT$1۹˧"VWSSSP)T$ ‰ $DD$Rjr3=ueݫ3$@D$ $#D$u D$ <&1$L$19;ta $Ȣܫ3=3u 3u3u 3=3t8L3~ h"3~lh͐"]hͰ"=3u1IX3 3t h"qh"tL3o3e$jmt1 ܫ33t 3t3$ D$ ܫ3 u=,353 331|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ ܫ3|$E9u KD 3D3D3DL /H3 L3WQD$lP2 D3=UuBW"5<3h"$sGWj1ۅu"؃|^_[5<3hޥ"h"jKjVPz$b#QPQPQPQPVhg"hlf3',j譼USWVӉϋt$ н"t"V$#tb=Uuj1=U=|$0h">fLJUh"bF1N1N= 3u fSWUh"=X3uUh"X3\$&0tUhH"gj(WPO x:?r3t T$ 1I\$fǃ$^_[]WV΃=@3u)$1@3tI=331ȉ1f ¸t@3Ph@3hL3~ f=3fJ3Utj@jh 3f ^_USWVӉΉȃ н"t"|$W!,$$j\WU2~ D$EFI 3EPART3M u#E1M1 uu Wjj4 ;Et 11=3t } tu$u SVRt$hH"Uh&"D ^_[]USWV|պ$u $D$$$L$ T$,D$t[9-,3~x 3 D$ D$ 353D$8$t}t ։t$(t 3D$D$($b#D$ L31ۉl$8QD$ 1MD$(D$8D$D$P$uat$(T$,$L$P=3t-t(WPh"N L$ T$8St$,T$4$tD$XRQPT XL$ tC=u=D$8L$XRPQT l$0$$L$ *D$ D$Xl$0|$$L$ tW$=3tduD$P $OD$hl$( >-<31ۉl$(-D$D$D3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$ 3 35,3<3D$t$1L3P'3 = 33tDփ1WP 3u, 3uh"رݫ3uh"Mtgh}#貱ޫ3=t$ 蹵@ Rh("肱 h"sh`%f=3uB1 39x @uuh"4Ph="$=3t3PPhY"^_[]á2=3uxPh;"53535P35L35H3hD"趰5L35H353535 3hm"苰5,3h"xPh"ihZ"\L3 P3525353RQP5H3h"$ hz"3 35L35H3RQP5 3h"5<3583ho"̯ USWVPˁˀ 3 3 3133~t=u3t 9r u֋ ,3~:3”>u~t:t  Iu3 щ $ 3t&=uݫ3օ4$u ݫ3G3ti@3Ȩuh<"h͉%賮@3tj3=uы3Ѕ$tN<3=3u"Phq"豾0h<"袾Ph"t @3 =@3uQ)$$ti%ti%1@3tiы3х $t4$P5<3h"%=3u5<3hN"1t"13=u ы3ݫ3^_[]VPD$ L$ $QPAh"we3H e3~e3H e30he3%Ɖ t9tDe3H e3~e3H e3he3ƒ1Y^h1"j2USWV1=$3˃y CS t 35311 uY1ɉNVt11@5C C"t"Ph"- h"n1He^_[]SWVP$2;2u+ 3u"QhmdPu y h#`-11hL3<=@3u;5@3|- @31Puh"V=,3~e13111 3 3Pt,38C;,3|hr",Sh",$2;2u+ 3u"QhmdPt y h#U,^_[USWVP։m1ɉQPU- 1O}t#Ë$8uD8"u r1^_[]USWVP։ϋl$=3T+3 L3tú$b#t$76PSRh"T$7St$h¢"D$7UPS\$ ShӢ"ש7PUSh"迩77PUSh"虩7PUSh "聩7?PUSh"f77PUSh."@7PUSh?"(7?PUShQ" '1PPPUt$(SRh"^_[]USWVˉ1u=3hڲ"T$$8$43|$͉)uh$b#Wh*"ݣ |$Z)uh$b#WhM"ã D$|$3:33 3l$M?>33KL$ u}tGE)9H9^_[]USWV,։L$D$DD$Z"tD$u"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h", 33D$HL$LVSQPvD$T$D$PVSUPvD$|$ D$@VSPWivljӸ1=2ƉT$ L$@PVt$QR-vPSW|$LWVUl$lt$,t$,t$(t$@hߧ"Z,he3jdh3趯 |hr#h3|3\$ $t < uC{ - \m3DAu<-j D$$Ph3> D$$\$ hz&Se1K|$(@D$Ph5"S4 $ϋT$ t։t=t$h3&S4 t't$h8"S4 ct$ |$@D$1=2ы583jVWRtD$ՋD$D$D$D$D$$t$t$D$$  T$<3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Thr#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhb"%3Vtƀ3t$Vh<" 583D$,$t$P։ω,^_[]h1"j"USWV΃ twttu"^T$(|$$+<3уD$ ;3"L$ 3|.|$,T$0 (3|$9=$3|=3u|$4u 1^_[]Ë-,3~} ʉ$9tw3|(tk 3t( T( (t1+<39\$ \$$}2;T$}#=3u6|$4ttD(OG1nF "t(n9Չػ}n9l$\$QAuƉ3tt  $tt ^3 311 3t$ -,3t$|$$|$}3] ʀ|(tP 3t( ;L$T$|L( (9Ή} =3{|$(t ;3KC 330"1$t=t 3  3S"=3|$(50353iB14303,3(3$3 33Ɔ3t$ |$(P3903u853 B14303,3(3$3 3331Ƀ|$(T$3\$1 5,3n 3|+D$Nu 3[\$j5<33)؋ 3P|$(t$ hhjc:3VfǀU03L$ 3D$3ƋD$$ȉ5$3(3,311,3u3=3h""u"s"=31|$(9 03u853I@14303,3(3$3 333Ju UPQ! ,31|$(tD$3D$ 35$3=(3^_[]h"jWV3t^ tڋt֋|҉tΡ34 ,3 QPV4! ,3ƀ^_USWV T$L$,3@hPh3  ,33~C 33$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR  3;UjPy fDŽ;UtZF , M ;M;MU;; 3 <3T$)ʉUL$  <31 EE=3 3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M,3 ^_[]h0"jWV1=3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5\m3<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$`]!1Kl$ 22uhUP,zQ5H3PZ ;2u[jVW52\!1Kt?D$H5H3#$SUPM 52V52 ;2tÉ؃ ^_[]hͯ"j|USWV$0$,1@D$l$D$D$ $1h"WV$  suMyj U5< á<8=L$90y8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-_3)1<$L$jhQP4.h\3hedAP<[ =3%59l$| 5@f3UjDž\$ t|f3H f3~f3H f3 hf3j jh\3hf3 f3H f3~f3H f3 hf3j 诖<$ D$tt$b#tS"Ph3"HD$f3\3Waf3gdWPV Z xnu)D$PhwdVY h"h̵"VS1^_[]Ph"25<h"j4 h"h"Nj贆uPh`"hlf3 j蕆USWV\T$3< $S'D$9d$ՉjRPt$ V8Y11 Sl$UV] 9 1U\$tL$j@PQI 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4D&h"XT$l$ 31ɺ31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf 3ŅtMaQ4D&h"AT$ t tuf f1113|$ 33T$33f3l$E<$g\$ttXaQ4D&h-"賌 ;B Q4D&h["薌 <$\$t4D&h"v<$l$!F1D4 GXtVjjh+">Vj w(h4"V3 w,hF"V" w0hY"V w8hn"V w4h"V w=3L$o"j0-EPWt$hŸ"jL3{<|$\$W4$+Wh"h"Sʵ4$u hu"j$F j/P 5t|4$4$*jxUSWV\$ l$|$t$1E3d&33h"WVo h~n3itVn3Ѓa~.btCd3봃otBs3띃NuS<331=33mjSh&5<etHPEuA_3)ރu4t$$V41ut$(t^_[]hd"jfPh"hlf3 jw$ʹ"=3uD$ D$@"3t $P=3u %=3u "=3u y$@P0#hʹ"h&jWVPh3"#Qςt1ƉPjPW Wt jPsVWP^_ÐWVt$|$ VWoat$?/tWhY"蘏Vhr"芏^_WhD"jgfWVt$ |$7賢WVUSWV $$l$WVSU$ $ hU3WhXa"uWVh*"jGD$@tF$j$ht&hVV$$$h3"n~juUSWV$$$$D$1 h"SU  $D$D$1G$D$ȃ 1$8&N|w5<Ft|$`N|Z5<Fx|$Cj$hd&5<P5<UFp<$h"SU6  V_3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hd"jWh$jGbPhW"hlf3 j@sWVPt$jWV 9u9t x^_Vt$h"j-Vt$V? t@^h#V^Vt$V;t@^h%V|^WVPt$jWV- 9t9u x^_Vh"jWVt$|$ VW]t$?/tWhY"Vhr"貋^_WhD"jfL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds h"i-1VWt$ t$QP:1@PPVVu4u0u)OËPhh&P?5 }D@u hh& hh&S5 }D@PE,CEhwc%VfS\$thwc%Vhк", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Ph"+%t9\$t h$"+\$pD$p\$D$D$ 9\$~\$~tShW"+\$9|1} t h~"k+hW543h"讈}4xME0;E4ru0h޻" +},u,D$D E4t h"`D$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$uttPFx@HIt$81VRtRRP*t$ tPh"9QL$xtL$tD$8@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

j$WP1HPWh3Vh"h"&u=_3؃rKVh"hO"jD$t t @@u|$$h"Ћ45@3j/VumD3Vh"h"hSG$DPS.u"5@3h"hh%hhD3F@3D3 Ph"Ku =3hjS螜 |$4tg$y\hh5@3t D$xD=<3~1hSPҚD$ F;5<3|1QQQPD$ u D$y05@3*/0? PVu h:'#E 1HD$j5@3Åy'5@3.0 PVu h:'# $DPS y'5@3.0 PVu h:'# $L%=ta= uD83u D83L$t$QRPS5@3ul5@3hP&5@3h$"NDŽ$$lfsD$tjV$$$ $L$ Z$ $ u4h^"L$ u.$$lfst!$$Phwc%4hp"L$|$u$=2|$Tt<31<3ɉ\$Hu0<3tL;$$ s5$$ %DŽ$$lfs<3t$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s h" h"UL$8J#$L= j|$W$($(qD$8T$ t$V,N|$(O11VSh$Pt$XxHWD$(+D$L$,L$ ʃ|*5@3h"JT1D$(+D$L$,L$QPVSD$DT$XD$PD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$袸D$\D$8L$\ t&|$D$ fD$Bl$B|$`l$D$`L$d QPhSt$Xx>WFD$(+D$L$,L$ ʃ{1QPWVth5"j 1F\$D1VPSh;"BD$XWVPSd%|$$u1Ʌ|$t1ɉAw1@|$Phi"}BD$tt$5,35 353t$\t$dt$<5(35$3Q535352PWt$L@ƃ|$4tVA9USWVӉ $)|$j W\$ SIN Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ (8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$h"jUSWVlf31F/WVUhh"WVjh"WVj!h"rWVjh"a WVSh"LWVj+h";WVj;h$"*WVj$h`"WVUh" WVjh"WVjh"h"WYBWVj h"WVSh""V6fD$t1B9| 2I 21l3Iu顴2Pu3 2~ t1@3@9uUSWVD$921A9|G2SƉ<$~ SjV" 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u53753$2^_[]V$T3 X3D$D$ l&T$ t$ 25\3t$T$L$D$\$ $n"=$^Vt$FtN H N tNHNfr v V P3^VD$`sH) `3d3 h3HtP4BPQ@@1ҋp3v9tt33rh"j+tp4F@p3^USWVD$T$#253tC=P311-\39| n-\39t%9P4uH$3L$X(3\$ t Fu1^_[]h "h"hhƃ"USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>P3 h3 29|[5|3tFNu 35t3t5FNHNFy F4VPVP3@P31@j@P U1@PF ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É x3=h"h"hh7"h"hhƃ"Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP x3Hx3N^,H `3d3h3H@p3P p3 3H3H4I3H89t;tprp3403t4F 3H^hX"hQ"h4hƃ"USWV}]uuu W@t T31@X31HCSuu WW KN0F,xNF4VPe^_[]vjv  fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv v^_USWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3 53^ft$ t$ j,SWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[h"l1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS3$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h hz"USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP-3T$3D$M u1^_[]USWV(t$OdQ AuFV FVt RP OdQD$xd11 |$D$$D$ D$D$D$D$ $uD(tȉDpTtt RPs tuGW l$ $BGWl$$tRP,݃1ۋ4$FÊM t19su)Gu7|$ \$'ŋl$F|F}F m}F F$|$0tfhjDljPLtLXt uB\I\$$|$ C$|$4Nhӈ"N^<1ɺPt`tLtt l$,\$(|$0uejttPttPĶA 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=2lj2l$1 UPQSWVhjKË}Pw S P G1PWH¹tTt 2߀<$u1 t1 L$QWURPVhj蚵Njl$hu P# P E1PUtA|$4t h"[SW1^_[]u C4CHKL1}Mt|$4t7hi"k[t$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPhʇ":$  $ Vx19tQRh "& 1@^USWV |$,\$$t$ tCPPt Ttt4RQhq"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åth"%hf3D$(u KHKpStURQPt$DljT$t h "@Yu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" 3VRh" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPht"D$L$9tQP$$h"t$Ht$L$tI9ȋt$ tPQ$$hĆ"V1t$\^_[]h-"h"hh:"h-"h"hPD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$"D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttu|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$8"nu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$R"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$",D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D3uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW軆ƋD$0T$UW蟆ƋD$0 u$$$UWdljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPERP$GW #RP҅ERP…$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPh"TD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPh"D$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh" D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWwNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPlT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP$ t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP}|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP|$ D$TBL$?ttXLT$BtJ J T$$T$ QP|L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP{ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVyD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv J t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h~" D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hK"h h"h"h h"hZ"h"hz"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p 蛊A L$H SjQ ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QPm1 ^Vt$ V(1y?1I+F$ыT$ptj42QP!1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jDƉ t,U蹇Ftf^81FFH1|$<΋t$ 3uN 3NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPt$ w$K\$tSD$ hD$@p$Fx~"1ɋ@ L;H|PHsu"l$ \$ 3{3 3\$L,D(Pl$ tttt$T 1¹pt Ѝ t$@F01FHD$Pt$.KCLLtPQ4$SXtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(3y 33Py`P迬D$@3 3C9݋|$F(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$>F0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tWLƅuWhu"jkK$$<$4D$Phd@U@f tj1OLVhedAU! F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h ,%t$Q1 Sh"Uj CPh8"UCl C Ph"U1l CPh"Ul CPh"U l CK,C,Qh/"Uk C0PhD"Uk $@D$t P{1-Uhzd@$<W t1 VhedAW hjU跧 D$ P$4&D$, 9L${gL$9u0$S11:8tx$0h"Db$11҉ $ƅ*ŰP Sj PUV ^_[]$0h"jHUSWV81ۍD$4ShPSu,`1NtAljSPSWuWuMU D$t$$$Q1e^_[]fUSWV $( $$ hojS h3"#U!t.P|$"V(t!Uhm"JUhS"1OUh"l$D$QUPh$|%W݆tPUh'|%WƆiD$$Ca2=ouV%\$+{&V{V$( ]hh0"WT ƃaT$,"V1u\$ىjW$( h5" VT$"V$$ h"V, ^_[]1ىj=ߊ< t< uGjh)#W k2$( aj2WPS EKu$( 8~y$( 1\$ىj(Sh$PE u$PUh" "j2PWjS E2$( ;(|VB\$8"V$( @VT$"Vg$$ hc"h"GuD$ $PUhw"S'uU詖<Shh" $( aPWh"Uh>"$( x?$( Z1ىjPySh$P|D uSUh"y j2PW R E2$( ;h||$jt\h"@PUWx $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"W蹂L$\\L$\\ $\]u^E x&Yt8u1҄tʋ$( t?r QVR V荔q蝤8uUh"Ih"Ph"4USWVՉt$hR 1I t uFjh)#VS u<^Ft t u^F t tW"PWV tt$hU u1I1ɉ^_[]WV׉RhQx t6< ~< t<#t< t >t< u6AWhVD űD$ 1GtPh"$^_Vw1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh/"+C< t< t< uh3"#S$ƍD$$VhPg L$T$\$PQRSD$0PD$Ph"D$@P t$$$ىh"rC< t< t< uS7=$<rLjShD"Sh`";Sh"kh"Yt$<L$D$D$L$ oPHRtXljo 1tX L@uH~vCtTjhhn" V*$^_[]V )UjSU D$ D$ CD$CD$C D$C$Cl$Uh&b#VS u D$CV螐)1$<;obD$D$PSh" =USWV$0xjWZƅ~F$0h$1jUZ~4$hPY C9uЋ$4h3"#S_Ǎ$ىhR"$0St| uƄ$ $0ph"QU}D$$0qh"QP[ىD$PUqPUSf u׋$0EED$1ɍ$D$ $PhS D$PD$PD$PD$Ph |%Sk|D$L$ T$ ыD$E L$ T$ D $A9L$D$uPph"h"I8}Sh"h" Sh"h2"'8 $02t$t$h"$@t$Ph" |$W}~14>_G;}|V/_1^_[]USWVD$(}~;$ ~VE pSI $PjVWjS|SD$11D$D$D$D$$D$ D$h<"u VuC H5$h&D$>j 5<PKI Cr3밋<$PCrj ha#V@E ىVvS1PouE$ ~S4VE $Ph jSPt$VePuVht" ,Wh)"j7ÍD$LPStu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BVy Q8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQsb $Phn"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh4"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WP`a $Ph"Phr"tM"PSh"' .1$P;$h"Shrt$VW"9;$PVh"ԫ|$$Vh"軫h"jhr t$j9=3:$h"Whrt$ "?c.\$jh"WhrS$d|1$XAA$Pj2PQ^ $PhV"Phr"I~~;$1Fȋ Q&w ة&QPhX" G`;$X|΋$\>9rh"$`>ߋN8 Q&wة&PVhX"販 `Ouet$$P\$ ZSh"胩h"$P\$;$PPhU"R VdhE"Sh*rt$  09rh" h"$\>$Thm[% Vh "$X~:$\1j h5$V{ "tQC`;$X|j 蠧~-h2"o$`>V_`Ouj o$X1~$1:t @`9u9u$\Phs"1@\D$,\$H|$PS$hjV L$,9F Vh"VhrW h"F0Ph"菧F0Pv,v(v$h"rj 舦h&"[$Th"GPh"h"FhU%VfD$0L$4$PND$8FhQ"Vh(r WO  FtsShp"٦$PtPhF%h"賦$Tt*Mbi)QRh"~ j 蔥$XqPSh"T ]hJ"B$X~n$1Wȃw,R"$@&L$7"!"" Q& 8""PRhb"ץ F`;$X|ۋt$~G$`>G8tu #P Q&w &QWhb"聥 `Kut$h"VhrP>U"tj"PIt$1 E$`$d $jj h3P$QPjVyjhP$V8 V$`t$Vh"פ$XMbi)QR$\VhD"螤$|$|$|$|$|$|Vh"f $\uMH#1wh"EL$!r "$PPV!t$h"!11҉4hӀB9u$b#tH#QPt$h"ȣ=3~S$h1h #詣1PQh"茣 C uߍ_ j 虢 rt$h"Vh&r@t$S.#;$PtF""tM"RPt$h"t$ USWV`p׉͋$tph"S}|,$tSÃr t1C1|L$PVQ] Ou vu hu Z$1hoVWU owt1$0 j2t W%6 F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh0"WX5 Ƈ$L$h1"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jhj%S7 tVjh"S7 tBjhTB#S6 t.jh"S6 jha#S6 u$D$D$h"PhrWh"PhrW=3t?|$"t"PVh)" |$u$4ȩ&VhD"ڟ ^_[$oWVƿlf3Ph"WJ Vh"W; VhW"W, Vhx"W Vh"W Vh"W Vh"W Vh"W Vh"Wҡ Vh."Wá VhO"W贡 Vht"W襡 Vh"W薡 Vh"W臡 Vh"Wx Vh"Wi Vh"WZ Vh "WK VhA"W< VhX"W- Vho"W Vh"W Vh"W j膕VRhQw$ t^Vh"$j1$WVPΉ1WPhPPj PQ  u^_Vh"Qj#USWV։ωl$PU\$hjS躁 E9C Sh"ShrW VhH"蚝ssss ha"聝ss3h"l{""t"t$(Ph"E t$4t$4t$4h",$t$Ht$Ht$Hh" D$8PhN"$t"Vha"ܜ$4ȩ&ht"辜$h"誜Ę^_[]t$ t$ t$ f tt$h"j"USWVӉύD$(jP31t$`FFF FFD$h$b#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVPD$HD$PD$P x&5l&|$D$ fD$ l$ \$Tl$+D$Ty1\&Ph"$j($PT$D$ +T$(+D$0хyL$XD$\D$\5|&D$XuT$hL$l+D$$D$ $߬$̍&ݜ$ܼ$D$pt$t$$߬$̍&ݜ$݄$T$xL$|l$x̍&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$Pw DŽ$ <\$D9r<"ShrQ3h["^h"UhrVuh}":t5|$d} r"<$c!r"P ^_[]USWV$`T$$<`$8`t$D$0hE"Ph*rQ 0͉L$9r\$~HT$ |$ $1hWt$ @p u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$ o u$8`D$1@$C`Mu΃<$t $`^_[]t$h"jUSWV$,hEs"4Js"tŋ$0h"d43o"t 3~?-|$h"VST$ M~%Hwv$& 33ǃDt*Mh2#5<)3u5<M433nNRt 3j W5< 3L$9&-<23332j W5< 2L$9]` 33}3nP3-tWlP-ujjQPh7"jD$كL$l$ umt$V=l$ 1  ut$)K3h"5<h`"p5<h"` $L$L$GȍQw[sV?PkP0,-G A6PɉGu$t L$-AGL$AL$$j=3u"hh"h"h"h"h"h"h"hlf3ҋP$W`Ph 2$Wa bU*yŃ=3u#t3MIрK=3u }8$V+ƹV])uV+W $VVY+DžD$u h%"Xul$Vh#hlf3Ɗ Vhl%h$ P諆W(yl$`t$Xt$T1ҋ\$މT$̓=3ut3MIрs6=3uA}t']h`%S$ath2#SauWH(Ņu{D$TƄ ML$XE|&hP$ Ph>"hlf3ˉD$+hP$ S ىV1 D$@W'$W^PhC$W_ $'hlf3jjh":$WL^Ph"W=_ j)$W^Ph"W_ =3tVhlf3jjh"0:3$W]Ph"W^ 6WKThlf3jjh"933hlf3jjh$"93ꍬ$U$P:]GV.])1;$v7$5<P{3$P\$$1Ehhlf3jjh"9l$WK(_D$h9jUP/L$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h`%SXt jh|#SW t ;/u f. Gf./WVSV9SWEt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSStH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 t3H $s-t$$tHfHxt P2)1^USWV=3thf3jjh"-jj9#tvƃ=3thf3jjh"l-x31GNIIˋ^s t3 tVfV(x3ޅu3=31WS"ơx3Krk=3tV$Ph"hf3&{ ~uV7dV'%V`v v"3F$53vu;33K^_[]USWVPl$t3M1t$"Džt.w w!ƅu h"d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=3tW"Ph"hf3y W_1l$$ttF9u t G9t$&Qt$h3h"hlf3}y<$WbWE&F~X|$<th"V_VCbV&vfFt$ t$ t$ h"hlf3xEuFufFFV!|$WP`WV&N=31ۈ33|NIL3h3M3ǀ3|NAMǀ3EFNDt$h3h"hf38x1N1@=31ۈ33|NIL33W%Mǀ3FNDǀ3|INOWM3ǀ3|NAMǀ3EFNDVdPt$h3h""hf3wC<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=3#~VPt$h/"hlf3w1t$h3h"]a >W\Ut$$t$$|$$WX ƃ*Vhg"V%]1@KGufGfG1@=3$ WbPt$h3h""hf3BvUt$$t$$|$$WƀH1@=3ىV_bPWh3hU" |$u V[v vY3F$53Ut$$t$$WDUt$$t$$W.PZN1@=3t-ى,VaPWh3h""hf3Qu؃^_[]S133|NIL3t!h3LJǀ3APEǀ3|ONTt!h3&Jǀ3FNDǀ3|INOt(h3Jǀ3|NAMǀ3EFNDƀ3t(h3Iǀ3|MODǀ3ECHGƀ3[SWV=3thf3jjh"%3=31VWftmxtg t3W sJX tCf{u7=3tSPh5"hf3s S\S [빃;=33k53tc~ tWuLfthS"W Z=3tWRPh5"hf3bs Wy\W9 륋v$^_[SWV=3thf3jj hk"$3tS31{ t$C$Su[SFuՅu53th"VKYv$^_[USWV=3R3utDhf3jj"h"$,thf3jjh"#53t$G!jj#^ơ(3;3,33,׋-3WV]Ɖ׋ ,3(39sAWV2ÅuWVh"p\ SPh"hlf3q c렉1‰1 u`WVÅu h%"%\Cuh;"SXCt SZcSSPCcQPWVh"hlf3Qq:K39tPt$ ZU-3(3;3,33^_[]USWV=3thf3jjhS"d"f 3jY9T jj\ʼnT$3 3PQ\D$5,35(3J\Ɖt$U9\ʼn$St$p\Él$9$\$,3 (39ˉs6f 3j8DTk D$;(3,3rM\$ -39sI,395(3s9-3tS 3E9u,3 (39\$ ,3 (39ΉsZWVÅu h"YSCPh"hlf3So cWV[Ɖס,3 (3911 uU9t$D$ rIWV<Åu h"|YSPKAc9-3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5,35(3fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=3thf3jjhl"FtVPXfvu݃=3thf3jj h{"u3=31ҹ$RL$QtMƋhtDEt9VP|$ Wa1ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV=3thf3jjh"3=3rc11CWS5t:FfN~u %fFfth"VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh"V ~u,|$ t%h"VRWh"hlf34l 1^_[]fUSWV`=3thf3jjh"y535353h."hh2g3 t=3uFFF%)Fu9rV9=3tJhf3jjh"!F 3t(t$hf3jjh"F 31V9vtRPh"hf3?f 3thf3j u$ 9̓>t9߁^_[]á3tPjt$t$\uù2WVIAfF=3|C 3)f(35 3jQh$3u53F1$3PVQp = 3F3^_ù2Qh/",J8u"h"hr"53hS"hlf3dj~YWVjh21t)h t 8@ W萷^_V(3 ,3t7#$3=@u%o>(3 ,3t$3!=@t^USWV$$$ $jhWVp+,$3tE1M1 tmjWVS$8jWVS$8t$Shl%hV_V8$ 3U Rh53DžtGh`%P}:tSh"hlf3vc 53DžtGh2#P?:tSh)"hlf38c 53[Nj531jPP6*+^^$DOGrhPD$PhR"hlf3b:hPt$V $(j7V@ 3u D53Nj53j1PP6)+^^X^_[]SWV׉1jPP1)+FF9tX\$)yWh"hlf3b %؉jQP6u)~tF hP6藳 F^_[USWV|$_ OtGhS7i GO9}vDty)9|n4 ȉG.uFhW%PQ8;-33rv=3tUh"hlf3&a \GP1=3t:Ph"hlf3` %1=3thlf3jjho"T1^_[]USWVD$$P+TD$x/@thW%QLg1ƀ81Mbi)$3H1ًP1 t 3P RVN553At\G9uGSVP"6 t53Džu*hW%D$Pftƀ8MbE^_[]USWVt$!M1 tFjhRW&,$3t(E1M1 tm`ƋU R^_[]ËD$0 iUSWVX=3thf3jj&h"|3 0Ph":lf35p35,35(3ha"VY>0Ph"V~Y jNSWVt$|$jhVW  $31tQ1Y1 t ȃ^_[V'=2#t12PPV誯 VAx=2#t12PPV膯 Vx^USWV|$\$1 tI;33s9-33QPWSDtH1ًP 1 t@$Ɖ^_[]USWV|$t$ t;533rWVh"B 33QPWVf t߉^_[]USWV|$u h">We)3u`Ɖˋ-3UDžuh"z>-3)ً39w؉9vlj<3|$3WS2G^_[]USWV։ϋ\$ t;=33rVWh"= -33QPVW{s LK$\=3t%[$tC1K 1 uh"S9^_[]SWVt$f~thy"V9~u(~th"Vg9~ th"VS9FN tkQPDžuh"V)99tt79uNH4~^ SW FtPh"V8.>Ww'333F$53^_[ËAP 9ttЋR9uIHËIH h"Qt8Vt$V'33^SWV|$t$Åuh"V,8;^ty^C Fs j/WGS&3 3W W&FV86P,(1ɅF fN^_[USWVd=3thf3jjh"{=3td|$xh"WHQƅu050Ph5"hlf3P Wh6";t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6vuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u3$53L$T$9΋$D 1$T$|3~L1\$3 tAD$t$ jjSmG39|͋ 3 $53T$|L$<q$Q Ai33QA 33QA3A$t$ Vjj(QF @t330Phc"hlf3WN t$xho"8V-#h^_[]USWV$=3thf3jjh"e1PPU Džy020 Ph6"hlf3M Uh"88D$,PWy020 Ph"hlf3M Uh"7$jSƅu h "7SVW xD$j(PW y0820M Ph"hlf3M UhH"{7Wן3RrD$l$3=3,$1Չ1 9$hlf3jjhj"jj53533jP3u h"6PjPh`%HĨ^_[]f 3D$L$ 33D$L$ 33=3u t$(6t$pPh"S6D$ L$$ 33L$T$ 3<)3؅~ڋVt$53952}/3t P PP3t52^1Fhlf3Vj&hB"V=V|=3thf3jj hi"=3tF1PPh3z; 2yC!.06 Ph3hqw&hlf3H=3n23 3A33 33~P1F 39|3=3t QPx; QP52 *H 33=3tPh\"hf3H t3u@ 3 3 33t3hlf3jj&h"D=3tD=3Ttk333uI) 3=3u =3tuB 3 3 333 3 33Ph`%TD$hs22H=3t3u.=3t53h"hf3F h3"%19 =t3unx3i t3_ =3ut3|^1PPh3a:g+0|Ph"APh"91Fhlf3Vj!h"j1Fhlf3VjhQ"X$+09Ph"hlf3E j:hh7"Ph"hlf3E1Fhlf3Vjh"<VC:V2to=3uf=3ubf$HD$=3t PjE:?Phm52  y"c*0xPh"hlf39E ^1Fhlf3Vj)h"V9USWV(΃=3|$()1\$@kD$(D$$D$,D$ D$0D$D$4D$D$8D$D$hlf3j N12 2ˁ +3$\&RQh="~lF|FNF0FXF\F8F`Fd1FTFPFLFt=3tPWh="hf3H. =3 33hQV@ 33^_[]t3 PUh="k s-3hh3U 0Ph"hlf3- j4"USWVEp3f 3D3 @3D$?SDžu#Sjj0SDPO/F^_[WV|$ th"WWNƃ=3uhVzx=3t.u Ft#h#W=t9h?_%W+t'\$j SW $ 9uy6h#U$~h#Wt@h?_%Wt.\$j SW蒇 D$ 9uyvh#jD$PhU54 u ^_[2h"#jSWV |$t$ >h#WEt9h?_%W3t'\$j SW $ 9uy6h#U$~h#Wt@h?_%Wt.\$j SW蚆 D$ 9uyvh#jD$PhU54 u ^_[:h.#jUSWVh-$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUh"D tjUh7#0 tG99ufD$u\$ tR$,4jVh% EjVh=# 4jVhB# 5\$ D$7f@jh0uht$Vj P54D$^ރ9tD$j@hK#P苽 ߉tD$P5DaryDpriml$t?tD$P D andfD D$PDgrowfDnt$VD defDectsDuVjh#Pؼ V54545454h#Et2tR}jh#Vx H}j1h3#VS N#}jIh#V. t6Wh"Sh"$UփOut$é h#4^_[]1h#j褆USWV}\$j S54O D$t"NuD$Hj@PjSPhy#jA$j$Vjj54rF=tPh# D$D$ D$$fD$t$j VE 0  9 1L$81qAQQ a A j QV54-D$t$ *jh#E p6  D$ @L$jhtjPjQ54h#*hf3蝸D$t$H1D$`D$L'Ƅ$0VhQ`54 $j D$tPSù |$'y9D$(ȋL$;$&|"@D$Ph=#hf3j DD$$<JD$ D$ L$jhtjPjQ54~e^_[]ÄtH<t<u'54h# 54h #hlf3 P54h#hlf3zhE#h#jE 0h#`USWV $ ~($ 1j4hT#K ?C9u1CCJt$LUPV? CJjh'UVjS54~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P54545454hX# vL$D$$jh'hVjS54Ffȁw$VhU裷 VhU蒷 ƅtL$D$jh'h$PjS54]$f1Ɂw$PUhWh#/Wh#vL$D$jh'h$PjS54$f1Ɂwh#[/t$ t$ 1؃;D$ D$4ƜF>|$Ń &hN&hh% ~y)L$ t-D$[u`^_[]<t$<t-<uCjW54.h#j-r54h!# 54h!#hlf3{ P54h!#hlf3`jUSWV\$$|$(t$,1EEVPW E \$ ]Ejh'VWjUt$4$^_[]SVL$T$D$ \$F^Fjh'PRjVQt$^[USWVt$|$ \$$1EESPW E]jh'SWjUV,$^_[]USWVt$ l$tIl$L$߉<r uBGu".Ko13Ār< uF9ul$E^_[])1l$: rx\u@tfE\\7tE\: 0E:$ 0E:$ 0EIt]EG9ufUSWV } 7 z]h!#WSw Hw$&<4փDu4 444444444v4j1FV Ph!#V1ouO5_39}E4 4=4uuu 4=4u4th!#  Ȩt&j&=4u~&Ph"#sD$POjh!$#Si1$ 4 4D$L$( 4 , 4D*h$#P|4 4 4)he3PW G?t  4rx9u 4  4\$)<+\m3T$JDHUBR4k< 4D$ $ 4L$D$1ɸ4T$ωD$ \$S5ƋD$)D$tGD$ D$H 1ۋL$|$4VQPq 334ۉu\$ \m3DQu+<:wS褾eKC CCCCuh%$#eKD$P踡D$\$SQ $&D$KL$  S J#GBD$ @h4 4 4 $ 4uh$#h( 4虣Ph5"#P0 4u}P|P$t 0 41jPP~ =4u'/htu/hI"#jm~j jhz"s MPhX"#\jKAkdT*T$JKL$KL$ KL$L$ \$ KD(B\$ TH\$ KSAL$AKSAL$A KSAL$AKAL$AQ蚢, 4( 4!уu+D$T$ 4$ 4h($#j9jtPhQ$#hlf3 jJUSWVP=$ 45 41,9|1C=$ 45 49}`s&H-&E9ƉMm|)t6jju uL$>L$9ȃ}  $Q)1F,MUۉu1;}E|u(E EmubWVl"#VWjWjWjWjhhVx7 x`j"hy"#P5 h( 4U jPV5 jh$V5 4WXPWV5 V7^_SWV։ϡ4 4H 4 4uhh8 4n8 4h"#h"#hSh"SatZÉ "#t$b#h8 450 4Ph"#SY|@h( 4g Ph##SU yh"#Ph"#j襤<|.i< $b#tH#QPh##S t Sjj!hA## Sjjhc##Z 4tSPjh4@h< 4u;hVjruSi1W^uWV^_[WVP##=4u%4<u##4u##uz"h450 4Wh##j胣j &h$#`=4uh$#J=4u6hhh##4 xjh##P/3 V5p 4Wh$#jQV 4h$#jxV9Fj_%h %# 4u4ujjs4##u####u##$= 4u D$@##D$=4u ##=4u ##=4u "=4u $=4u $z$ 4uH18hl"#WPV4 o8Vh##j輡 X8Vh##`j=4u hl"#^jjh< 4hh=$#fUSWVa΀-% plj\$ Cut$BT$ҋ $)|$4;1ɉQD$PS{ D$ D$ 938* 8\$ L$ D$D$W|$h"S蒟Dhy&S|;hX&Sf7h[#SP3h#/#S:'h(/#S$D$t$ |$@1ɉQD$PSX D$D$ 9؋t$88|$Ŭ1ɉQD$PSe L$ 99։D$蒬L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh44t2h&2#v 1<== 4 ڍt$81 D$ \$phjSh4PVT$RWQ$1BD$L4JD4`L$p$QRSRPV謃4  4u1$PP$w x&Qh4h1#= 41<=4 j=V6v9= 4 j=VvT$81 D$ t$ hjVh4PRW4P\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP耂$h4h 2#D$49t 8VhM2#S1JD$ $$Qh0#,=4D$t$= 4$D$D$,D$\$(VxGC@D$p9Vh_2#+0@Pt$h1#|$oQh1#=4D$WSt$h/#VD$ 81ҸD$ |$\$ Cj"$P3YÍD$pWVPSt$ $PӀ\$ E $4jt$tS7 $4jWV# -0+Ph4h1# B4  4$Ph4hqw&D$ $u1@t$2|$ Qh/#(11G|$1\$ tpupth|#QYD$ t$D$t1@L$ ɉ%t.#PQ^Q|$t 8t1j t$ h4$`St$hM/#FQt$h/#7.l2m2L$ L$ ف$K{8P|$W螉D$ t@j QSR D$ ;$|$8tQtUL$4 T$hjRh4QWt$K l2T$ gL$4D$ 41ɍAD$4tT8`T$ Q$QRQPW8~c4  4T$JP$wx&Pt$he1#t$L$ $d$ r $3 $tu¸[#t(/#PQh0#|$D$u |$u |$TF1@]%t.#Pt$h.#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh/1#L0aPt$hJ1#|$L$lj% L$St$hk/#{D$$D&ߣ1ɉQD$PS L$ 9t 9St$h/#,D$ D$ D$D$0L$0RPQt$,t$$P{tBD$tUtsD$ |$4jVPM D$h|$t!811FD$&|$4VVP  D$'$D$8|$4jVP D$p4jVP UD$1=4D$44$Vt$h/# Ph.#= 4he^_[]4$h0#ًt$D$t$$t$SA@9s Vt$h60# S@D$t$|ܡ1ɉQD$PS# T$tD$pD$ 9t8u诡8 St$hx0#Qh0#臡1ɉQD$PS' ƋD$ 9t8t}St$h0#St$h//#D$t$։D$(L$8`OGL$0d$ rxL$D$nT$ߠL$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hl.# jlj-{Ph4h.# h.#hx1#h1#h4h&#SWVPD$t$|$L$ $QP67B9w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS|w1Ht$L$ltT$d;WuT$h;W(u QO ŃtD$ppPUr D$DGXHr P_oXd^_[]USWV$l2484t 4/4Sh4itW4މ)ˉESQ|$ Wq DW4VV7fǀ4/SUtiu4Uh4,^_[]USWVhT$D$A'#&1Ch4ՍD$ CL$;rjt$Vp{ ufD$jD$Pjh4Vt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPrt51t ttt ttth[-#+ 9uЋkT ;$tl  1L$D$Sjh" {t+1:LtPh-#軟 G,;{r܃TD$@TL$9uj 賞VoH1A ^_[]h4hq-#+USWV }= 4t D$ toh-#Wxtcʆ1ɉt$QVW  T$$9t8u蠆8,Wuh-# = 4j11CL$ t$PSQVuu^tWt =41=4u?=4u6L$1J1ыT$1 u#MUPj h-#1ɅRaMUPjV tK=4u-=4u$1H3$3|$ uMUjj h-#MUjjP e^_[]ÉSWVt\m3q~FDx@uAFX@ut9v\m30Dr@tH^_[USWVPω11s6tUVh<-#SUh#S t9VE4$Euuh$b#x(Ɖ$t^_[]hH-#hC-#j#hH-#hV-#USWV\։ύD$ jPj P蜀 1u0D$F|fD$Y|Uh-#j D$ P$L$D$ L$/Ph #j D$ P[ $fL \m3/LA .sD$ L<u\$ SjPj S E9[|$ t D$ PVh-#ۛd^_[]WVth΋u\~8tU~4~`N4F8 I9rPsD1F0F4F8FXHr PTDFX^_fUSWV\$44h(3#sP\su 4^ha"Ptu 4j^4Jmx &蹶'?c.54芓ha"P=tu 4M4=4M433#tM#l$PKrt Pu|Qߋ<-t<+u{uNh%SstGSM16kh83#q4t8u)h?3#q4Pqt 4#hF3#}q4Pqt 4O3#1=4tjh^3#~FP7֛j觛N=4u0j_`ujjB=4t!=PM4u=4ujhu3# C1FVV7=L4uh$#502Jru\~jh3#B jM5L4f:0BuK@44!Ѓt4M44Bzu=XM4t0譚|XM4jS=M4u T4=R4~jh3#u j j 6GWVt$ y54544ut[<|=N4t=4t|2'V1Wu=WSBV|WV|$ Wo@jPS9tWPD^_t$t$)9tjh3#jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]fUSWV,\$@94<4U5[4YZ=H4u 4H4U=v====,=XAf2 4iL4P4T4F=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff f<D$L4D$L$d$ P4 T4D$D$fD$ D$5[4)Pj5[4Q 4,^_[]VPhht@j] t1h3#ktP$t$uչx%~X4h3#rkt(Pt# X4 X42 X4 X4u.h4#!kt P##Tƅ~5\4h3#jtP# \4 \4 \4 \4P^V[tP=4t1H Vf^PL$$`41Qw$& 4#M(uMf`4 x4#44#+4#"4#4#4#!4#=YÉ$4#/uf`4'4#uf`4`4WV׉vu1=4u WV^_SWVPh*4#iPi1Ʌ 2h%ui?&t4Qh4d|t4=4#t4Vy )#4@4#4C4#4E/&4#4F4#|4a"y44444444~ $N44_%4t<ӕ#$b#$b#t 4T#gtlj=4I4#O 4L4#>X4#t 4i4#!s4#t 4=TM4t8=4u/湄4#4D&4=4u 414$b#u 4$b#⹤$4t8u44$b#C&q4=4tt8u44$b#b#:4t8u44$湇4# 4t 8t1@ 4$b#14$b#4#u%VWWh4h4q#i&V5454h 4h4HB#>%V5454h 4h 43&>%V5454h 4h 4#;tlj= 4#m 4o"&U#$b#$b#tơ48t,<$1QQP<} PW<$We@$h4# 4⹸%=2$b#u$b#u$b#48t2<$ X4IQjP| PWv<$We@$$#S> 4# tÉ$ 4#$b#tƹs"=4u$b#t‰h$b#Ɖ5( 4>u *4^_[É⹩$ 4z8{lV t<0 1=4u Vw^USWV׋t$$\$l$;Et*+u(>%$b#t D$ L$M^_[]USWVր9tMτtC18 42U5X4W(v 8 418 4U5X4V v ;8 4|ut$4^_[]Ë 4X4USWVL $։ύl$ D$?h4#W\)?SWU,F D h ! VUhu $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$=xt$4h ! VWt L^_[]Ë 4X4V=XM4t =4=M4uF 4X448t!48t=4u 41B4=M4u 4X4b=M4t 4X4H, 4=DM4t!=X4|1Fj 2F;5X4|^Ë $ 41B^ 41B $ 41B=, 4ug=XM4t =4uN=M4t 4X4=M4u 4X4=M4u 4X4, 4Ã=4", 4Ë  41BY ( 4X4Ht$j54 x 1B)=0 4t  41B'0 4t  41B0 4t 41B0 4WVD$ #=$2 lj Ƌ 4j"  4j 4j=M4ttV$ 4j50 4^_WV|$ 1Ʌ<+u OL$ GW^^-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$&1@ÃQ*A wO$ع& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th%V<^trL$PQV t4uRL$x4# $x2P 4#T$x 4#$x 4#w^1J4#^aD$# $2  0 49uVD$ T$5$2! щ щ! ‰ 19^Ã=2th4#Ë  41BSWV@΃=2tt4 4tVs\tx1Cj S*VGVZSP_GVhv%P  4 4=4 4!Vh4#j@W膁WZ@^_[ËD$8 4WV92t#֍|$RQjWD1B$52^_Ãw8&ÉfUSWVPt$ P!уtRPtt jh4#jh4#l$$\$|$Q t^tY9uE}㽥4u <Ճt(ˉ $19u tC ;$u~2KՃujh%5#t jh4#jh 5#D ^_[]1ۅs IQRP踒fVt$t=2tjh95#52^á2xy=< 4uE @ 40@#4@u.< 4jhN5#?t Z4t2Pq254)4V1N=@ 4t9t/ @ 4,@wB$@(@1҉,@Ɖ^USWV=2@ 4@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh`5#1@$qQ52 9D$}@ 4럃^_[]USWV-@ 41|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5Z4(@ 4@9@S @ 41JЅt8=D 4u/@u1u0@4@ &[WV@ 41t[@t @4v @ 44@0@{!уt RPF1G)t Z4t^_USWV@ 4t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtH@ 49t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë @ 4t$@(@ ,@1HUSWV5@ 41H(@$@9t#H1ًP1 u,@;Hs D|N4%D$z9tG1؋O1 D$ ~9 $tG#G=xM4t @t2x9 @}lh j.tH @1HGG7FGF8~FNOG Fx ~,@;GsN+xM4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@>E!ƒ5@ 4@@2tOD2Q@u;G  )RQ@w u&@ 40@4@&OD1@l$1tʼn$yjh5#1=4u 2x~OUQP] 5@ 4@@o<$t0@D$4@=D 4tU=|N4u#L$ Qh"$ |N4j2=D 4t=M4u q=Z45@ 49>tOOHO@ 45@ 4wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jh5# +41H^_[]USWV@ 4ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2á@ 4@u1I4@0@Ë9t1JQQ 9u@o @ 44@0@1@@(@$@,@PPP@A!ƒtjh5#81PPjt$A!1WV@ 40@4@!΃t@@9} 0@4@^_SV\$t$ 54({@ 4h8@j@ 4@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV@!ƒt@ 4 @ 4@P54vz@ 4@u@^[SV5@ 4@  ˀuH9tPQP Pdž @vv Hu5@ 4@uE u@G5@ 4dž@tV1@ 4P54y^[á@ 4t@1fWV|$t$ t=H 4ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV9(tD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h$b#jL4h:#lLh!4h!4h!4h!4\$ -uF :tjh:#]jNbt'.t5!4bt0:wtptcu+!4F&jSh!4 !4jSQ ,uF!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4!4ho:#J1tPh?:#J1F$2VhJ:#WhL 4P(hS:#dJVha:#WhP 4P ^_[h{:#>JPJj321B th:#Jƅu&h:#Iƅuh:#Iƅt]h8#Vnu6h5#Vnu$h8#Vmuh8#Vmt1B5#w1 \m3TA ruƀT 4ƀT 4ƀT 4@=u=H 4D$T 4SVt$ !4M1ۅuD!4;1Cu12(u!=LM4u2 1ۅÉ^[D$T 4ËL$=r!=H 4tP5L 4j hT!4Ao'T 4u T!4U!4uT!4ESCT!4Ãw@T 4uQhk:#VPt$ u t!4ESCuw T 4u;Vt V5P 4B$t!4xPV@,@T 4uPhk:#V5L 4j ht!4knt!4^WVD$L$ =H 4=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$x&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=H 4t'~3P19wKS>~-19s2C,9r9v)CK$PjW ?)߉ىjVW ^_[USWV1D$$5)4!4!|$7l$h!4jW L$)ΉSUV D$t$!4wɋ )4)4<9)4!4t$ \4)у|Z~V1\$ l$h!4jS L$ )ΉjUV+ |$\4+)4t$ 9}!4w!4)Ɖ5)45)45VYt$D$ )4)5)4 )4$H $~^_[]ËD$L$)4 *4t@USWV\$;=M4t@D$0n t3>SU>uF8AU V o ɋl$u9tSv J>t1|$jjSOF ~.EFE0uE^_[]V)4t";T2t1FVh!4P/ )4p^USWV\$,=H 4tV)4tgفuH *4J *4*419*Qh*4~-)45*41E4)4J *4*41E)4=)4u )4 )41҅; <2t҉օt1PS;H*$&=*4+"*4Шu*%=tS )41)4]^_[]Ét$*45)4 2y)4!4)É 2n1|$ l9} SWh!4<; uԉn$b#t)4!4VWWX=)4=!45* )48u!e0*4*4tP *4%MD$P9-)4E˨ -)4E*4 *4? ǃ*4^_[]*4] v*4e*4)4=!4v!x ux ;|)4=!4w%*4)4< t )48 t*4*4 *4)4B5)4a*4)48r *4)4=!4wx u )4=!4\x tQ )4=!4.uD$ L$PjQ课 $T$e^_]Ë *41; )4|!4á)4t @@@ 11[1PPUSWV=4׉΋$$L$ D$1AyōD$PU#D$=xh3"#U-^UW$ShUdk 0jhA;#U| ShU5k D$$t t t@$.sea1ȋ$rch1 te$.she1ȋ$ell1 tR$.mar1$k tF$$(2D$ $X2D$D$ $Uj $Pt$Wփ ShU4j SC11PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=4o=82u=h2u =G4P1TAP0@PjVP/OW0|8QZtQL8h"W[É4$pu1ND$PVx#D$ =uhVh4;#a0tPcƅdո(2Ex uָX2Fx uhA;#h#SZ T$Z^VUhU;#S:S/4$VWWVĀ^_[]SWVhx;#/P/tt;^_[&h$#V911ۅt+h#V%V%1tV<1AÅt^_[SWV|$\$t$t.9tFtVaF(2tX2u%q;#+i;#Qh#PY tWh;#vY Y=82t"hi;#h#v~Y V(2=h2t%hq;#h#vSY VX2^_[^_[USWVPӋl$D$ $uSPD.SS1tD$ t}t8^_[]StV믉h!4jPN SPuSqWV)48L$ Ƌ)4 \49}I9u)4xtWD$)4$)4V)48t,t$<$PD$)48uڃ^_SWV !4)4$ \4+ )4|51ۉ|$8tZO\$\4+)4$9|Ӏ8t-t$|$D$|$D$$8u$!4)ȣ)45)4^V^_[V5)4!4tR)4)Ɗ 0@u 25)4A=)4!4"*4=!4 1@^À=!4t8)4)4 25)4*41@á)48t AUSWVPQ+$1;t.߉WjU $)ډfu $;uƉ^_[]USWVh;#O+h;#@+Vh;#P@ Åt^_[]jh;#Wz@ t Vh;#Pe@ U uh;#*Vh;#P:@ ÅuVh;#W%@ WV9G t'փtPh;#VjU G?G uG^_Ð0*4i ËD$u5Ã<2Ph;#USWVD- 4ÅE\$9uz$1ۀ|tisljDDs9u>rjjx 4*44*4$t,tV#hj:} =Z4TeuYÃ=Z4e4΃e0*4~o6/=H*4u #=p*4 t t =^=H*4;p*4Ct}.CЃ jS&ed~hX*4 D*4@*4=0*4t 0*45=0*4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=0*4i0*4ihr%jjS\Fc`$(&=4 %t#-l250*4=ES[jUY  xS0*4H݃t =M4-8*4>!(Ƌ 2ķ>tjVUP t j=2u J[\ 2jry C$ܺ& 50*4 h<#9L4949P4=H*4SH*4C1Ƀ x*4l*4ῃ5H*45H*40*4/U]VsWWr!2@*=4%9*40*47N40*4h#jjl*4p*4n=4 5T20*4 }h;#0*4 _ghC%y1PPvN41; @*48*4 D*4HD*4@*4/=4 0*4%h<#1PP9L4949P4؉ك u. u.S莍iq*45l20*4%aih%{jVyl*4p*4 PZw 8*4 *l*4уBЃ@*? !1҃ ƒ!D$Z=H*4,9L4t 94h 9P4W jh=#j#t$(Vt5\*4\.4`*4LM4d*4N4j)eD$t Pj{@eJr蘬 L$Qh"$1;@*4D*4|D*4@*4)O=M4@*4u' D*4|5T*45P*4zM@*4jjP1;@*4D*4|D*4@*4跷ݫjj蟷ūD$<2D$Ph;#=4jh;#VR D*4@*4M4 D*4@*4M4@*41ɉ D*4|D*4@*41@Pe(ejh<#e1;@*4D*4|Y@*4D*4 諶Ѫ=M4u5T*45P*4Ljj- D*4@*4ʃEݣM4c D*4@*4M4h*4  h*41; @*48*4 D*4|D*4@*4q j5<2?@*415h*4"5h*41;@*4 8*4D*4|D*4@*4 j5<2RCi@*41D5h*4=M4t5T*45P*4J1=W D*4i@*4me54V?P/V$@*41ɉ D*4|D*4@*41@PuGjhs<#@*41ɉ D*4|D*4@*41@Pk 2V_e!ֹe5M4RPyJ1A诳է D*4@*41҉AQPcM\.4Nn\.40*4>X`h<#r1PP?ùe9L4e94e9P4e e S賁+̲1PP5M4n豲צ1PP5M4jP#'@*4D*4ؽy蟦=M4t5T*45P*4Gjj5@*4d:0ؔ@*4D*4艽*Pjj5@*49; eS贔D$D$Ph =#{豱ӡ@*41ɉ D*4|D*4@*41@P"etbt3tFu j11A; @*4D*48<#|$b#L$Qh@<#11%@*41ɉ D*4|D*4@*41@P'"e11A; @*4D*48<#|$b#L$Qh`<#je54<h$#P541=tjh<#o5l20*4nvh%1SVUh蠻Ag54rSPx]M4 \4݉@*4 D*4\.49‰}@*45D*4)‰\.4+4eM4 \4@*4 D*4\.4+4i1D*4@*415M4QPHFjh<#H3D$Ph<#d ։u=X*4t@*4 D*4X*4e,5X*45@*4tI~V8Jjh;#bUSWVP趮ܢGVD$1Ƀɉlj щ d.4`.4D 4=Z4uH9ljD$u21xUUjn6 9-Z4u;=`.4d.4D$tD 4 Z42t8teue^_[]USWVPӉơ8*4u8*41 r4$0utV4$#8*48*41ESWPO á8*4 8*4 h*4tu1Fx` sKu j]j%u0SW58*4 á8*4 8*4 h*4ujh=#t 4$4$^_[]WV=2u=XM4t =4u袬׮t 44!ʃt]54QY+4u =2uP5DM4=D 4DM4D 4u _BLE5DM4=D 41jPPB ^_SWVl*4߾h[&t$#0*4/ V+=p*4u V@t h=#t u%C%P1+4PP^_[V蛫ơ0*4"~S.#V$^%=4q*4VPujh?=#  tY>!t |*4t P V!|*4=4M|*4.h3=#qF<+t< t 4t Q V菛4/7E=4V蜭h9=#Pt% =4V^X@*4^(N5@*4jF5@*4jQP軯^5l*4V5x*45H*4H*4738*48*4PV4h3=#h$b#r^SV 8*4t s70*4Zb8*4shE=#i8*4 shP=#Q8*4 sh\=#98*4thh=##8*4 shr=# 8*4fyh}=#8*41Ct$‰sSh=#jV/V8*4CuϹ"tW% s=#Q+4^[fD$=H 4t@WV|$ Wjeƅ~WhVT ^_USWVt$0l$(|$$t U ,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD H 4H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tWP t W} WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f *4 *4 *4 *4USWVi $AD$)< u?FP貛^tP 9~q>#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp2hhh2h=#htjPV jh=#h=#htjh=#h=#hjh=#h=#htjh>#h>#h^Vt$ t:j j6 tL$HΉp *4*4jh>#荞^Vt$ t:j j tL$HΉp *4*4jh4>#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃV: 1H^_[]hY># t8tMjQP[ ƅuh;#t98t4jhi>#P/ ǍEjPW W iUUUSWVP1F=4jt$FP#19jV n1PPPS{!ƒJVWS <$S跀11 ?$:81xM'x+xG1O|E(|n|dȃ|$*4t*4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW St1N^_[]4$ |t|uVP11xtɉSWVh*4t$b<ƅui\$h*4e5*4PSh*4I5*4P|*4t*4h*45*4p^_[ËT$ *4t$USWV։ύjOGT$9sP:8uu#,^_[ÃD$ Qh"$USWV\$01F9L4949P4D$4$1t$ tÈ\, }D, *4D$Piurȃtu(vqle1A^_[] ƒddr$uAruuu.dt)D$t>P~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=M4ÃB1ۃ=M4ÃCɍH9 X4~Pj#|k+4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=M4ÃB61ۃ=M4ÃC%|$mu9X4~HPj#j+4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PV0ʼnPD$X9vpG$11Ʌu2~>9sWt$V t't1:%21F9r':$2u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW<V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQCYt1=N4ƃtEuG%t|Qh?#hh2 &AVh"$6I Eu ?=u Qh"@#$ u 覣!ƒtVHQh@#^Ã=N4t$4tPP&t54ËD$t54PF$1PUSWVu1954O4t_jP%=4tJtWg%W"=4u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =M4uID$xAP~t4D$8\$Ph>#FًT$WVt$j 1@t=4jWd$54t$V$t$54g$54$h454#4t$ t$ ۨ(N4=N4111Z4D$4PD$#Vt%V jP5T2 V =M4t~]t$ 1e^_[]h^3#SsD$tjh>#SY\$tXD$L$PQS\$ ىD$tL$L$|$t(h$#S1Ʌ D$ \$h$#St^h>#\$St^h^3#StaSOD$ te\$ Sh"$谎3 L$Y*4D$D$  D$D$ D$D$ jSNqD$xh1@D$ =M4Vs t$ D$ \$Ph>#ӏ߃Yqt$q,\$SL$ Qh"$D$ 0 h4tjP41UV=4jV訔#FtV54]hbZ54t854|54PVHj5414*4*4*4*4e^]ËD$t jPUSWV΋\$l$t׋L$2VWW UnV 9u jS^_[]WV.|$jWHoOx&Pp=4u8PhC?#ƃ`At;DOtjh?#ՃatdtpouhW+2+j Wn21jQQP5!¡2ty'Pzo28Ph?#肋^_USWV(t$<41$tjP4$|$ VWZD$ wD$t$D$ t UD9Hŀ}mt9UD$PD$PD$D$t$1D$t W9sLHǀt9spStV[WP,jUXvWh'A#VhN%UP W3 h3"#S>S ^_[]USWVPνdjjduljËFHN~ H VƒtS tN)M9|>,$jUuWPW蔵 Uvڃ,$C^_[]SVt$ h$#V1Ct'h^3#Vth>#V1ۅÉ^[WV$ VtVWVtWt^_USWV 1=M4]=4Pj\h"<#1Ƌ|$ 11@L|uM@-u)Fh$#W)1%tuQ%t s@AAۃ\$WVW؃D$jPtWVt$P W "Sѳ 1tXt^~u1O\$$D$jPW_ uQD$P4D$(0$#^jh@#4|1 ^_[]ÉOV@;t;V@1|$rɅuŋD$(>#1O;PrS USWV=4t^_[]j荈h@#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh@#U{PljD$UV\WQS\$B,8jUHrS\$SVUP4$& S \W V? V|V$k#N@ |^WV|$=M4taPWk1=M4#D$=WU*jP`qWPhP2LPW(kx#D$=@{WjPqWP=h@2Vj WoƉ|^_V|$PVx D$XT$\1jPPV|^UWV蒊lj54# QP`jt1GL$ T$3*43 *41@ u,L$3 *4$3*4 u!tL$\9|$X}e^_]ø'A#Vt$V9vHx/uAΉ^fVn *41ы5*41 u^ã*4*4=8M4t^6~^P~SWV1ۃ=D 4t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=+4t+4USWV-M4~ON}=M4~Q111SWuljӉ:}qF;5M4|؃=M4' =M41=M4|=X4111;5M4| V|ljՉ!<$=M4FD$1;M4á\4D$ 4D$\.4D$$\414\.4PPSUt$ ljՋD$ \4D$4D$\.49pt$j pF1MX4H91Z{1@^_[]Vh 2F;5M4uj{ t j2^USWV\$,=+4t+4&|$$t$ l$X4t  $9~ lM4$x 9} H9$!tT=$N4t M4tC(+41҃=D 4TRQPWV脘WV Ɖ1ND$(D$<$=DM4t7X4H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=DM4tzmz1@D$/1@D$=|2uu=2t hTA#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|2 4t)!u =DM4u=L4u+4=L4t Xm+49l$"X4HPj-|1Ot1E1=M4~1VV|{~ VVVD5 -D 4t <$tw y|2j@ ^_[]USWV=+4t+441=*4u!hM4y=DM4t X4'|$t$;D$||$$t D$9X4~ =M4É!tF=$N4t M4t0(+4,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=*4táhM4y=DM4t X4ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]ÅtX4HPjytm=D 4tPay1u11FUvUVRPVjv!уu Z4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V X4~&111RP!уtF X49| 1 X419^fVt$tsVGF954u#1=2tu1Ɂ2tщ 4AF=2tH +4v v ^ ^ËD$2tQ12tЅtË 12tËD$2t 12tËD$2tI12tá +4USWV\$S@Nj522tv W6W3 |$j4j'fSeFSF 1HF$F F1FFF0F,2tFq0@@F=2t@ +4VEESËnU9Ë\$sU腥 SKeFWp 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P蛤 w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=\.4jjPWV^_USWV,T$Dl$@ظBӃ=$N4t  M4t0(+4 @1)ʉ|ЉjSUQP虊كQP4v=`M4tK uu|| t u+| t uZ4ttZ4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tZ4ǃ݃ tkwRPW v=M4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N \.4 CfN =\.4=M4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1XM4l$t$1E1!1M,^_[]Ã=M4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjhdA#c^_[uƉסX4HPLi11 u^_[8iWV!Ӌ X4It*QRP4 X4HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjhB#bKy1V[hVjRPUo=M4jusj'hD$ jhD$T$l$ !Ѓtd9}\X4H94$SW!уRPvlj9Љ $AX4H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$X41VVjt$t$PY95M4^_[]1K16-+4-+4X4H $)QUjSWP(1K[6=DM4tf"g15+4SW=gX4HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9+4QE#>$4,$tt=t|<9+4|wC^w \$D$ShE#jW$4,$*E#f9+4u+9+4}9+4t9+4hu_G t t1"~#ut|\tt t tL@?3~|$j=W輜9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEuE#$b#6$4t$ t t_G칒E#$b#$40tUPKtuE#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVz+4^_[]SWV׉Ή5+45+4h}E#hSL=w )WVRQ/+4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl2 t^ +4 +4!+4JtGtO GO +4!+4l2 t +4u +4^_[]ÍZ w6$&tEGЃTZ$&btPeu>f +4랄tGOm>"#놃>$#w>N&h>o"&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w] +4!+4d   > +4 +4 !+4"+4&+4RhE#jh +4E# +4_t>$b#vVhE#,-4P+t ,-4Ղ"hF#蹻0-4Pt 0-4F#jVL4-4jVL8-45(+4h-4h-41-4PҎ $u-4^1|$á-4-4S<-41-4@-4 4-48-4 @-4@-4@@-4;<-4|1ۉ.4.4.4 .4.4.4.4.4 .4$.4(.4,.40.41H-4-4h-4#h-4-4P $u-4[USWV\$0l$,1=tM4uSUƉסM4 M4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| 0.4=M4tU t0.4-4Z-4D-4\-4M4 -49}Q-4ƁD-4 \-4ك=tM4WV^! tt$j VRP)NV1 M4)~$-4r5-4ƂD-4 \-4Iu܅~+1ɊT 5-4~=-4D-4\-4A9uס-4H -4ƀD-4 \-4-4.4^_[]Ë M4t M4=tM4t1M4@V5<-4@-49}9 8-4<u"4-40Ph-4 8-4@-4F9|Ӌ5<-45@-4-4.4^SWVt$\$u$D$0j?oPѷ/=H 4t&v!Ss1҅ SVqt1҃Pn1҅t$St@-4~- 8-4Vt[u8-4 @-4LV3Zt @-4t> 8-4VtV[t'i=H 4tVs1҅ƒK1JFVY# 4#4#54#4‰^_[QY# 4#4ʉ# 4#4á@-44.4.48.4á4.4@-48.4.4ËL$1wQ5,-4`1SVt$ 1ۃw)V5,-4:uV50-4'1ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ1F#9u!B1@uDA;1A+u%uVt1@^ÃwV5,-4Gu߸ع#L$1uj jE1ɉHH˅ SWV= .4 u|$t$\$t-1 |15D.45@.4tm1@Z ug N4t LM4uU=.4~+L.4 H.4\@P.4.4 .45@.4=D.41 .4=H 4 .4%=uaP.4PP.4T.419RhT.4bmhT.4mT.45L.45H.4L.4 H.4H P.4.4u"P.4T.4x,1WV=H 4t P.41At^_[ÉШu-%=tS0l.4=L.45H.4뢋L.4 H.4P.4.4USWVӋl$,|$(.4=M4h.4uBu>%j jzC1҉PPh.4(.4.4.4twQPl'UWS h.4xt,.4Ph-4蔅1h.4.4u+N4tLM4A\$l$͉=H 41؋5@-44-4.4Rk5@-4UWS% 65h.4' h.4-4PV軄-4@-4VP诅V荄 -4AVUUUЍ@@-4 .4 \.49}oh-4藅ơ .4 \.4Y$gQVlu&4-4@-4PjVPm.4$#54-4-49|@-4l$ EVjUek L$ )v %uh-4蚃5h.4 h.4 @-4; <-4 54-4|tq=8-40jf j8-49u"_l$\$u4Шx$_l$\$u$54-4 _ ‰$ u*N4t =LM4uKuG ڃ^_[]H 4m_uiud1UWj.4+-4 t2(+491J$;,+4} qɉы40+4)t _4-4\$ PjSi 1EL$4-4) @-4PjS`i ǡ8-4 @-4tW4V).4~Z.4t\ [5x2)Й)֋$F UWhr% N1.4E1-.4$_PdtUW ]H 4t6=M4t-QdtQd UWl $UWS t1@1^_[]SWV=P.4~4։1T.4Pd VW u C;P.4|1P.4)^_[Ã=.4~L.4 H.4.41WV=.4~L.4 H.4m.4|$t$ = .4uu 15D.45@.4itb=M4tY .4\49.4|.4.4.4@-4A\4 .4H9.4}M4 j M4M4jf=M4.4tL0.4tBx .4 \49}; j,.4P .4 \49}0.4ы .4 \49|L=4tC4„u0=M4t't4|$t- 1j1j 1j5@-495(+4 u4-408-4^_V=M4uajm5,-4ʅtMȺj94#Fu=,.4u"Ⱥj>F#Fu^SWV։ˋ=@-4G@-49=(+4 u4-488-44D$ .4; .4~~ .4@-4.4 .4^_[SWV<-4 @-49}1T$58-4ׁtu Ӊ @-4@9|^_[ËD$L$ D-4\-4VD$ L$=.4u=M4ttNI1҉ tK1G-49~\-4D-4+5<-4)΋ 8-4 4-40 ~^.4 .4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8Z4u/(+4H9| Qu@4-48GO1H^_[]cS 4-49t 4-4Mtۉ>?SUSWV-(+4\-jSYr jSLr DžtVtRU54-4V# 8-4UPW Ux 54-4x 54-4=8-4(+41t Wx 1Gt Vx ^_[]USWVL$D$ʃQPO1H…t$=(+44-4D8OlV tnZ4uc~4-4>-(+4u@4-4 (I=(+49rHŠIJ4-49s=(+4)\8OVà uQL$ t 4-4t=(+491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= Vw 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15\.41K\.4|EtESSP t\.4@ԋ=@-49=(+4 uS1Hte1ɺ|2:tWAuN1|21I:t?@u21|21I:t%@u1|21I:t @u^ËL$H1Ʌx 2USWV։Q脣@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=M4u1@$5.4+5 .4~1; \4^USWV։L$|$0\$,Ѓt.4!t6tC؃T$RjQPWSQ=M4=(.41ۀ=$.4tw4$$.4 -4ىȺVUUUЍ@)I-4~4,I-41E 8Vt$0j* G;}|Cu4$SG 0.4tf d.4`.4!Ƴttt$,9} 5`.4=d.4$.41ۃtQ4-4 @-4T$ 1ۅ~&L$ PjQ\ @-4~8-4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1E .4;\.4uX-4#-4uD$,-4=-4=-4~01-4 8jG;=-4|h-4t.4;.4~<$~.4 @-4 .4$.4~1 ;j_G9u .41;\.4uD$Ph-4t@-4 <-49~~51ɋ4-44*1 8-4444A; <-4|١@-4) $ .4@-4 .4; \.4~(M4 j .4H .4;\.4؉^_[]WV|$t$ =M4u1WVP PV WVt1@1^_Ðt.4H ȁ4G4r14G4tG4t.4xG4TG4|G4 G4 |G4G4G4G4G4G4G4USWVL$0D$,l$$|G4$|G4|G4t-9Br }$r1z3|$( H|G4u$$rtG4t :=tG4xG4xG4<$:rBJ jl$(jW|G4tC:|G4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?|G4t_ )ϋ,$]}|G4t|G4tV+BJ NF=xG4uW-|G4MEu$9ˉ|-xG4],$ϋ=|G4t sKӋ$JHJ^_[]USWV1=tM4tD|$(T$$!t3|0|G4|G4=|G4t'9PH }=|G4u11CŋE1ЋM 1 u ]u,G4G4G4EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}Z4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[Z4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStG4 11؉^_[]Ã=G4xÃ=tM4u +41tM4Ph>F#4VG4xNH G4d|@G4* G45G49|jhVF#z5G4^USWV|$ l$1Ƀ|G4|G4tKC9|G4G41 G41 5G4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9Z4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$RZ4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=X4~%GW8É!Ѓu O;=X4|܄u<$<$US111 )ȃ^_[]USWV1PP@uejhA#2p.41111ۉu WVSU1PPWV+Z4u Ɖ!Ѓup.4^_[]WVT$D$ =M4t 5M41)|щƉ^_fUSWV t$ >-uF(s7h%+V+h"#+艣D$1S6]+S)S\^SSjy Wh#À8t>tkV聪tmSʼnD$Ֆ$Uɖ $ȃ$jP'袷t$PShN%t$Udt$g  Sa'Ņu>tVha"F'U$Ucg jW W1FVJ]V'D$$t*P*hoF#y*/j ))3+4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhF#.1N\$h"Ss4h%Q)SH)h"#;)3(1S|&S[jj 觡1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVSjhF#1KtL tGf;t=ËFHN~ ;F~à tQu VS$Vi1Vj 輠1GWZWg%e1=+4VZ^_[]fSWV1G41K4t 5u'#ar'G__ _Gt P:d GF6u^_[ËL$ 1ɅV-$t:L4'W.t7^uM4L41L4L4L44 M4L41L4L4 L4L4t PLa L4Fu,~1S薺PW豺Fva ^F~ ^v;4t PNu VSWh ^_[ËL$t@;4tjhF#x)1HËA QUSWVD$T$1ɾG4=49~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9L4u L4L4uUSWV\$SκƋL4t@PPV觐uL4L4_ DžL4W_ u^_[]USWV=M4|$,t$0h#WX l$L4L4!ʃtWj UQP"L4uL4 h$#VtL4VUL4PhF#Wu^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=X49Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft PJ^  $FQF^_[]V=4tjhF#&dt$D$tt/uKV4;m?u7=2xCjh3G#뵃=2x%4QhZG#l&^jhG#jhNG#{Vơ4t Pv] VޣP4VT] 54蛙 ^34VD$$L$ t tC8.@L$$VheX&Q 2>jhhG#2xxPhG#j VwV螋||P|0tB D$0PhG#;D$$VheX&P >t.jh~G#1M4L$QhG#$^ãM42V2x$ X41Vh@BVPRQ_M4^VD$$L$ t tC8.@L$$Vh#Q 2>jhG#2xxPhG#j V>Ve||P|0tB D$0Ph+H#;D$$Vh#P >t.jhG#1M4L$QhH##^ãM42V2x$ \41Vh@BVPRQ&M4^V|$u%t$jVt0PhOH#N#^V|$u%t$jV؇t0PhlH##^SWVD$L$tPL4p=4tjhH#"VP>PR Zt V踘)X!ЃtV谕5M4SW? ^_[VD$L$tt\uoPe02_Pơ02t=(2t PkY VӟP02VIY 02QhH#!^V|$uJt$ =4M4tV4-L4hW%_V_h@^^WVD$t t0t$R4l7=tDMtGhuXF 2PHM4R4Qh"$5!Emtwt su!FF2FR4FR4F$27:X V^_D$u5|M46Ã|$"7VD$Hs^\jhH#7<2V)hͥ$&PhH#hH#Vq;2xu'hI#h=I#haI#hI#hI#hJ#h7<wVȃ=M4utjhJ#$FVPMy0PhJ#^_ÉPhkJ#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;(+4~,+4A9s } uE9u9t},u E&| t2(+4+$+4x2 ^_[]WVD$Pt t*$TV葃PVLD$ps D$ stopD$Tab =t2|i1Gt$rVIfD,V94,+4h&b#P_2 G;=t2|V D andD theDen t$V5x2hJ#P2 0Ph"$D^_à D$t t+uyL$tJQtQytWjhJ#Mà$2L$%2AAD$PhK#!%1%2$2$2%2 $2%2 V D$t t]D$t$jhSO$QVP46h$#V薃t5>t M4 $M48M4tP9M4$#L$QhK#O ^ËD$Hsjh5K#/Åu 4Ã|$u=M4D$u =M4~GTM4ÃD$ u)=M4| PhFK#M4ÃD$ u)=M4| PhsK#M4D$u"=M4t=4t*!ƒÃD$ t t%uCD$ 2^u2@t+$2"2P7QhK#V D$,L$(t tC1ɉ M4 M48,uT@L$,t$Vh|$Ql >tejhK#Ot$5M45M4hG$jVl0PhK##t$D$,Vh|$P >tjhK#9 ^ãM4M4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$&d~&s wR$&s wU$&gRtFWt4^tXBNIAt-u#13rtwu!uրπي@GN41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh&L#1QZSN4^[ÍD$Ph L#҃=M4=M4=M4Ë M41 X4+M4t$4Ph}M#hL4, L4USWVl$,H M4t&AUjQD$}ol$,7F]$&|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Ph}M#hL4x+ L4FVEŅ8D$EH$l&E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=4M4nAL$,9 ItIT$uWoD$,7L4j+o2Ph}M#L4V6* T$jV%D$,|$?+4t PK GP 4CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt WpK |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jhM4P M4IM4^_[]É|$|$ u D$PhcL# D$PhL#͉-M4ōD$8Ph9L#uA0h|M#j*hM4MËI1PhM#j*hM42USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0PhM#=j UQ xt-u)%tt0PhM#1H^_[]SWV9toӉQx@jP ljtG\$=M4t <\u ~t F <$t)\tPSSt GFFuD$QhM#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$M4PhL#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]h`#3rtP5~21@USWV\$(|$$1E=,N4uh0N4菴?,N4[49<$l$D$l$ =|N4t=p.4t=M4u2=dN4ubPjD$P) D$tD 29PaHD$=D 4t= N4tft$,SW ,N4=D 4u"t1(N4@(N4| j=y!趀8言8#1Hpt9=[4tdN4[1,N4D$ D$D$$PD$Pj2 9=[4t Z4t, Z4,N4^_[]øjh0N4UVVVe^]USWV\$0Z SoVo,jUVSh:'#UP葖^_[]Vt$VZ uVh"`#heN4 eN4^USWV D$0щL$l$ |$$t$4PWUtƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWVՋ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WPAÉt$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRWi)$l$D$ ׋ $D$ՋD$1PPU\$Saыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjPe^]fSWVPZ4t +4Z1N4WP(t>1C4$$N4u V WSCu ^_[S=R4tR4 \$2=R4r 2H 2R4[V52N4t(N42VP52 9t +4^Vt$52^Ã=R4tR4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVjي,`#O u݃|$0xG-Wt$8N ^_[]USWV\$8T$0t$,11|$GUSRViي,`#O u݃|$0xG-Wt$8߈ ^_[]SWV|$(L$$\$ 1Ѝt$F,`#NuxF-VQ蒈^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$Pf ƃ^_[]WV t$RVQ t|$P3GuVYf^_9Hw @sÃtP=USWVPt$|$R4V<$=M4uԇTh=4 pF#Vt$ P]Eu 448JMp;5\4| +4^_[]VWj .^_[]ËL$T$$b#PPh=`# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFuR4^_[]WVt$|$ zt!2Ph\`#PhV`#$b#PPh=`# ^_WV|$t$ t%WVra7ft=\4 +4 j Qu jF^_fUSWV\$l$=pM4u<؉%t1Uc1GWP?[PW1WPPUVd[1 jj1=41Ƀ=Z4HPVW Q Åt!WV4 |$t8jht`#'D$ tPVUD$ 04 D$ 89t V4 ^_[]Vt$tPU63 ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQt ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u aD$E ʀ[} pM4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]øpQ&fL$tt"u$ X4X4HI X4IR4ʋTUSWVD$T$ X45R4|1Gll\G9uTD^_[]SWVD$L$5X4R4|F|\\|N B^_[áX4~Ph5R4k USWV X4; R4R4th!t 1G31K;)1G1I4:tl!GtˉPW0  X4jQJƣR4X4R4~PhV*k !t\l^_[]USWVPL$\$As X411H$(uX41@$1R4<#|tZR44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$R41H; t$z|#=X4|O1;Ll |C9u^_[]USWV X4~.R411F1l9޻r G9u1@^_[]USWVL$T$9~1@+5R4A1G1֋l9߻rB9u^_[]ËT$X4!х1A9HhY&*R4=4M4&t&P R4h&R4h&2h& 2hH&$2USWV \$4Z4R4|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$D&=tM4EQ-s4C$ىË $Fw$&#Fw}$&X!уj WRPBBtDt L=tM4!154h$#P]1sTu~-M$PuYQA tLу|=RP螽1 $1=Z4R47f1=\.4u ÊCCs|,v, l,uȡ4!ƒtظ:,u54资j W5\.4QTу X45M4n9|$ V5454蛅PtmƉV* +1+5Q ic+Ɖ!уRPUVZ4=R4H8 Z4H=R4wA54kP豄 !уRPaٹ M4 X4VQRPnWg 454,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/154Mj WP j W1P9@p"@|R4$b#9 Z4t R4$b# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5M4Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^52~V5HM41=4M4tȉt 2R40A4^5$2'SWVQUNjZ4عZ49r ЍZ4WVS1 ;Z4;^_[VQ!уu$x X4H9}FV!уtt^^Ð1Z4Z4Z4Z4WV|$ =+4t5Z4tZ=4ta=X4|<1W!уtRP虆Ws@GX4H9|vuZ4覍5Z4^_USWV 22D$L$!ȃ2D$2D$ 1H2222=4=+4t4$=X4|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$X4H9|u $u^_[]Ã^_[]鍌^_[]TZ4K|$thZ4m=Z4t1=Z4Z4j jh`#"V΋At PO$ FVC^hZ4SWVt$>t_w $ W $ ߅u1F FF1HZ4Z4Z4Z4^_[hZ4SWVQ1u(\$|$Z4St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-Z4Vt;xH|p$x Hȅu^_SWV|$t$u;Z4Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=M4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^Z4U1tHt$ !t Q9y}1I(t(t$=$N4tT$$1=Z4uȅt^_[]hZ4Z4=$N4tUWVjW7!t"j]jRPWV je^_]Ã=Z4u pM4Z4Z4d Z4Vj5<2t2Z4jVx 1F=$N4u=Z4u@11N^USWV(U ]1Nt$ t$tr:tm1Z4PSi( $N41 M4t)1V5Z4hZ4 $N4M4ttxq @3Z4 $N4t =M4tj)$N4u=Z4tZ49Z4J\$tP1ػ&!Ѓ1ojh`#D$Pj@t$>SD$$PL$Qt$Tt$V>Z4$u:Z4 Z4!ƒt&9L$L$|D$;Z4D$Z4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$dZ4T$X/ t$Q t$ E \$(T$_CtN4$jjD$xP$Pt$4t$5Z45Z42$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$ V T$1H#E t0E t L$PL$THD$$e^_[]Ã=$N4u?hZ4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ \.4L$\.4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$\.4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8\.4+4t${ t$ o }tEL$L$H1USWV8=Z4Z45Z4Z4D$$8u=Z4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}Z4 Z4ȉT$!Ѓtsu!9t$ƄuYZ45Z4;t$T$$|@Ut$ 9D$ЉʋD$4$(+4@EhZ4hZ4}!(+4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># Z4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=Z4Z4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$Z4 Z4!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ Z4D$Z4D$$Z4D$ Z4e^_[]1JЋ4$|$9ωL$}@D$ (+4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=Z4 USWVt$hZ4tH>tC\$1EjU1GGGUSxLZ4G=Z4-5Z4t~'V uZ4+4^_[]WX USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)5Z4jjSt$DPV5Z45Z4s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@c4Pht[4cUSWV T$(\$$t$ 1`2PURS)ˉ<à uVh"$Gt$|$u u)u%u!1ɃtsQl2Ph"c#{Gt Dhd#a{^_[]SWV \$ hSh@b## uPthc#{ ^_[xEhSha#o# 4$at t$Qj V覛hc#뙿 hRm W+52t$S jWl+|$Wa[9uR1Vt$4$ԛjShc#4zV[=WV|$ 52j/Vt@jWh'A#QVLJ^_1@c4Pj*ÊD$f3J f3;,f3~{у ts f3Qf3jPhc4ha#" thc4h3"#PHt:j52P? f=2u5(a4虥hf3QjKhc4hPb#&EUSWVt$81GWh~j"5a4# 1-c4hzo S)D$ha4SD$U WhLd45a4 tLtFPFuf=2(a4tjQPޘ Päj t$4l$0jD$T$1D$EHM~EHMUڃÃ=c4uf=|2u0Iڃ% tM 1f=|2@ ЈD$P D$ƒ t|f=|2Qq f=|2uf=2tT$j \$Ct,j Cu\$T$f=|2x댉\$ 넻 $f=2tD$ @D$ Ph%b#Bڃf=2c45l2QjW5(a4  c4 c4 u61= c4#$ |29uj5$t hc#jvjڀ tf=|2u j ttFPFujÉUt$j&f=2t'+\$|$f=|2)b#tbb#WSP jhLd45a4ܔ hXa4jj(^_[]USWVP\$D$jP5(a4 f=21=c45l2jD$P5(a4譕 W9=c4ttػ1FU Phb#AKtMVhH[45(a4- =c45l2mVD$P5(a49 WP9=c4u^_[]WVjPhc4hyb#% t ^_hL[4hc4Hrhc#ptы L[4u P[4Q[h3"#PQCtAf=2P[4b#tb#PQhW>Whb#V \WhPb#?Lhu j$c4USWV$f3J f3;,f3у  f3Qf3t$hVh@b# 1GWh~j"5a4f WS$Wj $ha4Sj WhLd45a4h x>jƉ׉U^Z~*9u$hf3QDEhc#r11f=2tjL)RPhb# jhLd45a4蔑 1hXa4VW> WV4#Wj)#^_[]j5(a4^W1Sj"SW"VVhb#=S5USWV$f3J f3;,f3у  f3Qf3t$hVh@b# 1GWh~j"5a4膐 WS7"Wj,"ha4Sj WhLd45a4舑 谿x>j轾Ɖ׉U~X~*9u$hf3QCEhc#p11f=2tjl)RPhb# jhLd45a4贏 1hXa4VW^ WVT!WjI!^_[]1W5(a4}j5(a4mSWj!WS VVhb#<W*3USWVPh d#o1GWj Wj 9UtDƅtZW2W9uhd#o1Vjo Vjd  ^_[]hlf3Wjh#hb#Z1Sj6 SV' -2j/Ut@SQUr? hlf3WVh#.hb#W0WVPjhJ;$5a4  f=2t%52>t=a4VPVW܍ 1FVh"#5a4ō |$VW5a4 ?nu52hb#y: ^_VPjPVhc# t=a4u.5 2VyVh c#-:hd# nP^Vt$j5a4VtVhc#9hd#mEj0WV5,2t)>t$=(a4VPVWnj j=j{VhVh+c# V2t$2jh3P$5a4d 2u2$2%2t$2t$2f=2t52t$$52f=<2RF#tn"Pn2t$22d42t$2j2t$$2f=2RF#tn"P^WV,|$8V5(a4|hn"Wt! $#Xa4 $ Xa4Xa41GVW5(a4 hXa4Wj8^_WV,t$8W5(a4hn"VS1Ʌ#G OWj5(a4{8^_V1Vh{t 5(a4 j}Vhzt 5(a4c ^S\$1u8jP [ESWV|$\$1FtCWPt1^_[fUSWVl$$1dd4Pd4`4%PhP2hme#t$4U1I~1L$$D$=_48O>HЃ sX 4HЉ5`4jhP2hme#t$4U蛸߃ufH1K$&<dd4뷃EF<jh"S jh"S h#SgD$QPuV<h%S7h}#S!zh#S $_=_4<a41@D$<$XD$d4=Pd4<j/SPd4k<$$YxD$ P1PhPjPP5<( `4L$ !P5<he#QO a4d4$a4=<W *Shw%hPd4g 1@1H1HD$1@$D$~1HD$$_3)t5|$L$(4hI%VG t5a4 a4d4$a4 Vj`VjUVjJVj?_45`4hif#j V1V4$jhf38N#wL&P_ D$tu1=_4 1A111ɣ<2 222=d4t 2= a4t5`4 uW6uB= a4u5`4 u3^_[]xVh%f#Hh}f#Ahnf#:hf#j,5`4hf#!he#he#hDf# he#he#jhlf3jj@hf#j )hlf3jhhf#j(fUSWV,|$@h# jW^1ۅ_4= a4h_4)Lu.j 1=$a4ȍPU܅(a4j(a4x3=_4u?jP (a4teQ}(a4Uh"$c_4WŅ?1GVj=_4t1O,^_[]ÉVQ=$a4uL$ @Vj5(a4V 1Vh t 5(a4` Vj51@_4jh_4:KfWVP=_4t 5_4t$uhni#ƅhi#t8/u22i# PI Vh2P腱 %1&9uQPt$ X&uڃ=`4u%h`4h)$t$_ u `4%h|d4h%t$: u |d4=d4j:hi#t$l 1ɅuǡPd4u'>/5Pd4jV4Pd4dd45xd4 a4d4=`4u `4%|d4Y1ɉ d4Pd4t=dd4udd4t =a4lj:hM$t$襯 1Ʌ d4= a4u6dd4t=d4tP5Pd41 a45xd4j:hC&t$@ t 2j:hj&t$ t 2j:hS.#t$ t 2j:hv#t$ݮ t 2j:h%t$輮 t 2j:hn#t$蛮 t 2j:h#t$z t 2j:hE#t$Y t 2j:h%t$8 t <2j:hV%t$ t <2j:h^"t$ t |2j:hM$t$խ t 2j:h#t$购 t$a4j:h #t$薭 t 2=d4u d42=d4u d42d4tPh",d4tPh2"d4tPhi&d4tPh b%hd4h.j#t$菹 u d4hd4hb#t$j u d4hd4ha #t$E u d4 5Pd45_4_4t%j,VFtA1ɉ5Pd4 _4^_Vhi# Vhj#hsi#jttu$Vhi# ;hi#hi#:j!fSWV t$ |$6#N_4`4g`4%`4h4j#P `4VW8=$a41h,a4SO Xa4,a4%da4%Xa4%\a4fxa4 a4Xa4fva4pa4hXa4jS ha49ha4,ha4hu j`j#9 `4tj#Ph"$`)a4 x |AEjj5(a4D~ xPj5(a4,~ hj#ju h:j#jݮ1hNj#VW迶 vtHЃ rt+vhZj#8`4ō HЉ`4봡_3)ǃG<1\m3DHu0W-=r$hhmj#`hb#jhSGhWh`4 ?t GG?ua4`45`4hj#j V& Wj Wj Wj Wj Vtuhnf#h}f#jhf3襼hj#H2t a4 h#= a4t52u,u5= a452{52hj#jPhj# WV' ƿlf3Ph:k#Wt) Vh_k#We) j=a4tha4htj j SWV52t>u+t$c4t PW Vƣc42h#Vts c4h}#VtahV#VtShk8%Vteh%Vt1lf3Vhk#W( WZ c4$11ɺ20 ߈c4Bu^_[ñ1WV,|$8V5(a4WVjWV谆#NF=$a4t L$f=2t D$#$d$d$ wfD$ f=<2t $Vj5(a48^_hXa4jj SVPf=2tjljt$R 20utztD$= `4„u20u1f=22몈D$< t< u>jV5(a4z f=2t|$ $#t$b#P(X`u 2 <2tu 2tt A8u1f=2t \m3DAt Pm3DAD$jV5(a4 f=2D$P"/h,a4jjc USWVt$D$ $1=a4h j9D$1CSj'h,a4SW Vh"$(#ha4=tWD$ hXa4jj t$jUj=a4uD$ 1;$ȃ^_[]Ët$$4$e3H e3~e3H e3he3geȋL$ < U;t$ KD$ V1FVj-5a4h$#:VVha4,=SWVP2\$ x2t%`429u Gt+t' u9tpD$jP5(a4 Yـƀ_rc4^?t@آ c4 c4 c4 c4hc4h"$!PW1^_[Pe3H e3~e3H e3$e3t1Ƀ= c4!YXD$_rc4^?<t@ c4 c4 c4 c4c4SWVT$L$D$= c4ut1<1c41F9uRQPs y=8th%^_[hk#USL$ \$1B1t 9tA8u[VL$b4tSA j#8t6u(^@\VPtc4)ƃuf^?݈@b4^VD$Phj#=x2x2`4Ft2_rc4^?<t@ c4 c4 c4 c4hc4hj#]_rc4^?<t@ c4 c4 c4 c4F t*vPhc4hk#`4~ v 7^ÐWV1FLd4VW5a4q VW5a4!s ^_USWVt$jV5a4r  uD$41؍oD<jV5a4r D$< t r֍,f=2tc4t P u2D$y1D$h2#P'!c4tD$y2D$nD$jP5a4q^_[]1f=22USWV1GWjWjڙ VWvVjka4fC(a4CfC 1l$jjSq ~}D$tvjhLd45a4q ~]Ld4Bt8StGWuG1GWLd4U5a4)p WUl$5a4Uq 1f=22D$hU5(a4q jw%Ɖ,<= c4  A9rWD$Pjo f=2c4tyf=2~g|$_r5,2Pt. c4YSQ;Y~ڃ tZG9r QR"l$!y-8u!PWjl$UV2$Eh@p$jf=2tc4t P jfSWV2t32^tPtF tFFu҉5 2hk#hWh3"#WtRVhW`+ t4=`4tWhk#j WtWV?%%2^_[USWV|$h?_%Wj Wj=Wt@C@uSh7%Wu S6ÉXj?W9t0tO@t8JSf?!tOYt@t 話tWhk#~5=2t,2Ft = @t bt~vuك=d4~h$#RMd4^_[]SWV΋d4C!w\Cd4؋ f3Qf3; ,f3hf3j -d4 f3Qf3 Xd4#|>Wأd4NI$&Wh6#d4@d4N Q1f~ @d4f3H f3t;,f3lhf3j!qld4v Whk#& `Wh6#d4@d4N tEPPd4Vf3H f3!6h"$d4#|d4h$#K^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!nk#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uh7%S6uW 1@WlcljR1^_[SWV21t8ϻ2WPt!CtWPt Cuމ^_[USWV׉A tS^؃H$&n tWUtjPu UǾ WYF tQfB t 谭thk#I*N 1?!9~ t~ N 9tF N^_[]hk#fSWV,1f=2t hl#K|$,<0$ $ <in#5<lf4VPlf4tAG$VPd$ e40f44f4 e4y=e4nh%U/UPhr# |jh{t#hmt#hq hr#hr#hh8t#h.t#hKho#fhln#VhGt#f Wh6s#&UVshs#Jh8`&j)Whs#.iQWhTs# <PhOn#j˒u*e4 t5_3)~1҅ S| e4u8D$P(u hon#q$n#e4 e4y!ǃu ho#m#&t!ϋ e41Phn#D &u se40hn# se40hn#>Whn#+t%th:o#|$ D,f4$ $ 4hW腑 uW$ 4h:'#9ō$UhP tʼn-e4=e48f4hPU_ e4u%t#P5e4hpo#h$e4Pu5e4ho#e4uG=,f4tye4lf4=lf4tVlf4he4Qe4u7J$ e4z$u+he4Pu,e405e4ho#Z:u5e4ho#E=e4hj$$ t^ e4u$ thTp#he4Pu$ thsp##e4=$ De4e45e4hp#] e4tpp 0hp#?  e4uGe4Tq#ttDq##e4[q#@t$b#QPh)q# ,f4tPhhq#e4uu+ e40Au*hq# e4 q# e4q#U #he4u Vhq##,e4=u#5 e4M]u5e4hq#5[5 e4]u5e4hq# e4tP}]u5e4h r#j e4Au$ thp#=@u5e4+]e4$ thp#h D$VUPO s DD$st$s 8D$ s <D$tf4$l$4U&ht_uh"y# h_%h!$hlf3K &h"hlf3. uhlf3j &D$l$4$sf@8tD4$t$xVC@SPSV \$$Vt$SW'K1D$0D$,D$(D$$d$sD$4j@HP轎 st$st$hy#t$hy#t$hy#t$ hy#|t$thy#kL$9&t uQhy# &hy#:|$4tD$4Phy#!|$ gvVD$PU 16D$8uT$Bg)QPR] thIy# 1@^_[]USWVӉ͋t$V 1Htkt$t$VSUStGUNt$t$VWUS9uVSW] t'W;  W% 1H^_[]W USWV$$$|G8-t _3$D$ 1FD$hz#WS† it 1'29t9At&9IuJuiu3$tHPh{$ AtPqh{# 늡<A뀃Dtou&t$ mt$d<$W$uQ 1t$hWV jSV蹫 $FWPP uhh&VhiP u h#j}W8MT$'2l$D$G_HrY7ShjD$*P9 ft$fD$CL$fA37SChjD$&P ft$fD$f\$ $T$0 T$T7hjR SZft$fD$fD$PSU贱 $T$l$GD$x|$ hhjD$$PF \$ $ sh#2sh#"s h #sh=#sh^#sh#s h#s$h#s(h#sHh#s,h##s0hA#s4ha#rs8h{#bsXf|$rL$I#fw 4'L$T$ t$"VRQPh#oh#h#jWyD$f=212hjD$$P fD$|$<2fD$ $T$2h"$H$'L$f|$#t}#PD$=ufD$L$IL$}1|$D$L$ t\m314/Drt#E9uT$ЃDPhv#'~|$ujjPP} jt$t$ V) VhiWj u hZ#D$(|$ u,$PD$D$,$|$ 1hSW GG?t$>hSD$$P G$0hSW jl$UWj wh݂#hf3Wh:it$V芺 uO j.hf3j5Wh:iVE u Cw8)|$##P $$rkLPD$$PQ $<1|$Vh#t$kL4t4$'h/#hF#48~1D=PG9uh#g#4 D$4!4"4#4$4%PSWRQt$h\#4(h# 444,40k<SWPRQPh#4`h#h&#4\t h5#t h:#h#~"4d6|$1A t$t&u/7t$t nu Qh?#.FL9Mt$ $t$qVCP$t$RVeCh#Ph~#hlf3c jUSWV։1hUS jWS? sUPP|y t'Sh9iPf tVBĔ^_[]hh&h#jjsUSWV׉1hVU  jSU }VPPx tAUh:iP uGPh^#Pn1FSDBĐ^_[]hh&jrVA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phv#C^WVhY#0f>r1D~Ph N&GH9|j]"^_WVhY#f>r91D>Ph # 9} j:G9|h#^_WV$fGjRW+ WhiVl t Đ^_hg#jqfUSWVu }6h$b#jŪ h#VWy Hw$L'f4f4ԃBu|1PP5< ƅD$ PV膭D$(!=<\$yB  e3u1PPV= Ɖx\$f4"f3=tf45f4PL$Q0= ƅ~E1f4VPS; i)u5f45f4t$< ƿy5f4h"$if4e31O=\$t$9ȉQ=L$5f4u ύD$ PS%5f4r*VT f4Vh#f4f4f4f4f4V=3h"$if43V<3h#ˋ$B65f49nPh#hlf3 1@f4$;e3t=h$#Wt1̌#=f4u3"#PW;? \$e3\$=f4 1$ӋFHN~ HVZƒ =f4u u u1G1=f4up=f4u< u7 =f4>h$b#h#hf3  f3@t>$@$Ph#hf3yڃ  f3@ t_  =f4f3H f3;,f3hf3j$  =f4xf3H f3;,f3hf3j^S:=f4,f3H f3;,f3hf3jMڃf3H f3$f3H f3^f3H f3!;,f3hf3jI f3H f3I f3H f3Mf3H f3%;,f3hf3j-8ڃu!f3H f3-\m3DPuWf3H f3;,f3~ƒ tf3H f3hf3Rڃf3H f3";,f3hf3j^ڃuvf3H f3^?tЃ@Ӌ f3Qf3; ,f3~ ȃ t f3Qf3Vhf3P=F @t5f4h"$Bdf4f  f3@uie3\$t V)(e3%e3Wh"$cf41;`hf3uf4e^_[]hi"jfhh$fUSWV$$0h$b#j袡 11E1D$D$D$D$$׉jh 2h#$VcQ~Hw@$'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$j<$ىY1ɉPXuG _3$T:-u"j9uzuI _3 u _3)t u <$u|$uM1ۋD$Ã<$D$ ptD$  $4u9>W*uTWh`#D$u5t뢍D$PWCu!Whz#Mh+#j/f$1 |$ $jSVa' u h4&P01u8V 1CHHf wy$'|$uhU0Åu뼋ss l PVh:'# |$u.jSU< ss 5 PVh:'# 1F $tCPpQ|$t KP;AmPsT$Z|$Osh"$~`1F7h4&je"PPh#hlf3qjfUSWV$$651h$b#U9 -j4-j4-j4-j41Ch#VW[l e'H wu$('j4-j4-j4Ńo'filj4뙃prvj4oaj4j4j4%j4-j4-j47j4-j4-j4j4 j4j4j4j4j4j4j4u _3)ǃ=j4j4u-tX1Ƀ=j4=j4tL$H=j4=j4=j4=j4tʉT$4stj4jtj4Ptt$lVUhH2-p 9rUh#\hH2H2 @2QT$/u>t$|9A@2A @2I2vy/th#h;#jat$ D2Dh j=j4u$PhH2o>$PhH2>u@.8uT\=j4u=j4t@j4 j4t3D$ P6>1#$=@txUhH2D$ P6b>u6h"$j,a#D$=@uj4 j41ۉ  t1ۀ|$/uhH2h#.t9Uzr|/u (IHr IH9/touɉt$Pj4USWVT$juQ! P*D$1t$CHfw?$T'ss 蹜 PVt$ h:'# Psh#>|$(5D2C,H2)=|5TShH2hĆ# t$VO*1Ga{DuO|$u C(D$?Cj/D$ Pt L$)@L$D$h2#Q谲T$CS(L$)ʀ</t ~/t/FD$щT$H2)rPhH2h#t$PVZ L$@2@2=I2vx/u H@2=j4tD$PhH2;D$PhH27;T$KP3Qt$31 u@T$(3Qt$$3q u.shH2h#c CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH2h-# 1Gt$#KPqt$1BD$ $x'=j4L$ QP T$ j4 j4sHtbffM z4Qz4T$ j4t$/D$ !=@8fusha#jSt$ V3 1G)=j4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=j4t$tjQ\z4H z4/uD$PV*\#X$hSW [ WXt?$ VPhs%hWD$PW)u#t VQ\HD$PW*Å{5WV=/PVft@\$L$/PWFt@L$ Q\$Su)D$ )=|\$={5u= {5hf3Wh#hlf3 e3H e3~e3H e3he3螞É؃t9 t4e3H e3~e3H e3he3^ƒ߃Y={5u#D$=@uW^_W&u8={5u WV{5 PWQVQNtW#1ۀ={5${5VPWhÉ#hlf3jj h#x9D$t$QVP Ƅ fDŽ$.$$PQF'\$4$9|$ t#t$WP_$ D$Ƅ fDŽ$.$PQ&$3$$3$ $3$$3$  WVh# fD$L$TTPQ/ËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP贜^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPN^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP肛^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP趚^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQPk^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP ^_[]USWV |$87h$b#j jt7D$Phht@jE uD$tL2({5,{50{5Wu 4{5t$41۽h#WVM HσG$'0{518{51({5\{5`{5,{518{50{5<{5@{5P{5낃wp{5t{5^|{5O{5@T{51 {5"{5{5@1({5\{5`{5H{5L{5d{5T{5X{5 4{5=D{5t D{5<{5p{5t{51Vh{5Gl{5p{51C+<{518{50{5@{5,{5D{58{510{5<{51@x{5<{518{50{5@{5,{5{5{5({51M{5{5r {5cL{5H{5J1({5\{5`{54@{518{50{5<{5,{5_3D$=,{5u=@{5u =8{5th4#ZtP L2=D{5u D{5h{5 <{5L$$ ȉD${5 P{5{5  {5L$D$ ыd{5 T$ L$u1 T$ ={5t ŋ$u|$u|$ t+uhl{5j(l{5 l{5={5 {5tL$t*t,uw kL$t;t=u^R R K =L{5u==H{5T t/ ( ! =L{5u=H{5 t {5)θ =0{5u/ =@{5u!s =<{5u=8{5 t {5t1AT2U4${5 ^_[]/Ph#hlf3 jUSWV΋\$=X{5Y t1PSR ~jPk1ɉ=d{5tW  L݉t$=T{5D$W0 ÉL$ CHHf$'ks | PUh:'#M ${5{Dt{T.u =4{5tw=|{5uL={5u%sh#ǹ1TSh#L|$|sh#蛹{5VWZʼnى=T{5ut jSW W- Å0W08u ^_[]jh4&jG?WVD$ qH1ftYT$zHftIf t$f tf9t=d{5uyDt,RQ{51f Duf u RQ^_fu1@fu1HUSWVL$dh{5D$ <{5u ={5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$Pz PSl$$h:'#t$X 1@F F${5Z|$dt~T.u-=4{5t"fu=d{5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=<{5t-T$$L$(=x{5t-sh&=&j $W^$D$\l$t$0Kjs辎Džt=x{5tsh&=&j $UjsŅtщ|$W#‹L$@D$9ʉT$@l$ UʼnD$<9L$<={5t/h$#slW D$TPʌT$ 9щL$ 1|$P4M  à t$P֪ Ct$ P={5t +Cl$TUP蠪U\] ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=p{5tD$|t$ |$ nl{5ʃQPRWS$RPh|"jV2VYD$|=t{5t$ |$ tHVUUUȉD$|$D$<$$SWh`2$VUαU$t$h&=&VU諱UҊ$=p{5tDŽ$Mt$4t$ f3J f3;,f3~у t f3Qf3Guhf3Q={5tXD>f3J f3;,f3~!у t f3Qf3Gu7hf3Q耰L$D$ ρÃ{5T$9{5}`;L$}XD>f3J f3;,f3~!у t f3Qf3Guhf3Qf3H f3;,f3hf3j 迯f3H f3 1D>f3J f3;,f3~!у t f3Qf3Guhf3QYf3H f3;,f3hf3j .f3H f3 e^_[]SWV΃={5t vrhW%c1TVO^_[SWV΃={5t vhW%1TV^_[Ã={5tATPqhs%B ÃTQh"$0Í` f w5$'f3H f3;,f3hf3j@I/f3H f3;,f3hf3j*f3H f3;,f3hf3j=kf3H f3;,f3hf3j%Df3H f3w;,f3ohf3j|!f3H f3g;,f3_hf3j/C1@áf3H f3@f3H f3=֡f3H f3%áf3H f3|밡f3H f3/1áf3H f3*USWVl$(}=h{5tE G={5t=p{5t(DGP{51 {5Í4^69L2} ^_[]{E ;\2~*P5{5WI tM \2{5{54FMt%$Q  Qt $ B$Iu$ L2șƉșD$$t$D$ D$|$1ۋt$=p{5t( {5 U tt$ ;4$}Z;D$}El$)šf3H f3;,f3hf3j /f3H f3 MuC;\$rf3H f3~f3H f3 hf3j تD$@D$;D$ ^_[]j&LUSWVt$~=h{5tF G={5t=p{5t(GP{51 {5Í,C L2-9} ^_[][Gșljș|$$.1E  E;|$|6f3H f3~f3H f3 hf3j ˩1V =p{5t(41;$}D$)áf3H f3;,f3hf3j sf3H f3 KuGm=f3H f3~f3H f3 hf3j ^_[]USWV|$=h{5t_ C1ۃ={5t=p{5t(C=P{571F  Ff3H f3;,f3hf3j,脨f3H f3, +N,f3Pf3; L2} 0;,f3(hf3j 4;~&f3H f3 "f3H f3 hf3j 1W =p{5t(4_ŋvf3H f3~f3H f3 hf3j 蓧^_[]fSWV|$`{5Wyt pSP9 t81PWV Vh"$VI ^_[hu#Wh#j&USWV$Ux4(F$$1 |$1 9$)덄$PSUD$P[ tXǃt-tat$^ ?tL$T$d$.?T$O$E1 $ ;j3r9vL$?T$$$^_[]SWV ΉRQSc[ 1t4u t|uHthf3PjSSt VQ^ lj ^_[fUSWV$$31h$b#W^ W7%$ D$D$ hbI%SV- mu05<tChP=$WG 뼃pu D$ 뭃u _3,uk5<h`#j$#D$=@u.$VtP0 9r*th#j "|WP" ty/t AƄ/@L$M$D$Ss|/uH9tx/@tj/Sffޅt@VTsL$rSh#訫1A $'@PVt$ & ٍ$Ct1@$Mg4$T_PPhό#hlf3讝j4{5USWV։π={5ujVt~VWt9o8uR\$@SVt{SW9Wh"$1ۀ={5VWh"p VWhǜ# w={5u=jWSuWhы#H#D$H=@V#4={5/jV D$@PVjWuD$1Pt$L D$2x $b#tr%D$1Pt$\r1Pt$`tVPSt$D$BPhۋ#hlf3#D$H=u}1PPW t$HhV \$D${5{5VֺCVh#`1C؍e^_[]ÉVh#hlf3S e3H e3~e3H e3he3aqÃtH tC e3I e3~e3Pe3he3"q e3 tuÃ߉1ۃYM@Vh"$'${5SV0 {5t$|$SPt$ 1 Å11S5{5t$ 9x߉={5t{\$(t$,l$( l&$$L$$D$ l$ |$T$ fT$l$\$l$T${5RQPVSt$(t$(h*#hlf3轙$5{55{5t$ c Å6|$W\$St$uVh%#HS?D$hL$l$JD$pBD$tB D$xBD$|BRWtVh#t$\t$\W ~8tVh ##D$HD$Ht$\$ \$D$t$Ph"$VtVh#ot$cSZ1VJ5{5t$8t$ЋD$HPWtVh4#$Wt&}8-t$VhA# WtV|$Wt Wh#H1ۀ={5DVt$SWVP׉1jWPt t$t-h\#h{#h\#ho#C1@^_[%tPh\#h#ܤ B1jWP t$thÌ#hÌ#%tPhÌ#1돸d#={5uj#\#jWVh%Pha"SoSh"$jgzÌ#jVh%hˌ#ha"W:WUSWV8`2t PM`21{5{5{5{5{5@53it$L$,'hjV `2 {Vh#0jG`2hhV `2{5hjV `2zVhK#0jͳ{5u21`2{5d21t~{5ttja`2{5l21@5`2{5l21@D zVh0#0jE`2t{5tj`2 '6tQ`2h{5PVxC{5%= ts=`=@5{5h}#j許 Qy5{5hk#0j膲5`2`2{51HPhm8@5`2P[ 1ɅA {5-P|55L|5{5ˋ 3uL'6P'62v$@'=L'6=P'6>1jSS5`2Z!ƒu`x8f{5-P|55L|5 a1H 33=\|5Gt =}r t~=P'6P'6q˃u#=L'6tPWUV ~jWUVΔ tw߿(=P'6u P'6~~=2|218^_[]111RSWV։ωS+2D$t,t\$W3X+4$t$ctjt$-+'A#1@jt$+#1PW+4$It$=jSVV x^_[h֕# h#h#jVP=`2x=(6 (6t}={5ut=(6tDp(6HQP~'Q &@51{5{5$Pj M5(6h#5p(6褐 5p(6vG={5uKh{55`2Qu4#{5=u"P|5 L|5u5{5良{5=3w=(6t2~ jP\5`22~jQP׿ (6 (6t4={5u+5p(6hM#n(65p(6F`2={5u {5tP1{5{5h(6t2 (6 (6t'=(6tGp(6HQP~Q @5Pj (6h(6tZ5(6hލ#euC5p(6 l'6h'6 u \'6X'6jhQPbRPh#VÎ1V5p(6E5@5^USWV=3f3tlf3D$W~ O+|5 |5 u1@1ɉ$L$=h(63\$5l'65h'6h#hS <$t$W5l'65h'6a$hw#RPWh#hVω$VSh#hW賉}WbPW}tf=5t]t$5555h#hVg$Vh5h#hWGWnbPWj 3u_5@5<$t$WjVa$h$RPWh#hS$S]Vh̔#hPΈh(6D$=2O@5D$ #D$5l'65h'6VSP艈$5\'65X'6VSPk\'6 X'6 h'6l'64$t$VPQJ`$hw#RPVh#hS $S]$QL$Qt$Wt$$hݔ#hP$t$VaPVjL "$PW5(6h:'#t$訋e^_[]V~={5u(=|2~h~V5`21 |2~^Vp|51={5uE1jVV5`2RxRP5`2] y)ph#0jd 1N^Ã={5uh#jI&1={5u5(65P'6hB#j!1HUSWV1|$\$l$WSUc ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5|2={5t$t$5`2 ƃu*~3{5;5P'6tc5P'6tU{5L~ {5?5|2x52h#j, 1n52h#0j^_USWVP5|2|$l$1ۡ`2$WUt$ ƅ~)tދD$9up|5{5!|2{5Hs--n8 uc1hŽ#Vh5|2:~\%tS1jPP5`2WPx})RP5`2[ yPbm8tDm8t:m8t0Ty:m8t m8u |21|m8Eu |2xt p|51{5=p|5uh#j腥`tx>h(6Ht)t hz#52h#jL 1%hD#jl52h!#0j^_[]USWV1N=t|5=|2 3uh#j٤{5<u{5-{5sg{5\|51jWW5`2NxXͽuWURPu)jWU5`2{NyQu t#{5@{5=|2:hۏ#Ff@Phm5`2 N x|2h #j1^_[]USWV \$$|$ l$(1uu5|2{51jVV5`2Mx\D$ljT$Ӄ={5D$P|5L|59L$ujRP5`2UMx+D$T$EU,={5u#jh?#0j |21N ^_[]USWV~=|2$(~$$~{5t)ho#j蔢I1u)1ɍ|$h~W5`2 0|$fGWhm5`2>L fD$D$Whm5`2L \$h~S5`2S $h~S5`24 GfD$D$Whm5`2K |2t1<$uzfD$D$Whm5`2hK f $ P'611F$$~jQURы$ʉD$ ʋ$$~) h#b1F|?1jPP5`2Kxg)y11=2|!hː#11Fs1o[hh.#RjRP5`2J1yK7hh#.+hh#"hh#hhV# hh#0jB 1N5|2~^_[]fD$D$ D$Shm5`2J ygt$hA#gt$h#0j٠SWV Vh(6jC ygghf#0j袠 jVj y;gh#0jv 1N=t|5p|5=||5=4)6u5(6h#趟={5hl2WXhd2WXo {5aXΑ#t# 2#t:#QWPA S8 3d#t"#P5(6h#h#hג#h#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5{55{5hO#sWh0#T5(6h#Ah#4hג#'h#<=4)6th#j{52h#5(6h̓#ҝh#ŝ|$h Wf|$.|$t+D$5..L$f tWT= r@h@# h#h#Y5(6h̓#Fh#9sWy\Why#t|5|25(6h"#(6 ^_[hm#Мx|5t P% Wx|5t {51t|5|2h_#j|53mtt$11Hfhh|5}`th|5|S51Lch)#0j臜 1Ht$~chF#0jX 1HVt$VubVhZ#0j*^\SWV|$$Wƃu[b1~tHNtt 9 tu/bPWt#D$=@t ^b1N|^_[USWV1Fh(6PH{h(6P kj Ɖ+<5Hw> h(6SPh5Q@ (5$ ,5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5PUQPh55P1 hf3WVh5M< f3@ub(505 ,5 45QP.t h(6P(jh(6j xsZ1e^_[]`ho#0jՙ USWV (2x&,2kL29|׋yM1II1D51PQÅy19}WDu=3hј#j.hhD5OÅy1ۉ9|(2x(,2kLShD52y݅u=3tehј#j迗D51E$sVhE5D5PP )؍D51Eh#ji1IkFL2h(6ShD5#1ɉ^_[]USWV D$h(6xGD$C5$1F1D5SQ291Ch(6hD5h5P$ h(6Qu*D$PUhD5Q8 D5tu=3h#j耖t$hE5hD5- $W1CttUtB:x9u=3tFhW#j,WhD5Q19uh#j1H ^_[]h4#th5Q<t @51h}#USWV1Ch(6PHh(6P yj Ɖ׃='6t/53ut\h#0j4 e=(6t Rrx7t$t4h(6P(jh(6j| lzbV1ۉ؍e^_[]Ít$\$D$<5Hw5 h(6VPh5Q@ (5D$ ,5L$ h5kWeh5duy=(6tSh5t^(6 (6tSh5}h5Ujh5Xt@h5Em(505 ,5 45QP=5/u+?<u"5PgKPh55PC (6 (6tSh5 (6tpp(6|NPWt$h5)6Q=(6(6D$L;5D$P5Ph58(65t@t=(6u Pl=3t1<5Hr@tZ tUh5l'9D$X;5D$\5?uD$Ph5$Ã|$=(6ut$h5Åh(6VSh5P@ =(6uSh5/!؃=(6\$C=(66D$p(6HQPQ (6=(6D$L;5D$P5(505 ,5 45QPDy h5j=(6\$^=(6Qp(6HQPQ D$L;5D$P5D$X;5D$\5OPj v(6D$u(5D$ ,5L$ QPp5x535p(6)(505 ,5 45QPh5ji\$=D$L;5D$P5Pj v(6USWVj/h5:1Uh5Qt>55h|5UKH /tOGh|5WUh5h#jjO1N,K|/t1Nuh5h#jj^_[]SWV=h(601F h(6t9t71h#jێmQHbh(6P R=(6t i<h(6x t `m#(6 (6t#5(6h#5p(6 q (6ujh5^t((505 ,5 45QPu1=(6th5hxuth5lyh(6P(ljgSW, xa(6 (6t&=(6t5p(6hM#2(61G*ƃuejh(6j ^_[USWV $h(6xu d?*1Fh(6P,h(6@0D$ jD$T$=(6jSh59]jh5Q$=(6th5~gh5+th52d<5 w's1PP55 $jh5Pƀ=5/u+4u"5PCPh55P =(6t4$h5Z' (6t:p(6|Pt$t$h5s.Ph50(6@5h5T$t8=(6=(6p(6HQP~dQ ch(6L$Qt$5SPD ƉPS?&=(6tc=(6tZp(6HQP~3Q 2Pj p(6Ph5%dPj p(6D$L$ʃ|QP  ,5(5ʃ|QPxnh5*1C@TPh5Z%Q55hf#0jh58ch5)t h(6P4 jh(6j& =(6tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=(6t cxIxh(6PHx11@USWV $$h 5(6S = u$ /,4ŏ4/t EƄ4/FED$P5(6p#D$=@`1Gxv%xmlxd=(6t exRh5!(ttjh(6j譻 Gm'15(6hޖ#j 1GĐ ^_[]O5(6h#0j҈5(6h##뻸 )D$ )D$$h5 X(6 (6tV1=5/5t$PUK ;D$vh5hE#jN _D$PSE5WT&W^jh5Kt'h5K`h5&'VSh5NR xơ(6 (6tD$Ph5I=(6t5p(6h5+(6@5=(6tEh5C=(6(6D$D;5D$H5h5{<5Ht 1PP55| $jh5#Pt$h5 Wh5D$P;5D$T57wD$ Ph5;(6tk=(6tbD$D;5D$H5Nh5h5^^D$D;5D$H5D$P;5D$T5`L55hf#0j蕅P5WWWh5!Ph5=(6e=(6Xp(6HQP~ Q Pj Oj(6 D$D;5D$H5UfH'6H5L'6u h(6@L'6=~| h~Ph!#thPhR#j蜃1HãP'625{5y x1\'6X'6 H'6L'6ʉ`'6 d'6H'6H5=3u=L'6t4=~| h~Ph#thPh#j1H5{5 y xH'6P'6`'6d'61l'6h'6H'6H5~2P'6USWV=t(6thߙ#j艂1I^_[]Ã=L'6P'62uL'61IxՋ=`'6+=d'6|$\$52UVSW2g)9|11UV$)݃H'6|Jd'6 2`'6~H5P'6Pd'6d'6;`'6r֋ H'6 2`'6d'61)ȉQPx[H'6Ɖ5d'6 2ȣ`'6)=h'6l'6 P'61\'6X'631h#jWV1N=2=3uhB#jy1l'6h'6525H'6Z12~9} G{u'Phw#j~ xI1=l'6=h'6525H'6~ H'6 d'6h'6l'6 `'61^_ËD$L$d'6)ʉd'6QPR USWVu ]1D$ D$ D$`'6 d'6)ȉ9؉| d'6)։ P'6QPVSd)ЍT$RPQ 1ID$L$ )h'6 l'6|~ `'6d'6)ЅqxUtX `'6d'6D$9ؿ|‰d'6)ظ|D$L$ 1H1@D$D$e^_[]V1=p'6525H'6~# H'6 d'6h'6 `'6l'6V1xC=h(6t/x&5l'65h'6525H'6~p'61 t(61H^Vd'6;H'6v*5`'6)QjPA 5d'652^USWVt$|'6 x'6ƒ|]; X'6\'6}O1hқ#W}=\'6=X'6$-H'62 ( `'69)1 -H'61ۡ21PUK;2tS1\'6X'6SH'6 2`'69)QP륉X'6 \'6Nj-H'6S5`'6U +d'62)USX'6\'6H'6 )VQS d'6h(6Httt(61O1^_[]É-d'6USWVP\$1~cl$`'6$5d'6<$)"523x3ǡ`'6$5d'69|WUV 5d'6)11H^_[]USWVPD$~Z\$ `'6 $5d'6ŋ<$)Dž~9`'6$5d'69|WVS 5d'6)D$^_[]ËD$)USWV\$ l$؃|~`'6D$=d'6t$)#524x\ơ`'6D$=d'619|VQWD$ > =d'6)Éظ|$1H$$^_[]USWV$  $x$|$D$|=(6t7P$ly#B$ hk#0j.{$|r d'61N`'6)ȅ52  d'69غ|PQ$6 ~|)à d'6 d'6ظ| uXP$$3D$8$3L$4 $ hϚ#jUy hx$ h#j5y L@$ h#0j z'@$ hk#0jy111o^_[]USWV$$x$|$$D$x-D$PQt"6@4$h#0jny L$|L$1$p0L$1`'6 d'6)ȅ\$^ d'69|4$ST$ RT$RPQ$P~R|$ =(6 d'6tP;CJ d'6)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=(6t% u!$9$t4$h##jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=(6$4t1PWy#>hk#0jQw1HD$sD$$P$<J4$t=Vh#0jw $l$ l$\$ 525H'6WD lj\$11ËD$ 9D$D$D$H'6}$4$t$ L$ QL$,QWP$PWP$@ ى9u1525H'6$<躩 ljޅz11 ͉$03x$3|$ uRD$$P$8$3D$\$3L$X $0<$\$t*Wh#<$Whr#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[] <$0h#0j8u1K<$;<$W$4hM#0j uUSWV|$7t6|>/u/1N='6MWh#js '6.|$tjh WN V $='6'6_Shq#VP R$\uƅE<$8$S x<Shq#P$Q$uyw:0=(6t5p(6m $h{#Vjs15'6$ $a:QhZ#0js1N^_[É6USWV|$?/tGj/PƳUW蛵u/Fj/VXƅuhW=(6t$$W jWWy3UW-u%D$ PW)jUPWV/Fj/V1ۅA4t*PWQt1K#D$1=@ۉ؃|^_[]/WVD$t$ $P賦yu~8Wh#0j r$tDPry8$h#0jq$ 1$'6^_USWVD$Et$$^߅tPy68Wh#0jpq=(6t<$8$W 1 (6tt)$($u7='6uj'6Pz'6'6!UW3 3t%1PPL$H$X$T$W$tJSW苦y!O7SWh#0jpWfq$] 1$'6^_[]WVJ1uA|$ t$t$WĦ t(5p(66Wh0#0jp1N^_Vt$#D$ PV蛦t%5p(6i6VhN#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=3t =3D$PV轱t6Vh#0jKo_=3u&D$DL$HL$$Mbl$L‰T$=3u'D$PL$TL$D$ Mbl$X‰T$WVut658Nu} u&WVuj5Vh#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PV茰t%#D$=@uVhל#jm 1HjW |^_[USWV׉L$]D$PS#t6St$"thf40wwS tՃ} tL1@_1=(6uTG3D$ 3L$ uKG3D$O 3L$ u9t$h#jUl 1St$h7#Vj6m1He^_[]ø#D$=@u%h`%S%tS0Sm} D3Sh&#0jl댋D$$u1@Ë $jPUWV}wPVͮ1@xN=(6t1A$$3L$ $3$ u*0$3L$,$3T$ uVh#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $T'5(6h+#*$uu=(6tlD$PUϭuZD$ !=uHhWU蚞 ƄD$PW苭uD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUMUt$. 4$Ua1L$ t uu$UFD$y)Q8=(6us<$8$U xZL$ A$0t$Uh5#0j3j1H=(6t2<$8$U Uh{#Wji1ɡ(6tt1Ƀ$ !($t($t$$5(6hލ#'"jUNxN1=(6=3=3Uh#Uh^#j7h 1OD$PUtx=1$ ?#D$ PU1@=(6u;L$ ($//t$h#0jh$ PU1@Pt$6UK31 3t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW苪1x1K=(6t މ|^_[]ø#D$=@u5h`%W 1EtXWyĉΝ#$t Why5p(6=#`.WU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5H)6D)6 @)6<)6L$T$tI AQP2 DUVP 9t_L$ xZjPUQҋT$0y@oEP Džt<$\$MQVP_ D$8+$T$0)+|$$>h{#jJe*,t$8h#,t$8hk#0jf1O ^_[]SWV1|$tQ\$1OjWWSxjh'6S y%##\$t,SV0je^_[Vt$ xFP=(6t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(z ~H111Ã1T |A9uV$P$(E ǀ$1111틴$(3x$3|$ uUP$(xLX$3D$8T$3L$4 uF1VVV$( xE$($\h#*hk#.h͞#j%c #*$(h#0jc1N|(^_[]V=(6t'6=(6t'6=(6t@'6='6uh  '6t01x&=(6tDyhQ#jhb1N^WV'6tP1'6'61N'6t '6tqA'6uj1e3H e3~e3H e3he3tN;42u1tB '69G= |+'6xx'6 PW1t-'68j5'6h'6Ĉ '6&1^_SWV|$tR?tMj tSƋ\$WH~ </u>ۉ^F='6t%'6p!h#j`1Hh#5'65'61^_[á'6t@=(6t'6=(6u0=(6t'D$$u'6tjP5'6轝 WV=(6tB5'6t;11G~u)uhŸ#jA`6h#hlf3B vu^_USWV ='6u%'61N'6u'6}$ $ $L$P舐'6t#HHf w=$p'phE##"ph#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p= & '6qhY#0 ph #p j_e=(6t\@PL$QL$ Qpp p09Bx8'6jjt$t$t$t$ph)#p j[_ '61N1 $'LJ$Ƅ  LJ$LJ$=(6twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G '6 VqPJ  '6VqP) 5(6hލ#1u'6@e^_[]fUSWVT\$tl$h=(6P($6T$L$X$1V8$V<$<$b#$b#t4$tVjQjRD$Phs#S? $u2@$%  RPh#Uh#^|$x$h#S>EPD$Ph&%S>$Hs Uh#u# Uh"So> SFX^_[]Sj NUSWV@L$E\$CD$PS{3j#9#|#L$QPj@t$Vue^_[]SWVT|$dT$t$X$hS($XWVSh#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPS*yVSGu܃^_[Ã^_[įUSWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]V(6~1F1u(6h#j9W^ÐSWVL$D$t$|$<'6t'6tt\^_[7}\1KZ'6teSPti:tdx:_39}j <@_3sPVW hV'6:-u/'6È'6n'6'6`S6h#_3=S6h#hlf38?^_[f1Ã='6u1áh(60h#jV '6t"H '6p0h#hlf3}85(6h+#Xu_sUSWVd|$|j/7s(6t@l$x(6h+#P1(6+#1Cl(64)6D$ D$1D$$jh2h¤#WUHЃJw$ ';t$$@$'<{5묡3t 3(63r3t c3P=3#\$(6! <kL'6 L'6{5]#{5Y%2(65<R3t 33\$(6t{53el(6(6L{53=(6.(6 Pt$ * NL$ < '6$LF{53{53{53{53'6<'6{5n$(6q5<[Z 3@K 38<8-u x{5D$ =P(6u (6(633{5z#(63'65<WO (64)6s(6d3U(6P(6?{51@D$ )3 L$ ƒ ʺlf3tf3 _3p(6ƒu 9u , l$D$kL2h(6'6 (6a"1$jh82h#WU/~HЃJS$d'42ƍHw$L'(6뫅!<{534)6|{5n$m(6@X(6ˀC(61{5z#"(6 <@Ƀl~mtKotRpd(6SatDeJ1A (6 (6 3 3 3"3(6 3@{pe<{5SH(63 < |'6x'61ɉ5<"](6(6<L$hq jLjh2Q&h(6bl 5<Vh#Vz24(6 (6@5< i@(6||5(6{5Y%(65<9i <E L'6N(64(6 $! < }(6(65< =(6@(6 2%=3p(6f3 0akG1A11|$<$t(6D$tGNutNj]]hG#S?1t[hl#S+uE'6'6j5'6S^ 1AL$y#$]1'6<$D$h$#Sl$\$th3"#S.Džu e31 ðt5hl#Sau3'6S I 1urL$tP؅uAJjho#SZ uP'6D$t t PP CPߵىQ7 ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h$#Syt Wl=T(6<$l$S|$;'6,31ɺ G1Fmفt#u41A 03<1A 03!531ɺ.1!# $ 4u h(62=rnFr0s9-_3D(6PM_39}j4NxP_3@_32_39 1VV4b x_3@_39| Qh7#j?H 1FPhޣ#V(H VR5<h!#h<#jHj,5<h~#hh#5<hM#jG lf3Vhc#g%52WVI* 52WV9* Vh$˜5<h!#0h#jjG!jmh#jCGt$h#jjP$t,(XN8@tUjP$yFD$8UhG#W]1D$h.D$1$h$#U*th3"#U)Džu Je3tkðtAhl#Stjho#S tj1ujSðuh$#Ut Ww=T(6Uhs#l$}$l$hl#WA]tjWB\$rt D$W2|$ td^_[]á{5t8uhEs""{5t8u{5Js"UhJ#j E USWV|$W%UWWUUV虷NJ00ht$跩tAtZ/UVUUWY488ht$vuA t$h#0jxE1H1^_[]á'6t H '6hlf3hϨ#莙jtWVlf31FWVhh#IWVhh7#5WVhh#!WVhh# VUSWVPˉjPQ" փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9QI$1>tj,VÅtj=Vtmj tdAE0H@'6='6t L(6sL(6uh(#j6B1O^_[]h<#he#h<#j B4$ ɋD$L$01~WV5(6h|#hlf3q$ t(ο#Ph$hlf3I$ !uءtf3H tf3~lf3H lf3 hlf3j '^_SWVPωPQ,Ht4Ƌ$| tC$S衹 t'ǍCPVW; DG T(6 T(61^_[USWV$t%t_݊M\tS8uEEhV#j@Ej UEƃjSV t3l$hUVP@WUh#j\@S; $EE<\t:uCCU蚫 $AStRC1fGt,PtStgtstp1B ы$J@u $A=X(6tZ\(6HVV4$a Who#ji? 1H^_[]VcV/ h# X(6 \(61V74$ Wh#USWV\$tK;tFjW tLNjl$1pSG woD$G95`(6t%d(6x!h #j>1Nh!#=`(6=d(6^_[]WV5`(6t;11GFu)uhN#j^>6h#hlf3  vu^_USWV`(61 l$$=(6Kt(=(6t!9t)@tB9uKKt8<`(6CS Dž$h#j=z$uEP t?NjCt /C;W5C |/uHC C$#hx#j2=Ct/C1N^_[]USWV|$LJ$`(6tOwCu kPUC |/uPV3 t2[u1=(6O=(6=(6 2$=(6tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=(6tGtlD$@1G8D$@1D$\1GEt$ h#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh7#j59tNjE|$tDD$@t:$t$PVhp#hlf3yVhZ#hlf3d $t+Et$h PV} 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7'7p(6lf3WVVj覝uD$L$ L$$VjhVj}uD$L$ L$$Vj?VjTuD$L$ L$$VjVj+uD$L$ L$$Vjh#蠰(61(6(6(6P (6t$,NFF FFu |$WVj6 y|$ujWj WVj  y|$ujWj WVj y|$ujWj WVj y|$ujWj TWVj y|$ujWjn (D$,WVj R  WVj> 0=3t3i=)‹1@?9 tR=)6t3<$/>3i=)‹1@9 tR )61QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=)6ujh= )6#t\u#uGW tjxGj jW 艤 />3i=)Ë )6,t 98t#@u $j t!8h $1(Wh#j9- h#hU#j!-^_[]USWVP|$1N=)6ujh= )6#t\u#uGWڝ tjxGj jW  />3i=)Ë )6,t 98t#@u $jĤ t!8h $1(Wh#j<, h&#h˭#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhJ#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj軌S CS>tKt^?tYڃCKt6C;C C})VWh#j*Sx h#C=)6t$ )6X Vhb#jW* 4VhЮ#)6 )61Wh#j** S h+#}VQh#j*USWVPϊۉ$ts\m311JDhu.e[YAuۉ4$Åt>Vz,FN4A1R113W61J 4$$'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=)6u*jh k )6uhb#j1(1N^USWV )61Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EP $$$KCs{ D$C $C1^_[]Ët$ h 3P  1$$CHC1FwCE3踯 S误 S褯 h#j&1NwUSWV)6t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6j tx@ LHDh#jY 1^_[]USWV)6CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXjؗ J1ɉHT$, $$$P HN HF F t$1 H;@u )6-$)6 )6 )6-$)6Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@ )6=$)6l$T$s}ډD$0! umщjt[$)6= )6 tIjŖ t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Phl#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=()6u*jh=̟ ()6uhݱ#j1N^WV()6t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(@ t^t$LtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<Wa h#jj ^_[]USWV ()61Kt$/>3i=)‹tjh)#W1 t1H^_jhy#W u(=4)6uL)6uL)6h#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQz Ǎ A/G<rH )Uh@)6h<)6o   PhH)6hD)6G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPyEtQQP  ƅ(8$VPfyElQQP˳ 1D$@$$$$$ȃJ-σwY$'<2ǃ$)$Qgtxu&-u~t6h3"#V0Džu'0ף PVhG#jHe31FUWt5Ë$rt$VhZ#j$_Ft1N1e3t W(^_[]fVjh%"5xKh"P致X)6t)h3"#Vp\)61u;5X)6ŷV5=(6th%"h#j 1H1^WVPD$$|$t t(6t$(6 (6t"=(6thlf3j "(6lf35(6h"W? 4$VW Wj  ^_PX)6t$L$T$ $RQP 5X)6֘XSWV|$1N|5\)6t,\$OPWS t;j S91t^_[SWVPD$ $|$t t(6|$t$(6 (6t"=(6thf3j !(6lf35(6h"S> 4$WS ~VP Phe$hlf3 hlf3j  ^_[fUSWV} u7h$b#jѝ \$1h$WVl LtPt߃95_3D$h4#{ƀ8/h2#Vushz#Vua$PVg@tKD$Ph`%P@t4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02V#hf3薖 f3@uj3hi"j'c2Ph6#hlf3 jUSWV$$6Ih$b#jN 11ChG#VUj e~%q~3كrtރvt_xt)6ŃV.PtrكRtwftAid)6h)6뒃Wt6duq`)6zp)6ld)6h)6Wx)6Il)6;u_39|=d)6u 1Ĉ^_[] D$h j$D$,$SP I9v9/u؃@]9v8/@tj/S t@À;.uCt<.u{t0\$u h׷#YC\$)6EHu]j$8u )6P j蔞|)6a$8tӋD$t$ VW= x)6tRtD$W0=d)6u8ts8?ti 8t_Wh"$[Htj PWh:'#l +D$@uD`)6u;Whķ#?)6;;=p)6uW ڀ=d)6utV/tD$%=@t/==l)6u uWSWxs d)6 h)6х ˉ4=x)6u Ő=t)6t@jPt$f  u hQ#7P)u8Vr(NjGHHf wO$H'=d)6WOwP"{jWV5 GG \=d)6uWOwP:GHftIfgft9G =d)6u P PW}G  Gwrd)6蓿8=d)6uG ?tow k PUh:'# c=l)6uO1zuSwLt)d)6t 8t18?t'8ut/wh"$X)6V'Dž6=p)6u =)6t)6w w-h4&j\ww 舙 PVh:'#j\Ph#hlf36 j)6USWV΀=h)6uLVha#hlf3 hlf3֏e3H e3e3H e301C=|)6l$$#E=jR蘽8D$Pu"9=l)6uvVho#1Zhe3芮Ɖt9 t4e3H e3~e3H e3he3Jƒ1ۃYÉ؃^_[]ÍD$x $b#tr%1PuQ1Pu豯VPWSD$Ph#hlf3USWVAӉ΅:#K1jhV`) $ǍD$PW跘.D$3CL$3 D$(3CL$$3K #D$ =hD$WN)1PPPWX D$$h PQ KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PW& D$L$D$)T$T$ 9D$t;$SV6)6Vh"$T)$)6Vh"$TW(1@e^_[] &W:(u1PPPWH uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW% D$L$D$)T$T$ 9D$t1z%W'1PPPW螜 h j$PO KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW2% D$L$D$)T$ T$9D$t$W&j1PPPW Th j$P螵 CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW% ;D$t$$P$!P4 L$)L$L$L$ |$D$ h#W%|1PPPW fCXK\D$L$ȃ|or \$9ËD$| S$PW# 9D$)؋L$D$ظL$|(#W%1USWV\$l$UEtMƊAuA)k')\*6j赸UGG SѸG)6<)6 \*6t^_[]Ã=`*6t^_[]USWV\$tKƊAuA)k')Ƌ,)61Gt?uS迨tmt&uS覨u4)6jVJ1^_[]ËD$t @ъ@uA)k'))6WVt$ >tVG t|$u G?\*6wdw wYw WPw  \*6u=`*6t^_WVt$ \*61<)6t)6VPs8uG'u \*6t^_Ã=`*6t^_:USWV|$tWBuA)k'))61t(l$sW8tu tC uމ^_[]jt$ }t@1ËD$L$ pqSWV\*6ƍ1P腶1 )6tQ:t @ C'u9 \*6u=`*6t)h jVWw~R1ۋph0#)p43HQPP@%3Q C9uW荶^_[h#WV11 )6t))6Q:ujPuFȋ G'uƉ^_USWVjx268H x26(11C}t$Ej=Pt)AQUkh:#537(TjUt_Uh0#p(w23HQPP$3Q x26H x26(S UhO#53' u1^_[]Vh2#tauj4x26t$1Pc ơx26H x26@u1^fWVP50*6\m3DBuF:'ut t- (*6]$p'NF밉jWV褔 <*68*6 :'j(*6@*61D>G:'uGPV8*6WVP 8*68^|~u$PPh#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ50*6^_ÊVF|uܹո ѹ Ǹ É)B$:@B:'uVPQhd# fUSWV|$,t$(S脲=(*6jLVT{t:xIuxNt@jLPj V3{1tE@j P {)=(*65,*650*6"1,=4*6uƉS;^_[]ùٸ#V=4*6)u ^5,*6Qh#*WV$b#|$ |$wL3 P3 p26>t'F p26Qp26RN@>vuڋ7 p26Qp26t& @뭅+L3@P1576VrƉRPh$# 1 ^_USWV8׉ˋ 8*6<*6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh|"jVjVt$ % USWV Ջ\$$St$$tƉ׃=4*6%up1҉  ډD$$=4*6&uU1ۉ D$8*6 <*6ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹J#[#>#wSWVP=76@*676Q5)Ɖ=76=3ttxt>uk&q1ۉSPV ƉW9u$8t*F8u+$t@:' t$@u^_[ùh#}%USWVPՋ\$St$gƉ׃=4*6uKh$8*6 <*6MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljա4*6HwSjP ljա4*6uND$8*6 <*6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!TH8*6 <*6N"ىWP1Eكra$"ى=4*6#É4*6݅~h4*6 8*62É׃'1H8*6 <*6NLىWP1 18*6 <*6NىWPÉ4*6L8*6 <*6NىWPe$É׍Eكw4*6|$4t;~l-4*6b1A1Ǎt$WSh|"jV߾jV58*60't1I1@1l$QPh|"jU詾jU6  ؉^_[]ù#T#J,#@USWV֋] $t$ơ8*6 <*6L$ D$T$uPV֋=4*6Ww,L'8T'}uPW ֋=4*6ȃ}tً$VPt$ ֍GwT';E Qȉe^_[]fUSWVb3$D$ h#t=etuD$ jx260hD*6GVS診?SEU:@P谧áD*6)QPSXy D*6)١x26pQLVPS $jh;##ƅ<.u 1~.D0t/ua$Ph`%tGPVt6$3D$$3 $ u$$3L$3D$ 1e^]Sh$5t/h$"ux268Ltjx268j*5D*6uj=D*653[3f`5D*633HQPP3Q 53 3@u1[h8#[Z0oy Phm#AhL#7SWVWϟWP1u2\$Vm8"u6W蝟WPtVLD*6V1^_[Åuĝ0x Ph#jD*6tjPh4# hx#ÐUSWVD$ 3fa1Ƀ|$‰tpыLh $S$thd'#Su 1t$.4NJ]taM\uNEU\rw$0'\0u!11ЃwxAunjt$>3HQPPe 3Q t$.PN    ȉš3HQPP 3Q<$t*3HQPP 3Q 53W 3Hu 1^_[]ÁfHh#jfT*6uL$ X*6jPV=\*6t `*6K15`*60ppp VPj  95p06t =3ujVLVs^jpPT$=*6u *6D$ $1APV`*6\*6t1It$aVPL$T$ D$$PD$*6jWVP|$t$D$$m4$ WWV׉ΡX3t L39ty u hL3 =p*6*6u衘Ph"h`3 =t*6t5t*6h"h`3 t*t$ Wh`3 x4h4g%h`3xVt Ph"$h`3] 3HQPPj 3Q h`3 ^_SWV|$t$\$ASWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$ۘ4$w^WVt$ |$軘WY^_PT$D$ $1IP>XËT$1It$)Vf'T$ L$9upu'0fuQh8&j hd*6 d*6@^1x*6*6*6*6WV|$ |t|$wL3 P3 p26>t'F p26Qp26FN@>vuڋ7 p26Qp26t  @*615+L3@Pơ*6PV *6^_USWV\$0t$,|$W̙576jVi j=83thƉ؃$1t7=3u.D$0t Nf $uQVi=x*6u"W这j螵=83u11EPiWcu *6D$0u^_[]jUSWVL$,|$(306̓VԘ$x 'Uw1ۀ=3_=x*6Mjw1ۀ=31=x*6$=*6jwH1ۀ=3=x*6=*6uQ=46tTjw1ۀ=3=x*6=*6t  u8V31tu *61l=46tUW_j\$0SWh a=46tWD$,E=46tt$,WK_=46tst$,WE\$,SW=46t@UW=46t)UWyPh&#e hL3k=46twww. *6@jw1=*6*6 jwa=*6t *61V谖VuL$,=P56t l=r3t *6tu u^_[]PNjUSWV@|$T5T*6D$$w=*3tttn56576P$Ph6#Gtj P53[ Kȅuhn#53Rl$jUth5T*65X*6jm<$t&4$hhu#[53|$*6\$X\*6-T*6j wD$ \*6u=`*6tSw\*65T*6j \*6u=`*6t]<$t&4$h#538@^_[]j5T*6USWV\$;s3=*3{56576PP'h6#stj V53 vhJ#u hY#3HQPP3Q 53Vl$\*6ttQu {tF1ۃjU_|Sl$SP~ tuQV{*6Ju \*6u=`*6tjsUsV言*6 \*6u=`*6ttJ=*3tA{t;56576PHPh]#539^_[]SWV|$*6jw1=3t *65*6^_[Ë\$1x*6u/? *6ut΅tSw5*6x*6t"u8|*6H |*6Kx*6jw=3tru+|*6H |*6x*61 1@65*6+USWV1=3t5*6|$0D$Pm[thUS- =x*6tiD$*6,$\$4>G76=*3 56PQPh2"w 3HQPP3Q=u3HQPP3Q 53juw  Sw5*6=3uZx*6t"u*|*6H |*69x*6m"u|*6H |*6 x*6 *65*6D$P襏 ^_[]USWV|$0t$VR@O 76jPw+ _1=x*61{t'G76$pW Wuuޡx*6[tZtT1=x*6uI=3u@l$41; u{C76Us t=x*6u =3tʋ-*6-*6V譎 ^_[]USWV\$K1t@ \*6PSwƋk1OuD$}t 1{PuVy uR \*6u=`*6t~ jW|$x4$jt$jux W<$t$mE{t V[v1 Vh{*6 \*6u=`*6tA^_[]Åx Ws蛊0e Ph#USWV$$D$1t$ 56D$$t56D$Dx56D$Ht$05*6$P辌5*6E76L$XIEtH1F\$XljtwuG76hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjG76w誸tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P$D$XtH$r4$ ȅu$1ɉL$@=3t=*6u|$ ~ $@D$@D$ )$=*356576PDPl$41dz=u)3HQPP3Q9}j=WSƉt>u#3HQPP03QFPU 1Ո`1t$XtOË$t)3HQPP3Qv É΅u$u t(PV53 مt ȋN΅uء3HQPPS3Q 53|$ +t$4~jh 'W9x u|$$ƅuf|$# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$%8 fD$D$# f=46t*fsD$=X t= u ft$}u$D$@f%Lu D$\*6jU[qD$,ED$D$tD$L$` =z3u f|$t$Ut$4r t@*6|$D$D$`t$dD$,F L$\*6=`*6tYD$t;=*6u\*6=`*6t.t$`ijt$hL$D$Hs*|$# toD$ t$,t*6.u D$ 1@t$,o\*6=`*6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]66D$(66*6z8<NjD$ T*6? D$(66=*6*6Y1PPW 1ɅȉD$PPV26\$pf26D$ H26$26126\*6 66L$( t*6L$L66D$D$hP \*6u=`*6t$jV蚴0T*6D$ 5T*6|$t&D$1f|$tH t56x56$t*6h t$8*6H *6=t$L$QPy *6\*6t$D$(66D$Dt56D$Hx56D$Lt*6h2626t$pD$ T*6|$Pt jK \*6u=`*6t=x*6u 1x*6|*6D$@z$jWGT*6D$ =T*6h!t$85*6t$Ut$8nWt$Ut$8VpD$ffD$0fD$8D$L$D$u#x33t3|3@L$D$*6D$pySD$lT*6D$ 1D$T$PWAt+X*6D$|$D$*6=T*6D$$ 569t;D$=* t=%8 u)66D$(166D$TL$$PQt$u |$ uD$0ufD$D$4*61f|$ˆQP$*6$x26261@ <_3D$*63f`4$t$T$$L$t*6D$ T*63L33`3T|$TtD$(66*6D$tD$p*6D$D$tFD$t D$f|$t$lQ\*6=`*6t|$# t jD$u3F t3)N3|$@tht$Dhh[&m $P薀^_[]h#5*6t$1=*6ȍPu =*6u"D$4thB pȅu5*6t$ t$,Pt$=X*6uS葕'h#h26x26t$p|$Pt jt$h)D$(66D$Dt56D$Hx56D$Lt*6D$ T*6jP|0 \*6u=`*6tVW Ph#xX*6u*6j{*6t*61zWVt$tr|$w$ 'j Wv M $@Fvu;Ftj WP( $jpVg ыF @v 빃^_V t$t8>u3Ft,ptF 56QjRp ^SWVQR0t1OS jjP t6>F1"jjP tv^^_[USWV|$41GGG =3l$0\$S]}\*6AjUfjUPCh uA\*6=`*6t 4$I1CSt$SU\$t$$w \*6u=`*6tS|^_[]h#VP*6u1PPVPjh3lR tF$P{*6t.1QQVPjh37R t*6@=PATH5*6: *6 3 3^á*6SVh$b#Zx268uj21^[1ۈ335*6thB v|65x26 56SSQPV*6áx*6ËD$ x*6|*6PËD$@|*6 x*61x*6|*6Vt$ |$|vXPh޼#1@ *69~1Ҁ8cBx*6 |*61^WV15*6VDx2690t\Wzx260PjPfH5*65*6*6@*6jw5*6JWz*6^_USWV$56$j/W5Ct@D$PWD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVuD$ %=`uVyjWS ƅuWh%Wh# Whķ#L$*6x *6V|$|D$ p膇*6*65*6uu~9} ~ x*6|*6^11@1USWV4h$b#c|$$W^T$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h#53(14^_[]UWV׉΋ *6uj'1k< *611D$ T$l$ &D$ $,$<$\$ D$##D$~?6u0uFjh^$W! %We|80uHx.t x0@te^_]fUSWV|$7j/V@u#$jVP uaK$$WV4t Pu 1@Ɖ$m=*6ud$$UVuGft8t8Wt8t.Mt8 uPV_t &tV{vju$P OfSƒrtt~ *67PSCPVh:'#jSWVt$|$t$VW) st s^_[Ã|$u0jWC6t26*6V蝈jUSWVPD$tnt$ t%1;t <:t9tGt$'c,89-P3}@v,; L3t,WSQL$ 6FL$ |9/u 1xAA/D$PL$Q*6E9u,;E-*6L$Et <:tEL$<:t1ED$(Q}b $+ L3AQs^_[]USWV$1C1D$ 1D$D$D$\$h(#Hw5$ '\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ x269Ax2693t$$1CjWtV@wM$h '|$t&|$ t4t=03x'@ |$ux26H x268u56PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ*6/tPEȃw?$x '|$u/|$ u&u |$tf<u t$Um묃0+6r533$@th2#1@$$$$^_[]SWVt$\*6*6t5Hftfu9503| P0 9p}Ëu̓0+6r \*6t^_[Ã=`*6t^_[USWV$G$$ 'o56EjWS PqqM䃼$$twh^#Vh#FGPh"$\*6w>PQ^ \*6u=`*6t h#D$Ph#/thv#h#GPh"$Q t*3HQPP3Q*3HQPP3Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)!*63tFWP/_tc6|$tT\*6WO]PSnƉf@@ WPr{ \*6u=`*6t u10+6^_[\*60+6Q-  \*6u =`*66USWV$$$j/$7turfEE^569tth#V诀t $j$q1Ʌt@@t`tm$umtisD$ P$ xfE$Kk8k8k$ u=03x $u  \u =03y& u $MƋ$1Mtfyu03YL$$j$P 1OD$V`mG*6tAPh#m{t$t-'5*6hý#>{t>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=*6$Nu$5j8t+j8t !jD$}o$E$\$|$$t$t'53jS\P$hqw&VfEo$T$pƋ$$\*6|$ÍD$ uj$HfxT$ ufBuω7 \*6u=`*6t ׅt"G GfEG EG fEGE fEEĜ^_[]\*6T$ Éuj$fxE$ufBj \*6tbiVXC+L3P%jV$ij$t3fxu*SVm$=`*6V$hȽ#SWVP'1t8|$'L$8u%tWPYL$ t us^_[SWVP'1t3|$'L$8uWPYL$ t us^_[V't%'jPf@NHu^V*6 03trft fuxB =0+6r^USWVP\$=561N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#3wt1<:CG럡03y x5031Ʌx $y $Q503^_[]SWV\*6*6>t+fuwW`' ߉?u׃0+6r \*6t^_[Ã=`*6t^_[WV|$D$ \*6jP+@ft*fu vfFGF GF GF \*6t^_Ã=`*6t^_WV t$D$L$ \*6fO 3fOPtGWVU \*6t ^_Ã=`*6t ^_jt$itfxupE%1USWV t$811G$1D$hݽ#ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШPx26:KBx26*#$1\$ D$4$߅u U='t,]''8uUPUujUNƃ<$t0vh#4$x26H x26(t|hN#-j v/tuh\#vh#x2684$t3HQPPJ3Q l4$t%Uh#SPhl#+h9#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$ 'D$j/U-jU܀~]b0r= Ph.#:uhh־#Yuh#Bu h#7t.Uh#3+56 t$|$tJHh#_t$x26H x26(ouh|$돡56D$ FjUD$PK PcN<$u$b#|$ty#Phr#~Sh#pt$ct$1 ^_[]h#+#ct$b#RVh#Vh#1PPt$  5L3@PubUSWV|$D$\$=3t4+6H 8+6 L3 <+6 P3 p261ɉ @+6 P+6H 76Spp26tH p26~<+6<+6dH <+6<+6+L3PaX+6T+6u%Vjap X+6X+6sT+6UVWX+6-X+65T+6x=tET+60va5X+6΅u!c<+6p262V'X+6T+6t OX+6G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t56t D$3 56D$<+6+L3D$?~uЃtRWT$4$ D$1@D$ wy< p26H p26f<+6e$!PVVST$0/>u!y@u=D$ D$4+6$p26H p26R<+6Q=4+6un<+6+ L3;L$~[xuUH<+6Qp26H p26<+6p26H p26<+6$ |$D$5ЉD$$ p26H p26<+6`T$,H <+6>~=u|$ D$ RV"T$4| u76p26H p26~#<+6%J`T$,H <+6 X.`T$,H <+6$9Ut$ 'T$4<+6+L3jPHPuT$8 _T$,H <+6>p26H p26~<+6 _T$,H <+68 76w_T$,H <+676V_T$,H <+6$^4_T$,H <+6D$$ 4|$tu^_[]USWVt$,\$(=P+6t56t$D$ 3&j[XNF56D$ @+61oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=X+6\*6\+6u(Q>H9P7Y\+6NQP5\+6 \+6 \*6u=`*6tPX+69t31Ʌt AuQP!u=X+67vA X+66^_Vt$t"X+60v5X+6΅u^V5@+6t1\*66PV 5@+6 \*6uۃ=`*6t莻1P+6@+6^USWVt$(PnY<+6+L3PmXL3Gtr}t  KvC#:t /tQ t7=3tAL$,u8 p26Qp26ZO@랃tPY^_[]Ã=p26u Zp26L38t!P tx PXu$h;#ljPXGËD$,tÊ6'$< t< s4< w*p26H p26~<+6ZH <+6p26H p26~<+6YH <+6Gw/u}/uEuP USWV,D$DD$L$@9A|$$D$t1:'‰T$D$D%D$ j=L$QC D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$  66T$)11G<+6+L3D$D$<$u \$H l%t$l$UPRTT$LQT$L$ t,1t}y;@ڋL$ u4+6<+6+L3=3\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =26t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$p26H p26~ <+6ՍQ<+6V<+6MP<+6EK1ۋl$$]|$ D$EÊ6'$< u.p26H p26~<+6 tVT$H <+6p26H p26~<+6 FVT$H <+6]EuKl$ u% <+6L3)<+6 p26\$\$L$ D$E< w.p26H p26~<+6 UT$H <+6p26H p26~<+6 UT$H <+6]Eu1L$ }D$n $Ip$ '|$tp26H p26~T<+6R1G>L$u0L$ QV1>t5<+6U<+6ۋ\$uhT\$H <+6=<+6+=L3t$ t$(St$ WV-u<+6=L3<+6)=p26Sg1G<+6+L3t$PS <$t[1@Ftuրut܋ 8+6 8+6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh#dK)Ѓ576h#F׊t!#u(HL$IQWP576h9#D$ƃHQWP576h\#USWV5<+6+L3D$\*6@+6D$ D+6D$$H+6D$(L+6D$,=P+68+6l$0U+Q+L3P-PD$ P$jU3QD$,L+6D$(H+6D$ L$$ D+6@+6=P+68+6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 \*6u=`*6tfhWt${ yM8t\*6HD$EEt< uD$C낉$L$}1A9p26} RL$ƅ~N$ p26 FK1:p26H p26Q FK1Ƀ=p26 Q1ɉƋ$|$t6'$< t$< s< w p26F$ p26F\*6D$ x P蒺D$t P D$tP5=*6$u+L3jPt$$ 5<+6 \*6u=`*6t^_[]USWV D$4L$@-<+65L3l$)hP?D$p26H p26~<+6qPH <+6=L3UEWD$ P[N<+6+L3PZM576W蝛ljӍD$ P]NL3 <+6<+6) p26 p26 P<+6SWh|"jP<+6xt$GF9Iu|$"tjVU0 <+6A <+6p26)p26D$ ^_[]SWVt$|$\$P+6t#9Xu 9p ux2jK P+6@+6P+6P+6Xxp ^_[WV=P+6t$ 95H+6~?=@+6\*6?P =@+6 \*6u׃=`*6tѮ@+6P+6t?9p|\*68PS P+68 \*6u=`*6t芮 P+6u9q~)q$95D+6~ P+6P+6@+65H+6^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`p26H p26~<+6TBH <+6563*65<+61<+6^_[ÃЃ w=j PV( n=8ű$<=tuw~;52626b56D$526ØD$D$‰؃AD$$Z|$ T$L$T$|$,6'$< u*p26H p26~<+6AH <+6p26H p26~$H $ <+6Q<+6 @<+6 $Q$ P<+6$eØt2<+6 $Q$ P<+6$eØt2H <+6p26H p26~$H $ <+6Q<+6 .><+6 $Q$ P<+6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-Gp26Pp26~=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9r\+69tH9u W%8/t F`%Q荶D$;5\+6tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWV=E5\+6=`*6tt$tWE/Q \+6߀xruX@8tB@9tD$P5\+6x5\+6,Ą^_[]ËD$1Ʌt AuQPFWV|$ W7&@P7WPqDj7p X+6X+6^_USWV\$D$|nOʼnmIWP)|$SUÉpsi'x 7u߅u҉3D$^_[]SWVt$(\$$W7C 8+6L3<+6P3p26P+6js2p26H p26~<+6h9H <+6<+6+L3Px6jVP W7^_[USWVt$FPh&b#ĩ3HQPPu3|$Q1ۃ|11E4x$E9uSh#j3HQPP3Q|=1C4膤3HQPPޤ3QC9u1^_[]Ðh#辘h#贘+6H +6~+6H +6#=~u+6H +6USWVP83H +6t+u y+6H +6~xhL3蛤h`3莤 +6183~PX+6hSp{ {e28t_83xL28#>WjW !Pjj۟  h6#683p+683@1ҋ+6  +6@@P t 1++6+683{tXAˋ-+6M +6~ @لt+6أ+6=3t$5+6D$p53D$+6H +60~^_[]ø+6+61+6+6h#,USWV=83w \*6^t)kU-!~D(< t< u 83Hc F+6F+6F +6G $9t V  \*6t^_[]Ã=`*6t^_[]-V +61~^Ë83r t ~6u1@1z+6 +6SWV\$t$|$\*6 83y tja1 83I  83A$A +6H +6H +6H XtK =+65+6 \*6t^_[Ã=`*6t^_[RWV$\*6jW虜ƍD$PV uT#D$ =uD1PPPV u2jPV  u <$ELF1PPPV uZV9t:$Ph \*6u=`*6t菓Ā^_Wh#V蹜h#ؓV覜Wh#ēV蒜Whп#谓Vt$\*6ho VjjV |$ t83H~Q83pxuh/ 83A1+6+643 \*6t^Ã=`*6t^馒83tL$T$9PuHuá+6 83A +6A+6A43Aj8. 83@1ɉH H$H83WVt$|$ \*6|$t=+6W+6+6543 \*6t^_Ã=`*6t^_V583\*6Fx PϊFtP_ ~ u83VB 83H +6H +6H +6@43 \*6t^Ã=`*6t^U83Vt$ 839t`+6tPu^h#莑=83`+6t-Ã|$t=83`+6uh+6~P83@fWV|$ 9=/6=p06@3t P袉jh%"@3MPȈ@3hs P=5@3V/6Bߛ9t jj1Vj莕Vj胕Vjx觛 l069tQj1l06P5@3x7+0L hN /69tQj/6P5@35@3m@31Vj躔Vj诔Vj褔=/6@1VtV{@3FuhS#J3^_X*0m hPh#:9*0N h#*08 hPh#@3;D$u D$@3h$b#Dx26SWV=/6jQEƋPh"$Ǟ|-1GPhq;$蠞G;|ۡ3HQPPB3Q O5@3WtJ\*6V[V \*6u=`*6t{^_[h#ۍh#э(0 hPh#貍Vt$ h$b#C^USWVh$b#vC=/6x261FjPlj+/6i5rO@QPh#Q |,Phq;$+E;|ۡ3HQPP͘3Q ڛWx268tH x26@(1^_[]h#臌h#}USWV\$n;%u(sVd8V7H#KS?8#dS7 /6M5/6At#~i9:0#I {/6#4$D$D$=/6C1tQ~H$8?uEt$P:uUt$6t #tl#K\$ueZ*t%tS-tU+E#D3x+;/6}#5/6it /#\$1|$ t5^_[]áD3t /6i#뚽#SU~USWV/6)i5rO=D39u=D3)/6~9ut Ku ]t]tu`ǁTtCiu3itit0 5D3^_[]SWVt$\*6~X1tttG9uމjQMu@$19}q~5@tu ƆH \*6t^_[Ã=`*6t^_[^+5/6i5rO@Ph#賈+5/6i5rO@PhG#蘈P Ph.#脈WV11Fhi#_>kt!Zu忀ރlt puԉпɁux26tg8tbPh"$_m=3u =3u@x26tA53jPvW:x26H x26@uj^W53 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh%&Wߖ\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th #jD$P ] /6)i5rOC-D3+9tti-;)t RPh#jl$ Ue\$D$P/$t+,D$0h#jS0S\$ŋCt:tBuM ,%Ph #jQD,ingD,Runn}=tQ l$ ,j SP0 D$xxl$ ?Sal$ ō,@)QPh#w0 h%jQR ݍ,PWD$P}݃FD$ ݋\$GHO W謐H EuݍCWP2$u/1M|t؁Phq;$W@ N1MM|FGHO WBH GHOl$  WH|1GHO WH ~T$KWiD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =3$tCt>5@39t%5@3PVv$=/6~y\$t$1=/6tEt*t t.<$u u/S0=/6u WE;-/6| $^_[]0 hjPh#膂USWVD$4\$,tl$0|$WUS ƃuO8=P56t\*6/6/6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o/6D$ /6$iD$ 9T$tcu tQ=p06t 1=3uL$,uP9tPtu 3P \*6u=`*6t^_[]Vt$\*69tPT džƆ1z \*6t^Ã=`*6t^oWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$hm#5t$ntpu26D$D$D$t x268D$t(1PPSȑ EjS==/6u|$1/6-x26~6@ /6D$u}t!AH Et{1jPƅt9u ED$u :u G Eux26t Dt111D$uD$/6L$L$t$D$\$l$|$ /6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$/6C$jU9 L$tc|$tNuJD$1rȋi4h&b#jD$(P^.l$D$D$L$D$u U D$\$l$t0~Ot)D$/6y\$l$D$tUD$tMjPSD ?jVDžtjuS# =3u V 4Ń퀉0^_[]hq#{Sh#{Sh#{{USWVP1$1C11h#J1it"gu$ڃjt puЉ̉( x26t yjPƅt,1t/6)i5rO@Ph#H$t#tH~1i0 tPh%&轊11G^_[]Ã~1i4hf#腊3HQP~G ;| Z %PG ;| 3Z;|lh#yh#yV1=/6ujt$ St1+^V1=/6t. /6~$A/61F:uI}^V=3tO=p06tFD$t+ /6i5rOA1ɋ3u0VQh=#R^USWV=/6u65/6~%=/6Ft WN/6l$/6~"5/6HI}\*6tfiPƋ-/6=/6iPUV ~ ;uKuU l$hnƋ=/65/6i 1҉AJw)׉=/6 \*6u=`*6tmw\*6fdž=31/61B|iP \*6u=`*6tv^_[]SWV\$|$-ƅtt.VSt$W\$<$D$ #^_[0$ PhG#vUSWV|$ p06tWdW~*15p06T*6406V>V}5/6l$t$t%t =3ttttk0hWj~Wj~t uu`mul1V Vh#V%~tOh#V%h#vSVjuV5@3&tTWjzWjzt*=3t!WjzWjzWjzu/6^_[]0 hPh#wuUSWVt$ l$|$1ۃ=p06t/t*=3t!ttSVu5<3tEL$ji4DDt QP ^_[]WVD$t$ N /6=3u=32t=/6jP=/6~/6>f@..@.^_WVt$ \*6NJujVj 瀾tW5@3Z<u%+/6i5rO9D3t mjVt=tu  ρπtt=ttu j u VK \*6u=`*6tr^_b0w hPh#DsSVD$L$ =3t1ۅ SPjX ^[Ët$1҅tހu1=/6u2/6u) /6~/6:tzt IuhX#~/61@SWVt$$1@=/6|$(1@L$r"$H 'Wh#bjvu h4F#hr%tjjvjv 1~ hZ#21@^tjs%;th}#hΥ$jvh%1Wvhp#1Wvhu#Wvh#jvu h4F#xhJ#kjvm~ t+u h4F#Gh#:jv <u h4F#h##Rjvu h4F#h#7h2"v h;b#jvh#jvu h4F#h/X%;h#kFp]h;b#P~tF1SwJh?#.Sw 1> #t#P uh#hP$vh#v#'14#1###1#N9tQh&b#jWWSxuF x%Ph&b#jVRVjv S h$#51^_[hz#hz#jvUSWV fD$ /6 /6l$ 1D$U$u1!" $ ']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻Ou&!$}D$##} u#$%)4$<$zT$tvӃux< 't ur>u< '_pE~FЃ r# ,$t#\$҉Ӄ9uG8,$"2D$1&< ': '$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I /6/6 ^_[]WVt$ tG|$t jV~t'hr%hr%jVvu^_USWV$t /6 =/6D$P 56t 5656 $=/6z1jh 'St `P>;Hx@u8/UD$PV蓁x D$pL$t 1D$tD$p1ɋ/69/6*6tH1 8t:tGt89=P3Z 9=P3~*65L3WPVP >?2#<=p26l V: fiDle cDhangD ged߉V~v3HQPPvv3Q D$pL$t /6/6E;-/61-/6D$PĔ^_[]fUSWV<1UjCD$hhh UPjp ,59u 39È(06j U0r ,06j006h$b#U h@#褺3,$Uh4066t$T|$PT*6406舨l06p06@fD$PVWVW~=(06 Àu {=3n$hP#X*6ttQu *6 *6<$B=35=p06(ȃu6譧l06p06|26$X*6u7=X*6u73HQPPt3Q h`3tD$P\*6=`*6tcg$$=(06u>h;#J 't1Ph]#QPP[V$=3u3 (06t N=(06uEt$(Vhg#t8t$PTPV$76=3t =|26tj4 'kuD$P|26u/jM=3tFh"#|rh`3s*1ɀ=3ˆQPj=3u=|26t43765*6+p$$#uSWVD$8t^\*6jPnƅx jVO \*6u=`*6tvex"1=3t=*3t*31G ^_[11=3t 31j蜉V3V芉=3tt*3u3^_[USWV|$(V11C=P56tn1=3u4t0j53ujh`3q3P=83t.te=3u\1Ƀ=/6 /6jPPi1;tW1R=3uIu=3t7=3t.hk#hpEVuu$u蔆V#^_[]Vt$\*6jV3lx1jP \*6u=`*6tcj^Vh#ct1Ã|$|D$pPmmft$y th#ct$t$F th#cWV|$ W@P2 tWP ^_h#ZcSWV|$P39~b9\*6؃Pخ tr H3 L3P3H3 \*6u=`*6t wbP3\*65L3>L3)P3 \*6u=`*6t?b^_[h#bD$t L3) P3L3j h#jh D$ H3 L3H P3H p26H t26Ht26ËD$\*6H t26P \*6u =`*6aVt$\*6H3;t H3P FL3FP3F p26 \*6t^Ã=`*6t^=aUSWVP3<k\*6-L35H3t06t|F9uuH3PV  H3H3+ P3 p26L3=P3t26tG90uC H3 L3H+HH x@WSUPU 5L3=P3 \*6t^_[]Ã=`*6t^_[]S`h#`D$\*6L3)P3 \*6u =`*6`V5P3P3p265L3^V5P3+5p26P3)p265L3^ËD$ L3) P3 P3L3+D$ȣp26USWV(L$@D$D$@t-΍i11P wDGÉ,$Eu1ۋD$b USWV1\$@<uPƋtPEu1ۉ]h2626=2652626^_[]SWVP\$t$t2uhU%V1C$"h#^Z4g%(,3u*23v#03RQPh#^y#uȡ3HQPPtZ3Q (,3t"23RF#tn"QPh#h^ u.$(,3tPVtuv#VPh#M<$u#13t(813uƁ23u숟23h#1 [3t$Y3t(813uƆ23u Z3@uă^_[V(D$ T$039tuv#RPh#Lt#13t(813uƆ23u숁23^WVt$ ~t)~tP趨 uv袨 ^_USWV jA x26t_y 8-uUD$$x26126P  x26y8-@P1F Pơ26)\*626=26~-26Ft7ݧ 261Nࡌ261ɋu26 \*6=`*6J1F526P)ƅ2699S\*6 2626lj4$މt$\$)1*C/5269rL$ 9v!\$ۋ4$ P; 26w4$ 9vQ9w26 \*6u=`*6tIW1 ^_[]h #2Jh#(Jh#Jh#JSWVT$ 26tstm8u'1z:trrD8uAÀ~:u"9u x26Qx26 tf 261ɉ 26D5x26>1t6?-u1t+O^x26-uta5x261^_[Ph}#:IPh#/I|$u1PjPPge\*6jwx268t PI \*6u=`*6tjH1ËD$Ѓ w#j jPr~ u2626ËL$~ND$tH  26=26u 262626h26h26Qpph!#CHUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh$b#hD#Y J|$:uUD$8@?jPhD#Y ^jUhD#Y 1|$D$0)@<PhK#h`3V jhD#f1?\$D$01@11T$4*l$Ph&b#j UVhUhv#Y D$EEjUt$0X u0^_[]À|$:uD$8@:Ph_#K1L$0L$4@UjEfVD$ 831qqA1Ʌ /60PQ83p ]t u 1%8383@j* 83 u^qqhl#EPD$/6/$aQXUSWV'ơ83@tu'tƃ 83 x,$@D$t.$xk$18uWPtG'uD$tKjD$p4*t6NjpVWPVl E$ht83@^_[]USWV83@|$u 83A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq83@@|$Fu6|$uD83@ 83Ap8 u|$u83@^_[]jjX 83ASWVƻt u j pxʡ83@^_[USWV83kE1͋ 83x t*/6,PqN83@ C1Ƀ8Qs s j@83HOH O oKy K9t?U1CSpt ^Sh4'P= 83HO@ G 蝯83!^_[]WV@t$P 83A uyW wWhn#4T'h#j"Q Wh#j"PQWuL$Lx4T'h#Vh#jPQWUSWV83@1u 1=3tMtݡ83@xuUj @jtÉGpj`aC+t83@tj,(pƉ^_[]h#83t$p0h#O@USWV83@$ u83@$EŃCߡ83@$ '$ 83APUj já831Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt83xJjG B u083x,u%@:'t@/@:'uh#jÀ=3tjjj 83H0+H8O U 83p0j^@ 83QPI H pGu583~ h%vFm|$F83xujD$ 83Hu 83H L$ qx0j@83HKH K {@;u.83x }83x|$ T@0GjG 83@t(HS u 83@83x\$\$j 83HK @0Cku83x ux,uh%pjP@<31ɉH H 83Q0PCAHrAAtejC9t jW\G @:83@ u83@$EŃ!ߡ83@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$83X0j2x@ 83QPI H X t\$|$D$C 83APsVL 83jj 5jj,jj#jj jjh%jjjjWV83x$G Hs83jpW$ uq83p(x,u~ 83At8 u @A8 @tHA~րxru\tuՀh#83p0+p8j@ 83QPI H pG .Pt83@F 83t1^_jjVt$&9u^jVVL$1:'tA1B1t A:'u^uVt$j@ 83QPI H p^USWV |$$tD$ D$$D$l$E1$83xc 83x0$t $j\ƃF 83QVI N ~ut. 83I:'tAt=t A:'u1c83H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc43 83A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j(83 $+H8N~L$NL$$N @0FEPrj/v豜uG43 83+A8FF83@4 ^_[]jjjjh#L$1:'tAt=t A:'u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;006}X;,06~P,06I;-u{tBuG83x0+x8j@ 83QPI H xF^_[F h#lUSWV|$43D$=u ?vl$$5L3P3p26G$|$ t u Ǜ t19uD訛 $ tC9u?,$ u4383HH }yMt9t u>u:<$ t=u葞$)jWP萞 |$l$$uS\uNp26H p263\F u%p26H p26  F43#áp26H p26ƈF t詚=v43菚=t h' u4383HH p26H p26r=L3)FV,83x43+D$^_[]USWV$$1҉T$ T$$D$(54383r0=4't1$|$ fw|$1/fFn D$j8fNL3 P3 p26=8'u ƒ=p26‹nD>  $\ '=2'u f|>z p2643Bס83=2'Xf|>LCD>fT$ T!uhЃoĘ0N,諘05,/L>=6'fu p26Bn׍MN|$=@01fD T.fTT.fTT.fTD6'fD1AL$!(ljƒ(M p26FD p26BvNO|$s@81ɃfD T7fTD8'DfDfD> 0 = p26\G_T$ t$>Hff p26T$ Bf|>D>u6t$菋 nMn p26}f|>  p26BFfL D$$D$f|>tD>t p26Bf|>u D>v p26BW p26B*Ã{t :' p26}E+=L3 p26E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $> nMnD.=2'u p26 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTD4'fD p26T$ B1AL$ I) NjFfL p26B) 4383@8xt /6 /6$8W Nf|F\=`4" $"}f|  p26T$ BFu6$脈 Ft$HFuЖD$$D$ Poſ1۹$ 'D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTD4'fDu6t $q FHF p26B赕= t]H\t 'u 4 t =u 43831Ƀxɉ /6$6 p26T$ 'uF|2' p26F$ 6'$< u p26T$ BT$ p26 cʔ,t$@  4383xD/6?:'L$ \m3DAD$D$E|$}~6'f|t p26 p26B\6' u p26BNf|t p26B1@D$ p26 p26B݉ý {"XŃ', D$0$ nt$T$ Mn p26B1@D$t$C/6$4#U ̏` Ń< ?\u袏\ 0 \$1CHЃ w&Hw ÃHÃéOu M p26vNO|$@81BfD T7fTT7fTT7fTD6'fDőL$ uk%=I =p26 D$ wF p26P?ˀ p26@ww p26 x?ɀtw p26@ p26W?ˀul p26GXT$ W p26x ?ʀtw p26E p26O?ʀ p26Gw7 p26x?ʀtw p26E p26O ?ʀtw p26G p26A?ʀtw p26A p26H?ˀa*2626D$D$$26B1z:'t.p26H p26LjGq :'u\KЃ w4p26H p26LjG; ÃЃ D$ u t p26׃Z p26H p26]=Gt/ up}tkp26J p26/#@ǽh#tE%t@Ń:bD$D$$''¸U1#,W9uڍ1|$Nf|uf|t Ms@ L39T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|2'fq fq ƋT$ +6H +6~+6H +6 ډËFD\$D$$''辐Q1'')G p26x?ʀtw p26E p26O?ʀtw p26G p26A ?ʀtw p26A p26H?ʀtw p26@ p26A?ˀa2 p26AD$ ??p26H p26~2G:p26H p26~$_1c:B ˆB1=2'nD=8'G=2'tf|cf|.3p26H p26莿5L3Gf|uNT$ ؃t 4$t$nŀ>ts4$flPT$ )B83L$H,L$H $վ83pM tΉ${ Nu83xĨ^_[]1HE;006} ;,06~,06>uxkjy1$&tu>tyu6EBE9E0E"EEEA }83h$ Ή$nz Nu=tuS$##$:#43 83A0$b#u$G#b$#V$u#J$F#>$]#2V 83xt@@ ^Ãx t#/6$@)83@ @8 43H0+6H +6~+6H +60諄ƃ~0:=F $ '> t=u럃F~t\u^ 43@43 83A0yt/6 K/6$S(*;|u0d|83@=t*ʆ4$D$D$2'Kuۡ83@1v u4383HH @1@Q&83@-83@83@&tQ;ub83@ 83@؅83@83@ 觅83@u:\u?0 u64383@81Ƀxɉ /6P&Bjjhcq"A ځVȋ 83y8~0 p26Qp26@ 83Q8rq8^USWV\ӉΡ83@D$ 1,$T*6D$^+L3D$$UP4\*6$~S"ʼn$S5L3P= l$|$tD$$T*6 \*6u=`*6t?w43D$-L3P3p2683x t*/6PL%83@ 蠀ǃ[~!\u9菀ǃ[C tJ$Q u"4383HH s`un=ub\tX`tS43 83QQ NDt""u$p26H p26~E\E \@ŋ p26Ap26@p26H p26ٷEL3@|$t~Pt$jP荅 D$pŋȅut$ j轴E83xtH@1D$43D$jNǡ43D$Kt5 83At$ D$AExK83@t$ Ex P39ًl$踵 P39~=L3p26t1SUW覅 )p26\*6Uds $ \*6t\$=`*6\$t 83T$ QT*6Nf|u%Du p26Qp266@Vt$+t$ p26Qp26@~.Fp26Bp26ȅAJ։ȃՃ\^_[]á83L$H0h#W~<$t 4$er /83@D$T*6jPyjj#jjVtQr N^V 83$b#ytA5/6t7t u(56866543P5/6#^USWVt$,|$0l$U5P31BW;L3u(V]G269w&26WVS考 Uڲ^_[]Áw: t9v$P526|k tã26$26랾#뤾#USWVT$L$ -T*6҂Ɗ*3p*6D$1|$083D$|$ljWtJD$83*3V艂-T*6D$p*6X*6$b#jU\$t$l$=T*61F5p*6D$083$V\$S7 !{Vh4'P 83A |$t|$t=3u #@݅u:T$1rIJ$JB *3VVRM -L3=83D$*3t$臁D$T*6D$p*6؅tȁĤ^_[]jL$1jRfL$1tT$9Qt uÉV 261t!T$qt 9Vt 6 u^USWVt$~tT\$?Eu 26tu(Mxju PQ.Ex P4Un uF^_[]USWVl$ t$\$|$t|h@VSa VSaDžt9u 9t S9u95D3}5D3^_[]Åyج0 PVShD#WWVSh^#USWVt$ |$\$l$jMEXxp ^_[]USWVD$(l$$1ɉL$$L$fD$ À\$t!jl@ 26$26M|$];006};,06~,06Eu9] u26tX9X526t-pt 9^t6SLF9t St 261tF9Yt? 26tHt 9Y jjS PkD$($@t 9XjS1x\*626  b26 ,069|AQjSM ǃt;=D3~=D3x jjW' jݫ$JBXxp \*6|$u=`*6tu26t$(WUN mCO1O ntuK526jS DžD8t 8ujjSi Dž0 PSh#\$t 3t3|$t 3t3^_[]j 軄 PSh#苩0 261tT$9Qt uÉVt$526j V u 26|Qj V u8FPj V u$j j V ujj Vo t;D3~D3^h# WV|$ t;G;26|.GPSƋG9tVPWwow^_WV H3 A H31F |71FPWW y w;D3~D3Pgfff  26^_USWV$$$~\*6 8k$0'n  26t9i V 26tQt 9j b Y<(O8=3tNnjU6ƍD$PV荃#D$ =nhh]n$SUoƅtjV;!SjV+ $/nhh nhh U ƅV;5D3~5D3|'u" 39uu-jjW 9t1jPWV \*6uQ=`*6tH A1jPWUy v 0 PWVPW \*6t Ā^_[]Ã=`*6tĀ^_[]< hh j 趀 PWUh# 腥0蚀 PWh#k 1F5*6\V0 PUhG#A @8V08*6j0 PUh/# USWVPYxa|$\$;D3~D3oU= VUS 1jSSQ t!t$n$^_[]h# 4$N1EUj蠡Uj蕡UU苡Uj耡Sj uVwt$ g SܢVD$526\*6PV]26V9e  \*6t^Ã=`*6t^t1=26SWV526t4|$t^tCx PjV6u^_[SWV|$ D39|ȋt$|9}9| D39tV/jjVW 9u^_[?WSJ~ PVhz#WV26 |;006| p26t$ Pj Vd y28t ޢ8u>26 jjV0 ;D3~=D39t Vq^_Vj 迣tL$ T$526026PH^á26tT$269Pt uPrc USWV$|$<\$81D$ $D$1F5 <5_3h#WS:H !1tbhz$W^h$#WHuo1<36tE\*6436s[ 36t jV \*6u=`*6tF@u46>h $Wthvm"W讋t D$1p@|MD$K}h%Wvt8D$D$h# j531CKD$D$u}h:# v11 t=t8<36u.u h#v VaPhg%  GF@uh"#A F@uu=46tk1uu莩ND$E11P@É|$t<36tW436h#Ah1#<36t436 h$#{SfPhp# Eluh#53 Cu|$tE1F-\*6D$t P1<36D$t436X D$36t jS< \*6u=`*6tEt h"#11<36t:368u.u h&#aVLPhg%   GF@uh"#/F@ut h"#1<36t?368t3h1#436VPhp#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=46t61B=p06tbu^1Ƀ~7t@tuH1=34 36t1Ҁ9ƒ (u1=3B1ɉσu1B 461t)9t`tbփub1^։PjS1 $u=3d1@ָ PS t^u 46u jS1D$ D$D$$K?r 藔 1@ jPjF ^_[À=3u=|26u =3=31@V\*636>t8t6EU 46r46 \*6t^Ã=`*6t^eSWVt$u 461ۃÿ36t6368t+\*6SP \*6u=`*6t 36=46ru^_[,^_[V1=46u#361A:t2>u 46r^WV|$ 046u"t$=\*6tg=L46u^`*6WuS =36tӃ<36t>368t2t-P46P56=3tu=\*6u"葒0^_WV|$t$ 46uWVj 46<rjV芏uƆ 46^_áX36=46t1Åt8uUSWVL461GP56Qu953u V^_53t$WVt$ Nfud56FNtF t0fu^~\*6 ?NQPF N)N\*6vՏF FF \*6u=`*6t V N^_Vt$F t-)t'VfxQPR yNFN F^53t$USWVP|$t$j'V}Yt~th#V8<k>t!h'Vx1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=3uUWMGHO W]H"WVGHO W3H"^_[]WVh'Qj'VWt)19<>^_hL3oh`3bUSWVD$~@|$l$1SWU t 蠋8tF r)~1H^_[]ËD$)D$\*6X3tPL 1X3P3 \*6u =`*6PD$L$ T$$RQP XVPt$t$V tt$ P4$L ^h#PD$L$ $QP53 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+76+t56Pqq hd#jh6666SWVP|56`'C PVw u,$$w-CGσCGCuh<66Vh#8 u*$ 066066466866^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv t61^_[]ËD$t8SV œƋ466`u866$I 466#t#$#t"%p,866㟉466t$D$$^# ^[WV<5T*61$|$PWyt $D$PL$LT$H=T*6PQR 5T*6$<^_USWVL$T$tHtA|$9t91:'Írjt/9t+1:'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t UwV藈Ƌ $A$~ C@ $Q$f=t @UP蝕WVp ^_[]SVh#WV<5T*6p*6$|$jW u"D$LL$H=T*6p*6PQ5T*6$p*6<^_USWVD$ èu|$=Z3uÍD$PQW Ƌ@\*6Nt$݁ uF @SPуF`u vUG F~tuF1Ɏ! s%t É^~56t56u56t j~ \*6uk=`*6tb[r2j賆XxL$H @ $  $#`uWF `u WrF fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=26u0@=|26tc@=*6tf@=3ti@=3tl@=(06tp@=3ts@jPh#,WVt$|$ \*6twхVP? \*6t^_Ã=`*6t^_WVt$ t|$Wv 6u^_USWVP\$\*6j2ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFRSP}j=SNS迄UPu< ؉G@543S543hT3PmV ~ F1gjt$66uQG L$<=u5x56Ht562UjS $81F FFt5666~66566 \*6u=`*6t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ *6t8Q12<08uF=u =ut j=RPMF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVD661tr:1҃Љu66r׍P辂ƻD66Nj+t7Mȃu%EttUЃuEmŃ66r^_[]SWVD66>tLGu% uwA Gu#WA @tw݁Gg;u66r^_[2SWV|$tfh#W&+WKp9uWh"$V't*tUj'W{Kt8)WPh# h# Gh.#Whp%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPh`I$tUh`I$>=uD3HQP~ j( P 3j)n~=uGuthaL#EU3HQPP3Q ^_[]USWVP66u66 h66T$ t$\$D661<$?tIOt !T$ ttуt݋ 669|QPT$(66%66A\$$t!1=66t$ St$ 40F9u1^_[]USWVPD$L$ Yh:Eu?5L3P3p26=PSI)߸=PUH)9 4$ Q$t%<=t!p26H p26āƊFCաp26H p26裁$WS ^_[]USWVD$(01r$11h\"җt7ptnuO1Gru=t*tx268t$jUt$VD$D$^_[]áx268H x26(tϋ$ЉD$D$D$ P1PU L$ \ =u4)Ftt.L$!H=tFt=t Uatvtt($t@u7=t $ H 4$VU x26H x26(e&UQh# 1@D${1 Uh#l9ru Qhl#\Qh#QVHtX1h;#'Mt(IuNt xuփуVPx26H x26u1^h)#USWVP\$jPSZ 1NjT$@tуu1F\*6uaՋOW | uujh 'S GuGOu' u w;  $Wz; G \*6u=`*6t^_[]SWV56666~tFu7jwl543v hT3,M v : 蒎DNtuV _ BPRуG u w: FGF GFGV: N^_[ËD$ *ÃuD$jpp 1h?#"USWVP1$1E1h_#e~ft&vtxu teuԃe$뺋-x26Et=$ ˃1$u P| ƄuWu ƋEu1^_[]SWVt$|$h)%6=ju"h#t(jDO1@$'N19eNVTNVv IF~uENV F(t!u0P 1x8)uxu x^_[h#h#WV|։π9!utN76tfxt?(u >)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP)SI1>?f u%PV1u%#L$1PV1t1Ʌȃ|^_1@Ow$'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$諉 t$ J19{USWVӉϋu76fx@$\'$PW{1ۅD$PVcr$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW1ۅD$PV$L$$t$<|$@11$;D$D9t$ aZ$PW51ۅBD$PV,$3D$ $3L$ $$3L$3D$1 dVWe1ۅTVWe1ۅfVWqeVW]e1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]BoQ9-u1tQyt8ytBÄth#Qed't1h* jjh'Qh* jjh'h* jj hH'RςËD$L$  )VL$D$ 2)u AJ)^USWVPqj PV蚖 ljq8t"qځ8"u 11E9s:$9t( \m3@DQ@uuN9t ڃ^_[]Vh#yVh#nUSWV׉Et 9Fup  ^^E9uM1PPE~ōP@rPUE~ LH;NuS2 #~^_[]ÐUSWVt$(h$b#jH D$,^H $x?-Ok-u)sstdluu~xwGW裩Åu"\m3DHt'1Ʌ SҪكh)#Eh\m3DH\ƃ~ƀtVUtV觪Vh#jQރ $hk&S@a1Ʌt:S表u+$891V53V|-$K$8ʉT$h%W`1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWu.]&|" $4Ph&% 1@D$l$t jWGnj D$PUP ljӋD$9t-ف8ur1u m8tQ#x$b#UPho#3 1@D$\$ $4hJ#1@D$F \$ t$Ph#j*6PPPPh#532jWVPΉj WQO 9u=у|=}^_VhY#jQh#dj53j`WV@h+6|+6x+65=>t)j=W/8thW>uPh&b#j@V|jVh~# Vh3ht" 1"$VWhv# (#t"%VQh^# j,h#h#q VWh#bL^_=X*6t 1+6+6T?83261262626926tj=26u3L33`33tP, 3Vjz15*6 ><35/695T3t\3@8@u jR\*6jDL46uƀL46@u \*6u=`*6tx^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$,'$L'Vw vVw d_ t"Vst Vw?w(ZN@F1Vw q#w ZN@FVwL?O^_[ËtVw#?tރUSWV|$t6l$u,'E$'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t( Ã|$( USWVPu } 76763f`|j%v2m O1@ 076D$,76|$@t$(q%v>%L$ h#V詯<*u C he#S舯1N .u{*u{ 1HD$Che#ST1HD$  t$CD$'C`L$&~QF0 $'. D$׋L$ jj D$tfL$tjWt$QPh076TFu$d'76l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Ph076e76L$ Q0|$76H 76T$ l$=76uM|$L$ jL D$tbL$l$tf|$ L$D$$076bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$076L$\$L$$X8G76076E ƋL$ cjl |$D$VPt$w767676761  76 76Wt$*|$$076 \$$p76,76t P$ VSPD ,76҉D$xF\$wZ$'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ\m3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~Vp7676T$t P# T$76 76t P# T$15 765$76Љ\$H\tF5$76X])P0tXM\$u/^t-u#F5$76벸^tic\$>T$ j5$76F5$76{ \m31:DYt 7GuF5$76\$DF5$76ȋ\$+1L$ jlD$t1L$t5WQgp76L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ h076 PRQt$QP  76FP:  76 VjxP\ 7s 76T$t t$L$ t PVRQh76JMT$L$ t1PRQh76+.VWh0761PQ*t$P PQh76 t76(76T$z \trB<]*<0tu$(' ?$'."'#Eu uShA# 76 4$\m3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h# 76\),ҋ4$u|$ uWh# 76 ^_[]WVP760tp765[1ɉQPVw} Nj \m3#DQt$c#r& 76+ 76VQP4  761^_SVˡ(76H (76 u:3Prp~r0 P{3Q 밅u(76)3HQPPD3Q^[SWVP760t"76<'t<"u1B^_[11fZ1ɉQPV< lj+t:<-t6 \m3DAu)76+76VPhn#  76 $ڃ^_[SWVӉQIǃArVh_# 76GPVh076_ D$-76.76Ƈ/76^_[USWVP׉1PPP螞 ,>U2I@PUQ肞 x$tG9tC76+76VPh#.76+76VPhw#п  76$^_[]WV9t"΀:t976+769t\VPh#Z76+76Ph#賿DTX8"uD=76+=76j"U3 PVWh_#~RPh<#m  76^_USWV\$$8l$}hZF j jh'Unhƅu!hZF j jhx'UQhƅH h]et76x765#w %u<#YwxD#=w %u J#w؃uR#D$w؃tX#D$u_#؃L$u f#D$un#@D$uv#a D$u#B D$u #"D$u#D$u#D$u#D$u#D$u# D$u #i]=t76tj ct76x76# D$u# w %u#@D$u#D$u#w %u # D$u #w %u #`w % u #?؃L$u #&w؃u#D$u#D$u #D$u(#]=t76tj Gat76؃x760#wu 7#jw؃u>#LD$uE#-w؃uL#D$uT#[#u=t76tj `t76x76c#w %u j# ' q#u D$u y#Uw %@u#4fD$u# D$u #D$u#D$u#D$u#t76tj +_t76x76#'tX'|$FTPSh#jdWc^,^ u΃=t76tj ^t76x76tj ^t76x76'1' tN$L :Ntl P#PSQ]^ Vhg%.^t76t76^_ø#tfAuRh&b#jh|76\?|76yf|76M-~76uf^?^@P@|76ÐUSWV|$$71h$b#V  5_3ދ_391D$D$,h#U藍D$ U 59D$ urh#WV wU$ '$j5<蚱l$D$y1E_39zD$1 _3l$|$HL$Oȍ$WQ y hh&jt$VhBt @v|& y h#D$tPhht@pV& y h#D$4Pht@p0& y h#Ert&u+;?UVt$<$PW W19D$@D$<\$SUYu{SU[umSUu_\m3 $1DHu$jh#VM4 VWV@PWDVW芼D$<$H $xd|$<tWjt$ y h%&s|$@t'D$tPhgtt$$ y h#]jR5<h"$.1D$@D$#uFj PV` =8u$8u؃^_[Vh"$j WVhq#jUSWV f]676Z |]6ƒ |]676 |]6€ш |]676 ]67676hn#t h#t8ƿ%'#PV.tG uVh#j $$1ɉh #SU P6$$!'76kj j5<^ ƃu9<8"57676v <f76Wj j5<;^ ƃ _%76j j5<] ƃu;8"G5767676761A5<5<hS.#V,tch8#V,K7676B7676/76#:8"tD576  9u76rCjh#5<hm##Vh*#5<hT# 5<h;#ju h# 76t 1ҁ‰76|]6փ9576u<976u2]6976u#]69 3t 37676=76u\1ɅQIh# _3=76t)ͅt=76ut 1jhh76P4 $yh76h"$jz=76u1D$(Pt$Cu#D$0=u 76761N1$"' $$h"3o"t$h#Qhs%hVUOVrth"P$$Ph"$76d=6 $=d=6=76p;6B=h3"#t St1@$$Phmdt$ hh#h|tW-Wh"# $=\<6u \<6 =`<6u `<6 4$h;6 T76 $$1 uWhPh;6  1;6;6;6;6tjVh;6 h;6\ $RhS;6h76VW0 576VWF5 W&l$t$D$ 1ɉHHD$UD$ Pjš Džy#58#Bj“x߉DžVix9ujUjq 1|$nh3"#$PP<hjh;61 ^ W*%t $h#yMhf3e3H e3~e3H e38he3&ljt9 t4e3H e3~e3H e3he3%ƒ߃NyjUj] hS"#P1;6f3h76VW4. 576VWj3 h;6dtd($Ph"$$PAn1@PCjUj˟ CPݢ%Ph?3##tǍ$PWh&%VD$uhu"Z$Pmg %jPh'A#QQ2ƃu W VBWVθE#"'PV$%t uVh,#jwG 76裘76G76G76O1l]6t^_^_WV΃=l]6 p]6t>76t49t08#8#9tS.#9tS.#QPh##[ 576l]6p]6^_SWV#0''''VSh#hlf35M+#ujAVPjj"P轸 th#Z1Q1L"'$ =uh~ jj"t$ 1$4~F"u4$ 1@^WVκ u1H3 r1P^_V΀=76u6=76t񺛂 t41t)Ph;60h;6hedAV xk^Ã=76u񺛂 Jt=76t776t.h;6hedAVp th;6hrdAVY t=d=6uj2@h.#j&h?#jUSWVPύAPjh#hf3nKGw4(''h #Ph'#hf3DK f3w(h3#V.K w,h:#VK w0hA#V K w8hH#VJ w4hO#VJ W4O<W8#9tQh#hV#hf3J$b#OHtQPh_#hf3J$b#OJtQPhi#hf3xJ$b#OLtQPhs#hf3WJ$b#ONtQPh}#hf36J$b#OPtQPh#hf3J$b#OTtQPh#hf3I<$f$1۽af3Pjjh#4wVh#f3PIwVh#f3PIGtmÈJ9|6{u;[tVPWh#TD$(ffL$(D$ 1ۉa)D$u!)tPt$ha#yTL$4 <)ǘ΋I<9vt$h#PT$N<.”T$9vt$h#$T$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#S D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( \<6`<6t$(L$QhVS  D$ 1h#VtG<$hr#V.s4(1>tYj:WD$AL$\$hr#Sr,1tD$hN&WtkhN=$WhN#W\D$Php#Ws D$q;76efZ<6ujh?&l$!U l$(''1tUP QF''r܉1hD$ Pj <$Wh#QD$ D$t$ <$}trÉD$h"U& t:h'"U t/h,"U t$UWh8#WQ F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhX#PD$ D$,<6FʼnD$uf5;6l$u D$l$l$h/$Wh%Wh#Wh#Wh#W h#Wnhӭ"WXTh#WBh#W,h#WUhO"Wkh #Wh#Wh"#Wh-#W<w ~W|$WhA#(O T1<$(<6jD$<$rt$Wh#N D$f;6@<$Wh#N76fZ<6jUh;6jUh;6  <$t$ht$0VN J21jD$ Pj< D$;6뜉1jD$ Pj D$;6q1jD$ Pj uuD$<6J1jD$ Pj uND$<6#1jD$ Pj u'D$ <61jD$ Pj^ tt$W|$Wh#|MD$<61hD$ Pj uD$f<61hD$ Pj uD$f<6a1hD$ Pj ^D$f<611hD$ Pj .D$f<61jD$ Pjc D$ <61jD$ Pj8 D$$<6; 76sr"jW|$Wh|#W|$Wh\#΍L$$ t$d<6|$x]6L$$ L$h<6t$x]6rhr#Vkl$}}L"'1ۋ>t.W,Lt t uPUWߞ Á"'r D$\m3MDHu D$"91hD$ Pj t4$h#KD$ \$"r)Ut$h#J h#JD$1ۋD$p<6ND$p<6WT4(t$|t%hr#Vj L$1Ҁ<tʉT$D$< w'<$$ "'L$ L$l<6<$tL$$L$ L$l<6|$x]6cL$$t D$|$x]6L$l<616FL$<$C fF|$x]6L$! L$l<6|$x]6t8L$$ D$|$x]6tL$l<611A<$D$ h;61D$ ȁ(^_[]4$h#%ID$ WVPθWEV;6T<6fX<6h;6 fX<6=76u=76u#$}h;6hgdV 1h;6hfdV y 8t  8uv$=76u(PhmdVn xX53hu~ 41=76u$h;6hgdV2 y #1G^_ù#h#! 뙃=3tt$ t$ t$  M1HVD$ t$=;6thPh;6 ^D$L$01Vt,uVh#-t"uVhl#Vh"$蕸Vh%#Vh#@G^ht]6hmd53& USWV8 $RPh hh=6Q[h]6 76v|Pt$h#F lj D$T$1D$ XƉ 11 ‹l$>6 h]6h=69h=6hWD$P $;D$$b#=d=6t =}t=}uЉD$$#=76tȋ 76=WEVuT$tf976rD$Pftt=76%4$t$Uh#E D$t=VEW=76$t=VEW4$t$UVh#RE=76|4$t$UVh#.E=d=6$D$PSt$Ut$VhI#4=76u $h76Sf3V 576SVI SGSt$VhVWi d=6D$ L$D$11t4$h]#蜵8^_[]USWV T$ $11F1Ń=76|Uh#D QPWD$Pt$[9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=76tUPh!#XC Ɖ ^_[]Ã=76tUh#p=76tUh#CċL$T$tPh;611@Phi#tt"j QP< u58"t1H761Yhy#j薸Ph#+t"j QPI< u8"t1H761Yh#jMSWV։ϋ\$+76tItEu761tGtBh=6>6h]69w1h=6 1tth;6QA1@^_[VhA#j肷L$1=76T$ PG1ɅɉWVh]6~( WRPhh=6Q袊 h]69u ^_hr#uQVh#j8PQVh#jUSWVPӉ΋l$|$uj WV: Euw"9"t:M";L$ w,O>t" t9t\m3DJ@t1^_[]WV1t>΀9t7hr#V<t#ƍFhr#P`1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh#Wh#(@1۹x]6؃^_[]ËL$9/up<6D$\$A/jPU u$D$ ;6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh#U?x]6!Wh#??x]61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh#pbD$$Th#Sut]"<('WPWS '> uۀ$U-$T14 )'D$XP tpC"uD$TPh)#-$T$끹 # )'j" $eFMu SQЃ {Sh#,h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h*#p/$PQhC#R~$ &뾋$G,w0h#SI qt*Vh&=&SI tSh#%뾋$G0w8h#S )t*Vh&=&S tSh#%뾋$G8w4hB#S t*Vh&=&S tShW#f%뾋$G4w$u ~ˍ|$@WV[9t"b&J~PH k$''1OJH w@$(' &B(D$ D$$l$ CtGtngtbcB8D$D$l$c&ɋB(D$(D$,l$(B&ɋB(D$8D$<l$8&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=]6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph#h&#~USWV|$t$t$h"V! Gw4)'h:"Ph"V  GPSh"V GPSh"V VjjhC&GXtVjj h"GXtVjjh&"GXtVjjh+"Vj 0w(h4"V7  w,hF"V&  w0hY"V  w8hn"V  w4h"V wu 1<1A71Au01<  $jj@PD$PTD$ Ph"$~C9u<$u4f3H f3~f3H f3 hf3j k1^_[]h#jRfUSWV $ $ D$-@1]6]6]6]6]6]6$]6]6]6t$ h#US觢 c~!P$*' ]6˃PtdT]=<?1AJ5<?a]6뒹 .<]6h$b#n ]6b ]6D$]6T$:@=]6l<D$ Tnt uBxou D$ 1Ɉ ]6h%Vt]6h$b#`ء<$j:WC-]6tWutm繘]6S c$ \W]6t]6t ]6_39$ 1ɉL$tVh$P tj/Uu Uh"hh%h$ U4VDžuV<Dž7h$P苘 ƋohX#Wt(h^"Wth#WpV 1QQ$ 4PU7L$9C9$ $ 9tU}lj?,$u1QhD$PQV# h]6hzd@Pu tq$ PhedAW[ Wf|$ W D8$9",+'uWwfh^6,$h h 5]6P Ġ ^_[]h#j貖$Ph"$jΖVh#j葖hk"hj"ʍD$ Ph# D$ Ph#j薖D$ Ph#롍D$ Ph#땍L$ Q40+'h#USWV։ϋl$jX V͜ Uœ CCCOK G^_[]-hH,'PhK#hlf3xjUSWVP׉΋tASW~4$4(VS[ Wh[$Vt$ P# W( É^_[]USWV|$1_hX#St$h^"Sth#Su\]6toU3t[u=]6t .=]6t%]6toU3`t [u^_[]USWV$D$|$]6$b#tW3t CÅush(4$t$ uD$?b%D$ ]6t L$ mt L$ ^$D$ D$hC $$ t$hU^%hV $0|$D$4$L$h%Q'1G@΍K9|,SPZ Ŋt><-u(GD$tj=Vt>FD$ GD#th%D$Pu|$1F1B,$֋$$$,$D]6tP$b#tw"P$h$#  xF1Ë$4hg% C9uj Ot2ƅ|$t t$e 4$Z tA710h4#ލ|$t t$0 4$% ^_[]ÍD$jPV> x!L$ȃtuuhs#n묁tlP PUh:'# 끉 ]6utD$P$uW$P$u8t#tUVhu#a Vh&Qȅun8u*uVh&*jSVhu# jD$L$ ^6^6á^6á^6VPD$ L$ $lf3QPVn Vj jiUSWVt$8^6ut5^6h" ^6l$\$=^6t!u5^6hk# ^6US؝yW Phe$ ^6ttj ^6tu^_[]Ë5^6PVhy#b  jPD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj jUSWVu^6$PhW%k$|hWV\ t Ƅ|D$PVOk1ۋD$ !=`= بtLV|0h$PQ Džu6h^6h"$1 Vh$PϪ DžD$PWjVh#Wh#ue^_[]Ë$3D$($3L$$ u^6Vhh^6J t9Ǎ$PW#jx#$= uVh#{Vh#pWh#eUEM JRtHPQh# t$t$h,#hhb6fb6]ác6tjЃj WVL01Gj0h,'WY =c6jjX 0^_SWV01GWKWS)jS0^_[USWV1 c6$c6 c6(c6,c6(c61@D$ $1at4sDžW$ t7h$P Ɖl$Pŋ$ tUt$h[#$ uu&낋D$ t^pfjt$wUw$ Ë$ U؋ $9|ȉ$z\$GD$GD$1Qh$PQUY t,ƍD$Phzd@V t$VZS] \m3‰D$H9rHDQtD$=(c6t*wt$SV u D$<tQ?1GjY Sΐ GL$G 1ɉO GO,c6G8=,c60c6\$w tUvftt6j Ui Ft$Z F t$K FD$FGF0wVhm#hlf3 rUh$#_$ }L$ AL$ 15(c6tyvh#~ twhg%?j 6Í$Ph"$J؁^_[]hP#h2#܋0c6Ћ$ t9‹-(c6҉T$։鋔$ t$ t $9|ȉ$mNu\$(c6t 9Ct,Ph#V$Pu$ȃt1{ $ t#Qw wwh#$ȃt*t&t!Pw wwh#hlf3( OtHOKt$c6G8=$c6 t$w' w W C4c6H 4c6{ t t 0c6 0c6I 0c6;D$\$9(c6MŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$P\$tq c6c8$b#tJ;$h#Ph#hlf35 c6.>"#ty#Pv vvh #hlf3h6u$SWV։ϋY Wss ss҃ 4c6t~j EWss ssԅuA 4c6^_[ÐWV1t$|$ ɉ @4u!wȉXȉX\ȉ\ȉvvv PQ40Uv40<85v<8D@vD@LHuLHTPuTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40;u40<8u<8D@tD@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7tVw wntV FwwZtVFwwFtVF^_USWV\$l$EffEffCEffCEffCu usS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu)sSCuusSCu$u sS$C EDȉCDu,u(rS,C(E@ȉC@u4u0rS4C0EHȉCHudh#VŋFNxd6tbSQP xd6x (e6~,=e6tffOfGG@ Չn,~$N()ǃ~$N(=(e69<$D$hP-(e6>N,ș)N,)n$F(teh#V$FNxd6tbSQP xd6HT$<L=e6tAf=e6t4f.<$ ^_[]c6(e6F,)F$N($fOt@ c6븋D$L$t$ QPQPUSWV$$$ $$$(h`I$SV\1j D$SVWUhPD؃r_$e695 e6rPSV Pt7=e6tf%"=@t4^#WQh'l%d Whm#T^_[]USWVP|$\$s s@=e6tf9uRd6t=c6t=d6tj:D$1PPPs sQs s6Ot~1F=e6tf)9F=e6\$tAf)=e6t4f=e6t'fL$=e6fVT$Rt)f~T$JR>>fD>=d6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=c6=d6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=c6t Vt$t$Ut$h#N1Ƀȃ^_[]1A=c6t1=d6<$\$ HfUSWV $8$4}tE1ɉM4M019 d6‹DT 9 e6tRPKM$U(E$f M$E$U( u ^_[]%=uLId6(9‰|ǃ=c6t<|u=d6tFNFh1 td6tD$hVP& |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =e6t RPJ d6I0VQRPV։D$D$ ЉT$t d6=d6Q8k=d6L$$tL$D$ =e6t QP=J d6#8t@DQL!!IT u‹$8U t#DT tE=e6t!RPID t(=e6t1҉EU}@U=}@|$c6EM QPQPh$3WWhO#聇hs#'uQ{u u d6y0ƃ=d6e6t:tMPWI?UUlCD$T$NQt PWH~V ~V hG#d6|d6@ 뛋5d6F8E -d6T$$tT$D$ =e6t RPUHv0 I)؉$ʉT$t*DT tZ=e6t RP H$8D t6=e6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|Wc6E$8I QPQPh$3UUhO#薅hs#<$<t7d6Ht)$|$-d6Cq qƃ=d6t0FV=e6|$$tJRPF)RPF4FV =e6|$$t&RPF)RPF)FV )FV hG#d6|d6@ USWV|$ \$t$e69 e6aDc6 @c6 ‹-d6t9ˉrux9ˉ\$؉jL$QWPQց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס|d6t`v0WUL |d6d6pxjV|$(WS)Љ @c6Dc6=d6jVPSܖ |d6A^_[]WSh#|d6@ USWV$׉ν y@tnVՃ2v vv $<D$$8D$d6p0vv_ $G d6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPO19rÃ=e6$t$ \$ti=d6t,ۉ~A1_t4CT\$F9uۉ~1O ɋW @9uG W5d6萲t$ D$x- d6;Xt|$#=d6t JًL B tmt$v vh&#hWWVt=d6t$$B1ɉL c6t$ $$Bt$ B Cd6;Xt`R5d6踱T$\$1ۃ=d6t%JًT tN=e6t#RP7BBt/=e6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tbc6L$AI QPQPh$7W]WhO#hs#|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=d6t+FV=e6tGRPA+D$RPA1FV =e6t*RP@+D$RP@+D$ډFV +D$ډFV hG#d6|d6@ 1@$5USWV\$41F~3|$0l$,|!e6 e69|)S9у} ȃ^_[]Éދd6K89}=c6tOI.A!1‰9)=c6l$,|$0t!t$4PWUh#d6PVWU腞Nj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=c6!$l$|$ T|$0tN# $ND$T$RPWUh# d6<$\Ttq!qIVPt$ Sh#$@l$19=c6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh#d6t$Sh#1Al$,|$0USWVD$,\$( Tc6Pc6փσ5Pc6=Tc611 J \c69Xc66 dc6`c6Hc69hc6@D$ hc6=d6\$jD$ PL$QT$RIց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =lc6pc6txc68tc6T$t|c6‹D$ȉ`c6dc6c6WUS5c65d6贬=d6l$$-`c6+l$(=d6|$`5c61VV=e6tf%=tjvdv`;VdF`vlvh;VlFht4;TCut4u;TCuG9a=c6t< d6(1c6SS=e6tf%=u1=d6u(x$CS =e6t RP:9Ƹs& ɉ @u ɉ @uG9wt$t$t$5c65d6襬c61Ƀ=d6 Hc6^_[]PSh?#awUSWVl$|$d6jVUW 1ƒ Xc6\c6Dc6@c6=Pc6-Tc6=`c6-dc6hc69c68#{H1ۃ=d6(=xc6-|c61lc6tc6ډpc6t@lc6 -tc6=pc6WhI c6t^_[]UWhb#Tvh#Jvc6t Pj c6USWV l$ =d61ɅDT =e6t RP8 d6Y0މD$ʃQSRVo wÉD$4t,PY 1ơd6$d6QPt$0t$0L$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ d6; d6u3P5d6b =d6t-d6d6d d6d6Qd64 ^_[]h#\tSWV|$t$d6d6QPWVtH 1P1 t^_[WVh# tVd6tR d6~%d646g ;5d6s로d6Pg 5d6g 1d6d6^SWV\$t$s sǃuG=e6tfL$%"=@t4^#RQh&%t s s=c6tfhf#(8e6=d6RMT$=e6HRP#9L$0ơd6@0 T$D$=d6D$0T$T$4=e6t$$t RPY#Mt$t$$=e6tȋMD(d6@0T$,‹t$(΃=d6e6t+tMVR"uVFt$t$ "7KVR"MQ AD$:MQqD$T$AQ!EL$DT=e6t1ҋ d6q0RP耐 ƋL$ jWSQӃ=d6D$ t7~SPt$t$$NjT=e6t RP"|$)~SPt$t$$贀=e6tȋ|$1҉\$$ t/f d6q0RPݏ xËD$L$ L$0|ád6@0 T$ʋL$ȃ=d6L$0T$D$t!D$4=e6t)PQR!D$ T$8=e6t@ɉL$ D$ =c6t h#X=d6t h #Xh0#X/=c6u hT#WX=c6u hr#W3=c6u h#W6=c6u h#W<=d6t=c6u h#WT d6|$Y8֋T$  SP54e650e65$=c6 d6+ e6 $e68e6 D$Xt1NPSWUgʼnFظ|߃\$ <$w4Fd6<$t LX FuWFsT$ 8e6 Uh.#>jSWUt$@hR#h'#m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$w wf6 f6ʃǃf6=f6|$ |:w wh#= =c6h#qjG $D$|$tjVU¾ e6<)1CVUh$D$,p p*f6 f6ʃǃf6=f6 j ; hp d6tHd6 d69tDy1Y1 t 9u,0e64e6$|$ ,d6d6Q1I1 ы|$ td6$G0W4L$Aڃ]D$ p ph#J< =c6t)h#1C+c6h#;h#h1Ct ؃ ^_[]c6jpj|fUSWVP$T$1B@B-1 d6f6d6x,11=De6t>Q:d6x,$kd1PWSQh#hlf3ʇDe6d61ۃVU聶tzljl$ t$d6pt=e6tʡd6 e61ɉT$HtttȉD$LVUz8tD$PWbu(Cd6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$f6ŅtTM1ًU1 u3VSh$w wf6HPUMpXf6 d69tmu1 d6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $8-'h#F9h;#eh#ejj聴=d6e6f@=e6fh#8h=#eeU1hPVPVҜ1Bh#8h;#'et21VWhVWVW莜1 tah#+7c6h#du<tf@=e6tf @f=d6tjjxfh`; j5d65d6v,T$1B@Bs; -d6d6  $De6$Wt>E6+5d6=d6kdPWVQhM#hlf3蹃De6uF$hp#vv 躑 (e6A1ڍF$h#cvv 6ǃ=d6F$ e6&jPn1 (e6I F NQPQPhSt=d6F$ (e6t%QjPSh$h#>6#c6QjPSh$h#36=c6th#=c61F$(e6 I1)щN$uh#b-vv *ǃ=d6F$ e6$Wt jP_1҉GW1҉GW }hjD$\P2c =d6e6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=d6$tD$\=e6tL$Lu$D$PD$PD$XPyDe6;,$/c6$W=e6ve65d6;4$]|$T{$AhjWa -d6=e6tt0fD$T@js$&tPfD$T@js$FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=d6$|$TtD$\=e6tD$L$|$TtD$\D$PD$PW٧;4$=d6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h#ss QPTh#(^t~s sqf@fNCKK CQPh2#ss oOCK =c6th#ss QPCKh2#QPss fN c6;<$=d6d64~^1ۋ/uu q]]8u9rۋ=d6/CK tS  StQP HKX9rjj轄`^_[]c6j&ejKqPh1#/L$D$@, +A,USWV $0 n8$=d6ui=d6t`E=e6tȅtNE=e6t$; e6$e6s&E=e6tjPo@E$F0N4 utEh`%PR)$0 F=e6tȍL$A=d6AAhh`%Q  d6 e6tD$D$L$L$D$h$v v薉 E=e6tfM9v%}EPh($.O$h$4[4/E=e6f)=e6f=e6fEtf=e6t΋$0 AI 1 h#QP辈 h#Z$0 F=e6tȉE$$PpZEL$fAWQUB $)fEPUV  =e6tfD$fXWPU $0 G0W4w wmfH$Xc6$0 =d6t>}t8h#v v贇 h#Yu EBc6F0N411G9 v vGD$@=e6tȍL$A=d6AAhh2#Q7  e6 d6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=e6t2f)=e6t%ffD$=e6ffe6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=e6tfPjUBY D$fEutEh2#PNl$L$Aq $0 JR ωtljhx$RQUW݅l$EMك9v%}EPh$*$h$qWD$$0 T$ 3F0V4=c6h$ZڃD$=e6t΋D$p@ =d6X}$0 ~h`$v vڄ Eh#VJc6B$$0 1GPVtXD$T$ F0V4=c6h$茧ڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPU E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUa $EtMw\}.uVV4~0|Juh$ } .u8h$v v% Eh# U4$F0V4=e6tȋ $e69 e6s5h$juv v݂h$T4$=d6E=e6tȃu}uE=e6tȃtb}u\FN U=e6tʋ4$h$jRQPX=e6t}Eh#T1 e6EtjPgC$0 A4y0$$0 t=c6$=d6JR u=e6tPjVRQ菁h$cSƋE=e6tjP1Ƀ=e6t fe61ہ@€@t f e6fGc64$Crv $0 A4y0AI U=e6tʋ4$h#jRQP褀h$xRc6zE=e6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=e6l$\$tȋM=e6t1퍜$UQUPhScSh?$$"Ph5$ %9-c6th$¢l$\$ h$zQƃl$\$$0 A4y0| AI KC=d6taEO9tU$0 AI U=e6thg$jRQP%GEh#Pu $ c6fO4$E  ^_[]ËM PShv$"ȃ=e6tUSWVT d6d6,=De6t>)"=d6kdPWVQh$hlf3pDe6}ww cO W $T$ WGO ƀÄ:1=c6t4=d6t+=d6t"uGO 1F9ƺw1 tbQPc8uS=@e6xJ1v6KNj@ $GD$wOG tQPb8u E;-@e6|E;-@e6=4$h$b"h#ORv6话11|$D$HNL$D$D$D$$D$D$ h D$TD$Dd6pt =e6t ɡd6-e6L$Ltt tȉ݉D$PD$PRmu h$!D$TPv6t$t$~tyD$ C v6ΜL$QPt4t$t$af@jw wt$t$~t 끿\TL$tˋO!OڋO SPh0d6sNd65Ld6\$S" d6e6ttut5d6S5Ld6Gm {U |$4tU tt$h$y1ۋG $L$T$D$jUVg f=e6)1B\$&|$ d6L$ tL$ y1Y1  u"T$L$$tGd6QPUVpk{U L$uK`ى90e64e6|$4@t,d6@4 ؉1RRQPwHwDw w{` O d6;H8tmۋ|$tKC$ LL$D '|$ GWQAd6W |$$L$Aa |$tyttD$4@ 5d6;F8ubCLL$DQPD$d6d6tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$If6tu^_[]Ë5f6:0PVhy#I jAPD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj j@USWVuf6$PhW%$|hWVh t Ƅ|D$PV۫1ۋD$ !=`= بtLVd0h$P Džu6hf6h"$1 Vh$P[ DžD$PW3Vh#Wh#ue^_[]Ë$3D$($3L$$ uf6Vhhf6 t9Ǎ$PW诪x#$= uVh#{Vh#pWh#eUEM JR$tHPQh# t$t$h,#hhj6Ej6]átk6tjЃj -WV.01Gj0h-'W6 =xk6jj+.0^_SWV.01GW脌WS+jS+r.0^_[USWV$d6d6=c6$XPVU=c6u6#$`= t#Vh "oh#)jVӚ d6R=c6<$8d6=c6t h'$Vh7$Ef61d65d6d6d6h$h $ udd6ǀh P5d6O 5d65d6,=e6td6PP>5d6d6d6@ d6HHщ8<=c6th$j=c6uh#u_h 5d65d6e 5d65d6&=e6td6PP75d6'd6,d6d6D@RL҉111C QPh< $[ d6HLщ@D=c6th$i=c6uh#h 5d65d6~ 5d65d6.%=e6td6PP665d6@d6,d6*HHPLщ8<҉@D1ۉd6 d6c6d61Ƀ,=c6ha $1L$ d6L9| 9Ph\ $d6=c6th$h=c6uh $Ih 5d65d6 5d65d6#=e6td6PP45d6d6,d6@h $L$>d6d6ǀ,04ǀ(<HHPLщ8<҉@Dh P5d6M 5d65d6"=e6td6PP45d6d6,d6 d6c6G?d6L-=c6th $:h $7d6d6ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5d6 5d65d6!=e6td6PP25d6d6,d6=,d6t}=c6uth 5d65d6肼 5d65d62!=e6td6PP:2d6ph5d65(d6: h d65d6=d6Vh1LVjP# G011D$)9|ËLG8 $HLOd t1SRPV5d66t0|$u)h $h#s1AL$=d6tLSVV36 d6A8$HLId t1SRPV5d6U=e6t SVV5 =d6G0ŋ $A9e6 e6ʃƃVhe6VjP jw,d6y9 $e6 e6d69؃sd6Éd6d6C d6UPXƣd6USGd6 Vhd6Fd6 $d6=c6 d61Ƹ1ҽhWV5pd65d6|5\d6=`d6dd65pd6=LBALtl=c6HhA $Xh#11IPPQQPV7pd6f@5pd6+6 pd6fAtd6FȃtvFjPh` $ =c6th#a=c6uh/$nt1Fpd6f@5pd65 pd6fAtd6Ff=rmh $=c6th $5a=c6uh $t0fFpd6f@5pd6,5 pd6fAtd6Fffuzh $=c6th$`=c6uh#tt=11IPPQQPV6pd6f@5pd64 pd6fAtd61Ff9D> <:PVQΔ D>/|)Ot$L$6m62m6$!D$h8Jm6$ D$tB?JL$h)PRQ`SWVD$t$ $e695 e6r==d6 d6jSPVD)޹394v t^_[PVh$CWV|$ wu$-'1XD$@uPw w Ph"$*=c6th$<h$t ^_Ph$趽De6USWV$\TM@$ 5uh`贠h`VP =c6t h$#<=d61ۃL뀃=e6t\,L$UPQ DPPz$\, e6L$L$UPQ |$u $PP@1LDffLD@9u=e6t8PP\e6L$UQPf t"PP\L$UQP@  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h$(USWV\$t$=d6!ߋ,t9Xt6@u|$t&jFt1ɉH HHXh1^_[]h=$VD$ L$5d6#p9tыR9u @^USWVt$|$VW/d6!t7^Fu+11 33 1u{ d6tqt$0|$,\$(l$$T$m6t9PtjRQ m6(Xxp L$ m6t9HtjQ5d6 m6(Xxp ^_[]WV d61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$x0'$1Aȋ$sY9UT.'<0.'Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$-'4  <Qh($h $脹D$P`wZL$ D$$.'1B(ɀ!1Rh4$h $SD$H`wPD$T$ $.'1C%   [QhD$h $衸SD$H`wND$T$ $ .'1C%  [QhQ$h $6USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tW ƅuWhu"jg$$<$4D$Phd@U< tj1OLVhedAU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h ,%t$M 1 Sh"U衤 CPh8"U? C Ph"U- CPh"U CPh"U CK,C,Qh/"U C0PhD"Uߥ $@D$t Pw; 1-Uhzd@$<W t1 VhedAW hjU D$ P$4`D$, 9L$w L$9u0$S11: 8tx$0h"~b$11҉ $ƅ*ŰP j PU ^_[]$0h"jUSWV81ۍD$4ShPSu( 1NtAljSPSWuWQ uMU D$t$$$Q1e^_[]fUSWV]D$D$ PSk_$1NHD$ D$(%=@= j/Sxr)ك$0PSQh^$hR=D$jPdǻ\$$0PS: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS]1@$D$hh SO ƅ%D$ PVD$3D$ 3|$$  D$uH$0PS$8$P$TRPV VO D$4@D$1$Vht$jSVjSN ƅxc1GD$ PhFV  8u;VsO Wht$jSjjSuN Gy tD$t P蕢<$t t$~1Ox VO e^_[]D$(%= tn=@u$0Shf$hPSAƉ\$1@$D$:\$ D$ PS[B$D$jSM }tSVtN$PhF|@V x4D$t P芡U$$JhF Vt$USWVP1hUU= ƉRP)9-e6t1@fCM+PUUSF d6;A0u $ytWVC^_[]Ë\$-d65e6SUqRPX$@ `d6ؔؐh P5d6[ 5d65d6 =e6td6PP5d6d6[USWVt$(~Ohole6tUQoՉ 1=d6L$$t| tWVnƉt$$H$ád6@05e6QPWVsUC cMhml=e6tUQnՋt$( }d6@0ˉ9Éʉ\$4$rQPUt$(LPDTGlOh|$ wL$,=e6tȋ|$d61ɉSh$=c6th)#&h#lt$" d6QP#T$1RQQD$P1Aád6;X0t$~~1Ƀ=d6T$DT =e6|$t RPiL$ pL$QSRPuǍP2m6$|$1D$D$t1)ÉعF@jP蠓D`r9w<$r$l$T1C @<$9uG<$;|$}d6X0l$ot$|$oh\$ىh PU -l$($|$ t$ t31T$ph WP $@$9|$|$|$(1L$t1ɡd6@0)ȃ`T$1ۡm6ـ#h$b=c6th$$h# ع`֋,$L$t1ɉȉD$ օt$ tH d6i0T$,RQUt$> d6;A0l$,} $L$l$l$,d6@0D$Mt$ |1TT1PD$T$ ʃ=e6t RP)gL$(ωQM D$H 9tet$C9\$t$$h$ c64$F4$;t$SD$`1c60^_[]ËL$ ʋ d6f9u Sh$褤D$`,t$$h$ljv d6Ph.$CUSWVT$L$D$0(D$ X=e6tSUeʼnӉ OD$$d6@09ʼn} t$t$5D$PSUt$< d6;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q5e6t9RPt$ƉT$ et$1ӋT$1 t<$G RQdD11 u5\$$9t ;D$t`GPD$ GPWTt RPd$<$G L$;L$t9ta щʼn$;D$t`1h$辢^_[]USWV d6$d6x0UWt$0t$0%pƉt$ыt$$)‹\$(19r11 $p|$ )Qj`PRo m6T$4$1B srl$,$ ȈU1wX=e6t d6!9GX=e6tȋL$,1Ph$蚡 m6L$ $  h$y=c6th$-h#t$D$OPWTP1GTGP^_[]c61USWV|$,u$tz$d61@$d6sll$d6td6 L$  ƍD$1PQQVK9 d6;A0-T$zu D$`1]l$z$Ń1EGpD$hf D$ Pt$ u&xMt(T$hf D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh$џ=c6th$h;$Et3s ss3st$Vn[E;,$uc6%t#Ph$0j:USWV0\$T|$HOX=e6t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGe6҉L$D$td$PQx`É׋n11 D$Hp 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^q1Ƌy 1 t $B8HB8tQPQQ&C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h$'h$h%$h h$ɽPh$O4$V0Vh$h$h h$hn$hWVt$ F,t@m6th$&F,P1~,>d9~8uv0^_h$h$h h$ D$x,u@Pt P諄飄h$h$h h$ռWV΋I01t*N8~2IN8tPQP PXN0G;~4vɃ~8u^_h$h$h, h$sh$h$h2 USWVEH1Bx,T$1hcsM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vSqe^_[]h$h$hF h$薻USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hJ$h$hK h$膺USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h$h0$h` hF$h0$ha h$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h$h\$hq hF$h\$hs h$USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hJ$h7$h~ h$jfUSWV\$$|$ l$t$m6t5d6SWUh$USWV5d6 1^_[]USWV\$$|$ l$t$m6t5d6SWUh$USWV5d61^_[]V=c6th5$Œ2j5m6Htahj$腌h#+tSm6xL~61 m6 s"@Pt4h$( m6m6F;pL|^5m6vj+m6t'x,tPm6Pm6ám6t x,tt$t$t$t$P1WVt$|$ VW=d6dtX=e6ts,d6`uau33 u1@1^_WV c6t1 m6 d61!`u/aʀs2hlpx1Ph$ԊPh$h#gJh$蹊d6 ǀdƀah P5d6_ 5d65d6=e6td6PP5d6Ѱd6d6!1111QWRPjhm6hh $h#艶lh$ۉd6 ǀdh P5d68^ 5d65d6=e6td6PP5d6d6 d6dPs+aʀu Ph$PhC$h#蟵h+$d6ǀdƀah P5d6Q] 5d65d6=e6td6PP 5d6d6^_jlUSWV1L$ AL$HAL$@AL$<L$ `@'L$A \@'AX@'AT@']u }h$SV_ ka~(bt@it YltAsttuJD$PW,5uVPD$DPD$DPD$,PW(D$HPWC# D$ PW$uh0'jƉe^_[]Ãu95_3ujhT@'D$P4 u1PPD$Pje95_3t$Dt$Djt$0t$0S(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQRSRPt$8t$@t$8t$@W1u2h$R1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]S^kt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ S t$\D$Ph&b#hV^D$@w ww7VPh~$S 1h$+hY$WfUSWV1L$(AL$$t$@L$ D$ }] h$WS[ aLuKVbtit'cD$ Pu D$(Pu3 D$$Pu udt AuZD$ 9_3u~]#D1غ$Phzd@ tN|$$tOh0'j[t$ ut$@u1Oe^_[]h0'j'11J$THPT$,L$(HL$x1VVVVV]PeT$4 @T$ƋD$(D$8D$,D$4D$$D$$\$S!SjPjt$ t$jjW: X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWDl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPNDE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q \j H @AQ@A$Q @QHALh!$SWh!$h!$USWVP\$|$tus$" $"$jPtQ1@PVSjPt$8t$8W E1u>4$h,$$W V@WSh#$W4$h $$W 1H^_[]UWV} uOʃ<|RQPh"$VJPRj@x& $T$W1ٹ|$5<h#"$ 5<h"VD 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhT@'V 1OujV5<>uW?,VQ>~Ih3"$Q1$VQ7 t1PhE"$Qx 1O^_SWVP|$1N?u;j S5<譶 8u1u5<h"t$ ^_[WV|$1N?t5<71t^_h#$t$USWV 1O1;B։ˍD$ j P5<g уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5< >x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,ރjhT@'t$ $ tjVt$ $ jQV$Ѓ $V  I iTh j$U$  Vd tZs0wh^"$VIz1t^_[]1;BB  FjhT@'P  1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hn"$W{ 1^_[]ËD$L$stitau1t$QVT$> t$ Q1Phx"$Q 1HUSWVt$|$ t)l$\$$jWUS% tWUSh"$1h"$V*l$(\$$jWUS tWUSh"$V1H^_[]Ã|jWUS+11USWV\$1s3h%5< t^1Wd5'tuWh"#$t$ 1Nl5'h5' Ch%jR Džu^_[]WV|$ p5'd5'Wh>#$u^_USWV t$@\$D$ $t|$$L$|$t$,t$4RQ*L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh-$P%1D$Bh-$ D$_$ӃD$DL$H(X,EP!t$@E X,L$H(u4$t$w7t$Hh.$u1fUSWVPM(,|$8O] D$1h>.$uS sujsWVVuutqD$9_31t$L$ At$H 8n6H 4n6@0n6 ,n6h,n618n6F4n6F0n6F,n6F^Vt$|$uD$ h\$uoh8=$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP 0t,hT=$ MHtU4uL9rRQP t$|$t%u@uhVY tI+81tSul|$tDEM9rQWP2 u@u`V u@yu@u`V  teEptUt$8ЃtEu8uXV  t, ^_[]h<$h;$Ah<$h-:$5h<$h =$)u\u\hj=$udSh=$j~ wlh"$j fUSWVt$C 1tvt$D t[S輄 tCPN Vt$F tPUWG uWb S蹄 1S謄 WB ^_[]USWVu]Ph=$S t$f1j?1Nt}ǍD$ Phk$S td\$ t\hjD$PM& jS\$S] ShiW>  t$E L$Uf jQh=$P je^_[]PPhk$t$F u1$YVPt$ t$t$V tPhk$V u1$^USWVt$t$(D t Nj\$ P_ 9v))? )1N*Ƌl$W_ VPUZ )SjU*% ^_[]USWVt$t$C t?Nj\$ P^ 9s9Ƌl$W^ VPU )SjU$ ( w(?1N^_[]UPh&u t$=(1H]USWV@uPhq=$Vc ] h=$VB tP] |$ P\$$ShiV\@ |$ jSC\ Ph=$u D VE} ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP[ t!Ph=$SeD V| 1He^_[]h b%h=$hhz=$ WV|$$h=$WA t;P\ u1V\ jPV/ VhiWQ? t^_h=$h=$jVhz=$ h>$j Vdn6h3V V ln6hvV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh6>$hV>tVhl>$.>VFߋD$t$j7QPh6>$hV\>tVh>$=VF߁^UVuPhE$V t3$L$ AQhiV= u hE$1e^]h b%hE$hh@$UVuPhE$VA t3$L$ AQhiVe= u hE$蒾1e^]h b%hE$hh@$UWV}W#ƉPhǍ$W tZt4$P<tW@PVX tGPhXE$u OA t>VW1e^_]h b%hE$hh@$}hAE$hE$hE$ hE$hF$jY htE$t$> tPhXE$t$@ HhC5&hSE$hh@$WVPt$|$D$PVW tKD$tUh<$WC> tPh<$Vp@ H^_hC5&h`E$hh@$h`E$h =$j h=$j] SWV$h]A$S= t]PX GAsdWt^WPh]A$StNpxPhiS3; u?V1"1HĐ^_[hIF$h^F$hwF$j hA$j USWV 1CCj7Shxi Pu uhD$?,$PuhD$#Ɖl$D$Shxi W4 u hE$jP $L$9~D$~*1t j 9Sh"$9G;|$|j 8Vj0USWVHM'D$@M'D$ u WhA$j2 P%*D$L$AËD$L$AËD$L$AËD$L$AËD$ 3 31ËD$ 3 31ËD$ 3 31ËD$ 3 31ËD$H@ 3 31SV\$ Sh 3MuCЃ r"CrCr 01H^[h 3 H?r  ؈ 31ыL$t s61ÍAЃ r)Aw AwÉ71HUSWV1t$ D$hVPM 3xs6t8u^s6ǁs6s6s6s6s6s6s6s6s6s6s6s6s6@wh 3R&uhCD$0h 39&uhfD$ht 3 &u h~D$j謶 $5 3tvh3%61s6s6s63tt 3$h 3$U ƃV B~>CNs6F v/FwD$lD's6Au"h?$?$Wu4D$P1VhVVj V5< t69t$:*ƀs6l `C Lvms 33u$3s6s6rs6s6D$P1VhVVj V5<$ s69t$taYs6>s6Os6CatTl5$3+wtz39t 3 3$ÿ3؉$3_3 s6$u =s6uB=s6=s6=s6u|t =s6u =s6uftu^s6uS$ttH)ŋ$L$ T$ RQL$QWPU%u + u&h{z"h?$,5<h%j& t$PD$P & u h?$D$t,DtVPyDžuh{z"h?$JW WtS)uh{z"h;$Wuh{z"h-:$ 3t H9t@h{z"h?$$@ t%VWЃ$WjU#he@$h{z"h*h@$< USWVC) uhF$h?$j Ƹ 3jmP$b#$b#t=s6uLhj$V,  VhiWn( t!$uۋt$$4u=s6t ~ j 'hf3sWt& 3ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhB$h$VVUhB$&' jl$U$V Vhit$ t$,$t!PhB$&VhB$L,$jt$Vʲ Vh~it$ t$tPhB$&j %ꍄ$P$$ j:QPhB$h$P荶$t'$UhMC$&UE}uj:$$hB$h$P2$t'$Uh_C$%UzE}u- 34$tVWUmuj|$W$V| $$ DŽ$@Vhit$V@ u$ hlC$(%1@Pl$U%jWl$0U 1@D$81D$ 1EUhvi Vv j Ua< PhB$S$ Ve] H ^_[]VD$tL$b#t$jj QPRjVX V艰 H#uz$b#PVh)D$-у $b#tH#Qh=#PRhy#hD$t ^WVΉhjWF WhiV tD$Ĕ^_ÐSWV$h %V! u6hI$V! u$hH$Vq! uhJ$V_! tDt6 t6= t6!lj=t6hjS {Sh7iV t Đ^_[hH$j螤 Vt$VPh"$UtVdtPhI$2t$V襝t%L$ PQhh% V腝%uߋD$=rPh I$^USWV$WW1ɃtQÉ1 jVU苩 Uh8i(Sl D$ sjPkQƉD$$Uh8i(S/ :t$JPhXI$ hr%t$D$;D$t(hͥ$hr%t$ ej)j \$#|$hJ$1AxO'9xu H uh?&ot$(hjVF Vhi$ St$<\$8hJ$H$M'Qt8u 9A uVhJ$ Vh7I$,1#X4h$b#hh% j jmtz D$ ~[11ۋ!9uIuU蠙PhdI$bhzI$UhI$4j [D$ 1AC9|M rVļ^_[]POh1:$$hI$h;$hu"hKI$ hI$h'I$j Vjmut6hؚVV2^hI$jȠ hlf3jjHhJ$UVuU OPhJ$V\ t!#t6 $ t61e^]h b%hJ$hhI$KUSWV(ӉQtoh$J$U tt6H1 Rh8i(U u r8uIjh$J$S` t)D$t6t(^_[]h1:$Vh^J$j耟 hKJ$h.J$hKI$j蘟 SWVt$T$;h %V t\Ƌt6P6 V6 PWt+Ɖ߁PWt2 Ét611H^_[h˦%hpJ$hhI$hyJ$WV֋|$ QVWPhJ$j衞 WVPt$T$thI$V tkP56 V5 PWPt>ƉPV5t6蘙 ǣt6V1u t6$h#Z1H^_h˦%hJ$hhI$)WVPt$T$hH$Vl tbP5 VR5 PW訢tIƉPV5t6 ǣ t6Vu1u! t6$h#1H^_USWVt$T$1hJ$V thƋ-t6P4 V4 PWt6ƉPWot>VԿ ݉-t611H^_[]h˦%hJ$h2hI$h_V#fSWV|$ tI1H>t$|$\$j[= PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VG2 tE$$PwCt/$F ~G F1s f 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r 8"t$8t1H^_[];sC| C 9s} "WV t/t$ L$Ps(,tD$$F ^C F1_ USWVuD$ tV} ]CtP7 tEC tP7 u/D$ Ph&7F u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$VLt|$,$h%WD$k&tD$1{tj/t$TtAL$L$4yyyyy D$AAD$ PQt$ t$ $tsË|$D$4t'u#D$XPt$@D$4D$4D$ PD$8Pt$ t$ ÅuD$ xW1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WP7 t9t1ۉD$=rg"11HD$$P肺|$1OL$L$D$L$T$PQRhK$V 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PNjD$fVSP sD$ t P4$W, WT<4$uM S]s {te|$t^t$Vt$t_@PWJ, WtNVsE0 ߉Vu:M ۉt3EF ^C F1Vt$hDK$h%K$hDK$hE$ hDK$hF$j轕 WVt$tVMr 1H^_V^ t3t$L$|$ Pwt΋D$F ~G F1 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>.1-t P!K 1GG GGY1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUsrt>Vsbt)up c1H^_[]Ís s(CtP7 uCtP7 t1@뿋C$1$O'4v6? !6V P 3  v6 tMtk $t$ 4$UQ$t^hmR$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uhP$j5| 1Hx^_[]hQR$h>R$j{ WV0t$<|$jWhM$V萴t8W t7HfJBRhiV t!10^_hQ$hQ$WhQ$jg{ hM$j{ SWVLt6h 3VSTt6h 3W@VgW^\t6hV3dt6hWlt6hSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW2 Whi$ U $!hR$$HQPۍ\$4|$fGWhiU t$R$f|$*uR$=s6t PfD$(WhiU t$R$f|$*uR$=s6t Pc|$fG WhiU t2D$*=) PhR$+=s6t hS$fD$(IWhiU> t2D$*=) PhS$=s6t hS$1Shi8U |$DhS$1tPDL@uShi8U t$HuM1|TuD@uD$L|C\m3L$P9Dzty:t|$jQh\R$j uVh S$11t j,DLxPtT h\R$v<u h$j $PhiU tDh$S$r$t$h0S$T hRF#Ej [PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR PhJS$$=tPhTS$j $=tPh@S$^_[]PhR$jrv hlf3jhh]S${ÃD$1ɉJJ JJ fBRhiPm t1hM$jBv 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18hP$ju USWV,$@$PhiV tr$A jjj"z{ xgljj2 xi$-hSWC xB$/uE$0uf$Ciu.hN$p1H hSN$phmN$vpWmD 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'hN$hو%hN$hN$hP$hM$hO$QL$4QhN$(D$f($-D$](E!L$:!PS E P $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q tt6t tt6Eut6tIAtcAtCAtPA tSA@tBAyAAT$htt6UWt$PVt$D$VPRRhN$,l$ }"E!Ê<)\<$`Q'=s6`Cs|$[VPWl$PhO$hNO$<#<*<0<2=s6<$ O$<tO$sQh"$4#1L;$b#y3P$QRPhC,#G%9u<]K%C=Ph:O$h"$t=s6S<$CPhrO$RKPhwO$<K s k t?L$D$F~O$PWhh% NC%܋L$D$(Mu} L$D$D$FO$PtPtPuO$O$ O$"QPhh%s NC%D$ŋL$D$(ȉ</=s6%<C<$Q'WP$=s6CPhO$=s6CKSRQPh&O$hWO$C~@sFNuQPhkO$ IRQPhaO$yMuj>l$ L=s6?CPh/O$A(shIO$h"$&=s6<$CPhrO$KPhwO$Ck tAt$D$x~O$\PVhh% OC%܋D$t$)E}twt$D$pO$ttuO$O$ O$"QPhh%> NC%D$<t$)ƃl$ rPhO$j><$€5P$$Q'>P$rQ=PuJC<u;h?O$h"$=s6yCKQPhO$v ]=s6PȹDO$6<"<P$GP$ LP$bP$lP$tP$|P$P$P$P$P$P$P$h?O$h"$=s6<$CPhO$1D3 $b#t(P$T3 ׃l3 URWPQDU'hO$Muj>[l$ ^_[]ø wV'ø"øSwV'ø"VPt$ D$Ph7Q$V臆 tD$P^h b%h4Q$hhP$0VPt$ D$PhR$V: tD$P^h b%h@Q$hhP$WVt$(|$WhiV tgD$PhaQ$V҅ t7D$D$WhiV 1uhkQ$c1H^_h b%h\Q$hhP$[hLQ$jOh fUSWV8{ y h T$chj%M y h$T$dcjhTT$t\YdL$jQP+ D$tPh=V$ cjhTT$ D 31 VPh  VPUSWQRPh3`$1EVRQUh_BVWhj. 1H\$(C CCVWPPUPP P P PPPPS8VSj3 |$www wwVWj  VWj V5 S5 W5 D$ @ )T$VVQRWP41I9u 8tމ5t6 D 3tщ1@8^_[]hTV$Kaj !jj{ hV${ u8"V$jVt,V$jh$h9V$Vha"hg % j j USWV`~ZD$=t6tIt@ƍD$H@ L$1jQRRjP6ut$VhU$< 1t$HFFF FF1G>\$SVj} l$ UVWn FaƅZD 31OjUj  t:9uB$=h>U$jV/3  8uh D 39tttn1VSj VD$$Pj D 3vhT$@jjjm 1VSj VU6h U$1=D 3u$=|$ u'1VSjS VWjG `^_[]Ét҃t̓ u1Ht$8F FFV0 PhXU$u1GT$WVKtTT$D$8x xx8WPV0 a"{jhaT$h# g %SWa WhT$jf"VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP# $H $u˃^_[át6H t6t$Vt$VPh6T$ij!VqD 3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjҞ 裞XWV1N=t6tED$@ L$1҉RRQWjP舛t4$ hU$^_VQ1 jh4V'/ jV/ tPXt^VhU$>jNVhU$)j9PD$L$ $QPj XPD$L$ $QPjѝ 袝j6 XÐUSWV$$D$D$D$,1H$11D$hjV$WS.h f~/P w`1A$@V'5< D$u[FtR=5<D$,D$낃g<8#u(@j L$ QP \ $D$8L<Pj@$)<8#u)@j L$ QP[ D$D$8<L$QP7 j D$ P5<x[ D$D$8c1Fj D$ P5<A[ $D$85<hV$8_3<=t6u-t6~q5t61ۋtVPuJVh"$aFtPhDX$KFtPhXX$5j K-t6C 9|?,u)É\$(k <D$jPp D$PCp Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$0Ҿ1ɉQD$ P4 D4D$8u 諾8tz`Xt$7t6u t6-t6CPVBt Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UPP jdn |$tt$ VUWNp  UW, r8C|$$8D$@PW8tD$H\$|$tD$`1L$d3L$  u1ۋD$H1tW7t!t$ VUWo #|$$tS9u$UWH, RW. $D$utSPW- uWhW$hV1ļ^_[]Ë \m3DQu0S{PVt$ hŸ"jr> USWV\$ l$|$t$1E1@ <_3h'"WV.F ou%jShP['5<<tEPV<ǃuA_3)ރu4t$$V4Nut$(t;^_[]hd"j= Ph"hlf3Q j׮fWVt$|$ VW蓙 t$?/tWhY"Vhr"^_WhD"j= fWVt$ |$7 WVUSWV $$l$WVSU$ $ hU3WhY%BQ uWVh*"j = D$@tY$$QPh^'hVTV$$$$$h.]$j襭USWVMu1} ]hD$ PV2 D$ FxD$D$D$D$D$h]$WSC L~)Hw;$0]'5<Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5<L$1@D$kjuhl]'5<9P9=N|45<1@D$5<Fp1@D$5<L$ 1@D$_3H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W5Wo@$N|dže^_[]hd"j9 t$h$Phj]$hlf3C jɪWVPt$jWV5 9u9t x^_Vt$h"j]9 Vt$VoDt@^h#V^Vt$VkIt@^h%V|^WVPt$jWV]5 9t9u x^_Vh"j8 WVt$|$ VWǔ t$?/tWhY"Vhr"^_WhD"j8 fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh$sL uIƙ8KD$  =v6%D$ Vt$S jHSt$D$@D$ $p QPhb'hVOD$tS\$O$oj j ShWt$ P}tP轍Ph^$t$ SWh^$Jt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h^$ 81p^_[]WVh*"j7 jSWV\$D$@u+t$P<t;SP t7VY1 u6Cu6C^_[h8`&j6 j諧USWVPL$$T$ l$\$1$1 3֍zh]$US%> @~7M$_'OӃ23= v6v6먀'룋 <DF@N@늋 <IF(NnOe <R3KF ? 30O' <aF8N v6O <g\PfD$ p4t$ N @OPt$(h_'5<X3Ƌ$t v6t'tOt@tO t= v6v6 s=v6 v6g@tOy  3sg st1A T$ J sh#V1v6$fyhn%V1L$ A$I$sh]$V0L$ A I$sh]$V0L$ A$I$sh^$V0L$ Aj$PPhPhov6r<v6a1@D$(S<1 !%PPhPj%v6(<1Zk$PPjcPPh3=<h%Wih#Wi v6v6=v6v6=v6=<yW @<17k$PPhPj?w6B<10d$PPhPjp31Ghlf3Wj>hc$yC=v6<$=<hr!%Whuv6G=<1$#PPjPPd31@D$$<1"PPjPPjv6m<1i$PPhPh<v6P9<1Md$PPhPjw6 =<=v6j:WlAAj/WYA.?yv6<Ff$l$0UU݋\$UW|$Pv  w6w6s\m3DH,WD$h$W*ghJ&Wgv6W v6N1j$PPhPj l3,v6 \m3DHWD$<$v6hd$_3=d3_=v6tVhe$z5<hd$j5<h d$Zhd$Phd"j Whd$9Whl$.D$ =v6u1=v6@v6$1󫍄$Bv6Al$$+D$ -v6t1$ 1D$$$MljL$$ PWM?t$h|e$v6l$Ul$RQP_ $׉ȉ w6= w61| h2f$$t/$$T$9‰sQt$t$WPhWf$tFtA v6WPU0^ u5 w65w6t$hf$|$(F=$PUܒ uRt$hf$  A#$=`hw6he$1=v6 $VhLu Vhf$al$VjD$Pk w6-v6- w6݃=v6~VUWt$hf$談|>9|Pt$t$ )̓ }4$=0\$l$ v6v6ɋ|$  v6=v6 w65w6σ|,@σ|1ҿ9  v69|щ v6|$ D=v6Ejjhw60 .hw6he$v6=v6tv6v6t&hQh:g$e v6v6t=|hPh{g$< =v6u1=v61@v6=w6u v6w6=h3,=v6t#jhg$hg$hg$ٕv6=v6u=d3v6v6t$t$ t$4Ut$$Vt$t 9t V t U =v69$PtEtƃhsc$IDj |Phh$jd$ Pi j: j0 j& hW% {6$v6w6ApQtv6@jxQP$Phsc$ gk0q{Vhh$jd$ P̂$\ $|$8j`U$P/ $PSv]u/jZ$P$dP\ u$<mfsjWV' 9uD$8%PCFP$Phh$h,g$|$D$D$4jPc $u/hw6he$$PhZ$jXF hs#j : /dev3w6 w6/ D$ w6tD$ w6<$~~l$4 $jWh"[ u ƃrl$Wl$$U(\MGWU\:l$ ʼn\$4Ë$H$|$v6\$L$ u Dv6$dT$dž,<tx(=v6dž dž,dž(Ɔ l3p3u(jh m$|=v6-5{6u"jh3m$`|=v6,5{6 v6N0v6F4Qt$Qhfm$'|=v6w,5{6F4Ht$Phm${=v6S,5{6F4 v69}"QPhm${ =v6+,5{6F0=)hPhm${ =v6+5{6F0=|)hPhn$m{ =v6+5{6F0N49}QPh?n$A{ =v6+v6{6;v6|QUUUU)ʹ3333!!сis{09\~\{0\\5v6sXș9}%CX=v6~Qhzn$z{6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hn$y=v6**{6{4$=v611F9tA uPhp$jW $Kd= w65w6 u։<8=d3[ WVhn$x =v6){6<$C4$8=v6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPVNNjs8ƒPVRW|)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVho$v=v6'w6tm {6yxH1҉$q1ҋ8$$)$<$$1C$I8$ w6={6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W1L1C1 t׉Ë$$QPV$$V-9s($$$VKÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQ$9wȃr$9‹$֋$r‰$$$$$B1WRQPHË$Ë$ʃQPRS5w)ÍC4$$W$$P$Q@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQGj$P$$@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh2o$p =v6 {6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d3$_|HL!ʉG41SSjhjPSq,{6N {6I4QSPQ {6H 0{6 ,{6 4{6P44Q58{6щ <{6`@#HL 9| Hh h3H< v6HX v6H\ v6PTXH fǀ$$%={6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d35O _(HLJ$v6$$$t!LJ^F=v6$$߬$$ڌ$p&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$Po$j {6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$o$Jj={6O0 9| IУ@{6D{6=v6u\Tu))УD{61VVjhjPV4H{6u@{69D{6D{65D{6jPM =v6G w6 w61ظ|(RQho$zi =v6 w6 w65H{65v6~ ș)dہ|4hg'GuȹC=v6tL1$PP$$5v6V1=v6VhZN v61u;1$VhjVu  =H{65{6h`VWR# =v6tWV5{6x\H{6hhPK 1@$=v6hq$ޛ=v6|o5{6N,I\Tt~!NȃN׊Nd1 t1WPh`2$RR f$"f39u1H$Whht@P=1 PPftu!ѡv6t $ Q$=v6u$|&{6H,$$DŽ$%$ {6I,$1$ DŽ$1hf3 {6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hiq$J=v6Y {6j5 {6I 5 {6FU $F +$^{6$~J`^p=d3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=v6uFh$ NlK`ڍOȃ$ډFd;v&hKq$臗=v6{65 {6F $11ہ~U uv`щSA{6$~!ـ1@ {6Il {65 {6F=d3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5 {6N uҋ{6B8H!tk)D4{6B8)Nj5 {6$9sE)ȉـ1B~U uv`5 {6F$CHu͋{6B8$؋N9ȉ$J`~U uv`щS{6$~!ـ1@ {6Il {65 {6F=d3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45 {6;Vs2р1@~U uv`5 {6F$Bɋ{6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$4{6H 4{6V$P V PV~x; 8{6up=v6t<{6s4PP {60{6@0{6Kd15<{6s4<{64{6 {6q4jPA {65 {6{0 9 H{6PVQ =v6tH{65{6P5 {6g {6y0H{6$ryxtG$\0%TuCl$AP$ {6Ou$ց\TtQ!QЃyId t15H{65@{63 5{6\TG~8^xN`1?9'D{6+$~0lj$Ɖ$)ى$=H{6$%GlH{6D{69wߋ$9w${6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=v6} $H$$$~A=v62$=|j.Y扄$$b#tr% {6ׁ\TtQ!QЃYId t1RP$Vho$EZ$$;$$|W=v69{6H,t =v6 $$ DŽ$j XDŽ$C{6;X,/$~ j X=v6 $hjPu= d3 v6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$AT$h $ld3fDŽ$3tt3$_ lj$DŽ${6H4$ $ H5{6D@VL!! $`Nd8SsfAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t3@ lj$DŽ$ {6H4$ $l$h  5{6D@~L!! $߉$Nd t1$Sv4$j2{6@0p9w Au1H$$DŽ$1$$t7Rǡv6{6@05v6V$SQP$h$l v6ɉ$$$t RP&$CPKT$l$hߍ$󥃼$$tA$ȃ=v6CX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$ $pthj$P8 {6\T$$i$$ $$$$DŽ$H0$$_$ {6@$D$@L!! $`O$h+$l$  {6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h {6@$D$ @L!! $$N$ $$h$l{6Hd t1$S6j$$V {6$ȔȐG$11F$t =v6$$={640=d30w4w+_1H{6$`SWP  $PjS5 =v6t$W\=v6tH{6ǀ\8 {6=H{6x\hhP:5 v6QP'WV=v6t,{6 {6q4PP׸ 5{6HLNd t15,{6v4t5<{6954{6vG=v6t{6p4VVx 5<{60{6@0{6={6Od1Vw45D{65H{6N{6@4P5,{65e^_[]ÿWjV4 1=v6VW\h2#PBhq$j&Gj%Gj( G{6j FjFj'FjFho$Lho$BjFjFjFjFjFjFjFjFjFjFj FUSWV=v6ua΋\$=v6tv6{6St$P 4׋ v6UPSt$$5({6\ 9u^_[]60PWVhp$Nj$EUSWV"=v6΅ L{6u{6H4H @{6 L{6 =v6;w6 w6{6;}FWh xg'1I!;HtG#P;Pt;H uV9R_1ڍ_5H{6P=v6Wh De^_[]USWV΋L$l$=v6t=v6teUjQS1p׋ v6SPUt$$5${6Ԧ 9t?40PWVhp$Mj"7Dv6{6UPQ ^_[]SI`wD$$4g'1C:Qhp$hlf3VO .  [SWV1ۃ=v6։ SjQL0 =d3@fF F)f ^_[USWV Ӊϋ5{6F Nd t15 {6G=v6t {65{6PP跳 {6yU +y/\$|$y1U ={61=U L$D$uq`|$ G`Ӊ $u щw*l$$Dg'р4l$skPh4p$hlf3M ={6 {6D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ahr$ hq$hq$\~11҉ ^_[]ÉՁ|$U u L$I` L$w$Tg'ʉـ1@BPhQp$hlf3L 8ʍ 6ʍ   1$5{6$~3%)1@ {6Il 5{6 {6K=,{6Od$sC=d3CNdЋT$ t1҉t$VQPR{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRtML$|$ щT$ՉD$ȋL$D$VW|$RP*Mыt$ʋL$Vt$QRP$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45{6;F8|$}X1Bσ) {6yU uI`1@5{6;F8|$|=v6t {6VPP 5{6F Nd t15 {6USWV$΋={6G Od t15 {6=v6t {65{6PP胮 {6xU t)hr$bz=v6( {6xU ‹l$(H $t@\$=v6t {65{6PP ={6G Od t15 {6w{6,{6HC, $9r%UQhop$E =v6V{6 $\D$jT$RPQ%D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5H{6W{6\TudH{6jpxt$0t$ <$<=v6WV1L(ɉL(@ u1LXɉLX@ul$H{6jpxt$0t$ $,;=v6trUV胪1tttp踻TtDpC u1蒻Cu) i% $D l$hVUs ki% $D9Pl${6T$5H{6p0^_[]jS:j L:WV։σ=d3ȃ@PQR =v6t'ȉGffF=d3u GffF^_fUSWV$8tW1 ƅuWhu"j $$<$4D$Phd@U` tj1OLVhedAUA  F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(h ,%t$qD 1 Sh"U CPh8"Uc C Ph"UQ CPh"U? CPh"U- CK,C,Qh/"U C0PhD"U $@D$t P~ 1-Uhzd@$<W  t1 VhedAW  hjU$ D$ P$4裣D$, 9L$L$9u0$S11:.(8tx$0h"b$11҉ $ƅ*ŰP@j PU ^_[]$0h"j USWV81ۍD$4ShPSuL1NtAljSPSWuW uMU D$t$$$Q1e^_[]fWVt$|$ VWS! t$?/tWhY"|OVhr"nO^_WhD"jK fUSWV|$$\$(SWt$(t$()jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP菶E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVN" 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^j$VVhVhT{6S<V|<"VVjVV[\{6s<vE<X{680<Md$VVhVjl{6p<7k$VVhVjh{6G<Zk$VVjcVV3"<$#VVjVV31@D$`{6=\{6\{61@D$<i$VVhVh!d{6Pم<1H$Ff$t$VV11KSU$Pt{6p{6 $+Ph$Vj2$u Vhf$ d{6t{6%p{6ʼn߃=\{6~VWUt$hf$4|>9|Pt$t$軇 )σ}4$Y T{6-P{6uU-T{6uY5t{6=p{6d{6@19lj| 19ǃ| T{6u P{6͋5t{6=p{6d{6ˉjURP =l{6l$ h{6uA@19lj$ $t$u hx{6hf$jPVW v|$wext23$2fs3$ Wh="hx{6h.h'Vhx{6he$} 19ǃ} h,g$ l{6t$VUt$  UR t 9t V@ j)USWVӉ $U|$j W\$ S> Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ x8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h" t$t$h"j7 WVplf3Phr$V3 1GVWjh"+VhXh'=W$(USWVu} D$8jPC=x65|65T{6%UUUU)3333!!щ%iP{6Bd{69933T$u tv|$΍Q6656 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r=t{6p{6\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1l{6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣl{65663t$ƺQ=6D$6D$ 66D$661 656D$8666S666N56666[6(f6? f66 3f6\$H$SW 93rWh6| 5X{6|$t"VYjVh6 166L6H66D$6 6+ 6 1҃r1I156~σRVPW&56H19w+56|$OL$)9r΅u 6f5N65T{656VG6YVjP GD$AD$ 11L$\$66tn6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@6t N6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ 6|$11t$66=\{6~i T{6 i{5P{6Q5t{65p{6PRuht$* 6 T{656PQWht$)6@661QQjhjPQ6I 56jP  =`{6ukt{6 p{61! V5d{6 1N1Ƀ *&Fu  1@D$$=\{6|>hx$]=\{6|(L$ 6 61PQh`2$PP'D$$"f39u1H|$LWhht@P PPftu!ыt$\{6tL$QT$=`{6uL$L$D$ 1D$L$ 11T$hf3=6t$tX6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f56616 56D$ hh6P 566P56Vt$ =6=6 615d{6ǡ6)؉1t$ P =6Wjh6  6H9|$u_656 6)ʍZ9s1Gр6B9r)6VhP  t$ 1Ƀr!11ƃ6Cω 9rωp 9ǿs"ˀ6CI 9rޡ6L$  61Ҹ6Pt$ 56Vj6P  6 6L$)QhP  u16@ u桰6L$ D 61Ҿ6Vt$# 56jV  =6tb1=6t 13{K 6F;56r⡰6L$ D 61h656 G;=6r=\{6t$|\tX=6te6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=`{6|$T$T$|ʉj.#t$몸$b#|$|$tr% 6 6jQt$,Pho$($T$;D$_=\{6* 6t=`{6u&D$ D$D$j "1h2##~ j "=`{6d=616$hjVe fF쀁fFD$8FFFa fF56 ׉؉t$ ֍$fBt 6$,F܉VDF81 L$ F4D$4z 61CL$ =6W D$(\WD$S56tPjt$0X N6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ 6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP2 L$ D$1t$V 61CL$ \$N6 6=6t$,9sD$()QjP t$L$ D$41ҋt$(VW'V$Yj=6t6t 333@1=6à r t$hhjV fFAfF6ÉFD$8FFF 6fFfFV 6AFmlj\$r*D$p1ۋ 61zC9uߊ 61h65656f53|$D$1ۉt$ 3x1ɉt$)r򍀽6RQP Wh36V! 36D$ f6 61Vt$ \9\$t563D$ CiL$T 1VhVD$pP 956t6t333fD$TAfD$V3ƉD$XD$8D$\D$`D$dI fD$lfD$n 61@D$pAD$| 61h656iL$Tj f61ۃ=6 56<hh6W 566P56V 56 615d{6ơ6)؉1WP56562e^_[]h v$hv$ _u$hXu$Pho$Ph v$hv$Vhr$Rhr$PRhs$hVh5s$hVh_s$RVhs$Whs$VPhw$hw$vjVWt$ht$gh.t$`h^t$Yhq$RhFt$KRQht$B/u$1u$'h v$hv$"h v$h=v$h v$hmv$ h v$hu$j USWV6=6tr6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ6t N6 6Ѓ^_[]SWV=`{6u0׉΋ d{6\$QPSt$ 5|6t 9u^_[WVhw$hw$j^ USWV=`{6΁ 7u=61 6 7d{611;p{6-t{6ǡT{669v@1Shj'8!;HtH#P;Pt1A xVWh 7h$ h$Ƀhlf3輻81B X8ć8@88Ї88ԇ88؇88 8 uCء8h88d8 8 `88 88 ؉+88D$HT$Ll$H8+8D$8D$85&v?|$ D$ fD$l$\$4l$ D$4Ӊ 88&wh؅7 88 8888ʚ; 886eĉ811ۋ88D$T$ ؋88D$8D$8D$58L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05&&t$v 8858=8|$(t$(|$D$ fD$ l$ \$,l$|$,=8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă58 8=8ȅ7t 1Aȅ7y747 079}(8i-@=B'7@9u8e^_[]hb$hz$jЄ USWVh8j 7&\$Du{'-88D$hD$h5&\$Dݜ$݄$h8j6 u{(-88D$dD$d5&݄$\$D8;̅7D$D8 8 t]+ 88$$߬$8+8D$\D$\5&&s=ć8uZȅ7tQ8 8 t5+ 88L$xD$|l$x8+8D$XD$X5&wD$DD$Dȇ8؅7 &w١8 8 t>+ Ї8ԇ8$$߬$8+؇8D$`D$`5&D$Dw\$87$fDŽ$jht8jO D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$PHP SD$lD$lPD$,Pj5875<757O <h8j <7D$8<BC97)؉D$D$8 T$k'\$A9@8I؉L$A 8Iff9uć88088,88(888 <8u8@88<8888܇8ȅ7 1D$18 8l1A h}{${hlf3Aȅ7<1A t$, PVh{$ ΍T$(jt$>Ph$D$ ȅ7t$؉T$΍T$(jt$F$Pl'h~$΍T$(jt$Jh$΍T$(jt$bF$@l'h$΍T$(jt$$Fft$NfQPho$z ΍T$(jt$؉t$h$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h$G΍T$(jt$9FPh $΍T$(jt$ ؉t$h/$΍T$(jt$؉t$h9$΍T$(jt$d؉t$hI$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$h]$)΍T$(jt$-؉t$hr$hр$Ph$sL$lL$AQ D$iPhC$<h$ h$h!$Nhl8hZ$t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ|$L$dT$C;8u#Ph8QD$XXL$$ D$L8PQh8A T$Ҹ|$u1G|$T$PL$r |$ rIf3H f3~f3H f3 hf3j (  }T$A{^N2D$ˀ) h|$MuPt$, L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh|$h|$9 |$ sSf3H f3~f3H f3 hf3j   }KF߉Ήs(T$h|$+L$T$؅t%f3H f3~f3H f3 1I hf3j hf3Mء܇8;̅7*؅tءȅ7!^L$AQ T$Q=,8 (8 t+)|$L$p|$tl$p08)ЉD$PD$P5&H8H8P8P83v3ȇ8vȇ8\$CfK%X8f!tX8 ܇8T$ .KfKfX8D$ p8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$Jp8@)t2(uK \8ȅ7t1 \8h{$ \8 ȅ7 PVh|$ Ph$h8~$hU~$hv~$AfPh~$h~$h~$h~$h~$h$h-$hD$hT$he$wh~$mh$c \8h{$1BD$D$pf3@)f~\ȅ7tSωL$!ȹT$V!RPt$ hA|$xT$ D$,ȅ7t1RT$D$fxf53ȅ7ruTt$, L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B07C9D$=ȅ7 ؉T$547|$77)RQP4R GD$9L$~D$8:7uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E547)7t$>RQPhv|$47;07}0u h$Php$Cы\$1B\$D$\$D$T$jh{$js 1Ah9v"WV 88~b88 f3Qf3; ,f3hf3j.K8 f3Qf3.H 8by`)88 f3Qf3; ,f3hf3j8 f3Qf3H 8|tN=8t4f3H f3~f3H f3 hf3j }88hf3该hlf3袥8888888^_jj1A1=܇8PUSWV׉E\$1AMȅ7]E uWVh|$t h}${Sh}$mȅ7t5@D$ &\$D$$}$1ȅ7fyuhlf3jte^_[]UVh1AtD$ 7$}$8D$$9}$܇8D$$R}$X8tD$$h}$8t9+ ܇8} $y}$!L$LD$L l&D$Ht$H\$$}$X$ l ܇8ȅ7 X8L$DD$D=H8@|-P8& 3 ȇ8\$,D$(\$ D$\$D$\$D$$}$ȅ7,8 (8 t5+ 88<8L$XD$\l$X08+@8D$@D$@5&ԇ8 Ї8 t7+ `8d8L$PD$Tl$P؇8+h8D$L> QPh$lȅ7tkD>L> QPhˁ$F|>uGD>ȅ7ufPh$D"L> ffPQh$  ^_[WVɅ7u8jjV t'86 PWh$hhl8y"6} Ph"$hhl8U^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h*$N$t$t$ t$SPh$- UPh5$ t$t$t$ hA$t$ PhS$t$ Ph_I$r0G9s'GPh #| KG9r߃$^_[]fUSWVƀ8-uFh##Vu 8h##V׽1u 8T$,11CD$D$hh$Rt$0q Hw؉$l'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 _31;L$(uj{1L$ 1ɉT$Љ $PL$Au $AP{D$t2ڋL$ PWpE WǺf uމ$D`uY|$ujL Džuz PyP$t8=8uIj Vh##肥 Whq$T1FV6Ph"$V[h SUT9 h##=8Mj Vh##, Wh~$V% \$$b#z"$VWS˦ jjVWS车\$u4 1GWWWjWjWjWVWj wVWm6 u h$jg jjP6 u$8j& u"4 j& j j6 t)qtOQ& j j5 uׄ$8t1Aj jh## ukWh$jh$t$U7 $Q&bN0WWu5 $t$b#VIPShh%Wmf SWh$jkAVj&=8u$b#~VPh4$hlf3jSfD$tPh$MEhn'Ph $hlf3jUSWVPu } hn'WVm cR~5StET đ8͍Hw4$l'8벃L88둃ftTdL 8t8eȑ8V8G̑888) _3jБ8=ȑ8tjjh#V%d3 ԑ8ND$ jjj"j ԑ8jL$$Qh@hP u h1%_ԑ8i )ލ<S H $l'=8t1Aj D$<1CPS)D$D$ PSD$D$$PSD$D$(PSD$ D$,PSD$D$0PSD$D$4PSD$8|$ |$z |$o |$ d |$Y |$N F 8D$8gtj5ԑ83 rD$ D$$b#D$D$$b#_;-ؑ8S)t.H$1ۃ=8uWh$hn$hψ% >hk&Sg =8uhY$hA$hψ% 1C8FLCSS H3 VT$W$m' \$@1ɍP$m'81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 128#8L$L$# 1AD$ PD$@PD$ D$<+ܑ8R D$ Pj$838383 88׋t$#D$ Pj8d$zT$ ED$ L$TL$@JL$C8"3-L$#d$d$d$L$׋t$8:(8@.08"8 8 88\$ H888 t 8t 81SSP L$Y\=8j$)/jD$D$ D$$b#D$$b#ؑ8L$9a|$u qܑ8 8ta|$  ‰4 D$=8T$tD$1@D$ 蜿1ۉD$0茿hxShP8躻 atgcuL$S8 X8R88@8d8ؑ8\8x88 H8 p8tJt$(~A|t1ؑ8t|$ ObTؑ8Ȓ8tPt$ tH@WVhȒ8a Ȓ8=̑8t=8uu$ؑ8tMD$tH@Vt$ WHa =̑8t=8uL$$ؑ8tDD$(tIAVPW` =̑8t=8uL$(${ؑ8tDD$,tIAVPW` =̑8t=8uL$,$.ؑ8tDD$4tIAVPW_` =̑8t=8uL$4$ؑ8 tDD$0tIAVPW` =̑8t=8uL$0$P8)f=P8=̑8tP=8uG=ؑ8t4f3H f3~f3H f3 hf3j P81=8IWhP85ԑ8' u+G87t=t)7|$t+u-$/9|$Ph>$!$|$*$ PPh $w߻83u=8t"ǻ1ۃ8=81ۀ?D$$hӈ$ hu"h$jU USWV0=̑8AuF8,r!4n'h"Phq$aPh$Ph$nF<5$$n'vvvhϊ$AF|$(QPho'RWkf3PWPCh$F(Ro'QPSPWDkf3PWCh$F QPSPWkf3PWBV xdvvh$ V!p'tPo'~ p'tF\$(RPQhSjhf3SvBV e^_[]FPhމ$FfhNJ$F h$b#Ph$ F|$(QPh0p'hWjhf3WAVƘFPhމ$FHfw6$n'h$ch$aPh$NPh$;6h$'h$ h$hT"h$1H9vh&$ -NT$(PQR FHfrCfD$(L$)T$*t$+|$,\$-SWVRQPh)$D$(D$$D$)D$ D$*D$D$+D$D$,D$D$-D$D$.D$ D$/D$D$0D$\$1|$2T$3L$4D$5PQRWSt$t$ t$(t$0t$8t$@t$Ht$Pt$XhL$PSVh$hf3z^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV+D$  PY1PPWSjV貀|$dt$ \$h$e D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy93tE3P{y$L$t ha$h$QQh%PPhK$褿 C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP$#PPh$ f3H f3~f3H f3 hf3j T$h9t$g h$ L^_[]hӈ$ jh3$jD D$t'T$tt ha$h$QQh%PPhK$( ËD$t%u$%tup$Ph$g$z$Ph#ڽUSWV|$<\$8D$4t$0~u/jU_ u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhWn"8Ph"$(PWh# ^_[]USWV|$4t$0=8uM8hh8It 8'j.h8ot@hPh8P t"^tCt0Wv`rhhU%h8JP ^_[]1w)ȉPjQ) SVU1AFL$ tWWVWhr'C u;D$ D$ PEWWVD$Phr' tt$yUĨ ^_[]hr%t$  tԉ1|$l$Vh$PVSIHt$t$Wh|dD$P,v \$tN1D$;D$ 2i9t$sVt$HOt!ʼnD$t$Wh|dt$u ul$$WhedAPu f$a$>ukSt$h"h%h$WƄ$t85$ ď$t{$QPW, $Kà9Éu|$$P 1hr%j Å~A1ۉh"PQujVh"hh%h$W=Ƅ$|$t8\$ ď$t袐$QPWS C;\$ mUS|$l$|$$PUSWV  uj/D$$D$<$sh$VethZ%VS3hU/ Ƅ$hZ%sut s hZ%V膥tt s h$Vft P9 8D$ h$V=tHá8th#P萂(j,S \tZ SX4,PD$PU xD$!=`ÉUh"$* S4Dž?tG<$tSWUh $hN%h$VV tEUh$rZh$`?Uh-$h&%h$P蛦158t t蕌VPh8$I 1@Vh$'1^fUSWV1WWj> ~siP_>VD$Pj u> Ë} 9tVSh$ tNt$ t.u[D$.m"D$$<$ch$ D$8m"D$$C$:D$@Bm"D$$J$t$ }2D$%$D$$$b#}D$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$Sr\$ = 8uD$y$D$ P$Pȟ P8\$t$Ph$ 8PU uUh"$1@$~#Qh$y1@$\$$$Ĕ ^_[]$Ph"$j,! 7PhƓ$hlf3臝 j USWV L$$8$T$t-(8*jh$8 (8š$8$T$1i E$48t!u6$t$PsT$ uF$t$PsT$ tEM<ǃ he$1 ^_[]ËD$ t 0$8$4$݋D$ t 0$8$$ؾ,8Phh,8 uh,8h"$j fVD$t.})zhjQ9h$5\8 DI9T讴r%&%s'PQhh%5\8ߛ}#u5\8hO<$^DI9^ËD$ H^WVθ&%s'PVrt)uVh$5\8o DI9SGt8tPwh%$x wh0$fuj whjQ9], GQ9Q9^_WVD$ t;5Q9D$=8 l8u 8s';pt8@uVh $j @u=R9thR9Ph%$À Ph0$賀u5Q9=8^_Ã|$t 8$DI9Ã|$t &%DI9Ã|$t ?$rDI9Ã|$uhQ9hE$5\8 菲DI9Ã|$uhQ9hf$5\8躙 ^DI9Ã|$uhQ9h$5\8艙 -DI9SWV$$DŽ$HH$pƋ$ ƒtS!=0I9Д$t˔$Ɣ$atσ=ǰDI9^_[USWVx֋$$t{tp11@=\m3D_t1z\t r9΅t<΄t45\m3AҀ|Vy5Tm3TVP5\m3@u΋$ $t`1HhZI9trʄt<$1ۊHI9t8tCu 9sYI9B+$=FFu4$D$|$ 1 jI9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ jM9<$؉D$jM9$to\[$uvz$\$-\m3BDEJ<0HB,t ]tVрy$t[\m3BDC$G)=~"B $tG)=BJB5A\m3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5\8h$F<$?uhVW$ x^_[]USWV0$Du%$H$DhՔ$PQ y1E-XZ9h(jUh08D t$H4$=8I1VV$P8 Í|$0;=8=XZ9$H5@I95Tq#t58RPhǖ$Q8#5\8jj6h$u481DI9^_h$h8t$t$ DI9h$h8t$t$DI9WVD$ tZ}UuZt$~hn"W?tOhRF#W?tBWpy7vh$5\8? 1H_1=l81@1l8 h81ҾRF#tn" щ h8PVh)$5\81=l8DI9^_ËD$uD$L$hC$PQK tvD$ph$gu<=DI9u0=8t5\8hT$ D$ph~$tgu+$R9PV9PZ9ǙDI9VD$ L$DI9t u]H 8HQtsP~ t8=PR9\8t5hPR9h$P裀 DI9(^<Vh$cPjj$h$1V&^ËD$tIDuD$L$h$PQ t$D$ph՗$Ufu$R9蹘DI9SWVD$-uD$L$h5$PQ  1G=XZ9h(j\Wh08ؖ t D$1VVt$ ǀ?tx=XZ9tyD$thWh՗$eu $R9=XZ9uB=X8t9=88D$btXZ9=8 XZ9VVt$A DžaSjwXZ9mDI9^_[ËD$uD$L$hݗ$PQ< tmD$_D$L$h$PQ tI|$BD$ph${du8D$ph$bdu$R9ÃtDI9USWVt$ |$.E1ۈ$5\8jj,h$,.% u v1.=DI9^_[]DI9USWV D$ #D$$L$ h5$PQ L$ ȃ#D$$L$ h$PQ D$ L$$|<$Dh$#t$Rt3$8|t+4$$H$B$ 3D$$hX$0RD$1E-XZ9h(j'Uh08裒 t D$$\t$=XZ91D$ H9=8"t2#7$9t$t$T$$VVP4t$QXZ9u?=X8t688D$$" XZ9tA XZ98E_t$jFXZ9$9t4$ *DI9 ^_[]SWV$tKjj3tK~S 9uWjȯ1uho$贒1HDI9^_[þV Fujj{h# g %tj/VA t@hQW =l8t85\8V" \8HQP~ Q Pj ||j5I9h'A#WVz  jWVz Vh\$DI9jmSWVPD$D$t&D$t$h$PV蓽 rDI9^_[ËD$ph$^u|$h$ tD$x|$Wh$^WMPjWY uP|$h$: t D$x |$WhĘ$I^W588uh$8YD$ ph$"Y58^VD$t$588u h$X%aDI9D$ ph$X58^Ã|$u|$t&DI9Ã=8t 1PP)j=8t 1PP jf|$u|$t͊DI9Ã=8th"$3X'V1VVcVufVPD$ D$t}uD$p*lDI9fh$h8I9t$t$DI9h$h8t$t$DI9WVt$ t3}.u:hc$Wt+hY%Wt hj$Wu: 1Cv}tu&6hr$5\8Hb z1HDI9^_[t8u88P58h$5\8b1VD$ L$DI9ʃuCuD,"3tK4"3V$b#tQPj h$5\8au^Czjpp DI9^WV|$ W߉tQƋ|$@tPFWTF=8t3|$t,P6h؝$5\8aWh$5\8a ^_WV|$D$ DI9uIwOtAƋ@tP F6h$5\8` DI9^_Cywh$5\8` ^_V|$t.=,R9t6588h-$F58(xDI95\8jj,h$^VD$HrxDI9`=4R9t$588u(h_$F-5\8jj,h2$=D$ phd$E58^VD$u5=,R9t=T$ 588Ju:Qh$E;xDI905\8jj,hl$rQh$RE 58^ÐUSWV@$(@u$,@tw~!$,@$(@h$PQ tӋ=8~+$,@X1\Z9j US4 t F9u19u2$,@ph($5\8s^ DI9@^_[]ÍD$h@h8P hZ9D$@1ɽ $L$99` \m3OGGDA@u8ȃ$t \u_GGY \m3WDQuViuAG;$(@}/$,@9)Q4V $,@421@$F?tG|1ۍҍBWGDQu苄$(@9|ˋ$,@9)QtV} $,@tZ28L80xtƃu5\8h0$'5\8hE$~ t;=8u25\8hq$f DI9D$@9G=8t<5\8h8+ \8HQP~ Q Pj _j 6\$S L8L8059V =9t'~t!\8HQP;H~EQh@D$Ph8. 9$(@L8$,@PjO_븃<$JE1A;$(@t4fUSWV1$D$jh8r t%=8t 1PP1<$~KD$@$Ahjh j ِ<$t(=8t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4d t8=d8u d8D$ Y$-8t+h$#U1t}|tU8<$~D$@$D$<$d-SWV։jhP$Q jhX$W tlh\$WStjh`$W uYt F t8t4h$Նt8tjh`$W t ^_[(11VPP ^_[)WShg$j USWV$\$@t$<|$j hh$W |$D$ 1D$D$SiƉ$Pz.D0h$P(t$Dh$$t$, $t|$@t$t$@ЃD$;8t|$tt$QD$L$d).$`.$Y.$tM.|$Htt$H D$H|$Ptt$PD$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=8t;P-D$HL$H+8tD$Ej/t$L" t@Pt$Dh$t$HD$t$ѡ8L$D|$D$81I9I9I9I9$$98t1$Pt$荳u$\$` I9I9|$py$I9$h3"#t$L趸D$|$t$e$QP^u5$8$<$$$\$` I9I9I9 I9t+t$j5I95I9PY=8tPt$Hh=$5\8]R I9I9 tQPhH$5\87R5\8h"# 1O$=8K8 1O$*|$pu D$TQhܡ$a_8ht$hW =DR9|$Lu:|$LD$puuh$t$Hh$*uh$S~D$L$I9^$|$LD$L8|$dD$t$h $~8P$$W&$<h%VW1A$<$ǀ?tvj:W t=@j $QPW ~޻t?$9u3;$u*W%9$<r$)PWR t/h%VVDžm1Ft$Hh"$1$t PA$$u |$p$$I9 I9t$Lt Vhh$t$d脯t|$dj%Wt Wh$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1hW%W%tVh&$\$(2W&DŽ$t$Dۜ$F|$d'1D$(L$d$,|$h$$$|$pt$\$BBB BBBB H8JBB D$(PRW$8z( t ]%30:RtD$(Z$$PN-j j WhSvvt t%h"PS j "PW =8t+D$(xt!~X$tl$WSP5\8gMv jv Åx`=8u~PvvSfx)$P$P$Ph$b#蓈ykS֟ 1KW$Ph~$ Nȉޅɍ$Pg& PW$4h?$AZh1N=8tJ$t$uP~$$t$uPY$8~R\Z9Wh$#tNu1h@h$h8@ uL8059ދ$tPDŽ$$t4W PjW, $tPDŽ$$t4W PjW, $tPDŽ$D$(t P% |$D$$hyj谀$t8<tQ_h$$记D$$\t$ fj*t8tV=8tWh$5\8J t$$tI=8D$tPt$hh̥$hХ$5\8GJ1@t$ht$hh$f |$dwh$V #h$Vѭh$Ví`8tph k#V觭 ȅuI9 I95\8h̥$K 5I95I9h"$Va5I95I9h7$5\8rI1F&1t$lhܥ$V' $`#=p8t"D$$q$t^$QP|$h$; tPh$WȬ h$h$h$W讬D$$0$|$Pt1$t̥$ty#tD=8$tPh$5\8H FWh$$8W= $$0t-=8tPhҦ$5\8Ћ$$L$T $|$`t)։>ډ׋$$|$8‹$4$8$ $8ˉƉ$D$@1S$Pp$+$$$$+$ى|g@By)Qj$P $+$$$$+$ΉЃ||$`t$@$Dt$=$|$`tCt$5858w h#58uM|$`=$@$Dt$h;z#"|h$#t$D$8|jj n$D$@h"Pg D$@|$@DŽ$HI9 I9 m!ڃt9}M#$H5I9I9$$!;$$=8t5\8jj hƢ$D$T}D$@f3=(I9=88 8ƒ 89}%\8HQP ;HQ#\8HQP<Q 8tB$ڋ$!t I95I91ϋ$H1 D$h2#P h"t$7D$@|$@tDŽ$ t$D$@Ph\$hN$Vhp$O"8)PSh$迵h$%Pt$HhԢ$j2lh$hܣ$IDbh*$=DL$D$ D$8t$4D$ D$0D$D$,T$1@މPj 9t$Ûth$%jct$@ $= $#$1V$W$$$$$$t$@Ѓt$@Wt$Z u.5\8$PPBPh $Vw5 8=8| jZkI9x& I9 8I98; I9u188D1\$  I9 I9PL$T$ T$8t$4\$0r\$ 81tt$hu$5\84 L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh$AD$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj#77tt$h$5\83 T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@h$/AD$L$ L$8t$4\$0h$AD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h&$$;@$D$8$D$4$D$0t$,$$1@މjh$?D$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$h>$h4$hh$OZUSWVD1D$ D$D$D$fD$D$0D$8D$4jh`$Q8 t}D$VtƉD$j@Pt%L$L$4d8@P@ƉD$j:V@PD$ t$D$0|$"$jPW4 D$4t 8D$t{8tvD$ t8tj;P th$Ph$Wh$WVWhK$= Vh?$=1C)1C>l$,|$ $tc?tTj/W L$9uut$@jhW%V @L$ǃuC=8taD$t$uI$t>thk$V1Ʌ $t}thk$Um1ɉL$<=d8=8t 1PPӼ=d8|$DhPW' |$L$D$L$D$ tD$ D$$=88L$QPq=88t=ut$8t$8t$ s t D$,t>D$Pj3D$T$"tQPhr$; "D$Pj詓<$l$,|$u'j/VftG1|$t>tFhhC&l$LU l$t$1l$ -$R9D$Pj«9-$R9*x1l$,1Kd}Z<$t3$DSVW} ShW%W. SUW# <$hh%t$LVC t$l$D$ D$<4uT588=8V$tB$hP|$LW |$D$Pj588uj/U t@ʼnD$ D$$=8tAD$Pj?>uP=DI9uDhlf3jhh$)1D$PjV8DI91ۃcÍL$%L$0d؁D^_[]1Eh$b9Ph$h$j USWV օ\$ |$$jhP$Q( l$t=jh`$U t;jhX$U t9T$(.C fCPC fC C 1}Gt$j/UZ$t9lj)CSyS\$$UP { uG<$WxC Uxj@V|$$tZ{ u d8w@PmxƋ_j:St@PLxG_Ot[uUnj]U$tYÊ@t<:uL)SUV  V蹉,$}:1j:V;tEt$t$Vh$1ۋ\$ t3tHj PU0 }t $9ut=s fCt$t$Uhɤ$6CC tWt_ukܻ8KUVht$6 t$t$Vh$6\$ n1HJ38(u$b#UvC{u{ X%tW%PvC1 ^_[]hM$j WV։2vvvGvtvGF G FfG^_USWVȀ%t u7Qt*5\m3|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=X8t< Ph$jdVk#~ \8Iu1IPVQw jh8> Vdػ8j\=X8t< Ph$jdV#~ \8Iu1IPVQ^w jh8O> V΋tPFtPFFtPF^WV΋AtPF~t,WPjW FtPF^_SWV׉΋j:StDS)tPtj%S~tShS$V踉 S$ShJ$V螉 G tu)GfPu G=tPhإ$Vi h#V[^_[USWVP։ϋ\$l$ t8<tPZPUVWBjZ x.1tETw4s,I  $8 u@$PhӨ$21@^_[]USWVPӉRlj4$6Mw sEWSUh 1uCL=ʀw һru$wsME$(^_[]fUSWVL$d$`1@D$1ɉ 8 8 8 8 8 8 8 8 8 8 8 8 8 8T$(JJJJ5H8rBJ PRSW t u 0$@t0hP.P( PSWhŪ$1DI9hWh8膴 DR98<$l$\$HWj j UhSww t h"VS/ j VU# =8t*$xt!X$tl$USP5\8"w jw x6ư=8uPwwV诂yWVHu USh~$7 #$d$dh$/ DI94$ xwwh8w G84$ $8D$HSh8VcO D$H8=8uD$jUjjV h3"#Vo9h"Vo9=o9=8t5DR9h&$5\8C! j}^\$WSjUV WShUV DR9c$d$dhު$ş 1h$v.o9t Po9t PDI9Vs 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV(18D$\8htjUD$$hjUD$ D$D$ `8D$1D$DI911T$(\$$T$Ɖ t8<tPUo9HQP~ Q PÁo9HQP~ Q Pr,qo9HQP~*Q'o9HQP~QP'PhPPhhhZO$5o95o9 o T$ 8uv5uqrl=x8uc=,I9t&t uu5DR9h #5\86 \8HQP;H˃  QT$w\m3DXtDI9CУDI9DI9uss&5 иdtЃru\m3DXu 1@Au<1Ƀ t$|$ )t_8sW|$ T$ dڃ( ʹtu-u|$t DI9D$L$؅t$'T$9EPS B(=8\$$t$uE5u@=x8u7\8HQP~ Q Pj / 5\8q~ uFuhD$,Phk9詭 DI9ۋt$tu D8tD$(PуDI9|$t9ttCD$K1t 8jQ4$jQt$jQ=DI9tu jh=8D$t=tt@wu jT$=\8D$ t=t@wu jT$5\8=8jP$<t o9@ u|1ۉ8S8h98t71@t14ds'hZ$5\8  5\8DI94$jPt$j~P'4$jjPt$j\PDI91(^_[]V0ػ8jO=X8t#\8@=u1Hjh"#Pj 8= 8u P0^jh$81 V:0jO=X8t#\8@=u1Hjh"#Puj \8= 8u 0^jh$8N1 WVP=o9|$8htjHOƍD$$PW5o9  5o9h# 5o9J8h"$WB1ɅQǃ=8t @w3t.VjNh8$&DI91^_jփUSWV]U 8L$D$$I9"1D$881O=I9=I9 8L$$98t?}t9:-tRhz$5\8p tShR$5\8T =8tSRu Q99Q9t jP}D$ |$|$jhh80/ t=8jhFjxMhݫjiMD$h$#u VtM>|jj ;MD$~h3"#W2F D$|$n8D$ D$e38u Njhh8^. t$jLD$=8 8xPi  8|$tt$D$jDI98=8jLh3"#VD$|$t~D$ D$fxtD$xD$(PWux.#D$0=u$$ I9I9u h$5\8 Wh\$Vh$ϔDI9D$tt$jrKD$tt$j [K 8xPh  8|$ t|$t D$ t$Ѓ|$t t$]D$$81I9I988e^_[]Ë=I9 I9" t^L$ hД$V thƔ$V"u3Q9HD$fxL$ D$@щυtSVh&% Vh"$$R9WD$|$Y8;`8v+ d8tQ蜺8`8P]cd8jAD$ujj ID$=(I9tD 8=8t I9!ȉ'D$ !jWPt$W1Q9HspL$1HfytL$IT$fztD$PV5,85`85d8IE aPhQw#5NED$HQPD$~ Q P]à tWti8 8;L$D$|T\8HQP;H~0Q#5\8 8L$D$L$Pj#-͋D$@ @D$HQP;H~bQ 88D$HQP;H~(˃ tًz888PSPj 1HjWQPxЅx,5I95I9h$ $u h"$薐tc8 8;L$D$}%\8HQP ;HQ#\8HQP~ Q Pj D$@ @tu hQw#D$@ @t$.8 t h$1H88jq>|$ tD$ t$ЃD$t$1t$V8=8 Pj#-%h$h۫$h+h$ SWV |$$D$h0$WHt D$0$=4I9Д$t˔$D$Q9ƅu=HR9=LR9 4F95Q9t jVth+$jw$=895Q9t jVth`8h@$t$ jh$8& jhh8& hjE 8h0$W4 8|t1@v5\8h$賁 M5\8h($蛁 j#DI9!hOjwD$ I9I9 tQPh$ \$$SWh&% jQ j#D$ I9I9 tQPh$ Vt$h&%j  81WW"W4$jCj"= 8SVhH$5\8 4$joCj`" ^_[Åu1t PF"=8t j  |$1=8P"=8t j  |$1=8P!=8tV o91j $,y h^$=Է8t DI9jYVV=8t jf!j\!=Է8t DI94$jABVt$h&% t)Vt$h&% u=8 j =8{j\lWVdػ81VA5XZ958$I9rt suY$$dWPV Wh$Vѝ \8Iu1IPVQ1\ jhh8"# Ph$j USWVD$=8p888jjP贔 8h8tL$jQjhP 8<<=48w=<8j=8=l8u 8h$Ɖ=8~&t =8u!hk9h#5\8  =8tCDI9=$ 5\8h$} h׬$41A =88=@8=8=l8u 8h$>Ɖ=8~&t =8u%hk9h#5\8  =8yDI9=tT$ wJ5\8h$D| ?$tg<8h+$=8 +$3$t2@8h0$~=80$PASV3Q LPSV3Q QEPSV3I1  $DI9=t$$ <$$T$$$VRQPWhv$h`89 $$:$:$:$88D$ff8k=85 8Z  88=8188u f8 8t PZ 8jjP 8=8u(QT$ RQhPv  8 8Qh8P h8tjD$ Pjh5 8% D$18888888D$Ph85 84 OD$8j5 8iy h$蝅=8" 8$t#/=48=<8=88=@81)L$ ׾8󥀼$u DŽ$$j j $Qh$QPR =8=l8u 8$P$Pt$h&$Ɖ=8~&t =8u.hk9h#5\8 =8+<8 8tPV8 8858=88SWVRQPh6$H8$8$8D$|8D$x8D$t8D$p8D$l8D$h8D$d8D$`8D$\-88=8588 88PQjRVWSUt$|$$$$$$$$$$jjhM$/X=8[=8N81ۉh׬$蓂1A#h$hخ$u 81ɀ=8D$jD$ Pjj5 8? 1Ƀ5\8h5$u 1E=8DI9=$ w5\8hy$h$́5 8U  81AJ8;DI9=t+$ w!5\8h$W5\8Q%u 뗠8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,PhA$h`8 , |$ |$|$1-8-8-8-8-8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ fD$ L$$T$(t$\$VWRQPShJ$h`8 1-8-8-8-8-8-8-8f8D$L$  ȋL$$ D$( ȣ8D$ $ f8f 8;88jPh85 8`1ɀ=8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$h`8 \|$ |$|$18888888f8L8@uD$ $ ff 8jh8h8e` 5\8h֭$5\8hL$5\8h$5\8h\$5\8h֭$=8USWVX=8 8tuPUjjPCQ ƃPj5 8$Q t$ 8D$fD$D$jPHt8<D$T$ |$ Mbt$1PWT$L$+T$ +L$(x@Biy1PjV.a u8t8#th$uh$o 8t$4\$8VS5 8P ǃu+8t 8#uoVS5 8P t׉5 8LP = 8t$jWO ut:|$9uD$0jPjjW V5 8Ehկ${5 8O  81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ I9I9 )$fz$R|$0|$I9 I91PPPt$ P7KI9=I9|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q PQ t u\$,ى;=I9I9|1jPPt$ 6\$0D$HQPD$~ Q P " t ]Pj ti8 8;L$D$|T\8HQP;H~0Q#5\8 8L$D$L$Pj#̓88D$HQPD$~ Q9 Pǃ u|$<tN$@ @$HQP ;HQ t3 D$ $Prp;P~&у tr0 88gPQۋ] 8 8;L$D$}%\8HQP ;HzQ#\8HQPQ 1JjQPRx~L$1HfytL$I$fzt$PW5$85858eK8 t h9$ o1H88vu h"$nE @Ph\$4Pj ~D$@ @t$8 t h9$n1H88$@ @tu h;z#nj|$ tD$ 4$Ѓ$t$g1t$V-9t$t*t$hN$5\8K 5\8h$a 8 8|$| j%=8yD$ = jjSvBT$DD$@!уJ։1\$HPS舃s{ 1CSu Q 5\8} D$@PP5DPWh$ViPj#h>$h-$h3h$USWV\$j/SX t"W%9tjPy/W%t`%jPYDžxxط8hShط8  ƀط8.ueط8G1dMt[G09tÉ؉jhط8x.0uO.u1GOtSh $=l1^_[]5\8h$_ SWVd|$t1F5ػ8j"jdh߱$SS~ \8Iu1IPSQs= W9Vhh8\ SWVo9 f$D$@=u1H$jjSPvt h߰$gkhh$5o9o 5o9A o9j Dž,y h߰$k=Է8t DI9j9t+t&1ONthSP= ju=DI9(u jj'h$S =Է8t DI9j8^_[V0ػ8j 8u0^USWVP8hj |$ 8te$Ĥ8L81@K$L8Ĥ8188E8 DR9CthQP| EDR9 <88<88󥡜o9<<o9o9@@o9Q9DDQ9Q9HHQ98LL80I9PP0I94I9TT4I98I9XX8I9$hlf3n1@(^_[]Ãl$t$ 11GVWV5\8G _3)$<$@5858=88t:D$(ppppp  H8Hx8h8PVS 5858h;#z t8tP-8G tP%sƅut Psƅt=8O6e-8=I88uetahPhI8jp =wVh$hI8 q 9r&58j?#PVh$ I88uhW%,8 V-Vh$Po Vh|Y$Wp h$y tlj1WQh$| $Vy $b#$b#tWQV| $Viy مtWQV| $VHy مtWQV| $V'y مtWQVk| h̳$y a"tWQh<$D| hҳ$x ܳ$tWQhrR#| h$x مtWQh${ h$x tWSh${ U范W6FVjVjVjVjhTj9$<|$|$ $@j:0Jt$@0<jh8 hj+h j $@0j@VtxGp5<h[$<?u D$PPPh>$hf3!1PhG$F 8P*81\$(ht$Sm t$~$@@FF =8t 1d88$<@VP=8 8tȃujUS 8ȉx8t=u98Ph$5\8. 5x8  =8dx8|$|$ t&WWWv$@$@Hjh8 hj^h j O5<h$Y5<hݲ$L5<h$?Phq$75<j?葚PVh:'#5<h1$j?qPWh'$j] ރ uR80MJt$$D$Ds ƃ=ػ8tjWWTVkP腳 PVh$WV =X8t>5\8h8DL K=8th8h`I$5\8~ 5\8Pjh@h8he3'tEt W=9kL80t&ƅu'E$Y$5\8PK /0$~ tq$=8t9j 6Wj L88L8059V =9t'~t!\8HQP;H~Q~  Pjhj h j ^_Ã=X8t\8HQP~Q fPj fV58u<,"3t!0"3hrR#PtFuh$j[ 58ܳ$tPhh83 8^SWV|$1t*,"3t!,"3WP褔t Cuމ^_[V58u<,"3t!0"3h$PetFuh7$jpZ 58$b#tPhh8P3 8^V98H991I9 L8A95P5L8O:t9^USWV1|$-3t}D$3111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hF$D$P¬t uu ^_[]d;9ơ\8=8m#t$Qhy$P 3t73 8ttPl#PV8 8uV-jV D$E3Vxtǃu&Vt$h$ Vt$h̴$5\8E|$tw7j h$5\8"j 7t$Ve t$D$PjW Mr^_[]USWVP 9H9$t!uLI9t.u=I9A99!"3"3I9 I9A t tu I9I9tu$I91BI9 I9$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5H9 9;$H9 91tu I9I9I9^_[]WVt$ t8,"3t4"3VP(tuVh $j3V G^_h$f="3u ' "3\8@=u1HP8/ 1;"3USWV}uCjho96go9o9o9o9o9o9I9 I9 o9o9|$(jWfI98 I9 8w+o95o9G1;o9)ʉT$t$o99o9s?D$0o9D$(L$, o9o9o9=o9D$t8D$"t8ʃ|;D$L$y =8`E\$ |$tY1${ {{;{{WSWh ;{{{ {{|$$PS\$jU$1ۉ___ __$PWjҴ 1@G ____SW|$ S\$g =8fDŽ$ I9t$Ph"$hQS1FI9 I9ƒ\$x|$|l$x̍&ݜ$݄$ l&L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)Wh2$QPI99|ӡ I9tPL$ 訤L$ )΅~DQ4))h$b#Sht'Rh9$QP*Ƌ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4lu'QPhC$SWL$(+ o9T$,o9\$0+o9x@BD$ډL$hT$ll$h|$@8 81G؃D$@5|&vqL$`\$dl$`̍&ݜ$ܼ$&1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4lu'RSt$DhP$QP3 I9I9ȃ88D$u݄$|9s0;T$ D$r$|$\$|?؍<)hr$؍<)he$QP N+I9 I9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh8 VD$ B J1rrJVRVQa $^Ã0D$4L$8T$ 1ɉJJJ JJQRP@ x$1H0V'0j0^USWVh=8u=8u }t$XjV^+o9~=o9N+ o9y@BD$HT$Ll$HL$$D$$5|&8 8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и$b#tH#|$d5$I9PRQh$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ$b#rH#+|$QRh$Pt$]$ų i)s<$*<$Hrr޸t1@D$))kd΍ ;t%5o9Ĕ1$5\8h$]2 5o9蟔1NĄ^_[]5\8h$5\8h$Qh$ hj$h$ h8$ 5\8hR$SWVo91@ `t^_[à t,u>o9HQP~ Q P>ʍHr̃t"1o9HQP~ Q P\t"u5o9HQP~ QP趔o9Gduo91G o9HQP~ Q Ph[~#\uEo9HQP~%Q'H wr? t:,u3Pt%o9Gdzh$$\ 1No9=o9iU%u'ho9Pvtu :v2USWVՉho9QztDj.Vm1ۅt6UPhzu&)Who9VP u1ۀo91C^_[]SWVD$=8t5DR9h=$5\8μ nD$t$h$PV` uA 8ܻ8t8t$~Vt. T89PQ DI9^_[Pvt=8t"=8t5T8h$5\8 1G=8 Sh&%hjQ94M =Q9=Q9Sh$hQ9M =Q9Shd&hQ9L =Q9Sh@p"hQ9L =Q9Sh,&hR9L  R9=81PPv hh$j> WVPh8sơ\8?snt$h$P" Ɔ8 8?)PRQhe35 x?t$|$ 91; L8 ^_Ph$X- ^h$t$hk$5\8藺 =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=d8tDt Wo`h$.$t VR`h$PD$D$ L$PQRSm:4$uu|$l$ 8\8tQShP$P觹Sh_$P薹 D$WjPUhe3tU58sƉ$t=8t`VwSl<WFWt$P]J Wh|Y$VK WSVK $t P8_4$Vh$uD$uqh$ t66hs"#t$hk$5\8蛸DI9kt$VD$V袍PjV趙 D$Ph$膞Ƌ|$WuPjW艙 u{D$ u?h$ tt$VD$ V-PjVA D$ 8PhĘ$Ƌ|$ WPjW  1ۃD$  ˀuPhĘ$ĝu_4$TZ91F=8uR8,=8\Z9Sh$1Ouh|$ 1$tPT]$|$t.W'PjW; D$tP]D$|$ t&WPjW D$ t P\d^_[]h@h$h8G L8059UWhhPR9w uPR9PV9PZ9V58=l8u 8hM$At>h$hk9E r1ɀk9.)hk9Ph$5\8ĵjhع$hk9pI tfjhX$hk9XI tN=8HR9tLR9j hݹ$hk9_ uh5\8h$' S=8HR9tLR9Q9j h8$hjQ9OF thjQ9h$5\8 1H@R9$fO gK9uX e3I e3~e3Pe3he3^ e3 tuÅt^$g t^_[]Vt$VFt^Vh$jV4 hhPR9ג tPR9USWV=XZ98t`=8tW$tw4t9Phh4p9. j h4p9`4p9tJ4t91P4t98t9tNjwt8t98t9t$h5P8V@ |0/thhW%VA hh$VA V5$$PO  8L$8(I9$-81(I98$ t1=8PGt*"1SSQPVh7$2#u8DI9d$$r tk9$ t1=8POD$8$(I9-8h3"#V4t9V4t9t2$754t9F4t9Vhú$- h$ͻ 1^_[]USWV,=8t8l$@11 SjhU tUh$x ",^_[]<$tދD$0S ,^_[]WVP58=l8u 8|$=hk9hn$5\8蠫 fk920hk9h$5\8 k9t$1 U蒀Vh$UF D$(Vk!у $ 85\8jj(h9$w\u=DI9u=0R9u 0R9tj=l8ua5\8hk9N \8HQP~ Q 0Pj # l8tUhʻ$5\8g 4$|$58=DI91Hƒ4^_[]t$h$j2h3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRhk&P6z ƅu 4$y 1$^USWVHuI\$ $Cj j ShWuu ;i t "hVW0 j VS0 8]t/M I9Nt vuvvSe] jjS ƃPjS \$fD$=t8~%|$@jW3t8O$Cuu St VjP 1D$ PWhpa" D$ PWhfQ$h$Kn81\$@jPPhSvvg thh"Sj/ 28Shu$-D$ PWh$8$\$=t8~N1PD$P2T$@L$H+T$+L$x@BѺMbiy1fD$ PjS_ u,肂8tx8#tj}udb8AuZku<FD$ t:D$L$ PQhhu'e t\$ ۋEu Y D$ PWh$ 1He^_[] t$a?V WV|$h1"$Wst.hk&Wst!t$?tt$ h$^1F1^_؝ th5$j Vt$ Vt$ 8 t^Vh^$j USWVHE ML$8t$QPV DUt$F|$$G(EK9u61Cl$WSSUt|$ ut$G( t^_[]USWVxhb"P'lt+hb"Vlthb"Vlutt9pt9u }h$VW: Hσ s У"3߃c u1tt9σdt ltntFpt9뵈xt9pt9맃t Vu% _39u=pt9D4$9-u yt$$PQj1ۅtz<$uapt9tX,y8uNWAiƃP)MVWP^L 3.gz$PS߉ޅu4$h$^$%=t0=@Vh$=pt9G5t9=pt9jVV DžND$PWT$$P Vh$D$Vh$!t$$t S)9NvB11BW%jV $=tt9$uXh$Vhh%PW~9r DŽ$.gz=tt9uhh WI ) $D$D$P D$ T$4$ =tt9u@D$ #D$Vh`"$Vh`" t$ u h*$RVD$ !=t D$D$pD$5t9hVW" Wf|<ǍWh$7htI=tt9uCxt9u:Vh$H$Wh$he3ejD$P|$W t $Vh$b1PPPW0X=tt9$uL=xt9uLhh W ƒu 1@Pl D$ 1@P< T$=xt9u:4$T$WjVVh$F$P t$ $T$ V1PPPGD$T$4$ t h$uD$ tP t h*$RL$#L$tt9tGujjW tV$PQL$PtNWh{$4$:u W芮Vh@$aWh`"jWhV$ $l$pT$ 3T$ϋD$1 u V44$ $Qt$Pt$h$4$ $Whu" $1B1P 5|t9h>v'h#hlf3m jVlf3h>v'h#VM qPh$V9 j迂UWVD$PjOx2=xt9t0#D$1=uT$l1h!$jKh?"<|$VWj tt)u1)tu4h)$6e^_]ÍD$t$1B1h!$PjVh:$PD$L$ $QP=|t9u |t9XUSWV׉ˀ=t9u h*$u t$t9jjjS{T!ƒt7jPS tuhZ$ql$hZ$11PUVWht$؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph$jVL0L0D0.Vh$hf3 Whp#C^_[]PD$L$ $QP( =|t9u |t9XUSWVpT$hL$lhY!}hB!D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RT$ T$,:)QPt$tZ t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$u'1@ɽ9jD$0PVxŃ|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0fUSWV\T$L$WFW;t$Ņ1ۍT$$1׋D$Xf@ B Bj8h:$SPjP5"3Rв t$hN$$1H$D$D$ yl$1UUU D$1D$D$ |$4u4L$T$P9ŃL$L$0D$4|$(uXht$ t$ % ,$P݋t$ Vt$ D$|$T$ t$$,$|$(|$$jW7M,$hb$yNjl$0T$)ՋL$Ut<9u8$ŃD$D$0D$4t,$jD$(Prh%51K$h# 1HD$D$ l$|$pU(t$(t$_D$T$ \^_[]É,$D$$P蚳t hq$l$!ȉD$ !ȉD$!T$!ȉD$!!RPQt$ UWt$0t$ |$_ $Tv'Cىt KDP@uD$ \m3|$1 ,,C t ^DH@ujGt-Ê \m3DA@CCu 1OD$" 8\m3L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$~9$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êt\m3DH@tKCu$ D$VVD$PV{5z Ǎ$$ D$ VVD$PVU5T 94$ =j31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$~9L$ QhP ~911 |$ 1 $R+4t1BuڋD$8L$ Qj P3 Ǎ$Pj t$3 ^ŃuuD$ L$ }D$HPQ4xWt$ P2 $(4$hUt$Pr2 L$l$ ȉD$<9 ɽ|$X\m3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't \m3DQ@tVFu$$  Qσ s[ ^j $( PSC ]8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A \m3CDP@t Cu;|kw\m3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VcE =9 hh V` EKCDH@uٺ$yG=9 GKoCDH@uٺ$KfCDH@uٺ$ GQC t _DH@u%ƋD$pWK@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,|9t!9}uEpV@L*mj |9xt$p@ |9>GWVt$F1Ejhht9f Å1|$څ,5959hz$|$t5959h]$t9 t911<|9t6 uGp5959h $轁 WY߅uFu$9t@Py(9L9P`P9(^_[]R5959h$j 5959h$5959h$VQR5959h$$P5959hP$$P5959h$jjUja 5959h$lV5959h$UP5959h$>5959he$(5959h$Q5959h$5959h.$5959h$jj 5959h$5959h]$5959h$5959h$n5959hQ$X5959h$B5959h$,$P5959h$Sh"$95959h$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u$9_NSFJ1<|9tJ9ouwvSGt?G $pS |$698^_[]Ë$@S5959h$j SWV׉HЃ s%j SVw G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S/ uC9L9sL9؃^_[]Ë59=9SP PWVh$j USWVP׉΋$1m~ w]$v' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x "3"3>u)jH1҉P5"3 "35ojnH@"38 "3>u j5t9hf3=u 9P]hi"j LPPh$hlf3ghj\USWV\$|$t$ 91EtB59WVu ܆9܆959<1܆99Ht8h3"#p:h9 ܆9I 9KphE#jh9crf؆9"Ԇ9 ...99܆9@9 9 =9u98#uxnu 9  9W1 t,E-9@J}9܆9R)ʉ1ɉ܆99‹\$k91m1 9Q9u>#u~nu 9t91B C1ɾ8f 9@91ɋ\$u9\$t1A ^_[]ÉGQh"$j USWV|9uN 919u:=9u9e3e39$9f39i"91NHQPP;9=e3P7:=9tC9SpS59 th959J o9=9tM9t=f3tP9V959h9 99=9t99 9@99=9QPrf|$󡘆98t0W599VZ W59V =<W59$V( W59$U V U PWVh$Wh9_9h9Ƃ9޻t=f3t PV8h"h9c9rH9tt$t$Pʸ 9H9tȋL$!QPĸ 99=9u999f39i"h3"#P)c959h"$y 99$@1Q59P芄 59h9h9 ƅttb9|0 uNt$@ $@ $QV59P91@|^_[]59h"$jP 59h#h$h$59h$j h$h$f =9uh$N h9血jUh$벡9@ u:HQP~ QPf7t59PB 1=9t 9t SWV9X1t^h3"#3~ VjVWQPD1FT$1T9=P91ۉ__ WjWSQPHDT$t tCsBtt$u 9;Hr,9xt$t91BtȉÅQJA7$F@+6vFt P2 uF6^_ËFp vh"$j USWV ՉL$\9X9щT$Љ$ \m3P9E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B l99r7 l9P5h9h9X9\9$P90D$SPt$Vb it}ŋ4$L$]\4$L$t&uE\l99r+l9P5h9ƣh9X95\9F1C4$\9\9\$D$ l99ȋ$r+ l9Q5h9;h9X9\9 ^_[]USWV`}$111D$h$u W uu5<>ut0Gtg<;u<$8u _3ȉL$91t*Vpt@T$?D$D$t Vlj|$\$ |$t?1h%S=N t+8ttDGh$j 1E L$3 th`%H u3h"$j tD$PW uh.$ۃ|$ tt$ uh8$뼅tt$ uhax$렋Cu/h# g %tjh?$VV\ VeSPG QVhB$ *Phg$hlf3QF j:UVQt@t $e^]VhT$je WVP։ +1ɉQPWۦ V?t$8t*1H^_*8"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPQF tvPv |F v1v|F^USWVP1k<Z03~4Z03$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<Z03Z03$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op phlf3jjCh$8j>7V1=9iLSBt*jjj  V V~5H<蹣95H<ƣ9j5H<Q@9jP9t#1ɺH03A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$VtEE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8t? \m3DAhlf3jL W@$dz'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$tz'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuTLGQ=m$ 5D<'5D<71QQPS虲t$V5D<藸5H<i_1U)19}1ۋ$p$)ŊEt9}1< ˊEE5H<h!$1VV5H<UVj5H<рVj5H< 5H<貺5H<.= Tm3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&hlf3jI bxu+=9 9σqt$V^VxVq5H<QIhlf3jI ,$,$fUuE 9|)BfUhlf3jVI ,$T$4xut EfEuGza|1x(| E9}ED ufMhlf3jH !}Eu)ukE t uPu]f;}]D; jt$ND; tt$4UЃF4; ~ttt$4WZuE tuPku @pE u许u#pE9,Et)unE t uP u`EtPEEf~3M1tRMEGЃ9|׋E4t t$4UЃuqoEE tPZoE ^_[]Lt$59t$t$h$hlf3"7ZL$@ t$St$t$ t$UPh$'bL $A It$U59t$SQPh*$hlf36$jL+USWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$p{tS;tNt$Cj S)؃ QSVWD$pT{t G}uo $ $l$Atl$|$qKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufth$VSwz|$Gu1PPw|$ GL$G)VQw$  wٳ ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59;Ǎ PjQ =9ۉ9t @tFj9q 1@^Vt$ hh$h>9J 1@^Vt$ hh$h>9# 1@^Vt$ hh$h>9 1@^ËD$1@ËD$g %1@ËD$$1@ËD$$1@ËD$]$1@ËD$c$1@ËD$"1@1199)ʍ9hQQPPj jh  1ø91hPPQQj jh  1ø91hPPQQj jh4 1ø91jPPQQj jh 91Á=9ftpthh9h$b#hI91hPPQQj jjd1 1WV91hVVPPj jh  =9t#1GWVh$ WVh$ h$! h$ 1^_ËD$1hPPQQj jhr$ 1ď9j2BY1Ë 9AR@91ËD$@1@1199)ʍ9hQQPPj jh  1ø91hPPQQj jhP 1ø91jPPQQj jh 91Á=9ftpthh9h$b#h91hPPQQj jjd 1WV91hVVPPj jh] =9t#1GWVh$ WVh$ h$s h$f 1^_ø91hPPQQj jh 1h91Ë 9AR@91ËD$1@9g %1@9$1@9$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$@1@ËD$@1@ËD$@1@t$[1@VPt$跻ƉPjV] tjjVq 4$5N1@^jt$ 1@WV|$jWtWNjVP- 1@^_WV|$jWtWVP蹳1@^_á9ƀxjjPͱ 1@59Ⱦujj59襱 1@jt$ c1@jt$ Q1@Vt$ 9ƀx6虼j659P 1@^V9)thkj賛1H/t$ ƀxj6P jj6591@^WV9)thkj^1N?|$ƀx1FV7P蹰 jj759jV759褺 ^_V9)thkj1H8t$ ƀxj6PT jj659Vg1@^ËD$059証1@Vt$ 9ƀxj6P 9)t P1QQ6P虺1@^ËD$1@ËD$1@ËD$1@ËD$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$$1@ËD$#1@ËD$N%1@ËD$)$1@ËD$7$1@ËD$?b%1@ËD$$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ËD$1@ø91hPPQQj jh t 1ø91hPPQQj jh P 1øh91hPPQQj jh, 1ËD$1@VD$ 119‰)hVVQQj jh  1^øh91hPPQQj jh 1VD$ 01jPPQQj jh Ɔ1^VD$ 0hE%PthVh$b#hF1hVVPPj jjd3 1^WVD$81hVVPPj jh t#1GWVh$ WVh$z h$x h$x 1^_ËD$@1@øX91jPPQQj jje 1ø91jPPQQj jjqr 1øh91hPPQQj jhN 1ËD$1@ËD$L$A f@1@ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1ËD$L$A f@1@ËD$@%1@ËD$@K1@ËD$@1@ËD$@1@ËD$@1@ËD$@1@1@ËD$1@USWVPt$11Mf$0jWWSSUUh Wz^ x;}ԉ1@^_[]ËD$1@USWVP1A~9~^Պ\; 1ۋT$~N,$9uhL$PRQYvlhr%PRQY|$ Ft$uMh}r%vI;FVx$9tكaw~ ـb(Qh$P  t^WPS\$WF8tt$SVЃ F9u vl^_[]fUSWV|$59ti=9WZtW/tG-99v1Whuá9t Pϸ9=999^_[]SWVt$E3t59PrE31SSV*d 1NtjSSP91ASSWQQPS謙E3Wd =E3t@hH%Wt59WrE3W[ 91^_[WVt$ w?=E3t-t)959r!P[ t;9slj4L;3^_599959@j59jVt$59m99VLPh"$^PT$D$ $1APYXWVPt$|$5999D$$WVP1A4$^_USWVt$R5959 >-9E\m3\Jك@to@uwt uDZ@t< ty< =9u =9tI59ptj 59t=9uj 59[9999?=9u"59pptj 59 j 59199999 9f)91ۈD$u9C59ot$L$4 59Pp9Ƌt$|259:pVUUU9}j 59H|$uCj 59.KVW59(W E߃ @ Ȣ99=9uW59&ot7j 59%5959|R999959蟍 ^_[]t$Ph"$VPt$D$ L$ $PVP1A4$^h$b#t$t$t$t$USWVP|$ \$$l$(t$5999D$,$VpUP41B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW^j59躷1ɉV,$E|$@t[D$@8tRD$u:h+I%59Pt$@59Ph#59PWt$Dt$T h4g%59P4$&59lD$ 59l59Tm‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US59~P59lthC%US59P/)PS59 59褊59Ã~0L$ZD$  聓 L$X1)<(x1 \m3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP QtRD$(υ~] $9I\$)RPQ薑 KOuLuH|$@tAt$t$D|$W臚 Wnhlf3j D$z19Dzf tN;L$$} \m3DXuhlf3j  $9A)RPQ $8GED$t+)j Pt$59 L$99D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P肙 4$|0^_[]h$b#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59si59Ci$tKۋ|$,;S|$0L$Dȃ19AD$LD$Ut$HP1t$PQQ"Źt3;|$,t.D$DE9}STŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j P/tC@j PuL$$)݃} 9WUQS59ƅ|$ AVYzƅtV5D<D4$59PW59FPWC1PPW蒺 W蹅D$E|$ GWUPS59WPŋ=9V PW=9VtFPWB59ܹ99#WUt$ ShH%591$|$<\$HD$LD$t$(SPGT$t$t$Ht$HWtIVY4$tWVV<WFUP<W<^_[]h$b#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]h$b#t$t$t$t$USWVP|$ \$$l$(t$59i99D$,$VAUP14$SWt$(^_[]h$b#t$VPt$D$ L$ $PVP1ɉ4$ ^V59Qd59d^fUSWV $$$ P9159599Y%59W还9WVP= x{'Ft(=9tvvP vh9&B>vuɸ99999h%謝 D$|$ h[I%SU詍 e~o~1pKrtCGD9붃fg5<h3"#VqPhW \$hr#W~/ D jPh#g t \$Sh|$Wl u4 {J%x{'WPWVmb t }u몋}tE$thr#S. <=u͍4@hr#P. Fh~M%V 04$VW@ HT9h9h9hfI%5<o bS$$$ Fm<D$/J1WhM%`u#D$=uD$h|$d}:hM%wd t61W t@ < uFrW\ 1W\ jh1"$h$i AR5H<Laǃ5H<Ya1FVVPWv9$_t5959W59h VjVjhۼj5H<2#~hh9_D$D$@V返ljD$ V谔D$1Åj2P裇L$t|$ o u*t$ `%n ut$ K%n j|rjUܝtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11V0|$ t$~144 C9uWVj tPj虺jVh:# ![P9j9j"9$u誸t`=T9t jǡ jjGȜ/91 ^_[]Ét$ hT1GQWP Ph#hlf3 VWG =hlf3jj,h.I%j% Źhlf3VjhlI%V V1Fhlf3VhEhK%ܭV UWVVP{ h;#c Pڕ 6|[=9t>V萙Ph>M%W 59Ʋ599=9t>VHPhPM%W 59~599=9uhlf3jjhgM%e^_]Ã=9tá9tt$PP j j h;#T tPǔ t hW%趔 Zjh.w hjUSWVB L$Q^  Pq Ń j hK%Ut[ ~ uF t$|$ W WufD/UWZ Wjŋ>7Ptn,$n ;nu:FUW蕚t^FPv}tFljFn ~D$P葂4$胂UV So ŅSU ^_[]ËD$L$I41@fUSWV1t$T9j%Vt$t$ t$t$4$jjVP;=T9P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15T9耬 x9VPX~Bjhy9jPWyjhx=9V/Vbu%9ǀ$jhxupӫ^w9Ph"$jX jtO9)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP耖tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVfVfSWV1t$t$t$ t$t$4$5T9jV#jr4PVf8 9$*tKuKt!Pуt9$P9L$$Q3 tXD$t$VSVx)VOuM%uM%t*VB^_[À)ujhbsu Vt5D<It1WW5H<w 5H<蹨5H<tSj X9;xhj_jZjC]jVkJM%M%!}E'USWVο$WQS WhM%S装 WSUք Whs%U臅 S1tGUt0VVVVVVVVVVVh"h41PP/t US^_[]SWV$SQVD ShM%V SVW( Shs%Wل Wit VW^_[WV1t$t$t$ t$t$4$5T9jxVtkjo4PV[5xG9*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QD$l$1@$4Vo9D$pPt$VW Z$DaD$|$ $%t um\m3DJ@tiOGPXhg%dj D$(PW L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ5\m3t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u\m3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt040 Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWm 59t@WPh>M%V[ 59-59/9sh2#hM% 9t*W蚋PhM%V 59Ф.590tPhQG#hh%j[1e^_]Ph N%hlf3 j* UWVVl =9t>V1PhPM%V݄ 59659859wh"hN% 9t81hN%W莄V虊PhN%Wv 59ϣ$0 PhN%hh%j[1e^_]V1hhPhPjjPj jjhE3hи4xjP訪V輹^hlf3jjhM%ݝ9tPjjhM%j SWVD$x1|$9t9Ps1; P]PVh:'#W跎^_[USWV$$$L$$QPhVy $h3"#V= $D$W.1K4$袄 1G9r6|$  WUɋŋ$(\5F4$H ÃugD$ PVKuH|$dh3"#V; $t:|$G=9tVhIN%h2N%P 1KS1D5$$t 4$D 4$Ju9tVhIN%hQN%P9 1ۉ؁Ĉ^_[]Uf$$$1KM USWVu ED$l|$(PVW  ED$8D$1ۉΊ<'t  j Fj'Vu V躾ljt$ t$PS D$ t$ )VPh"L$Q` hN%V t+9s'T%u@u @Qj*PS ;'uC|${*1\$$|$D$8j/W tWL É@/ WL É|$PD$ĽSiv ND$+D$D$ .t Vt$W苾 tS.v Džu]D$T$L$;ȉD$Pt$ ÈSD$L$Wt$t$ hN%P  뒋D$L$T$;t RSFD |$\$$hr%S` G|$\$1\$L$9} :D$hP%y:B`|$u9Mx{;5H<tVBjPy|$ۋ|$t h"#$hP$``e3H e3~e3#he3輶9Nj|$t-`jf# ~;5H<t VP|$ t E%u15H<衔5H<#j5H<Q_t$(GtwP5uW#D$td$8u-e^_[]D$t$ hN%j7c VhdN%P) 1Sq2 1FVe2 Sjh#V%u1 VSx t$:2 $ D$pL$|PSt$(p t$ DZ9t*t$h*O%P 5999t*t$h#P 59踳9hC&D$ 0蛵u.h9O%D$ p胵ut$vm t$e s h9REtt8tjPf4 u%t$V6 6hNO%] j3L$1Ph@)VUPRQ5H<XtcjP~貢t05H<SPVY5H<PV1PPVԲ V\^_[]hlf3Sj+hN%S fUSWV-1@=ď9$hT%Pjq hqD$1D$ $ $?$V>9+%VWk PWt$ י VWk G|$U%}'\m3D$WPWt$ ױ uD$L$DAu >uD$ |$O 4$ ))ht$Pl FD$ |$$ ))Ƅt$P$A8 }? jS\z ƃ $NfF8Ju1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p ď9 )) hPhȏ9Ok 14}'jVhȏ9$ t1GuD$(VhU%j@$S 1PPD$0PD$XPSw= t|$Lub4}'hȏ9hh%h-jSj"D$L1QD$PPQQS = ShV%s1=ȏ9su=ɏ9lu\m3 ʏ9DH$D$$PhW% u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TV貹 j!W|$0W袹 iW&]hhV%QCh 9PPji= 9 h 9PPhh2#huW%A PhV%j+o hV%WohrV%WohV%WohV%Wnh 9hV%Wn = 9t!h 9hW%Wn $9hW%Wnh W%Wnh.W%WnWhiR%jtnhȏ9h1W%h DŽ$h#9VVj~j hQ%V7 #9defa1ȋ '9ult1 j hW%h#9n7 #9manu1ȋ &9ual1 #91 #9none1 '9 tlf=#9 tb=#9t`h#9hȏ9hW%jtChȏ9hW%Sj~$${#9Ȑ9hhW%HOh"Ifhȏ9hW%hW%hL [ 8 Ȑ9hO%D$ Pj3 ~ht$ h̐99f t$2{j h̐9^thP%D$ Pj ~ht$ h>9e t$zj h>9t=>9t Ȑ9hP%D$ Pj ~ht$ hˑ9e t$z=ˑ9u:h Q%D$ Pj@ ~ht$ hˑ9Fe t$?zj hˑ9kt=ˑ9t Ȑ9hhʒ9]u=ʒ9t Ȑ9D$1@$" h9S$Wd Vʒ9PPjxVˑ9PPjw SW8t%Ȑ9|$$|$ t |$ujɓ9PPjye|$t j9PPjz^hɓ9$ =9u=Q%=r!ƒQ%t๥Q%=ujQh9c j9PPj{h̐9PPj}Ȑ9u4D$D$Pj|$uh>9PPj|=>9M$M$t>9=#9Q%t#9=ɓ9tɓ9|$ti=9M$M$t9=9M$t9=̐9t̐9SVWQRhȏ9Phʒ9hˑ9h"h,$L=9M$M$t9=̐9t̐9WVQRhȏ9Phʒ9hˑ9h"h(jjjZ xP$ "9Q%Ph"$hb ha}<hȏ9hFW%hS S"jrjQ$H1WWV$Ph8U%T4 t( ;$P$TshJU%jPbt^DŽ$ 1WWV$PhiU%4 ? ;$0$4&h}U%jPh`uq59 1H t$t$u1t$t$uhQ%j<$t$jWď91@$F=>9h"hQ% hQ%jft$(V(N VlPh2R%hR%Wtf=ˑ9thˑ9hOR%WXf =>9th>9hZR%W h蝺hlf3P> j USWVL$,!ij u!D$@tP jPhɓ9 ] L$,%ij u!D$@tPȯ jPh9\ jPPT ƍ\$1 jhȏ9S\ Sh8i(V辒 V3 ulD$P.GhPh#9k\ WHt;ƸI$#9SPU] SVU\ WGƸ%uցļ^_[]VPhȏ9h V%Pj"#Vt$%+ Vj+ tfjh-V%V贠 u;h5V%V u&h?V%V ujhJV%Vy u"h"#j* ƅu4$jp^Ét t t@hVh"98[ SWVt$hVSuT|$tMƄ$j.V=zt#GSVhʒ9Z SWhˑ9 hVhʒ9Z ^_[SWVʒ9S蘞hˑ9艞hSh9Z =ˑ9tO)~!ɒ9.uʒ9Phˑ9Pt(9Vh`%WZ Vhˑ9WZ ^_[ËD$w~'ø$b#USWV$VhE%蜟u $1퍌$UhNS%W :HUUW f@$|$$jhUS%P 9tx/uG/$N~/vt$jhUS%Pa $b#w~'1҅‰)ˍL$$QSRPh]S%hU ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<9X1ɀ=9/9QPhs%hh9 1^ËL$1Bh9WVt$=ď9u jG7Wj 螄u1@l959o1ɀ=9/9s%QPVWh9' =1ɀ=9/9QPVWh9 1^_Vt$V dЉhx9$^WV D$Ph9K u:$nfsu-Vh9h9V Vh9h9V tWj 蔃1F?t[h9h9hjS%jPu>9S%h9VWh9 h9VWh9 1 ^_SWV=ď9hUȐ9u(h<%Q\u9h9hS%U=>9t hQ%˵= 9t huW%赵|$hȏ9hS%hWX h"WƅVWPhS%j[h $V[=#9th#9hS%Vy[ hiR%jj[Ȑ9uGWPhS%jK[=#9tDh#9h9hɓ9hS%V%[=Ȑ9tChBT%Thȏ9hNT%h9hɓ9hS%VZhiR%jZh2#hS%XPhT%jZ V%SWZhrV%WZSWZ=ˑ9thˑ9hV%WcZ hɓ9hV%WPZ =ˑ9tPh9h`I$W/Z hʒ9h#WZ W芗hiR%jZh"T%Zuh̐9h/T%nS= 9theT%XShȏ9hyT%FSt V#j y^_[USWV։ϸjPPfK tCËl$hjW; ojhȏ9WS WVS- S 1H^_[]USWV$΋$PhE%|u tW$b#V ^l$PSU 9<$u9PVUWh[V%hC1Ʌȁ^_[]ÿWV%fT$L$t$a"u/Átusc$Ãt6u8h6h/u uh%!wP~'hhV D$L$FFhTV~ ȃ ^SWVP1ۉSSWSjh~'}t{4$U1ۅtjSSWPjh~'}tEhr%V t&|$\$PS׃thr%jd uVf Vf1ۉ؃^_[USWV6X%~'\$|$jSP2 ƅt Eu$wS7P wh2#7kQ G^_[]WV~'|$u~'t%|$ jWQ!2 t u1^_ËL$E34USWV1td։σSPSW  t u6P1PhPPj D$PU* D$t΀8uɃ<$uð1^_[]ËL$E3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'EBX%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ, $V1VP 95T9D$40$X@h"P@tt$45H<B<he3(T 5H<9r T9ɉt$ =1MD$Ni8D$$11t=i8,49tǍXUSN݉|$|$l$$99ƀyH1ۉLPTXVUQL 9" .hQPL VUhX9L ,9L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP9$()1HD,048Ƃ(1 T9<596W9|$c[ 9P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً T9ɋD$L$ӾV W$b#QSPSl$GUu 9$H@ VW$b#RPQSD$BPC 9t% 9QUHDRhX%P =9$0@ơ9$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-T9L$QP59 u<59h_R$Pdž$l$9()8 9 9VM9VjP L$ D$@D$9 T9yuƇy$u4P4 44S*$똋D$9$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$8D$41B$D$D$1ҍ{t9l$4fDŽ4DŽ48El$L$),$|4xfDŽ4DŽ48T4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽ8D4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽ8D4B1hPPPPjPPjjR$Pjz4$1K|$$8h"$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh"F3qE 9F31@멃=T9yuT9T9s19dL$w BsÁt1USWVD$$9*t1G.$ )$PhX%hV[ ?b%jt(hfMVhX%h% j$ iW%W踢9$Phw%hVܮ WVhY%蜥 ]hW%Vjj\Q1PP3Ahg jl1qZ$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$ ~'hY%D$P Y%D$Y%X3|$0tPhX%hW% WhY%D$P2 ?b%D$Y%zh}Y%D$P Y%D$Y%i3|$0tPh#Y%hW褬 D3t#Ph*Y%j\$S臬 S\$WI D3t#Ph1Y%j\$S\ S\$W L3q"t1"$r!%tWRh8Y%D$ P; D3@Y%tQY%D$?b%D3|$0tL3tQh^Y%hWϫ WhdY%D$P wc%D$wY%Q|3Y%tY%PD$P Y%D$Y%!hY%D$P Y%D$Y%D3 $t!t$PQh&%h7t)$j4$JUtQ8Ud3U$ :=T9t$ $QD3$t<|$t4øSZS$PW^$ $ t )$ El;)1^_[]ÉSRUSWV 1ۅt6׉ΉRhO^%UD EtjP肱 t4$HT؁ ^_[]Ê$ h?b%Wф$D$jVù D$jQQPS Sz  9uU$d=Tt=Tu@$x6D$8;$du)Vl$Uhi^%SSVUh}^%SC$ Pu1Vt$h]^%P4$OS$ l$Sh&b#UQ1 h:UWVjPK1PSG1SWVT$L$ALBLu1Fuy,1Ht%Z,u!u1HRQQ^_[9rwًz89y8rw19HUSWV 91G*ZƄ$hZ%进h"hP#菞PhZ%jVC 59t 9QPhZ%V赫 5hVZ%SC9)\$J$WPZx$L$@PQ؞ $d$ PV D$@PhZ%SB D$0PV`Y"D$0L$8L$D$h"P܁w\$D$H$194$h"W詁FuށǐW$W SP;t$$ *h^9tPjjh:Z%[1PP1+~E8>1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7#t$b#$Z%\$t7ȉL$7 T$wXY%D$ ?b%D$$(~'$b#$uht$$P~: Z%Pt$hZ%t=uD7L7qQPh [%uP$$#d%D#t $D$ wc% $T$hW%RT$ D$L$ 1@D$hE[%RT$Y%D$L$ hW%RfuD7#t$$D7$b#@tt[%$b#yy[%$b#t[%T$($b#t[%T$ |$$$b#t[%L$,$b#t[%$b#t[% $b#t[%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4hL[%t$D?@غRPhZ%t$>ClE;F{Pp\$CPWܚ SMt$0|$4hh褕L$0QjP7. P8W[MtVhZ%t$y> S:M=9u#D$@9@@hTPih[%\$ S0>h[%S">h[%S>=9th9h\%S= $ 1|$@VVPWhB^%+ ;w$b#r#t#Qh"\%S= hO\%ٕhU\%̕h[\%迕=9t hd\%評hk\%蜕1hiR%WL=SzW\e^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ 'ht\%U) UeuhY%ht\%U) U>FjVD1Ktljt$"h\%-G$G?b%G w"Gh\%-G ${$?b%C(s4C8'h\%-C<{@?b%CDsP$sT'Sht\%U( UstlSh\%U( "U4-F$F^ FSh\%U( F'U,F $F$^(F48ihY%ht\%UZ( UtlY%Wh\%U9( "U,F$F~ ^Wh\%U( F'Ue,F $F$~(^48+4$iƷm۶|$9U91KhZ%賙tzhP#臙tiD$hP#Pj記 XWl$UVt$t$!I6IOu4$I9Ph"$h 1PP}#9)t5Phw%hUa 鋔$ 1$ 91APuDFl9Ɖr:9Ph"$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbh9]%h-]%hh\%L$T$jt$oËL$T$jt$XWV׉κ?b%jujWZh$b#Vh2"#蘔 ^_V 91ɾ 9r^^VD$ 9tU@8xtlIuAH1FVVjjhh 90QRx tjh 9jZ6 t 9^À= 9tjh 9j36  9USWV 1WWj6 &iP5SPj 5 t$ uá\m3D$1/dev4$D$iƋ1N/ u1FSt$$P/dev uDL$DAt|tER|$$t.jVj;5 t \m3L$Nj4$D$/devG4$D$M[1O4$1O1V=E ^_[]USWVPD$tPpP11OFtFhW%Put.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T_]%wl]%PhR"hs%Vi ^_[]Vt$D$QPbLt(D$t%t!h*hPQ;FD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$59.@ujP<D$1҅D$t 9tL$BuT$ЋT$P]1hPPhG!h!jjAPjQQhE3w i4WPZw BM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h"PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jP/;D$1҅ӅtwUrt\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$FAЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W^9ŅjWI9{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ .D$$@$;E tL$ A;L$tI1۸hSSh/ShjUw>~`^_[]USWVϋ@PD$ P-hFPt$VR x1|$T$RtPQL =P91PWt$$t$$kD$T$1PWt$,t$,sk t$t$RPqh^%|$dW D$,tjPpW3) t$ Wt$ ") |$F;pRw L=D$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQPVh:'#SX9^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6e<^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVhy]%h:1^_[USWVu 6X%~'jVP uh8j}w v jVw& E3OE3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPh]%hSƏ Zx8^x8PG@$QP"B'$HffsWBD$Bjh]%G1ۃt$D$\Uh]%h]%Wc@ Vh]%ST@ Sh]%W% S$Ph}Dt$VW3W}Vۻ$Ph]%$a5 1ۄ$h]%$Uh^%P?L$LQhN&P> t$,04t$jj h$b#RPjV |$LWg\m3r \DZ@uWQVt$h^%ht$ 貍 1C}$].1ۿ 9PSWr t$L^^^F~ FFVhQt$ ? t |$dJSjVsr $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h$b#RPjV VSh$ht$j }G8@É؍e^_[] 9=}t'fy"V9 W9NuEt FuXt1€1ɾY9( Ӏu A'w'X9 ' Àu A&r  uȃsƄ\$,04t$jj h$b#RPjV $PVSh'^%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h$b#RPjS W$mPSVh3^%ht$ 蜊 -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ hz[%q Y|$hW%u qdDžtoh'6\dtkDŽ$v/rDŽ$/dev,$$VuP. D$/devf@/VuP Q踃낋E\tu xt@@AED$59$ttt$PуuN9덬$WPUk t$/devfF/9WPVH [Sla\asa9aO$CQPU {PWV9$t(tt$Pуt Nj59,$1D$0$h@h"P5tt$G9PUcbtTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVSs $WD$pV l$ Uh%VS ǰD$h^"Wah#W`tyhX#W`tgh$W`tUhZ%W`tCh"W`t1%D$t^%tD$VPS VWS Uh%jBR DžED$4$v PS} t"vh"$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=P9SWt$t$\$1PWt$t$\|$ SWVPVjB>u1@G93s9s%VPWSh9a wsVPWSh9K 1^_[USWV |$ faa@D$L$1C$b#=9tha%j9VrPWhh%h:vD$PUAD$h&959h?d%j訙x9rW!9u9QWh9Vt$D$PWh]d%SR$'D$D$ =mdt2Vh9h9% Vh9h9 1$hVSc t$t$t$D$ x9jVV蕈 ~;Ƹ PV D$i jQPj e9]D$|$hz\Ww~'o ~#u4hx9h9t 21jio9ލ$9Hf@8tJu1SSSSSjSSjjUVjlL4jmoPV>VMktx9Ph9s u`~*=9t!ha%jU19Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]hd%hd%h'hc%q^USWV|1ۀ=9t}h9hd%jŕ ue9Wd%s%9h9VWSU{ h9VWSh9v{ VU#N@1 É؃|^_[]ËD$L$I1@Ã=9tha%j(9Vt$ D$t PmVj=m59^USWVPWj<1F?tihX9h9h_%j讔uL99Wd%_%h9VWSUh9oz h9VWSUh9Yz 1^_[]SWVPVj`<>u1@;9_%h9VWSh9z h9VWSh9y 1^_[ù1@t E9It1ùtA/9t 1ùD$/9Au$9ËD$$9SWVhflhy1$hWV^ 㹄G3WSChWWh;Wj65l9WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW$9tI1r rr2t_0u&1q1ur1ۃ0݃便_r @뜃|$tB R`BB`^_[]USWV|$D$L$BJ 0uQ=h91۾?&-`9B0t#1urF$9tuh99u'Cϸ`99t0$9\9tX90 5d9|$Q-jVPh&_%W^_[]WV|$t$ Nt tuh_%Ck_%_%2tW%jjPWV^_USWV|$=9t h9j;WWG9u9l$}QWVhjV%hUv 1PP] ơ9t3Ѓ<PUuu#D$=ueߋ$$$tL9P{jۉt{uh_%jz$t]PUh_%h[Z$tP9hhSjP2 jP WX VO jUh`%h V V) tP$tT9Uh"$hi jj7ah59~1@|^_[]Ã=9t=9tUh2`%ju C$91$tX9Vt$hD%V-PtV9t 99^t$-9u9USWVt$,VND$j$t$VS)to1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44ML$|$)L$OGj$W(DžuD$@PDžj$t$0(|$1<$t$]D$PVhVVj D$PS# NjD$VtuK;|$0sED$ )UPt$VI0 1D$44UEk D$44L$D$D$ j$S(Ņm<$t$ >tV\$Sj VL$|$);\$u ^_[]hd%hd%h hc%USV5G31/t.T$ G39u9t $9t q/u^[V1ɍt$QQPVh8`% y1t1^USWV|$(1$PPWVh8`%` $D$(1PPWVh8`%' Z$LF1d$Pj%J4$>$'h}d$Ueh~.hhd%ehhUdW59D$hljU59K 'PPqhVjU59#VJt PVW XWD$ PSt$59JK 59\'59Sjhe% j D$ PUd Uh`%c D$(SSWVh8`%{ $j腷 h`%fMuQ1AtCjVw u4Vhe%"1ɉtjVw uVhe%j) D$(SSWVh8`% u$~hL`%jTȁĐ^_[]1USWVhhWd%"9tPjjhg`%%1\9X9T9P9L9H9G3/u D$8G3ڃ9t$9u@H9Q/uD$/u.X9H919haj G31@|$>Z$9M L9L$ T9L$j5D<>5H<蠖5H<r=9tha%j聈9\9X96P5H9h{`%jaa9Wj b0D$ttRN1ҋ0t1t /u oBrg$9uƃ$9\91$9uAuVD$u,D$ L9D$T91@$9\9^/ T9FH9X9QR5L95\95P9Ph`%h` jj\/_59]139tvh`%hu>h,_t$FVj.~th`%j軆h`%j謆h+a%j蝆1G0909thGa%jfhW%_L$QPtu{h`a%_$QPRuYD$3$L$3$ t?hea%ha%Mft!ha%jޅha%ha%a迪1=9tha%j訅9]$1L$VVPQh8`%@ }t|$ thL`%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$h2#hb%{at@Ƌ|$]1Phb%S9 4$WV VChiR%S^_[USWV-I3ta1FI3t&U7Jd1tUh"$h] 111Fo u1tjh1@1^_[]Vh_b%]t$hPV8 hh9V腿 x(9ƀ9hrb%QGg j/P<@nb%d9^SWVh{b%&]9hPV VB9K5d9< 99PVhh%hW=i jWh%$#+ hvLVUOj< 1hhb%WWhLjHj j j jVWW$94ƣ\J3WP*\J3V9W jjNt$59hb%WVh h_b% \$WPS S蜋SVj) jj}N1@^_[UWVj( WW$ W |$ hPW* j W_tZd9 9tV("RWQPhY%hhe^_]1PPjvfG0{"PVWh{c%hlf3:b c%^_WVt$ 0PprPGt$>FFVj F^_SWV=G3/t/t$G3GtPV8t /u?É^_[USWVj$t$ 1ۅtKƉ|$\$FUShSSj WV $Vtu;D$ rj$Vƅu1؃^_[]VPT$ D$t$4$VP ^USWVӉϋl$jUttMƅtPt$VF S3OVUP tP׃SV^_[]VPT$ D$t$4$YVPv ^À=9ua9ga"@9+d%l95d%D94$h97$`9&a"p9SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP $LL $UT4L$ L8L$T$T@Lƽ$$hVWUR1 uD5<w |5L Ku1PPD$P )ƍD$Phd@V+" |$D$|PhedAV" Vxf$1 GaD$P$,hd%t$V 1PPV $C]su PUhhȪ9t$t.ɪ9CD001 ͪ91 u=Ȫ9tZF9|4$艬ja$,hQn%$0u EPPL jOh9D$4Pa  D${O1ɳ$$uƒrL+1Ht$,D04$t$$,hQn%uf EVPh$PP EtE @E w-G$9@  V萫؁^_[]1D$L$I@P$9wʀu/9Au$9 $91USWV$$1$hWVt9 E jShWWh;Wh5l9Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur$9A1ËD$1ɋ0t1ur$9A1USWV ։D$ $E1$ z D$$ ,$D$&e% $E@e%u\e%D$$5e%Oe%ue%F\$$h9EJ \$\$$&HD$\$$)|$=X9=9=h9$ <$D$D$e%<$q|$4$D$ h9D$s%l |$D$ X9D$9D$e%=ď9u$ByD$1Ƀ |O3\$`J3C|$D$$$$D\$$({|$!<$D$h9D$`J3{=|O3$b#|$l$ D$D$e%$kljl$4$H K=ď9u $fxD$|$D$$.$$C\$$'|$u1=9=9=h9$ <$D$D$e% <$2t|$4$D$ h9D$s% |$D$ 9D$9D$e%$juLl$ t$<$D$Qh%i$ \$<$D$h%i$6 l$4$:G > ^_[]Á=]M3ftp]WV%={M3PFSWV|$ty9GO4VSM*tRV0 t{S599Vh959hN%hSO jSh%$#w fG\J3~"PptVvV1^_[ËD$ 9Ɓ9 Բ9fH ز9fH1SWVt$99V~)S4:Q FԲ9Fز9F1^_[ËD$L$01.)fSWV1ۉShPS$ tD$$PY t Vˤ68V跤681ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6*u61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW3Vy 681ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=P91SWt$ t$L$ T$#D$T$SWt$ t$r#D$ ׋9t$ t$(2f%L$\PSWt$t$,t$RPPQ&K $P91WSt$t$#D$T$WSVt$"É֋=9t$Ht$H迍$PWVSt$t$f%PPPQJ $VD$`Pjhq1@USWV u C(D$|$8hjW/ wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QjJ<$L$ PP@Ǿ'|$D$u$'B 'B'B'QP׾'B@ tu Ǿ('pЋ$+L$L$8L$9ǾX'HQQQQRPRPjD$ tj\m31҉tDH@tӉOGڄu܅tEۋl$0t/t)h$#SD$ &L$ tEH/uj#EH@EH`L1^_[]/EHjSP2 EHHLSWV t$ vDh&=&WSA 1WSSPPjjh= SuFDNHA`1 ^_[ËL$Ahh1USWVL$Ayg%sFH@HthGg%sFH@HthNg%sFH@HthZg%sFH@H thbg%sFH@H@thjg%sqFH@Hhog%sS\;T p8Np,zs oh$b#Uh g%sd{91F( {9FH@LP`,PSUhg%W{9j5P9vv{9j5P9v$v 59RPSUhg%WlpT{9FH1@LQwFHpX59PQE|FHp\59Uh'g%FH@`L$Ph&=&jQ9 hw+VjP P5959hg%sV"bJq+~V|$jPWRUvPQd@( m4*WP59hg%sIT1hh*P5959hg%sh^_[]Ës=9h*PWUhg%VҋFHP59UUSWVP $1jlv nD$~ 1ɋT$RL$QVPL t|$@trL$T$t$(t$t$4t$4$vP|$,|$^1ˋ~1 u5~3|$u&^3\$u|$t|$;>t&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vHD$F@ F59me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|j94$ukGllPwGX FPvt~C $i)ىQRP; 1D7D77qfD7 D7 j4$~Efn'  V)RQP fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A iOu\$ 9fA |$tAqfAAj 1AA tAfAA A AufAAO) 91jEVVh5h[hrjJVjVQPh094C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*ChW%PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$LC$10s$1C$s(!C(1ۅÉ؃^_[]hif%hTf%hlhf%6USWVt$ kFllPv9Nj\$FFi )tkllklPRQu ,$kl11CPsNj$ /L$s)RQt$  1/D/D/D/ i{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV9t$ 1$V[/} Vٞ$T$GD$ pjVTD$D$ 1ɺ<t$V"t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$tt$ Vhf%D$DPR D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$PN |$YtZVk MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWVD" )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơP9}] aVt$ t$z؉e^_[]USWV D$ 8t$8L$j QPA $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPpVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋P91щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSHD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$h`2$jV C `L$rL$DPhf%uL$DPhf%jQ D$D---D$D$s9CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVhf%P$M SVhf%PM V.W%SP9D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`h`2$j$PD t"?tt$ Whf%D$LPDL D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t P+$PW{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD B$uR1jPPPh-hPj jjj%VjMF4x!t$PW0V%1@^_[]hf%hf%hhf%LWVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ 'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; ؀'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh#jS t$]E٤fEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuBt#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=,9t@u.1}hGju tEx i%rti%ti%M u@=Uu,>t'D$ L$9;\M`|ˀuK(Ѓt tu tPjbjWmPƍD$(PVſ$1 $$QPVO $VP9$ul$`=u]tP$PS: $5fǃU'V~PWh"$hi% uQe^_[]SWV0\$@1҉1 F FFF =(9tjP4D$VjRRS0<^_[USWV9(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$hi%jkt1e^]USWV8=(9EM 0~klP1МËE E8؃lklQSP ߾d'9$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =l9u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPSnx F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ hn%hn%hehVn%BUSWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSW L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$|:u l|:D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQPt T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(|:u j|:D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$ 't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQr |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut o%1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPVo >uD$ D$iousD$fictO4uQG4 t51ҋ5\m3D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDkg l$(Ph p%U{b h"Um [Ɖ$Uhp%jYu D$Ph.p%VFu wXw\w`hRp%V/uPwdhip%VuwThzp%Vu f1ۍ{aE4('WuWuWhp%Vt E< t<uEMPWQWhp%Vt$<Ip%9|"#PVwtC9z1hiR%WTtV± D$PD$Pt$\$4Shp%hp%WS 1(^_[]ho%hno%hBho%hno%h1ho%hno%h ho%hno%hho%hno%hhVn%轺USWVhj{{1O1ۍD$ShPS$4v9+ōF,PhedAU% l$$4$0$($<$8у|1҉$$Hd F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Qk D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$,$$hp%jP r=t31>t9>u 9>t0uk9uVVOVUt,1@19$,|;ЃVt$4,؁^_[]USWVHD$1PuهRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^dD'uCa FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[ho%hp%jg6ho%hp%jh(ho%hp%jiho%hp%jj ho%hp%jkhVn%蒵D$T$ L$DrRQP!h ËD$Djt$ P؇ USWVl$j/U 1NtbNj\$)CDWPUŬ uHD/t(t+t!u GF "u^_[USWVPӉ΃=l9ui"sv|$4L$0Rt$`VQW] ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=|:u >X|:~V19|(1@@89|~@w1A^_[USWVP=:|$(L$111=D'"\$uӀt0t u@tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1hD't$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhhD'h9 9k911KjIdƃwD'DtGCuޅtH=:P d:t)1ɀ<t 'AuV\t^_[1V :t(:1t ҡ: :F9r:Pt^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$hh%jQQWRjjhq%(,1^_[]USWVhu}WWPHD$T$9L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv9@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  $b#1ۺL$#PWVSh0RQt$kPW$b#PShPV9VL$'Qt$t$t$ t$PPh`g$h$Ǻ9$0Ͷ$9$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCC4ffC C BCfCCP=:rC fC*C,^G1ۍD$(huSSSSSSSjjWPh貓48P胓@,hrt$VWrW膔FuQ1K59]mt PKmt$A591m1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]hr%hq%hyhq%USWV$(E]0輬ƋEp謬ljl$E@ t P蓬$b#PWVSjh\1U5P9|$ wwg%t$R59RPSQV׹ U5P9w$w ʑl$459RPSPU覹 G\$skhSjPD P迹Vc9j!hIr%Vu V|h裫%L$59PRUQ hv$59P%PUS hKPSD$Phjr%hh9Ǹ 1҃9Q9A \߉$4PWhd0$j$W肸 hWh9oN Nw@EƆ9 Ft3N$t.1@Ƅ9-H9s Nr,ń9$EBL$ ;QU9Vh|r%WM Vh9WM h$&İ^_[]USWVX] E81h$b#PPPPhr%PP衷 9_ vSL$QSWPL t@D$ tWD$8uN 9uhƩ 9D$9H*h$b#Vhe0$Ep]+D$8u RPt QPVW҃P91VSt$t$D$$VSt$t$ݎL$8QRPt$ t$hr%Ep]D$V9p1h$YQVu WPTtY$UtOwGD$VP薏)vVQj P蟛 W@ )Q$YQPlK H LCF;puD$VPh"$Ep\ e^_[]USWVLt$`T$d\$1*kvs0C41GPjhdQ3  9u vEL$QVUPL 1hPPhhhj6Pjjt$(SP衅4ōt$ VPqwU腆Sz_~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 59'_|$.9L$`ʉAfAD$ 1Ƀx fJ1O S^1L^_[]USWVpU t$01^F4jjW1AǾ'D$ǃ@l'SPHD$ $9L1OًP|T$|$`1 |$0jP4D$DD$ P9|$ 9ϋ$|$1HPPVt$t$WRQjD$L$4t&t u$Ut$ t$ hs%jt$#LWV $ ^_[]USWVՉfD$/D$jh`%D$5謔t&裔8t虔SPhs%hUi VSU6 991j/Urm t5ÍD$9tK9vH8/t@P> CߍD$ PWD$%= h$PW] FƄ$/u&踓$QPhh%hU聠 /h$PU5 hh`%U5 e=@uW= x*|$VW$PZ5 9r>?0|$WW W01Ĉ^_[]hU t}/u }$$tcD$UxWxƁ`|$tVhW%U[5 9=VWUC5 9%|$W x(W7$>1F1S 0jh*#jm SWVύD$ PQ1xVD$)tOjWx@ljj PW[ Wp u $=rɁ uƉĜ^_[USWV h讐ljPhW@ji \$hjSg jhs%D$ƍD$ PhW@VGi t$1hUS ,$'tWPxu-9D$C E,$ !u1L$PPPPh0jPPjjj!Qhm4t$t%j=t$VWf_Wzn6V ^_[]VD$@t(L$ 4@ƌ'VhW1Ph F91@^ËD$ 9fH 9tPPQQQh t%j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺ek$L$~D$<P t3$b#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$$b#t$DRQPhvv%jV` D$ T$Bj5P9QPJr$b#tC%t$DQRPhvv%jV D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o59t$hh%jt$hVD$XP1WWjjj0賕,P9|$4D$09L$QW<W,D$DPV[~ljӍD$DPV_t|$߉څu D$$H؋Pٸ"D$<h_%t$t|$,] {t+[1hW%Sst Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$hh%jt$hVD$XP1PPjjj0?,j D$DPVp D$׋D$@t\m3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5P9PQI|$ RPh`2$jW ;9CVDSjP jPPh9+ V?(^_[WVt$ 5H<N5H<q~$uFjP8F$1O~(1h9QQh!hW hRjFj WjPv$h9{e4F(x;F,VPOWv(afv$T?F(F$~,v$2?F$1^_USWV4ˋA@Pjq$z C{$t%K0 u G dfG lJu,'fG G5G(-G G,.G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPc+{$4^_[]V$j)藆Nv811Fu >tlIut5t.j+ȅj,輅L$PVhψ%jPQ@ 'u tEj,j+荅L$jPPQW( h"#7j*fL$QjPT6 h$j-?t$R59Ph$jFV辒 j.h,'PVh}v%hh9薒 İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5P9RQ;jL$RPhw$jQ G<(\(|(Pu#]j#]L$>PSWhg%j&Q%j5P9SWiL$t$>QRPhvv%j&V蹑 $F|(,u)|$hgPhv%j(W膑 <$1e<(Ou*?D(Ltۍt$h趃PWhv%t$t(Tt(PPWh$j(V! 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPhv%v7t 4$;|$|$upd^_[]1؍L$>PWhv%j&Q舐  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWhv%j(V 4$h^VjP lj|$D(dph-PVhv%j(W赏 *USWV9$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá9H1WjHDWWQZơ9$1$ 9@u <@TX uDHXT=T9tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W$b#WRPPQ1ҍD$*W Q$b#QRhQPD$$W Q$b#Q1Qh0QP&)ߋ90D$pL$$QL$.QL$QPt$SPW/ 90uNjpfL$$QL$.QL$QPWSSj'B0 h$0+|$pG$DŽ$$T$0<$tT$@BfBB1ffJ B 1BfJB-1B fJ*B,;1=:r~(uB0fB:B =rID$$t?x,u xPtlIu&59t1IHH Pt$$VW59, >|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,OhW%D$ Pc[t5h_%t$ N[u$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0H9)ދL9\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$| L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(6| L$)։t$ t$A59 1FhCw%h2w%h]hv% XL$ Nj\$T3L3ȃ3|FD$D3|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4rS tt<1^_[USWVGD$59l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 1:9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDX8AL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9}P9k<4LE1UЍe^_[]USWV1:T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=D9t*= :11M<t9\@u 9DDMHEr=@9tO :D$PP1ipt$1t9 :ut$P9t:,@uލEpr=h9| :J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@ :D WVu)y8u.q$t"y8uqxu Hu^h4#hx%hm h(x%?D$x8u@h4#hx%hm h(x%>V 9; 9tD9t99t‹9u€92t 9^WV΋$tRttyu)99tЋ9u90u1H|$59,1C1҉T TTCD 7k<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D 7$kz%h^\$t$uq :t)PhSz%h^uK :t(hhz%hq^ u, :t(h{z%hR^ u :D(Fp=D911 :Pt4 :t( hV$ P L$ 5| :`8~8Ph{%ht$%Vw> hV$ Pa L$ 5| :h8~8Ph{%ht$%V1> hV$ P L$ 5| :l8$~pPh{%ht$%V= hVU L$ 5| :p8~1Ph{%ht$%V= hVU L$ 5| :7 878h{%ht$)Ve= hVUV | :t$PUh{%h;WD$| :ts $|$|$ u^ 0D0<4t|88uL$81ɋT<|Dtsu|$ $D$@¸Ѓ=l9@D$1HD$$D$1i8 :$P59\$ "$x 1ۋWSPQL $($0}U$WX3 W|8/tWfDŽ/ : $< RP$PW t $L|$$t0|$t)$Pt$z9Ǎ$vl$t$؉\$C$;X |$O|$\$@|$5D$tL$4= :,$V PVhs%hD$)P: 5 :.$b#t2"#PS2 >tiD$Pt>Sh-|%hfT$\$  :$DL$4L$0 :0|]t$VPhs%WS :( ( PQVh{%WSt$\$ CCa5 :.> >,>(>$> D$)Pt>Sh |%hTS$$(t$,t$(r 9t P P91`9tWWhVy%CURWhy%hlf3< 9t8Why%P< 91Ntjhly%P< ^_[]1N =p9tt$hx%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ 9V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$T$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃxP90^_[]h4#hx%hm h(x%pUSWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4L'jP8 D$$tIh^_[USWVL$\$ t$$tNKk.WV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h&b#US' 1USSVVjjt$" S'u xL$1^_[]WV|$ 1uOG P t/1; }ON"h :x 71^_WVt$ F1hWP  dž dž dž$dž(dž,P40^_USWV$h^2t$hPV $$$'D$@{tUhr%Vt USVi 8Ouڋ$xhLuhMSPhx%V}C(~Ph&b#hV% }hNHC,~Ph&b#hV$ }hO#C0~Phx%hV$ }hP#VPhx%W}^_[]USWV$ R3u*11IhuPPPPjj PQQjhQ3P4 R3Nw'$R($'WP\1N1jWWVVjjhQ lS, T0D$4h&b#QP# 1PD$PPVVjjU D$Pq x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jP4 IQkd)Qhx%V% ^_USWV$h^|$hPW $$$'{hV VPhx%{hWvvPhx%W[hXp1~,t[hYS1~0W[hZ6ǃ4V uh^V0FT~PhN#hW! sh[[h^1~`{h\vXPhx%WF\~Phx%hW*! sh]mFd~Ph&b#hW! sh_HFh~Ph&b#hW sh`#Fl~PhN#hW shaWPhx%V/[hb1~pPPWhx%S:^_[]USWV$@1N R$fT$' 1jWWVVjjhc|Gl=Ol9,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h&b#QP- 1PD$PPVVjjU D$PCm x1pGp1^_[]1wwVt$F~|F P t1@1FF^SWVT$1ۉZBr 1Bl@ZpQkd)Qhx%V輦 ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_h|%h|%hhC|%@ SWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$t9uht9s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW 6Pw$$$X'@21^_[Ã!t*Wp1@<QKWPV rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph~%Q D$D$uPh ~%j[t1ۉ؁^_[]E@USWVt$ $=`9$Wh%jP 1t t^_[]Ë p9! ÍD$XWh%Pj1~jDj.tD$$"#Vt$\hVj hD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1hr#W ƀ8tt1tCuVL$ D$ j jVl É$qj jVl t#D$Zj jVl D$T$C\$ \$D$|$u\$uthhr%S hVS \$E61ۉSt$,j SVHl É$ tbD$ ʉ $tQD$ D$tGjh1$t$}Vf tOjh1$Vf tdjh1$Vf te|$ush"#jeD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h'l$}Ue hjd$tJ@j`PQT$ T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\P_ T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<*W߅uv ^_[h%h%hhC|%1 D$ph%j iSWV=d95l9t^s譥3裥t$#$t$j(PVg 4$a_u9hsj|$0VPh$jxW WVV &t Ĩ^_h!&h|%hhC|%C USWVσ=d9u hٸ 1t0?t+d9t!-l9E WPb tt/|$thh%S- !hvS u4$$$$$St$h~%j ^_[]SWVD$Qt$Rh %Pj h"#t$W$jhЌ'P uWh"#jV$tAt$hr#W 8tjt$2h"#jV$ut$g1ۉ؃^_[USWVӉ΋|$|$tBh.%S h5%S h;%S hA%S hI%S hO%Sv hV%S` \$hy#S ǀ?t($'WP# uE F@j`WV -j(W< tj)P+ t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVU |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h&b#WUN WUUjUx9 H>wѻPD$x0h&b#SU SUUjiU@9 H=wˉ9DD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]áx9tq.x9Vt$ x9u W. x919vFt=Nl :wu1w, :::^ËD$Hs-s D'.h4#h%hh% Vt$ =x9u-(t;u2L$ rȃsd'$tu/:1 ::L:^WVP|$t$=x9uI-j PVO =v1t-h;t 0 :t4, :^_Ë $9u։^_-=(&:t$&:ù^-D$1ËL$T$t$ h5.WV D$$s1!t$ T$L$7GWh. ^_SWV L$T$ D$$t$,|$(;sCShn-^_[ËL$T$jh-WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF VhA@-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh-^_[]VT$L$D$ NFA0F VhS,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Phf,D$Ph8H,1\$}UM;t;Gs} Shw%q} ~Sh,{%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW L$D$ T$VQPRt$Vh}%h$P0 $L1QhPjVx`WhydP] D$V;|$t;jWSz \$;MU}h%h%h h%; 1e^_[]RSQy ShX%RQ ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSƭ )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H, :)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSVr )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt SU. @$\Cǃ1:k0hWV= D$4WhPW$XiD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(]%tÉ|$U d#D$0jPUQt$(%%1 Ⱦu#\$,hPt$ k W2t|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,PT P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjYjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x Ptn{ C K$;}sL$4QjSPL t_D$HtW, :)1ɉAw Puu2S"j@jP fdžUSo1ۉ؁4^_[]hu%ht%hh% USWV4D$L D$PhjhƋl$X\$T|$H,'WR F|11Kn^؃N$F Fdž?džjh>US @džPWtwt%D$ D$D$D$F114^_[]hu%h%hh% USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPW&K D$vP6K 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h%h%hxh%Ώ USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D7U154Q:50Q:58Q:D$D$ D$1D$hӃ%WUp; pu <8Q:e~ft$lt*zD$ƒbtCeubD$벡<D$ ChjVV5<hރ%4Q:0Q:zVhVV5<hq{$D$Vu=_39}4D$$D$l$ t%1PPUV D$yUh"$IL$ tHt$(Uh%V) h3"#6uRh%fD$0Pt$Kp #D$8=$$ 4Q:0Q:jÍt$0ShV_ u UPV)v UjD$0v 4Q:0Q:S4y h%t$(T1|$P Hy h7%- y hA%vuWjt$zG1St$kG4$t$Y%Sh#PP/t1hO%t$t$!G4$ft$Z5DQ:5@Q:HQ:f3|$tlf3LQ:"f3tzf3=l$u1HL$(Qhht@P~t PtL$* PQ:t$Buh^%lʼnPFyh%T, D$ yht%@$uBL$$4jP?F4$t$xV6 6h%j 0PVhO j 觎 j|$WUt$  x>tq1.SPt$  y4 19u2@Q:DQ:)u 8t1FVh%1FVSh%Va/t$D$D$L$D$ L$ D$|$tvD$ PqƋT$ уƉǃtωÁtt؉D$ u g 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj R UNQL$ɋD$tP肟 V茎 P h$b#PVhɄ%hlf3˪ jQ V jV jR3 VP^Ð=R3u R3LQ:@=u1HP1;R3USWV}uCjhhQ:? hQ:xQ:lQ:|Q:pQ:Q:XQ: \Q: dQ:`Q:|$(jW> 5XQ:5@Q:\Q:DQ:?X+=xQ:|Q:@1;Q:)ω|$$\$ dQ:95`Q:T$s;D$0Q:D$(L$, |Q:xQ:`Q:D$dQ:D$$D$ =HQ:EtQ1$w ww7wwVWV @ 7www ww$PWj M$-1~~~ ~~$PVj֌ 1@F ~~~~WVW? =HQ:B5fDŽ$ 8Q:t$Ph"$hQ_ 1F4Q: 0Q:ƒ\$\$xT$T$|l$x̍&ݜ$݄$ l&L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh2$QP譣 PQ:9|ӡ8Q:tPL$| L$)΅~DQ4))h$b#Sh'Rh9$QP0 Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4'QPhC$SW跢 L$(+ hQ:T$,lQ:NjD$0+pQ:x@B‰L$hT$ll$h\$@DQ: @Q:1F؃D$@5|&|$vqL$`\$dl$`̍&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4'RSt$DhP$QP9  4Q:0Q:ȃ||=DQ:@Q:݄$|=s4;T$D$r(|$$\$ ؍4)hr$؍4)he$QP襠 ƃ}u 4)h"#QP ơLQ:@=u1H$VQP e^_[]+XQ: \Q:T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppr"u%h8%T* 8t 8#u$SjVV tGtV $1E48FB$)Ex t$7@[h8%h[%,覂 h8%h&%菂 7h8%hI%eS^_[]$Vj$3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVhjPEuh%hg%{RÉhPKt4VhjPMEuh%hg%-R1H^_[USWVp $$$!19L$PVW1Hl$Uq ƃU! VD$PWZ tb$UtM$dt蔔 $dPU t$jWU tu)$-j4'WBU虺 1Hp^_[]Ë$j-UPz, D$L$PjD$L$PjSVt$ t P닆t>PDdžW1ۃ1ۋt9PlDRdž- t^[VV Vz 1u9 19^SWVlT$|$$VPC1Nt/ǍD$Po PSW t Wl^_[USWVӉjh0jQ ǃt{jjjVz L$ F[9#t$b#<9#tŃ%$b#$b#t %؉$b#t`%|$u$b#SQRPh%jhV ^_[]USWV$=~~ 71Ha~B11ۋ$4Vn <(Gs@ ,PVQ&Q C$9u1$WQ  ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)Q} jj7ƅuƋNtHNO N uFF9sSP8tVF^ St$PCP ^GNON1wOWh Pw {@v=V=1H^_[SWV$uShԅ%h{%EM $%~GuG$O1@G$GD$GD$ JPRv L tOt;HO6{ 8 { 89h%h%LNF G8~ ~u3FVh jv S?uh%hg%3Lt6hWv  t%uh%LPWVu  s V^_[WVp׉$ftPh%h{%K jL$PQW jjP$ PjW  tnjjW t\PjW tHD$|PWV t2Ph jp >u6h%hg%J"h%JW h%Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Swbڃs tAt1t% t&%SL@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV?t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW,jW,5^_WVPt$4%@5@u^t8tW%V$%8Vh&j?#45@u`V,2<jP, u hL%G,dž,sh5%|Gj?3 t1t3u5$0$ $1Ph$%F $ $1PWh %F^_WVt$ h#pG8r4@84^_8t8t uh>%W荬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@R|uh]%FD$n D$SPU69Vt)ǍFxۉ,$t1j@SP! SUh%F SUhr%E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ jm$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Poc w_ǍCWt$PF ;)QjPUo hF%Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQhč%d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYh%Qb~PtVAt(t NLt m#t%PV^WVt$ >~Lxw16tЄuOF$uItV@u h%4=jjAV? u h%=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph%;G$C$G>C>>-ك**PWQ> WtHAt[ƃx t Ph\%p;s%KFNtTHNUh|%;j 1Oj 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh%:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV+US?^_[]USWV׉΋A Ph%6:11BU>%tPVٟVUU1n 6ujn1^_[]USWV $ D$PQhh L t$ḣ%h%9$1Ph%91F\$ MbihS$(V EuVh"%?9uh 87t uh 8 uF띃tVh"%9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=-6uFGGtIO9tA t3@UUD" _6WQjj.>jV(t0<t$VtSB< t<=VS= ḣ%7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/kf 7 Vh7%h:'#!7T$1|$`F(f9t(~ tωӍV QPRhK%6ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$ P\$Sh{%6 <PUt$WPSh%5T$ V>t*4$QV8 H^_[]WVt$4rDD$ tN8tCt;D$ jP, u!h%h%5 j-^_Ã~+ajjj蕯 ̓kh%h%hƈ%5 1m9h %h%hƈ%4 <6Rh.%5@h݈%h%hƈ%4 111dh%h%hƈ%w4 @+X1BWDPU h݈%hֈ%hƈ%14 11G1=Q:Q:6u P9W+Q:zh%h%hƈ%3 t0S vPh6%44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4V%T tE9u݋D$ 9t9 u~<$h'%WM1PPt$$ sUVWy s WW;9t>G 1PPt$$ UWD$$ W1D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;hk%WR .h|%WR !h%WjR D$$D$h%W8R |$t$<t$TP ǃt1Fl$<48P GF9uW$t$<l$UP WUD$P E t=1FߋD$@D$PO Wt$U EE F9t$@Gu݋$;D$ut$St$@ސ t[uD$471D$D$D$471O ^_[]K\ |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tWM tFt$9t$V#Ѓ с u VXVu{^USWV$1t$t$($|/xh%WK hk%WkK \$,hVSU jFǃ0҉%R31O$$0@4jVe9u11@PPM$u1Ajj- uD$l$(D$ D$D$$d%t%Uhp'P$V?u$duiM)4tQ6uD$ 럍Hv H w?$ē'<$\w$'D$ %D$[D$ PxGD$%D$2 $d 1@D$D$D$$h5<" $hD$%D$D$%1@D$x ˀD$D$FD$9_3t$bS{($h($$p$l_3)$艄$\$,Su1VVVS6$U$PjSA\$h[%芢 D$9_3$4$|$0W ?_31VV4Wo6&$$Pjl$|$t\UsHrBPt$h~%# t$\$ Sfg&S 8$U@ $`$d$`$d_3T$ QR$4 $$`h{z"hY%l$,<$lD$ t<t,<ulh%輞 D@U+ uDhn%薞 LHUIL h{%t TPUs D$1DQ Vh""4$h{z"hh%"D$1Cl$,$bu Uuh{z"h%d"D$PU'$tCt)QqtrqpQ#$PyDŽ$WU':$t P@ $ A$2Uqq$U# U@$;R3t P$dP@1uh% !$dt3$Xt'L$jQPۻ uh{z"h%#!$j"$hfhf3! $J$d ؁^_[]Ë$r,u'_3Qj$4 $u*$`1PQQw $$c@u h%$VUI h؊%$`5 $d$`$dUh8[jj$=t'Uh\[j$($}h{z"h%h{z"h%D$L$Ph%U$"h#(xN 8th{z"h%3$`UN L$a+N 8 S$`$d$dl$,hh,%M u!M 8th,%h{z"h;% hhI% u!M 8thI%h{z"h;%^ UtUh{z"hY%Uh%1k$`r;$d@ щ$`$dU膶tePh{z"h%KD$ Pjh0j, hS"#yUPhn% 5$`$d҃ ց u$`$dr>1r_3$L$ QPUM W$`$d %r _3$$b#$b#t% t%VQRh &U{\$,1D$WhPIu h4%ShWj$$nuh{z"hg%N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x uh%P%$4PF$$9|t$t׃z Ru$dh%P_S[$bh%JhZ&yD$ L$$$XPUhVj$d$ uh{z"hg%6 $dh%谅$dD$ L$$$XQmUhVj$d$W uh{z"hg%7S$D$xh{z"h%`_h%h{z"h!%9h{z"h%*h{z"h@%h{z"h% $O Ph%$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@hԌ%PJD$,PB't#%@tD$,Ph&Qj$dWD$0P"0$01~ tVh_0jj$$vSE WVjh#V%ʳt*VPIuVhB%MW}h#V%hÿ#0^_Vt$V蘮t$pApdr$PhJ%NjjtVhVjdj ^WVPt$D$uPh%h{% jP,譲 tuIh%h8uM, ,芳dž,>wt=D$|$ffN(ffOfuj ȉG_1_F*N>QPS F>)^_[USWV$lt pvh%PWJ t=wM$lD> 8th%h"$h$u)h%h%hh% $$l~>1ɀhL QSP ƍl$hUPt$ ͵U- =wfD @PUhh%Wudh%h6%htI{>tA,$fEC(ffEEK*S>RQPX C>4() P1pČ^_[]ÍF Ph%n tt {>u[[ht h %? ~>t$fF(ffCCN*V>RQP F>4)mC Ph% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#; 1HXjVu V >8t~L$ T$pFhf@H X@fPFM1^_[]h%hk%hGh%hk%hHhL%4 D$tFL$tt 9Jt :  : 1HBH@M1@h%h%hhL%=4 USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;v&: 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jNDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h%h%h h(%h%hh9%h%hhL%T2 L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h%hҔ%h|hL%[1 D$t L$HH@Lh%h%hhL%.1 D$t@Lh%h%hhL%1 11WVD$ t!L$T$t$|$x0p4P8H<1^_h%h%hhL%0 USWV(l$<\$߾@'1|$ |$|$<$E4t.1FM0 I?r6 E4  G9rՉt$@Pj蕢 1Nt91D$ D$D$D$9E4t$1E0jS45 t G;}4r1(^_[]h%hl%hYhL%/ Q:tD$ Q:QQ:Q:WVjPj1tMƃPj) t/1vN F NN F N$(F(N,FH V^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t P5NSv@1F@FDFMF t@PtQPV PO؋PtQPV$ P.F uPtQPV, PF(uFN^_[jt$USWVu-~L =Q:t'Q:H Q:Q:N8tv|x| @t,'\$$lf3SVUO Uj [ V3 s SVW  ^_[]PL$T$ D$$PXUSWV։0 $VhUF S PUh:'#W/ ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXáV3ËD$V36 SWVhS$ s 1OtFƃ ||t . +D$HP V3Ph"$Q]  V3^_[áV3ËD$V3@P V3 SVt$ } hjhR3hlf3 V3 s1fà , jSPD  t- V1H1@^[# fVt$tNVJV?VjcV-jVVO6v^^SVt$ V1Kt=jhj t!jhj 1ۃۉ^[e Vt$t'P軚džtP蝚dž^}D$t$t$t$ SWV$hjW( C jPW Whi 1NtF$$T$ !fD$f9t hWhi` t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv + 7 + V1H11Ʌti $BD<IG9uލ|$$ ^ F>L$jPWVT uF>*PWVy 1T^_[]VD$0tVjVi v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8$VGw}uM ufE O $Pt $jSVPUQt$4Vjt$8!$?=^_[]ËL$1t$VËD$t 0 VD$0tVVqv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV|% Fjŋ$@V8~ $1WT$ȍD$l$C txuD$ Psot uAutF L$0QPk tًv\$~;1$D$0Pt@ tF9u19D$$"$8ЃD$P1~11TjT$4R4ҵ t GP9|PX~11\jT$4R4藵 t FX9|XD$ 9D$H$~11LjT$4R4B t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$7uVhx%t$ 0|$w$H;D$t$\hjKlj$w jD$4PV CG$C D$ jt$ VU C yQPD$|P D$lD$ @D$pUhi$\ l$D$m@t$ FGF<<y<$l$D$0P$0u R`~/1djT$4R4C F;`|ӰD$|$0WQE~t$\yWh%e$_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQ $t$6@u<$tWztmWqG@WifGDGȉGHW}t GPGH$G sWw}GLGMO9EVh%W%$7t)|$ jVWR w_ jVS> r# 1N^_[]j:SV t/@1UQhQQj QP G8mt" (G8GjSP O t \m3DPu:pKCu1l$PVhVVj US$ G0Et=it.u1@1QVhVVj VP <$ O4G4SWV$WjS F jPS WSh~i tD$Đ^_[USWVP*!D Q: Q: Q:Q:hט%FQ: Q: $<  O+VQP 9v1 LJ\$ I;<j,j@t ǃD h%Vj,jHt ǃL h%'j,jPt ǃT h%t$$Wh'VA D$9rh%h%[H$|$ 7D$PWD$t$hr#D$Pb> ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$Sb J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0W!qD$t|#t3=w&AL$0h%h:'# HD$1D$S0Wp 1ɍD$D$$D$ 01D$ύD$PD$$PD$hr#D$P\< ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h{$U h%U h_#U $D1)h3%U 1Ʌ<$t$V H9t- t u!H\Ht$9u1@$D$$<jPS) 1Ʌ $1@D$S$@tXtT$@S $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPdg t6ʼndt$ `Dd<t A`Nh%<$Dt&u"t$ $< 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U@'J tu;uHUh%D'D$uuUh#t$$t$$PL't$$^_[]USWVt$ t-tQ  8uP|$t-tQ uPtt*t$1PPU6 t xTuXTj卆jPW5 j\$N@DtW,Du싾@WHLtW,Lu싾HWPTtW,Tu싾PWX\tWg,\u싾XW(xVo^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(_3|$$t)`#L$# $ 1CƋl$ \$18%s%Shp'Pt$ujt$\L$,1VSWPiUAjt$\t$ VSWUKU#jt$\t$$VSWU-Ujt$\t$(VSWU|$Xj=|$\W5 Ê@tC< t< u CCu1j h%W j h%W jh%W jhؚ%Wi jhњ%WQ jhǚ%W9 jhĚ%W! jh%W jh%W Pjh %W 8j h!%W ?L$P1T$XPfL$T$t$XVY(1Kj/V uD$|$PjP9 L$r L$rL$T$t$XV'1Kj/V2 uD$|$P jP XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;R3t P11j|$\W6!ƉD$VPyjW t>th#V%VC V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h+%h8%OD$Xt$P jP h%|$Xx D$P$<t$X  $<PU D$PX|$X hv#|$\W t$1VWjWWWWP L$P9>t$Xhb% |$X t$1VWhWWWWt$tv L$PA 9>t$Xh% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVCO jt$\t$$USWV%Ojt$\t$(D$Pt$P1t$X#džD$X= 84 j/P 1|$Pt@j/P tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$t L$P9>t$Xh% L$P ЉT$jt$\# h>%~|$Xq j,|$\W * ƀx 9l$Ps%ƅ |$1WShSjSSt$t ,9h%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t0 L$P9>:t$Xh+% |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP l  L$j ZP< t< lGG|$Xt$P$*t$X蹨 $h+%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J|H 8Ut$Xhd%011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h%@D$X  y@Uh%D$P |$X D$P D$P D$P |$Xn$6t$Pvih%fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XV螪@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV\Fu8jt$\t$ USWVBFujt$\t$,USWV(F t$Xh%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tVO 9]VhM%'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$t超 L$P9>t$Xh%|$Xtut$1VWjWWWWt$tu L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t7 L$P9>At$Xh%Qh7% %P C t$Xh:%W à \$Sbƅ|$PPhG%SV  jvV訾j/t$\ AL$1|$P# KD$ɋl$t t OGuh^% N|$XoE1j:W. l$t2At$1VUhUUUUQ覃 9.Mhm% j=W  ED$(@1 t H@Whݙ%+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U SGJVh%>nT$P   xUh%=D$(h+%J hM%Ɔ <h}% D$Pǀh% 1K$dVh%D1DDD DD.u hE% 1D$(1h$WxjhQ%Wb1xh%WJh)3$W4hh"WPh%WJh %Wh[#Wzh:%Wh=#Wh%W hӤ%W> t$ hڤ%Wc h%VM h%V7 h%V! h%V Y h="VZ h-%VT h&%VE h$V6 h%V' h2%V h̤%Vq h%V[ h?%VE hH%V/ h#V Vh%  t KC  t KCWh%Ɔ  xt$P1$ƀhuh%XttC< t< Cuh%0ǃh+%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h%WI t-h%W7 thK%W% t hܝ%W t@Ch.&V th%V D$P@ tsFH t t@@1 t H@ttC< t< Cuh%Ƈhh%wsF< < F1$SUjF tUhO%1C CC"$f8l$1USjxSjSSWz $D9]$ƃWh.%ttC< t< Cuh֜%Ɔ L$P1S=flF D$PV99  7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PS.#CUP!#؃8L$QP#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  h+# 1F؄t  H@h%1K؃<^_[]ù@D$PǀǍ0PVjaC whǝ%F -{]< < Ch%G11|Kh@ ыD$* * h+% C{K< t< tC C{< < Cht$1VWjWjDWWSiv L$P9>sSh%8l$1S 1K;4$(ƍ|$WP1 FWP$ 8UP D$P4$VP L$PT$XjCut$PjPFCt+j/S軹 tIGC1L$P4 1D$PVSj@ u7tb\$1SVhVVVVWt L$P93tQUh.%tGShO%1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uh%j?suh5%ItF1tC< t< Cuh5$Wt)W' Åu"=1rWhP%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP t(t$Qk,1҉T(T$T T!h+%SbIVD$0D$ FD$(F^ t8U ljD$FWUPJ >)QjP 1FFL$TT$`r|$\s72USWV׉ˋt$$V >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=\m3DWtCT41Fu|$ D$ |$jjD$P蜃 T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$PF T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9v 71M^_[]USWVՉϋRË j=PN ,$|$D$ V 1ۉ\$t?t9D$ 1j=S )9uWVS D$\EuV袨4$2 t5ƍEjPt$ Z 4DL$hV%UhV%hb% |$$t#4$ tzSD$%P8|$HWt$ |$WPRVh%Q Ą^_[]ÍD$HPt$Vhr%t$ah%h %h hՠ%h %h h%k USWVu 8Vt h%跨ňjjU襜 jWU菜 Gt ;D$TG9t ;D$TWUWVUurGTL$tIѺ!! tD%WWj3u!( 8t 8t h'%ާW߅11SSV进 tLWVϘWU9t! h%舧WSSVu Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$S'tCPt1bl$SV輓DžGT;CTuoGt ;CtudSWNuVGttCtuGKQP.u6G8K8QPu"Cx;Gxu%W|&t%SSj11 8t h%Wj0u2 8t(h%ʥ|&t%SXSj0u 8th%脥1ɅtWV蓖W^_[]hԠ%h͠%h3h% D$t%@<t <u øP /1h%hv%j;h1% D$t%@<t <u ø /1h%h%jQh1%n D$tBHttu#xðÃxux uxux /1h%h%j}h1% D$t>Ht4t uxjh'POO Q /1h%h%hh1% D$tEHt;tu&xÃxu x uxux /1h%h%hh1%I USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^n Wo1=u!GB9r1ɍ|$0+; /1NjB1ɉÀthAu_1ۀ=Q:uD1FFFF FFGFQ:SVrVW_uPQ:މ^_[]Åt 1u19[:Rt1h%hɡ%hh1% hա%hɡ%h'USWVP|$G<t<$ $ l$W)Ã|WhVH ۋ|$t(ٸF\$$)؃|PjV 1=Q:u+Q:W9u!Q: /1N^_[]h%h%hnh1% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQK ^_[h/%h(%hh;%h(%hh1%Z USWV|$t$)Ã|UhV t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQGSKWVPQ/' ^_[CPh$WV 1t߉h &h%h{h %h%h|h1%= D$tL$tf Hh%hG%hhp&hG%hh1% VD$t&L$ t/fqPp QPI H^h%hR%hhp&hR%hh1% fV{$'Ph^%V u^USWVD$t$V1Ij0V1|$/ooo WV5't-1C 'I?r   DE9u֋-'t/11C 'I?r S   DF9uWt$Vp( 1ɉt$\T$\RVQ2P?}VDt 81I $ȃD^_[]WVP|$D$L$ $QPW: tWjh t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjPI tbL$1tHhӢ%h%hM8| /IG?uWG9rD$^_[]h%h%hhf%0 USWVl$t$|$t1ۅu>t7NL%t Q& m#tÉS1ۃ1Ct:tV"tXtSh%t؉8txt@HtPt؉CjVt.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPVL 1H^_SWVD$1t^|${t 1NA~0jh%W uW# W G9rhf3膛 ^_[USWV |$ 7u ;l$$Ujh%U聺 \$C UPWh%nS$t^DžtnjSW  8th%ho#譙9h%螙1HzSlt$h%h:'#r tG11CGt0WJ ؃uh%h,%-?Ņu1 ^_[]Ë$t|$u%tPWh%h% =mQ?PWh%h%ޘKUSWVӊB D$ L$$t W *QP qNjD$$7@uMh#}k%tQhc%W k Ph%We |$ t$h%W@ {D$ D$h%$U̸ t$h%U貸 U |(6h%U舸 1>h%Qn h m#$UQ 5h%U; hv%U%  h Q&U hs%U h>%U 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Ph%W I4Н'h%W +7$@D$o|$L$ uMD$@tBL$qPShƃ%WAƃ%D$ E|$tShƃ%Wܮ <$tBt88t/S5t"D$pHpDShƃ%W%M|$ tSW3D$ t7t1Ph"$W D$ 0uWU Wܤǀ|$ WD$(P D$ 4#ti%Ph%W; vKL%t$?&tRhɣ%W AsHh֣%W 'CPPh%W  s$h%W S荠Ph%W {Pt;CQt$(stPhhV tVh%WT {xtCxPh%W3 tr7@OǀD$(h`'Pt0ts~ t!V~t&PD$,P9uvhn%ohn%b1OĨ^_[]D$D$D$h%WH t1PPt$0V tc1PPV 9thr%h"$W oET Ph"$W QjUt$0V豅 Ņu1UVWUu h>%$V臲 h%Vq h%V[ h m#VE h Q&V/ h%$ tzhv%$ i%tn|$"D$<u D$xuT|$t SΪu@|$"$<u D$xDu'|$ tjSui%4#(4#4#D$ 4#4#ti%Uh*%W Vh3%Wv SLE%tPh>%WP 3E%t= t1tV E%u vuPhN%W ?q@th\%W|$"D$<uMD$@tBL$q PShs%W;s%D$ S|$"$<D$@LL$qPPShs%WXl{USWVl$t2E1Ft/׉˃PWh%S tEu11N^_[]USWV\$l$|$ttUPWi 1tk<.tghTq#Wk tUh$WY tCj h%W腮 t/tj.W轈 tUW8b 1t^_[]D=|Vt$ 'Bءf3H f3;,f3hf3j k f3H f3 Fut$f3H f3;,f3hf3j ( f3H f3 Fshˤ% Fsh% Fsh(3$ F sh" FҤ%٤%ߤ%%% %@uwxn%rh<"r]%rR$ rG%r<%%r1,%r&fZ#r9%r%Q F sh>% F shG% Fth$ Fs hP%j f3H f3~f3H f3 hf3j f hf3詌 ^ù1%TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$Vtg$$QPVhu%h4%ha%US 1N@t+9w');@MQP&At9w :)߉hu%h4%h[%US ^_[]USWVD$<P] t$ $hy#VM ]NjD$@HD$?1jh|%W葪 ujhx%Wz u|$D$4Njt$0tNF tA.t;\$SP D$P1U1HPUUUUS@ 9l$u9t[,OuD$,Njt$(\$Sv 豪 t-D$P1U1HPUUUUS? 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ hy#V Dž4$by14$Sy 1H^_[]4$2y USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQ蹉 t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$ѵ V ĵ "1H|$0t1rЃ^_[]虵 茵 7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy\m3DHes\m3DH@O\tx\m3DHд \\$ $2f\\ $$ۍ$T$$ۍ$O$sZ/t uP8 tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1観 T$$t4<$t s%|$$u1Fm 71N^_[]USWV Ί \m3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl育 1 ^_[]ÿh 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3V^ 18۱ 1H(D$ p%t%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjS C@G jPSS fC $4CCD V$4Pz UShip螉 C O*W>RQPz UShipg  1N^_[]WVPRQs ~u~uF $%h(%hht%ԙ USWV$l$EE"1ۉ]E E]1SSD$PSjUxt;$tEPW[t&SSD$PVjUVxu-џ 8 tW`1HW`1$ÉGx9wt9wkG uZ$T$WuBt$ptehD$ PUr U$f^9t U:9r  V?`19؁Ĭ^_[]h%oUSWV(ˋl$ FtGFlGFhGj Whri 0t 0^_[USWV |$4(1CCCCC CCw jVSr> Shqi Ut uVh%bL$ȃփ9t1D$j Shsi 0Bt uVh%b ^_[]USWVD$t$1s9s+tKCG u1苑 1H^_[]USWVtY։ϊB<t^<<Fu~^SVUd Utg VW\WuVWWxVS{tPtox軐 /dVWyuVW1zt:xB^t-t8t!8_>uG*SVPX tuU 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$׏ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS誋 |$jjI`Ƌ$(@h@h%ljFuJ1ۍl$Sh%j U h@UFuC 8tǍ\$($PhqB@Wq f<$f|$ jUS: ShlBWp txD$PhpBWp tZ$$VЃuBD$PhfB@vp t(D$FP>F u+ h%^Ft PV)O1ĸ^_[]USWVt$fFtV)vv vl AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ ` FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP,o ^USWV L$@T$*@h t$ Vh%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@ʦËD$D$ PS8CL$QP'؃8L$QPSt$@9r$؃(^_[]Å,$D$ CD$V(ŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUjEL$QPY8L$QPFUt$@+$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $PPVhǧ%S 1I/ދ$0$4Wj$@U t|$r $,84$GP萁P$0Vhا%W蓵SYGPVh%Wn$0$4|$WjU $,t|$w1Ћ $ QPVh%$4 $4#]SӀPVh%$4ٴT$ }ltE$u?ClhPhhWWVh)%$4腴{,t=u8C,j@Ph@hWWVh8%$4@$0t1WlC,;r鋆Dt%@1W>C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$Ph Vt$$@$@$L0- >}k|$`$0PDL$L$QWh Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$Ph St$$@$@$L0* E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VeP t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$|  | V1(^_[]ËL$DtD$L$tPVQO D$ƅuZ| SWVD$ L$tT$$w5| .11t$|$X+9s| "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p\@v\F\^VF`t# P(@v`F`^SWVjh0jN 1NǍ\$PSPhW]trjSjjW]t]jSh@hW]tBD$$1ɉ $L$ L$L$D$fD$DtD$jPWS t WC^_[USWVt$+VjUAChu,$t#tVh$Pj.A^  r%s%PShv%xPShJ%6J 1Bh $ ^_[]WV΋tF>rD&Է GTt tB9tt9BTtI䋆tÀ~>r QVh%J ^_ËD$$PL$1Bh $` SWVt$tgw]Vh7$jE@^ w$wPSh4%H GLheQ ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGH%_0wF SPh%VH _0G89+\$8D$<l$8 &|$ D$ fD$l$|$Xl$ D$XG8N PQh#%G w$,vw(<PSVh%GG0GH% w$uPVh%WG G0GH٨%c1HG8G4 w$uPVh%G 8\$0D$4l$0 &|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( h&|$D$ fD$l$|$Hl$D$HG4N PQhb%F ?G0D$ D$$l$ h&|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu Ptw0PVh%E w$xtw0PVh%Et$6u$HujGtGht:?ǩ%tPΩ%I%GHPutj6=c@O;Au<t ɭ%?u%GH0ts]Sh7$w4Q;ShU+w8P;Sh+w0P;C w8w4Phԩ%D 1HG8G4]@uPD$u>C wiVPh%tD wwhV3uVh%DOhD$L$u2wHS;3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th5%DjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]hW%hM%hh%Kk SWVt$^ She%cBG0+G8PSh%A VheQj 91GɀT$wȈBBV*QRPR= T$(  D$tz tA<t]<tYD$PPj4]D$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph %9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ KD$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSP4 ǃL$D$؋L$؋T$B)Á+),PjR\ ,L$1OAhT|$ 1|$CD$PjsǃSt$ PZ3 G D$G D$ GGDCff_f_1ۉT$SfGEh轥 fGG@D$ffGSf f_ t$WhD$ p\W F Ph%07_ ΃]w'6uhJ&V Vjj}&1gydA$jD$PVo$ D$D$uD$HwK*PQt$ u)C Pt$h%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'PdžtPdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h豞 ƍG 4$D$,$5&D$\$$}%(WhDVje^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0j* u&h4j@`GH%GP_iVjhStSE0H pLJ  twAQ \ BjWh>ajPh%hg%s'sY EX>@P, UB( A J*R>RQP)  ]rts4 t*Mq @T$hRQP[PV]h%2C>t2Mq M*T$hRPQ'PV]h%& PjI1wLw w wL$u]rruG XixiF SPh,%% D$h$PS6NRh%%@u3EpCP t: @ NH M plYhİ%d%u Vh%P%h%$e3=u1HL$h$QP t=w:F hZ%PhB%% wT 1Ƀ8tmF SPh:'#$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP!' hZ%$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6脨L$ <G cSc{ ni;`CLsu&1C &cMScq s$PPVh%! M1C1G G\$"O0)G4)G8uL$YME Ph%B A}w s$NPVhe% WuWVt$ VhDjtht j6rt^_USWVt$ ~3E(L$tW9ud G N Qt$(Ph%zW0Edh;%WWNttxV1ɄutZE tS@;FuK_ PMPShԱ% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EH%j7ruHW댋Et {WZtstـT$sO$tPЃ8u)ʃAr M N@H@USWV׉΋D$$E t @9u ;M$^ PKPSh% EiP6莢$u!}@uHhjjWV Džt jWVjj|$$tD;%EHPVg#8#4 u2j 1Vh"jj؃^_[]ËL$heQWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$hQSWV1{\t^_[ÉjhQ蟻 C\t4WhRjpuh%hg%J 8u"5$V3h% Wh%h:'#z 1NcD$T$ PUSWV$$($$$$_\ftPh%h{%; ch$USY t'sPUV`t3_\t,Ct$?tF Ph%h:'# V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%h{%I t `jW0芵 tD$ WV h%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ? t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r PFPVhh%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@sޮ%n1ɋl$ T$Et*u4%& Vh%M"!%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ J%t$\$SWVStǍF WPhO% WQ} /6uhF%VEiP6Vh"uPj EP'P $,uzh%$,tKP(/ Í$PmSVht$ P^V1$,$t$Vj6S >uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S踈 t$ =4$teSPh["Vt$Wh7%t$( ["ۋD$t$0% P<4$L$ t/PUVt$Wh'%QSPh["t$Wh'%t$$s $PUt$ WhJ%Q\  h%@V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWPy +މ^_[]SWV(΋6ulVjjoK AuA jQV_ t=Ht*ub 4$;PVhw% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ PhW% v B1F FFL^L$h'aWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph+% ]%GHPVq^_[WVt$ F Ph% OhGL^_D$ȅtȰ (1SWV\$C r: 1H4t${GPhV6 ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0h`'D$(P6Edx t]S(YƀH|EdH #HL$|$WVhEd@ D$WPuhF9VD$(PUY1VVP VVP ƍF8Pbuz3WMhVP SWXG| WD$(PXjVPF ƅuSD$(P臮C$t{tlSWD$|$WP\gFWPOgF8MdQP<$Ghu5 j<$Ghu5 jD$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ P%Pt2Njl$$L$1tFt@t0Q;Ut, u&, G, 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u+L$( Ʌt ѹ )QPh%jWB ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h%FVD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr* t$ $ q>YtiDD$ \$fl$Ӌl$ h%WU{ Y* 8th%h%t$@s"j@{Dž@7gh D>1ɨ1QSVK PQFRC F CFKN\$l$ d ! Fc ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF $ oUSWVD$1tW8tQ\$l$G@tjUP詠 u8u@$Vu4jjt @H h%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUjo t:NhVRPh%j.Qk. @jPW t&@`F`Nd#h%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSP$ tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h%1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ h%t$IH1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀ=jPj7#91Fuh%WLJ1N^_[11SVt$ ^d؃ FdF`u uhF Ph% F NhQPh%L u2 tQd s((th%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh'U趎 ShĨ'U蟎 TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU U V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS9 t=m<$hj.PSjJi 1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh;%o 4$ f4$ 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP 5%W51VPjp^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPUf tKd(1tD$ @`C`|$u%CdtC KhQt$(Phг%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$ 1H1^_[]SWV\${C KhQPWkƋD$dž\uC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,h% GdD$ D$1xG O4SQPZt t $tsOdtYG %t$OhQRPh%Wj[u! 81t 8t h%w$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPws t $t8$C O0QPh% OtHO\$u4$FTjPSO NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$5 D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRhQjڽD$ t;t$(hͶ%Ej6h%V,e^_[]SWVt$VjjŽtj11G9quƁjmمuިt?5j6  sh%V,^_[USWV] D$@Cxt$rj.VL$0QjM |$,wVh%VwD$@PSuX tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh%h%e^_[]T$rRQPh*%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh% RQh%> \Rhڷ%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVPo L$  uhj/ËD$CNC KFCF CCj.L$vQP赟 Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph'%T$$RGTD$0Pji $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$hP%<<tj<uŃt$h%|$$HL$Xpx jP$P\ D$<t$h%|$rst$h%$p΁Vt$ he%t$$$x|$D$ƀt$hָ%B1|$t +D$(t$( 4XPjQ Vt$D$`P \$Zt$h߹%t$ $A D$PAD$LIL$HD$D%> |$uFD$8$u>D$xdt4D$t!t$ut$hp%|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWV1QWh%t$D$u%D$6jID$@`L@O|$ut$h%6몋sLߋD$,9CPut$,t$Vd VGPD$$t$,XGLtbt$,Vt$P wPD$(À|$$.&D$$h%|$$3WQ%t$4q t$h%Etk,΋D$9t ,JutVt$4q t$h%U|$u/j |$u$jt$ut$h%`t$et$4t$t$h%|$$tL$11BL$jSD$(D$$UWV}u WYh- ƍG 4$D$,$5&D$\$$~%WhɶVje^_]WVt$ VhWVhɶWVhW^_SWV|$G Ph%轶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWP tF F^_[hԻ%\^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%޴L$jQP u h4%4$BHJAWhjjfG Ph%gWhW iShG%踴Yjt7UhRjP诧@h4%hg%苴)h4%yd^_[]USWV׉΋A1PUS FVUSt!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh%] t#@uUhʺ%c S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h"%Mj봋4$VUho%j WjDu! 81t 8t h%荲L$o@G WQSRPU踶tDD$GdՃGdD$ j.PUj9 t'OQPh%j.VD h %)hC'  WhCPje8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPW\ uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuh%Ph%Pit-u~`?w#F0gF PhI%(^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPhe%h{%1 jSWK tD$ SVk he%p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uhw% PU!D$C,9r|$t"w 7hw% PWT!,Nu^_[]WVt$ tqwgVhj迥1GGG G XGft^_# Vh%h:'#賮 ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUj 5 \$wWh%$$tXjVW讻 ÅFD$Pjt$ L$QƋ ulp|$NjSWv tL$9uPWV.X t0 D$ PSh%g ^_[]h%۬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PShͼ%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%B$ WSh%ӫ F PShS% t){4t#D$} t*tu VhD% Vh%Ъjjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E%fة'9t Qf9Au<< <\$H $ܨ'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%%諩D D$ PD$p Vhp%% D$ PD$p Vh% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh%賨D$`$T$B"pF L$ QPh%茦 1Br&$F  $QL$$QPhz%V<$tD$x%$l$ |$$ PD$$PVhܿ%ϥD$wy 1L$ T$t$QPR SWVPjh0j" 1NtKljjSj hPt $jSjj)W۷t WB^_[WV jh0j谧 ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPV| t?jWj$j)Vt"$jWh@hVu%hw%ڤVA hw%Ť1N ^_SWV\$|$1tD$'1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G Ph%WhGW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Wh%P* E]1@EEE,E ]$z t(xVh&j j"Wh%h:'#谢^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$L'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPSh\jP$h%hg%$1ۋ6<$tD$D$$t;F SPh,% D$$hPS6r%Ch%rJh%ԟe3=u1HL$$hQP< Ã37@$:VL$QRP% \$\$TSjji D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Phΰ%躞T$E|$wD藏S GDtL$$SQP裡 _Hbh)%ߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2 8tn 8tdD$ Ph%h:'#r FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Whc%蘝ot/KVhYj j1Wh%h:'#螝 vF Ph9%褝*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjP賓cE <$L$ VtxEtptk8] 1ɉHH@H HH$7E%$P6S!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t%tPV>ELPu4 u<Udž6ttFtu7@t'PX>8dž ^_[]à Vh%h:'#L$1jSWV|$WhGj蠑txWhSzWhYScWhSLWhxS5ws^_[SWVt${Du ?~ Wh%P& 1@1ɉKCCS(C|S KtHd sHdit xtY^_[Wh%h:'#觙 ^_[ønL$xtYBL$x4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O Wh7jPuh%hg%ۘt|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WC,$;lrD$Vh%P D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@PJ D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hWt$$t$$t$PD$\0 t0L$ D$ PQhVt$$t$$t$PD$\0 D$ L$)1HV t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$('Z   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP) D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUP范 D$Ãx3 t 11A9r1Ë71$1 $`'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Phҽ%Ր1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N (H (H (H (|$ t*G>r!D& D$H<D$@6 VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh%O D$P4 uOt$ pffBfBpɋ<$tXQlRt ڃ p7t$ffBfB<$tD$WVPR2 ڃ L$t3D$fffBt$tVWRω ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPz |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$D$ǃL$tJHP dtKWUP覆 D=l$_D$ fǀ<$ 1fw ,')h%̓R|$Qh%j W D$l$ f9<t1}~ QWh%P聁t$sf<芲 fu.Wh%趂(Ex(Et(Ep (El6tj]zD$0^_[]USWV΃|$$w Vh%1H׋ 1ۉt$$S1ItUα $]h]d]`\$,Džu\$Sjƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vh%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph-%΀k(UPhG%b ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vha%p},WVh{% ^_[]V΋QhYjw1ɉHH@@ @ @$t $^D Vh%h:'#f ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth3%VP6+jVjjv-wx9Dth%V4u Vh%x^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPhY%Q}1%8WjjuD$$Pjg<$w$'8uJq%=ǃ8%8u+%8u%8u x%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ h%} ؋?ut$u {`<$uhs`t$ h%} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%v:fD$D$D$PjUVD$0T$4)̓w! t$hd%ufjPD$DP)x D$LȉD$LD$PȋL$LD$P9v)襤 t$Pt$Pt$h%Xul$4D$h|tjD$@PUF upmjhD$DPt$<ǀ{fD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h<%sܢ t$h%s|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh%*s wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Ph%Lrt}u^_[]8V:6)^_[]SWV΋y Wh%7r 1CCCC CC$t^_[Wh%h:'#7r ^_[Vt$F Ph%9r1B^L$Vt$?N Qh%Po 1B^jL$$WVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀ{L/艈L/f$HC;,T^_[]SWVt$VhjJg1CC C XCC~ ;u Wh%h2%P1|$L$8jQj*j)5@R<su h%Q<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5@R<9ry hO%QQ<t+DŽ$j$Pj&j)5@R<quK1ۃ|$$(V3D$,tD$t3S?XR<uh%hh%ƣQ:Q:|$$tF1FFFFF  F)F.N,Q:Q:9rF t$ƃ|$t.t$EL$Aut$h%+(V3D$,|$,tF)F/(V3F Q<@;DŽ$jjj:2 y h%Q<,R<Q<0R<Q<4R<R<8R<R<fQ<'u%j.$Wt$|jbuj.h"W^% WhJ%p j.Wt$,j/uj.h"W+% WhZ%"hj%3 hy#& Nf%fw ,'P Q<GNju j.$Pt$ j]h%<h%藐 hy#芐 Nf%fw ,'Pd Q<F h%Ffff=fh%fPh%FffQPh%؏ sFPh% L$$T$ /Ftc|$ umhG%h/%苏 Fz$'hC%t$Ɖt$ t$QRPh%L hр$:Ph%`4 'h" Q<F<<%h~%ڎ Q<tF%s%P贎 K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( \m3D$0LA $sf%PQ F9uEPh% hU% hi%h~%ٌ |$ FPh%Œ 6Ph%貌 |$ "h%h]% h8~$hv~$L$$ 'j.$Pt$ j)F$Q4'h%Th%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"Pc $@D$@|$ Ph$b#hh%蓋 t$ 9|$oh%h%l D$$$T$ $@WjWhf$8q&P# Ft h% f3H f3~f3H f3 hf3j )L$|$$t1 q΃j.PL$QjSuj.h"$PH $Phg%S |$u"tVh%9  h%* f3H f3~f3H f3 hf3j & t$GNjL$+{h1%νihP$迉 Q<t$Nhͥ$衉 Ntu%8q&P} 1L$1΄u j,| D$H@%xO%-%sVQ/ D$9D$t$uKj,7 hV% D$4L$:D$tHj, D$4WPhg%؈ $D$4D$ uj,߇ h_%貈 f3H f3;,f3hf3j)蹎 nf3H f3)h%hP$` Q<؋ f3Qf3~ f3Qf3 hf3j I Q<z|$h ot$dc~)/F1#ty1h%n2td3h%豇 ^ F N t$~WRQPh%膇 \$Sy/ƅx*Vh%e 'h%V N h%< D$@Ph%& ~`1St$/t:j.$WPjuj.h"W WSh%׆ Sh%dž C9u\$,t$ |$d|$h19wƉ΅hf3@ (MR<T$p1Ʌu9Q~} V&jVk # VP jR} 5 R<h% 5tR<h3% 5R<hM% R<tPhd%҅ tR<tI R<9~hy}$貅 0D$D$L$d$ l& \$$}$者 f3H f3~f3H f3 hf3j | R<DR<tzR<$$R<|-R<0V3R<$\$\$\$ \$$v%Ʉ $hf3<> hf3/> USWV $$919gՉ $t$ $;8t$hh`%$, =&GШu+$ ؃?9?)9K9si \m3LA $sf%PQhV舂 =hV$,h =GC~ 9r9$$ul&hh`%$,V =wDG$8:$ t-؍L$VSthV$, 1 ^_[]USWVP։1|$4$u9|.HPh% %wS$'W )1@1sC9uÅu.Ph%=&蘂 t$߉E1 `^_[]USWV4)ȃ'h %C :։ϋ ˉ h%ˉ $Wf_oUSRQt$Ph%ہ Gl$j.UPjuj.h"U Uh%褁 Gj.UPjcuj.h"U_ _Us()|c؉<+<'ueh %0<9#<,uth%8 '<+ugh % <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5v<t$PV;hD$$HL$L$ 1x1PPPWG jh@P 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$k ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$g_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$v<D$PVPxq L$@D$D$ 1 G|$<$D$=HV3$TD$j=hC&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hC&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSP SVUv |$|$t$ "+Hj=hC&P Ņt$,]&a 04$Q"a 0D$$@'߈FHGNm&Þw$T':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4Z "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H Y dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=v<u t11jNtv<1v<v<t P 1@h3"#h%3t v<1USWV1=v<MT$ l$(L$DžD$5v<hhv<;  |$t$ #j hv<# D$v<h #Vyv<tUPJ uTWVyv<WVyt7j L$QPCz x#L$9uv<;D$ D$uL$us v<8 v<APQ~ PQH  v< tuQhhv<9  |$uv<1^_[]v<z<z<1Ҋ+~,u"1t$L$t' t" t΅tAL$=~<u~< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=v<u#v<v<tP7F v<t v<1^v<v<tPF v<VtJT$1Aj<ƃ=v<u#v<v<tPE v<t v<1^t v<t D$v<1@1USWV D$,L$(l$$~ )$1H$`t v<1A\$9|ωL$ tgp9tX tt$ PF t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$v<v<tPD v<D$,L$$ ^_[]f11f11Ã=~<u /t(~<11hhH~<PjNt~<1L<~<t PQ1@h3"#h%{o ~<1USWVT$1=L<+\$0L$ D$D$|$(D$5~<t$8S| l$,D$ D$D$t$j S  \$1 h #V%uE|$tt$(P>E u~ #WVtEWVtt^j L$QPzu xJL$9uAE;D$ D$<u/h #Vttj L$QP9u x L$9t[ ~<8 ~<APQ~ PQC  ~< tuQt$8SN{ E h#V tEth#V twh#Vsah #VsEHh #VsE /h #VsE$j:t$ T 1@|$ uL<1^_[]WV=~<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhhH~<h~<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=H<u+L<~<tPL$@ L$~<D$$tˉ01C؃^_[L<~<tP@ ~<PPhhH~<h~<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=H<u+L<~<tPL$? L$~<D$$tˉ01C؃^_[t H<t D$H<1@1fUSWV\$l$t$V? PVW U? PUW S? PSW޺ t$ V? PVWƺ ^_[]WV t$uRt>DžtA=R<t ^_Épxj Phu"O ؀=P<u1F1=Q<tN 1맋5LV3WM $b#QQh%Pփ@K USWV1ۀ=`<t ؁^_[]N D$ |$GSSPhT<jW&u T< d< h<r1Hl<$b#1ۃt2u3hWh%苺 D5\<~ȍQ2w$h'q<PAu p<?$D$-LV3L h/#L$Qh%PՃr<PV3@s<TV3 l<I9@XV3 l<I9@R<P<Q<t<p<yq<pr<gPV3 l<A9~WHPV3Os<FTV3|t%ƍC!t2)É$)t*܂<L$ ܂<$)PD$p xPh<{=r<=t<WjD$hpj Phu"Y 5LV3D $b#QQh,%5LV3mD $b#QQhe%PփVB 111{PZDWhVA ESWV 1L$ |$ ru\95<s(>tGǀ=r<u.;=<rN;=Ȃ<rDX< DžtVjW>A =Q<t^D 1ހ=R<t& ^_[À=P<u1Ffu]pxj Phu" 뺋5LV3C $b#QQh%Pփ@ NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95<95Ȃ<H_ŋ <!9r؅ x<9s9s_h< 8!9t.M9wI9rE<8! TV3!9u!=r<=t<X<Rf ʼn9rPVU  8!!ōD$p <PVL$%D$PVt$83<Pt$jUV:thŋ$L$Ai Qh<8=r<=t<u=Q<A 1=R<tM^_[]t$h<O=P<1GDu3t몍D$0xhj Phu"讯 5LV3? $b#QQh%Pփ= 9U7)SjZP)MPjSC= :9/ $)QjZP)PjS= tƉ111USWVˡ<!9ta)‹ l<h t u9=,$)<l u=r<OE$)ÍFu\wl׭'xD$X <PWPW=r<N V܂<5܂<w(X' w׭'1É;GsG1B TGHO;Mu9}tAtDEWPc5u%E9tt9sMxt MPQ{}-E $ut=r<tGV^_[]ÃWU4 VjZS6; vjZv !; VjZS; V t$=R<tt ^É01ɉHHj Phu" ҋL$SWVȋ<!9t+)֋ l<| u 9t%)D @A Qh<@D^_[USWV=s<t^_[]þ$b#VVVhK%LV3Vh"#h"hl%LV32#=p<u2#j%=r<ueX&(#=q<u~&RQPhx%LV3i)&=R<u%"=P<u##M%=Q<uq<$%=t<u$VRQPLV3LV3$ T<|$gfff̉ҍ4މ劄1e#GO wһ$b#"#SUWh%T$t$|$f4SUWh%LV3LV3$ <Ggfff̉ҍ<߉劄9e#FN wh$b#h"#Vh%T$LV3$ x<|$gfff̉ҍ4މ劄1e#GO wh$b#h"#Wh%T$LV3$ <|$gfff̉ҍ4މ劄1e#GO wҸ$b#PPWh%T$LV3$ PV3|$gfff̉ҍ4މ劄1e#GO wҾ$b#Vh#Wh%T$VVVh%LV3USWV΃=Ă<tPt <3!1P]ǡ< <!)ȉ9r1U\Ă<9tEuótP-h<!1PPjhjUP) t(<t<=<=<-<1ۉ^_[]V΃?< ; <v$1u<Ɖ <^USWVP<<< 0trƃhD'PF,=d<=<4$t|n011FEEhT'PWـEEC<(9r:5LV38 $b#QQh%Pփ=p<X<11<9s[ $,0EEhT'Ps+<C<]ǡ<<(9r<9$sj,Ѓ0EEhT'P`x< <s <)ÉE;ǡ<<<(9r$^_[]4 L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡd<D$<D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9|<s$5h<!։Ņ9<v6J Љ  ȉ  F1r{@p9x<sBJ Љ  ȉ  F<< XV3u%1I#5<!֡< TV3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPU tPU$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=r<t=t<uVj1^_[]VhUK0 USWV5<1!-܂<t E܂<1-<E@;<v@uW-<E@<tE3t,ÉE uUh<=r<t"=t<t!܂<E-܂<^_[]VhVjS/ USWVΊ l<T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$Sn~VSSD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt$+-<T$ l<^_[]1USWVȋ5<!) l<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPĥ< Åk jŜ<W SW܂<܂<;-<r ;-Ȃ<1WWjhj\$SU t\tV9tRSP uE0 j@\$S0 -LV32/ h"#Sh%PՃ=p<1lj1<4$9v(< 1QQjPjVQ @wg1=Ă<jQRŋ5<!Ɖ)tP0RĂ<9tut݉<$/Ȃ<u1]4$D$x Pĥ<tA<$̂<C 9r09$v+jSVg SV{܂<܂<uɉD^_[]+ VT< X<r!1F<u. X<T<F9r^USWVP $1N=<1!׉) l<D$)ot +t=q<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWVzDGWV;_s_u.G WPK=q<u.M,t <-},^_[]jPR 5<^_[]USWV@׉9 <95Ȃ<jP;Ȃ<u >9uPO;Ȃ<FjWV2 *1ۡ܂<t  ܂<8<H@; <v@j<H@ < 3H <HPĥ<p<9rWVg u=- j@S0 -LV3+ h"#Sh%PՃ=p<9=<u]܂<t  ܂<6<H@; <v@u,<H@ <t=<p xPĥ<@^_[]9Ă<u)Ă<Ȃ<( f\V3ø\V3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[áj3 D$t$PlUWVL$T$ ‹q~y ;q~ t 1~9 QPI ^_D$ \m3DAD$ \m3DAD$ \m3DA%D$ \m3DAD$ \m3DAD$ \m3DAD$ \m3DAD$ \m3DA%D$ \m3DA D$ \m3DA@D$ \m3DA%D$ \m3DA%D$ \m3DA@WV1F|$ 4X'W: tF u1^_ËD$t w$\'1ËL$1t9t1ҍB|uËL$1t# t|$t\m3LH1H rËD$t \m3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ Tm3DAD$ Pm3DAWVD$ $b#$b#tƀ>t4g%/( 0DPWVh1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$<L$L$ tU_|$$1Ĥ^_[]USWVt$~X>3܃ V$' j F H @(N]_?[\;^r~uFF<<C><% ^q{t|~F~F ;^r~uF<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uF<F^9րրw t$rI{i9s <$=\m3]D_\,<$t~uF F<<Au~uF <F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A\m3IDJt"m9~~uF <NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF <F"{u@9s \m3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup \m3DAu f'tf`uW~F=@9t8}@u~uF ~uF <FЉL<$USWV t$ ^h.\u/;nr~uFF<<EMŁ'$~]$'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uF<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uF<FωωD$$xt~uF <.n~EFx \m3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s2\m3 DJt"r 9~~uF <N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF <FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uF<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! ljTm3TXL$21@u"Pm3TXL$1t$1ɅtT$T$1=j3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8u<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 \m3LAtx Pm3uTm3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQէ F^_[USWV1y19sC11-\m3D]t#=k)CB9u1Bt=|yuA <Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$L')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' F<FUSWV\$1=j39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}Tm3Dh j31҃9v1B j3Pm3Dh1҃9v)1BuG <G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFF<<<^_Ã~uF<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uF<F1^_[]É؉D$%'t$t$U4 u U' t/uՃt~uFG롋$USWV 1=j39v413A8 $A,tI Tm3L$ Pm3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRq tF^~uF <F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=j3|$ r3GtD$WT$ou]t$S |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4ѿ L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ g ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf \m3>|$u l$`\$\z \m3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" \m3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA \m3D$¿!DQf_֋D$ !DAf|$$_8tV|$u\m3L$ DHuf|$$_u3|$u\m3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4讚 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ B ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf \m3>|$u l$`\$\z \m3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" \m3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA \m3D$¿!DQf_֋D$ !DAf|$$_8tV|$u\m3L$ DHuf|$$_u3|$u\m3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t VѤ @wj/V 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPhh%jPh<<ø#%Vt$1Ʌ1t э^fffUSWV[Øl$(D$$u1vT$8|$0D$L$ 1L$)͉D$,11ȉ$D$411ȋL$$t$t$|$;D$ T$$75@PW EPW @PW PW֝ tPW |$D$ tH@PW艝 PWq @PWY iPWA tPW- |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,1 9r 胼$ t+$ $$ FhPWT $D$ D$jD$$ xfD$4D$dzF /$$ AfAfIӕQPRhW2t$ VPj $D$ $P1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ VyhPWS j:Wr D$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVPWt Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃK, D$ $t1L$ L9s ዄ$ @<C\L$|It$tjhQPR*D$4 2qPh$P$$9s|$$$9s$$[1 $L9s D$HL$H P RQt$ Ph$P$$9sD$42qPh$P荺${$_9sD$hI$/9s狄$ @2PQh$P$$9s獃%t$Ph$P誹$$ o9sD$ tW2QPh$PB$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ $$$9sD$dL$HL$PL$pRt$t$t$$h$PD$L$HL$HL$HL$,HL$(HL$$H @ T$0PQt$,t$4t$X < 9u8jjܖ% t\ P 1 4> 0ǃX ܖǃܖƃ\ t 01^_[ÐUSWV[õ$01\ uut!j/V(c uS\ tƅu* ƍ|$VPQhWj=ri ?h@VCǍD$ jPW ) D$$WtLD, L$Pjhjjj QD$(Ps Ƌ<$t'Vu D$8 tϖ 8 L$^_[]ÐSWV[f\ u[ÐS[Þt$[ÐUSWV[pu }芔 D$<$| t$u$$D$PZ.ut=k<T$JL$|D$x$L$x$PQrh$$$Pt$glH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$\1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$ D$@j PW, ˑ 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $Ӊ \$ 8u$$>$0։蝉 D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ,]|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPR>ѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6W8G4jjdv6}g jjdRP˕WPGLjh'v6Ug W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$< ;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[L$ܝtEׁ؝u$C t+t9u11ՉL$!։1^_[]ÐUSWV[{|$GtB#l$%t$P?t!G t7t9uӾ^_[]ÐUSWV[ tC#l$ t$P.?t!G t7t9uӾ^_[]ÐUSWV[ÛtC#l$ t$P>t!G t7t9uӾ^_[]ÐUSWV[(t$0t$, ǍVP‰t$D$(%D$1퍃؝D$ <$l$ܝtg|$ !RP=tG t@/t;L$uЃt'D$ t$j…<$uNt$0t><$9tRU PUWo >&t1<$We&^_[]fUSWV[t$D$hEt'1PV=t%D=u1` u VPj D$@ 8^_[]ÐUSWV[h|$ D$hEt$1PW<t%D5u` ^_[]ËD$@ 40tM'd D$jPt$V ŋD$18t|c r"u##` ug(B"tt$` a{(4$WPjуH WPjSV[=t$ v$v $Vw$^[ÐUSWV[D$,8tD$,1퐐8@ujHƋ|$(W F$"jU-F D$ D$,F>D$Pt$1}nu1ɀ}ouL$D$j=U- tǃ|$D$,t1PUQ:tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$j7Ņ8` t 4$"V"1^_[]Í UPjUSWV[E$4$,Wa 0(jPU uj:U, (jPU tKt$}/3t$UhV( jVPUP Pht$UD$PQ|$ jjWjjV8mt$ jjWPjV8t$/D$PVǍ*$0VPW  FD$ GL$ !jjQPjR7tqVUW  R_ 0$0X_ 0(k^ 8uj/UBŃt$ $0UW  ^ 0(QPW  111^ 0$0P$4  11,$j$4V$4WjU0PFPWrt$t8HPQl& ^ 0($0P$4  1,$D$PU ] 0^_[]Í(,$UPVWt1] ('WP$8$8ntVCfffffffS[+D$D$ $L$T$jjPQjR5yD$[fffffS[D$D$ >$L$T$jjPQjR95yD$[ÐS[kD$D$ ?$L$T$jjPQjR4yD$[ÐS[ $L$(jjPQRyD$[fffffY~T$ОulОÐS[Î~t$*kSWV[l~|$Wt$t$ 9rq[ ?)WVPjО^_[ÐSWV[~|$Wt$t$ 9r![ ?5)WVPjО^_[ÐSV[}t$ ƅul)PjО^[ÐSV[Í}t$t$ƅul)PjО^[ÐSWV[L}|$W ƅtu)WPjО ^_[ÐUSWV[ }l$|$UWƅttu)UWPjО^_[]ÐSWV[ü||$Wt$qƅtu)WPjО ^_[ÐUSWV[k|l$|$UWt$ toY 0)UWPjО^_[]ÐSWV[||$t$Wtƅu*WPjО ^_[ÐSVP[{D$L$T$$RQP芤 ƃu*PjО^[ÐSV[Í{t$t$t$A ƃu*PjО^[USWVP[J{Pt$0t$0t$0t$0t$0jt$45 Ɖ׋,$t1:X (&*t$,t$,t$,t$,t$,t$,PjО ^_[]ÐUSWVP[zPt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1W (v*t$,t$,t$,t$,t$,t$,PjО ^_[]fXOzL$"wÍ0ffffffUSWVDXzD$4T$dt$XL$l|$`1ۈ$<uЋT$\l$ht$T$l$D$L$D$D$ D$$D$(D$,D$0|$ L$` tt  %ju %#jo%#jxD$X|$L$t \$4UVWRP \$4UVWjj[m~D$$<$|$ D$81$|$ <,PL$4 !GD$ =u <$fa :u <$FR 8I O3L$8 =u!L$$;L$sD$=D$ L$$L$$HL$ D$$*D$$y|$ ;D$sߋL$L$ D$$ΐO? G<@ fu  $t$T$։t$81 tl$81 u<@* <$&  |$ $O?1ҸGD$ $ t1#T$#t$ b|$0D$$<D$,;D$s L$,D$$D$$;ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$,w|$$T$()9eD$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)yD$\$4VRT$$RQPr;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9l$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$Pjjre $~D$$|$ $1\$4WRD$$Pjj=e $ˋ\$4VRD$$Pjje1Ʌl$<릋\$4WRD$$Pjjd~D$$$D$ x@ut$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjbD$$u|$0L$$tB;L$s5T$ >#\$4K L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[mjt$t$t$t$t$[fS[lL$T$ Pt$t$t$[ÐUSWV[èl|$$t$|$0t$(aD$ j/U ,$t|.UPt$ WVt$8IuU\I 8uF]t$ t$Pt$t$@t$t$$t$$t$$t$$t$$t$$t$$t$$0&$[ÐV^N>t4L$ʁtPD@t1t ʁPH^Ë6u吐V^=D$t4L$ ʁtPD@t1t ʁPH^Ë6u吐S[Î=t$0[ÐUSWV _X=D$ T$$сtHD@ t16|$t сHHPT$~YP$1;|$t<<$~P,R4$Z! ˉZfBtBtXDۋ\$jPZ1 ^_[]ø񐐐WVZm<D$ t9pH@?t;:u@D ^_øS[<t$0[ÐUSWV0[;|$D:D$Hx,pL$L|$DGDD$GHD$ fD$$GLfD$,D$(G|$D$Pw|w|ut EGDUWjWWV1^_[]ÐSWVZ¼8ttL$pH9@?t;:u1PDQAP|1t$:^Y|Rtqv^_[øSWVZ8D$txL$pH9@?t;:u1PDQAP|1t(:^Y|Rtqv^_[øfffffX7ƀd ÐSWV[\7|$0 2, 2 2x 2 N ` N$ NTd NX N\ N`` Nl4 Nm Nn822,22xG G$`GTGXdG\G`Gl`Gm4GnWG1Ƀ2QP莟G GhWW ^_[ÐUSWV[Û5l$uPŅh4j1ƋD$L$dž3Ndž2dž2d 3ƃd fFddž2dž3 h3,V 5VU2@xpu xhdž2jjjjjjV&FjjjjjjVFVbZVPjjjjjjV F tdjPVGVNV% VlGHt 3t VdVK@Z2t Pte2tuc29ʼnu3V1^_[]ÐSWV[L3t$2t Pd2t75c29lju2V"Z3I3;90uV"^_[fffUSWV[ë2 t$@+@+@+@+@+@+@++ uǃ >ǃ <ǃ ^ǃ vǃ( #ǃ :ǃ 'ǃ #ǃ #ǃ #ǃ, -ǃ$ -ǃ4 _ǃH |ǃ` oǃ( -ǃ0 -ǃL <ǃP >ǃT *ǃX !ǃ\ f2Ot^t8tjtfxh ؋tvQjPW+ 1t QTpQTtQTxT|=u^_[]ÐVY01t T$tpqttqtxqt|1=u^ÐUSWVP[z0p l$j+GG(ujjYyQP5 u0Pj4j3JxQPNej>0( j< P j^x jv j# j: j'` j# j# j# j- j- j_ph j|`0 joP jp@ jr0@ jy X jz j{ j| j} ǃ( !ǃ +ǃP !ǃ ,ǃx !ǃ -ǃ !ǃ .ǃ %ǃ( 0ǃp %ǃ `ǃ %ǃ aǃ` ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ iǃ %ǃ jǃ( %ǃ kǃP %ǃ lǃx %ǃ mǃ <%ǃ nǃ %ǃ, qǃ #ǃ$ oǃh #ǃ4 sǃ %ǃ8 tǃ $%ǃ< uǃ 4%ǃ@ vǃ ,%ǃD wǃ0 %ǃH xǃ ǃ` ~ǃ #ǃ( pǃ@ #ǃ0 rǃX d"ǃL yǃ e"ǃP zǃ ǃT {ǃ `"ǃX |ǃ ǃ\ }2NthtBt'zxp j ϋtuQjPVph l 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX++h l$+4+ع x( PPu^_[]fffffffX*L$fǀh ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[~*t$0[ÐUSWV@[H*|$TED$G8$u!O9OuO9Ou 9u_uWEt Wա|$XE3t:`10KEǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3D/1j ‰PD$<x-.D$8|$AG $tJt PwW' W~"G @t; 8u1E3t%`10EEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u_*E2$t L$Xu$ L$Xt$AsiSV[&0t$t$V tt$Vj^[ÐSV[Ý&t$ t$t$V tt$V^[ÐUSWVL$[T&|$0D$(T$ 2D$ED$4D$D$h f!tW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃh ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4h ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃh D$4Pjjjk 4449)4L$ 4QWPt$%4;4}2Dž4t(D$4PVt$ t$ 1|$0fh 4)Ɖ4fǃh ff9t |$ u |$ t)Q)RK* t$VUF @f|$tG&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4fh f1jD$` `4rփփ19‰4 4fh fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4fh f1*Pjj!Q j S[t$j[ffS[0t$ [ÐUSWV$[|$u2t PjP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@(+P蠰tjjP ,GT'+PvtjjP GX!2@@xGX GXO <W$` OT d2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V P蒩D$$<$$u$P HuǐuU PD$$鐐<$$u$}P Huǐul$Ut$Vj V$U$|$~"14W;>|BV9^_[ÐUSWV[õfǃ| hyu$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$!j T<TV$2@!4tV =wlj<$hVt$ V V 1rNj2Z1퐐T,jj L,LNp9u^_[]Í+PjS[0[ÐUSWV [|$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ P8GGMIAG GAE3t4`10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$v=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qUB 8uE3 $tԋ`10vL$Eǀ3뤐SV[ý0t$t$V t V^[ÐSV[}t$ t$t$V t Vr^[ÐSWVP[;$t&T$t$2PWj $^_[ÐUSWVP[1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[T$9D$P- 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[51tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[è D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9 | f$t|$u!|$t'QL$ )RW\ŃuRG @tG 8u=D$3t.`10IrD$ǀ3G @|$tmG  f Hȃ | fftVWQ=Vt Hȃ 9 Hȃ f9ufǃ| f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f| D$DhhA Qʃʃ19 f| ^_[]ýG @tB 8u8t$3t)`10oǀ3g 룸+Pjj Q裳 jSWV[ |$WGƃuOG @tD 8u:3t)`102oǀ3^_[ÐUSWV[k tt$339}3AP3t' 333343;33PQRP 33t331^_[]ÐUSWV[Ûtt$339}3AP3t' 333343;33PQRPA 33t331^_[]ÐSP[$tT$ 2Pjj $[ÐX tT$QT1øUSWV[FTAx43fTFT$P輟j 趔+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhh$to DHDHDHDH uǀD$ FF^_[]øW+Pjj+,7+PjjQH jNu+Pnj8ffffS[~0[ÐUSWV[X|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQ<uF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[0t$t$V t VN^[ÐSV[Ýt$ t$t$V t V^[ffSWV([Y0Wt$<2WV0^_[ÐSWV([t$8Wt$@2WVd0^_[ÐSWV([0t$11;3}:tt3PpT^_[]ÐS[^T$t$t$ [ÐUSWV[(93|$0t$,T$ $u0\MDH@utl$4D$ U 鐐t$ D$PL$ QD$ P\x)t$討tL$9D$)<9u AT$)RU[t( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[è8D$ $4VjPjvtSʼnt$U9hƅtMD$ $t$UD$PV:tT$t$$V Vfx^_[]ÐUSWV[|$3t P 3~/11퐐440x0;3|4w؞3ǃ؞wwLJ3j0jp4tW2Ht<@xX3~3,P<72@HX3@$4Ƈ31^_[]ÐUSWV[t$3t P3~/11퐐448v0;3|4v^_[]ÐUSWVXHt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$W 1Ґ$t$V|$(WD$0PMt$$蠉ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V. $4D$)Džu |$ $tR1VT$  4$)tWj V T$L$ (^_[]ÐUSWV`[H14t `΋43t42NzRЃPWVPVHhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<W٠ PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DP y;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$PD$T$3;4}D$PRjQD$PRjQhNj$D(P҆D$$L$ ;47&ffffUSWV[K|$$D$hjjU萆 t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ UJ D^_[]USWV[Û|$$2t$xƋl$r:D$0袅D$4聅uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$U 1^_[]ÐWVY=D$T$ t$w4  p@^_fffSWV[t$VO~~tyы9uv0nv,m9p9p 9pt PmmVm1^_[v4m9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PlffffVX~t-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[þ|$uT$ L$O[ø[ÐS[Î|$ uT$[ø[ÐS[^|$uT$ L$[ø[ÐSWV[,|$u<t$D$9% ƉM1^_[øSWV[|$u8t$D$|$% Ɖ81^_[øVXn|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$u9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZžL$1~t$ ~9J$u9r ^ÐUSWV[[D$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[ڙt$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux hQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p `912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [xt$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[T$L$ Aq D$t$jVPt$ ^[ÐUSWVXؕ$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[T$L$ Aq D$t$jVPt$ ^[ÐUSWV[ûl$1t>19)Rju uuu0tPU^_[]ÐUSWV$[Xt$D1Sl$HGL$L$T$ jt$t$t$8[ÐUSWV[t$L$F +A F(~~Xn01N,,NT$+JR, AEQUM vPw;E;~}F(^_[]ÐUSWVD$XX2h P8ցp8x;{ umueP8x[$u9uxu p8x9u6q ~t-Iu!ut duP8^_[]ÐD$t @:$1ffffffUSWV[ûD$L$Qq +P+p yijUWjjVRQP$^_[]fffUSWVH[h|$\|$`L$lT$ht$d!1D$xt$t$p)xՉ!)D$xL$T$x!$x4$)t$`v9l$ ,$)׋t$\v9| T$ 9|$|P!)l$tD$`H9͉L$)D$\@9Ɖ|9~jt$dѦ1H^_[]Ë $ًD$ D$D$D$l$!|$Fl$9tD$\@,|$x|$D$L$D$ 9w,$t$)D$ Pt$d"t$;|$ w|$|t\DH@uUVt$hV D$(GD$ D$$G tqt$$T(@xL$$ rjfffffS[0[ÐSWV[t$t}19pHt.1F:tVtFxvvv vP}u-F9u" Q+Vy1҉VI+N y1ɉNA^_[øS[^L$1qqq qj [ÐUSWV\X&IX1ۃyL$4D$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Y|$4t}\$\$0$Pjt$,IT\$ D$L$ H HD$4;Hϋ@,L$4p F fFV( }![ , fN, 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8Qp0QjP-ɋ$Kd0PjQQ f~$~gD$@u]D$(t$Fh2u&@9u%$PD$80%;\$6>v t6>vuD$@tt$ t$tNF$jv=D$@$ $0jP Ktdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ D$AD90 t$$0 0 $Pq|V\$UD BfBD$ALfBt@zAD$Rq|\$|$$uD$D$ KD$D$,T$D$,p;0 u4 D$Pz1r)10 $Ph WA\$ ƀw 0 $PQR\$ D$@0 L$P4 D$T$D$$)ЉD$L|$T$ )։t$,)3|$L D$P@D$t$+t$$D$@H0t$ T$pxpu@t*t!|$ ׋T$t$6;VaHTl$Ut$$Q}f 0UjPG jjjt$V(|$@UjppG jjt$jj@t$ Q fUjPAG |$D$,T$Lt$ )T$T$Ll$T$TI,T$DD$Dt$8t$0l$D|$,D$ ,D$H4;l$$;l$ ;l$D$@, D$L~9|;l$Tl$@D$P9AuqwD$ht2$VP\$t6uw0 $PV\$D$px1ŋG 0 $h QPl \$ ƀ=r{,t$G0 $h WP F$h Wt$ P \$ w0 $PQw D$PGD$H$Qjl$H&D$@, D$H$QjUP\$L$89͋T$HuD$@,T͋D$0;D$+L$8D$0D$H,t1L$|$ t-L$ :$jjQt$Rl$E@$t$ 4b $0$QjPD\$ D$t$ )jjPjt$0oEHVPbxpuDt.t%|$ ׋T$t$6;Vt$ Lt$l$$UQ b 0VjP7C jjjt$W|$@Vjpp C jjUjj@"D$ PQaVjPB |$EFD$0D$,0jjUt$R1D$@ɉl$8tT$|$9zt4؋$PQa0QjPJB |$jjt$(Vjt$HHL$ QP`ϋl$H $0VjPA |$ |$l$$l$|$$@VjA uL$j|$ |$$L$ T$$F0VjPRA |$0t.L$|$$@Vj$A uL$ $jjt$(t$R$0|$ l$E@$Vj@\$ uUjH@ |$ |$t$$t!t$@UjHz@ u@L$ IQjp0_ UjPJ@ jjjjt$|$$0$UjQ@\$ |$0t$t$$@$Uj?\$ uL$ ɋ|$l$y8VjL? D$ t!l$$@VjL? u@L$ IQjp0 ^ VjPT? jjjjt$0@@p10QjP$? T$$jt$RjQ\$HD$ $jjt$t$R_$0|$ l$E@$VjH>\$ uL$L$ T$9Q|$ 0$UjPQ>\$ |$0t$t$$@$UjL>\$ u%,,+PQhrR4 $7 USWV []D$41\$t$LL$H\$DT$@|$| PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ | ^_[]Ë,D$0L$ `;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [TK D$PBpL$ t$tIT$$`| t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$Pjt$) ǃ ǃ 11ҋ`D$8| tlj)D$4>$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$PjQ0) @x H$L$T$ t$`ՉL$)4/L$T$ 9~L$T$ <$Pjt$( ǃ D$ ; ;T$ 9<$ to j PTox) @ltQjP%( F t3 j P ox) j |j m  ǃ 1;  $l$*ǃ ;  @@ltWjPV' yA t`j t$,nx )ȉ }u D$8o@@lU8 LQj `u ;|  "UjP& ;| ~U   @@xuă tjWSmx) j띍 ; ~- @Uj% yxD$8| )ȃ,$D$ D$4$jP% D$(19 ș)Љփ<| 9D$@u t!j t$+lx) j t D$@, @D` D$,$.  -;| !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$jx )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP# <,$ t!j t$ix) j f ;| ~nUjP" ;|  @@xu̓ t!jt$yix) j룉PS[nBD$ t# PQ)ix) P1[fffXBHy8~DyD~>Hlt htðuu냹tt u1ÐXA@ xÐUSWV [ÈAAP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21ChD$L$ /jt$[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p p0!0 0(9uD$t4$L!L Lq1tt  ^_[]ÃttِUSWVP[ú<L$9 ft$9|$ 9l2uCUw$-4$t$sk&w&|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXx;2hT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVY9|$xv9{`|iT$t$p"fr"f1l2u@>_w-s y&f>2~w-s q&f ^_[]ÐUSWV[8L$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZ<8L$x?9J\~2D$t$|$ Irftf>vf1^_[S[7ǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[[7T$L$l2uI~w-ss&w!&ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐXo6h2ÐUSWVP[J6t$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[4l2tu6@t!|$0QjP (!G@f@d^_[ÐX3f@dffSWV[Ì3D$ yOQW~ ;O~ t Q WP.W6^_[ÐSWV[3|$D$OQW~ ;O~ t Q WP.W^_[ÐSWV[ü2xWt$W^_[ÐSWV[|2|$Wt$WX^_[fffffffUSWVX;2tLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$d( $ș)l$T$ $L$$$D$w3x)ʋ=T$P xl$tD$  dl$lыUE)Ѓ9~t$7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$H'D$g1fT$t$j xŋd0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Pbx‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$tPL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K 'Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K 'Й~ ƃQWT$H ^_[]ÐSWV[Ü |$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[   jt$t$t$P1[ÐSV[  jVjt$PJ1^[fSWVP[Û|$t t9t QD$PL$QjPW]L$N|$kK)l$kK) 6;6i)`(PU@t;y t0q$t~fuUv u1 q d(^_[]ÐUSWV[D$$L$t@1D$D$>D$PL$QjPW\L$kL|$kC)l$kC) +7;+7i? ))PUt7q tAy$t+nuUwu A)y^_[]USWV[èD$(L$1҄t@1D$D$8>D$D$PL$QjPVm[l$-?L|$ ) i)ʼn) i)kn7{n7lj*SiŠ)Ǎ*PD$Pt1D$H*<tzp t:h$D$t}suPuD$uދ} مt3l$,t+Et$WPuVEЃ^_[]ÐS[t$ t$t$ [ÐUSWVH[t$\$lD$P褨ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$U*L$QjPUXL$ȿNt$kK)kK) 636i)`(PU|$D$$d(ED$j=UtƉH$$D$<$|$W,L$QjPWWL$Ƚ-?Lt$) i)) i)Kn7sn7Ɖ*SiŠ)ƍ*PWfD$5tcL$f <$|$WoL$QjPW.WL$ȽkLt$kC)kC) +73+7i? ))PWtD$E*E!D$)Dqh $$D$gPU]PUEn,PU-FPU0sPUtc,PUtrg,PUtem,PUtXEPUu^O1<5.' D$UNj$tPp 1L$;D$v==wL$L$Qt$諮L$uD$ 9D$ tf, UQC,$t'UW0|$BU߳4+1t$ 1 t]|$uf, FM $QP4$n  $LD=uVQVF $4D$ H^_[]1|$t4$-1USWV[öh胢WT$L$ $L$\1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG@'M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$l/ 1Pʋ$H $$$H $<<$Rt$W /$//$H $>$D$^_[]ÐUSWV]ň2~:^^t@\|,$n*^ÍxЃs.ÉD$$\D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%\Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[ 1l$E<%uEpuEπ r?уstlu~;|$~,|$t릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[- L$ T$D$$Pj [ÐUSWVX $1h ։ͅu4$ u'$h蝚 5 @0t$E4}0u"$heE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$σstlu7D$ ~ ~$DŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,?E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $=ȉىӉl$ |$uGD$1l$뀋$\DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $>$t"A$|t+H$D+$1$uՋ$1ڃV$t@!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,袠RE,}0M4T$$V$0PRQ1$E4$1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PAP=D$π$O6\`D$TDl$H$th$V9r‹E0M4ʃ9‰\$WE,y$H$|T$\t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$41~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$V1ۋu0M4A9s E,u,߃$Vu,›rE,u0M4tڍqu4 $1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,螚tRE,}0M4$V$0Pt$QE4E,M4},$1^_[]ÐSP[]T$ D$$1Pj= [ÐS[.t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[T$ D$$1Pj [ffffXL$ÐUSWV[Ø|$(t$ l$uPƅ>l$$uj苹hjЗL$tfjVP NjD$uj(P/D$@ x |$(u(-VqE\1F4,9Pk1D$tGuP|$(,x |$(tF|$(m,V|$(-Phht@U膾 t$t$tL$t RB(JtRtPtjjPv IA(tPtjjPov IA1t^_[]Íx,Pjy=-VSVP[LT$L$D$tRQPVƋ$t P.^[fUSWV[t$|$t$jt0ʼnVU"|$T$VŸS-Pt$t~Pt$ptkX-Pt$Yt[^-Pt$BtKd-Pt$+t;k-Pt$uA1 @VK^_[]ÐUSWV T$L$[Ýǃ r-P̏Ņt'}/u{L$$ t$  |-P萏/P}PVcuU|DžjWWW1tpL$v u\D$ VP$tIT$ L$$ Pt$ ޙV`'uq-1V='-P莎$|$ $~:s1퐐Nt:t됐tÍMwUPWY D, L$$ t$ [tu{PލtG-T$ PQhR~)T$ L$$ t$ $-t$ $:uw1퐐Ot:t됐tÍMwUPVY D, L$$ t$ [tu$ $ȁ ^_[]Í{- USWV[hl$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%~\$L$ A ZAthhP +jj!DG(hhP|$ Gt\$h(jP|$ "\$jh|$ G9ouG)o\$UD$p|$ Go\$UVP舨 W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$P_F$ދ\$PD~ F$D$\$jWcF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_=|$ r ;jW{+DžuI8hVt$V/| $=jV6+Džl$$UL$VQPUW/1tt$tmT$:uVD$PrW.uNT$$L$t$(PŃu/D$PL$$4ŃuD$ W0^_[]ÐUSWVP[ $QRtkt$14$>|t9j|V-t.)9uUt$VJ t6u0,1(V袾9ſuUt$V[J ^_[]fffUSWV [D$48H L$@ 1퐐/t <,tEP~UWPQ .,v3l$4uWEED$\$cD$-D$|$j|WtD$4@ T$L$ t017t<,t\$RT$BD$P}tDl$VWQV Ut$PD 1<$WڼNjt$D$Pl$8u9EW|$WVܟ W訍D$D$D$ Džt$膍\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0$\$<u3D$u'\$U |\$8C k$K($fC K(K(|$T$ t$4-Pd>p1\$91\$-4$K\$-PdD$P؋D$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$ ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q貊 ^_[]USWV[8D$t uy0-|$ 1퐐/t <,tQL$5$Pyt2ƃ$UWPO 4$t$P; 1^_[]ÐUSWV[{|$ t$FN,9vtU6uCu;Uyt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[|$ l$qhPWʹuLt}D$x@ȃǃtVot$ U脹)Lstƃntfuă뿐1ɋT$z HVD$8l$|$ u)1|$-WuPt$D/W1pr-WuPt$D1TL$4xT$$s$tntfuσ1} t WPV? l$ E|$f>t WPV }t0EfEfF}WuV f},t&E(fE,fF}(Wu V试 f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[ë|$ t$FN,9vtU6J|u]uUUGqtHnNT$l$f,Ninf|FFWRP跓 ~F 1^_[]ÐSWV[t$FNy9vtW6{uCu;Wpt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[xl$D\EDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1.bGj|U)D$tL$j|UQt L$U=rUPt$P 10^_[]ËD$tP貮L$ =r*."D$t+P莮L$=rG.QUPt$T^jjPxtt$ $@ 1D5t <,tFPnD$4 VUPH D5$(L$tSD$HtJ11t <,tFPXn Vt$P D5$h|$t+D$Ht"t$7a $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0q$@,t'<$O 1҃ ҃f91wуuе<$O G$1҉L$‹O(Q9T$0RD$p )q$D$t$HjjjPjfWjQ.VWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[*|$ $ ftGt @1@WG(f hwUX =wb, Ƅ |)ƋtVPUW 9vD|ŃƋGtVPUW 9s D|ŃE$^_[]ÐSV[-t$ tavwlvllvalv Vlv$Klv,@lV7l19 uǃ ^[ÐX @ÐY @u0USWV[e$(E$$4D$$0j:Wut*jQP` t0V$0W NjE;$^_[]Ãu 1tMut6$ut,xf$O:t @t@uS4$l$w$D$j@UPU <:t$EF<:uEl$4$D$D$OtuP]P]CǃqbD$O@$$,PQhWZ t" ǃt= JjjWPXWP/P]t /j/V荊t|$uFA$jPRQV'FAT$ $jPRWUQV-/VPjESV[t$ j:VVrt*jQP tt$V1^[ÐVY~T$փ1ut^1^USWVH[8t$dl$`L$\D$Dȃ=u<$yu!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:`# D$t$DRL$D`# A @`? t/19<$d# D$D@ @`ƒ?t/91c# D$D@ @`Ń?+t/9b# D$D@ D$@|$`D$?t/;|$  ՋL$a#  <$‹D$Dpe# D$L$ D1 <@4$T$<`Ń?|$_u+t/19QL$ T$D $L @`ʃ?|$_ut/19 l$ D$L(D$<_D$$D @`Ń?+t/19 ՋL$ T$D |$_$D @`ƒ?t/9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0tU/R/;D$(Q,^_[]É<$t$D$x# VRPQT$T$L$ t$ ?3t/|$D/? t/D/ ?t/D/D$t//T$T$L$ t$ ?3t/D/? t/D/ ?t/D/D$t/D/D$L$ < t/L/ ?t/L/ t/D/D/ `# <$<$5USWV[Å$D$$  ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# Hy3y4t2tkƷ< sԃ1@tt# tlj瀍 ; 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# Iy|$| t!qtAD>1tBD>׹@# HyD,|t.tkŷ< s݃1@tt# tр‍ ` 1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# Iy|$| t!qtAD>1tBD>׸@# HyD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ;` 1ttD~t# z  fABy w~4ABy w~4ABy w~4ABy w~4ABy w~4Ay wʼn41 @tt# tlj瀍 ;` 1ttD~t1z$Qy$A# y$B# $u1 @tt# tlj瀍 ;` 1ttD~t⍃z# 0pQPQPQu# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فpzр3ʉрUɀʈǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ΀# D$# D$x# D$t# D$p# D$l#  ʋD$h# ыD$d# D$`# D$\#  D$X# D$T# D$P# D$L#  D$H# D$D# D$@# ʋD$<# D$8# D$4#  D$0# D$,# D$(# ΋D$$# D$ # D$#  ω D$# ɋD$# ? ? ։? T$ځ` $T$ 1# u# E# Qu# ƃu %?? lj%?  $T$ @D$Xƃ $ ΃  ` d J΃  ` d J΃  ` d J΃  ` d J΃  ` d J΃  ` d J΃  ` d J΃  ` d q[ 4$l$T$ L$ Ń4` x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]c$USWV(]8D$<X%UUUUʁUUUՍ4P᪪` d x   x ` d x   x ` d x   x ` d UUUU $؃` d x   x ` d x   x ` d x   x ` d T$H l$ ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $yX $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3` 3` 3` 3` 3<$t$3~3` 3` 3` 3` 3` 3` 3` 3` 3` 3` 3` 3` 1#t$t$D$|$811t$3=` $3=` $3=` $3=` $3=` t$$3=` $$1L$t$|$l$3l>l$|$l$ 3` 3` D$35` 35` 35` 35` 3` 3` 3` 3` D$t$D$D$$7֋T$ Bl$l$l$$xl$ ` d $x   x ` d $x   x ` d $x   x =` =d $x   x ` d ȃx   x ` d x   x `! d! x ! ! x 5`" 5d" x " " D$@P1(^_[]ÐS[ËD$1ɐȊt tT Tt t t4 uP1[ÐSV[ D$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[MD$$D$DD$@D$9\$6D$L$T$@jjPQjRFSqD$HPj -ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jPƺ$jP贺D$0Pjl\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjplt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]USWVd[՚$|D$<$`# hjD$@P DŽ$@D$V}$@8$u H$@D$.0$@UV,ljD$Pgt;uHd/WP3il/WPiuD$[/WPhD$UV蹘ljD$[4jPWh D$,u:|$$@PW#x$@L$,UV_D$l$0t$\$UV?D$ D$D$ D$$$@&D$ \$UVtt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DWD$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$V41$xUc$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-/PQR#_h$DUt$@VzF j jW hjU hj$P D$@hjP D$<;$`u`d^_[]D$RWOD$t.T$@PQhRml$ $KfffffSV[D$ h`rƉP7)Ɖ^[ÐUSWV[ؔl$0/jD$PUc thh`) $)D$j PU $l$1}$K1D=t<$t h`tt$,aō/% 4$t$L$QWPjbV4% L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃/t$ Wt$t$Pjbt$(VƇ% % %  % jQPR ;% % %  % jQP ;% % %  % jQP ;& % %  % jQP ;& % %  % jQP ;& % %  % jQPS ; & % %  % jQP  Ƅ;& jjt$ ^_[]fffffUSWVD[|$\w !o2t$`tD$@jPVT NjD$@9t8tnD^_[]n8"u trD$ D$ D$D$D$<D$8wD$X$2a$/WQjPI0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$,D$ tKWV(tD(1t${ t$ o Uf T^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[mt$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[>ljt$t$t$@[ÐS[ljt$t$t$[ÐS[kjt$t$t$[ÐS[îkjt$ [ÐS[Îkjt$ h[ÐS[nkjt$ H[ÐUSWV[Hkt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[hjt$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Èit$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXhL$Q##wÍG4ÐUSWV [xh|$(l$$t$ D$45D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[gD$ hPt$0A [ÐS[îght$t$! [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[gD$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[8;D$pML$LjPt$lv D$h|$df$D$V L$)L$D$PVW;D$ |$$v=D$t$.D$lp8L$ QjjVZ V|$)cƃPD$2PL$Q ? $ $$m=|$D$lp,t$ jjt$>V VE|$)Ƌ $PD$2PL$Q[  $ $,t=D$D$lp(t$ jjt$>V V|$)Ƌ $PD$2PL$Q rg $ $,p=D$D$lp0t$ jjt$>V Vk|$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7:L$R)уtuÐWVt$  r!̐cw^_fffffSWV[Ü4t$|$G@hjP  Tj@PW g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[u2$$N$@r8hUtE\EXETEP$t$tAsE@hjPD  Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV  h$$V[LhVU< hV1;$u Ą^_[]USWV [0l$(16t$ %T$$NP NT  ()`N`L$$WRP ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP 1 ^_[]ÐUSWV_^/$hRP RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$ЍL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W3 hj$P g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV$ D$hWD$$hPD$;$xu D$e^_[]\ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[È|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV[D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]ň$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$n54L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$I5$FQ? T$‰ً$|$D$G<uD$ $4 $+u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4訾L$ |$ )t$)t$$t$,)wD$ L$?? n4 T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍4FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N 5FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q3 l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj 4&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B j4Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?ፅFGPGX FGTG\GG?$L$u aD?4FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  6FL$Q? 5FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$5$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't5D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$5~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=+/5$FL$Q?P$4$NL$Q?D$T$ ߋ t$/5$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $usUSWV[FiE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRPf )t]D$)WPu8O }43M(U,E4E09w)RVP E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[<t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU F4n0)Pv8U 1tN0^_[]ÐUSWV[;t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RBT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVX%D$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$4L$@D$?? u)D$(5L$(5É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+hT$D$tq01t ^_Átփ*tUSWV _L$ y y$q9NQǃ8|$L|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[l$$t} t}$t }t9/t ^_[]ËGHǃ80D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPȢ )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[ø|$$ $w9>~NQǃ8wHl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw cw o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw u o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw r o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQQr F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw q o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQqL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw p o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw o o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw n o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw Pn o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq l $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq j $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv X n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv 4X n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv W n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu S } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu S } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu Q } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu rQ } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XotÐUSWV^HL$4t;T$8\$0Ӄs3I͉у1&Ӊi913tƒT$4zR13tƒT$4zR13tƒl$4M1ʉ3txT$  1ϋL$ 3tÃ1ؐ\=13t\=13t9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3t3t3.t3t $3Qt3t3t3t $3At3t3t3tD$ $3A t3t3t3t|$D$ $3At3t3tЉ3t|$|$ $L$l$11D$D$33t3t3t3t3W13t3t3t3t3G13t3t3tȋT$3t3W 1‰3t3t3t\$3t3_1ˋT$ )3t3t3tÉ3tϐÉ13tW13tW13tW13tW13tW13tW1Љ3tO13tRЃ^_[]ÐS[t$t$t$ [ÐUSWVXȘ$D$$tz \$׃vND$t$t1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX$D$$tz \$׃vND$t$t1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX $T$tfǃvEt $t1ف 1υt1Mu밸^_[]ÐUSWVPXz$T$tfǃvEt $t1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[>t$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXFÐUÐX_T$J r (ù)ы(ÐS[D$D$ P[ÐS[t$ ?.[ffXϏL$ P $ d, | 0 x8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_;T$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P<L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$tPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YRxL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +8)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +`)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVXt\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[ nt$舰ƅt|$7V3;G K ^_[ÐSV[ýmt$ 9tt$P:F1J J^[ÐUSWV[hmt$tLƋ|$$l$ $P:D$PWU, 1uBJ(Vo u 'J(^_[]ÐUSWV[l|$GtE/D(U8]wUt#V轡=yarau D$0VcI1^_[]ÐUSWV[[l|$GtE/D(U\wUt#V==tcidu D$0V+I1^_[]ÐUSWV[kL$A1t3)D(U6\NjD$pUt D$8H0^_[]ÐUSWV[{kl$M1tMuD1V[uVt(WZ=yarauD$8UH W1^_[]ÐUSWV[ kl$M1tMuD1Ve[uVGt(W=tciduD$8G W苝1^_[]ÐSWV[ÙjPt$ t$ ) t6D$t7<$D8WZt$WtD$ 01kGbG^_[SWV[jPt$ t$ ~) tFD$tP<$D8W`Zt$WAt,V=yarauD$ 01"FV聜F^_[ÐSWV[yiPt$ t$ ( tFD$tP<$D8WYt$Wt,VD=tciduD$ 01";FV)F^_[ÐS[hL$T$ jt$t$ [ÐUSWV[æhQ%Ƌl$$P5D$PUW' tgVD$tz<$D8WXt$WtH|$$t@V<9t7V65E 4#E8VPu 댅t D$ 01D^_[]ÐS[îgL$T$ htcidt$t$ [ffSV[}gt$t$u_Pz=tciduL$1=tcid^[ÐUSWV[+gt$t$#_P(=loobul$VEloob^_[]ÐSVP[fD$Pt&Pt$t$` D$VrD$1^[ÐSVP[|ft$t$Vt$t$` D$V.D$1^[ÐSV[-ft$t$t$!^VP8^[ÐSV[et$t$t$]VP9^[ÐSV[et$t$t$]VPg9^[ÐSV[Ýet$t$t$]VP9^[ÐSV[met$t$t$a]VP':^[ÐSV[=et$t$t$1]VP7:^[ÐSV[ et$t$t$]VP:^[ÐSV[dt$t$t$\VP:^[ÐSV[ídt$t$t$\VPW;^[ÐSV[}dt$t$t$q\VP;^[ÐSV[Mdt$t$t$A\VP;^[ÐSV[dt$t$t$\VP<^[ÐSV[ct$t$t$[VPw<^[ÐSV[ýct$t$t$[VP<^[ÐSV[Íct$t$t$[VP<^[ÐSV[]ct$t$t$Q[VP<^[ÐSV[-ct$t$t$![VP=^[ÐSV[bt$t$t$ZVPg=^[ÐSV[bt$t$t$ZVP=^[ÐSV[Ýbt$t$t$ZVP=^[ÐSVP[lbD$QP0t&Pt$t$\ D$V D$1^[ÐSVP[ bD$QPp0t&Pt$t$)\ D$V謔D$1^[ÐSVP[ìaD$QP0t&Pt$t$[ D$VMD$1^[ÐSVP[LaD$QP/t&Pt$t$j[ D$VD$1^[ÐSVP[`t$t$T/t&Pt$t$ [ D$V萓D$1^[ÐSVP[Ì`D$QP.t&Pt$t$Z D$V-D$1^[ÐSVP[,`D$QP.t&Pt$t$IZ D$V̒D$1^[ÐSVP[_D$QP0.t&Pt$t$Y D$VlD$1^[ÐSVP[l_D$QP-t&Pt$t$Y D$V D$1^[ÐSVP[ _t$t$t-t&Pt$t$-Y D$V谑D$1^[ÐSVP[ì^D$jP.t&Pt$t$X D$VPD$1^[ÐSVP[L^D$jPd.t&Pt$t$mX D$VD$1^[ÐSVP[]jt$.t&Pt$t$X D$V蒐D$1^[ÐSVP[Ü]jt$-t&Pt$t$W D$VBD$1^[ÐSVP[L]t$t$d-t&Pt$t$mW D$VD$1^[ÐSVP[\jt$-t&Pt$t$W D$V蒏D$1^[ÐSVP[Ü\D$jP,t&Pt$t$V D$V@D$1^[ÐSVP[<\D$jPT,t&Pt$t$]V D$VD$1^[ÐSVP[[jt$+t&Pt$t$U D$V肎D$1^[ÐSVP[Ì[t$t$+t&Pt$t$U D$V0D$1^[ÐSV[-[t$t$%SP*=gntsuVj!t L$1^[ÐSVP[Zt$Ht&Pt$t$U D$V脍D$1^[ÐSVP[ÌZt$t&Pt$t$T D$V4D$1^[ÐSWV[j ƅt%PVqFF F^[ÐUSWV[{>|$tzj C1tcPVpFF FW{ ŃPtQP)~n Vp1^_[]Í666PQh/RSV[ý=t$ tV P4^[Í6"76PQh}RSV[]=t$ tV P^[Í6"76PQh}RUSWV[<D$tfL$ L$QPjj01x@ƃ$Pt+ǍD$ D$Pt$ t$W01ɉV.ʼn^_[]Í766PQhURUSWVP׉[V<,8PQXj t}ƍPVnn~L$N uq$p' U3' VPC9tBPtnU $u vV1uWUԋ^_[]ÐS[~;.t$Pc[ÐUSWVP[J;t$t 9.t 1^_[]Fu VmF $Pt͉NjFu0PW&,8PQj t!UP$mF~$F qWaUSWV[x:l$1t 9}t ^_[]ËE D$P tߋMu0QPD$%,8PQ)j t'WP_lE$ED$E y4$.iZ¿9L$1t 9tËA ÐVY9T$1t 92t^BBtu0^ÐS[N9T$t 19 uL$ tB ;D$v1[ËBu0PQ$[ÐY8D$t 9t1Ê@$ÐUSWV[û8l$1t99Eu.E PqtNjEu0PW$^_[]ÐVY^8T$1t 92t^ËBu0^ÐUSWV [8|$ 19t$$9Gt{o F D$D$Pt[$W0ȅtЋT$ՋVtэQPRt$t$V+Owo tQ1 ^_[]ÐUSWVP[J7l$9EuwD$tyEti} Pa$PtFUu0t$RQt$ P*M}u tQ1^_[]ÍW7<76PQh;R8 S[~6D$t9u L$ t9t1[QPzk[ÐS[>6L$t 9t1[ËD$ Iu0PQ[ÐS[5L$t 9t1[ËD$ Iu0PQ[ÐSV[Ý5D$ t9u L$t9tf^[Ëp0ЅtItRP[אS[>5L$t 9tf[ËD$ Iu0PQ[ÐUSWV [4l$(|$$}(t$D$t9u L$ t9t1[QP:Y[ÐVY#D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY#D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY^#D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY#D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [ó"u t1D$D$ D$~N~(DN+t 0tV-usD$WPv$ T$ D$1ɿ9D8"yxu"D$j\D$WPv# T$ D$D$9T$rF8"u<WD$Pv߂ T$ D$!Ѓu 8"ttjPVl tu L$e^_[]ÐS[!' jPq' PQ迻1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[D$0' VPV+1^[ÐUSWV [èt$4NswD$8t8@tlr@uppQj WwjUVUZ tWVgWt UVY[1 ^_[]Í8|88PQhRWVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[ÞXPQq' Pn[ÐS[^' Pn[fD$w sÐS[D$ ;D$uPt$t$ w [1[ÐUSWV[D$ t$tPD$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋$L$qD$ tL$9QWPnu 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋ H vHN1 =tP w싔Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]ÍF9,98PQhRUSWV ]D$ \$$p1}<"$N<\u< $1ۃރSTl$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋ(Hptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍr9W98PQhRUSWV0[$Du wj0肤11<o<$ou}u $hD$(P Y|$,D$D$@@@@ @@<$GHws 琐HOP} wP$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUW%Xt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUyWu҉p9D$9D$Ews 搐<<}jt$W tfjt$W tS9jPW E $AEtLt@<-Eu<-u}>u$h\t u94$610^_[]Ët$t[$NjH<w sO9t1V\ED$"} D$,$t$U誰D$m$hō9D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VuTD$0D$ jP^F,F0F4F8F<^[ÐUSWV[9 t3Pj躣tjj@DžuUaOj@ҙ1t=lPWH>GjPZ]o,w0G4G8G<1^_[]ÐL$WUSWV[È t$1l9nU]N4 Džtbl$~4<$tC1퐐F,ƅt7<$t'W|$WV u,D$ E0Wӧ u,D$ E0t$V[^_[]ÐUSWVP[: |$oUZ1tIl9u?$jj袠t,\ ,HW;~$9uGD$tl9u L$ t9t1[QP:4[ÐYD$t 9t1ÃÐYD$t 9t1ÃÐS[ÞD$t9u L$ t9t1[QP3[ÐS[^jt$ <[ÐUSWV[;l$}t^_[]j@tƋ|$lPVn0jP~OF,F0F4F8F<}(t7h薋tL$7PUrVp0bUSWV ։L$[r|$ *?u-wG"}MG]jjWU -9jPwwt,ut$$U!jPww,(Ox"OD$ $QPht$0Wv$D$=L$$?u%8"uh׃P8:uQ'!jPWX t4jjWG t#\jt$(P6t$>t1t$$IU. ^_[]Í==9PQhRYS[ÞPt$ [ÐS[njt$t$d; [ÐS[>Pt$ [ÐUSWV[ t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPj-D$(Ct(w:a:9PQhjRQ趘GPLW衘1^_[]É.%:a:9PQhhR@a:9PQhyR:a:9PQhRzS[þL$A4tPQ4I,Dt*Pq,[Í;:9PQhR::9PQhRUSWV,[8D$@xl$DuVJ}4tS|$(jWl$HU4 tjU3tlD$D9(t9$VJ$,VnJPt$D54^_[]jj)tt$ \ ,At$DVL$*L$ql$$9.|$F' jP5C' PQ1[ÐS[D$L$ PQ[ÐS[D$ t$P[ÐUSWV[Ûl$}tQl97uGW2DEtS90uOH<1;M uM;H4w\t @,4ȃMWC^_[]Í;K<9PQhR;];9PQhR;];9PQhRSWV[|$wVqCGt$l9uG@=9PQh1RffUSWV[j}ƅt]l$PV"FF Ft0U_}tUt$P ~n V8"1^_[]ÐUSWVP[:l$|$D$D$j|ƅt61T$T$u͉ǍPVS!F~n ^_[]ÐUSWVP[úl$|$D$D$jt|ƅt61T$T$u͉ǍPV F~n ^_[]ÐUSWV[;D$1t&|$tW{t>WUP萞 j{Džt!PWN Gwo 1^_[]ÐUSWV[øl$19}EuBM1tDm $t: $UB{t^Ut$D$Pڝ U;1$D$j{t"WP$ED$E E^_[]ÐZL$1t 9tËA ÐZ¿L$1t 9tËAÐSV[ÍT$ t19 uL$t r ;t$v1^[ËR1ttVRQӜ ᐐUSWVP[*D$1t 9t ^_[]ËHh t( $tDUyt؉Ut$Pf ątv>g>%>PQhR\>g>%>PQhR=ZL$1t 9tËAÐS[ND$t9u L$ t9t1[QPJ [ÐSV[ L$ t 9t1^[ËT$19Q ut$tRVqC ֐USWV [øt$(>t~(t  ^_[]ËFY_jQvPgt҃~$tD$jPv  ʼn$u n8"tD$N N$9u8"t=>>%>PQhR1jPj N,$Uw7ǍFPD$PU tcD$;$uZujPV tD|$u W1,$j`wƅt-PVF~n W赇t W裇D$$0USWV$[%y11T$G=w ⍋jAPQ訙 u,1Ƀ<$tL$;L$c($ 1띃tGT$1ɽ<$f;T$")t$,$L5%>PQjtRSV[=L$t$ 9t8V 1;Q u.FtRqP&= 1uyu"^[Í?>%>PQhRw8?>%>PQhRXffffSV[Ý,PQ6|$ u( ' V^[ÐSV[Mt$ 1t 9u V^[YD$t 9t1ÀxÐYD$t 9t1ÀxÐS[þD$t 9u L$ t9t1[QP[ÐSWV[|t$~uo~(ti jPvv=t' !jPvvt1( |$,PQ&5V7^_[Í??`?PQhR胸SV[ ' VPƃ' ( VPƃ( 1^[Ð1ÐS[nD$L$ yt,jPB2F,F0F4F8F<^_[ÐUSWVP[xt3Pjwtrj@,nDžuU~Wj@n1tE,$LUW/GjP1$G,w0G4G8G<1^_[]ÐL$GUSWV[ø|$1tvL9uloUP1O4ƅtIl$44$t*1G,}(uL$UxUSWVP[z*։ $|$?uwG8]u<GcjjWb tCjPwwt,t1|1jjPUt$t1U^_[]ÍBB@PQhRR`S[îlPt$ 賾[ÐS[~jt$t$t [ÐS[NlPt$ [ÐUSWV[t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%@@@PQjmR?QrGP=&Wr1^_[]É.@@@PQjkR@@@PQj|RתS[D$H4tH4[ÍlAQA@PQhR葪USWV[D$,hUt$0~Wp%~4tR,$ljUt$4V tjV2tLD$090t9$W %$W%lPt$0\ ^_[]jjjt 00AD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ð􍃕8DDPQhRESWV[Ìt$~ t 1j Vt ;~ r^_[ÐSWV[L|$t$t0t*PVtuj Vm^_[1SWV[t$F|$uLPVujVm1^_[Í8DDPQh$R胚SWV[t$F|$uEPVtiu]jV}1^_[Í8EDPQhER蓙USWV[t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Í8+EDPQhdR#USWVP[jD$1ɅQh Dt$7jO1Ƀ#hN$GGG wtHt$WՃj W=tjW$$D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[(t$@|$t$t$jt$ >[fffffS[t$t$jt$t$t$>[fS[ްt$t$jt$t$t$=[fYXZQ̀QQr頍S[Þt$t$t$t$ލ[ffffS[nt$t$t$= [ffffffS[>1;D$[ÐS[1;D$I[S[88t ja1[ÐS[þ88t j11[ÐS[Î88t j1[ÐS[^88t jъ1[ÐS[.88t j衊1[ÐS[88t jq1[ÐS[ή88t jA1[ÐS[Þ88t j1[ÐS[n88t j1[ÐS[>88t j豉1[ÐUSWVX  ( ?) R4( ѐ>t1 @u~1ɍ( >t 9u#;T$t$1 ^_[]ÍSJJPQj>R{wffffUSWV[$áL$(3L$,9L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]Í.QPjS[L$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[ät3T$8tOl$@toKVPt$DR芌KKIKPQhRo멍KKՍIKPQhR}o뉍KKIKPQhRWoT$Hk\ODH@utD$ j PW芙 $T$t8"u,t"t0OFgPVQt$HT$ 9L$<lD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)KWVPQt$H11҃^_[]Ë$T$|$(9ыl$,}K|$09Njl$4} LUWRPVQt$Tt$T褉 맋L$8fffYoimNA90%ÐX?L$ffffUSWV0X$t$DL$H|$PL$%1|$L$W"D$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$fC T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ w-1$3l0^_[]Ë$LL+LPQhR.f$LL+LPQhRfL$XUSWV0X$L$Ht$DL$1|$L$W(D$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU< T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$U&1$e0^_[]Ë$LL+LPQhR_L$XffUSWV<[8l$X|$Tb D$\}  |$T  D$u D$4tǃǃğT$PT$$9L$$0T$,LT$0\$|$ <$D$(\$ğǃ|$ l$XL$1L$uHD$4;L$$D$T4>-u FD$,t$06E<+<-~ğL$ XT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Őğ<0ğȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$ğ+|$ /Vğtu<-u ~4$<:tkE$<4$PV,L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t4$P $? t/ǃǃğȃ<^_[]À:uL$:tVL$D$X:L$u^W0D8t}:tjWPeWx:L$T$,L$ $_D$p70:t%j=R*@)D$Cȉ $ğ|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$V7ND$\(pD$D$ 1T$ $ $.T$tf\$QURN uUM $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:hRQP… \$ğ+L$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tRQP@ 1L$\|1uD1 <-t<+::BtD8tD$X8:tRP?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:tRP.1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$80D8t}:t4$P趃 $E<-t<+u:}:1<: :LLLPQh_RTw MLLPQh`RTD$l]MLLPQhaRT|$T;LMLPQhR{T MMLPQhRQTL)MLPQhR*TnL)MLPQhRTfffffUSWV[Ë|T$t$+ ǃ+ ̟;D$}? 9-u7yПI+ t8--?̟0П^_[]Í0Пj-Rx$tǃ+ --LM׍6MPQjRRR(MM׍6MPQjSRR+ ПП+ ::tlQR#tXx:?u'1x:t̟H̟;L$|鉻 + 0П̟T$?u̟?ȟ::^VMUPQRrǃ + ?tq̟c0П:D$8:E?ȟ3UMfffffSV[ zt$ tj jV ^[ÍNMPQj/R.QffffSV[ýyt$ tjVRO^[Í\NWNNPQj/RPfffffUSWV[kyt$l$tyjj1trjtkNjD$oGG EllPjQRjWtKjPj U1^_[]U8l$uEU8U(W|$7U(릐USWVP[Zxt$ l$ME 1҉s9r J9sAEOQ0t`U)ƒQjRD$ `Q E $}E T$)9w΋MVRPT( E E MU9r‰^_[]ÐUSWV[ËwT$L$t$ D$t0tUyyNNjNPQhRMpxA)9}8ITTi t?NNjNPQhRMx3rH HPp 9r@ 1^_[]S䐐S[Îvt$1[fS[nvXt$ t$ Pr [ÐS[>vXt$t$t$Pذ[fUSWV[ vl$|$t$t1UPWV1^_[]Í ONPQj4RMŐSV[íut$ tjjjV0^[ÍONPQjARLfffSWV[\u|$t$t1hPWV_0^_[Í\O!OPQj6RlLfffSV[tt$ tjjjjV輌t^[ÍOOcOPQj0RLfffffffS[Þtt$j t$t$[fffffUSWV[ktt$|$tBjW*~G0t ujW,^_[]ÍOOPQj/RVK띐USWV[st$|$ttft7t9fh L$f@Hx$p,L$ H(L$$HDL$(H P1^_[]ÐUSWV[hsj81L$,l$(D$$t$ T$wGo Ouu u&t,t+$ttڍ|uft?$L$t: $fH f@xp$L$H,h(@DLH OW1^_[]ÐS[~rL$ D$T$rRQ0P [ÐUSWV[;r|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[qD$t$t$t$0P [ÐSWV[ìqD$8pPtWփ1^_[ffffffUSWV[kqT$l$t\tE0~-},t xr }$t jr2U 1Ƀ^_[]Í0P֍OPQj;R:Hu8P0P֍OPQjRQP { tQQQPQhR AL$h@FRQQPQhR@ l$2PQj2Uw]U6ƋD$XtPUt$\ ;D$4u 8^_[]9ffffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^SWV[h|$t$t2F)F31uF FF^_[ÍUTTPQjYR?뭐SWV[ìg|$t$tg~uP\$wGN Qtz|XUTPQjwRK>VSV[ft$ t ~t/>"U/UTPQhR=~uр~|$^[ÐSV[mft$ t ~t/F"UDUTPQhR=~uN .wu^[ÐSV[et$ t41~t^[ÊV u.wL$~9|ԍ"UZUTPQhR<먐SV[Íet$ t~t0^[Í"UoUTPQhR<~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[d|$t$t@1u6T$L$9w"QjV"> FfFF^_[ÍUUTPQh.R;뜐SWV[ldt$t>~u/L$Fy |y|9IL |F1^_[ÍUUTPQhMR\;랐USWV[ct$,|$(O $$PWV N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍUUTPQhhR!:UUTPQhiR9SV[}bt$ t"~uDNu;V9r1-UUTPQhR9~t^[ÐSV[ bt$ t31~u(NuV9rT$x 9v ^[ÍUUTPQhR9fSV[Ýat$ 9y ^[ÍBV.VUPQjTR8אUSWV[Kat$|$t.l$tGMϸwG)o >1^_[]ÍUVVUPQjbRJ8뱍iVVVUPQjcR)8또USWV X`$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQg9D$0 28t p׾$VPUX 7+D$p)t5u+VQA$RjP8 7D$)smH1 ^_[]Ë$"UwV֍UPQhR6D$4$VwV֍UPQhR_6g$V΍wVUPQhR16D$a$WL$sWՍUPQhR5L$USWV[x^l$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQI7 D$ }+$x)t6u,WQARjP6 l$}<$)s8O^_[]Í"UV֍UPQhR4V͍VUPQhRr4렍WL$sWՍUPQhRF4L$;SWV[\t$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9"UVUPQhRJ36VVUPQhR 3)뒐SWV[ì[t$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1"UVUPQhWR2VVUPQhXR1VL$t"T$ tփuQ^ÐUSWVP[*Z|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP2 D$$L$(l$0O}^_[]ÍWW$UPQhR|0T$L$8D$4VU=WWՍUPQhR?0\SWV[X|$L$1uLwt?;t$w6)w*t$uQRjQ1 ^_[ÐSWV[LXt$|$D$Vt$P ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWV [8W|$$D$(t9D$ L$,ň̍gWL$]WL$U $t4EtM9wEM )9w+8t;9rt$t$ht$ -d$<뭋D$4 ^_[]ÃD$0D$4(+T$ ܐSWV[,Vt$|$D$VPt$  ^_[ffffffS[Ujjt$t$t$t$j[ffS[þUjt$ t$ t$ t$ t$ t$ [ÐUSWV[uUD$$$$$ $$$f2}t$pPQj VID$,D$0D$4D$8D$<l$$D$(D$ D$L$ PQV$6 't&6P]&FgPVQ$D$$D$hP$S$k$$UhhWCD$ D$$GƄ4$$$UhhW.Cj W;t$\8D$1$0Ut u뜐44 w$h|Wy΋\$TSÐƄ4$$   t tL$$рwrt ␐@D$tl$$<-<+$ @ |$L$ t$֋$JD$D$PjL$Q$&P$@|$L$ t$֋$^D$PjL$Q$&P>D$Q$l$֋$WTl$&$$׋$$P&NJE<-tb<+tD$Hɋ$@tD$$L$Q$jP+JtD$Hɋ$@tD$$L$Q$jP%؅$U$j 1$$׋$$Pu\~$P$1u7Yu,N$P$t/t u $Uhh$$W>11D$ D$4D$1ҋ$D$;$ȁĜ^_[]Ë$1ɋ$ύ-YYWPQhR.aXYWPQhRnSXYWPQhRV蓷USWV[h8D$(L$0T$4t$,/l$$D$ D$f$t$RQjVP;L$u^_[]USWV4Չ[7D$$0qƃ,- ,- Ƅ$/jjjhWUVc1Ʌ |$$/jjjhPUV8t1D$(D$$D$ D$D$FD$D$D$ $L$ ȫPQRl$Uj 4$|$.vt:D$.jjjhWvvuW$3Pu,$@$/u,- ZPRQj14$kD$;$0u4ȁ4^_[]Í{XZWPQhR h>USWV0։[6$DE$,8aƄ$+$+jjjhPVW}1D$$D$ D$D$D$D$D$ D$GD$ D$$L$ȫPQR$Puo<$1t[l$l$* t=D$*jjjhUwwuU$/Pu$l$1PE;$,ue0^_[]Í{XZWPQhR $TZZWPQhR xbfUSWV[84|$,D$(/D$wl$GQjPk  G1t$ 4$1D$-t$ $ $‰D$9$6Ѓt$ш̀Ѐ w ЉT$`̀şw©T$M̀ſw ɉT$-tuʀ߀¿et$ w=݋t$|$<$$t$&$$1 $+L$ r#E[΍;[[PQj`R D$,H$$t$,F $)ʃr#m[;[[PQj}R F$)N)!r s.^_[]Í|X;[[PQjCRZ [;[׍[PQhR1 몐USWV [ø1t$ ~Nƃl1 V҉$t`L$FшT$?r?鍋-1 $j@UPQL\$+-1 ~t0|$>L$:$u -1 uL$>͍ >T$1ҍl1 -9si$:[U;L$s>t 9sE.9r9s34$[h9s맋 $l1 9s$-1 ^_[]fffffUSWV[[0t$|$pU|8PPWVWEU\^_[]fSWV[ 0t$ W1PPV W^_[ffffUSWV[ø/t$tLD$F$V~nF:m1 PUWRt$t$QjV#$^_[]Íf[[PQj3R듐USWV[(/|$,L$T$ |$l$捃\UWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]Í[[PQjBR[USWVH[X.l$`D$ D$D|$\SrE$MUu}m5\UWVRQt$PjD$JP"$$G\PQf&jjjjPVoƍO,0 VjjjjWoƅQUVzL$\ QL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$hh@V>p 1lj,$t$\hVWo Ņ~UVD$ P> 0Wp0,$xj$uj!至ƅth$\L$QPJG1\F LFuF E;$lu5p^_[]1㍃\\\PQjNRt'USWVl[$$D$h$UD=$$U= uj!聲ƅtXD$XUPKF1LXF LFuF ;D$hu2l^_[]1ꍃ\\\PQjhR~J1S[$t$ t$ f[ÐS[#t$ t$ F[ÐSV[#\1 jPV  D$ jVPjX^[fD$ȉty!fUSWV[X#t$0l$,D$tjuj) ƅtRUP1 F LFuF(;D$u6^_[]1ꍃ\P]]PQjFRur辡USWV[Å"$ $$P'h@Vil1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ y|=P$Pt$ok ƅ~.V$P$P |) u84$Ilq8|$$uj)ƅ~$$QP1F LFuF(4$Wk|$;$u^_[]1踠裟S[~ jjjjt$t$[ÐUSWVt[H $D$p$U$$U= uj)ѭƅtXD$\UPk1L\F LFuF(;D$pu5t^_[]1ꍃ\Y]]PQhRG~fffffffUSWV\[H|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]Í ^]c]PQhR]]c]PQhRx$(ffffUSWV[ t$0l$,D$tjuj)謙ƅtRUP1 F LFuF(;D$u6^_[]1ꍃ\\^^PQjFRur^USWV[% $ $$Ph@V U1$|$$ $ u#D$P|$WBP|$`l$d$$ʃ|&jQPt$ |=P$Pt$T ƅ~.V$P$P` |) u#84$T8|$$uj)螗ƅ~$$QP1F LFuF(4$WPT|$;$u^_[]1XCS[ jjjjt$t$[ÐUSWVt[$D$p$U$$U uj)qƅtXD$\UP1L\F LFuF(;D$pu5t^_[]1ꍃ\g^^PQhRkGfffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[êt$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPط 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP| ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [ø|$$D$OGD$ $?17l$ )ȃ8w ^ffffSWV[Ét$(WjV xqN|$,t?r$d$D?r'm- d$!L$jWV* ^_[fffffffSWVP[t$tB$5 PQhRx>L$ $¤5 )QVWRs.5 PQhR5 = t@= ^_[fffUSWV[+t$D$D$I@t NQw |ى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]Í}_t_:_PQjbRSUSWVX[D$lD$ 8D$DD$@D$Ǩt\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]Í__:_PQhtRSWV[y|$t$t5$D$ WVjjjP1Ƀىȃ^_[Í__PQj:RqffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[(t$(l$$.PT$(18D$8tP)rjt4)sD$(8rl$ ugPt$9ŋ$t$b趵0rD$8tP(Wv4$V#t$J#r01UPt$ҡŋD$G6#oD$ G = = D$8tP-(G^_[]Í.`_PQhR &.`_PQhRT$(#93ásLjUPQRV/j5USWV׉L$[B2jeVj+Vt-1 |$WjPj%eyFu<$|$1jrV!t?b $UW`ft1jdu%ų07!w!詳01^_[]ÐUSWV׉[W= tu8!mu?ru<6"!FtjPgv!+u4jjg&v tjPg6 ^_[]ÐUSWV[øt$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$Ӟŋ$t$]P0D$8tPI%Wes4$t$01UPt$qŋD$G6oD$ G = = D$8tP$G^_[]Í5`_PQhR迫&5`_PQhR蕫t$,|$(T$0VWU jUSWV[t$8$8tP$= t9ut>mt9uu+$8tP#贰h1VEu= $8tP#|$jWu 5 ƃu V8tUqtt$^_[]ÍE`=`_PQhRFfffffffUSWVH[D$`|$\t$$UVPW9ZtUVt$aǃu.覯8uj?~;$} VPaǍD$9tLVpA$jD$Pit&UPt$hWY{D$$oH^_[]Éƍ``Q`PQj>R1fffUSWV4[øD$\l$HSt$XoL$`u0tDunuRt덻`tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ t0L$ V2 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$虛Ń|$jt$ RU||$tUjt$ RPe|$t>jt$ RPNl$t%jt$ RP5tjt$ RP T$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQWщ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WPƉр|$ul$э`4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0$~0蕚L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$}L$,T$$ Qa4$Qt$(V0WRUt$h$[4$|$2jjdQU豘ыT$,t$$r`4$Rt$(QPVt$dVt$dn 9wijt$ QRTщ9|$}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QR轗щ9}T$ 4$T$\ijt$ QR茗D$ ы4$T$\BK`PQj8R莢D$l``PQj9RfmfffffffUSWV[$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]ÍaύDa aPQhRM>USWV։[$$F t%G HO =rĥ,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQx D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]Íaba aPQhR|[Taba aPQhRR4Taka aPQhR+USWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVOuD$t @ t$?D$ h |$t$(${PVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPO)u$|$tq;$PT^_[]ÍLL)19t,N,19tDtP\t$FP\F^_[]ÍTaJa aPQhRuUSWVY T$tht$1BtBظkw+|tրztЃːt *u1^_[]ÐUSWV։[t]F,F tvjFUPUl$~D$uNtQjPaD$ L$$t$ F1퐐f$t=tsAuE @u1$P-l$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu跏$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$PIŋ $fE$$UW$L$$Q$QP$D$,!=YTaa aPQhER蹆M lt$10dD$/ Njt$$E @D$uPPUu 8t E u;$6Ĥ^_[]ÉNjt$몍aa aPQhRaa aPQhRʅ|aa aPQhR装$caa aPQhRuOTaa aPQhRN7Taa aPQhER'L$ Taa aPQh/RL$,USWV[vT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍΍ aPQhR蠂a΍ aPQhRuT$8b΍ aPQhRCT$8ffUSWV[Ū$$c$$tu資1D$$tŋD$3l$ 11h@PdD$(D$$D$ iL$L$\QPctYD$|$D$0t$\ d$<0fD$PPju@] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tPxvPWu uh6D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P (jD$PD$0J D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$ybjPvo u|$1D$Wt$v>Ƌ$6yd$t$\D$|Ay DAD$$uD$*\ՋD$DJtDHD$D$ $@uP \ DAթD$}bjPD$pYNjPD$p; D$ |$t$ztG$`L$tZybjPq@jPD$p /1ҋ$t}bjPD$p1҃ |$t$D$|$t$$$&D$ $D$|$D$ D$(D$$1AD$ 1H1D$ D$D$8譀< 蒀Y1D$ D$l$t)pD$D$\PjuV |$N8|$ $%|$tcjPu |$t&D$u|$8|$ $tt$Dtu V,~t$jl$ U{ 1$u U@;$uEČ^_[]Ë|$|$[|jb_b%bPQj_R~yy1!S[jhjt$t$t$[ÐSWV[ܡ= t-= jhjVPt$$t8= 0jF= = tPY/= u^_[ffUSWV[[|$= jjjP = l$= tUQ= # = t]1i = 9= wHt Q7? = W.= t$UWPȟ = u 1T$ Ɖ^_[]ÍbbbPQj= ^_[]ffSV[}= u*ǃ > \1PVܔ= tt= *VP!1^[ÐSV[ ǃ > = tP89\1PV[= u*VP1^[ÐUSWV [Õ$ǃ= ǃ= ǃ= ǃ= ǃ> ǃ> ǃ> > = hhU虠D$ 1Ʌ$t$L$ $t$ > L$l$<ǃ= = hhU0D$  > t$P)j\WVqO t8t剃= 8#tj\WVGO t8t뉃= j\WV'O t8t뉃= j\WVO 68t牃= ǃ> ǃ> j\WVN tD8tP> j\WVN t8tP> h= |$$W" |$j\PD$ PMN ǀ8tWfu͍jUW0hth/UWhtTdUWht@UWgt,UWgtUWgQ> E5xxMf l$<$j\WVgM 8t牃= 8#j\t$V4M t8t艃= j\t$VM tOǀ8t扻> PWg"= PWftb4t`= D$\1c > PQ[ > l$tэQPfu= <$j\WVGL t8<$tP> j\WVL X8<$tP^> t$t$1ɋ;$u ȁ ^_[]SWV[üt$ǃ > = t P۞&\1PW= t*t+V= [eu䍃= *WP/ 1^_[ÍccPQhRgmZSWV[t$ǃ > = t P &\1PW3= t*t+V= du䍃= *WP_ 1^_[ÍccPQhRlZS[= tPbǃ= [ffS[L$T$ j@t$[ÐUSWV8[öt$PT$$t$,ZT$L\D$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$0t$t$ [ffffUSWV [} F FEFUVzRu)ʃԉF:FJFx9uRu%N ;Nue^_[]USWV [Q} F FEFUVzRu)ʃԉF:FJFx9uFpRuO{ N ;Nue^_[]ffSVP[ìD$L$T$t$4$VRQPffSP[}D$ L$T$$RQPIfffffSP[MD$ L$T$$RQP+JfffffYT$t :t(1ÐUSWV<[t$PD$D$8(VPQ` B hjD$P\ B D$ $'B D$ t:t|tD$ 9r(B waPQt$q ,B aPQt$tq L$ zQPt$\q xNt$ (PVQt"dPVQu 1  hB V!j:Pt$^ thB l$AUPt$w tL$8B ˖UPt$v t D$@B 3UPt$v t D$k[ffffS[NllPt$t$t$ [ÐUSWV8[luD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$y\DP@Ӻ\$%D$ D$$OL$ۀU|$ɋuL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P7Pt$t$- ZD$x$W7Pt$W @D$x$WW7Pt$W )D$x $W,7Pt$W D$x$W7Pt$W uD$x$W6Pt$WV zD$x$W6Pt$W+ `D$x$W6Pt$W <D$x $WU6Pt$W D$x$$W*6Pt$W D$x($W5Pt$W D$x,$W5Pt$WT 1D$D$$T$EHL$D$D$D$ Pp5Pt$t$ D$@D$ P?5Pt$t$  D$@D$ P5Pt$t$  D$@ D$ P4Pt$t$Z  D$@D$ P4Pt$t$) D$@D$ P{4Pt$t$ D$@D$PJ4Pt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ |$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ eD$ e|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$!e|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ Vb-D$Pt$V ID$ V3-D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$lQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$\ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$0A(|$€´|ejWPx O$BejWP[ 9$D$D$P"D$PWt$ % 7D$@D$$Pv"D$PWt$  j\$0T$L$0DHtJD$0$Pt6uF $jP9F$F(W|$*|$z$d1  $PiUB$J($1 UB )iJ$$dB(1UB $1+1|$r$L$B(aD$ t$ D$ L$ȃШ uNQi)1uB,i)\fиwi)\f1N Vk4<$ȃ u|$$uD$$FL$NlQkdl1u'ui)\P ףr1с)҉)i%Iэ))ƒʋt$$$Iʉ)ʋL$())uFЃFL$$ШL$NQiҐL$)1uE,i)\fuwi)\f1=‹Fk4 $<1ʃ;D} $r+3LMAD$AuNL$tuϋNQi)1uB,i)\fиwi)\f1Nk4$NȃF ?NQkd)1u'ui)\P ףr1с)҉)ȍ 0i%IЍ)ȃEHx3QЃs1΅$u t1$Ep]΃t1ɿŃD$ $D$,;$0u D$ e^_[]#fUSWV[Nt$,D$(K H9ttkH͐w ˆ|$T$ H w ,Ť,$HP x(@D$US =*efF F????F:?? F ?:??F?? ?F??? ??? T$̉ҍ)эeQPUt$Wt$$t$t$(R|$,WVB,9s1=`elQUt$ WRt$t$$P|$(WVA(9r1T*8^_[]ÐS[ÎMK Pt$ s[ÐS,[[MPt$ffffPQjIRX!USWV[Il$L$t*t$1Ґtuщ )4@tRjP" ^_[]fffffffUSWV[hIt$$|$(9jVPƿGLjVt$, t$(LD$l$,L$ t-|$,RUT$RT$t .l$(RRl$(T$tX$|$  tQPT$ <$EFt P}F tT~tE1t(0\F t((MF t( >;~s F @ƋF P"F,t PF4tPF8t PV^_[]ÍRggPQjKR?ehggPQjMR?efffffffSWV[ ?t$4W1L PVmW^_[ÐSV[>4VL PmVގ^[ÐSWV[Ì>4W赎L L PQmW蔎^_[fffffUSWV[;>t$l$VvZVt$j[1u<$Vt$B[DžtpU7 t]wtуUP t u막t$~utQ ^_[]É1ԍ`hhPQj1(\DHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xshihPQhRF 0 ii֍hPQhR USWV [è3L$(l$ D$D$(N|$$L$ߐt$,D$PUD$PlutxD$ѐwztM׊D$L$uD$ `l$ s+D$tD$u:t)2ȫihPQhR  ^_[]Ël$ u렍J΍ihPQhR >΍ihPQhRi S[1t$t$jt$ [ÐS[þ1jt$jt$[ÐS[Î1jt$t$t$[fffffUSWV[[1`L |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉdL uj(ƉDl$Uxtwn$Nj 0Q 1xL utjh=$ʼn`L 0ƃxL LttMjуdL @1t*n$FUQj PQ$|$z^_[]ËdL )USWV[/hL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉlL uj(QƉDl$Utwn$Nj 0Q蜸 1L utjhʼnhL 0ƃL L|tMjуlL @1t*n$FUQj P"|$z^_[]ËlL )USWVP[z.l$UNjpL $tOs;1҉v|L ljh=pL $uƃ|L D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$lt0dL tuR:tt!jуdL tiE$SdL uj(ŋ$,tIEj |$WPA WtE@E$L$1E^_[]t$t@ϐUSWVP[Ê,l$UNjtL $tOs;1҉vL ljhtL $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$|t0lL tuR:|t!jуlL tiE$SlL uj(ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWV[Û*t$|$ tЋ`L t61=tDtPǃ`L D$L$ƃxL pL t?1=tDtPLǃpL D$L$ƃ|L ǃdL tD$ x1^_[]ÐUSWV[Ë)t$|$ tЋhL t61tDtPǃhL D$L$ƃL tL t?1tDtP<ǃtL D$L$ƃL ǃlL |D$ 1^_[]ffffffUSWV[u($tA$1uh*ƅtcD$E/$tt$$9ux/Ĕ^_[]J?$9u/(>?USWV[û%t$tD$tdPV$xaa1ɐ΍,?UQBt&UP$y.w8"tV g1^_[]ffffUSWV[%t$VNL PβL ƃL \ tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t PǃL ǃL 1F ^_[]ÐUSWV[#|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]ÍKn}nPQhR]nn}nPQhRv6USWVP["|$t$t#l$ t?tajUjW^_[]ÍKn}nPQhR빍nn}nPQhRun}nPQhRxUSWVP[5"$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lh$p $L$1xjjjU|$ `NoPQhl$XUjjjh@Uujh@6j D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ j ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$n}nPQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QPrT$ )ʼnl$‰$L$\$(l$$|$ t t$_it$,D$l$ tEF4$腼hD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PU5))\$ )D$Ɖ$T$<*)׉ڋ\$QVPN Wt$DU@ t$$t$ t$0Q/L$0\$|$8T$L$ D$ɋ,$tt$T$fT$Ћt$ 9v8)PUX|$u(U޹|$ |$L$1|$k04$薹Y0rL PKL PL L$ <$14$-$lyD$0P|$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xW t_WVPW UUx~1L$ ȉŋD$8L$D$8B\$WH |$ t$dUU |$;$LP^_[]0WHnL$nՍ}nPQhRL$,8BoL$nՍ}nPQhRꋴ$tL$,nL$|$nՍ}nPQh RE|$L$,L$|$nՍ}nPQh R $|$L$,Ń|$ \$t t${c4$նn}nPQhR$|To}nPQhR~$|Y\$Uj|$ t\$t$b\$t$0CXL$ÐSWV[ìt$|$tatY8t1t0:t+|t&9vt:t |u^_[ÍKn}nPQhRu}n}nPQhRKVSWV[|$t$tGtiL tPǃL ǃL ƃL ƃL WV^_[ÍKn}nPQhRunn}nPQhRpS[.L tP#ǃL ǃL ƃL ƃL 1[ÐUSWV[$,E$$$(L uL ȋL u!Q0 L L t%1L L PQq1t $D$uz1L VwMVǃL L HL @MQP2 L u<\1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL @0uًL t:tuT$ T$VP tfVǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$V]ǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPǃL ǃL ƃL ƃL GVǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL Un}nPQhRM$<Enn}nPQhR$<ȐUSWV _ǘT$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd谞XƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPW誨ƿdD$$у¾2w/:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPU"tL$(U$W螭 ^_[]ÍKo֍}n$PQhRc|$no֍}n$PQhR.|$|$(So֍}n$PQhR|$&Kn֍}n$PQhR$nn֍}nPQhRUSWVYT$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jd0t]ƃdNJD$$ƹdEt#<:tu)FdPWҥu`)nu N$UW补t1L$$8$o#o}nPQh`R$W^_[]ÍK#o֋$}n$PQh"RL$Vn#o֋$}n$PQh#RL$|$$&#o֋$}n$PQh$RFL$Kn֋$}n$PQhR$nn֍}nPQhRUSWV[k l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuPZ F(N8D} '~wF^ FPB^ uWv$AR tƒN ~?:V|@uH)ƒVԋ^ sLFF$BBQWP uvvQ K~?:uFV;~t^  ^ 8u^ F,;8u e^_[]Ë^ 茅S[^0t$t$ [ffUSWV [!} F FEFUVzRu)ʃԉF:FJFx9u0Ru]P N ;Nue^_[]裄fUSWV0[sD$(}PQfXL t$M L$ML$f|$ L$T$|$QRj WPBuOt$ rF|$j WP^ u0O L$FD$D$ PjL$Q蒵 79_t$} urP tgM9uWM % oQPR}Wuz19r"y";L$(L xjjP@ PFJD$t$ L$ WJt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V uEPVuՌ ;EsD$t$WkHL$%D$"T$ ;UwRPuƳ 1ɋt$;D$(u ȍe^_[]6S[ojPu;L lh P{>P [SV[L hVt$t$t$%t1^[fffSV0[Êt$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[ìt$|$jW1j VWU) jW(^_[fffffffSWV[\t$|$t PpPQ ~^_[ÐSV[ t$ tPFtPAFFFtP#FF^[ÐUSWV[Ø|$(?u pPQt$$oD$t U諀jjjj|$87#Gʼnt$Ptqt< t< tt$WHqt Ń1W/$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ P-E D$ 聾L$ v8ukD$ $FD$,t$UpmŃzAA jj t$D 8 8tq0|$(tPϭ$tP GGGtP~GG製01^_[]Ë$fffffUSWVP[Jl$t$D$ $ t t@u$Sq?qpPQj8RZ@QUVwЃt 0$^_[]ÐUSWVP[úl$t$l$ t t@u$Sq?qpPQj8Rȶ@QUVwЃt x0$^_[]ÐUSWVP[*t$ l$T$D$$$ t t@$u0qqՍpPQjpR2t$0@$QVURwЃt ٻ0$^_[]ÐUSWVP[Êt$ l$T$l$ t t@$u0qqՍpPQjpR萵t$0@$QVURwЃt 70$^_[]ÐUSWVP[t$ l$T$D$$$ t t@(u0qqՍpPQjyRt$0@(QVURwЃt 虺0$^_[]ÐUSWVP[Jt$ l$T$l$ t t@(u0qqՍpPQjyRPt$0@(QVURwЃt 0$^_[]ÐUSWVP[êt$ l$T$D$$$ t t@4u36rrՍpPQhR诳t$0@4QVURwЃt V0$^_[]ÐUSWVP[ t$ l$T$l$ t t@4u36rrՍpPQhR t$0@4QVURwЃt 贸0$^_[]ÐUSWV[ht$,|$0*T$>t .$ tEt@u%rrpPQjJRVE@NT$RQjjjuЃ>T$u-ks^smrPQj[RT$,$ t|$ tEtHHu0%s s׍pPQhR踱|$0EHHPVt$0t$0WRUуt Z0$^_[]ÍrrmrPQj}RaS[lPt$t$t$t$t$S[ÐUSWVP[êl$t$D$ $ t t@8u'sspPQhR跰@8QUVwЃt g0$^_[]ÐUSWVP[l$t$l$ t t@8u'sspPQhR%@8QUVwЃt յ0$^_[]ffffUSWV[Ët$l$3$PQWz t"t$ VW @WjjPԁUw'PQW: t$fffffffS[jt$t$t$ [fffffUSWV[l$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[]~VUSWV8[E$L$4L$u$X$PD$u$P| $$Pt$Pr :T$$EjPFnD$tk|$jW'nD$,D$ tND$1ɅujWnt3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVW蛆x9!xt19)u|$T$(l$);$Pw|$$XD$0P螢ƃjPltQ$1 T$|$$T@uX$L$0PVQW蓆t5WD$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ 薆‹D$$t $uCr.蠯|$茯1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4V͂ DžL$~9t/;$WVQL$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j|$l$t$D$Pnt$ mUmVml$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$mt$ vmt$jm넍_t tsPQhR葥St tsPQhRryt tsPQhRSt tՍsPQhR`$t tՍsPQhR跥ꋌ$hRCt tՍsPQhR腥2t tsPQhR謤t tsPQhR荤LUSWV[D$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]{LUSWV[Kl$ |$t$t Vz1L$1jUWPV^_[]ÐUSWV[l$$|$ t$t V*1L$T$jUWPVp^_[]ÐS[îL$1jt$t$t$t$6[ÐS[~L$T$ jt$ t$ t$ t$ [ÐS[>L$T$ t$ t$ t$ t$ t$ [ÐUSWV[L$(T$ 7t$T$L$0D$L$11jUt$,jP`xD$Ƌ;D$u ^_[]JUSWV[xD$(L$,T$$>|$T$L$0l$L$T$ jWPjU1xL$ȋ;L$u^_[])JUSWV[|$t$t V.10L$1jUWPVp^_[]ÐUSWV[ë|$ t$t Vޗ10L$T$jUWPV^_[]ÐUSWV[[|$t$t W舗101jUt$$PW^_[]ÐS[0L$1jPt$t$t$[ÐS[0L$T$ jPt$ t$ t$ Q[ÐS[Î0L$T$ t$Pt$ t$ t$ [ÐSWV[L|$t$W{uGكs^_[!t_t$t%<FF ^_[ÐUSWV[|$ u ^_[]l$ t$W |t t- t(W{tWP u뵃!}/=<PFPF ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tvP<$|$Dփ 6D$4)D$4@u \҉L$x MVyt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉUy$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/\DPg%0W$\P$D$4@uW^xu#\DxuGws>4$$^_[]ËD$4  !rfUS [E$D$D$D$PQD$e[]fffffS[Ît$ t$ [ÐUSWV[U$$%= uRl$l4$Qƅt1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGHlG D$ D$4L$ $Љj0)t9D$"D$ <u !G OJD$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw P?ōG UTD$t1 .YMPNQPT$ Rb u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRI4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$踉1ӗ"utPQh1R較D$u‹.x1F)EHftf },$FtpPlJu|$t$u N)$xDuW@8/tOF(uIljh@P tFFU$U<$u~yljF^_[]FUSWV[[t$tf8}t v$t>V }t!v$Rv$Gv$aIVXIW^_[]ÍuuguPQjBR&vfffffffS [ëlPQt$ t$ ,$ [ÐS [kt$Pt$ t$ ,$ [ÐS[>L$T$ lP[ÐUSWV ׉[T$4@xtb=t= T$4t=uD T$41PL$HL$DL$@L$ D$l$ L$RPQUWV-=u蔆"كTw",# $T$сK1 $  ȉD$D$ ^_[]ÐS[L$T$ t$[ffffff̀rS[ôt[̀rS[Ôt[ ̀rS[tt[SWV[\|$t$t-9t!t F9u1^_[ÍuuPQj*R\fffSWV[|$t$tt1WVv^_[ÍPf9vuPQjBRuύ[f9vuPQjCR~뮐SWV[l|$t$tt1WVZv^_[ÍPf9vuPQjBR~uύ[f9vuPQjCRd~fffffffS[L$T$ lPt$ [ÐUSWV(T$ [òL$<\$%t$@|$t;D$<|$"v+覃1t$ \$VPo\$u<+t<-t D$1 1ҊD$L$L$T$ t$t$^[ffffSV4[ t$hjjjPVt$X&ut$Pt$Pt$Pt$Pt$VjY4^[ffffSWV[ìt$tFh`V1t+ju蛀0Wc苀01^_[ÍaVvPQjFRz뙐SWV[,|$h`W21t-t$)u8V 81^_[ÐUSWV T$[ÿE$ j(0ƅF F8$8t jO0F$jPgD$jPW xl$ t3unio3$$n tD$ u 98a$nfsu F t$WV tK8~8$8tv$v$@v @V@~81E;$ u ^_[] SWV|[i$PWZ1t?#D$=@u$jjW t1jG ;~|^_[ffffffUSWV[l$,E D$ƩtT$t |$4L$0L$u8uEVk.E ?EED$t$1D$ D$1$1ɐw8l$|$Ut$8l$)ʼn$ jjj|$jjjt$<9_D$ e+D$tEt$0lh@t$8{D$ $uD$,D$, $H g|| $D$,H D$u/ED$1 $ο9sD1$9s)u"rL$)9|֋ Jtޅt׉ҐօuP,uTQjWPD$T$:D$tsj1ɃD$}tTȉ$t-G $ QP;mT$uG $ u|$tGRQ<|$x5l$,}+u uD$EL$ME Uy!1^_[]ÍovvPQhRt말SWV[|t$v ;Ft8P;uF^_[ffSWV[,t$|$tt;  QPl^_[ÍwwvPQj:R=tuō%wwvPQj;RtffUSWV [èl$@|$8T$4pxth=t= t=|$8uF1|$8L$xL$tL$pL$ D$t$ D$UPQVWR9 =tot$<ȃwX1TfFFu:<>@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[Tt[USWVTX8D$|$tt$ht&L$ptCwm\$7x\$kw0wPQjxR7r뵋\$kw0wPQjyRr$vl$l1 D$͉L$4A\$PX(gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$Y0wPQh&RpV\$xwY0wPQh'VowPQhrVt$xo$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWPS  \$Ri*1T^_[]Ë\$w0wPQhsR4c$\$w0wPQhsRc$LUSWVTXD$ L$pT$htwL\$ h ֋\$ kw0wPQjxRb$vl$l1 ШD$ʼnD$4֋\$ P:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ xwY0wPQh'V`wPQhrVt$x`$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVP \$ Q1T^_[]fffUSWVP[Z}|$88tqw$xG$t,GO4$6tV1‹n1 uV ;Wuj ƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$jUTƅtF PVW) u$n*jU!t@ PVW) 1*V8t uVV $tD$ 81^_[]fff̀rS[ôxt[ḃ̀rS[Ôxt[SWV [yxt$ |$t[D$D$4$zU0L$jjPWjQ-1uSU9 u BU01 ^_[Í xwPQj,̓+>4 фuߊt*ɉ > u Hu))W3DLt8u;L$ u$^_[]fffffUSWV[Ûvt$|$t]l$tvr't#t utH8uΉ^_[]Í>x/xPQj񐐐9t uD$))t8t)Pt u+D$ PB^_[]Í>xxPQj@RLD$(SJxxPQjARWLD$(7fffffSV[tL$D$T$ y9xRVQP Q6Q4P 1^[ÐS[~tD$y%9xP PQj@RP P j@4R P [fUSWV[tt$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JPfOyxPQj?RJ눍[fOyxPQj@RJq1^_[]fffffffK̀rS[Dst[USWV [(st$ D$PIܠؠ7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$!^_[]É݃t209r9r֋9s9r9r봐USWV]xqؠ|$0||$4D$Pܠtؠ)1ҋؠP1T$,ރ s;DžܠDžDžL$0AؠQ1@t$ sAs(1ہ1)L$ܠ$D$0Hމˉؠ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$-^_[]Íyy\yPQhYRF[USWV[ènt$ؠD$.̉)ō$P裾ܠtؠ)1ҋؠPܠؠt14$D$^_[]Íyy\yPQhR EUSWVP[ÚmWýܠtI010ؠ$9r$9r$ؠi0mNA900WN^_[]ÐS[lt$t$t$b [ÐS[lt$[ffSWV[ìl|$t5jWt ctVW(1^_[ÍzyPQjARC몐USWV[;ll$t{jUt=ǾtUWUt1l$UPt$ L "19s#IH8^_[]ÍzyPQjVRBaffffSWV[|k|$1t,mPWzt |$t=t=tƉ^_[ÐSWV[,kt$t-tVW tPW VX ^_[Íiz\z"zPQhR-B믐SWV[üj|$GPtƉx @tVP1^_[ÐSV[mjt$ t%tVPMt L$9H 1^[Íizxz"zPQhRvA뷐USWV[jD$01t:>t41 |t$t$ t$ W8 uD$ <=u.|$$ P 9ttD$0P M9u;P s|9v9tfPǃP ǃP $jWP ;F04F8uyPD$0t$s )$jWP E0E8u4)  $PjQ B $P L$P ^_[]ÐUSWV[hhP tP 1t0tDtPVtP Hى|$tjjD$P tE t5jVt$ F:P tVt$VŋD$P 9tPǃP ǃP P UjP@ ^_[]ÐUSWV[Kg81tR/tL,t4t$t$UX5 uD$|=uօt D$1^_[]ÐUSWVP[f|$1|mPWtfƀ<=t^tR)tI1 $ $lt+Vt$U4 u|5=uمxD$8.1^_[]ÐSV[fPƷƅt(C0^[ÐSV[eP膷ƅtB0^[ÐSV[ÝePFƅtB0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[dD$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[ØdD$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[dD$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[ØcL$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[`T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$t1^_[WVMtGPVܓtۍGPV+tʍG PVtWV 묍9{|{PQhRm"U|{PQhRFUSWV[[Bt$|$Gt/uTot^REwn1o  u-GFGFFnFn GFG    #U|{PQh$R||{PQh%Rt||{PQh RMGFGF^_[]Í||{PQhR S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ÐìrS[?t[v̀rS[?t[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWV[?|$l$t$u7teFꐐ*t 8u߄t%H됐38t ut 111ɉ^_[]1f}|PQj:R]}}|PQj;RVAUSWV4[%>$L $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOF2}l$0PQjU!1UH $\9ȋ$QU$`- FfNӕQPR$`U$`01Ʌ9$Fx$P$T)}PURQw0*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D LӕQPR$`$`/l$ 9+(t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`(~$PEDL$0}PQ|$W$`Uu.t;$Tg$P$T)D$D #P|$Wt$L$QR".L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$R-L$)D$D Pt$t$t$Rw-L$r)D$hD Pt$t$t$R>-L$9)D$/DPt$t$t$R-L$)D$DPt$t$t$W,19D$F$PED$1$10D$ #D$}D$׋D$ tD$ $ 1QPt$t$UI,H)D$>Ń19t$un 1f$PL$$T)fv fD$ &}VQURt$+L$ ;$T$ŵT$0L$RQPWt(8W$\9vpD$0Pe;fǍ2}$0PQhWC+Wj$\9v QW$`O %1QW$`5 D$0P8eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aG2}T$ PQhRx&= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]Ís}5}PQhR2 |Xs}5}PQhR $$bWs}5}PQhR;苰fffffUSWV[U1$8$E UP7`E 1Ҩk4$$4$0$,uRUZ]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPKt$D$L$ T$PQVRu@m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVU`24$1E u U[;$uЁ^_[]1ҋ4$E t菮fffffff̀rS[T/t[USWVP[:/PaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pf 8^_[]ffffffSWV[Ü.|$t.jW!G=tjW^_[Í}}PQj@RfffffX/.L$rÐSWV[-t$u8~}PQhrR*VtF~tP^_[ÐUSWV[Å-$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$WtGotP܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$qf}PQhcR?F HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$0JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1 *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RYNjD$$fxxt$ T$@>PL]fD$>P8]fD$>P$] f|$fD$f|$"D$<$$!|$hVWt$8RXgD$D$$fxxVT$@HVNjD$91%L$L$PVt$V 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8W"hj$P DŽ$DŽ$DŽ$DŽ$VWP$Pj%課΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WMPt$t$t$DQ$Pj%T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FP ZfD$FPYfD$h$!Pt$ Vt$8WUfNjD$$fx$!xV^VAV=*htL$L$t$L$L$|$hRQD$赀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$ht@\L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yxn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V臒L$tL$8$tYt$`~l$(u2D$4t$%Ut QtFUt$`)L$8uBffU01l$(E;$%b%^_[]Q͑pUǍs΍i׍}PQhR΍i׍}PQhRc$%]΍i׍}PQhR+.CY΍i׍}PQhR$% ύ(}PQhR$%~ύ(}PQhR$%MT4qWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[Æ|$F$ jPŅtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$Pr ^_[]Íʀ}PQhR@рʀ}PQhR|$|Xʀ}PQhRUSWVT[F1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4D$ D$$L$j L$QKtL$t$ t$~e t tt,…tt$ P~u$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"RoT$GtItu܍(}PQhRT$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1ύ}PUhh RAύ}PUhi R~USWV T$[ÒL$8D$ l$4"t$@jV1]F1t 1Ƀt @u\1<$L$D$ Pl$ U,1!PU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ PQ 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UlGt!D$881<$;D$ ^_[]ýWt‹GwtP܍͍}PQhRCY͍}PQhRX}PQhRt(}PQhRMifffUSWV([$H$<$$E UPM 1U4$Um$DUtڋ$D0W+t4$DptPW tu뗐$@tP$Hp ոj$DWH1$@T$t.$@öT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$a4&t$$DP藙 D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$uAT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$@T$L$ ut$t$$LUPQhRffSV[}t$ t,FF#EgFFܺF vT2^[Í]QPQhR밐USWV[t$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ ! L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVPÖ^_[]Í]ZPQhRleZPQhREUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [8|$$l$ D$O $W?17T$)ȃ8PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWζ ;D$uY ^_[]Í ^pPQhR茴]pPQhRb\ffSP[Pt$1Ƀ $ȃ[ÐUSWV$Yt$8D$D$ L$\1DKNl$\$1Ҁ0u.N 4 ʊ0̓+> ut+ɉ > t Hu)1Tt8t;L$ u$^_[]+XfffffUSWV[$$$=\$DŽ$DŽ$$jP($8jPM)DŽ$PDŽ$TDŽ$XDŽ$lBh&f$`$ptx$$DŽ$hDŽ$t$`PVQRt(Ƌ$`FP$tptE+$pt PvE۴ ;$uXļ^_[]ÍzPQjt 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4R(YWjP蠤 |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W-{ Pt$l$ U{ t l$ /D$D$<F\$hPWz |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WURyT$ \$WjR薢T$ |$L$F t[l$Et Nj,$U \$Wt$T$ Rhy E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$yT$ L$E E$\$l$TUf/4$Uf$L$$9sD$DQf1ɉȃ0^_[]D$D捃1%PQj]RAW\$萡SV[t$ t Vf^[Í=PQh/RfffffUSWV|[xj$1tGljPWڀt)l$XD$\|+W)Q W1|^_[]jjWjjUjFWt҃,F0~ F8|$F8|$t1F9#1t\1ҁ$s$rs@sщʉѺ u)jWPj[=F4~F:F:t1F;pS[t$t$&[ÐD$@ ÐSWV[ÜT$|$9W v#wG,ʃt$<u0 Ћ0茠L  )r;GvQD$Ot$1^_[ÐUSWV[t$,~$ED$\$Pv(t$Q 9quJi${tD$D$4$9t$2D$<$8L$HL$D$ l$D$$$$`$ttl$$;%`t %)l$ ΃$D$D$et$L D$0Fvt"l$ ׃$D$D$dt$L D$0vt"l$ ۃ$D$D$dt$L D$0ut"l$ ߃$D$D$@dt$L D$0ut"l$ $D$D$dt$L D$0Fut"l$ $D$D$ct$L D$0ut"l$ $D$D$ct$L D$0tt"l$ $D$D$@ct$L D$0t$t"l$ $D$D$b`t謆|$4tʊL$DL$ D$D$,$t0dƁ Ot yI u2D$4$D$E5L$@L$ D$l$$$记Ɓ Ot yI u2D$4$D$4L$[6.&+bp^_[ÐSWV[|$xuƁYjVWu y2}WPVr$ ^_[ÐUSWV4[ȧ$D$0D$IuD$HL$j.QPjNjT$PQj.jR_y$tEL$PQVP D.0;D$0u 4^_[]S&USWV([(t$L$-uAD$QD$ +tD$ +u AD$Q\x<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX81D$\8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$n֍/PQhRvpːUSWV[}PfD$|$D$ D$PKlHHPP0ppp RQWjV譌$r D$ƀe^_[]USWVP[jl$ PU^EBPUF PU.PUPUPUPU΃"jPU# 1uR\MDHt?tj PU t8u$8 L$A.&L$0t9^_[]ÐUSWVP[ږl$sPU蹂txF u6jPUg" 1u[\MDHtHsj PUҕ xs8u $8 6D$t8^_[]fffffffSWV[|$t$jWLGHO~;G~ t H WRYjWLN^_[ÐSWV[ÌT$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[9|$(D$$u+$PcbD$D$D$D$ jWKG0u ǀD$PW>?jWqM^_[ffSWV[ìaHt Jt @t A ?t/t5GtU\$ L$ 1)D$ E0|$}4},1tqtk<.t t<2t[|$T$ `T$ D.BE0}4B9DD$ @ PU0}4D$|.|$T$ uT$ |$rx)D$FD$ƎE0 E4u!\$jt$jhVD$(\$1M0QU0E4A}4sKjD$E4D$ Cf U0}4D$u0}4WVu`Z C)ljD$ s2\$L$FƎjQjhRD$(D$ Ɖu0}4\$uuE1$+PWQjdjV8^9E4BPVu0< E49s)\$FƎjQjhRE4M09U0)E49L$ u4U0D$T$t$\$w)D$FD$ ƎE0 E4u"\$jt$jhVD$\$E4M0QU0E4A~~}4snhD$E4D$E0A\$Af E4w-FƎ\$jQjhR\$E4M0QU0E4AE= U ME4u0} PVu,WA!A9AD$1))lj\$}$&#u E PQjdj$+W\9E4@PWu0: E49s%FƎjQjhRE4M01U0)E41E4u0} MU }$"u D$ E HM HL$HM xQƃE t$ HV|$Wt$PQjdj$$+W2[ 9E4?PWu09 E49s%FƎjQjhRE4M01U0)E41u;D$ !u <E PlPL$ Qjdj$+WZ9E4B?PWu09 E49s%FƎjQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu08 E49s%FƎjQjhRE4M01U0)E41u E PQjdj$+WY9E47>PWu0 8 E49s)\$FƎjQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$FƎjQjhRE4M0QU0E4AD$`/}$D\$u M QU Qqu It$\$QRPVjdj$ +PX\$ 9E4<P$ +Pu06 E49s%FƎjQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-FƎ\$jQjhR\$E4M0QU0E4AD$#M }4E0T$WP=;E }4;E0 E4u)\$FƎjQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E PL$ Qjdj$+W/V9E4:PWu04 E49s%FƎjQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu0;4 E49s%FƎjQjhRE4M01U0)E41E E PE Pt$ jdj$+W+U9E49PWu03 E49s)\$FƎjQjhRE4M01U0)E41M AE  L$<%\$^L$ L$FL$ƎL$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu02 E49s\$jt$jht$,D$(E4pE ;D$8}0L$T$FT$ ƎL$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-FƎ\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru E PQjdj$+W`R9E47PWu00 E49s)\$FƎjQjhRE4M01U0)E41\$ E HM L$HM pQJE T$(|$$VPjdj$+WQ9E4H6PWu00 E49s)\$FƎjQjhRE4M01U0)E41|$\$E ^L$ L$FL$ƎL$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu09/ E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E ,PQjdj$+WO9E44PWu0q. E49s)\$FƎjQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0' E49s)\$FƎjQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-FƎ\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$FƎjQjhRE4M0QU0E4AE L$) \$PXE M4+U0B  ru0M4B\$PQjdj$+PF9E4:+Ƌ\$P$ +Pu0% E49s)\$FƎjQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$PD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$L$L$ FL$ƎL$$+р਀tsRPt$ jdjVD9E4g)PQu0:# E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L$|$X\$PVQj2jWC\$9E4(PWu0l" E49s%FƎjQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$FƎjQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$FƎjQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$FƎjQjhRE4M0QU0E4AE MU \$VWu,P}$E PL$ Qjdj$+WA9E4&PWu0U  E49s%FƎjQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu0 E49s)\$FƎjQjhRE4M01U0)E41E E ;D$%L$^T$T$ FT$ƎL$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0 E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-FƎ\$jQjhR\$E4M0QU0E4Au 'E PlPL$ Qjdj$+Wz?9E4-$PWu0 E49s%FƎjQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0{ E49s%FƎjQjhRE4M01U0)E41u E E PE E PE PWVQjdj$ +PC>}$u E E PE E PoE T$XPWVQj2jR=9E4"PWu0c E49s%FƎjQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W89E4!PWu0 E49s)\$FƎjQjhRE4M01U0)E41!}$E HA }$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0k E49d\$FƎjQjhRE46?D$E4D$W\$L$D$L$FL$ƎL$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$W/\$9E4Pt$u0x E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0 E491\$jt$ jht$(D$(E4  L$D$L$FL$ƎL$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$.\$9E4mPt$u0? E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E49-\$jt$ jht$(D$(E4\$9=}4E0)E4u)\$FƎjQjhRE4M0QU0E4AC}$n }$bPL$ Qjdj$+W[19E4PWu0 E49s%FƎjQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0g E49s%FƎjQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0 E49s)\$FƎjQjhRE4M01U0)E41M AE I T$(}4\$E0.E4u)\$FƎjQjhRE4M0QU0E4A g}4+E0-E4u)\$FƎjQjhRE4M0QU0E4A}3}4E0 E4u)\$FƎjQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wN2|$7I$+t$I$ +f@======2|$7I$+2z4|$7I$ +r|$7I$ +rz t$>I$ +rz4w|$7I$ +r|$7I$ +rz4|$7I$+Rt$I$+2|$7I$+2z4|$7I$ +r|$7I$ +Rt$I$ +DŽ$ +====2|$7I$+2z4|$7I$ +r|$7I$ +rz t$>I$ +Rt$VI$ +Ƅ$+=fDŽ$ +==2|$7I$+2z4|$7I$ +r|$7I$ +rz t$>I$ +rz4w|$7I$ +r|$7I$ +Rt$I$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$L$D$L$FL$ƎD$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$%\$9E4(Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\$ \$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$D$D$D$L$FL$ƎD$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$#9E4M Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0 E495\$jt$ jht$(D$(E4|$ D$f E4w)\$FƎjQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u ηE M4 U0B  ru0M4B\$QVP"  ƋM49s)\$FƎjQjhRE4M0L$M0)D$E4z|$)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P蒨PQjdj$+W%9E49 PWu0 E49s)\$FƎjQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj?}0W3 ƋE49s,\$FƎjQjhRE4}0}0)E4E \$u4u0Pjև}0WƋE49s,\$FƎjQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$FƎjQjhRE4M0QU0E4AD$w|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$D$D$D$L$FL$ƎD$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0j E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$FƎjQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u %E M4MU0B  ru0M4B\$QVP  (ƋM49s)\$FƎjQjhRE4M0L$M0)D$E4|$t)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$FƎjQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u xE M4U0B  ru0M4B\$QVP\ {ƋM49s)\$FƎjQjhRE4M0L$M0)D$E4|$)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$FƎjQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u ǭE M4U0B  ru0M4B\$QVP ƋE49s)\$FƎjQjhRE4M0M0)E4sf )E4w)\$FƎjQjhRE4M0QU0E4AE4D$E0D$|$)D$L$FL$ Ǝ\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$FƎjQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$|&D$,;$p+u ȍe^_[]Ë\$?USWV [It$,|$(D$ .ʋ7l$Ut$Vt$40RQĦ‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>s7%D$D$Q@(D$ 9s$FƎjQjhR)))x ^_[]1))lj$.&ƎPQhR뽐USWV Չ $[CGT$8D$4 D$L$D$"u$FƎjQjhR|$4QA$93<$779$x"D$D$FD$ ƎD$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$FƎjQjhRMQUA+<$-i"^"D$4L$D$ ^_[]ffffYDT$4D$#X\ÐUSWV[D|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v!(+t$^_[]ÐUSWVP[:D|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ } (^_[]E ffGftC,$RWסxǃ9w,$)xD$ hHGftf,$RW腡f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衠 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [øA|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.Q ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[(?|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U远x(ŃtߍE;$wMȉ;,$v [(+l$xD$$h,h,L$ H(ŋT$0PhRQuu苪U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0M(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV X<\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jōJďUPQhR|$ ďUPQhRϏďUPQhZRgfffffffUSWV[6D$$L$1w|$ u 0@0 PUWVt$(t$(QR. 7Xo6L$u اÐX?6L$w1USWVX6D$|$4t$01>0N xtNi|$|$8Z~D$D$\D$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$\Na$PQj>R ;\$qa$PQj?Rl USWVP[3t$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Íq$PQjgRr 1fffffX2r ÐS[2r ht$ PN [ffffÐ1ÐX2t ffffffUSWVX[h2l$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMnL$"jWRPj2jQŃ9D$"PD$tPUD$pD$)D$iǓ$))ŅtUT$ T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ |$"jHQPj2jWH9W|$WD$iD$lj|$)ƋT$ D$kD$p\ txҋ9|Wy>TWPڋD$+D$pyxffffUSWV[K/l$Uƃ;D$vS (`|$UW1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[å.$$$hWP! x3l$hU$( xUWL1Ʌ;$u ȁ^_[]5ffSVP[ .L$t$D$T$ $xRQVP!x9rRQP ^[USWV[û-|$t$l$tt$$PW+&t ^_[]VWh!t W LJWVU ͐USWV[;-|$t$l$tt$$PW%t/ ^_[]VW t W LJWVUF ͐SWV[ü,t$|$jW1Ƀ PVW ^_[ÐUSWV[{,|$tt$O#PW$tw 0l$VW/ t WRLJWVUM ^_[]ÐSWV[+t$t5|$r#u#jV#tjV$F1^_[S[Þ+D$tL$ ttu H1[[ÐSWV[L+t$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/#^_[ÐSWV[ü*t$tAjVq"t2|$jV"wsf~ 1^_[ffS[N*L$T$ lP[ÐUSWVT$0L$@[*uD$\VD$ P-ǃx\$D$t6i=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$$$$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$t$,PV1D D$,\$hPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$ND$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[N |$  g >L$s*D$@--tr0twPu@-'[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[l D$Hr} %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[ýt$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[D$ L$t9u[ÍPQjpRiS[îD$ #L$t9u[ÍPQjpRD$t&L$tu1u 1tÐS[L$ D$Qss)ǀ[Ãuu ǀ[ÍPQjpReS[îD$tL$ t 1[[ffUSWV[kj ;1tQ@@jjPj V(O8tE(Wr5(^_[]ÐSWVP[|$tcOGQ9u0$jQPi 08t  G $GT$pw1^_[ÍYQPQjZRySWV[Lt$tRtC|$t3~t-0脣~r4k;~rPXVO^_[ÐUSWVP[t$t@F$t*.1tt$Vt 9<$u1^_[]ÍYdPQhR뜐USWVP[ZT$J $Ћ*1|t$W2t94$u|$ l$tW]E$F;$} $)Qtu<|uprP $كU|D$ t$QPt$3[fffUSWV[ |$$trƋ|$twD$F t2t$$t$$t$$PVŋD$t V4t$$t$$t$$PVSVx 1^_[]ÍPQhRbUSWV,[3$H$($Pt#,$t$;$Lv,$t$;$L$DT$ Ph j.WIl$u D$(hPW$L tNj$L\0|$DFŨteD$tQu<.uOD$t)DNu.t"=/1x.u<:t+uj:t$y$Tu<:uVD$tBD$u,lNu:t.uuـx.$P$DD$$D$T$ L$$|$W8ɔPt$ PWQRVUD$4Pz 1t$$P$D$P|$l$֋$D $H $A$Hу$P$DB$B D$$HB)rY4$t$VUt$N# ~q$DA0A@$H$HU{$)‹$Ps@<1t$;$(,^_[]Ë$Pщ$PUVZ $D7$H$@@ t4$$HV $P{,$ՍPQhBRl$ChqSWV[<|$$t/ƋT$L$Wt$$t$$t$$PV1^_[ÐUSWV[l$8|$03L$4uRuM?u!Wր1?u5u/ -t/9uqD$DT$@t$vx ux Pt&D$j.PWV!tl$t$x D$P賹L$QRPD$PWU $t!Q蠊l$|$TG )|$TWT4$ll$tNjM;L$Pt$hNt$ `L$TR< t< tT$ $t$W1yD$ L$L$T$H< t< tD$T$9‰L$r0D$(PQ3#D$ T$+T$‰D$2T$t$VxƅL$T$HoPB1t$aD$L1D$1L$L$T$Ht$@$F D$ FL$r|t$DD$@pD$)ȉD$)r]L$@q $9wLQD$PVT$  T$@Bt$0J BL$ ) $@W藵L$ƃ)s6t$L1U萆t$脆G(^_[]É $D$D$D$D$ VWPq D$@8|$tpD$D$wD$1L$D$D$ Pƃ$)W$Vt$t$ L$ D$@@ 9|$u|$@GL$D$LU褅t$蘅 USWV[t$$|$%.VQt,$ ,$A htEhVl$ Ujl$UP‹D$p pp0Wt$UV贄Wt$ 2uBF tt$ G VnD$@ ^_[]VKWߍ1 PQhRUSWV,[å$@$(ȉL$ ? $Ll$LW $Dt $Dt1$D  j(sx ‰l$D$Pl$ MffL$MfD$E t$$9fl$D$|$\$$T$TPt$0t$0BzNj$Hfxx\$$PՃRD$ D$ ;D$$\$|$$;$DD$D$0$Ptȋ$@t$<$Du5QZT$=$L$P)D$l$<l$$LQ$t$8qDŽ$l$HL$ ;L$$$T}$PL$,)QPt$t$0t$0ZAeNJD$0D$$D$8D$D$4 $T$$Hfx$x\$t$T$HT$!l$ / t$$D$(9\$UDfD$0EPDǍEPDՃ l$ 91ft$0f"D$<-\$h$+Pt$0VQt$0U@qNj$Hfxx\$$'PT$HF;t$  4$T$4L$9\$|$r/(PVz l$4L$)$1D$L$t$V=ƃt$$'PNjD$,)9\$P$+PVj D$$L$D \$#fh$+Pt$0VQt$0?,Nj$Hfxx\$$'PDB;t$ \$$'P=NjD$L$,)9\$Q$+QPi D$D$LD$$|$ |$Ht$$9wD$L$,)\$QP|$WVt$0,>ǃD$H=;$D|$ uNfff -t$t$PL$t$(c$Qt$@Ff$w-j5D$0$Do4Vd4PW|$t$8t$HQj%T$T$@t$$P6St$t$6Pj%贗$D$@9F f|$0u D$(8gt$|$u$L0V1ƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WPT$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRv l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0V說=~ $!D$1$D$$1D$\$|$$Rn{1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$<Ĩ=(ƋD$L$,)9Qt$@Pd D$$LD$ꋄ$H@ tՍT$$Lt$, D$D$l$)Ճt$,)9sC$LAURPX 4$"yl$l$$T$8)ƒ)19s@Qx蹷1$X;$(,^_[]Ë$LnRPUՊ 1‰(si֍PQhRviT$$PQhRIT$4z?|$4X聳USWVT[ó$h>Wt1T$ T$G j(Bg¸hl$D$D$ D$$D$$1|$ D$ l$Pt$ Vnhǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tPWgt1ɀ8 L$L$D$D$L$ t WPStT$$9s=ȉD$))9)ƃ $1t?tdD$FFD$F ))t$0uUt$t$ hMt$D$MD$L$ut$t$ hNt$&L$v^_[]ÍהPQh`RT$הPQhaRT$XהPQhbR蒧T$_jffffffUSWV4[l$PD$0|$LtCt$Ht\t{uL$LI;L$00/JYPQjIR뜍>YPQjJRƦut$L||$D$,D$(D$$D$ 1Ʉ.<:u~: t$LL$ $t$ ~D$SL$dL$1D$jD$Pt$$V ujt$t$ Vs t'It$) Ɖt$up1ɀ|$:"tA?m$L$09ȹVT$f $f1$|$ D$1|$ |$$D$tt$$p1ɍD$09L$f$f4$|$D$09t}+D$T$ҹtBlj1ҐD/DD.D9u߹)щtR)ȋt$NJT$ )ʈB>81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍJoPQhR]>oPQhRBKUSWV։[t_~\LZu 1^_[]É4$t$0t$u'_ dPQjnR^fffUSWVx[è$D$t$$uz$|$ $OW͕t$6WRQPUjV6$79/VW$VMS %/1JzPQjHR3>zPQjIR#$=D$,D$(D$$D$ D$D$D$D$1$  LDLDT ʉTDuދt$11Ʌك|$t к$ʃ$|$|$ Jt'D$,$9L$ L$uT$4$у|$3t#L$,$9͉u|$4$|$  t'D$,$9L$ L$uT$4$у|$$ t#L$$9͉u֋|$4$|$(Ϲt%l$Ƌ,$9u|$4$|$|$, ‹4$9utƿt׉|$tƺt|$ tƿt׉|$$tƽt|$( σtƹt|$,t¸tȃ4$9u$$|ȃt|$F$ȉD$1퍃LD$0L$t9|;l$}9u:ِtNwD$t9 :u5u1$t tuR|$$uF|$,u?t$t)tt$4VW蹹L$9K$G O Wo͕URQPW|$JjWm~nL$t)9sdQWVN V{L$t|$uGL$t9s<:HT$t9s*D$F);$w$P1|$ ;D$tx^_[]ÍJ•zPQjhR1>•zPQjiRƛJٕzPQhR蟛>ٕzPQhRu(CffffUSWV[$8u{kjUczE(D$t`$$$tWtvRUhsE urjjjuT$ !ЃE S耠1L$1$L$ D$L$ 1$uP}Tu'$tGEt@+E<$ $<$+Eu0)׃>t E<)׋$΋$x`<$1L$D$ D$$}T$uUt$T$ E ulD$;tM gE=t܉t$L$4QP{t$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QPH{L$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tR^D$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQ'^D$e ߋD$)D$Uyu E;D$U_otjU xİ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t Q]E0EEEe jUw1뙋t$uyb)EۍPQjGR/'PQhRD$D$ D$N>PQhRѕEtfffUSWV [Xt$@|$4uu>FD$FD$\$jt$8t1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$uޗPQhRaUSWVP[ê|$l$tVtxEt;tu0$EQUPEQUt $f1^_[]Í9{PQhR~uPQhRXaUSWVP[t$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Í9{ PQhR豈{h PQhR臈T9{͍@PQhR^4USWVP[t$|$tctt2u6GQWt& $ $G͉QWPt 1^_[]Í9{PQhR豇{hPQhR臇T9{͍TPQhR^4USWVP[|$l$tcEtDt u91?$EQUPEQUt 1<$1^_[]Í9{"PQhR豆{U"PQhR臆TUSWVP[ |$l$tStuEt8tu-$EQUPEQUt$1^_[]Í9{,PQhRuX,PQh R軅dUSWV[K|$T$tL$t )ŋt1tXuQBWQRP t?t=Gȸ UQWP%BWQRP ttGxUQWP 1^_[]Í9{6֍PQh*RFh6ՍPQh0R资L$(,USWV [8t$$l$ P|$(k6Et,t@EL$QUD$D$EL$QUPtm4$7E1;t$,vu{ZttQuktq<$trD$Vt$U ǀ|$tB}u.u^[ÐS[Ρt$t$t$t$t$J[ÐSV[Ýt$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[~t$ t$ [ÐS[^D$t$ P[ÐS[.t$[ÐS[t$Z[ffY ÐXϝL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXH$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$JPQV ƍGэ}L$,|$ U(!Ћ$'W|$ƀހ:w7$|w;t$b\Gn߃^rxo;l$1\,, $*hwkdT$Ɖ*t$i $*hwi (Ћ4$hWm;|$Yȃ|$ U(!Ћ$JPQV xuD$ ƋL$$+QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$;w(^_[]Ë$wᐐS[ޙjt$t$t$[ÐUSWV([è|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ l0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[L$T$ lPt$ [ÐUSWVT$[ɉ$t$4|$ |$0t=D$0|$ "v-d1T$VPP\$u+t-t$0u#D$ D$t$0t@D$u20u- PQjFR[p{>PQjGRX[ S[ރlt$t$Pt$k[ÐSVP[ìD$L$T$t$4$VRQP5^[ÐSVP[lD$L$T$$lRQVP^[ffffffUSWV[(D$|$(u-|$ "8u D$ L$(A0u ǀy$1Wl$,uP>3 E})Elj4$|$t$(VbQ~6Wt$(V73 t)T $΋T$rsxoD$D$ ;0srnEt%  ȉ  ȉ ŃU2tL$L$ ) $^(D$(H @^_[]F @4$utD$t0ٍęPQj@RXD$,cUSWV[kt$l$|$ jW7WUVt$ jW9^_[]fffSWV[8ظ 8tfl$PQ  Džu:jt.P ZGGG ^_[ÐS[Î PQ`[fffffSWV[\t$|$t]WV0 ^_[ffUSWV[+l$|$[$PQVx t"t$UV| @VjjPt)W8'PQVw ^_[]fUSWV<[å$T$PE$8FNt,$ @QP0,$NolȃFFD$$lD$$Vj Pl1Ʌ,$t$ D$D$D$ D$PD$XǍԚt$8jWPhVr=hVl\D$t}ƍPVr\tGL$T$RQWЃ D$ t2L$t*tBRjQPv-,$V D$;t P[D$ u QPtj t$|$|$|$ |$|$l$l| |$||$|4 ,$t t$ jQP1Ct$D$t*L$tt$t$уD$;t P&[E;$8u^ȁ<^_[]Í ֙PQh~R6T_J֙PQhR T8S[Î|D$ L$01h[ÐUSWV[X|t$,INtT07RQPWq~17D$ID$ D$|D$kD$[$ t$7q;~F4UqFDtt$qFDtu&u8tMt$ pFDt4$pFDtt$pFDXt$pGj o^_[]Í ,֙PQhR9RUSWV[z|$ 11 t5D$0ft$ 9rԋ <.D5tDot-1t P9tGGPGT$JRWO ֙PQhR9Q !1ɋ I `QP~t8 Il$u}ml|4 t 1^_[]ÐUSWV\[XyL$||$x$+|$x8D$8tvƉD$DW) tgi9t uD$tL$HD$ D$ W9$u8; H u(!D$D$ D$ W`D$PD$xD$<|L$Bu 76._^_[fff̀rS[st[USWV[r|$ P$D$l$$lt$L$T$(PVUWt$<9tO $+t$ O"1^_[]ÐUSWVP[Zrt$vO8$l$ L$T$$t$,PUVt$8=9t5^_[]Ã19tiF9udFqF9ulFyF9utFF9u|F뫐SV[}WV&1dPmV^[ÐS[>W1dPw[?SV[ WV趨1 V覨^[USWV [V@ ɉ$tG$W$\$1=L$D ~5H $WP%\$uD$D u $hR3\$Ɖ@ tPj3t0jdždN-00|$~H hWPO @ t(̪Ȫǃ @V҉t$>iFs0hFށdN$Ȫt$>-00t!t$t0J$1ɋ\$+dF$ >-00uȅVaFs0`FށdN$Ȫt,>-00t!t$t=J11ɋ\$+\F$ >-00u D$D ^_[]ÐSWV[LThRƅt(T$j!tVw:181^_[USWVP[SD$tBՀ:Pt=ǀ}:ju1ɉPDžF $1퐐9}h.dNP Ń=~߿TFFF fFdžhFdždFdždNUTC><$~81퍻1 9,$t".dNjEPW uƄ.dN_1^_[]ÐS[îRt$[ÐS[ÎRt$jt$t$[ÐUSWV8[SRM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtfL9| }Z^FD$ 9߉D$ T$|$\$#)L$ #11uj+D(H(4\$tg;~N|X1Ƀ|I|$T$ 9}'4}t$;tt$t}։9|كu>L$dFL$(uV*T$iFH hFdNP(}jȪ[1+dF GыV+D L\$jhY`QPӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U|Rut]9D ΋u}\$-1kD$ \$uuPVftML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐSWV[\Ot$W1dPH PjV@ WȠ^_[ÐUSWV[Nl$t$W茠D u1dPUjV@ ;WP^_[]ÐUSWV[{N|$t$UH uƃH U1Wj(t (H(^_[]ÐSV[ Nt$L$t$j'tt(H(^[ÐSWV[üMt$WaH uƃH WH 1PjC't (H(^_[ÐUSWV[KMt$|$UH uƃH UӞ Pj&tt(H(^_[]ÐUSWV[Lt$|$UlH uƃH USt$jQ&tt(H(^_[]USWV[[Lt$U1dPG@ t jP.UʝH uƃH U豝jjƉU萝^_[]ÐSWV[üKt$D$t jP4WLH uƃH W3jj/^_[ÐSWV[LKt$D$tF t jP4WќH uƃH W踜jj^_[ÐS[JD$t@ PN[ÐUSWV[ÛJt$tF |$U1H uƃH UWj^_[]ÐUSWV,[%JD$$$(=ΉT$y |F 'D$ D$l$jP$LP$LW*|$t ֋|$ ωjD$P$LV*ʼnր|$t |$ |$G $@D$G~$(PjQ" G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽%8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU(|$u|T$jD$P$L$L(|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ dUSWV4[8GL$HD$AD$ AD$A D$AD$AD$A$D$,D$ D$(V蝘H uƃH V脘#D$|$L$jWjj'|$uL$jWjj~'|$t1ՉNjt$#0|$ xt$ |$H4^_[]Ã|$(xۿ뿐SWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[E$PpD u1dPl$|$@ tABR lP~;yQq|1)͋$P^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[KCUD u1dPl2|$t$@ tWVP ƉU諔^_[]ÐUSWV[BD$D$fBt π?:t k?:u$,?/4$\$u(\$jW=\$ W?= t$HD$Xnfo/D$ToneiD$Pre/zD$L/shaD$H/usrD$\\$hWP; j.WtU\$j.Pet59tx/ux.uHt/uэ|$H4$$," 4$\$h@ W蕋ǍD$HhPW8 +&y \$n0\$W2D$(W gdND$4lPD$0T$LD$D$T$#D$ D$`T$a |$b L$cy ρ D$\T$] t$^ L$_y ΁ Ήt$D$dT$e l$f T$gy Ձ D$hƒt$i L$j T$ky с D$lƒt$m \$n T$o|$y Ӂ D$pƒ|$q t$r T$sy ց ֋D$|$1T$1=y\$$ZL$ʼnL$,ȉ\$@ÉӍ/L$‰Ë\$$[B,9D$(/D$ D$tXD$t‰T$4$\$T$HЋ|$)L$(hL$,QWR8|$#D$ {|$t9D$t9$T$,HXp 1D$uT$1l$t= $Ƅ9>l$ $\DT$ՃD$ 9|$D$ Mȃl$uAT$j ŋD$X l$EÁy] ËD$h ݋D$X T$j ݋T$R l$] y M  É $Ƅ9>t*l L9݉9@1l$l$~iD$9T$$4$1><t >nm^9};|$ |$ 91L$tL$T$14$|$\$$L$ L$T$|$F1\$ ʃ{ s {y $dFJ|$,ӄiFRN 9hF9q\$T$N 1ۅQ΃1rY̓1$\$;8dNT;8eNT;8fNT;8gN9u\$1ۅt"|$41D$(/9uD$4$T$|$1ƄfNfDŽdND$81L$0L$<1ۋl$39l$l$@L$:.>unM߃$iN$\D$1. $tDA)>ii;T$tyl$lp $ Y I|$0,~;uM}|1ۉȋl$p{<$L9t }`$@\$ ۋ4$.S؃1Ƀ1ɋVr<$w̼  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF$Pr$p  $hF$dF4$91tA ́ 1ҋ4$v~$x<ыl$hF$dF4$9ũ~ 1\$躳USWV։[Á4tK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR' $Ec\$jt$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0V >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$!8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$i QL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$L1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ@1i4Q9uB ^_[]ÐUSWV0T$ $X!&D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$)ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ e麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$7)jhUt$ !T$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9 l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP)Nj\$jhUt$ћL$D$|$s؉D$͉)пjjUt$FD$(|$\$jhUt$$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPI)jhUt$3U\$T1ڽT$\$jjdUR)jhUt$ޙt$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$@|$ 9|ځD1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$4XD$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jPn~ e1^_[]fUSWV[;l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]Í؛PQjFRq)؛PQjGR|$$bL؛PQjHR>ffffUSWV[;l$t$|$tU6^_[]ÍEPQhROʐUSWVP$[t$T U`t,j膞tPx $Hp t t 17"  xuxt)txu8u밾U`^_[]Ã듍EPQhRqKUSWV[T D$ P`p t t $x L$ L$ǐ|$$tD$$9G t GtOt  tGwЃ GЋt 9tt DžuZp u';|$r$;|$s<$$<$C<$1p t$ _p u#t7W u^_[]ÐSWV[Ìt$T W^"  xuxt&t xu8uju $p@@ t t 1W.^^_[ÍEPQhR&IfffffffUSWV[å $$$$$tD$$DŽ$DŽ$ $$jP7]$@jP]DŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^PQjPRpPQjQRqT $ ;$u ^_[]8S[ lt$t$Pt$t$7[ÐSWVP[ D$L$T$t$ 4$lVRWQP^_[ÐSWVP[Û D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[[ t$}XjWE`HM`~;Ep~ t EXHMX WRjW^_[]ÐSWV[ L$B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[} D$ L$ $XQPR[ÐSVP[L D$L$T$$XRQPVD^[fffffUSWV[ T$(t$$|$ t&t"qTN @14$t8t$jR/L$0A uy$‰Ņ1@<$1qyQ0uE)ljuދt$$$)1t$ ƉACAAAjQ֍PQj=RCK׍PQjQRՋ)v1WPV/ L$(9l$QhuC}T$RPV |$(Gy<)ЉAjQt$$jU$+D$1t$ Ɖ^_[]ÍXPQhR[L$8AffffffSP[D$ L$T$$RQP[[ÐSVP[ìD$L$T$t$4$VRQPEB^[fffffffUSWVP[jt$|$PVG1sht$t$ 7Q x=|PR+fF FfFfn vF$F,F(F $tjjjV^_[]ÍxPQj>R)ffffSWV[l|$t%jWw jW^_[ÍŝPQj;RxfSWV[ |$WG;D$w+t$9w 9w9w 9wPWVY ^_[fffffSV[íD$;D$wt$ Pt$VɅ ^[謅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[dt[USWV[Kt$F0u ǀFFF tVu"Vut) aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]Í@PQjL$aD$?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$PI\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $XD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $xT$ L$D$n6 D$0 L$ I $T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $PD$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPNƒD$ƒ;T$,v$+D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$P谏\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$͞H$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$͞H$PQhRUD$뀉׋$G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$͞H$PQhR=EL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$ЪB|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$͞H$PQhR2U|$뉐|$UD$xT$ Ӌ$ЪClj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZ t$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v PGE|$8E|$8|1 uT t$ 9wS$w닔xwl$Pmt t$T l$PU\ / U| 룋$L$19u $PW<^_[]þUSWVP[D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$肑USWV [öD$ 069rljT$D$uj$jWPH 螔(藔9$T$JHJHJHJHJ H JH RPE$jWP 8(18t!'0t$QU0*)4$PjV5 $L$D$ 81 ^_[]ffffUSWVP[ÓEET$@t$DT$$dpU }֞jߞjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP  )ȫjRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]裍USWV׉[׳l$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[òm|$hE t$p |$<$ MM$U֞jߞjl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPD )ȫjQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]ffffUSWV[ Ex\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$֞juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$ߞj؋E\$ȫju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wPD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػt|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃tL$T$vثtv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU4$t?$L$U%:$1xL$^_[]þTx0ffffSWV[|t$|$ty8L$tu1 1 ^_[Í9+PQj5RhrfVL$T$ tu1 ^Á1 ^fffffUSWV[àM1ЃωT$(ЃM$U hE81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1F֞j<ߞj)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$ۄ$܋҉t$$~@CM ~O$VRM$U ȫjQP )ЉT$$ۄ$ $܉=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$Lwm|D$D$,$ۄ$܋|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$ك|$tT$L$؃ݜ$$$$$݄$D|$@ػtD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكD$!؃|$8=؋كT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋|$XD$X fD$hl$h۔$l$X$$ڤ$t؃tD$D$9ك|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثtv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[̃D$1r 1 9vW<t8Ɖ^_[ÐSWV[lD$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[݂D$ PHpR=^[USWV XT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[ހxSVH[õD$0hjP Z D$(D$,DŽ$@DŽ$DD$ D$D$$jPjE .L$(VPQj@9D$$D$ D$D$D$D$D$jPj\ js[j[S[S[îfffffffUSWV[Ët$|$tK1tt (h1^_[]ÐUSWV[{}uu,\$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$4ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋt$(PV'T$4D$(hPV'uD$(D$D$L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQJ D$p '3 |$4t$N  D$0P QVR  t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}E("P"L$D$ffffUSWVt$F98[J |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[Iu }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[ It$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffX/Hǀ ǀ fǀ ǀ) fǀ- ǀ fǀ USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[FD$H~( 1u 9r1$PƉ^[fUSWV[ÛFL$8?tP賖 w̽ t{̽ ?u1>PƅD$t/Fn?tPSFF ^_[]1?tP(T )ʉʁ oΉoUSWV[ÛEt$tbF!r VO8}t3W蝕}F̽ ̽ tW{̽ ̽ ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[ÈDl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UE!r\U18}$PM}T$,B̽ ̽ ti4$%\8}th$P1}F̽ ̽ t14$ݒ$̽ T$, ̽ D$TG^_[]Ë̽ ̽ 1␐T$1Ɂsrr@r"y(6s@sރx @tS[Aj,tL$H@[ÐUSWV$[èAD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU<8?t:V݌?E̽ M̽ $t#V踌D$̽ M̽ $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[;D$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [39E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[U6$t|1a1ԶѠPQjERh P$1D$jjW{ ʼn$tƒ9tt#D$PW&to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F UOĄ^_[]fS[5t$t$jt$0[fffffSWV[4|$t@jWaGHO~ H0 WjWB^_[ÍQ٠PQj=R 럐SV[]4t$ t%FHN~ H V^[Í٠PQjIRi ffUSWV[3t$atrt!w 11ҊNtgtGɍyw@ؐ+u˽뿁뷁 ՋL$) `1^_[]ÍcZ PQj>Rg fffffffSWV[2|$f jWbG0ǀǀ 1G t WzƋO twуy y wG0tW@9t QG0G0ǀǀjWG GG:pPQj8RG f  ^_[f̀rS[ô1t[SV[Ý1t$ t;F0u ǀVNuFH^[ÍPQj;RfffffffSWV[1|$A8uGG Ⱦ uuL  O @G0taW@9t Q G0GG81t&WXG GGfG u WG t'DV\PV؁GOQPwW$ GO fO 1!t Gf@f  fG ^_[Í.PQjJRSV[Ý/t$ tF Ш u V[1^[Í8PQj;RSWV[L/t$t` 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWPƈ6@VRQWPL^_[ÐX.L$|AA A AAAÐfffffUSWV[e.$ut hj1$džt.%u%D$PQ?1t+ 8$u! 8u $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hVu VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaF?j P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCt(1V(1^_[]14dž$j$tJpHHlH H H|HH 88oUSWVՉ[ô(jq>lj1&NL$jP$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[9'4jQ@# t D81t>0`rPt._t u8~)1 9}8tQ݋t PlqVt81^_[]ÐSWV[<&|$tOW~^_[ÐSV[%D$ p|$s t.jt$ 1dž,dž,^[S[Î%L$tAt[[ÐSV[M%D$ p|$t_dž,1t$t$^[ÐSV[$D$L$ qt dž,&t 1҃ƒt$t$^[dž,빐USWV[x$l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uNU׍KPQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $wbύ֍KPQhR1Vǂ $ǂ(#idž,^_[]Ë(Lyw+jt$(t$(VRu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[L!|$te^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[ |$(o(o(OG0!D$;G9} $wD$D$ P]$L$L$D$QPt$荠 $L$QjP t$葾$D$ Gjw讷 $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$Wy ^_[]ÐSV[Ýt$ t$t$ #F,;F(~#F0^[ÐSWV[V4aA?j P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>NL$a D$`$^_[]Ët$ |$L$$Jl$Dijt$@URV2uD$`뒀gt$l$UV݇ ut$f\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr<2PQjbRvrUSWV[ D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í<2PQjbRrPfffffUSWV[ |$oEtjPu7 EjWu,EtPE EtPרDžDžtP谨DžDžU荨W脨VU^_[]ÐUSWV[ |$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[D$;D$wt$ Pt$V9 ^[ffffffL$1s!t11҃9rfWV_}D$tL$ P1 1^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[øL$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$<2PQjbRvT$(L$?<2PQjbRJT$D$D$른O<2PQjbR$u 1(^_[]Í<2PQjbR<2PQjbRUSWV[T$0t$,l$$E( oM;dM9X$E(  D$($I҉t*t$BfD$D$Pt$UmT$< Pvƃ9Љv*t$BfD$D$Pt$UlT$< vƃ9ЉuXAtQjPup ƉD$fD$D$Pt$UYl jVu# T$0L$fT$|$(u 0t$fT$EL$jjjPPQUjT$LM(|$fT$MD$jjjQL$QPUJjT$LGM(FjPu臕 ƉD$hfl$D$Pt$l$,UVk t#jVu$ T$0M(E(jVu T$0D$ED$fEDV<DtG PU7ntkGt PUntNO, F)WPPbo ,$fnT$0|Vnft9uf&BMf9s $fMnfuvv9f$+t$0ftpt$ 1fuf9tL]4$f9r1ߐftMf9s $fMMf9s $fM)ȋ$t$ fs:t$,fFT$$J( 1uJ;uJ;L$0vfJ^_[]1ftMf9tTMf9r1ftMTMf9r1ftMTMf9r1ftMTMf9r1뢍<2PQjbRT$@<2PQjbRT$@<2PQjbRvT$@<2PQjbRNUSWVT$[A,D$L$;t$cFjv7 $FD$Du (Dt&A PWl$kl$}sBu`}U|$W UWfz;i ,E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$,D$$t%ht$W0 $t*+$hW>P1Ƀ89t$1퐐$(j?Pt$轖 taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$ZO<ՍPQjCRWꋌ$1Ƀ8cfffffffSV[ýD$;D$w.L$t$ 9w9w9w9wPQV ^[dffUSWVx[hD$tD$pD$lD$hD$dL$$T$dPjD$@FD$X9tC;D$$uL(^_[]ÍFPQh<R j$jU0 볍8P'VUSWV[Å$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍlT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$8Pg#[ÐUSWV[l$j@ƃ#jv@1jb@j$jU+ WU6+^_[]ÐUSWVhL$$D$|L$4Hpx |$8x|$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø荗USWV4XD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$LB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$ܢlPQhRے\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$ܢlPQh|R趐\$T$\$<2PQjbR腐\$T$\$ܢlPQhRQ\$T$\$ܢlPQhR\$lffffffUSWV[Ø|$8D$,hEtjPu_ E wJrr G&E(uI1GT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc<2PQjbR蹍I<2PQjbR艍w8<2PQjbR^;E,jjuK[ Ǎ<$fD$2E(uEf $fD$$E($EfD$1$8t$EtPQE EE($}fu E(jQt$xsB tt$t$jbPwэ<2PQjbRTD$<2T$ PQjbR(D$T$Ǎ<2֍PQjbRUSWV[{|$l$t$FtPNF FF($nf~ F(^_[]USWV[&t$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7<2PQjbR;몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ<2PQjbRB!fffffUSWV0[íu~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍<2PQjbRƒD$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$<2RQjbPT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ :8u 9u1)^_[fYD$@P(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPIz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$`P\PXPTPPP LPHPD@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[t$t$t$ [ÐS[t$ t$ F[ÐS[ΞL$T$ j[ÐSV[Ýt$ tAdj@PV O FPhjPw F@FDFHFL^[ÐUSWVX5$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPm FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[t$ tA$j@PVkD FPhjP8m F@FDFHFL^[ÐS[Þt$t$t$ [ÐS[nt$ t$ [ÐSWV[Lt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVl ^_[fffffffT$D$fUSWV[pMD$$&yddḰ ~? gL$9 \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <X 1D$D$ D$D$L$8T$jjPQjR)DtD$8X D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$vL$L$L$ƥFL$եL$L$L$LhjjjPQRCD$L$8T$jjPQt$RBL$81 u*jPy _UiK1D:0D$D$D$ D$L$8T$jjPQjR(Bt$8|$<7QPWVD$D$D$ D$L$8T$jjPQjRAD$XL$ L$&hjjjPQRuMD$D$ D$L$8T$jjPQt$RHAtD$8he^_[]fffffS[n [ÐUSWV,[Hl$@D$D$ D$$D$(L$ D$QPjX W91|$D1҃|$H1‰|$\ 2d l t |      t t} t{ ty tw tu ts d1`YRKD=6/( !    s#4Á` uH< |$9T$vQ׋ jjjhjPj! \ t+f@ fɉ9sfэ4fxtnF|$DtL$DHH|$HtT$HQ|$ tuī|$Dt̫̫1|$Htԫԫt$jWj ,^_[]þ |$ $ LjjPQjR=<$ ȅUSWV[WtV6u&dP7ƅt3&ȫtUmuW0x&ЫtUmujWN^_[]ffS [+ uoD$D$$ T$jjPQjR<t1 u,YPQjAR^  [fS\$t}D$ ËT$ D$9s.Wd$\$ L$)ыD$)1҉_[)W d$\$ L$)ыD$)1҉_[ËD$ L$1ËD$[ÐUSWV[l$T$D$@tA΅|$ Fu|$,uJ!@uAEF rF MՍWRWQPUfD$ T$l$;;OvQP2OV QRP ET$El$$1|$(Fu|$,uA!@u8FE i M֍WRWQPVuN>NQ;WvRPt,NQW QRP FEE1^_[]ÐSWV[yD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [(T$0|$,D$(L$$)q092sVP$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[8L$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[(|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[dt[̀rS[Dt[S[.t$ t$ jt$$t$$t$$t$$t$$  [fffffS[t[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[8$D$D$huET1}8XM4tI$P E8*$$E4E0|$ 1D$L$j`QPu8VR4ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$($,|$ W$Ƅ$D$TPWt.$Ƅ$8u$L$ThPQ  $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU 8 ʼn`UD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PWx h$PWb U|$|$Tt$h$PW/ |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8ISltC$($,2D$XP$06 $0$$tRt$t$;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPyB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPg t$|$ t$$tP2A$$t P"$($,uWP t$l$$t$|$t$P@E$$8$j`t@8@P$i$t$|$t$PA@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[qtM΋uA~8t:~4~"`N4F8 I9rPF8^_[ffffffS[ÎqD$L$ AQ jQ0 [ÐSWV[89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gqo91pjPQw1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[ü[t$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[ø Pjj%Q4SWV[ZD$L$Pt prxxp| pPxtz xyV 1^_[ÐUSWV[ÈZ|$ l$9v`wDt9xtNȅuT$81$Xq3H7<871*׋PtIQPEjPQD$ pD$,L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~yk6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p&2 D$ L$Q$ЈA1ÐSV[}Xt$ V PtHP tQ P V1^[ÐSWV[Xt$>gthGt tww$Ѓ gpNjPQw襦;u<tww$Ѓ 4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[VD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[XVt$0|$,ttqP3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P| Pt$8=t +l$1jt$8_1^_[]fffffffUSWV[ÈU|$(T$$<Gx:B tzu?Rt*d2 O2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj WV t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$xT$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]Ín2PQjGR(T$4yn2PQjHRm(T$4USWV[P|$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;DW,ܯP=Wx- jW^_[]ÀO @1USWV[Pt$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]ÍPQjVR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[ÌNt$8uN uRt8F0t~@9tRF0N FFfN ~u VkN u1uVVF11+NN^_[ÍɧPQj'PQjBRuK'PQjCReaSWV[Bt$|$9vF tBNtjjjP6!ƒtF 8u8F %L$%fF VtQWP ^_[ø/TPQjTRD>TPQjUR]2KTPQjVR6USWV[ûAt$t^9vu}L$D$|$ ntWQPR!N tfN FPVT fN ^_[]Í/]PQjiR9vt>]PQjjRj_SV[@t$ t$9vuCNtP̋^[Í/ePQj{R 9vt>ePQj|R뜐6̀rS[t@t[S[^@t$t$t$jt$l [fffS[.@L$T$ lPt$ [ÐUSWV,T$ X?D$D$@t$Dl$\$t7D$@l$"v'1ɻT$ EVPu+t-|$@u$D$ D$|$@UtED$u70u2E ;T$B=sD$ DP[Í[ÐS[:T$B=s\DP%[Íf[ÐS[Þ:T$B=sD$ DP%[ÍŪ[ÐS[N:T$B=s\DP[ÍϪ[ÐS[:T$B=sD$ DP[Íת[ÐS[þ9T$B=s\DP[Í8[ÐS[~9T$B=sD$ DP[Í[ÐS[.9T$B=s\DP[Í[ÐS[8T$B=sD$ DP[Í`[ÐS[Þ8T$B=s\DP[Í[ÐS[^8T$B=sD$ DP[Í [ÐS[8T$B=s\DP%[Í[ÐS[þ7T$B=sD$ DP%[Í.[ÐS[n7T$B=s\DP [Í)[ÐS[.7T$B=sD$ DP [Í1[ÐS[6T$B=s\DP@[Í;X[ÐS[Þ6T$B=sD$ DP@[ÍC[ÐS[N6T$B=s\DP%[ÍM[ÐS[5T$B=sD$ DP%[ÍUn[ÐS[î5T$B=s\DP%[Í_&[ÐS[^5T$B=sD$ DP%[Íh[ÐS[5T$B=sDP[Ís[ÐS[4T$B=sD$ DP[Í{C[ÐS[~4T$B=sDP[Í[ÐS[>4T$B=sD$ DP[Í[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[2t[D$t8t9@€tuuuuH+D$ÐffSWV[\20t1fjWQw t u1^_[ffffffS[1Pt$t[ËD$l1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[+l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]Íش|PQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[M*t$t8D$ t|$tT$t121Ҁ9 11^[Í|PQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[E)$0ЉׅtPϋ$t[RWPQ$$$4UhVH$yPVjsq S[þ(t$jt$t$PUSWV[Õ($$$$0ЉՅtP$ t[$RUPW$,$<QhVt$t;}l$VPQhUJPUjup tWD$ hjP' D$D$DŽ$DŽ$ .L$VPQj$;$^_[]ǃP膺҃¿+w狔$ у̃ǃƒS[þ&t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[:&D$ D$D$$jVjo uƃ tjljj0jVjn jIjfffffffSV0[Ú%t$̀rS[#t[S[#|jPt$t$t$[ffSVP[Ü#D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[#t[PS["[fffffffS["88t3[Ë[ffff̀rS[Ô"t[S[~"j1[ffSV[]" u# V>u@1 ^[Ðfffffff1ÐÐ1Ð1ÐX!Ð1ÐÐUSWV,[x!l$D|$@ |ƃƵ] =sdf Fw%  =uɋ 뿐 QUhWL$L$뀋 |$@l$Dt1 t& 9s8u+p /ƃ D$D$(D$$D$ D$D$D$ D$ D$  fD$ D$D$Uj(P׃8^_[]Í]PQhR]fffffffUSWVX$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$ *MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$[8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$+l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$[D$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$[D$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WP}T$$4$4$4$4U$0R&U׶=r,j$ K;$u;^_[]Åt|.u|$qpUPQhWKft$|=(PVt$|UQ2$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$ExnNj$L$|PQ J$L$xPL$QI$ǃ$fB$) $W 9$A A L$|PQlI$L$xPQQI$Pj\I$PQ%I$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWPbDƅxՍ7Pj H7Pt$H7PjH7PjdH$ 1۸$IUSWV[ël$ |$t$D$@tعP) l$$FPj)GF|PQGfFD$@ u1ftPVPyGVjkGG fffG )^_[]ÐUSWVP[úl$0t$$T$ |$D$@tPT$$։)͉ $9L$(B99t$4D$,WPFGPl$UFGUVP誔L$4 )΁r&IPQh=RCL$8QPOF+l$ ^_[]fffffffS[îjt$ [ÐUSWV[Å$ $D$0$jUEEt U uEEEjqU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžh]ptkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU+DD$ djVU P!uƅD$$}`hVW ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ P tPǍ$WhhPhE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #j P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w d A< vhQt$H ƅ_Pt$^nD$ kc$< t< H$< w& A< vhQt$V赇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< tPVe< D$<@@@@ @@D$@D$82}j5Pj j$P-D$PD$;t$ s E$EtJP|EDt%uH(PWYu퍃)PA/Pkt#V[ML$0 ;$u ^_[]VUSWV[[t$xP6"džft91 9s)tQ!DŽͅtMtt|5X9ut!xt P!WtdžtPtdžf^_[]ÐUSV[TEu jPc$D$F$FWfF e^[]ÐUSWVx[EL$ L$pu D$jPbD$3D$fGt$V jWV VWJGL$ ;L$pue^_[]TUSWV[[t$xP< dž|$ft;19s)tQDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[4D$At;t$0UP EO $L$(T$ L$]L$dL$ F< t< tjt$V qjPVܡ j PV¡ 7jPV訡 &ĺj PV莡 j PVt 3zjPVZ  ѺjPV@ غjPV& ۺj PV jPV +jPVؠ jPV辠 jPV褠 j PV芠  4jPVm ejPVS $`FPC5d$/FP#|Gt^zGddGtAPt$'F P|GGtPQ7< < {$H׋$ut$0UP $4Py뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]PVX?r?D$PVt$y D$L$Ƅ|$PVnX?r?D$PVt$by D$L$Ƅ($H^_[]ÐUSWVx[$$l3 h3 p; t|P9h@tP|x$D$D$%D$ D$D$D$ PjjjQt_ett. T$t tǃ ǃx ^[ÍhUSWV[ûj0>ƋD$F Pn>FF蠍(Ff~FF,t t x 1ҋL$9uF(t thx 9tF F$F藋(t x r R| `  ^_[]19u뫐S['QPR j萚SWV[ܭt$8t t3x 9t^t, | z t$ ;[ÐSV[t$ t>t t7x 9u x ~t v=KV4K^[19uΐS[þt$K[ÐWVXL$ tsAQQBQQAA,t tDx 49u4x 4~ v| `  ^_19uSWV[t$trTt x t/<t) | z A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍+ݾPQhRyoL$4T$0^ EjVtE 1t u1@u)d1Ƀ Vt^_[]ÐUSWV([ؖt$@l$<}GtjP7> G ujU蚌0 81qujWjjjU 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P@ L$9jD$PD$P밾L$jPQUUu*t$t$ ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP` u !1(^_[]fffffUSWV[|$ t$tGw#jP-džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RP,t2MQUQRP$ EG/1^_[]ffUSWV[ø|$$G,D$$jj78 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$<2׍FPQjbRi\$8=$roD$L$,td;l$tX14Eju7k7 t%MLH4jP7>9 ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [Ø|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$RE $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]Íֿ̿PQhRgT$믐USWVhX8D$|$|G =tŋ\$jj$W?{$jj$W\$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$go ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WgO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$T$ PQhSR!bT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$PQhR|a끐USWV[D$lAB9w}) >P2Q D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pjn _1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V1Ʌt‰ D$0L$ЃVhPL[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$081\$$PQhRzX\$T$ D$4@USWV[T$B =tL$|$ t1|$,t*l$$|$(tVz<t~UwT$ D@jf!P=tfOtfO1 NjJDHjWPVFi`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P= L$,1TMGDHjWPVh t&dž(@f8u$dž  ^_[]ÐUSWV[vozA =tl$$G)B fT$L$D$ uf͋t P ,$Uj|$(todž(dž $FDGjRPVftiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PVmf t׋@f8u$dž wSWV[m|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[æmT$$wA =tF)G D$ *$Ffu^L$t P 4$jL$t$,t$,jWQPt$DFjWPQ,etjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[Xlt$0l$$D$jPj |$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-11-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/netbsd-11-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/netbsd-11-llvm/i386/20251028150036Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/netbsd-11-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/netbsd-11-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8utf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/netbsd-11-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-11-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20251028150036Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-11-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglux] [-i index]gi:b:luax %*s %*jx %*ju%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/netbsd-11-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-11-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/netbsd-11-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/netbsd-11-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/netbsd-11-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/netbsd-11-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/netbsd-11-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/netbsd-11-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist