08h*<  h*}.#Tt th*@@<@T 08h*<  h*}.#Tt th*@@<@T Uh*t  `Ah*h*h*Ah*h*h*}A.h*h*h*Ah*h*h*Ah*h*h*Ah*h*h*Ah*h*h*Ah*h*h* Ah*h*h*Ah*h*h*Ch*h*h*Ah*h*h*Ah*h*h* $ hh*h*h*mD|h*h*h* (08@HPX`hpx x$|h*h*h*L$Ih*h*h* (0M$h*h*h*8@HPX`hpxE$vh*h*h*5K!h*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h*ah*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*!h*h*h*4!h*h*h*!h*h*h*!h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h* B!h*h*h* B!h*h*h*!h*h*h*"!h*h*h*"!h*h*h*"ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h*ah*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h*!h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h*!h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h* !h*h*h*!h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h*\?!h*h*h*\>!h*h*h*\=!h*h*h*\<!h*h*h*\;!h*h*h*\:!h*h*h*\9!h*h*h*\8!h*h*h*\?!h*h*h*\>!h*h*h*\=!h*h*h*\<!h*h*h*\;!h*h*h*\:!h*h*h*\9!h*h*h*\8!h*h*h*\:!h*h*h*\7!h*h*h*\6!h*h*h*\5!h*h*h*\4!h*h*h*\3!h*h*h*\2!h*h*h*\1!h*h*h*\0!h*h*h*\7!h*h*h*\6!h*h*h*\5!h*h*h*\4!h*h*h*\3!h*h*h*\2!h*h*h*\1!h*h*h*\0!h*h*h*\2!h*h*h*\/!h*h*h*\.!h*h*h*\-!h*h*h*\,!h*h*h*\+!h*h*h*\*!h*h*h*\)!h*h*h*\(!h*h*h*\/!h*h*h*\.!h*h*h*\-!h*h*h*\,!h*h*h*\+!h*h*h*\*!h*h*h*\)!h*h*h*\(!h*h*h*\*!h*h*h*\'!h*h*h*\&!h*h*h*\%!h*h*h*\$!h*h*h*\#!h*h*h*\"!h*h*h*\!!h*h*h*\ !h*h*h*\'!h*h*h*\&!h*h*h*\%!h*h*h*\$!h*h*h*\#!h*h*h*\"!h*h*h*\!!h*h*h*\ !h*h*h*\"!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\ !h*h*h*\ !h*h*h*\ !h*h*h*\ !h*h*h*\ !h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\ !h*h*h*\ !h*h*h*\ !h*h*h*\ !h*h*h*\ !h*h*h*\!h*h*h*\ !h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*\!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h*!h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h* !h*h*h*!h*h*h* !h*h*h*!h*h*h*!h*h*h*!$h*h*h*4!h*h*h*!h*h*h*!h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h* !h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*!h*h*h*ah*h*h*ah*h*h*!h*h*h*!h*h*h*!h*h*h*ah*h*h* ah*h*h*ah*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h*\?ah*h*h*\>ah*h*h*\=ah*h*h*\<ah*h*h*\;ah*h*h*\:ah*h*h*\9ah*h*h*\8ah*h*h*\?ah*h*h*\>ah*h*h*\=ah*h*h*\<ah*h*h*\;ah*h*h*\:ah*h*h*\9ah*h*h*\8ah*h*h*\:ah*h*h*\7ah*h*h*\6ah*h*h*\5ah*h*h*\4ah*h*h*\3ah*h*h*\2ah*h*h*\1ah*h*h*\0ah*h*h*\7ah*h*h*\6ah*h*h*\5ah*h*h*\4ah*h*h*\3ah*h*h*\2ah*h*h*\1ah*h*h*\0ah*h*h*\2ah*h*h*\/ah*h*h*\.ah*h*h*\-ah*h*h*\,ah*h*h*\+ah*h*h*\*ah*h*h*\)ah*h*h*\(ah*h*h*\/ah*h*h*\.ah*h*h*\-ah*h*h*\,ah*h*h*\+ah*h*h*\*ah*h*h*\)ah*h*h*\(ah*h*h*\*ah*h*h*\'ah*h*h*\&ah*h*h*\%ah*h*h*\$ah*h*h*\#ah*h*h*\"ah*h*h*\!ah*h*h*\ ah*h*h*\'ah*h*h*\&ah*h*h*\%ah*h*h*\$ah*h*h*\#ah*h*h*\"ah*h*h*\!ah*h*h*\ ah*h*h*\"ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ ah*h*h*\ ah*h*h*\ ah*h*h*\ ah*h*h*\ ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ ah*h*h*\ ah*h*h*\ ah*h*h*\ ah*h*h*\ ah*h*h*\ah*h*h*\ ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\ah*h*h*\! h*h*h*i!h*h*h*!h*h*h*!h*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h* ah*h*h*ah*h*h* ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*!h*h*h*!h*h*h*ah*h*h*ah*h*h*!h*h*h*!h*h*h*!h*h*h* B!h*h*h* B!h*h*h*!h*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*ah*h*h*!h*h*h*!h*h*h*ah*h*h* ah*h*h*ah*h*h* ah*h*h*ah*h*h*ah*h*h*h*h*h*bpf!h*h*h* $h*h*h*~$>h*h*h*$h*h*h*$sh*h*h*$h*h*h*$h*h*h*Ah*h*h*mh*h*h*$h*h*h* $h*h*h*Ah*h*h*Ah*h*h*Ah*h*h*Ah*h*h*Ah*h*h*Ah*h*h*!Ah*h*h*"Ah*h*h*#Ah*h*h*$Ah*h*h*%jX{8djW8:ݤ5= pY"&4JT-^ rHh :)qaJW<5")53'q2WOir3qYai<%X9`z)߼BfuPX=(} +J"4)2+0DO:BNֹ#VM Lǧ/ Z>O_[YcrwRs-1;/stş'n !OTbdd?)c>OV &xDF'"$jo;D$8 s%lsARFwB:!]u4'"#B?;WasOEZn ˺S"9mk8JG`9UIfuE#9ҤkkES_]I0-ui9<1A{E:VecDbfF@&5gWq ?<:y75ES t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(44 (ѸsLLNetBSD; @PaX NetBSDearmv7hfeb3D0D 0p@-#|h4L T%JIHLOLT 0I  L4lF5DO-9F 5FT,AF8F4L(@18@- Kn:f*oB² *IO_mQeppGHɠ-O'PNFXO TFkh;k`+(F$2AFл J3h3 ,-ѸTOsh+>гh ,$7)hHF. pCO FN0)hPF ]F#a+h+)FFN,I rHѬKfZm IFFH  (Jh3`pG-pCF-FK"F)F0F`@0IF@F #e@0 I H {zp@Y 0p FFmF@)F0F, H1F p3h-ApG#sFF `ֱ0FN$h60FN(Y/I$/Hh O!.B F(HN4h+ $I$%HRh#@c`$HN(ѷ O"Kp49F~0FN04h-+I$H& HN0H)Ft($0+ Oѫ'J@TK-OhFHO~I NZF IH$ F3FjNAF KX`h+KhKhC/ИKh O +@Kh+8ГLJI Fkh;k`+(F$"FD F (0$ Y,8FNO TJ>I?Id! 2. F Mr#SY#C 4J1I2Id! 2 F MX #SY#C (J$I%Id! 2 F M>tOzp*F3F0Ozs"(F1F2"(F1FOzs2|J td!p 2 F M' bM       &F F N-G*L!j& 5jCk"j5&*D jG?? bj IxO dOk2F!hj[jG(#j6i= ;h+;;` I d0[պajHFO `+ ` p𵅰4L%j YCk2jj DG??bj 'I8D"k "IijG(ki!h[jjG( 6E 2Bu#0kI'jiG0 O 2Bui8F!h16EBBв.F 0`m F IFhO  I@!!n!FH 8U9-OFTMF0+FА8+BJ@ A40+>УhHch#H####oH ###o"hH#H## Ma@ B1 0 O + 0f0M0Lܳгo$0+FЃK0#0#+`O~K4~K0 #0 zK{H*F2 +hO;;+`0)hB+` 0+AвoвiI hK0 #fI<bH>e{ k 1mf [ C 0+$*RK@2!RJRH (0++hIFOJOH2OJ2 2JFLK,0;JKJJKH #FIHEK@3!:JOsEzIF@F2RF9FFXF2FFIF@F2"F2 F IF@F2)F"F0F2FF #C# @!#j 4RFX;FH     J {,!      L q | .&#^HNe 8AFHF2bz OsEOrx ; OsEOrqUwH00+@,0+#H" $hЧ"40+"H LBy 9F2 JF)FF0F2>F FF8F22" f+JFIFpH$hȑQ1 h  2h 2 #C# @!#nFRHRKj+ 1cQ~UDH !2F+FFHx0 OsGE{09F@F2ZFIFFPF2F 9F@F2u"F2FF9F@F2i)F"F0F2F ZFQ(H LAF8F2P ; ?OsGEOrAF8F2> ?OsGEOrAF8F2+UIo1"+F2F@!z Hx z 8 ~,F!F I &`9F26DB pF Mk`   -OFFFF)H%&DB {:05BI%H x ^+\ HYF-X 5\(4O500 x00 x00 xɠT, #J8Ih# `jFL( ۽0+;J`0+;JS`] @th, KZh B)iBHo 4-GFMFliO !+iB$4 F6FFi+ #"#9FF0FP F,̿4,i$kiBH{o  -CFF0HloL0B̿H F FFB (F4()i;F"F@ (-hLF4 KJh30 H3oa9 Ki" 2 #Da  B Kh30Ka8@iHo  -OsM؁li p;xY2I +"O (7p )(((iiiiiiiiii^.30-.^. \D"0x?.. .@ 300xA2@ (I1F "QFCF;316h"+3fa0(Cbi F(<#10;0+^ h8:ѽ(FF(M+i;DB<ݳ y IF2 1XhIFHhH0;0#h  i0h;0##hԘYF*i8D/+i-hDRo F.Lq/1QXibBA+D",(Fw09F30XF1hiIFHH90;0+#h  0jp;0+#hԛ2x\*rx6/*6 -G#Ll#CаH!gF oB=030@BF5 D)F1zhIFHH0;0+#h 7 0nP;0##hԙ1%(@!"p x +8B!@B0/F7D309F(0r;0##hԚ*Fo/|1Q"ZU0x!XBXAr!+B%+oB$۵F0Oz  D30QFS(?m0n;03#h?x?z0!xSU0Yx\)љ[xU=F|B0B!EE/F0GF7D309F(?/0np;03#h?:?<0oZ x1ZU1 [x (H1a+DB!ݳv 1F2 (?0n`;03#h??13Dp!/ DB`s0++1H AY HFF/qCB!ݳw 9F2 (?0np;03#h??10F+D++GQ*ѠJ1h8#@ C` KF1x!+ I0 /! F, H'  A7ML0x +:KKh0xP1@ *EH 30 *!n 0x!+0(0h0HR-8u0)F300ph%IF%H%H0;0+#h - 0P;0##hԛ#0x -# pR(YQxT nK-AhL0F E2Pn (x /)!ȲY(1Y).,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,Z,h=fM,tKlQ,m% F+n*p* l* 0 x +MHE0EE1 Qh(ZoWaiF(% F+n*p*l*0 x +1 -(`iE0EEaiF(% F+n*%p*l*0 x +1 (#B3ca(FE0EE!):ah)Hq[x320] Hi &F(?r% F+n*=p*3l*60 x +G!i (Y(R(3x 1KN!0F}(@J#1O3`J`E0EE!+НH"1F.3x+Hah)[x320XF(? x!+ђH%F+n*p*l*0x +ݮ xH".HMh-IF-HN-H0;0ù)Kh [+\+!hF(,Ji +hO 3+`0FF+h;+`+#Kh  _"hFB+h;+`+Khԛ&h  XFF!F(:F1F0F(  0 [K-OhZN|3h3sh3UH6oRL#hQK"`P RO 0,F30,1, # # | FOl E Z?Kh #3h7J0sh`s`0;0+\5KhQ i R. ܾ"  FXP ;DpYhh`py`hHh`X`4Xh#h`#hX`Chh\h#`\`h ; =?d k ^ , D -A &M1; ZF J#+`Kh`JhZ`; :X*уh,`DhhB F FDF D , -CF LFFh"hB#hO bh8F PS50Fh`0Z"`d1  "`-(И> IF H H`h5  DIFFH $-O]NF FF3h빭IrhK* FGH)FH  ]pCO/n#`o Ob)F-o@/^?# FI<(pCOгhS FI(pCO3hkh[+x/+0(FIH)F v FI3hCF@!F(F.H(8H"F)F (#FyJvOaDovOb!F -P  F(OakJ `( `I(fH)F/!(F([/! F(UG9F@F.Fo/ڧ o*EEDO8S=* PIF蹼BCO8S=P PIꈹ*P1 BB T1BB?}3i-si F+pCO@I(!F F'F P)F- S PRF!F- S i+_й\$OX8F+"IX"Fv0;0+@FFp8F (0' Y/IH"WXNEF   L  A #h+li)BiZJ ! ` i)>+jTJ ! l XF- BFPF -BFF8jpHIfF-BF3DFF iF(ѵ(jF(ѹ 0YF(`QF 0(Dh`:jJ!F0(D` Fa3jXOrEp-: J!0-j,+?KBsD,!J-rj1+? KBsD18B333KgB^UUUV-OFONFOJF!Fk+">FF R!F 7h/(FOI-k#Ow(F$Fx.h(F.`.|h+[1IP0;+R#nnnQnnQnQn%H\X!j`jFXFL#sal[\0.+ѳi+"!F(F3l+sk!jPF*9F(FF Fk+)њ!jHF#sc xinh-GFhFI LH +(IjF H& 0 J`#3H#aO &MFRFAF8FCgxKbmhlC"mCuH+v"pK`mh3"ian#ehCC boo CCR @!hFR F F й^IHFj+[b#*++ SKc`l+QK2F#c/8F`i#d18G(΀$gj)X[̤`eoPtc0x̐FKhh;EKh3pCO)KJ ) FF9FP9FF\yI !CFqH;hZ:` {h;{`+ HF@C Ѹy?rY?n;hZ:`x (sh+"F)F`Hj FGXx FpCOG(WH!FmG*(FGBF)FRHapCO@F(FGr@a FGjFH!F @FG3si4O F!@FGFy)F4paFa( `@FGh8Fi8FGB !F+H N FG((H!F D3h Jz+0#PFIF##3`@0 ###F*F@0IXF {z@Y |H&m9F@F01H!F @FG 0 @ˌ$ˎaF8FGZ&H!F 8FG\`-h+ H!F #@c8FGPH!F 58FGLH-lh-+5!FH 8FG!F(FG H)F^wh/?q"F)F H@i!F(FFd)7KXsFhFFFG$( I %K(F`I!FUGGhGdp罱G F!LGGTGR#"F1F0F( I!G F)FLG,0-AM@M'kh+lF>IhjF#&#f`G(-8J DhOBG(-2Jh SO4 F M*IjFh#f`#G(-'JhOBG-"JhOBG(nFIhjF#O3G(/!F8F&!I@Fp`jF I#h3G(-dsh Jh@F,0mFpɃhF;`+ GhZ` "ppG-OFLhAGMO3JO`#33+a`;h+'JbK`kahBЩi"h+UO0kOr!0FG*(`-vJ3Fh ^#`rKkahCЩi)"Or@a0FG (`,hJ3Fh w#`&#``KkaOr!0FF(`,[J3Fh \YKka# c`WKhVIhG(,kiSJh DhFO0#``'0шjpCOji EI_/CIhG(##+a(i>h(C$2C@ŀ.5.b.$6O@6Kh-+FYFPF+C@0K=``O##h"#*|??,Fh+##.@o;`'.O`KJh`J`mCIJ+q***OC `,0 0 0|,<,D+,M!d P'TK@8m!!,\.%Kh+0GU_B-OS. `(KOB`OSOOEF=`UO SBF+FYFPF+uH8CO ;`.:hKOs.?|;!,\ KMi+ Lch+ݠhOBiFF(`` M 0,0#LcbKi #"#h* F ,vJh  O0h(,0 0| Ki* I O0h(K JIhhw 0!L!FFF$*F1F8FFND-D F,FFFF$*F1F8FFD-D F,FpFM Flh,Nh1i)FFJ#s`hB`3` FpF #s`l`D,jJh j FI ,0 0! -sFJMlh, FFhBFFN#kbs` Fpsk`3i;+5(5,h +;;I $l`(3#"#h* hbr($l`#s`(,h+ $l`,hE+,,#kb,vh+,ph+,lh+,fh+kj#,I ,Ѫj FI,RjJh  KhYi F! I j| I,0 0Nx-!1K𵅰 * /MjhB.Jh:*-I AO0Xh"`i*!*<@!Y`B3݊BOth'#"*&(+#F2F+&hf**!@"i`Z` I  h IG(#k`Ot"Z`kh+I 0,00|8mg)O-G FpFFO# Oxh(|9)!h* F%cI9$BpF Fh$*( ,x Jh O0x`` 0+,0 0F7L F`h(%5Ki+:+)v[1I t)vR"h'#*j ,8(Jh O0``Kb*ڣj+ I"F!h*L(*,J3J-`v0F)F+>CII#h0F,(, Jh # c`,0 0*W|!m-O]{O{M F:hX*F uIV#0[bSF##"F#0+:;h+ʀ!0F##eJV|dK;FV,+`J;FLOq]JL3FOQ,@XJXI(Fh ]t0ӱQK!0F##GJMJOQ 댨+ꌩF F.;h+DK VhBK9FCFV,+x7JCFLOqlL:J;F6K 8O!0F h z0܀2Kj;##"JJ#!HF#JBJ   L+8 JOqPF*JOQ[Ff猨+xꌩF Fg,k0|ɠ 0!L! 9,"!,04!! -CXMYNYLh+#3`3 0C#i+NKOOh8hEMKMI8hh8h(hIIhFFhjpCO$2C`iF:`@Kh+?Kh+(h(!FhF(h("4 0C #i+ ,O2H9h,)K8h"`(O3`#C#3`)O#3;hj3b 0CML+h# h#+`;hӱKHh+>젹K"%hQOSI+DF F(FI - h(h,0 0!!$!Le P0|!%H!!!!!x-AMI F(,Jh f" F(,|Jh VzN{Msj@+0C@L0#sKtHhoirI8F+(pI8F+(+i3+j9F;iHhHhKh;+5fHw^O9h@FpbHmbHjaHg@Av(]I+9h#[HO40t`QXK"` F MUHFTHTH0 QH s+ S+ Y+hi(iiJH)y+HH#4OH9h@FDH@A((6I+4(Н0I:FR;+1(B:H$Oqؠ%Fw(.DB5ܻFOL#[+*?<0+%-I gl,*I"FH%Z&Kq hBF HOq$%F$B0I EO0("(,0+I 4HOq H)FiGL#(W( )FH J`T 0p/d # "!0|-OO ` F&p+N+$-G( AO;hlG(;hjG( (( F+K#B!!h0$!!!,!! !!x!h!#y/+ m8uH*@uIFH$rM +hCmHEȹ0+h+hSB`CRhXBreK#BAZ0K_J+hTKF F43h YKh WKh+ (84+B +@;+9 FF+5KKS#@- F)0+?خBM+h+?ӮK"`;h+0F>(ۯѺ0F(ڱ!$! !!$%H!,!L%!!x Kh+( >(KhlG(۽@ !!-OML+@BO38F!h)@oF ї;/+"hI ~ h,Kh@/*X)J[FOyh @I"Kh !bE  $hx D!T U4BIZF Q .bBCXIh)sYF0Fj,x2CO0!X'f(!-AFDL- 2*s&%' h0B@DAq#hFi*F(:F+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(#6DBr##h2FF(F3DaKhYi)0F6)(0"hBDa܈!(=!<,\!8 Li#hB ٥i!**Kah8@X8!,\-AFO FL- @$,=iB1F,F&DF"F(-F#DaO0!,\-CFd FO-v B,8hOyBv 0O,FF"FF*dF#D,0f %FO0,\!-GBC̰FFQXUh 1F"hF(>=KhiF@FD( *S8J8h `-v U0T/I( O * O0eLBv@F*FD($0-fvD&@FD(T*~J8 61BBT I(T*h J8h  e!|'T(((o!,\F8*TTD(*>J+Fh D(*04Jh J#4`8((!pF0FiFD("KhB CXHh1BBB0CXHh1BB I2F (F&p%%!)0 FFiFD( '0Kh۹pCOI F) FDR(-* J#Fh UO0 FDz(Kh&*J#F!\)1!$(𵯰FF6F4#g##9'N3h&Kh  FDh쀻3h[## J!Kh[##J!iF FD`*^hN+*ZJ#Fh /*P J#Fh -iF FDz000bM)h)LpF FFDn p2F)F FD(Kh&*J#Fh O0!$) FDhKh&l*#FJ@h !$)-OFx̠ F/+F0O7 FO/O /!% F(HЀiF FDXF@ Fl0/#0iF FD똻p@@O0'0#2F)F F}! FD^(iF FDh  FAq#jF FXF'/'O0!`-GFh#x/+ 2Mhh(1I"#k`O09 "G@ADټ0UH*`#h#J3h N3h 5"'0`!h;FBF1v~(*<0C@$8F<:( K$h&4 JQF 4`D!)*$!$*E*;!h-AF FFFFD(@.Kh ( 1BB 1BB#I2F O0pCOI F)h FD^()J#Fh d FD(/ !F0FDb() F(/J3FAF @!*V\*t*S0F(4pCO*BCXRh*s!PPBu## E `iF(FDV0pCO  I*FO0'0#"#iF(FM*SF( P Q# 18pG-AF]VD,C()49J#Fh 7Kh;@$ F<F2Jh(?+=( F.Kh.KhC""RS 3 F#b4۱5 F)FC( )J#Fh  FDjJ#4`(t'`g(t(@0CD D #0 '(!`!d00*!-OV[@3(t@)FM@  FDFO 4;+܀ǓKHh)xKhc FD\F0,pB On9F F  (|чKh0@$ F<), *(@(@F>4 +(tKxHh)d! FD(̀ FD()2nJCFh Gq F#R)h 2 F0#dKh+$SU 3QJBJA"@F#cF@2 FC C,!)#FPJhPF+)5йzIKhGJ#FIF rFTGW[#9F FCh^GG9F FC^V:I"F O0S @!FC,H4I"F FO @$ F<(O (4) o@ao`a @(4*?:3$@@3*F F@Aqg0+K(4F 0C JhC M#7!L?!!`+f0*!h*E++@!d0pG-OFFFF FѤ ^0+#`00CEFEF[0h[f#FBFx3*#` # 8*F!F8FBH)$J/A$+F8F'"(8)Jh KthhDFDFI O0IH hSj!F0D'  `*D f4F}++~!(!!!sF F p$O3O2'( ) J+Fh F+O0I"F0FCd()J+F+! +0Fh F(CO3+` KhSQT"4  3EE#0! -G"]WFO "]$FFF _(O RF(RF0FCF( E(Iy#3BDBCXRhKEB T I( :O00FC2( T)J8h B`CXHh1BBTI(%#"0F'BT)J8(FȄ+'T++-C)L h #3&Oh-1$N@Ish;s`+ 0F^CmO03hZ2`x0B-h"ZUi"8F& `( hjJEXUFMFciSeaci+ (hca+`!$!0H/KJhLh+##aCaKhiC@ahc@@`0 IvO0{( Kh( !!!$!t,! pFFx3I NO0p FI(F(8(+\/+#+T KvB %`f`h`F`aia`,=,X!$KZi !Q` Jh "b Jhr JhZP$*Yhh"CpG!$!!|!Kh z K M NOh#bhR9F "h)F0F#h (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx! !$,-GFN-3j3hWh0h.Fp`(#3b(O4 F P0; +<%;+;2;;88kKh+Ёm#(qh#"2###jj [IyjZJij Aj WJjUJZO "  m@F'(4(jpCOe+س_]гO9г_wsh @Bj'\sh@Bj `PT0'N9K:Hh( F(\si"Z`-q O7г@OLгO#4S3###4"Kh+RS 3RR ##4## AO@b4C()shJjh_#  ##$!$! ,,,-!L-pFhF# M  ]CBO@v FJJ pp-0-:?K-Ah FS;IBF Fl FACV(S 3 #!<!F@*K*I/F(F F#s#8484;+c#j FKѲ3 C "I$ CFI F4*I B F F%^# FI+ I B!F !-F-Xj-k-dS 3#F9S(8H#-s7F FC%2p!x 0?"hF$)FhFx)F F0@CͼDFB4F (*O +0 ,08B#FA,78a,W808B+0, 8%F(O0BB ;D$(;ѓBTO0 8 (AqOF305W5Q]pPBDO FDO0"(!FADq00 QГBpDBF x(@h3?oBO5BpBrZk@`F!B F* MF F F (* FB+0:ղ-@QpQ@p F;0ֲ . @p Q@pBػAֲ.@p  1@a;ڲ*@p  1@Y@pO0Fp]D+>&BPO0 p +AqFOv5404W4QlpSB)D F(DO0"( FA@qQ0IЕB Kh, I FO2`c F$$!-|-A FȀ!+LF!hi.Kih!` x-) !y'$I1 !q`!y!hO'`x!`!!q!yyC)F0FAC')F0FAC9FF)F2F&L#U!PIH H.<KhQЂB`0| L!F H!F H!FHH!F "./p0G1A-OFdFO YF@FYF F'@F8F(CF (J;Fh 0F/#cUNF2;\-O FF/! h (I0M)FF(PO JF_FM#`0 KOJ!F0F C"KhKh]Y*"JX+ FI `*56V@ hz(<S -)CM59=Q #ΉΗΛWΛ=emu͓͙ͥͩͭ͡UY]mYquy΃܀T1K)` /I 20I` +*K)Khx-*(JYx#``#$K"#K$J`#K#K#KKh+!Ht(ˀK"`#`hK"`J#`J`J`|?!\!P,d2V<0|!$!2%,`&| D! H2;!!t02A!`!d0!L!K Kh&(= zKK KKJ+i3+aKhka&K|E  XFOF I KNJKNK"E%`X؀IK)p FIDIOrE%=BK"E`7&KE>H IF'z O30&HF(4I t#Kh5(E.K"E` ,K"Eu`*I Yջ(K"$KEe,d!2%!!&| D! H2;!!!03! !!!343JLM!!3f3}!c3!!3 0!d!`0,`kKh(EefKhZ(EUbK"EU``K"EE`^K"EE`z\K"C`u[KqZKrSKhYKXXKXJUXKi`&#`VKF+@;CH SITH SLTNQO-O3Y#OI0;0+%ڰ1 FII)@?#`GKJ#75#`AK+@"1F@8F%\ b0Z "ph+5K6J`6M7++?k2M+hBf"T#Ft(+h3+`+V'KhB&I >%KT&`h(T#!(߭+h3+`+hBK"`1&|!x!t!p!l0!H H2R!G 44H0 .!/<4B!P,`Khh`pG!P8KhK ILhMh8 KHh&@#!F(F 8!P!4i4!L?1FF"2`,FO ?(1*(6,B/![(+̼ox"!/ F4x]-5ѧ!GBGAB;x "Jh*O0/+7`+,*1%F+kx*++9F7 x+#2F F(?-А-ѐ о]ЬEEؿ"E"!FhDx/+5CF(@o I*O0`h1FBCD;aB8 D0(DB (py}9=6B.KFh M,H,L,N-O(F F0F8F@A(:$I&"H&B@CBH03H M.+ѝ@$H F.FHV0FZ@BF0F%(`O0!L6\666677-7=7d-O]|K0 EFFF @@BFh%O9Osi#0 ")F(@F[h LcB٘E LcE𼀳hDF0h LcB҂FMDO@F ]&)3\)-Bx1  0: B((R*B F)D LcD\*&* FPF3I:F hD LcBS+x La+FBF+##p Lc B+x!I[F:F Osi?QѶiE+ si0xI:FH 0x+?l?-@BYF8F%`# I[F:FH Ld!7777-CFMx"JI |,EF+xFI2Fp\+55B F(='"AF*p8F FOcjF9F 7I3FjFQ FO802x(F+F+x38FN F\+55BO  `88F8 F!I*FQKahr`\`@F Mg)P)S)G)8F F^3xI2F+p p) s)ciCciCcaciCZha78868!8_-AFFFx;I O0 )F I%`E`0F&( K``hDh(F`Ta88! K M N Oh#"i 9F "h)F0F #di!81Kh*RVD,L-I h!i%A!a(F@(Ih/ah) 3FBRi4` F#4p0 ``I Sch /"p#c`O5ch/"p#c`%h(F&`8+\/+#+TO`#aD%*I (!!!99+V#F4Kh#i.hy/+di,Kh@ Kh+KhO0 h9F%( KDh+(F\(# 4 h"9F !!!F]KFh[y.+Cy.+уy/+˱WI(F젹*FF2x)Z*,.*,.*  .F : . t  []0Pm.+O0I.F`!F ;0cx0;3D+Oka F;0Kx !31;+a"F ;0cxF0;3`"F ;0cxF0;3`#x !(F0cx0;3k` v@0O0 #x &!0cx0;3d"SClskax0x0:"Dd3!FFAM/hS@="-AFKFFFiԱ@=(F%T!@!jBEB!BB(FO0` h" F ! pGF!KMFFh{x/+ iF8I*F  MF( FhI*F , F M@(F `(s`## ##07Kiab`!`>V>m!-AMNOilcha3h cjh h :h0C #3### h Kh!j h h Fi!!d000@)s¿@9@@!F$%FBSBO8F$RD1F F%FpP%5 D-OFLM@,@ЀFLGRXk1F@FT @FL$O #hB.Фi, CF(q#"#$(_2FAFyBLU&`##0S' aC'@ 8#$2BB & Jh O0 2F2B&nJ2FAF$(B`CXRhBA 2 M&R Jh  F&FJI l>>>>? !0/K-GFhF>-I0FQ$ F@"V F; F(=@FF `(F```F'@@F%F(`(F1F%(0Fm(F|( I O4F@FZ FWI!?/?\?wF KFFh h@"T @T!h(F%0ah:F(F$0`h!p%F(O0BB7. F1O/..O /CVTCUTBDEt01TPBD4 FD8"0!%UO0 p #ST\UTlFF0OpB DB0[(DDK@,-A]\FO\ *F:KD.&h#BD",x/+:3JkF@   N (IO0 ]KZ*, CDlD2L?,#DlF7 CDFJkF@    (JkF@    s(ڵ JkF@   d????pFh FF*F3e-p@(e"@ɻF#F h"#(F#`3`pF  FI ?Oa gKhOa pGOq!0#L#`C_B  hY`ah3!`!`h(̿  0O0!8F'x+"I#~Jйhc!` F8Ik"FOqF(F$O4#`O4?0?-CNOxVF%h1F(F%4xch*FI 8KJI 2O09FHF%( :*IKF*FK"`@12K@;@i@!0|-AFFOq0F}(O0BB! FU%0S #840K;+bK@A@A ` @[K "dFBH "F (l"F<t" !@|z??Dy`" !B`BPH`BPBPBpBH`P#hH`<SC  2)*1)80y($/(5)<#BB4#($84K*K)T " "$%zhQBCQ#4(4C C(43y /+0qB#4#84(4CCBB($BB!X zhQBBC#!!-GVİF4Z*. -%%%Jh"%TI( TI(T~I(T|I(,d*yI B%h+5c-tI:F@!Z%d"9F#4O O+J" D/"," #IF@F(KT_I(+ 2# A d"0##;+1##0BC  !Uh " X+FCBs00 SgD" B:DO0< "8D%mB#J5;K ! C S#(|(<#s( @#j(#%IF #@F`F(@#(#F(FPF(q@( O5(FD9TI( ! (4 ++!@@A A*AGAeA!pA pG pGpF.xcI"0F#FI0F$KZhi CCI F"a"FOqF(F3BFI2F O4 Fp?A!AB-CFFOq0F(O60FBB!(FT%S#84Yq_@FY@B#/#DG;0K;+ٞK@I@FIFKD @/`v "dF" ! (|BC ??P" !tB`BPBPBH`PBpBP#H`Q)H1("tFQ@Q#<1 (1("lF=<WG H 06+ 0+٣3*vHH1&g+أK*@#4BC&X0ZB(4GbCC(4*x+IJ#4(4CS(4&#4(4&CC(4#84+h;y/)+`q($4+I BBBR($O ##4F4"FFQ(K&# CCH`2+($B B#($4#BB4#($84JVhK+O # #4BCX0ZBGb I JK+ F I5 J I /V!!BG!BBBSBLB}-OV}F4+*+'FW;c+<ݢJRh+ d;;DxF3*/*+cI:F;+IM(`PI Fh` 8(h F> Kh+ JIO0YJ!V!D s FSkK"`KhKhCM+h+I d#+`KIHh \H1F\, FIF H N I Jp@pG!<!x!!ɠ!LDD02IFH * D6̰H!F8x/+$I:I F4عiF F?0H&?0 &1BB *1BB$ FLSDDG9E\Jh3`pG!IFH  ,DK-AF>OFF|hZ(FhpCO M"I@F>BF(?(( 1BB , 1BB*pCO$#`F F>(#" F"Q V986OR0F$&/y{> F>(#" F"QOR!0F$ /yx>f F>F(x#" F"Qn9FOR0F$/yr>F F>F(Y#" F"QONOR9F${k>& F>(:#" F"zQ0/yu> F>07_1Fy FFOZRFFO >PE i f_1Fy FFOZRFFO >PE i i_1Fy FFOZRFFO >PEۮ i o_1F{ FOFOW:FFO >B®N:F0F(k Fl%pQ5_ѷ_1Fy F=FF*FO >B}i /Ff!mIFH  E, hhQhXh?pFh4h`h%Fp(Fp N3h33`#h+`h F3h;3`+Kh+^! !FL%N#h3#`0Fhs56'-#h;#`SKh;@>9F! !@!p$ N%F0Fh+46',(FpZhx5F!@-G/N3h33`Fs#FF*HP+:1')ѫB &H)Wh?xD# 3h3h;3`# Kh K")F Fpp&O 'E FG}V?@FYh v3hh cCh;C`+ hY`  phZ`! !@Q! AQ2|F /2'!#HD!@FF.h$ qh8F#F(F(F F5F8 M(F F`D M+hh`+h3+`Ca, $ F8Q!-AFF8FM+h3+`F F8F#```@F3h#`+h;`4`+`3KhA4! !pFFhTah(F#N8&h$ Fp$hF!h(-G F@%(F=!  JF`HFF`IJF% TIF8F  x0hCh;C`+ 2hhY` "phZ`#HF;mO%NQQ2|2x-CKMNhI+hF+P7@" F"nKxr\ Z[x\ёH#F +`\ЈK'FhK`?\> p2F!F"0 /`/*k* *zHF% a &( \  U;E3' a x=+D 0 F" ?*9*٢:(R 7|*/~*V^*z h2 `$;"q  F F     bxF=*7>* )`*bxF<*=*/ bxF|*F Lcxa&+ F Ecxa=+! F > cx++4' 6cx-+4( 0) .& ,# *$ (F %F "!FF !J!!Q!RFKHh!RBKs[hM.h+` DK.`0FH"xK*F$R"` F"F F$Hhx$Bh3IxJR\ HL3(F!Fp!!1pRdRbJRu8FFF#- dq[mu 8H)04 ~EHSCHO)Ѳ??>H ,#(FF F8#"FJC D@`?  !,CC@?  !A\@C@BpO!!FBrO!!FBrBpBBO !!FBBO!!@Y@C@RRR-OFF x %*F F-U G9F. &*FH##F ;FG1FFPFTMFF F(F!FR!"K𵍰#FF#a,F F;F2FF F(F!F (Р +J9FF F/. TF F F FJ!T &" `!^8 FMh)+8!F!-OcOFFFFO O ,o,x,5,8ZH,##\FF$,w ",1FXFh#+F F NH*'+ػpJH`   D TT'+$`.ѻ'OO6"2FEb3J" F F##jJ F#%#3FAFFXFiP $,F##m3FAFFXFWCCb`.8i',JO6$4FdOFTD8i"!RRR^-OFFFF.##F'+FF F@ F F2  E%"FcF@F FE20F:FCFF F) EFF&FFF--!EP-CFFNh+F F#F Fh+##FU9F HCFFHFT P$$%(F!F4F!-CFFP0+F F##FU1FHCFF8F C(CPO$,F(F!F!𵇰NF F FaL!h숱CxI+уxN+ F'70 !X(a4`aJ!%hF F#H0(F!F!S (-GP(Mh7(L 'K & hh0*x  0;Jp0+k +0+xF;F=FNK+{#hFK(FhF F H*F F FU  ,M1h1`!S*! Jh@F#F/))`!`!F̰ Lx/+HiF><0& F>60 &1BB *1BB  \pFOu(F)FF`H FKX` Fp@ּ F#8h"+mF#0hFHHp!S0pF Nrhr Kha H` F (F]p`p Fp@!0SD-OFK}MkhchyzL #h3#`kh`#k`#h;#`#sKh lh\h"pH LihoH" G lH!F F8FiN"Z09F(`ddK@h3`;x/+oh;F7x*Q0KFBF!FF!h+!h+!h8F*~"!(FZ`$h3I"FF !d -AF F*sL$>Kh3"1FhF$Fah5H 8F A2H 2H )0H1F z.Lk hCh;C`+B B"hhY`*"p hCh;C`+8 4"hhY` "p4H H1F -M`h+h3+` FhF+h;+`#Kh H r oHH1FhZ`hZ`!\VVV`2|V! !VVV8FL h0*xxB%+`h8)F (4PP8FL h@x+xB)F `h84O K"0%h IQ;:0(,۝rh1!l-CFL%dd#h3#` 0ChBh;`8h(5|-#h;#`k KhSCd+0F! !!l1-CF KO5Bt&h3xF+B:*4F:)тtzN3h+j5` F5`F4F%*i9FHF(5F<:+6k$!\1V-A&MX+h3+` 0+#h`h;`  F~00 ?(F#h;#`#Kh e0! 1p!!@0+@h X -O&|F5F4F@FrP9h xc+E"CЂH^p(v(V($&%zHM4 h*@ՀvHvJc+FuH= F Z! FFH.@1F F'F( Bh *R #xB!FXF (-tYH O'-6WH I !@TH$ ?8F g0hsNL hCh;C`+ "hhY` "p0 h,@FAH,F \FhZ`/! FJ0"!FP) E1I)J1HF 8F ,Jh! F:&((H !Fչ lhF#H-"H|-!Hx- Ht H OO~OOC" FO DKh3W|WWTWWWW2|WWbW!\X~X X!X6XSWx!G-OF\MF0F(hYNlTO,:Њ,؀,:,/ ,%/,/3h;3`+TK +Q#MMMMMMMMMM@F 0 *4N4hl93h33`px3/H F(:*$,O FK#pj' 0 ;+۲ + 3h;3`++hZ*`3h;3`+ +hZ*`C+`C+`!!<1h1pL-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`~ci3h;3`+;h+!! !!7Fx F!+$Kh0 0@+*+ Khh(=;S(x* 0; + # "` FzF h{x =+ \ Kh-x+ KhBۛhDKh 5 h+ 0 Fл 6. ">9)H+. *ZF qBQF H!FO h2#&rDCJ :* Ҳ * : "+ : ` "F!! !!0!L1h1lEK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0iD`lh `h`aTF E#x+$Ё+@F  F40H. F@F&p H LEF(TFF &F!!ph!2 M L Nhhha#hh3#`>#ho`;#`+3h+!! !8F60)FFB KjD``b8!) FOF";F;#9F`F0FFih`h(4`&F#hC%`2F6hF#FF5`.F+h+,`F! ȿh1-O' FFFF[غ*Zк?Lк"#xЁ+4#xSE 4[) غ\#xЁ+4"xCx' x۲+E #x+ cx;@& 4#x+ #xЁ+4Bx#xRКB4#xЁ+4;Cx+*+Ё+xҲ*?+[+'FF0F?*@bxB44"xBBx!*^*Dуx-)?s])!*^*5у""x*и/Ё*-bO x+xɲ)@*?P[*FX:) WI(Fx%(FK -x[!FL3F3F"BZx*њx*ШB*xGIR\ B EOҎF( )x)5B)x4J 5E>rFF*\*FF+x-+5kx]+2Ё+.\+,5+#1p(##b(ؿO +F+]*dZE?F45BO F;x+?֮7NF/;NMLx+EЛ] ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xppK&pMԡhBK yc0eO;0+;hZ:`"yp6bK^Lh!h' `^K^K^K}C;`#yp@/UKhOJ!bh,KLW;+x+1#hGM;#`++hZ*`"p#h;#`++hZ*`"p;h+#h;M;#`+d+hZ*`"p:C+`#p3C+`#p-M=x+0 ;+ #h;#`++hZ*`"p#h;#`+S+hY)`xpC+`#pZB*`xp#h;#`+ S+hY)`xpx+ћZB*`xpC+`#pm!L!!GG!!T!1\1pKMLZhVhK3KY;+?$ /0x;0+?𒀗ЃK0 ;+ +h;+`+t#hZ"`"p+h;+`+q#hZ"` 0 ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpYC#`#pRZB"`xp 3۲ + +h;+`+#hZ"`+h;+`+S#hY!`xpx+ц%C#`ZB"`xpO C#`#p C#`RA*N/Kx+?G+h;+`+#hZ"`p<C#`p6_,KhBZhD00B s;?;h<`0;0+ c;`##p;h;;`030?C;`#p!1h1l!-CFLFxOh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1F"Fc FC#`p!1`1h!-AF-LFA,H hCh;C`+&U"hhY`&O"pB"HAF hCh;C`+>"hhY`&O"pB hZ`W&6DhZ`W& hCh;C`+ "hhY`6hZ`2|d>HXHXKhpGhB`1 Kh) Khj3c1 i@ pGh(h pG pG!1 Kh2`Zh:Z`pG!-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3A$! !!1 K-AhN,j3h'i33`@F`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02 i+u#h;#`+chZb`xh+3hh#+BF!@F8$S"!@F8(8FJ3h"`Za2hahSi D!c`FQa1h Ji@ (&!J,+2Ja!h:`*ch;#`+#+p#.x+pK03`hKh.pahi!`!F)o1 !2d2X1p2x L#h;#`+chZb`x<#h;#`+ڽ@1!8 L J#hh`hRhaabhZ`#h`O3 ``#3a1 !FLFI#h3#`"!(F8vN3hh( 7hi`#O`aa K"``#s`#h;#`3Kh@ ! o1 !!F.N!F3h33`8$*H)F8 숻pCO+#" FQ"" F8(F I( F8$H)F#" F#Q F8H)F FTB8 H9Fn3h;3`# Kh +! [4XXYY!FLF#h3#` , O(F}` K^`#h;#`8``3Kh@t! !1 !pNM4h+hh3+`(Bi#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@>p1 ! !!KhpG1 pFNM3hB ЫBѬBHHp1 !$Y38ML+hB81 !$8FPM+hh(+h`81 KhB`pG1$Jh$LcC#LehB %2FE ݖF2R|B 5 b`) )$O30 bhU%b)Ldp/0"Fbhc` !dOr51FRMhB QKhQL(g hCoNH!7 `0'8FP7/GHGK"N 8F8f `0 h AI `; h(`8*hB! ! ! 5O! 89hB 80Jh"F*H 9h hP0;:h"F$HR7hB 0F80&h"Fh h.0h"F h! O3#`! ! `~!d!1YJYS1pum!YYF0+fH2K2Hha2LaC10N% !Ow3h33`B 0B(%K(Hha%LaC103[h? ѻB5!20h(Ї!FH OpO5'; 3h;3`Kh@Qh сBU`p2!dYOr5! Z Y!8FM+hB+`Ї@! Fa+h;+`3Kh8@B8! !-OFFF 0hI FOؐQB0+-і0+k0Fݪ IFPhShBE_  ++ +E 9Ѐ F0#00CE@qKrHhrKr@hZCBG'B "-"gJ!kPFh bJ !0XF[XF@D  Q^YIXFFO .!FDch;c`+ F#h7/"`!F|պch;c`+ Fx#hZ"` "pch;c`+ Fk#hZ"`|"pch;c`+ F^#hFZ"` "p^+" ".J!O#(J!XF&J!XF(OsB "YF 0~XFDH@qYF F :7?# 0GF!d1Or5Z0Z:'Z?ZHZMZ\0Fp@ӹ ; CCDXh PU4mh-(FB! p$& F+OrB 0-OFFGKHH[h x%+d XFXFCAH+&@JQhB"h"D0۱ Fkx+Ъx:-+++%+3K $i ,,HO)F'KZhSD(K!(Hh3000+ kxp?+QF8FL4F69FXF8(j((F&9KC;Ԕ Z) "R,B4HH$1ZbZ!dZqZ-G/N0H23ic.M/O+h!hP0F#+H+H!1h OA%H2O yC1}0CE!Ch;C`+# hY` "pn F+hh"[h*`+ PF 1MhZ`!d!Or5ZZZZ\2|-A'@L=F>F F0s;D+;Hj(p(g(&'%5Khh[h 3H!Fh0KhD/ILCa.H%(FF&y)H-:0;! KC#HX5F# sC8F6XCh;C`+=0 hB̿ # #P`p0B0hB̿ # #Q` O.F(ZZ![!dOr5[$F22|KFiH!H@dB F!dZJiH#;pG2 pG pG!d-GFNM+i+F>Z#+a@F;@GN3h33`(TOhp(`C"! FO>D"F82?b3k`3h;3`#7Kh 4N! F3h33`2K0+#0#63h0/H xC3h;3`##Kh n F0 F40O QFF#F"EPF,`2B03!B *4r@!d! !1pF?JFFh`=K>J` F F+ :K`/h..8KN0+A0˹7LF)F 7r뮹1K)Fh0h}@BF*H0h!F q!F m!K60s!F e!F a!F ]/K"a.!F !F 0+F(7 H)F7( I H.!!!!d1p1Y[*[4 FF JN js0+ ""BO07"F1p-OFF #`jL@FCFwnh+#h+(F00! O2OqBؾ 3BЀ0!H0S?ЪE ?  ъEy?  E"3@D@O4O\` 0`FO"4P"90C09($0300F0!#B{00Kh+K60+""Bѹ*{K!Fhx0;0+N Kh+?IEEEє!!1p2x!! !d"-GF F F " F(.KN04,N0hF7B4h7F F0lh@j"F HO| &@0BڽO0C0C0 F64Д0ոД0#0*F!F8F1p1Y!d$!M(FB` M,+hhё xH l(p(Z($$$ K6 "0 D@N+h!7hh:"FF8F+h*`[h+0h!FC[B!`1p2|-O$NOF0FFPFF FH!Fn-p-H3M+h3+`F 0/K1Fh0jh@DRF(H!F 0+ #K$JhSCJRhB! FT! F`F& :OrB(t0+ F+h;+`#Kh 0Fp(OrB&6! 1Y!dOr5!1Ki0H#P0F -H%+H&1+O0B#(M(hCh;C`+&*hhY` "p!Kh0hPOrFH8F51ZhZ`M F+h3+` F0+h;+`F# Kh F!dZZ`Z\2|1Y! !HKhh@}! FH h@p8L0C1"B ۓPUP-H(F#ca823 !d[OS-O!WF||||0/F;[?"#;W+؀+=+nأ"Ҳ*% " ;+AxMTW[`oCBH>, D4C hp$d5UFF-8F ApG, 4S l)F@FDh(FzF\-ON$M #C0FF0Kh3hHp/r/d/+hx,h#<F F)W!HKXO LF(FSJ h"`%"  5(F@𲀝\)(\+C F5(@𠀝 *Н)и"h:"`*HPFFsJ%h B)(gH(@𹀝%ph"h"h:"`*#PFF-Ѹ"h:"`*PFF F + F + F +xDI0h0F:"`*PF0[=J6O h"`Z|rw#h3#`p3K"0hhV" '+L%h=a"h2"`Fp(L :$MO "hJDE#H"F5!h"0h0LV8F " ((F "!F -L%C\! !\kh!1`1hG-A&yL FF(@0305F50;0#mKh RkKhh-|.u^r#5F0"5kDw" ,c5kDx" , O <^r#03F3jDw!"3jDx!3ekDOHF,\r# 06kDw",6kDx",LH,FKNKILL#h3y@F#y\IF74/CL hCh;C`+Y"hhY`>N$>O "p)h9y@F*2F:F45,ѽhZ`2H,N1O܀yyB*h\@F45,%L hCh;C`+ "hhY` "p*y8F\hZ`)I$hF F4y3,ѻ $&U6A8F !F0FC6.K:F H]1p__xK2|?__E_T_Z_b_4__;_p KF $yBѽ@0(KHY\1p_x_{8Fych=U h8@8-AF T 0F0+р<FFT_e L=` F##qe(FG !-AF1N#sàih*MFa-) Qx)=-)ђx*@% +)2гa8Mc(D (o(;xC,8F)F!)Dih@,a)F!)D)F FKHY]=)FZ%$ K@@,[h+ѽAr!_x_1p!-A(PMȿ OLFO ȿaOؿa3+q sih#ci#06ѕp/ V`@FR@6p0+6060+ЕN0F +60N0*3h#b+x-+#F0%K"y23)*ѕ0ai!i#Hi2hM*`ha bu#j+`ci+"ibq "h`FFh32%`aAh*!Zh*3"ba 1p!_!`(-CHi HhFFM+hBH$OFh+`:hF2:`իh$t;T+C/*;h`;;`# Kh  +y  _!_! !(F#@FF! L #h3#`@ Kih V#h;#`#Kh ! !!x0; + "!(K"Xq`!-OFF8F x+A1h) hc4h%?' $F4`3NJ !KOrJHGp':FpCHFagG aYa|𵇰F F/Kh*F! F=KhBFO ' ' ' ' 'w0?0+0?l?F;+`(%H\(^\( H?('OOA+7?a+W?/٧XCo HM1h!1`KN!!bbb<bSbk2T1+h +5Fo+h;+` ?Gc?#p۲ +b+h3+`#cpF+h;+`{?3+hB;+`; c#p۲ +c+h!3+`ap)h9)`p?GҲ *X*hF2*`"Zp+h;+`3+h;+` c#p3CҲ *b*h!2*`ap)h9)`pA۲ +S+h 3+`Pp*h:*`po3+hBB;+`;c#p۲ +c+h!3+`ap)h9)`p1AҲ *Z*h 2*`Xp+h;+`p/7+h;+`c#pcCҲ *b*h!2*`ap)h9)`ApA۲ +S+h 3+`Pp*h:*`p'e'c?'aKJ\ ;++h F;+`#;F+h F;+`{F\(B? ( 0300h K'(3D[+h F;+`#;F+h F;+`G+h;+`\#; ( 0300k2cshZ:\(`(}(ۉhI²+hA\; 9)" F+`#;F+h F;+`+F$$("(ћ++h";+`#F+*h:*`\"bpFqh)+`#F!)h9)`bpF#9IO3DB:+h F;+`#;F0FrChFF`"Z*ۉ+?t0FGChFh5KB +h F;+`#3Dg9:+h;+`C-%y>(1##`00F`\b0 a)(F(0 Fbb00Fa0 (FNF|(#&(###`(8%u<(>(#&(###'#` `0 (j\`a0j-("``K##FA#*h{( 2)I \(F*`"+!J{+Oh*h2*`pM#(Fz}(FAJ\L8D$h4@ [1}( F '#KbNbb1h!!J1H"F0Dpp9F'F}J\2*hܲ:*`*(KuJ\F*hO= :*`*JDF/@%+:+G#+IO2F'F0 )*hܲ:*`* KO/FР0 *F *h :*`07F0FLHOF%'F,F@Fd(РshZ  G+9KG@HhT?`0FChFډځON+IZ`HOB /}+"HF ''(shhKBш#*`0F0jIChFF`"Z$#*`0\*hF:*`""Zp0FR J!ChF`"ف!$Jb1hNbLKH-G0h $i4&F0h *h4D`h3 b0 khhZBZAF F(kh`Fh+0"F!i"QFI0ij``2TM+(IK0߰h!EK<"! 0AKh@Kh#(P8K:M$!F`6K`+`m"F3I*hj; )3,I)Mi!   2#KF$Kh K`K K`K`+F_0K`K  K` K` Kh+!# ~KK!1p! 2TM1h!c -GM"+ha#u (%*hSi3Sam(v"dd|+h[j;` O F F`` `0( +hi*  +h F Fp` `" Zi2Za p+hi+ # #F` `` ` (+hjiXH  J #`F+hik`a+hi *j*NIi(+ 1#`IK`#`C`+hkai``:*Zi2Za+hk0` (!1`c`+hiZ* nF++h"a(( ! & W`0F[& *h #`Fkk` +hkF``;.h3i +IiIO0O T+hi*" "ak #FJ;F+hi+:+hi * ! 2Tc!32Xk+hF( +hi*! vk 3a+h"`a(Р +! b ( #3`+h &]F` #```! +ha (1*hSi3Sa#;`+#h+ :#4F` K0F ( +*h8FSi3SaF F+h[j;`1p-AF=MO$+h+h (ka8`F+hi(Oi *\j4`&*. B+J&O +hh:h0FZcJ!H0Fh/!FH*h##`;hk#a+h``^c FZi2Za)O0O #`F+h`k`a2T1c8cW-A%"&L0a(< Si3SaF( f"#F# ^F`F` &FWFe``4`(>F##` Si3SaM @VF0F0H51pci2T8!M*hQaa` +h$`(*h Si3Sat+hh+hiHH8 F2Tc|"FgpGChBhKFhpGCh hhBpGh!lpF FFch```epsFhF2f(H4i FF F!F$2p!"FF(2! ! !F! !F 1i*F F3BUKXh8 pG!l FF:)]KO3θ FF]K3񔹈BpF FF2^!F(F2B h(F2R0F!FFH(F2H Fpdr-AFDhF Ol`{h;{`.h(F2, FDF]!lp! N L5h#h(F3#`+h(F3`F#h;#`3Khp@p!l! ! KpFhp-)F F$hfh.аh(26h!lJ$h +ܿ3`h@ ,!bF2(2K2Kb , $`d2`fffg!lpFNh +JhBh ! F2۬B F2(FpPh+ h +"! F%F2~@h+!l!8F Fj(KEh``8!l KFS 0hhB` F@3<FF!lJFhpGhBh!l-CFOhFF;h -;`ܿ#KUh;+ҀB}71FHF2 qK$`!Fh|IFFmHN"!2!  F2-dK0+𧀬Bq"iOr@!0F2ZKV0+5i!0F2CFOr@!iF20h F2`HK"`!h)1FFEHpCO F2r#`&iOr@aiOr@ !h.;0FN0F@ *F1FF0Hn - .0s# 0;h;;`#(Kh 1')F0F ""(h*h*F!FF(F2nFW# F"! F2NB")F F(h F2P0F)FFH*! !hC1pdd!dpF F FHXO0p Y!FFH! F2 AF-h! F2BF -h9!FFHH@H@dep-OFFFCFD#O"I2F8h!!J!K"N-FF3h8h[%I"F 8hIOhB BFYFhC8hIF EFQF,h+$ 6-$2|xe.He6e4e0M8 !MFh2xC Ѫh*b ! F2nE8 !R F2fA " ! F2^B" ! F2VCH5!le<8F KhhBphFhBch)FGh2H`8!l-O$DF 0F@ kKhF`D`` 0eKeJ`0dKbJ`h0B^KhB`+h F;+hB FF8 &!FFRH! F2(hFH FMB F2 Fws+jph!F(d0300 +6K! FhBF22?F5\h* * *.Rh!FF(H ! F2 >h+ "! F2r "!PF2j,h+(RF!F0F0;0#Kh $030:F(Fmh2!l2|22x!eden!!! -O&JMFhO F;++-+jH 8F:F1cH9F  B8F`)hp9C)` TI" F#JF!4+hBOL h`#hX}.r!(Fz{FXHy' "O2XQG* " #"B$!(F20@h)FF0HO2"!(F2l0*h)FF'HB#F!(FqX{/8FF8FF0;x0+x+8F(0BKhBH9FE,JFԿ##Ha |, Mk&t<&|e4euefB2|fe!ef.e!HF F)] h;+Y/O)TZChֲ;C`+#hZ"`p+hlx<+ѫh+h!Fl+h+;+(i!F>+ѫh+Ъh FI+H!FH!F h* ch;c`+ Ft#hZ"`-"pI F FHdhfP8FTK,hh hrJhB1+K"`B`8*Qh)Qh x),!" D" K60+,KhK`!|! !1pFP40J#FH !8HHd!f-AFYCh;C`+#hZ"` "pO%L &(F9FF Fk -?-!F@F#5@-ѽch;c`+ F#hZ"`p`@&M'L+h3+`#h3#hx h4'`> K`+h;+`3Kh@! !!|! KhXshh x)2BpG pG pG!|FONF3h+L[h+Gx+%%HKh+J/H-F,U9,E,P3)cjF F0[+K-_YBYA F0N&DR-! F~<#>,33G2#`"iF 12%$+%KN0+%,% K6 zJhb0+%K60+%%FKN *, Ф* ٓ603)ЩB! Ib #R<CBL!|!1p! ֹ(-OFF%їIhuhI(F(I(F(Okx<p+ OO,EѸ@𞀊H%(@thI FF(@HK!h(F,F~N{h3h33`xh!y` F3h;3`#uKh f4@,#0OfI8hF(@4F,@odN$dO%FZh[hx`H(F4-F8F ,[H$5@-WHVO$lkh{khxc8Fhh FF@F4@,%,?eO$%F@N@O --[h>He(F4F8F ,@F$W5@-,1HOF+Kh 8h(@>h3x-+sx+&,?!7O$IHF&F(HFF(@K:hIh=%xDH0CH FFH%ff f=f2|! !!|LgDgOg:H2xgXgB ,,.0300FF O ZhXhD`! F0;0%Kh<?3?]&?%W?HFY(?dHF(F?,?lиO kD0+ H I F,F(?z$?(;!gB! !|-CFK"`L?'N\#h#hx3h33`kYBYAZ3h;3`#0 ?-ѽC!|!! !pF LF#2 2,D2;+!(FX#2p!|KXmh+(x+ pG pG!|-C' L N131#rQ3@+1;1qUh-hFX2(FAFF(F+hF!|!TK@ 8 !*pG!|8F M\2B ! ! ! \B8!|˰#FK`"b!*5X"*12d">K>Jd2`C :K `j ر6J h3`F81K ` F?*Kd1(Kh&K%N &K5h`-th,#x+A)F Fu`p$;+   1! Fd"""b>*#`" 11!F1P "@S  CC !|!T!! "K _!|8F I'!F F `]8 8BOrOA H8 M Lh#h3#` #`k`#h;#`3Kh8@<82d! !-AFFFFO- *F1F8F1 - FD `h+O0hFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+3 Mh+hq`F3+` hc``0D `!! !8E F?C K[iB F8@ch;c`+ F#h*xY!`p82dKiܿ2dKYiֿ2dFH!FgrR]pGKRi]pG2d p FKFR& ;+Ap0Bd#<p@pG-G F'!Ff8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pWch;c`+ F#hZ"`""p3x[HI0F&7\0FuF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0FF(ch;c`+ Fy#hZ"`'=FgH2dKYi42dL FD@>2dFxr+ HHgggh-Ah h"xh3xB.K=! FhKh0l=!F0Fh?B#'F4F.F<+#x;/0;0 =*+O ,p h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp", ] !! !`1p!hWpF MF+h3+`T+h;+`sKh[p@`h1Fc$hp! !7M,hLHHh `#;0>0h xhh"``kh#0Cc`h#a`5I!hg%O~ch"h2`Ԡhch F4h,5-ѽ@[ՠhxch#@c``&F!"FF BhiC՘G(h3DhFKFh(F"F!FFرCh2CiՐGph4D gh)F8Fn0=!8F D F$hh!4-GO hDF>N+xr+ ''0F`9KhhؐܠKn(p(Ѹ$ /(FZO$*Khh-#"F9F(FG!(F0nk\=+ 6&H Ch#C`:F1F(FCh*FPF $.Ch;CC`0 h- F.(FI(H)Fs!hhlF"FF$ FChY*5M)h1)`r#c`,h<,`,Kh+1 D[xI8F^ch#c`chCb`ћԠh"h F`$! !G-ANO|@ #heh0m:h@FhJhd. F_h+Ѩh!#i;@hh0DGkhԨhDhk`h`#i+a!2P1p-AOMGFFF(FF`VK'h=U Fv, e, f,&x,O''OGFC/(hAF0Ch!(ܽ@(H" h-CFL FH030;x-+F|xEM(h~*hDI0t`3`0`;0#OV %*pHFF(@1h]HkO?@FGs*њx*JНVI(FF((FF(3hB(Fx/+GJ#xh320Z FW(Fȿ- F(h(F0(FF ;I*F 9H" 7K!h4HShx+L${n"` "HF$ FFEѺ&I x)ѺOBoAE?IHJFqDh)!F(F/l0 KXFIO2h?F,,U!(F/VOfjRbjz2|j#jdjuj0z"K#J"v!Kh0=!(F("!(F!$!d'sTdk2k` [_kk[8Kh+J#`J`tLKJ`"Zaa`%he KJL`hKJ``8!!! !l!02T2|2d22x28 K$`G9KO2`K`KS[L(F #h3#`KJ@#! (;#h;#`# Kh #8@ۿL!T1\!l1p! !!0pG8F F8+h)F`h3+`$hpF&N F,G#h*h6 D*`+?!!!!!!&!!!&&++;;;;;88;;66h)Fhh)Fp@ȿhlkh3Dk`h)Fh)Fh)FhXkh3Dk`dh i)Fh)FpQ`FHh;FOK,J`pFF@h1J h2 *D `+2 22222622$044<ѽB1H9FK"aHK/F"a\$8F4pa$-W;DA-7;0;$ $ $ $ $ $$/Flk!kF+O FF xh\(4Gbxc*%JiCsa0*b xF3<7)ؓB0AFM*ѣx-+x4@G^+ F;?+@C^* ` 2FF!KIhKh!`l02x-AFF L@- H9F%##a9F H2F&D,Dj#H3u#t!lL!F xRB H!F H K"aDh"(~!FFHldl!Jshhܱ3`(&2F` FF FH!F0Fp(F F!lOhh,&5F0F)F3`#x"+'+ ex&-Уx+ H!F#;a"` FF F F!l-O#N(-F F3aKhS#S`h%!J!F(F0їKhm-# =4#FOS+2`0,FkFhBh+ѯ\. F "MF(hCh;C`+ *hhY`$ p%FhZ`%.kx%+ѬqM(hCh;C`+h*hhY`phZ`jI F#\*+F0.+"ј0*+FZH)F@FXI`O6DUI FXO40xOعWعBSع%APEH)FX +R#WWWWWWWWWWWWWWWWWWWWE+ػhh) x"+'+@rЋx#H7#;a Z0rzcp"F1F(F&!2|<llEllFxm~PF0~xe(dFO\ O^ rOs0cc"F1F(Fa((+PR,(.&*'(\("(КI  h FA2JՌFe cFf n r t v A M" ( O?Zp(@@Xp-"pa b 1F(FDF0;ihrL h"h0@π#mI Sf!F(FDFm~EmO X~=`I"PF\:hP~5e(x! pOs a2FNH#F)FJ0mPFJI"`hHH2F)FCH6b"FF)F>H,hhx3`s`?vFuFaFQF(FIFs e#1F"FY1FUa!FN8# `hh^h `hZZ[FRF1F(F1f[FRF!F(F'N.B,  Ki p HxQ2|T!`!l hh/\h"-C8OFF #6I  FP #1I "F(?+h*`_h'+HAF"ehu&I8F85D#5<"I+! "8Fd(FHBFHBF!xHAFch3DH b^5D {x?+-+H0#H mmr0rRrXr`rrFI I s(sCChsFhhhH8MN)hq FF F)FF Hp@/3kh0F 5#D|sXmss-OFF:!ZF4344IFFx=!BF F#;QF(Fc 4I F (a`+i-I F;`*I F(HAF(F{bl"I F(7`o1I F{`I F AF(Fhb 61h) x[E F(sh;+AF(FPsh;Dt3h+шNs ss smnsF2#K0#M0#P0Cl# CCCdk#cc#bpGj#ACBrcc#bpG"r#clBl`3CCdB3cK@CcCCd#c#bpG@$ hh/#dBj80]F@kn##cfF@kd##cdFjhK#I..#b#t`"pFFH." H@\F:cc d `d  Be f 8,".F(F..#bp>F@k F8:#bF@kF8&#bf dH.s80B@FH.껂j =kBRBckBcBl"rBbBd"bpGjF@"80#l#SC@s#d#b I.(I ]tsI .v(I  tnsI .f(I  tosh"phF F+x-+5 ##bKI # ȱhԢj* H)F3h2`[hccH)FCh FG p nsr0FFFF1h9.x-.59hyF(F8h#h##`rhC 6(F@-."h{h" #`78 FhJh@(F b8J8(F$( JD(FT(J<(F<(o ppq8FL#h# ##`e`8!pFL&h6FahHb `pDH. HX H)FT0H)FN#hD#`!8;`L) F2Bh:*J!HtH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHd!!rX-OFFFF@F0F)FBFH,Fٹ HDЅHAFD'H9FD HHhM,s i+𸁺j /@)-o6?H-QjW+`ir){]H5h,s{jYzw+k(񐁻i񞁺𩁹𮁸@/k/ʁ?Huh,с(Ձ؁/i2Hh,cP+T@s\N+QQ%K_G0F,GD/O/Rh[dmv,@HiLO%h-@t(F`7Hww:wPw]wiwpwww~vwmww*H+8F,@𮀿H<,@𦀻H2,쮸@𞀷H(,段K0F,ݮK0F,ԮH8D ,ЮK0F,ǮK@0F,K 0F,K0F,H-8,K0F,K0F,K_0F,K0F,}Ko0FzyHHyHPyHXyH`yJ 0F,{+trHx,vpK@0Fl,mkK0F`,dUdHW,_bKo0FK,VB\HB,Q;XH9,LVH@D2,ISH+,EQK0F,I @Fl( iB9H)Fi0*0 ( 1I@F("/HB.I@F"+H+I@FFO3F  2BF!H)Fb3eI@FF(?O3F ( se!W[|@c'!0X!8L!HI@F8F`O3F z( 3fpI@F&F`O3F g( e]I@FFhO3F T(y eIxI@F wI@Fp"O3F ;(` sf0nI@Fx"OsF '(L p0dI@FFpOsF (7 r0[I@FFpOsF (" t0QI@FFpOsF ( v0HI@FFhO3F ( g?I@F~FhO3F ( ga+ؘ0+0HBF)F:iB-HBF)F/+H#BF)F)FX  [E,?)F K E?IHF>  0H)F4HB  "1F F8H(Fp6 I(F K"1F(F S$4`B| |Y9Kh@,l#`O028F&L5+]7 FFQFF+x$+kx#(F"BVxT)HB))IP0;Kh{k"#FC##Y@0C+,R#4;4'4'4'4m4'4'4'4M4'4c4'4'4'4'4'34wcڲ*HHO0Fzg ` P0 zg    @! Kn:f*oB (КmQeppGI,Hɠ-GFF" F 1F#PF,I 9F*H. U HBFE 4!K$"8F1F !FH tX'0!DF FQFS)PD(FNE (FFB5 %7 E{r2ɠ-OF MH FFJH!F}OAF+(#W# `C𮁰IF(H"9FdO [ {I";F=A("8FP2F)F FxNxOxM 1F%Bs9F@((Fl  (iHh砀0eNaOeMj1FCGh9F((F@bZNTOZM1FjA-h9F((F&bONGOOM"k1FBh9F((F #cDN:ODMk1FCh9F((Fc9N-O1M1FbkA߀h9F((Fcc-N O&Mk1FwBŀh9F((Fc!NO!MJ 1F\C(?9Fv(5(F$!ɠ~|Gr\<a -6J06N6O7M1FL A\p9F*((FVL0+N)O+MN 1FBAp9F((F<N0 NO M"m1FC'h9F((F"#eNOMbm1F0( 9F((Fce MMm )-OMFHIAW(ЮM.h.Oѝ0+@G0`+@BxP`0B:0|VaB  `03Fh3SsEbF”FO0 `I"+(# nABxI `ȹI""HE0F&1FF@kh+ FG 5}KO S `{(=ѠDh  F9  `IFC?hx4+]ѝ4`+Yل4`0BRSa;RX[hDkB]H a*  " aWH y0tt|X  F QF  `A? (BХik" F0 a"?? aXF a#" F(kB6H aO3Br 0[@ kBr +H a"1F0&K:F&H!Fh=%K[h+?ɮ!O%FO3& B Z B02FK!F8Fh%#D65H MGZ2e~|Z!ɠ!r~|Kh F0:*F`ڍiBhQ`p0pG0, FNIFh F*KKLILIS" ^KI" FVGI" FP!FEHmCH!F mAH!Fm[>H!F!F 2j;I F.j9I F(*k8I F$k6I Fjk5I Fk3I FH 1I FJ /I FL -I FN +I F*m*I Fjm(I F!F'Hl!R99F\!O`5V+9F FB!FH F@,fh'<Rat}R-OOFX Fa+dЉk)a,\PFFPFYFFYFS@! ` FcJjhkFvjFFFlPFF4VJ@!XFdTI:F FB*{ F!*OKOIPIn4+{;ڲ*k+iMhMhhbhMhhWhhhhMkh:FCISFBKhk{1?I Fk)_hh;IF FhhkBA!F+ {khhKDX D1IB FX 0hhDkB2!F+ b*H!F)O+뉪hk{1$Ih Fk{1 IhI FJIk!F* !F k)!F* !F )O+)h+3&8JK\oF FF & Iz H!F<0B F@+2F;F)F F6pG@pG8Fh`Ȉ؀R[B@[(R[B@[шj\\pbjbkcHkXckckc@@BBHlXdHHJJLLNNmeHmXemeT BE pR uBD 3l#J1C 1 f# 1 `# Q XC Q Rh"C B8Q 2BC Q #T###QFHF4~I F^XxL|I h+h0bhyI FxILF(oM (h+N0rI hpC_nJnIoH* 2D;aOS4(hYF+00F"{hSD{`h+Oq zF౤FJFKFOFNF)ihUHvKI(h+09jh( (yWF!( F 9ƼƜ@tF3 Ba@GFih3Hؐؠ,?,#ih-H##xv2BA$hz#BR(hs:F3F??ihH6GHFPOrAF(h*pHXF.PF ~!dw dx4'  Ctqɠ(-A FIh"`(4I" !i. "T(/I""`hxF Fh'Ih"+ jfC2s3!I .I"`h4xFFhIh"+Ѹ??I*eMI,(h*0#h jh I\ H6(@Zt!dyW-CFFM$OY!IBF @Fh48Fh1FG hC+ LMDOch`hBFN `0bh I3d!mJFRh I!W(7 F@Mh I(F^ I(FX( K Ih*`0 h 0V!dw(7 FMI(h*B0 hihH0!@dIFFH  `-OFF F#  3)+ "   *I0FJF*0'I j (yF(!IJF0F*0 BM,MFtt $ B&z!IHFE)FPFObC#:F0FAD4ODdot~p FF *,KB7+KB@}SB F&IF $KBc#3B F FJK(FFp@*4 F^p@F FH*& F FFH Fp@y FF H Fp)FdictaraynmbrmK !*03(pG!-AFKFF送FFAF@3BF#"H#24HH0@*9H(Hih2HH2H! H0@* !4$&FsFF"`(F+xFO0px+h"+C;3 4`FZI"FH111I &&U-AF&OFhhB$I @|h,!I"cC5cB Dr??##h1FA*M`*{hB `<Or!D0FOpO04$!Q-AF\ FXFCFHAF F1ERB Jd"+H2F+FAF*O4$#!A8F LL2B 0y p("!x#18!pGv0OvO0.єa@vfD`a`A?`(`hh Ch(<` hh +h DBO0( a@vfD`a`A?`F D<,`! J1`L0"DD"ACF!-OFF %J,FO ! " #  KF +L#OKYh OX"CFF @OrKF pA Kpz"CF Kp " CF@d#oHoNd!oJ0F2mI  iH #gI0F83\2 +$+Rx *_IZ h1 V-+! "UHF F0FWInF FTI0F0SIBF0F*QIBF0F$舳HI0F33\ +R@HV#=I8Dg2EHOEU5KOYh"ECU\2\aEF F\2EDTXDXB%X EXdeXdeFD B u B A *FH  #FN]FTF(F!F T!u4$}!xH"sMQ THkh;k`+ (FFN F (0I +hZ*`xkh;k`+0F+hZ*`x$ YXBXAp@pGH -OF0NFhB.I zuhO kBD D t[F"F ??O0rhh9FO**\`)shBh"F[F ??`BhOr9F D rhh!F)hshBOp4$&!8FK"rM"F"Or)F !F!U"!oU!LM$("4!@,8!!ވ!-GFJNFOrF pH1NF(MHrB (FEtD0OJ*ztPDR N0Or! D02U"!oU!=bwDtq#FS BG X2<D I UFtFDh##q##pbhbFhD8H2(F3H2!FL0E@ s2wS˻BFH2u)D:RH2;H2!-OFFF@)GT0BK "$BA""B*Г8H WO FE|  JDTEu ڄH2+8F423* !!(7*5+)2C2+ـLOq y 0@gI  TESE1#LbTH2+)й0FH2++021+2+OH(MH6 2+BHb>-չ6BBH"602!:BFܓ)OPqFRH2;H2TET02F+!*0F#BA~FyDDEBs2s0FA)1_0D\X2"(F!F<M02 HHHHH!>|V-OF d !([)Y/MXb EzNB2BAD2+HBO <ԡE0rD'!* FQF DXDEzB{+й? F±HHH!qLpFe}k3CK#;B2BBHO5(F }pT" )FjF0F CF # H;CI I\"! F%!J"h pG!-O}FFO  YH(ܥH }O)F  8F3F()@CK"I#*(Ah H!#J1FH7T맳KOYhAFpA@0H{K"*lXBdaeJ- PEy`">) DO  !)KoH 6cK23DjH!?@s! D1F]J!`H?@s! D1FTJ 1˹TIK2+ }B\OIg"(F!FMHp*/+-2+AF;JDH Z(F!F0@=J>K>H)ȿF0JAFFRhy*F#F7H&M4$jy[(Os;VCJCKDH)ȿFCJAFBHQFAK2+p#ER접B=3J4K4H)ȿF3JAF3HI2+O-K2+I #F;%ҝ>0)+#JAF&HvZ0)+5JAF"Hl.QE#"*+JAFHZ)! xFI KYF"#|KJAFH @ J4FT @+𙀄KFH"鎅0r X" KEd}K #[bBzzxH$ F  qI{ OiIFF OO3dIFF aO@B? EJUXRF "B? F(v`1ñHF FPHBAACEC  wv ]HZw6JFXEEw]2JO $ !ڱ-J sBFw jORABw'=F  2 U?J'ٱIFE y @@GEyFFO33+1EyRHFFn!&ѹFFM2+@Հ,1O $H#F WF{B C ؀+9@2"DB 7 7CFJFH_Fg EyF#c }K*8H"&0RB cTKvH 2"$B SFO FBЕ1{0F EFwʁ Bs F6uFBГ![JEFwB AF 13)ѫX DEFFu کF&FHKO8FQFX"\2BF TCH BEB ##REREJFFF#3F F#JF!F6CF,M2+5B,IF &FFFJF!F6CFù#6RJFCF!FFHI JFCF!Fh<?ޭHI P "!FXFL&$!''-MmZF !X2[BJECE݀3FHFAF^02@#{ @  0F @F   82+B,@ǀgHJ("Op@s: DB"ZH2"F;VHC;FPF2"FPHC?F`&?"Op@sp:CH?C` DB"2"F;9HC;FF2"F3HC?F{`&?p?C`+?2+?HBLp-CBZLF 2~WHnWO%TN 2)F8Fz)F#5"0FV- 2+P2;KHRH%DH" 2B+}r(FHBH< 2+qTFF|"KC}F!O"OF F0H9F }\" F I" F#t\"! FK2+h+#9FeH#"i2BBh&#iB!#3N3LB d2C0I((.H+J! p0*H#B d2C"I(x( H2ù FH2B1o0"ACE"B0H)FhROu-iA".0 H025;D4$!dm B!ވ-Fi,/iI F HI F I F Nh4h<Khñohhv,F h9F ( Kh+Fh0h9F F( F$G!4@F FFF8Fr `0Fn#`kh````4l`-AFhF F (F0F $ F5)FJ3F)FF@D<`FDF-O]Ki L h)F (dhI K# Kiѹ Oph +`RJOa `0Fv#h`+hc$h !F*h O@&,%h$` ;9FF(K%C$ ]`oKi QlK1pJqH hqNBF0FS%BM d(F`G,R  wmwi S3h+Ȁ S 3h` ]Bv(F8F0+-+  =!HFE$ `#4;E$4\FFAH  w$w! 2Li 8:긹 a 88C 0Hti/k (!Ki[*L *M*F@A 4@#h 4@bh+T?+Zh+H 4AF 3H 4AFH 4AH 4Az!?B=e4`L4D;IX S F3h(HLj h '( OrBwFHT S3h`KpG!|KhpG!|KhpG!|LR F!F  6-GFFF5ILch!hHhS!hH 9F0F-PFwFHch{ chS$h!FFHv !|DD0  R]pG R]pGHR]pG R} -Gm$FiF@H$@(B=H0F mr@20F9F(,%COaF0wH>%,FRFFpHxw+i+o.o+i6gIJF_H%`h! b0F{hOcJCFf\I (08F F'PF VKhCFSDEF x;72pՠ  p/B :FPF:F#` 0B ?;`#0{``0p30 0 F0F :i 0FhJFQFF   0+?h1F H1F8F  8@F": a{_@̼`@dzLͣ8FRF0?宂EF?h SHFzJ0B) PJH#)iZ$+OqB SO h@IAHh*ij2Z`jh`#+`hI k``` #03h;3`*Bri:raLFQ (iFwhw(FwBriBh?h/Fh+{i+8FdTF`.?#1FzhhGF(? ?eBF/@FF( ?=EF4Z?hO fͱ$=IFH 8pF6Mðkhch+Q3H FCp@pGHGOqh#h+0)N)M0F(H kh;k`+$(F>F ,kh;k`+#(F4 (y,"$hJK)FHhhd J+hZ*`x竉$+hZ*`x +Y,n,N,ѤY\B\A"0tHɠ`>z𵣰#OFKNh;`3hFH$;h" F+ !F'N:hڹF F'FyHp#;`-vH!Fv&0F#3h+ x3h+ r(FF(F'F d3h3+cHcH(F"r9C(F',+':F(F'C;FGCwG|7B3hKH,Cl3hFHpC&(F<C3h=Ht(FCD7I X@(FC&%D! pC (H|" ԣ %I $H$ D&HH#(FjC&v(F'?&H!"<"0"4΂Έ#Εθ7CϜz-G FI#F'6Os{H? vFxH6)FHF'BFsHF(Fve!U*Ѫ)lHl"! 8*{o{O3dzg`##`'8F(`H9F{)|{`#` [H| k|i~#*}#a|#cbk}}ca}"+~a#~a~e#i#b+#Cc!b 0#"C#c1FbvmF8H vdF3H#iclCcdfl;% $0+#& C' c( e(0** dR"H-- HF,03#. C/ c1 c00#2 #c"!hbc2FKC D#k"hSCBB Hm&0F@d(6PzДа9FHFR'CѝI"8FIp"Fع1ù11U+ї1+ ї3S3;3U+ї3+=ЊHI F(gЇK&!h2FHF;`S 31ES13#kKC #k"hSCBB yH8Fv@Fv9FHFR'dC&#k뱗!1#!C!c!c1#!C!c#dckO !hRFHFKC ck"hSCPEBVH cAFHF'`BѕA0  O"A0백akO JHx@  0BIFPFl  e8Fv@Fv(Fvm;H9FV%h ik)F@ 23D f2H)FB/HAF:cjKbcecmBF*H.jAF clF e opCdemBH:F@sB @sdZK#[OsBOsdH1"#!e#efIRRaA2RѪ_&цF F hvF%H#k%!h*F8FKC "h#kSCBBH0Fv R1F8F'|#hCk8F!k!"lKC!*F "h#kSCBB HR1F8F' #hC0Fv(F(sFFlFhF" B$c+`(h n3fp #o3#g (#mB  K J Fl@2F HV I <0O3 +`K Қ]sҤ-OFXF FF XFvg0`8HYF9 h#8F DHBF#F @EB H"0hvAm8F*h1hZC&m*hSCB -O%U FFh4m$ Fv"F@xH!F v%3"F)F sil xBKxRьx@,NOtB$x(@ƀ%lOr BfopBBd4O3mCE` v@8Fv#`(F opDBx(y y- My-эy--, y,Ly,ьy, ( %OtB}opDByyHyyxxsBD00+. @ [#  BBxH(1#sp 63rxr*lHFFmHmI (L(1"AF#(11 RF'(  cC(1B1"BDDD(1DD#DspIK@!IJIH +GIu((1C(1D3{+@rxQL 2 =F Or!XF z{  +K; # !  ( ! ( ! "KB"HH.-@- ;F/FF1{ BB%/ ' :F/FF'Pi7>H"@h؀"@Or! 2{1F^ψB o#O p ( ;3h)!h"'-?Ϯ - =FHF"'AF+FO2 'RF|C%qz ). D3sqzDs 3 \ D O D (9/@L[[opCB_ѳ}q}CCC_i`g uOrYF R#0O3 0\m/@π##o! RF+FAF C?o/ B1BЃHDD^R`C@?FHI (5wDDvDL opCQF@FBuuu_#__- P0B? hC`^}`ñFHI (߀DD#D 0wwsw`I F(@π_ 1BHFFHI F(! 1_v_ 3wL opCB|1su|1uh 1FSC/RBڲ B? - ;F/FF' ;F/1BN皹jI <00h+?sFcHa#*P0B Z03 3+ChB?XZ0 qFUHk_FSH<^$PI F(#spDDD% 3 M_FZ0)FFBH@FAHAI PDDwopCwDuw5wvL BOuuu`DD()I (dP-^/h_+?FQFHF`,F%.F;\PF" Vp̎" p`x` J! HH]#!H#J̬" `K4 G %" p 0"Ih %K! "$X `" p h ! D! @ `-O] F  .%FFFP%\B0`pC_@/!0FCxr+ b#`rJcOaT!`FUEP.,4F..O Fl`%F(b0pCOQ ykhhJOaHFZHFb%F,. F%D( ..2SEZEH F%\([t%, F%LO4T` `.`%(%O45FO`_hh!%5F&FhhOr@!%%NFF aj(Xt5p2" F(ڣ"&`'J3F!"!%IF%( h+ F6%" F I F%nI F%( I F%%at$## F ]PXf F@FFpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`PJD`lwhd :  lm(d 0 lcd&`p`lSd mO(e`mKhemGemCeQ BC p`" 54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\|q|pc|cWtFglfWdF^\C\BAXXS BB czgfp j $d$(^(,X,cWF H>HL8LP2PT,TX&X\ \-OFh FF44``h H`Fh`h` `H`iHaiaia jb`jHbjbjb kcTS BB D\5KE'L53#T"#XPZR3B2*5q5pOr$ F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!FHP0F mCxqzqql\K hCKhyqq  """-O FFFFX"!F #x0dKv 98hhh TKh#F2FC!:Osm2F#F AaFNCf0D (F@* @JF;F@A HF9FiFOF}P0 ! E  C  -y ڻ2T30RhC; (oshoy~H2F#F AaF4NC` D6F_F T#0+2 Y"""\2C8 FFCk   0Or @pOh( B   I P0  @B(EBp̀0 vCi+@i# 0kaCiF+@Ѐ #i I0D0 DB# 0KP  (@CECz ڹbi<D5 @DL0@ CiF+}jI"ijH AhKh+jgH# 0cK hkZ2# o Fj bb0@pnh fj   bi<D5 @DL0@'h"F 2IFDI\hu4H(0Kh+K0hOu `pOh(`k kK"`0 5jF% b~`pxnKh Gf#W4P""P"\""FFc'F pchK x+`hF2BB' pch xx+ `hFh(12BBРh(#-AFFFF)FFee0F9FCh`D`@FA-OFHM)tH)2CrK hsr*CG3F*FMCU5D QeO"j;h]kUCF` #&[br #0F MZKhs*FuWKhFBiYQF[ˈ[ˀx# 0 #[bu+ Su&D& F#cMF) 2*s爈voO`FFhF60S0;0 0 ch F@ИGFA)K hC 0;0 0 *FRFiFF k0 tD#9hOR 0Kh 0#Fn]# 0?Q FF""\""""""MFFFF H(!F(F 3F:F@ATL,uK#BrHg!F(FFY(  I Kp@OFHN Mh"7 FF0𵗰FFFoX"!FhF #H0K7## Khr`hOZhJiF F] o`o")-Cp,qEp  +rsEr ҽCF "-OFFFFBBp)Ft Fc#"# 0  [kZ2#F qwKhwK)h 'O@gp :F4p(F ))F #Os60 #OsB0fK@(Fh 0*F0F F\KhF0ZkBiFb F)F"$%F=jFFQF"iIK0hi iIk DE"" nHb(lK `oPoiH;0cL0"! _O#>F F!SH !ȱ[Jh3`0XHQ#"MSH"(Ѱ;hC! *F@N8JPQF0 + J4O /p@OH6H6H("! L0#Q?f!H i[R"##`0IFK@F31IF@F)#C Ox+*H."ѽJ "*"(Bv"P"4P\K rQ93#<FFB2 qB8O##0"F4+ F4+FF@CHCHBK@F tM #"THFQF #"NHFQF03= #"BFF F)FC;COO# F)F#BF Ի?? F#)FF@ 0PiW)FC3C# FH"F+F?? HZF3F Kh+ """P-G FFF@FE&=L ;KhS:Kx;"9I0FGI#"#F=F-K,K#BB7 'I(Kp@OF%H9N"HAF3hSKx- H3hH3hkxp`GKlH#(K"`-"X"P"d"'>T4P`"pG8F M+hkF1 C +hk+h!kFi 2 F8$"\Kh @pG"KhpG"Kh #pG"-OF F )p]K#Bra[bBOprpOy0kB Z rIBp JJhB;IH+@:F+FX8F)F02\%ΈF>IBM` (VC Nv PFr,I Bw80YFvBv N)Kh+ +F:F(H$J\5Bii(h2SC2HBr#JF#FbvF AB~  Kh+?Q +F:F H0JF H0#F> =""TrT"\)-OpF FMK#BrKH2F+FJ00#pSx НBp BBp`0"0F)F@FFFF 3\% D1KBi, Ci~ 3DB"[F;n !@ @;i@ C@pDL"hi#a:k40")F `0Fo#F310"0F)Fo Jhi Jh "T""""\-OFLFXABKEP1IEAҕHKFEr #j"PF1F K h06PFFFF 3J D\5Bi, CirO~ sDCo" ;n !@ @;i@ C@p{nEXF  @ C(ajCH): s`HJs6*FCFkh[Kh˱ZKi kXO ERH*FCFkh.kcLKkh+Os#Dc sFb6 `  O  vV` FVF^EZE%JX h(e(Jh*<&EXF;X I `  OKhr. [HBA  0h B ZE ZFhB B"0"\T""""""-CO +KJFF Fp;FC&H2F+FB$L{F;B2#k ee sJp(FhR#!`0B#@:CO 2FF3;Fv `2(O " Eغ $'O'N(M;h1hB8d1(hrQ+hk#Hv!F>ss210^"0X5^3B*h;h(`d3;`3h*hY1`B#@"\""""""8F K Fh JhR# H*F#F2BBh8""pN3hKMh,hC;+hB 0hr(hr#+`3`pT r"""K"h pG"-OFH0$ FF+F ChGFXF $ K*jF(@Q0k30tk;FOqFB$qI0 BaFL#EAK(Fh+4ДKh+@CE%iR# B#33JC" Di  HE# 0}K!Fhdjh{KBBzKh[oCE=uKFxJhi(D Q;C O O Oa(FgJcKxhiH ! _I  hIoYEYK!Fh|GEۣiO #a8O Q+OZA+OIHKhi*ES7IhC!!)@ѕH0+mV jAK @`@A## APF-:HR(FSc/KhF+>v` q.H-K!`S'9!纱YFF (FGFУi#aS';JF3F(F7` 27i \O #""""\"("-Ot] hF F`+# `F !(0CpL_ 1, Op@(5BOprۼHh<)r+@.؀2C)FOr;k&]i@pFFF:E5Z@Ā<5@D%@5Cql@qCm " B ACH0"bQ@+0-.ۆJ#E@A`##HEH(.0F+x0kqC>uHuK"`67 .Pk#b0+|$.k #O sCOz`w *m4Qm+F:FIF FjP0  ZosC 3jDg n+?)F"'.A k`j(?hKF 0kqCFF0+ ch FG ] FXm(8єH0+-w!J#E@A`##HE.HS(e0FñyI`tHK"`_ W`I`[""("""\lFh:2+B#+r3OB#y1`l2> 8Flhal0Fx(F( KBq  8 "l$hV#BB+r3B#  `8FF F2H F,u[/K#BrT!F(F+MF+Hr*Kh+8+h+3`hoxh$Hb F"HZ!Kh+FHR+h FFHF+h۱jF 8@FH"E o+h+`hFH oi8G""P"h\"PDfqXFFFE/F1FJ+J,Kp@OF)H_'O>h&H&J;A1H0+ #  !F(FKh˱IOr(F4h#p@oH(;h+ I" K`j"P|"p""H""0F FH# !F(F'x) )HK+0#p#䖷K-OhQF FC$%&2Bt@2BB7̒" F)F0[FFFJO hR BqFV! .8 &^E(^F0Fq#FH&x+$%F~ F)FxF+5DYh0!S FBXhq~K F)Fh C `FxI0<\%Bii(QCL|hȡLrбPFs08F ,eK h*+aKzhB#B^HAF0+[H%# 0zh FUK)FBO5zm 00ABq" C 0;j;;b4$;4L3B2$OR0;09Kh2Kh#FO  pCO;г O?гO$#3pi[Da$OO8F F)F e KFXF tQ8ц #3+?ZK9FhQ#3pKh8#3p""T" U"0"""\"""Ox #e82&0  Ym   +HH @FYF O[!Oh AQ)J3AO%Kh2rp F)F Fb(?oOxd8 08a8baXm   +HH @FYFO[+KPf"p"-O"dKFF`h0 \F1JBii'UCAqh|MAr{N(F0i F uKh+Ȁ3h+ȀrKbhB#BoH9F $X"!pkKHFAF90gKhF*@h;*3*X+XF""X UKh*TIOrXF4HFAFue#pX0+ #  ]EJ;A1,RbhHF:KAFBO5{m 00ABq"@0# 0#j3#b4-L34L3$iB$hOR3`#Kih3hiFi&H ` `3h+?8 !Fi0oPtUdZI"l"T"0"" U"""p""""\-OFtKFFrKPphOpJX- O0`F!!O O|Brr  $XFD XC>A ,vڍQZF `HKhk 4X$F(FXF# ,1F5?  #E$00F I8BFx܀*#hBFx h  *DBx ؀#nH:2P  (vF(aKhkXBsZKh+X 4"[FPF FPIF@FF h!F FF+V Q[{F(BKhkXBs;Kh+>i# 0i#aOF;ѹ40HF  nE)W 4lF  U)YF8FY$RFFLiC$iO #aKhkF0F6fO #9/93U##@ :##""\7WF!P $ $H$H yѮF(O HF IFH sFFFF FFBx+I3F*F p-OFLMF!hch##hHe(F1FsBFX#h %HH(F M##r#hkhH1HHBH?M#is#hH(#}H#H.#h~H'S#h|H F#hyH#hwHi3#hsH hqH thk"1 DB # ###hOzp@DT2OqIJ IAq YRF+F@l #"d  #RF+F;FJFhLHch+# 3Bbh[B#S@ P ,0Ozjz4 Z 0J HDJz8 VCf(D-JzH a j  #SHJ#iSHFN%i-@ #l+<H8N%l-@ 0"P'@Wl5Zy<CpJHch+r%%d%aedl(FhXORfhnononFn#p00#0 %KhjBPpW#0#z0+(H'K"`l+?h#h$H0"H@(?XHV逹 #B"IH!8F(?G#hH!b%=#0F-h9#0Fx-h@@hp5w"X;\-OFH0W+zE3*s̀2j(F9FF cJWaJXA +q@#[H=[Kh+xZHO PF3j(O 2K1@!@ C 2A4E pN$K`$H#H(K "`# KT``hE эBBh``BBhO X""P"x""`""Kh @pG"KhpG"Kh !ApG"-O=FFF2IFMF@F+h pCFCFF*SIp`"`I"(V "2C#p = I(0"`IX "(V ѣn+ЀHBFKFH(@FIF +h;zIOrLwI"wK"`vJuJh30%45Br  k;B2JBr OѶOzfKh+VeHRF3FP kBBS;B2^KhKpO%\H( IF@FSK-hhYkF-O,MKHh^kPKOzhH* F##EKhkXOrJp( F/>Kh3RF@H3FP?HBFKFL#/Hpn(@XIFp@F}#Kh+H'IOr% 0K_M@ O@Kh*q$Kh+mqJ3;)sfңn+cKjI h[nXF8H""""8"h'H"""""\"TN"P]"l"""ꄗKhKBFUKFHIF@F2FF(0Kh+v _KI(5+uBzpӄJh<.zi3 h+Z2Cd{K -hs(F w O C0pKh)pX@ F\(?hJdM3A`X(Հ o(@ɀ]K`]HB\Hg(@Ā  fn+JEu h+JE@u -sۥ  %) 5@t 9kC3PDC##2[0Kh+? YFT#5F0HQ+0;# FF'HYF{  Kko  P4CKh+?g  T+VFHYR+)  394KF F H"T""\""p"= $Kh``O@V  F##pBFKFJh3` Sp+h3KhOsBFB@FIFOrF g`guK*h *F`hd*BРh8e*>Рm9F F##H0`+hcM+G+haKh+AmhQQ/WHBFKFVHhUK"`#p o`o`n@FIFMK"hB OpC#eF @ |+hBKCMhZk1VsC3*hDj*vѠnRxmFM(4KF` pO h#H0= kKDF*K=J:hU ,m,<5@%D5@%BplIm@p  #C@ C   ;bQ^Ek{h8FGՍ""""""Wv"""\"FFBE KFHBFj3Kh3H@FIF[+hFH0+?#"#@F#IF## H ( kfI""PH@"K -O'MNKhjB2Qk'0HHTDLDNEpBufX"!.K% K K 0$jBmQK`0>\Bii LCNTi NtHhNrcEr0FF*FFBO*NA~1hD9a13A B-*F#FE-CBs2hD;c34C Epu0 FkCFwfJ\5B d2"hfLBr F0i@F ^Kh^Kh*T+T\Kh.Wx@&ZO;hNKh,QFFd hC+FSIJFRH#;`PKh+`OKx+\NO0B;3B/5sbF1BAr2DTF XF F!K'h C5@Tp5$@CO BB02FH#Ff3"T""\"x"p""0"""""P"d U",PFo0MHQF1 9FRF0F)wL8FCF1GBB:HYgCtL4Bq}EvE?xBs$c&N1h PTxhoi3hD"Z`]8F#FBB?O$@@O EBOFM2o&F( F HQFuBrҡ PDIF~`$B""f-OFiOTF *@F"8F!FPJ(OݱBBtJ  t hB "O-hh B4G""pG-OX"!8O#P0$6KF&F4Kh4K`;hjB0;h,QFFd pC3F)I*F(H&#0EF:h B6F-t% F)F*FKEh@h  )F F{x*PF5Dot"\-"`""""h hPk[kpGKh @pG"KhpG"Kh pG"-OF袭$l`.TѧKh hF`K#Bv0F&Cxq2CCIF(@׀HF1BB FJ Hp(h& `0ñy+JH[(#q&&K`K"`2*syIOrFis0+##0#0X0;nKh#0[0( 2C4y3#; BQ۠!/F*  hDD*F n!B:BF F.0"h*ҀEIF(@ȀF y*G7@wBpyO j[E|u ")F&(\FKh3c  b5HS#"3I*p(**FF2͵BB +FB#00OR'K'Lhi6&Kih2$KhiFi# 0 =#T#(FF@(ACq0D;c32C@ pa""T6"\""""N3h=,AFFd [FI:FH#3` H 2 "\Bi+iACB FhOBr8FN& i(FK h*+𚀊Kh[KjhB#BІHYFV0+~H# 0KhK 0CJ0hC~JhCw}K6hhxK\%i0 < kOBii+WCL hwnnLr  @# B@B 8d< * C B1Fs#ZKh0+"##h;.@j;[Eє0+ـ+?f2h)Fie_0h5O0 2 "\Bii+yCBh8OnBr8FW2HYFO0K0hh{iK-Il(_K!hz3hinKh#i20I\%B JO\%K0hhC(KhCE"T"0"\"" U"""""""X"$ 8"""KhKiKh0\% < ́OBii+WCL hwnnLr  @# B@B mBF88D02#$5+ݡk8F#j B#jB#+kB#.nѠ "!萹zKB jhBTimI, rIV(RЂ(FoNzkKjhBThm@B h0F# 0bKx+@\KB@𫀙DjhB5qmI(?mVI@a(?fNKjhB5pm@B AIDK`CE CkhCE5sm[]9"6B܀&:HkhBCEvs+n[CE c]9'6O 5r'IkhCE mF[];A  9D H7/ѻ\&HO 5r'IkhCE mF[];A  9D H7/Ѷ @TK`" U"0"d-O 8F8F$Bӽ!F@FNg  HFF_E 4-AVL-#h 5@`%#h#*A6rS60RhC-0+lGKGHS%#hDN!hORiD4>Kih0#h3%3M+h+G2H!hOR+L 5i#s 5'Kih&KhiFis# 0 F F F  A%HK-F 0+ЅK`H+h+Я K`"\4""""P"KpG"KhpG"KhpG"LR F!F x -GFFFT5ILch!hH:hS!hH. 9F0Fd-PFmFH ch{ chS<$h!FFH "DD0  R]pG R]pGHR]pG R} D-Gm$FiF@H$@B=H0F mr@20F9F%Chn_?I&pABHH"ܰ""|"P"""\ 8""2"""T^Jpkh]C U! Dsn@WJIFF`(FOS#aRKh+Tj092"\PEi!iACB FhDMBr(F)ki+0iF(;h in0#i02Ii\%B\8h)0+Kh{+Iu*M8h)F(J0hC'JhC9hORib)hi_0iFiJ# 0 0K$pH=h0\n &.DB(FU+Y?B9hAPF"""X 8"TL"""""KJ-OO O3` KFFHEhlP)FFHHF  0!(FK(`hl4)FFH pC_ВH)FH(O KLx+SЅJO3`#hHH)F|J#`J#OOQOp`J 0a J 0a lOQaOpl{IF`OQOpluJOQaFOplsJ`3йРnH!(FdYK(`bK"hhC)FgH$1F(FNx IF0FH^H1F`PJKh *?D0F07TJ 0`PFIMOJ+h\(O Bѓ0+L+h 5(O @6K"hh*TP+IO9Os9K"hhC 0Y 'IxJF(F hg0/H)F0#+H)F*IP(I('H)FP"H)F`EH)F""""%""P""""""X"\";4[4"T"``""iOk'H)F9уH)F`H)FObQF8F)"ŒFFːF)F0ŕuJvOV (覺B% 0OrA[FJp@lH"(?djN%BOhKiJiIiKjHjKjK%I O O2F(1ܼгJ BF0DR 2YFDF "CF)FuېPF3FI@pR@O ۛ # 8B%"Ś@3`5緛B1h9H8H7HV)h5NOR 5i#s 50Kih.KhiFiO # 00++h%HJ#K*hh +O NչEKh+n!hJKH)FF=b/V"T"4Qj""""""T"hCNH)hMJc@SgIKg 'jkCC wC?Ko`O~ @w"`D BwcD0 G+@ؠ0+k0+@+h0+#h+(H)h0F0"!Wp0L%P%Or0#X30@F`QF)hOR Kh#F # 0M""|"""""0+7#h+EHI)h"0P%ORc0#X30VKhRKh#F# 00+?X+h !1c#{HH$(')hOR 5#c# 5KhKh#F# 0+h0+(وHH( )h#,OR0zKhxKh#FfU# 0+hkc)'sHqH()h #ЁORcdKhbKh#F:)# 00[+hL%2@+hL%2@ł+hlkB0VHo*hk[Bd#h+@RH~( LOR)h~CKhyAKh#FCJ# 0 0+hl[kB0>H9*hSk[Bd#h+@ʂ7HH( OR)hH(KhC&Kh#F(J# 0 0'K\BF \CS(Q HF(@*G#h+@H(>XOR)hKhKh6""H 8"X""#F_NJ# 0 0,+h, ,%*@0%45BB1зH+h0u4e#h+@^H( ܒOR)hKhKh#FJ# 0 0+h(0+8x)5НHT0++hx"<"(%#h+@(H^( \OR)h^KhYKh#FJ# 0 0)h8%<5lCBB4}H+hblCB#h+@qH( ܑOR)hkKhiKh#F_J# 0 0)h@%D5lCBB4]H*hlCD5#h@+@QH( XOR)hKKhIKh#FVE?J# 0 0#00+@;0+0+@/+hL53@)#h+5H~4J)hh3`#L5#P5OWsT5OcX50-F^03H$5+@ n AHD5LDl;D3DDi@OR0` Kih\ KhiFiJ# 0"X8""Gl""""" 0uH(^H(KV)0Bq~H+h" #h[{H( OR)huKhsKh#FvenJ# 0 00+?=AiH#h+0B۱C1aH+h #h;WH(!tOR)hQKhOKh#F.JJ# 0 0GHN#h+DHF#h+@H>#h+4-S ?baE0Z9H9K*F8HFKB F"8`"BR)  B%H#h+Ci# F#qcq# 00K"`/Kh/K) OrOb`0*Hf-h)L 5s7 #"''pY+ɲ.kp03B&!p"H@SHB%xO ! (Fj>K!`F(Fj7K`(~nH"JO #p` J`J^|H"" ""*"h"VKh IpCOس_гOг_ Kh H @OPCO ""T~F4Kh4H3I0FF Bt0Kx/Kh+.H1F-K p,KxD&Kx+*H1F (O(M1F8F'Hkh;k`+(FTIJ ,kh;k`+(FJ (y, Y,+hZ*`x竉ս+hZ*`x +Y,n,N,"P"""X"HɠpF KFFh H2F+F!FDHi p"P2KOp-A$-`/K`/Khk9Fke,H,KOaaOp @akR($K9F$NaO @ @afI( F( j9FFOpk4F(,(Fj|3h4Ean`+`5`]`O 0a,+ѽ4a"""\"0""-OFAKFFhHZC;"DRF8PE#F6HJF6NNRF!@F3H'=FUE JF#FQF@FF(8F AFKr#2h3hB-K(FhIsB")   DOqOrAaF FF HF73hDD#H<""1<-OFFF8@3RFDKEK"`HBF3F%HE O 9FDr# zB(F0HrH0DD"@F<"-CFMi Fu3K i3Oh2I#B9F0H#i%0F Pea#i*KBF)O,F.F;kL0B F#*FIFHF'8hkL4H$BrAn  @#B CH@IFhH0#*FIFHF;h4kD;hPB"r~""\""̑ 0}pG-AFIO hMn #;hCC3;`2BBK!Fh H{h2F3i{`+Fh\e`a"\"\""-A F!MF!I,hBdhBHd  #F >CrBB$hiF F2 F`Z`+he`#`+h,`\`iCa""\pF FF!X"hF.hFep FhF)$ H0+ ^ Kh[ H~##` HFH(##`H "P`pF N Mi3h)h Kh32hi(hp@p"\""K"`pG"8FL FTBu H K"h Kh0T1BPhH8"""\4-OFF eFFBB ѫ3C F=IOCHFAFx;+3I:F FT"YF'pnEEOHp7$&KeiF+$ Ft!F;FF/"G,Be3CK)F0FeKiF=#0Ub F?#<79FO;\hyѽ"\\%[K-CB}F F@𩀐0+)U h#O`j(`(hOHOb!FLKhLHPKKh+:JNL533h OxO)hFOHhF Wq:F3hIFHFiF"2 E[!;3h)hF(h:FiFWp3h)hF0#0#04#k$ \3#j $0$bj44OS<$j8D$ @L$"#0H 5L53 #P50"0#"# }T"T7""\%!KB?ѐ0+; 5044b303040 40 5 5L5?P%P% 3WqWp OrOrpGT-A0Kh+@J`L h(ڟKhA񤹝IKx+<МKh+8ЛM+h+QКHlKJhhKh*Oі *KFOPFMOR1FitKihqKhiFiI h# 0ZM& hO)FiMj h)Fij}h B9iB!|H{H4(+h+ФD)F hi6j(FjEFmJ#ZM`lJ`+h+D^O;h0>YN3h+4eH+h+49hPM#OR0ci #X4PKihNKhiFtid@I h# 03hKNHMH((`KKhJHJK3M"`OR6Kih6Kih5KhiFAi1'I h# 0:Kh:H^6K M"`OR"Kih#Kih!KhiFi I h# 0)Khk(Kd e1FhC2F)FF$HB`Kh h""""""""Pq"\"""""""0""""""T"\2-OݖO>hkB۔J Jax!aEr F@ @ۀ B@ǀ(FAF \2F~HBii)HCBryIhPFuNBrU;h@F oKh+3h+lK B#BhHIF;h(FKhkOz#FRF,EFx FO6$$ O<4O``p Y)F FIBOXKB B!H!Khk H# # '$\ " h*ۨmK@FBH0Y0C@ H( K` ""\Y"P"o8""pKh ?pG"-OFF FUBгi#a _0kBOrtB 0 F)Fk\ @Fi "FIF+FGB " 7#FF#$BB-#! FF[EF F^E0#0 "F+F0kB [i+ H ^EBi#a Pj^FF F}"\-Om` F" FFF(BF >FEQEF 22BB3(##2FHvKhHJ Hw(K` "P8"-AOB F !+NFFn3h+ #OsFC(F"# M+hkBFSi3@F9F3hCKix)h" i"aORLi$ Kih 3hiFi# 0""\"""-GFiFFyFQ F;PKhmF8F FFHJHIK` GKhFKhk#+FiRF0F" i"a@FQ F9H&ؠ0kBOruC0(F!FkiD#8F#`"HFqe K (F#!F#"CE i"a*F8F#F 0kB[i+ H4 """"\"@K-OMFKJF+hFJCFDزr'S6 @QhQxxS+-!8!!$+hIFH#Kh+𺀐H4+hx+hK+hIFH$#+hH# $+hFp@O +hFwH##JF "F#q*hkB Yi)>*+h#D +hS60RhC`HIFpYKh+X]HD(hAF+h "#F7+hkB Zi*APHQF=iNKNHNKFhB yCE Hy0BѸ*ˈBCHIF#' i#a@>H8(C( K` x"\ X$""h4""["P8M+h %3JLBH#h 8# #CH +h##CH #h+H H( 4  "\F^"P pG-OF FFF)F@FRF3FFFj`#"LDO O` FE`۽ #  qD#H -GF4 FFF%! F@FKJOF#` #q!  # #!F# F 3F mK": F^^F :p FFFn2Fg2F`2FY2FRppFF F((*Fmep-A @EB xA ҍBt Bt ҍBt Ew   Akk@P!BBh-OFF"iFF%@B7K@217J7H^cBv FFajF  ]E"  '@\FCFHFBYF#bh D=Dg"i 'XFCX CFHFB)F#bhsFGBv>FFe|Wi!@BK@e1JHcBv F5FQJH1F FY K@?QJ:FCF(F (, F$3W-CFCi& F@jFF3K@OQJHj1F(FTQK@QQJ4DI JF#F8F(#AF8F#kF2F(F(FIWK-sCFh F N3hBF HKFV0hKFBF!F p"t"K-sCFh F N3hBF HKF20hKFBF!Fj p"t"'KMxQH(N$O+hmB(hPH H0( (hJ2hR[m8FS4Rh4""xW"tL h@j $ hO##`"x7FHh(j,)F0 F"x8F FKhmJh Kh`# #BB  8@n """\oKsh;+nKԿO@bO`b`kM+h Et`) fH{fH(W a)7)5`Hj]H(]Hp)h\LOR 5i#s 5#d3#a3TKih~RKhiFi# 0#$F! $t#|3.h e2# FF!AHH@H9H))h8LOR 5i#s 5#d3>2Kih:0KhiFi# 0$*hd3+6Y)6ؒaqK+-HH (?k!HL)h#ORa3d3iKihKhiFiq# 0$+ FpHF"T"t"\""""x,NfI"j@ pG-AFFFFR BC !F@FdHa` ?88F$"A𕽽-O-#FFF3 FK  h3SB/F=FыO:FIF0F,CF!шO;hB)@F(<# F#O3 #BF??F1 gGl-t-b- F+0rI F5 FAF F Fx#AFF ;hB Fj  #B;FPmEBF WI2F F(F5N9 FIFbF!MI2F F1F FTF06PBPBAI F7FNF HFhIF FM?F7I FMF+s$4";R; FF(I F; R;F!ISFBFIF8F F01F FSFBFIF F0?sJCF!#I F%###rY\4<4A`~d-CF jF FF'm6BJF)F F*F!FCkCCc@FC:F)F F7Ck#Cc#-O F FF 3BF1F FCF ѩKhB4ШI zmb/#A/%L/СI lgE gBO0c/i/ (F0(Ff (F#@4pCO!,FO  F  nh! FF2C-~I F|B#ѳ{I80 +`b\ $ F( Fj gH<dI FPNF0F&g.3x/+0F3F]J]I(#$fF WI F0HF!@  FQI#?HF\7g.JI.0.#sCOsCI FOr1FHF/B F(p F0ѷ"<]&|V#5(H4""gBFF (!FFeX#vT3#3FHCjje? F@e:-ODFFF,Ӏ# BfEx H Ep D>8F_I$iBEBiEIEx(- 4ZRIBF3F8Fea#bcb(-JKS -II8FFKHKS%0M$}(CJ#aZFKF@F1FcF(]bCb#@EBaiAq aeaa` b #,FMT@ EsE!iMa%aish%#B bLba ciCahaeaCi,aa a(F I8F4[ I8F F #K# ##2##<-OFFT, u-*F#F0FYFC *FF#FFiCD*F#FPFAFC*FJ#FFiCD t/_лi+@:hzh*r[REvz f # [ b X CEy `By[X T,u*F#FHFnCС9MCUD  O"O BeF8F ,u *F#FB #C*F#F@43 Dc kF ?ikF-OiFFF۸sIXFS^pI:i nIY ]JE3i;a3i_a0F9YBFJKF T DDTEB𪀝Bt  RFVIXFEO4%FE2d RJ2#[b #C F)F@FIFC BFDKF T DD#Bt-Eiɱyh[O8hbiDk -IXFO8ag.pa#[b##[D#BrIKi IGdBq I<a#d LC3i;a3i_a0F3E{TFx#$$,$M#$g$$iBpGipGipGF-CgpTE CEr ڀi F iW BE~!!bl𵋰F$! FF8(F IO0 J !v(ȿ  Fܿ# 4#$IFK"F IH$| I H> M NU40F, I%p%% 4:%*"* I7O0**    &0@pGpG *8F FF +2711111'1) *,"$& 8O0: *"+J@!H( K F I*F      JR#0  &O"|&T -O3OBFjF@aI0F%F(Fh\JBFBXI0F Fd-O'F#FFFFjxECFoFE#4+GIBF+F0F@F)F$4"OFNE FdXDPCBzOEF  34+ݗ0"+I+HZF@!~(KBFIF0FlAF 0FGC28H#)FFj$XC'"FjJFF5EBY`E7JR#0&VEW&&"| &&O-OhFFF#O BF9F0FBFфKhB(F !(FF2C&{I(F p, A,f,vI `F F s,# (F 0O #jO (Fi#.??4jdF_11 4+ Jݗ1"SIQ2B#RK0PIJF(F!*** *0______________2*@J@!@Hv?K*A*cIF F(F+mV5\<A67+3E77]𵏰F FF!4"hFZOK :F1F(FCF KhB J#iF F) iF F0I x77<5tKSB@pG#-O(F FF   BF9F0FCFJyKhBX+s F'`i+Ui+RBBL # F# #F??F1 F FBF3F! F0?! h  F j!(@ I FN<5889+9?9a9x99::98F 4+4+KI F8 4Z` 4k 4Oj 4r49`d \!0FJ0a F 4jP4H41j< PFIF6 F0?L 1+I 4$$j j 1Os1 FiCF Iv O3Bx ? [1qF9:Z:x-G% FFF.F JFAFPFLC/+s F!xi+TOsBBI $KhSE#SV FV-N(.a8 ( (!$I  Fq0, F&, FgH CCi<5::pO F d  HbC"1 D!"2F)F( H#0#F0H 6p:D0|]FFF<0F5I:FO0`iB$i^Oa[R9F-H%j#+H#"$4#'H#"$4$J+F!'!!J>+F!> I">H`J!> >HVm#8$!HJHH #SH* |];';?;V!`d':; ;<;" Kn:f*oB (КmQeppGIٽHɠ𵽰FFBV(t DfCH=@V?H?H?H?H?H?H2C7H;H!j| F1![R,"" GBB;04(,H,Hx $!8m#jF~iF'H=#J!S#FJH1+є1+HFH=@KJ(FH=@;f;m;w;`R``;;;rd;.;\;H-CF] eJeHFeJ bH@cH&(FpaOF$ F ]#8F &# 8F i.1FHF#!#"ji &jGJ!"3F!EJB3FB"" AI""F"?HB>H9J!BB9H9H$O O2"!(%$2"(H m#8$!y"H"H #S H$ifHbOaV@F#1F#i"jy ^I; ,;;`d';<#CZKhB!0FiVH"50Fl( `( a8 ( #u(JI F FEE0Fz00F+EE+s0F,!xi+ 7BB )0F-i(J (H'J %H%H0FF/#@F  #@F iPF ~#)F#:ji r?iHF<=5I; ,;<;=4=0-AF FF!4"'KnF 7Fh3ScE2FF!K!N2FAF(FPCF<I"8F&KhBJ;F FT*l*H O09F F0$ I  F0=R=_<-:5Q+B@+pG#𵉰3OF FF :F1F(FC(+s F!`i+Ei+BgBB<ԱKhB# F##")a8 (!$I n F0, F, FHQ i=<6:IpG{ {S{{zzSzzӈhJ ]>@pG FhFF @وzrYz  3 B-CFF FP Fz Zz  ۉ0sxs+x'F"iF@F#*F F9ipBsxl+O&F"iF8F︹#*F FqiZC7/jF)F Fd67.-G FFxs  QF Fk%(F 7&I"F 6 5  3 2 1  . ( ѝ0 00**+DONF9FFP#c˄QF F"  O5>3pFpL&"F@!hF6hF4G. pFL%O#1F8F4Z=>kpFL#FD F5`ir)Fp@xp-AFF4443309FhF$ CC00#@c0 HODCFI(F( F&F2FAF F& I(F FO4R IB I3F(FD F@>>z>>>𵏰F FF!4"hFFOK :F1F(FCFѬKhB#JiF FFpcFJiF F< I ^FFiF F07@<Y-68FFIMK8SB@"FFI7KSB@" @pGpG-OKFN FOF2F)F FHF3 ѨKhB ЧI ?Oo+;hF($$*ڝK!JHI(ӀHFYF8FF(ǀ8FI@(⁐I^F(@ہHFI(Fci;+=F(4jOs}I"F&(OF1+jF({tIZF(rД!(FqI$(jД!(FnI(bД!(FkI(ZД!(FhI (RД!(FeI(JД!(FbI(BД!(F_I(:Д!(F\I옳%YIF(FHUIF(FQIF(F쨱MIF(FXѝF )F@FRP(FTCIHFa8FN0  4k;IRF8FL(6i8IBFPFB(5j3IFhF F(, F ,J!8*I F((m%K!%J%I F(#I"FgB4&|<6T@@B4#j=C.@C:=n@AAAA,A;AHAVAfApdAzAAAvF(?bFF(s5jO h$3j3B EIRF@F(^CIBFW,F(VлO>K!>J_>IZF|(IC"l0Fn"l0F!n~0bnl)lckB(F<h1+#o˱!F(FG0mI-QF "l0F!nR0k0FmH0mD8WaXjXrknX|`XXXX-AFF$ F8FnF(FF`p1FF8FhF` F$(F, FAF F(I6]@-AFFIjFF@F( +&CFO08FF(А"!F"9Fk I0F0н0"FI@F+ FbdiF0 F@ FFF0d#`O0BFX?#8F"FF(F2(! FFFtF0>#`O0BF2?#8F"FF(F2(! FjFI4@#`O0]pF/IjFF(-K!-J-H-I F.XFŔ) I(FJ I Fa pZ3YEYZ=ZOXjZi7 F F0J II(FF0K@A J H0 F I KF>@B0E*X|ZZYXj7 F Fy0J I0I I(FRF0 K@1J HI F@B0E9X|ZXrZYpIF,@O5#`(F$p~E@-I (FanFIF I+F0F0 I p IjF0FTFI FaJZZZZ䀐iZ𵉰IF8#`O0 8F0Fa-FI HFI3F8FP0 I . I8F%V0I Fa(F`b[[i[6FXCHHHZ][D[F 𵅰  YIF~0I 0aFI`I(Fj0I2%OBȿB Fa  1F8F 5 ix[R[k[`sFFAF` 1F FE0I*F FC( ^ [8FICF(F$0 K@1 J Hx) FI raJ 8ZEHYZ=H [ IFjF0 K@A J Hf I F0H &[YERYi[ IFjF0 K@A J H< I F0H &&YE^Yi\I#jF3I %]iZ F IvF0 K@1J HI F&@BZZEgYXjF08 (٣a*أWA*أ=#`O0F"!nI F#G0I i[6pFIFFXFĕ pIjF(FmFĕ !hFIFF0FF(F@B\ ivp F!IjFF0K@fAJHj!F(F0O0 p#* ]BbB;B2@ @e !#vF(F I FpF(Fl@BC C\YEtY\رL ! ! J H` "F>IH[D\\,_jFIFJ@0O4#` F F"CFIH^$\1E~`*FF J Im!HBONL!(>FH8KI"F(;FH3FKlƹm!H&JKIDD(F"F H(F Bsh(FG6hE\F6\:\@\a] A`pGA`pGA`pGA`pGJF `l `dpG6JF `Qm `SepG6JF `m `epG6JF `Ql `SdpG6JF aQn `3SfpG68FFH0v#`O080 +$ A;+f#M(F>(\ #,T 6+CK \"0JFnpG BЀi6-OTNK @@ D`Oy0FI  DJgI B7I DD@uAvB;L5FD0Z7IFFF'F&F%FF 0KXxF Bi*i+8@U,BB" B@FG(!@0 D02KEB SEI LBA@FG(By @F^;e6g^"0-O]FF_BF 3FF}CFѕJI O IF AF(FFJI0"Oan#Jk0n9FHB"9F$jI$0Fv0!уH$"9F$jI$0Ff0(|H" AF(F70 nJvI()uH#S9X@,h"9F$jrlI$0F)@#(2)gH!(Fy"9FjZbI0F#O 0W `n#F(>YI :!#nVJOaj|n#x۹:##nOahn#KJj#x+!FPF FF0D!FPF F<0DchAF(FG$h 8I0F 07I 7H F`5LH0k(Fv(1K2I0HpAF(FH0I0{@ˀ`@,̀h"AF(FGi"9FHjIKHI(F0F0BєIJK)FFhEW^^_@i_Mi~_i_q_^i`$i`8_`R`j"0ET<`xii^^6``9NT#9H^#Jb#S2I3HV#S/I.Hyf#S+I)Hoh#S'HX#&Ha`#Jgd#SIHQZ#SIHG\#SIH= P@,?6ch(FG$h0"AF(FG ]```_T<````-OF FF` )F F0?I:F dFF@9J 9I FJF4I FȐ1KO0 F:@F6 'YF8FZ됻YFPFRP IZF F K0hՙL0hԙM0hՙN0CO06[AF F F(-h. lIhh[E`g"0@ɠ𵋰FFFI I(F OF("hF>IjF(F0h+I I"0FJ J Id;`;h I"F L adB"(i8dLOdYdv FFiI#FF ,d-CF!I FF0KOqJH>N4h NF(FF8FFȱFHFiCFJ)FHF$p$(F$`D FNF0hiF` F`]5 J0h6O0p f-dO(d"e-AFI FF(K!JHrN4hPF(F6F8FFF@Fi8CJ)F@F$d$$$qd$C 4`O0edO4d"eFIjF F0K@JH*I h + KN@CsC `eYO=d"IH|e(0IFhpI FdHI F^ I FZK!hFhhCZh%"` IjF F]0 I %0ef-dd"i7ers FhvFH/hF H M NhF8  Hp!F(F4F`eMe4e-OFF{I f0FC BFuJuI V("!"!FioI(F0+ј"! jI 0F0dJgIfH@PxeKXh !FdHpxB:ZxBP33 [H!Ff!`]FWI NI(F0SIhFQHBPIP B MH8 JIE) FL #ji!F8FCVh c`-GF FFF 4#`%jJFhC2s3Fx-2Bx2Bs "#h"+O0@F1FHF #j9FPF^0h(FI{`Fh F"@!q-MOFFFFFE h8 _WF0$hj`O0FFļļĜ40 40 0 0 pj(86hkbb`-OFF@# 7#`O0i)@1j)@ IhF(@"!-ހ58FF( Ii,KFD/!@FF#;#5#%   YF@FF(@ i)@,Ȁ " F F"x*O O "#`@F`(-~I8F(sOsQB?lY)?gy\)bA\ X^0 X 8F__F(?M(FBFQF 0 p9F(FF(F`@/?5ri;FIF0?,i+Ҁ,πYF@FF(@PJCFPI Dh( h(? -2-? "`WRc@F^(A X X0ESպbO #`8"#O;JO;$O!? F FYPO;+?2kDO;Ҳ^ xX0V:,;+?2kD Fx#x*?!Fa( W<+ #ɲ CA(7<0< ,لe4RbftQf|+t#x1F(F_r$JI i"FF FJI ch07QZOZi-AFFFF@FN(#`O0@FF #ji!F8F CVh c`-O%FFFF   GpW;F:F!FHF5g`;hIFhF[FG F5x2 F00g+-! F^J#`O0(  +-:O` O0 -OF(FFF#`O0;Dj  #!ia00sIFPF&8 0h2($h0-+YFPF(( iIaiybh*=C$70h( 0h ( H #6FF)F0F!Cck xk`i+aI BFh#Ff-AFFFF>#`O0 ji!FF@FCWf`0FFF$ !FF_m8K`T7`QFF !FF_W(KeDa7Q-AFFF`i0FFB hcaa_ _F0`ixO05i`ahcaa_-AFF (!FF_ F K:F1FO`FCa0 FDF_ F%wQ-AF F ,!FF_FȱK2FO)F5FC$b ;F0 FDF_T FQ-OF!FFFFFE8hO  B "`O0tO  :hO  ENtC<`(hY+ "Fh(FF[FeFG(eh!F  4*h[F(F"FG(eh!F4-G%FFFFE(Fh_h'ig1F h]1FFGFPF>k  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Ah%0O0`k$h08F F_{`ciE``a#`a#t F8@O08pư&IF %IF0FF`"I`""H#`O0Fp(FfF FbxxFBI ROr!hF)F/*(" !F/&*(" IjF0F0H ffQffȁiJfIHg 1K!-AmxFOrB8< 02$+*0>HR)-.,C0C**+7H xh300[Kx:+* 1H" 0H)F.&$'i)@F".?k75/?f, i!H;H [H(i8ijkik kk2k@8iiiiSk~"xkk'k:kIkPkXik^kbkn_   @FHOsBH (!kk0 I$jF%DED D D0I(FF F08iiF"!hFIjF F0I , ij IF0 KOq J H. I F0I nYSiikF FFHF:0FOE%D< &D3+ 8F"Bѽ@> =- `6-O=.I#E El\%t@XXXXXXXXXBXXXXXXXXXXXXXXXDFHJLNPRTV0[cx!JIFH`cx 3D  *МJ&Igx+FHL؂I7ԒB> WH]6"8@FFHF2I0+СxH(0+#y'FIOHxxfxK>ppc^FEݸyyy(yDBPF7FHF0+СxuH/M0sJBErIgH0+mHIFKFiHhIvF18&`?aIv_GF F. 7D /h8&IVH_/6؛0+?I%Hb0+?"zy9HX+5IHP0+?!z 1HD0OĠԐI OF F FDo6.R9(PF 8  9F-H-KF8h,KBsB(J(K`EF"H7n : I#J#J#Hbx!F2+#!H!J+F H H H H H H H H H H H H HHHHm`mWm\kkMe.hhkklaklokkllll l(l0l:l?lHlQlXklj0%   I  0 K@A J H I! F)0I nTYSinY  IF0 KOq J H ! F0I nYSinuK"`pG?pG O4S+2h @pG(OD ##D( R^e^`]pGF^FFH FoJh+`"T R^7^2 ]pG R^$^]pGK[h˱" ##!##3F`H FO4"ToF! Ht! FjC H!F JfT0H!F no>oPp(hK%[hӱBF! #*F#!+F0!F[H<$  % U UV FPFHFOHMH$"F DDGK"GIHH4FHjDIEH  AHB@H"!O0(" " 6N5`6M"O0~C h+0H0HAB+,OrB((F! F3h+ +OrB+ + O333XH"F "F4h," " 0hp"Tozooop&opJ?ppyps%&SKh#p@pG;>+ `Y T! "D!00"H!"|FI ] MF(` IH!Df([ k`0?q"\e M IFF(F)FHI"F(F :qqr h3(0TK! CC B K` 03ȲCBKK!`qjqq(0TKI 1CC B K` 03ȲCBKK!`qjqq(0@# A C%BF#CL`BK` 0K!`qjqq(@# C/F۲L`BK` K!`qjqq(@CS_FL`BK` K!`qjqq(@CCOFL`BK` K!`qjqq(@ CCcoF#CL`BK` K!`qjqq(0@CS_FL`BK` 0(шhTIòCS! C_FM` %B۲L`BKK!`qjqssqK"#Iz@h]?-AF! 'FBO@F`)FFp()FjD(77 FhF]I*Ff"(F] `0Ffv`-A F xn+Kxo+4'fL%FAF80F](F'x!Fn+ Cxo+0]i(=F ]b(чpIFFH Zvf-O]F S 4E3F S 3 S3)Fh SF3Fh6 HYF#QFqڀIFiIHF 8 ` h+@ԀI(F(@̀Ig(@ƀHДIDБI=ЏI6ЌI/KB 8A(F0 Ng!@ f` h+ I"8F(@ڀ~I  `+:hO@$48 4IFF(@`B$hh#U``00bH  $0@FS$4B t> 0VH>CF(]s]o.@/ h+@\ 4"8F0@[DH ,8I&,?9!nP#2B) .I"PF # Z"(FYF!F8FFFع&Khk$$H F ]TF #K aZFH #r I3II;F0J OaJvv!vCw,Nw/t8vw6w[wa "hvwwwBwGwOpwXSB OH8FOfFx)?-) O =!FP^`#4;G+G4G+0\F$^HJ]]$j0 ~ B @`h! 0OH*NLONOO2F @A 4#h 4hnh+ 4*F8F T?+h+ =H*FF SF3h< , ! ( Z"FAF (#0L " h (.%I 4f 4@4$D48O$.ٮ0+?Ԯ 8A(F0H)F(OrB])FF HRS 8@4Fwt@ wwɠwW-Oh$ F #^HJFAF\N%h z%VExkWI+BWJ+FWM FVIF()FUH0F0+OKEMI(FNHZ(qhJHJN3h+oBI#FH-QF3h+mQF?H#@H###F0`{" @{ IFH V|-OFFt"F0F!F>#:J#`#`09FJF(FA0-De8 (S "E!"O!!"W!!!!"_!!"}CCC"FYFeI $eCUhW# Z (FV#hZ\C#` 3`3g&tp<}&|{] e at#H)FTx, 0I+F"F Tx<[T< `Oa#Jg ` }$|8F F(!F H8@ Z#x/+ !FH)FH8@ 98} IFH X|-OF#F` FJ F|;`#`0J)F FC0,o(H#:FYFhe I ZeU#AFTxhQFOL&t4&|p<}m c#!FH 0|h++vh\ H? KF#F IH ?=7wf8F F(!F H8@ #x/+ !FH>)FH8@ {8}LIFHD |-OF#F` FJ F|;`#`0J)F FC0,o(H#:FYFheJ I e0U#AFTxhQFOL&t4&|p<m c#!FH Z0h++h\4 H? KF#F IBH 7wf8F F(!F H8@ ޻#x/+ !FH)FH8@ 8}IHP <-OF F F#|3`)FJF F@AKh,o(#2FYFeI e~2hR U#@FObx`h9FO/<p4&|, f"$ FH#F1F 0jh I Fn{8F Ff(!F H8@ @#x/+ !FH)FH8@ 8}IFH >.-O%tOFFF")F F`.FFF"UmJAFHFC-jKhJE3ѻ€o^F X#4WhX58FT4#`#.@8F T0~WI:F *u(f(M(W*9(;G(,g8(S ) ((((()()3(((()O(U(oC oCgoCoCoC8h# gz8h#`gs8hO gl8h&e#I#8hRFeh I eNW8h%`P #g cg.0gELCj0oCg#0+.?@ g;&|<pM d(#!FH T0I#F*F ^[$ dOa F# Jg'! H&"# @}$7" FFJxB(I#F*F 0FY( FI@ݿh$FZ( FI@Ϳhx"FBx (I"F 8F F(!F H8@ #x/+ !FH*)FH8@ g8}I 0KIKKKKFH  t :q7 " FFx (I+F"F 08KFF K%*F!F>8fF I t!FB 2(F8@\A" H@-OFFH"! F`F8IH" FD@MZFAFC фKh.t28F(S --y,M,M,M,M,M,M,M,M,M,M,M,M,M-,M--,M,M,M,M. ,M,M,-,M,M,M/,M0 ,M010y,M,M0m,M,M,M,M,M,M,M,M----,M,M-,M.,M,M.%,M,M.-0-y00)070u,M0I0[5Kh 4K"`P2Kh+/K"`i#saDiC#(ha!iCSc&JhC`1iCi#(hD!iCC diCcg!(hF ifcC (hI!iC3biC@iC3 I(h:FdFI <@,&|<"!t"!l"!xp@xAHhA`Bi!aYBiAaaBiA@aBiA!ao~I h)a|I ` zI h)WvI `i!qaZBiA1aD!Bi!AaBiAaD!`D!`ZdI0FdcK`bI0FdiCa`b]I0FdiCa bXI0FdiC3a`bSI0FdiCSacNI0FdiCSacII0FdiCCa dYDI0Fd|iCab?I0FdpiCa c0F#diCCi#C(hR!2K` (hr!iC`biC#`(ht!iCb(hw!iC b(hx!iC ciC###0X#ObHFhh9hJF F"!x"!t"!l ""!p@|-C] G%  {H#9F@F*h 0#$hK+i )h2F F#sa3h *F(H,'I;F2F (hi FOa0F#Jf`h # " 2 h@Cp(лtFH#H kkKk kjjKj jci ]}$1AJ"!l8F F(!F H8@ #x/+ !FH)FH8@ ӽ8}Bx**I ARF@h#F(F O3c`#h"!Xh O0#hhe`i#"!(F #h(Fii F(:F1F(F"ChsFO3OzrF FhF!ZC T(`h#2F)FxpO0sFF F"#!F`(F##2F( Kh#hBch+ ѥhmh`I*FhHO0p" zoP(< `0 <pG FIBð(>2"#@##" #>#(h[N IF HH#`O0C] o -OFFFFBO0%O )FZF`DUJ#D ;I8Fh3`D5#D :<D 3SK<3#C(tH#`V<(D+V,"IHV" 2m3-OF$  FFFFF)p[,u :O6<#`0FRFGE {O OAF r`AEp  F]FDFHPEISFHTGCFh(JFFia7FeFFF F7F-AN} x FF!F@FOr2(FV)F(OpMF4F$N4D#I:F0F #Ch N}( 0F L!D ĕH " -O["F FFHH@!0FFر' "9F'ph?I@FkF*FAFHL8LP2PT,TX&X\ \-OFh FF44``h H`Fh`h` `H`iHaiaia jb`jHbjbjb kcTS BB D\5KE'L53#T"#XPZR3B2*5q5pOr| F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" PFlF8FhF0FdF.D#$B\5KE D"0BP%K-A]h F%u%+g(e6Nh3h3ihRk3`ЀPp9F.K#BqJhBA۳hB@9F_P,9F Ffsi*FF ]Ao9F FX+FORFKhh^hU!B@B 3# FE!07+FORFD ]"%"%"%"%-OFMFFhhQn   @$Ci8C0#ihFiZhKBИH ijYh:bJBO5sAIqm"@X\CZT0#ihFhhQn   @$Ci8Ch$:$A1ih:` jSCEyoHJFCFR Qh"HFAF0@FFFF 3\% D`KBi, Ci~ 3D Bo"v;n  !@@;i@ C@p ynD   @*CC :kki FQFh>JHFoi\oBOAF7>0S9F0FG((XR BA Xd6S BB @fh FkiQFkO"1F8F$'09F0Fgp p  E 6FEz @8eOr1F8F"% U-TT"%(#TpGP# \C TpGR##FIH W-OF hQn   @$C0(C8PKh3 Fi0KJEJH%i-@FH.F(F1FZh REvsnn  &D\ECE*H4](E*x8$jgOdO  _EbO   в B`!DO   в B!1XFI 0kEu0ZiBu Hv%I$.F"% Uu"%"U 0$5+/:F#FG/CBsnDx)b#II>x#0h+I(F>t!0hXk4bO HF =GD0 p JtI #De@BL@r[ CSfd04 @+F#"ihkAoB@kBoB@hDoB@eHoB@bCB@_3B@\3B$$#iO@O ;# \gKFhC @h*Fk0#FZFK`" FPFX@FZFXF/!OpZF1FOr!*h:J\kB@ZhOzq  hKCOA22$0.K00G()?h#De@Bl@r[ CSh0 p h( [n@+FtOxBFh rC2K`3֮O ;@"!"%AC"%T"%+YIIOzr>thSC  (F\Icd#ddd#c7!0hXkQ? #DeL@eBr[ CSR #d@  @C!4 @@+FD0 " B$ $ $ $ $ $! Ozr OAh SCD0@0H0L0!K00SQ?h#De@Bl@r[ CSR #  h@"%"%"%"%@"%ķF^c"!T"%"%"%"%O`^Kh+I# h8)hOP FObhObxiKhyihh0+xiOr!Wp0+ݚHj0+@hNj0:5U\Bi"iBCEhInEr  @#*C@!CF#J KIfB ~(@𸁽R0+P#"h0"+:h+jOC F,oL#FhjB@kH <8dO{0GF  "KQEA\%FVI+B% a` D%4<`DEKBD p0C_CKBu@H( h!i * i9K$8I{`ȿ`  h{a`Ŀ@;g)#@"#x0t[KEgx#e  0mH:fxfzn0BHV% kihj Db-O F8 D"%"%"% TWH@th"%ɠ8 U@hREi@JhnZEvq nJFh$5+ ݡi #@n\CTi i3aeKh+Od {h[ET{mS 2C {h[EP57XCm@P5?+ @ d  FF0 0F FXC@;Z3;R80  D~O`IFlF) IFOPObF 2FF(Ob)hOPF# :P#J#^ * , :BQF,9`#{eO3eJI  h)F`2" Af fH zf@"%Yh|JB5smxBpijYh:btJB5smxBpij;bhkX0@i3DhOO Qk1Qc1FBi򪀚B"Dhxn&hikQi3DB@򻀎B0hi$5+M2fj $jENKh#jzkFh !jjVn1Rk!b@,hj!Zk`b@h`iik _OW8D.:Kh+aihi9Dh6NkDci 0o+F(#h\%@4(NBii%rCQ@h^nQ@p  @! C@#@ K\%BN3h+5D PhOBvrn 1@iBj2Bb8 U"%TT"%ShnSEvqnJFh$5+ ݡi #@n\CTi i3aKh+Jd{hSET{mS 2C {hPSE m7@?*0d"FF"2FF @;Z3;R80  D  |ISk3SciZiBîZhBvsn6B UiSj3SbnO nD#1FoE +?$B FP#`6@#` 3.OL O +$eB3FP#`6@#`KFB R @I 8F z @J k08`x`0@FOFFEͮfiE>D(F6 @F #kcDBh.H &f\Bii%ACFk  k   FvdFD   !C [FFF?+ Kh+@@2D?k. H3@ UT"%hKI*FF0I2"\Bii%HCBhqFBrxn  @B #:C@H# DDB3h+hj8CwKhswHt+ qKhk 3  #:* 0fKhfI eLghcgbKh+303040 40hJkcSCoTIOb`iRMgib!`+hh9FwKKgihJK\5 0+WpOr!vCKh<;F2FQ+h+hiZkF%hQnLdH  Rk&@Ci8C2jcjB+h#hFZkh !jjUn1Rk!b@!k`ihiYkI L-)F FA1"0FCF~_+)!4T"%"!"%@"%"% 8"%-O}FFFFJFF(aI:F (_I@FO (FO78F }(.UI"F@FCF Nh+PHIFkkj`j`#k+ackka#@0+bB0kbclbN'@IXYF0"F(F*F;I8F29I8F 7I8F5I8F4I8F2I2F@F,0&I"F@F&0,IJF "!0FTHF0 0BcBO# (1*2D m 0%FF.0 C_BHYMVL+h+% 0 B2SHS1QKh PKg g4FJ#jjhJHZC * 6" O3@A `F<(N;I + (FP + + PF ` }`` xB`8FolDgO5 4$ _$< DDm(FXFN!@&23h+9 K+pF I V"*"*H"*$"*"*("*8E"*|JY`;FOhW;+3OPO0+h+ݷHb+h++!jbi;#!JFKfAIZp2h+h+?%o0XC#P'+8GF$;&FBdHL0;d0 F г 0<H3Z@+O OiID&<,RXDDx@&0HF 3&rKh[FRFF ADAЁ!sHZFX6;B0 O[3.sEO`DO18OO F~hOO FExLODZF,6S -NKF (0!IHO ZF O1 ,]BFO,6KDXh9KF &5H!(6EȀ0+ݴL0;d0 F5X-@'Kh+@.D?s43A  i uO  C 0sH#FO 3  +BBTя"* WH@thɠ"*H"0"*"*K #  } Xf$6JE,6KDhpK&  *kO . 6F 0IH3"#K.FD0DBo0+ǀV=-Kh+𷀔H. Kh-@@LlCm񭀋Kn!H.O@!" ((  D06SC!"3$#06'K*( jO&F&B* O \KbNd6z2KEx # "% "!lK;nA#3'4/5D0\!LH"3$!t&#0#@'!F*(@S>I>H&)F0F &^")F /FRH0""3$>f 7ZC"1 DO1BuOan!J!IL!;*0"!0F%687JI6O v@F V#F JI%E"04"*"*HEI#t'L@FVFp 6*FB-D0 &DBO $#UEz@FV7V3FZF @0FV# "'5l+rJsI̹F% 5UEmJoIӹci"3+DF#F%BӪ!5SE"~CFZFF Q&#@DdF #SEMJOI j!H# DD2F%05~DK"q!H6I i&!XF  "YFPF;XV[F& @kV'/K8F@&" #ci<B'HOcDZpO&鲨!hFhH-PF(?Ff& QFaH:`+hpC_D C@ZHQFYI"PFh pE_(ѲE&7xrWBWAs"MIh@F8H'AF(AF0F;+ًH"F?@%+؅HFXB'HJK +F/! zJOa"(?o!F3fF(hpCOgF#F0F9FC ѧBvCBu^H? #?zGa>Bp=g ?.FCs-FHD 6 9Fb0KFOsD$D-9@phC DB@ր0!F 9FDND5OpEC .DBJcOsBKB"+H O3#p!F@sXCP!F0Ou =JJOrB B]KOqBH`KKOrBЫB]O BГB HL)YxO >*Qѹ  !FO@(8 B8F> @Os@@a XTm="!F7F O`OPDF\aK ?" >DGF=-=H Fг?CӥHO BҡH)F .ПHOrFF# 0" # 0ДJO|F L Bv m'@p@|>" ?)O(F8!G F Br|H U=ycC&I@A sC&F  FOD6mJOvFB0(3F3## CHU#x)H"/I@A/#9B(FBTHC@v# $@sOrFB); +# +? @sOrF@HJFfһ##B1=9H)D&6H7K) FF*FVQF1H8F+(B#-##B #I{?>A#G G3)  COH@&!* !(%팋F FTF8F ##$.Ps[D +@H 23I "FD ## O&# ## #### @#$# 2!J) F'2"3#K)F%CEKhd yRFICFH}J#` @oKOsBiBeGEb #QѬB)F"FbAeB :FfH"F!(F й @KOrB̀CE@ɀ r+sks ss +tktt t+ukuuu+vkvv v(a)+bHkb#bIbJ00 10K20 30 )#p1$b1ZX1ih13h@ 3IA##B#rilrDCC !p q Jqq'KF$JOa"%B' #+p# kp#pB7IT"ES1"F)FXFnC?BHBFQFѹ,xʱ3+#0fffg0" "x2 !JOqBBEЋBDCE aK+`S 31O3z3 CEE f)+p#&Bٹ * ""T3"E+F(F(#r2[C#2hCR[siP3i3[CB#hC[+hqGF.!!3H !F1H .HFA ,HFB*HFC'HFD&HE+F"H1FHOwHHJNMF B 0F(FHKB 0F(F +?{O b )?*/RRaAGUqyXKC-SЂhh *Yd j@08  Ae K hM N OB`bU1 #0@-'B=#<BIFH: -C FFFF A F F(;AF萱}Kh"!@Fh:F!F(FC FHKh8 I"FF ~h+ IJF vihhs`h:F#0&Ӏ)BsFMh hJ@FH Hp"!(h h J3F@#0m#0\Cxx"x"y#KFHv]Ild𵉰FFh3SBF*FhH I 60 H,FH&FH-٦B5 8F/p𵍰FFjFh3SBF*Fh(`-Mh1F Fz *Oh@՘xxa\[x"H! @ջ* h-՘xa\x[x"H!*!h3SBF"Fh `0+h սHHF @ #05JI" ~0I 4#1[ I#pD F"F: D #@@Cp1k3D#< Kn:f*oB (КmQeppGIHɠpFL%L8!*h/<1D<1!K"`. 81;81+f<1 #<1KO2`LHH˄`p<1<1KO2` 81381+#0L0#1ɠ0F- bIbHbLbH`d`Hh^H`":d2BYH 8d2+sh?oh? D%%+: v`+B+p DKynBH)F2* + R; ( vh.5I 3I@@џ@ џ d2)Hz : +R0;+D 0H: *`  R0;,k0@@?6C-@Y#1u#0L0#3#38@ !  Kd2+Կ l#0 Ki Ld2 I`2"Bȿ2L0#0QFHh#N!DB"Dq8!.pV   KhcCս@ _?ə?333333#0L0-O&LM-`2 =`B0T1BBC2 <`'C@0"1FBڢI #<:s";FV(h՘H#"!&(ڑII #<02N@0hX1J!T!#ghO >/4'78F# xMKF*FBF  OEdqHDqHdpK"!pOaX`2+F"D3`2!;jhCVI`] .ձ@ jh{:j`As;h hdBEOqDHq;F*F1 @=I ({NhV#蠡k#H+IE3QD@+HYF Ԩz;@ ! {*7#{F3FBOE(ki`{gD #0#(׮lKmJmImKbHmK mK mK mK mK mKmKmKmKmKmKmKmKmKmK pjIF F( @WF(?حKKhch`I; h\Bȭ[Kh#h+? @F(8!F @M16F @2XhB ٠h C` `F&4(F((Fg `CSF0I:HTDF @@F(5I BHFF~3J C @@A%FFPFF(YPF9.@I b FSR$Hʚʝc6ʲ5m$<$< (<a}˝˴"Rv̖~̸V$<$<nO)Kh[;hI; h\BկKh;h+ IHF(ЪIHF(?| I# 0yZDoObJFIHfFHFJ*F9FHF[6FVK"1F FB#!FC"#FB233Ih/IGF*C3;D3Q F(8 F0F8#FFCCB0Ѻ?=B?!h1Bw 8FQ 8gFB8F (  ( 7#XIZKhr:F]IYHN y D Cy 2 OIFCh 2 DKEDI "6  [E32BH  :IF ([x/I3Hh3I  j0IF ( ] X(IF R&IF F(LI#h+ H%`H#h3#` 2IF (e $<$<$<\Bfffg^fdh5Xl~͏ IF (,f IF F( L I#h H HObI͘͝$<ͣͷ Kxi+ H3#p!hHu $<$A@KFIF"Fp IF@ IH:b IH4#IH.H$HX#,$HYFKFIFhc h=\%B KhK J K I( FF I2F H#F(FLP$<$<6ɠ;-CF3KF3IFh h 3$OO \ A )Kh#F(I)HHF3C%Kxi+$Kh+#Kh{#Jd!e/2F+F0F)FFx{F Fx00C0G F2F+F/F$C〸LP$<$<Eɠ$<$<LTZI;J hh\<$B PCyˆ+"B€; F$<LP-OB.]]SSBSBO O FBi,FwKh;(FuIFuH(FCmKh  U F F;F*F(Fp(FZFKF8FVFCvѴ0X\CY F9F9F F4CIKh+0Fcy+ FFI:FFFH HZF8FKFÈFCÀ8Kh+0FjF Fg7I;F*F2H.N(F(FHZF8FKFF:C3h+?e CC3h+?T *F(F';F"FIZI FH?by*/M F FQiZFKF8FFK$<Λ$<γɠ 9cy+)F F FK8FjbKFbbZFlFKh(?J I;FFH>I:FH0F I;FF H0F:FFHS$HX$<[ɠuϘϵ8K-Gh7I7H7O&$2Bv2K3N3Oj0F!F4FCy+,Ic h\Bj|-е00;(FIFFPF|(F(Fi,jD mjcy+Ѵ0I Fg3h; Ff9FF@FZ F Fki$<ɠ$<$HX$<$<K-AhIHM ,j&GF4.,jM#j$J3FI H 0F$<ɠԛ$<$<L^$<;V 'AbtՅբ$<0յ$H|$<$<-AFmFFFFF(@H:F#F9Or@a0F9I2F9H8HhQ 5IF3H m*i0NԀF2h^miF-0F F o/F0FOg:Ft0KIHm#jPhQIFH` 0:F F0KI Hm#J0hQ IFeD5$Yt$@.Zd$<(  ? L#x#+#" Fx F4#+ H#"l@HmL^P^QF FFK#BpH"F+FmO F)F{h:hER#qbB#` Khvj O2BB9F0Fvj$<p$\4$<֊BijB ћibpGiBтiapGF+I֙QpF F K#Bp Nsh2hR#p2BB@j $<$\4QpF FK#BpH*F#FN(F!Fsh1hQ#03*F#FHp@޾YjBB `p$ F$<ֺ$\4-A!mF 'FkF(FFkFk/..p hAF.@i,$ F m5.$j8/!FF$ F8#p(F/##pF(Cy+H)F|FL/'6*yB H!Fj F)h F! 5B| hQjIFjH&iHIF(F0( hQcIF`HaHIF+!0< FPF\H"F1F(F(+hQ_VIFPHTHIFn(F"RKxR)r)uPI 1BB)ЈBCIrJHJH (0"(F(DK"?KAK@Kh _ ##"4D}`(<`1D('B4(3( 3D(B^S(,2DC(,S,C,S,C,S ,C ,S,C,S,C,(3HT"D"2$<ɠث$\4\ 8Z`$<$<قٜ$@$<$<ٷ$< F h=FhFG##` =pGYϽսcKIHm  b$@Kh)Kh,Kh2IH FH[h9@# FnKjFIh(hQ? IFHLX$<$b@T`m-@pGpGaJFhS BDKBKm I H ]"S BD $b@I$@>F L Fh"i DBHh*F`i9F5D0D`$b@d KiDao J3 Im H^ F]F$b@$@~#MF`+iBli FphiP0FPFha.aK(aImH##2FK$$b@$@کK FhCK$h FF`GKh I%#F??KgmhPX I;F2F@ H(F>$<$b@$<$@8ML4C0+"mIHJK$#e###c`* H!48$b@$@(R$<b$fKsFh F;H F!F`nhGKhK*F!FP0 KEmlhP I+F"F`Hz p$<$b@$<$@q8FL hF F8)FP(4pF KM`khB NPP0IH l`p$<T`$b@ۦ.K-AF-NhC5,KhñȀ)O:! Fp@Fh# F;t`D(9 b I F HIH*hP^JIFIH`hPKJIF3h33`!F HAR,F$<$b@$<HgBVYJ[*$g$<𵅰=L##0:IF:H22Cb"F5I3H4M8#3K@3I*+F2H"7-M.I+H.h.A##(IF0Ft2.h2C,F!I0FfN8#KI*3F"7(hTI(hN)hH+h[I JJ$<ɠ $@ $<; 9Eb-OFhŰF FNF0# FHI LFB#hBӫzKhCyJzKzIuHLEF0pI E#y+:pJOq8Fy0S#yPFkJjI#hh.#..2xy`y2B"hK:#D@FR:F!yT\J0/SKhZIPF#hDy`y2B"hK:#D(FR:F!y*OJy`y2B"hK:#D(FR:F!yFJ#y+ EI8F|pBI8Fv(60+QF>H*.. .ѢyF(F2B2"D5J y@F1A1!D0J0#y+yF(F2B2"D<)J...ly!(F2B2"DJ y@F1A1!DJ0hy!(F2B2"DJɠ$<~R T`܊ܙܪ.AUܻ$<Kh(K[h pGT`$b@-O(L$ #F94#hs(ЩH;Kh+'FFKh35E(@Kh+)IHIH\#0M KxR+K0+''F:9+LьK(FIJKKKdH)F&dd)FXF(FOa `H0ԝ 4 + `~ zH)F0SE7 J $ )FmH `IF#)A bQF(F `YF3 +)F F'RFXI(F)FUHUJUI(F(F2 `Oa0  JKI ` 4 + aAHN@H8 Dbh(":HF?4J(F6IF0H B/IH.IEE *H F FBB\#IF HvH IFHn$b@f$<$<$<ɠ:$<$@3Bݩ݇!xJޞ޴$g F Q$<$<ߍߦK`$<m_T`:N"@9C3h)3)4I4H+ 2K0+90+ۮ.H2W0)- `=X*sY=BOqA3hKJKI-ȿFH*F= `8+Hg4+?H!#40- `=$<߲ɠ$@[D$<$f-OFLO5 B::h#1FBK)8O)%ch(D+?IF#hF;hB ( 0nHYF&;h9!hif-@#Ob5!Z%Ob@FR9399393QWKFJFh..98h/O# 5DܩF-eKILHKK *,*!*"EIGHGKhCFHC  X :BJh"BI2FBHiF5F5I=Hm=I2H#:I/H=h!*F(ch!(FA(hP0.IF!HI#+Fh??-[MFKhI!Hp#hC J9h`0 +:h)FHIOb(D3$b@$<T`U$@l$<j$<0ɠ$<$k$#= mK##K+eKH#h+?kH IHd$@b$<T$b@$<~$< 0He$=-O=# `J   ` n`h+𝀝KiKBМH]H4+𓀙J434 #C@ +@  F ## O T %0B@;+y hHKhñHI[F2Fm8F0DJEIFFv#*F!F;FO0QQF FPO434N'8NF`h%0 Bo/B30F<(3/JPO?!&K"$ &H@(9m@F5c9mH3h+0DhN`DD)BK Hm$<$@T$b@$<n\𵩰N3hIHLMch"PF(`+h+hO|JIFH d"hb+`K"O`I:h hS5#h CCF BchF (FhOJpIFkHPFO.3LF(h COccI]HcK3h:`)_IQH^HR\O58F[J;59;99;9h3`:HIQH\PHX#h۱LKNJhNk#)FLI9Or#9#Q :D3s93hBKxt+?K=K F*Kh(hNI;F2FHF$ KhS I3F J H- F I$$<;$<ɠT FF(I(H F&IF$H`i#IF Hi0 IFH j0IFHi0IFH`j0IFHayKJ H)FIhIH F@F H)ql0F%B#OaH#KJH0i5I Fq$s"ÈmFI^ FC [FhF hT Fs ` q FHFhFz m2pFCy+I2 F3KhF@(C@hN*F Ip@F H$ Kh3*FIp@HpR$<f$<wɠ-C/!F@D'O/O ?/+0F'pF`0FH*Fh0FAFC뀄FCy+I#jI F F# CKhF( hN "F I@F H Kh3"F I@H$<f$<ɠFCy+I| F# CwKhF( NhN"F I@F Hn Kh3"FI@Hd$<f$<ɠFCy+I< F# C7KhF( hN"F I@F H. Kh3"FI@H$$< $<3ɠ-CFx2LF.+ FFCx/+!h-H 2F+I  h;F-A!h%H9!h#H#J"I hJk I hJ/I hJI hJI hJiI h!h #h[I 0JJ$<Glte4{bI -CM`/FF "Fb( I 0 +;#0B#H+UwH!Fs$wpmFFlF! F#xE*Oa&H)FPF Z(`#xF+K"Z`O0A+ F DB< +#< H!F,I ~ 4 mp$w FF FF^ K!FFhF FTBI X1F(F@$w𵅰DQL`QI RPI VhNINH`MI 4K aII#ih"F(Цh@!0F(d#pAKqh?+F0`h*FHOHDkCEH6+hCHFpF(/ // L0F)F 3L03F@FthhhtiO 4i##pKл"Mр"! F&Tc=0F2F0 _ fF($#*((a ءWA ء7i@+2F  B+"F+#pO!F(F  O /!(FF/р(FL0{C!Fh1FO7/#0(FAFZ/L0HF(/Ѳh!FHFOL(F^?F(FJ> (F`Phcp#@Fh`I*F V,_Z$x8FL h)F@`h84TCy ˆry**0D@𘸽@ COqJH0H${h"KF"HKK](F((IHӸIIH+h!40 J #Fh4" Hp 0BBLKHJ70  !FOrH H0!" tF(h.!F(I0(p!hI${h$|h_Z0Eh)OLh,LД ԅ!(FJIXhI HOrH0I,OcJOqHv,B$OqJHh,! Oq HJZOq JHN-$${h_ZRXdaKFQ$+BsLD.' x] Zp+p"D pB*ݱB#Hp${hH$}h"KsFhF HOq"`塀H.!ꀱAOrH #xkIOrHHpK"!ex- - FJ+FOq H`h1Fp@ Fp@{V8$|h_Z${hpDx,,x J#FOqHH@@Ux${hR-AFFY)F0F,FڽA HV*F+F!FHAIF"F!FHAA``-O$F# "#F"F!D& H dBNI0FرLFFF!D(DI.DCH-tFFhCVѸДy BEOx[IԔy0B y9F !L;x`+5;C3D10 ) #hP"!#Ih@IRFXFI n; f+X1 #DB(FOL#`mZe "p$,FgBHV8#]#!"]-OF!MO 7 FFFF,)DV\*5O `F#"2K!F?IFH lHFCNM F7h{3`70@ q=N@A |# !J0JF]0@F+F^`j  0?RF !@FVF `3kD#G,#x Y2 o`jD.#.<P" !n5/-A$OF%Fb V" "e#F*FAF0 JI "F9F(FLS4?;H\JI01&6* K IF K K K K K H [;7MI,hF FL"h"ch I(h(hh3`0@pGVH$8FLTh+;+"JB#CBhL8@IFH#C 4hLIFH%#h 8$$m-AF("F"0FAF0  I FLF(FAF0FUd0 FALgK1+K9FHZhIO@[ B 88FV#5 6AF $VH&*-CFLOFF F1+@1!S .BBK"!F(FCC>ஹG+ J F)h]K3`pGL2]KhH`$VHR-AF=Lm1+;HN @=!O 0"AFF, #Os8F3`Os0 9F#h+ mT"AFOc3`OsK5R# )o@# `#*s3F0 hLFH,+ Hh2C-HT$ym-GF9OFFF1+f1!S .]:)F F/K"GC>+KF+HZh 1+. )F FG."H0&8B.ѽGH1#HF)1+PF"F)F HG $ɠVHMw/-CFKNFFD3h!F',>DI FO3oB#HFG0*Ѵ@ F "` F^B /H"F)F3h+ x+h+'F1+#j# CoBB?#)F@F,j#C!oCB?#)F#@F)FJ #@F#J)F #@F$-OFcNFF3h!FK'O,Q . PF0SH)F%@F> FFF6 IH"F)Fk3h+ Z@F$FXF@Fh+.PFGF0Ѵ@ n'F1+Ѵj#OC#)FHF,j#C&#)F#HFPF  !J SFd! )FFHF,8F ! J ;Fd!")F FHF^$4K-C8KMt}wBEO!/!!AF(F0H)F CDF)FD2F( #8F$<%FdIF8F`VH$$$!-OF$HF#L%F!hF F)3h B"8FMP@#9Fp"hI k3`#"YF8FPh! C!BAEPF(@#9FJ"hI54$@>N-AF1MFFq/Xj2C #CP)HA#!S .B;!F@F#K"A B>হKFHZh1+. !F@FA.FHj,N%$B H)F\A x0FR7$^ɠVH/0% FF#S0 0*I"F KjC+F Fc1 H!FH$-OCF+F FY K]h!F*FF H6)H0H*$VHpF F&#f0 p*I"F Mj1 C3F FC1+K!FHZh1+ OR,#H$VH-OFFhkKh۱#jH# hp (#2 ZC8FKCFX ZO3 (# AF '3w (":FD0F0 = FOK p("" BII*F q- &F /FO ZCEݸ 3 ZF+F! j2CI#("1F8F (639F(" F(O fE(Q p  #B##QpB##QpB##QpB##QpB#1H9F# H########$V-CF`"*x FAFD/#JH#xX(FKUFX l#O3#F%9FHFU*0 T F#CK,2B/I2F <0/#C#C  #"F1F$IhjC!F0F3FBF!u# #5BܻO\1H1FRODB 8FB)F#@F5:$V&0FF%#U0 0*I"F KjC+F FO1H!F zH zgzg+z;g+;; ;R0;$0-OMfNF CD3FF3h!FOZ,j FXF ZJ ZId TRF4!\O FHFSIFOS AC@18F h0?Ѵ@ 8 M#F`HFXCFE EJ4ñ؂KJ-CF'chJ K-CF@3+𓁛KB1+mHQqzH*KIt/#h"k@]HFjalHf#3p*I) @MIOrHIOrH*J\* AFOrH* I}HOr4AFOrwH*zwItHOr AFOrmH*zoIjHOroAFOrdH*jfIaHOroAFOrZH*j^IWHOr_AFOrQH*ZvUINHOrpt_AFOrGH*ZdMIDHOr^POAFOr>H*JPDI;HOrJ(OAFOr4H*J>0CFJIF0K JIhGF')F0Fw$0?H;F!F F$$VHy-O,F=!F&`FB<'?+|7F#;I(FbxJ&809`*xB;F'F.# M$`"!@0"!F(o A,!(FD%@ FFKFO O3OFLF9/F8O 8+wH)F==!@FbF`}I@F<(dL,! FTF" +uI@F*(?ѹqJ)FqKqHFw0+@݂ dB"pF$fH)FbJF FB^H"F)Fx+h+o FSI@F0o QI@F(5,NI F(LI F#' HI F#' EI F(܀BI F#' ?I F(΀h*Bo@CBOr`VHlo#(-MK^i$БI@F(9,? x*?%a)'&&&&&&&&&&&&)&& & #p"F3FFFfFfFvF&FVuH)F"sHBF)F'''F{*7tC"`@F6EdH"F)Fx+h+CBoBBOAt`TFfM XL # 4@//@MJMH)Fkh"`@FEGH"F)F[x+Th+)s %pHMpXFf XL+# Ff@F4$0 0B-H"F)F@F"`@FE$H"F)Fx+ h+rGM#FfXL# +#H)F Mz/x H)F3?sFflJt/M H)F'4v /, 3/,/,/جH)F/ѫH)F3/K@cp#I(F~(BxJ#(FQ908CFvF @( "(.ABB#+0(Z:@#`#@ # 02ZhJ)FFHUp#.!)F "((FOr "pOs# zKvvJ8 p0)F52o@# h2CoK)FoH "#4qiI" FD(gkz=+ _J8 B_ 1D`H 0"!4bO #4OsOw#`(FQK"0)FX"AFZXFp4KXS,YoC,`#2F#`c#F<0hJ>)FF>Hh2CX6I:H;+3J9J"7I" F(Eѫz=+(J8 B=O D=!HFF@HFqOO dv 4+#H#4 K (Or HF0Or # K0T/D )F(H)FqOϽ-VHH$0cv~gVjxB=#<I" FVF( +z=+?J8 B 1D+H h #4$ KFD@0! F1 H1PFF豆hN- JUIFHLػh"FILp0 G#0 9?##  0 ! FO T'&JF FP??~h"+ xhJ!FFWHsBxTH!F0+-++.2#;3" #S1F0 Ϲ (# &C '##&0##XF*h+ @,#,,#'I@F#c#"I@F\$ '#FI@FR# &#FX#I@F#D## F|,FDBH!FIeFI HQݺVH$$m);yFIFF*0G T(FqOJ,h+*F@F I#D#I"F@F3F<##$MIFF(FI"F(FI"F(FI"F(FI"F(FI"F(F~I"F(FxI"F(Ft I"F(Fn      1 L _  8FKhIVFpF tCF H)Fl` 8"F)F $8*FFH $c  mFFOahFR@ I"F hF j m`pmFFFOa&R$8H!F& mp&iF(ZH!FH!FM#C&h 0k`+h  &2F (`  $mFFOahFR8 H!F mKh  hiF (`$-HOLMFFF0 +*hOa FR sH!F.iYF#40F|  FjI0Fr(hYF F dIh8 0Fh`IvF(q^Ki ]IR(,!(FlF#p F,#3p=SI OK +x3OH(FI秱LK@LJ @E4 @8FpFH!FzEK @DJ@>F 9KiF8IP?e;IF.?\F7IF(Fȱ4HKF"F1FFBH F(U%FpFC^B^A(I#F(H2FF(F$H"F1FO 4+ @(H!FOI#FH2FO ` C F P$( ZJY l }j    * @-O$OcjF!FT4CF4pO DAF(Fl0sB'P'FPO E, FIGI(FRFP$(0BH(F`  B9FImF(4IFй `SFZFOa"+K `h8 bF&H  7 `+( bFH0+a `JFOaCF#9K `h8 bF H47 `( bFPFAde'r$< d|"Mh#FFH F0I+FFF H( Fp@I I FM(1F)F p 4-O F- " F ܕH O`hCI I *F l ډIUEЈH*FQF,q,v,{OcNK'#C0F &+ +}/FTFO aH)F X3F:F@P~:F3FPF FIFx:F@@P3FFalPH+FAF~ +{AOK*OC(Osz'+C:M &'"FCF!gL0?!g FZSFBR<0?خ P!g @FRBR[(0?Į %JIF$HH`   +F@2F@PI`  2FX+F@PQF2F+F FAF J HIF@YOYIFH <-CFFFDl `!(H FT@BD=D-$1F `nȹ4;`dx HbOa;`Rr@J I=DL$`8FL!hQK*FIh2KO2`(F24xH( "!h HLh J` J`8hah* HV$0%e%]<%]8%]4 KhSK"IhCH!$P$0$ K$` Kh F; K Jh+#`1H!$`$4$T%e$-C)1N MFF-L FF;F"FAF0h0hObHF ( #K$#I`+F0h F MJ0h320n+) ?+a+OK*FI`0hpp+q+ $K"1hH`( K$I*F`I+F0h*FT$$0$l$X)$tLdqHKhKhx pG$t$X-A N3h Kh M! L#'h+`!`'`#3`$l$P$t$X-AFF걨H$"@< T1h27$\ bE!T,LiN/.FSK$F+>+F@<ױI"^'h27p8B7h7 p4BLєB +ZbE.F"p"+$"!K2F!xx(9#zH+p,F~K@1𜀼[kм\^м$@%Zxh7p@0*@w/*O+bBx2* ({$(\(*XxB)3_x0/"ٓdEЧ1T$|Dl,7D$|O Ep0hD@H,3x2x(3B#A$ R@񓀼0%w?kWxS/]/\/їxF;cB##p+x+Ob1F(F".F0F1  \$|/\l<\H|Bˤ E\/$/Dў h 3:0*!w/RrF{/X,/]/:+bBݲ%e\%em%a\%]\1:R$|/Rl|RH,Bˤ Eݎ{bB݈1:R$|/?NRl|RH,B?Gˤ ElbB8eK Hh"#+p],/?0]/?'*$05(yLJMNO#h(hCFHKO2`1F40:FK J Ih& K"@HhV4$0M[R%e%]<VO$;hBKMh.hCK)`h"I"F zhB 3 JxS Hd(.`<`,YhHY%]4$$Vx%\0KO2`@H%e0KO2`@Hr%e0KO2`@H`%e(LO3#`KJIh%e$0%\(LO3#`KJIhn%e$0%\(LO3#`KJIhT%e$0%](pm#$$Kh`Cm-KO2` mp+D+(J s(+Xh F(hh,Fxa+/KNhK*FLKJhh;#<$"YhBFћh#0F)F(FHW J 1(ѧ N#F#%e%%e%e%e -GHMHwKO2` HM(sJ (pK pI$`!FnH(hlKhhMkNlO"FF(_ `K"cN$dOB3h+=h-@XKh+@S$h@(8YK*F `PMhSKQ$hbSKhSKFSH)FS$B PK#h[ <)hKKh{IK"`h +h3+`BK4h "x 2h#+`*h*h!F(1K!F6Jh;hh-Kh-KF-H)FB!F *K#h[ )h)d$Kh+?_!K h`h+h3+`K`P,"!:"O aP$4SHYY%e1$l[$$4$T%e$p%e%e$t$P%e= -U)3h+0+hd(K" Hh0UKhKFH)FUB K#h[ c)Kh+ K"`h0 030K%e%e$t$P$l%e-G(mF#F&&Kh`[kNK$O2` F m+7+HJ n(+ F(.(?K?Ih?K: hh";#9!*)FF-6Kh5K6Hh4J 9(ѱ3F2F1FF-(%h+(H9F$3&K ZhJE.њh"CF&HJF9FK K(FXh2??2BA$(FHh"%e%e%e%e%\$0Y%F%e-K#CO KK)%eQK#CO KK%e-CMH]KO2` M(YJ (VK$UI`UK #hB1F cM H,`#+`%eI$$0$D0# 087KO2`0(4JiF;+0HYh(F+,HF)F*HF(F!F(F, ,*#K#Hhh+HhF!FHF F!F Fb-KO2`h+Hh!Fu Fr!F FF%e=V=^$0 =v$Tp(LO3#`нp@ K NMh 3xK\3x+)h Hp@JI(h##`p%e%Tt%Tx$0=p(LO3#`нp@ؾ N M3xK#3x+)h Hp@JI(h##`p%e%Xx$0 S@KO2`]((JiF(HYh( Kh Kh# K Hh HYh(K"%eh$$0x%\@kKO2`]((JiFr(HYh( Kh Kh# K Hh HYh(K"%eh$$0%\-Am FFFObhFXo$B HiFZ( 9V$ObhFHBObAFhF@4K"` m`%\4@ KO2`](JiF(!H%e@ KO2`](JiF(!H%e@KO2`](+ JiF(+ HJiF(%e%d80u KO2`8 L#B%h#`H%`IhH%e$,78C+Q KO2`8 L#B%h#`H%`IhH%e$EO80/ KO2`8 L#B%h#`Hf%`IhH`%e$\a81 KO2`Kh+HE@'%e$T*81 KO2` L#h!F #h!F %e$T!F #0(KO2` Lh!F H F!F FHF(%e=vjp8=KO2`p(:J(Xh>F33K4Hh/K1Hhz,K.Hh.H!$(,I bF [z{'Khd K&Hh F)F L!N"I0FFP0F41D0F " Fh2AOh8GKJ h;#`Y)F %e $0 nt$[$T%p%eJKK`%e%eJKK`$%e FOF(O3;`(N#3`KHhb3h3h"Ih H33`;`, K"ph"@H%e%e$0%em%e\(7&L %M#%H+`%Kh.+h#`0 O3(,+M !J##`(h`xKhFK? + F !,`lF#H#pOb)hl? +Ob!F Hb JiFv(%e%e$0$D$4%a\%]\(8!L!Jh[ `J`(8O3#`8MhI(FGFK"`K`MKI(hJh+F F( FHIh+h I(FG(K` I(FG (J#%e$|$?_$0KJh+K#K"`K`$$*%e$KJh+K#K"`K`$$<%e$8F F)F F8@ۿJKK`%eN%eJK}K`%e[%e(-GF FF*|({nhAI0FG(f?I0FG(c=I0FG(iO,\Шh`,ZhY%! a!F \F+K`+K`+Khs(J'K)Hhh)I)Jh+ F'I%K`%K`Khs"J KHhhIJh+ FIQF !IF  OO%&Od%( O0Djj$$$$0?_n$$"RK`%e0KO2`H( Kh Kh# K HhZ H ( K"`# Jp J`%e$$0%\%Tx%Tts F(KO2`pKNh31hHp@~(Lhh "(xkjhI0hH#0hSF H Ip@J%e%\$0Y%e9T80WKO2`8L#H%h#`%`%e$-C(Mch;c`+V(F^ (Xch;c`+Y(FT (O5JiF(ѩZi2`+c` F:CF "K(HhbK`#hZ"`x.p .;h"hB3;`Ka"`13;` K=a`#+p5#hZ"`x +Ѧ0KHhi#hZ"`x +%e$ $0$t$,H!$,$,N0tO33`p((J}(!XhJF?? FAIZhKh-t##%e%M$0L08O3#`p((JiFA(!Xhv?? Kh^h! I2FF(F+s##%e%$0V0KO2`(ѽ@H0@IhH*%e\aO2K FW@H2I@h$0i-A@O30(( JiF(XhF(HXF`xK*F(FF0FD4 F^"F)FF"FI8F"F1F8F8Fj8F#0F0FFMd4%e-O@_(KO2`(($Jf(!HF(7xK*F FOF0 r|#N!FLF;.#)F#` ;`#HKRh(FFGL%e%d%e%e$-(FO FO3;`hI0FFXI0FFI0FF($hhBFJh3*hI$IJ`h ` h I#%e$0$$-AFFFUF8K:FIAhw@hF#c`0F JhF``B=H"hIAh`$0$-AO2M*`((AgbhAF0h4*:F "(#h+#+`LNO "%eWH$0(NO3 F3`н@1Hh OF0jh8h I@@hFW#c`"hI8h#3`%e$0'80 KO2`8 Kh3 K Hh8@L#H%h#`8%`%e%\$08$88C+KO2`8Kh3 KHh8@ L#B%h#` H %`IhH%e%\$0f$*8 FKO2`8Jh2KHh8@ L(OIh%h"` H%`hH%e%\$0$Ջh;`+ڊiB ( hZ `ppGٸ-OMXa_KO2` M (Jd(ІK$M/FEуKrhIh)Fph "54}IOBO&#w&hO ;iBҀuKh+FF+21 TnLO F+x˹#pmL#hhh?FccJgHh\J;iB5$+ \+Okx5;+x+5YJhjxP1@%# #eF0;jx P1@:B3  FBQ#2R#Di*5B B FS S DO;H0K6Hh(*KO2`Bz21Jh)K0Hh0JhZ&H   "XFn"hh G Jh:0#K hOBHRH0#hhS?6B?%e$ $,$0 V%p$H nt$T$$\$LFhFR##``hFL#c`hFF#`K "`Kh Jd!F KhC|H!$`$P $0$  Kh Jd!F KhCRH!~$P $0$-AFFF%hI*FFF2;x ;۲+!2FAF8Fй] * :* HFF2 x ;۲+ !`(F%FpFh F:!0Fd頹I2F(Fh##P+"(FI(FIp@Թ0FOF0%!0FD#p I2F(F0FE|+"@B %4  8F@hEf#c`h=(Fn!F(F@hEV#`8FKF FFh(< :F)F0F ` #h+H#h+ ;\ :Ҳ* C  Hx *3 #`T$ 0x#OFx p%,-Cx[=hZ5`%Ղx 5PW$7$nO۲ W$7$0D p10$0$0 p-GF FFFnI mI"P P#`#0+; 6fI"8F~(# `#aI"8Fr # `獱(hFX `hhT``hPh`+#`SH:FIF@F F'O0/!PF2(OPF0F@!0F(h%`+AK"`[:!F([<7:!0FF#;3x&`-1 "(F+x;x#BOsB%H;FJF)F E(F*FQFFh+3` (F`` h++Kh-ѥh-ChH+0`(Fq K M !!!!'$!7$h;\$dh;`+ڊiB ( hZ `ppG-OL I"$O3FD D@D|(@ۀI (F0 x x{H)F$ :# F L O &x+;!F(ЁIEYI FET(~I FEM|H{H*F!FO ##p +x+-+x+/!(FnBF@*@jI5+(F'eKh.++@,&x6^I F&-(x(WI(FzO`RO0!F gObF8F  # *Y # "0 800+F9K 9H*FmO o(F#@! @K ,K`~ :!v(?.#;q&(?n#F",F+FfF,Fc&FFOFFFF + _(й-йuJ#I !$!T!e!m!u!}!;\$p!$h!!$T$xHF.,I$-+x+𡀖Ob!F NIObH)FObBObGI8FVODNu eCLOb%h#`3h+[@I8F P%`$H P6II:0INJ OKL41,QH1P(I0x#IE}H3A3A3A3A&+A3Kxk,JhKhgH$$bKh[!!!xL+^H$/!H0!!UK`$TLUK  RK6 hC!|##L+@ÀJKKJ$KI`&&$HH!&|V@#6#;K9L2C&u##B($7HP\6Kh+q5Kh*O4&FF'FF#J!hB!-I(@l+K''+@J2R🅶??REsڷ??@pH??BAKh+@V# $$#L#V$#~#%e%e$%e#V##$$gBɠL$I hK h#SѓK hzIOR`wLOrI FK`(K(L*2+0щHj(KJ$`(+(x+𯀃H4V(Yx+V +O: 0`F@FFIF0FF($+tH#x+YF FBF8!F@DvF((FEL+?+hYK#C(_HX"*+ "[x+*x+PEе$I(@I%! F,OH!F5#O2T3(FSVS\1=HI0?%V3 SSxCU#xc@I F8?H)FS FE<#USIUI+h#`L!a'*O IE,-w/)*Ka)F Fxb#c,TF (hEF*F H!FzO5+IHn,8`OO5\\P$0$%e$ $%\%e$65$C$d$;\$$$+h$@$$ Fi|O #!i@Ci쐹0۹h!`h ژHiVi,c9F@BTRF9F(FN,i+ЍHiIFh0i"isi[ (F((FO52#H/.-w(|Khk- ;;. < K#C?IPH9 @1OKBh[I=)F:O GK*FGIh#I(FZAK*FBIh@H!x|+! O4&FF'FFAO4'FF&FF%e$$0B@$)# )E$O)r%e%e$s" F IF(I" Fz@#FF FpI FVFXI" Fd(I2#F %h++HPxC I" FLF Fp@!!!#!)𵅰#!2H툱0Kh++!F3(I  'I 'O'M'NB Kh+3!F:!R#(+hB #+`!R#_4hdI F8#x|+ FD #3`+¿33$$T$$$gB𵉰 FFGI "F0F+h#3F8DJ h20[aջ O$p)5KBF$$hZ`}1-O+K"`AF IF  @BB  L#hkKE иٸи? G 1kKE йٹй? G0.$x0+\ Kh+?WGS,?_$$$a$-A!N 4hdH`KO2` FApGO I#;` AFF0hh1hH&0hKI@F"`^@ ;hF;--k G)F t$$*i%e$ $*-OdM"#JFLFxi #   먱 (hCkFBF{H9FzKO2`$r 4OrYi FqK`tBFnH9FjKO2`l9F # %S!i@CiKHHh GIBH S(4K@Hh@K)h A87k0CcCCy<7B":'&B K/Hhs0 Bѝ0Bѝ B'K˅ :78'#I0hJ(EK0hQ$|$$($$ +$$$$+E%e$0+J+q+$,,I$,T$+v+++$0,)$$T$Ĕ97+O XF M#0h"#!;hc"Oq0iHf8'gI0h(eHeKh#0h"Oq[I0h#  0XH!0h87(SH297+\O 0+?Rk;h3h#O ;`DKh;7='<:7?H?7>7OF0+ѕ , <  # !1'@C`F,,Kh,JhO2`[F')H!!$K*`F( 0;#097+ѬKJIh0+?死ѻ O %":`+#0h"#!,b$(,$,,$,$$-$0$,$T$SKFSLh h/1F@:F!^BF@! hT0#h9FDO#0BKh+ؿ<#As2!  Q t#9s Ozs"!"rCDh+h#+'H'K(6 hAF h+h#+H# h*F!8F'`0Н90+ #"!#8F h1F*( H hO3 #`$|$bM$-`$-C- -AFgO gI#;`eKhF,*@bLe"``KaNh1h"`*h`) Or+3`ZN|s|ˆ6sˆpNKNIh$!$!`LKh(!(!`IKh,!,!`GKh0!0!`DKh4!4!`BKh8!8!`?KhKHh&9/'p7epO@F0' H0/<.+3<1#;;\-\$$0-$0F7MM+h6H 5K14KO2` M0@ۼ!"A  #"iF(&H,%I"(h(hH"K "!Fh(HK1KO2` l մObiFC( /( Kh  % " M0$$-$%e--$(0LO3#!FHKhLKh+*ГKh+ $$KhB"ѐH(" KhKHhH KO2`KJhK)F$! F^~KHh* 0wKhB LHq( ! FB!6(VuI utK#S<qH(F9 J F3hK#S/eH(F,^M kh3k`s ~ m > FtMH#k`WIhUHu( (PHk(OH!F  JI @K2I\`FKhX3EM+hS  8+d#Bqb Xs.@ ZeH< [$C&F;+ VJE ؉ L ىXKh0=4-s(!PH . # G# $ F 5DK#+r (h +L:K 9h# ,8h#Bs##~ #3B# (F #3B#U hY`x\I#BpK hbK# hH%e.Yj%\$%e`$..$%e$%e$%]4$$0.$.M(h(t,` # R# KO2`V ]x Xw +? G| 4|$%eŰJ Ih# FJ g`JK I KJhKh@ +EцKh+^O2# Jh;#H!(X}L%#h+O|KO2` 3@Ѓ3@уwL h(O3#` +@Ƀ +@̓gK`fK``K $iKh+,Kk x-+ +cKcIh_K `Ih+  E(FXI WI K K TIn(R x|+N !(g /!F<h+ 6h + EHr| ##p Bı ! /##p(K 8  9H9K9K8B < Af+K4Mh8 < O05/KhF!KhKh+$+Kh+Kh+߀;+w+OK#SI G ȉ!(< H&F%]8%e%e%e.YjV$$gBɠ$$$(}.S|#O$%e$%]4# JE ؉ L ىKh8=<-(fRh +]ѓK  # G# n +@?J2+)?}C@=Kh+?u KBp!???c!# ##:0RoK h"SlI*FF F BiH0( gH(aM Sh;S`+ǀ AF| ,>VO ,>[LT[O2C% #"B,F Sh;S`+ bB? (4E2Bu# "#( hY`x43 FT)h# (h#hZ@s###.Br3B# Sh;S`+" F ,+ [.G Z Ph +SK [W hY`x DJ3AK`YG$$$$O$0//)$%e hY`x8%I#Bp"K hK# hH8LI h!hH I -Kh+?,   * ) +?3 G. .$$0//,/`$pGKHh$0/81KO2` L" hF( HKO2 @`f %e$(/FIFF F0PF"BF 8FL hF F8)FA(4WHh;`+ڊiB ( hZ `ppG L#hK H I 0 `#hOaHhK*FH$(2$,2L4S H I 04OaHhK*FH$(242<$0FJ$!F FhϱF5FEмB12,FF!)O0FW-OFFH8I@FF0,b O,[1N1K2J 1M)F0IF(hH F! F O 8 z+F F5W?FCF IBF<, BFYFh^ "F0FhGCh " FQFt$$2h$(2f2^W2n22?KpH!x!)$))*!x"F4 ) ))Y!)&F!x"-=& -)&2[!)H!a"x!*Fp!H!!(\-Uxݹ2%[H()(*FV5x2F6-"-2F2[![F"("($(^,8LK (8 K8#8`$8jFF $838$(%p$p𵅰@LAN(8{JlixF#1F6I6H#OB(ڂ0$8+ 8hhlCF)H(8# "H,HCz3,8H)h "#8F08 8$hh`G483+z# hKB I g I c$(h%pH n2tpGFI I"F @h5i5 L#h3 `KhB|#hXBXA^0$0KJ-OFhh-CC˰O!f#`h9t#@0s:4 .z@08 򐁵@PF1F@0 P0F FsS @yKJOq h2J{IEF IFPF JK 0DFJ[FFq~DOaaPFOaaFPFF q0DJ[FfDJ FqDE q0D2J+FDJ:K2Bs"NO VF0+3@rI  y0+R(𠁜I |Kh+dJ 1!ZDJ;sK@F9Fb턋@0FYF $J@0 q D {+{dOd [F*Kh|K*"-:Dh ~* yKyI DqSuJ[ tJD#AF:FFEp+@#Ա[#0 qgJ1DQh` 9t#@0s:J IK@0)p8 π ݍ@0 P0^% z/CSO"p-@[% # @Jd  q2KD p&K {#+r ۵ټEp+JOsEs J%JOqF Z"KhFA  Q! `H!@YA.%e$$%eH%e`%e6X%eQ6_6i6v66!$0$%e$+ ! $ 3BR +# F<5FF9.z 9JYF(FD+ q3JD2K "FhCtMa#`@FF"K@0! 0ȋ{jB?2 OaaFJYF(FDOaa0Fx F #HO0hZ`xMc& p`nCh;C`+!nCР + (,(\( `nCh;C`+ZB> hZ`xhZ`x)F`hv4%e^46%e FOF9F@.!0FF!F@Fp9F0F*F|]d F$$%e-OFNF3x mI0FL`fHNh+ЕH1F@+j.!#1l%(+0rK(FF(0@e(e (-@aFY (~KIFhF(@RIFF(5FHAA8h8F>`( (n(l8(*S _]9F(Ьh_IȱcnB( WHVH`nO0_F(0+8FcnA(BHBHnC(0+8F:Khc`n$hZ`x ( (@ʀ`nCh;C`+F.K/HhF#-NYCS 2U+I`nBh:B`* A$I K$Hhhx h 2@ B"p (z`nCh;C`+BhZ`x$V%e6%\4677Q$4$07$,7$ 0J`"ch.IB.K.Hh`nAh9A`)"Cp (n B 10hx J; Op3H9FFO0+Z abi2` (?=)>KHh6$,$,$077%eKhF;sI F@xI" FhK"`320[K"Z`I F@K"`I F@ K"a I F@(K"Za8"%\8(w84h;`+ڊiB ( hZ `ppG?K@Nh5hO33`=H(6ѕ;I8[$48`%\x%]8%]<V%\$8E%\|8f8r8L hJ##`$M`J(h`J`Jh)`KO2` K` K`@ K,`h J`8$$$T%Tp%\|%\x$$$$$4$  K"`{ KhS K" IhCH!>$`$P$0$F"&Mh U+h$N3hc!B0h@#3`N0h(!0hPO33`#+` }+hN3hc!Cj0h#3`#+` K `dV$I"F t`$T$$$%e8mK-OFhMkKFkLFhjKh8F@F M@F 瀹4 d$CF4@SKObhD!4puB 04T K?KVB4pF FFF%\gB%Tp%Tt$T%Tx pGFFFF1F8FF숹 J"`o#` J"`O08FdC\ *F"T,##`>BNsh;s`+ 0Fh (|o#`3hZ2`x +0K#`;j;xH;-CF OFF8F$CsFBFHd 9IBFaB #H9D;U$BKI J K(hhhhB+`  2`%p;;H;;$H$L$0-Od FFFF  $ #CQF@CHFPI@BrI"F0FnKh+6Й FyhBi/F:i(FiCF$ #& bh6@C9ii0jI `@B@ a`fH0 F d "!(F DF_I_H3Fj I"F {H(F#xHF F F!F FoHF(F!F(F,Z,gHfKO2`$3h*F8h+=bI&aHP"$B4]K]I8hWKO2`>z#=(F!F(FT>j#=(Fr!F(FD>Z FGI 0hTAH$F F FL!F F x+7H?F(F:!F(F,/K`/KhZ"(F( # h+h#+DBD(<#`$bMhpGjpGCjC#"!h ]8!0! >~F (F F8#`Cb$&F0!0F>iF2F!`Fb(F#ObOq(F FpFh h`i>`h> F> -OFF FF0+ ![Br#fC,j,8дBii8F(4F6"F +j+bi#Da.r2F(hQF*B h+z h#+uhbh+\ѫiB`"Fhi9F\,b$aLFFa+h0 ##0O 0+P![t#:s-IOxOzs(xBF!hF?.h+h#+h2ع#b F h#+$hi!F>(oO86DDl(j Kh0IF Fv<#`bbM$06!$Sh-AFFFO`>F``0Z #`#bOc`j#%(Fj+!B5B?ah*F0FD#sUh+D5F`bhp3" #FFPj+j#i+#ibhY!aTh!iB I`hAF>qF(0 +}FFFF1F8FFjC K#`o#b K#`O08FpC\ *F"T,##`>B" +FF0 + K#`#ob;j;x>pG!`!H%jK!Z0K>13H1hGpG%ja`>.K-A°h#KhCKh,@ BL !F*!F &H! ! zH@wJ1 wHwI !<hGrKrLh!h FkMA,ǀlF#hx@+9kN#hx#bK1hGfHgK*F(FL(4 h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`QMRI(hFFhPMGN"FOq8FH F$)hIHIHkkFF`0)Fx08x + F @HW3008FZ "p(7O9Fxc8x + F)H53x;x,+x +x#Z"pOJ1h[hG F 3 FK!FFh3H%u%vl%v%j>a`%v^t%vUG#%uVhD>l>B%tL>[K! `%wL IK"` %wDm!KH`z%wH%k Kn:f*oB (КmQeppGIոHɠ-CFM O"(hn1+`&O  "(h 0s FF H>I"(hq%tLa`>%l%wD&H! z! vzCF3ИBH! `! \F V!F RK/!LA F@`A" F I Hn I 6!FIHdI>>a` >>K"sLXhIH1N[P+x;(F)FFph8I"ph4K "hh0n+H:p%v(a`: %v0%v8> HP"iFu Khs K\A F(H!FHlF>%qa`>>F K!h8 F\H!FH8 h%v@??  K|Al#x[ FxK!FFh  a`%tL K7FLA/! FtHAJ# F+F0!Fa`F pFx# + + `F+FK , ,њB10 kx pSFB-AFNFFt3hshFh!FH$Fl=C<HAuS ,-)2D@Fhs##P^`>?-GmFbL)FbMF h`K"`I`"`KXh_K_I"hL h " # 0" h <*h 0*""@ +QJ! PH,OI GLOF ^F F#hù" 0+O3#F @#h +*/d"FB5H5K>1C *K`1H40J! /K"&IXh1F p mW(ѝ 0+ + +p K>1+HAFJ[ERFjE Hf##`%tL%q%wH%v(%v8%v%u%k ?a`?.%r%v0?0Ű*HOr0J &H0E0 "H*"HOrFM ! FjI Kk)F (݄B!Fh = H F~?E?U?k?x a`?K-OF0"FFXh{I'zI pxJ!F8FvKvI"hu=(7rKhrKn1" mM"'FO ch;c`+' Fj0+cCa(ѵ1{(_ (1 #y  #hZ"`x (i+ѵ.1+  pO  +е1+е>1#7BH9Fbn1+#0~8K"hv *V5K l /K1 4>x F F FnIF #I>1$K"IXh "J! +~h*"" @Bщ.MfHmHH%v( %u%v8%v%tLa`?%q%v0%r??.?%wL%wDp°9HOrF(@6K"6IXh! x! t1J!(F~/K0I"hn%,H.F+K>1C `'H 'K""IXhx%J! X! D! @Bp (FFFJ(݄BK!h` !F $!F HZ F?E%v(%u%v8%v?ka`?%v0%r%tL?p°;HOrF(@8K"8IXh! ! 3J!(F1K2I"h<%.H.F-K>1C n`)Hw)K"$IXh'J! ! ! Bp (FNFF(݄BM!F(h!(h `!F !F H F>?E%v(%u%v8%v?ka`?%v0%r%tL?0LF hnI(FJCchCc`! h\ J! V 0#ch#c%tL?%r0 MF(h> I FHC3(h!0 0#3%tL?7HOriF(a4LhFPcy#cq0K"0IXh&1 #10D#00#01 1 #11KHi1#!1K`1 #12 #223Ht@HH?a`%v(h?%vD_"LI h hI"@_%tL t{ tzF,!@ 8F F 8)FU( 0MGI M0(AH?JOaF;KLA:K,F f 2J!F F xC -H 'IObnFBѝ03 +IH",HIHNoIK`!Dx *#Cp H{B8?@a`@ %l@kL@ @0%kIHP";HDOr@!L( ` IH@@ HOriF H@KhF!hkz%v@P%wP@b?xa`0P"MI HLHQC+H M0@(55Or@!H M0@ JOa5hF J)FhF+ M0%v@x%k@@b@@8?P"IHFй HI(8@ I HW M"FlTn1+Kh8@8%v@PV@a`%tLpP"m I!Hz MHQqBF*H mp@&+mIFZF8H1F mp@ J5n!jJOahF2 IjF F mp J%v@%k@V@a`@@@IH JBL-O(F K'ĒO5K"`%缱=I,$'J#O1`8J`8JpO3%O5 O4 1IS"HF+J>``+Kp,I b*I ^(I Z&I V0$J !$H"H(O!IOK%v_E<%uEB&|EBvcEGE:E0%uEZD%vEw%vDE%vl%tP0%QF%pH%t%p-I"-K:``p0+I+H!z|,'H(H,k'K-O! #H#JRh "! "! Rf"KxCCL! h0 I h"! O0%p%u%p%tP%tL` t -AF_M+h+i@]HF\I [HZJ x/)69-WI"F:z1TNDV)wQN3hCQI2F:g0OS3`MNNI2F:\0Oc3`JN3h+e#3`HO:h*iGI"F EKP``AO;h+(:hBK`"AK`AK`":K`5Kh*+5KOb`6Khk`+h3+`lhL,! F0K(@a`h` F#x/+! F<`x(вs6 )H OR`'H!F "$HW+h+}:yI:"98 0`3h+7Kh`KhI"F%qFtFyF``%tG%vp%vl%vGF%v%vt%uFFFG%uGwI:"9huK8 `0srKh)ր0h(8hh@ kK:"kI`9yiK" hI:"9odK"l!dI:"9e_K"`aI:"9\[K"`]I:"9SVK"!YI:"9IQK",!UI:"9?LK"%vLGV%vH%u<MIFF(F2I"F(F. GrGJhI 4 %qt HCh;C`+C hZ`xK[h+##@H%qL! %H` )F%qHJ! %rJ! %s0)MF (I#`^! Z!H!F hLDch;c`+ F>B"p 6 2 KhXBXA0#hZ"`x (pB3 %q%`H9FJpGB pG pGKO\ v^%?'+)"HpL !BaxFYpF)*F@2[Zp F*F[_p+%sDG(K((O^@0d"? Of"eHpG"de"%q%tDFHLMNO < <Kh2ùoF0F  <T<*" "F8F 4G^a`GG%q0!MFlr!Fw.!Fw2#SC@rp"CCI2C32""bOr$ !b#sCcl!: 0#c%qa`pMkh FB @(`h+ HL#x+Dq2;p@Hp%qGK7nM0@KhIJ*xb Bl " FBjx ԝ F H FhG 0) 5a`^%q`pF-L.N1 x[<(FA%I F#s`p"I F%u`FPI F@I F0I F I"FHH2+F!(FN$M+4,B+! F!#!Fa`%qcvGEBG`4%tQK1#Kh a`%wXK"LXh!FXK!F"@h%v8%v%v0p°#M "(h&F|0 +M##p1빴B"#1y#0K "Xh&BpB*(h ";TKh(h I0FtK`n#y#0#1%v0a`%v8%wXQJ0[ `pGa`-H!M XO! WI hTI T;hQN%#00# 0O2!hF(ݽ0FI"8h( ݛ0S+W+B+F0ñOb O@* Dh+(F +Kh+ O1!FE("F p1+0+ж ڱE ^+ h;`+ hZ `px @+"F!o(iB (ѷr%v(*=a`%v%q%tL%wX8F L hF F8)F^(Рh )FV(4a`CABAJ@  F F@y! H@'y;+&!0h&)F0F P0F<}(F`H#y#P#qcyCcqhB`+x !;#B`+x{HH IF n; f+ oBۋmXep]KpG]KX1wHpF0L#h;!+.h0F@#hD+y `;+65.555? #h"+"`0#0 `! )hHzH1Fvh#h3#`.F #h)FD#`0h `1FH`#h"+#H#`p@g H1FRh#h3#`(@p%w\`QHHFpF+ B$B Fpp\* ^*Ex@=\ FEx0ֲ.؅x0=. , Hn"BBx/*x0=,H-CF9I (=7O ! FF6=! F0F(9#p FF(Oy5["(F4FHFn4F`y! F4#h+L#h+H##`LAF F(F F)F?! Fpp FbF@y!th(F#x!+ ` FP!F!F8FDjI%w\Ha`>M$L%F h\1Oa!JhF IhFFXNO"F@1hFz Fu0#u0 M#y`#y4BT<hD<3hiF8F6 !hF#phF3a`IV%tI)pF FFy[ FxF(F pI0F8 FfF!F >s$M N<H FpI"(h *(h1F$RI"(hI(h"(*I(h("0!HX HO!( HK!( %tL@fJ>J: tx ty%w`0!I$ fK,3CLF0 V 0KjK "h FPPB +! 4]4B2%w`a`%tLH\!H,0@Ja%w`"%L&I h #I" h! hw=@ x! hwI" hH}0(3(H$H" ^I hXI h" R h!w`I" hF hb%tL tx tyJ~JJJ@fJ0F 0=K>1@D4KfKKtKK%xKKLL?ˮ2,QF i* QFm B2H31HNO4&F d-H-H-H-HDtD+ %dnO34+ع?H h BH;2 %r+ h BH; 2 +H?a?x ZLL-L?LQLgLLLLM-OF O0 :FO0:FfHfL8%*F! R hahCF"  _I"Os]K%%o hiF8WH,FO7>FFFi`%F'F&FFO2AFXF?KHO4b%FPF;,@F;) 8F1FE5D ùO2 QF:H@HFQF i$ Gw F !g(/HH !g(AF XF MC BU1F퀹0Fv "(Fx(0!F UH 0CRH!F$PH#"(F#t 00Or@!8F\(FF ~pFL +h + ;+ (+O HGHHHHHHHH4(#ih0H "i0h %x %y\ HLI#`BFZ(H#`+#`F H!HHH`HH(H#00+)3+3ȿ"-30ĿK`KxKpHM(F+FH4(F+F4Kh+cKh+@^H}H4 T4 TvHz`ax#SrHoh a+x#%aalHbx##ahK4gHTx+@#T4S_K_I_HP4\I]H4[KB4XIYH4WK44QITH4RK&QH(FOHT<(ՀLK5KH0M(F.Fx{"F[xF(Fv(F0(D)F=J0F"M9:H(F/Fxi!:[TF(Fu(F0(D-N)F8FM2FWZ%x[ w [b%,%y&ʰM&%%xw3R%}i%}v%}"%}"%*.!HZ(FH eQ(F.FHI0(F)Fe5xK"`  #4#H,(?"x+?*F0Fx0zE3%0' L5 Kh+ JiZ: Kh+JiZ2#5%x%T΅%XK!Jù%x΅KJi%x΅K!J%x΅K!J %x΅8KLh+JiYKh+JiY Khk 5iB#58%%X%x΅%T%pGFK![ @!JY%x΅KxJiKpG%x΅Kh+ k%KJi3%x΅K!JXi(%x΅L5J!Yr5YJ!Yh5 J!Y^5J!YT#5%x΅BKhCCH@ `pGc8MFJ!Y0 J!Y(b J!Y #J!YE8%x΅ KhK KE4@ F@%4%xFK5X@0g F@%xFF#XBXAK!Jp%x΅-AFFFFR PB??FH-H!AH)F (BH!H)FB8MLGCH!@B4B<L-"F"A&6JaxTRKhb33BpG%~8CMF+h3H!(,`8c-OAq N3hcS,S<B*[B\ ddODDWEFFBx۽0hhB ѻYFHFO 2CEB ъi1&5H h%~c JhRhz$KhpG8<pGO0FpG%~OЮK-Oh&O0+3h(B,t !BEB0$iBD?  O i BvthB2??p04ՎK[h+ $B B  9(@thND#``#iFa%%Fi`a{Ki(t,dGGvGj??ЎBw$4BBk4@O :F3F??PaHYF_!BEB*0$,FiOBTKhhBJ``h#T`!``h` i```a04iB+DFhS 43 4dsh `ip```i`ad6Khtd4KiȰhHx*DwO2`"0Kh[/Kh(2i1)D0i@pDa*8tkh `p 5Fce ;8I p9[7HD!84H=x1H51J1IW1H.p@/J0IN3 9J!(,HF*HFع)HF'K$%&h&Kp2o%pB! H~I FxI FPI F(I F(H!d(ЦLpp&P\% %$hox%~}K\pG%~K1F0J FH !)IHt HR@F F J)H F !pP,%~%(ò****+  pG pG pG pG pG pGFx+F(()#B #RBҲBbx@) \*3FxF8( ':F`xa?C`x |`Cx`x|0Cx?Cx|``x @q|C!y?Cx |1Cx`xA|PC`y?Cx|Cx |1C y4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p%~FKFhh)ݔB 4`B <) x'B F!IF(F8,5дiFBx(pCOѴOqCJ FIPJI FJ!FHtJ I FB H!Fk F'0@'0xxxL#h07#c`#hH#hZH#hH#hXH#hH#hHK@!hL##L H H%O!/#NHMhs`@4@FSM(F\h(FW HS,, !@FHFH%fZ+ĵ%pFKFFX` 0F))F Fp@%-AF FN3hhF8(FA¼3h#c3`O"F0h9F3h#2` ۚO(H!(FнA̾%)@p,XMkh%+F>+; +p; +R#pWoYoYoYoYoYoYoYp)p9p +R#ooYoYoYpCooYoYoYoYo/+"7+)hq)`p@:iip@U#x%F4++ +,L h76+x #`(F `hFq#aAx"kixp@x"ki@xKh+Xp@px!+(j7 FO(bKh+q(jIHp@@ Kh.dF$m1FHp@%%x%x&K??h"@! F Kh M+ LO/h&h*` `KeU/`&`%x%4%%~-CF)e JFFDO3FMdd2#00CԱ2Bv#0a0+Л,8 2 3F F"F .%x%~% KXh8 pG%KiFHY]\pMj#bp@ʿ5(kh+++ j(hyb7 Fv bpg %!F Kjq`"bb%8F D,DB8 -O#jLe&-hO#`hKh3s[;`O 0C\KhO0';j+Do& (( P;MKh JKhcH*DKh(0 kO  ~:H98+0+e.7F԰Ԑe.@ch+q+o*+-+,+) - -'s7FdHЙ0: K 5HF/+07+0 +)(F(?Ich#;+P(@K%%x%y%x%x%$B% %,V%x.-!(Fd(Hech+(F(? i(?x#}F.ȅc+ӅR#yy7ze{x~y|i~zy]xz;{{z%|I|zy}9{iz~~{Ayy{_|xy'k~K|Cz%{{{|+~yyz-{%~q}}}{z7yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyrixh3@_- #`-+-&#-0!-)h+ -Z -Xк$;KhB?:KhB?8KhB?F--* ##`* ##@(F(?حKRFxa;+##aZa(ex(Уi#a+ 8d(3H#`h#@+7Хah)Ji!!%%yL%y%yPE&KhB?KhB?KhB?i+(Fa((FHi(i#FF/ 0](?ҭ-+-ͭk +?ɭR#xxssssxssxsssxiOS"hS@#`*-@-!-OsKh+ch7+?OsKh+ch7+?Occh7+?#P0wI#" e&W#+rqJ`2*s0kKh "!`iwe&#+r`J`2*s0"!`i2*s#"#PKh+ 2*s "2*s"##"2*s#"#;Kh+*2*s$ 2*s"##"!2*sn0&Kh+"!w {F= #+r;`nKh+ \"8hF\#+r;`Y"8hFkw;IB%yL%y%yP]%xP%d%L2*s#"#**!2+ ڄ#ck`ie*sd#"# )p[#i+Kh ?mH9Kh3+?ӫx"l K`n(?Ʈ##`2*s#"##BW#hCs#`2*s#"#ai V&h&LCC#`2*s#"#ai 9&`{&h&LCCCs lgh]K^Hh`"d\0ZH!qYJ YIhYKh+}HNKhSIFQHWQKhQH1FPJ#PI h.LK!h!!!9GH!62*s#"#`i(? !8 528H*s6K7K 5H! 2*s#"#`i(?߭2+H*s%K&K2*s#"#`iF(CH2*s#"#`iFH%`m%x%[sO%xfZ%O%%x&%(z???qKhk2*s#"#`i(?\H!s?TKh0FhJ\0F C0Fe?#`##`#wIF 0+ӮsJ sIhW"FoI mKhBF?kKhB?jKhB? (e& %͹ (?#bIF `[KhBF?YKhB?XKhB? ( (?(F0+}FOI% w9HKhBF?ʬFKhB?ŬDKhB? ( (.%(FF(7J% 7I$Ph.%#YFF0F2*s5K`5JhBOvvcai[`".K`h+߿,Khs[#2*s"K`!Jcih Dh+߿Khs[#ch+?60FI#"(F)Kh+?#cL%`5%xĵO%G%yL%y%yPBN%H%%4%yX%Kh0pG%8FF D$r!F(F8-OFF@FF hD,F WEЬB< +4##pd@F>!2FF(BSB <,**+B8F!+ 3BZxu( F6F6F&[K# F'F<`E$hxxBUXx]( g(  5`d(f(d 羱Xxg( (xF3(?+H+F30 hZ`F`XxpG-OFFF ! 6PF(J=D?XF+ ;NFO5a FFH(ڽ@!H%c FFH(ڽ@!Hz%K FFh(%K FFXh %7F MFh(0 Fdx+h!F( %-GFWKh$$ F?!FFF0F6-(F)FyF(FO4!8F6zF(#"(F??0F6:F1F(FF(FOsEWE0F62xBrxM*Ѳx+*xG* ,<+9F0FA,E*,n*uc-GFh0Bf0F 0F 3 (F}((FyKh$(FV FQiF#F FFHFqF+@ЀjIHF(`hKO i%cK(F`+ FbM@aLk`/`4`I(^KIF"`%ZKh#h @Fd8####QKh PM@F6 /h#+`#hH$HK1FhGFKh+EH0F6~BIHF(O3O =IHFv(O3O HFF 3H6?8F1F8F6 F7@F60F6B (F *@FF(0FKhO Q F(C(H Y(LO 7%xfZ%%x%x%x%x%x%xO%m[%h%x@Kh%xKiN0H!V @H% fZ-AFO FF.@F=F\ @F(ѽ;hѠF% KF"h%xK" `%xKFO2h%xK" `%x8F$ FFF@B F8@M 8pF F2F F:F FFFF#x+5*FAF F^,D;;xx-OF8$F%FF,K,JF,J8F!(FFKhO0 &JO9F(F_Թ/ݹ LFMF F)Fֹ8Kh7KhCXд??R3Kh+N2Kh2KhCH#0)Kh+,HQ F)FF?? FѸ!F(!F( 9(@F9??кE K"O0`O#0&.U%y%{%x%%%$%( KhS Kh( Kh+Kh8pG pGBppG%(%%%y-GFFFB#.KhB̿&&F  F)FF?? FѺ ѸEGO0U& F)F.XbnFKh+`%y%4-GFFFpZX 8 FwoF?? F6KhG.K h9(#"F8F+FlFO RF F aoGF?? F$%F%~%y-AF FF.F?? F AO0Q*F#F8Fh)K(FFhB pG{K(FFPhB pG{F @F޿8FMa+hB F(`# IS``#hB Jhh;`5g F8@5bi:ah8%x{%8KhpG%8FN F4hB0! F8F#B5F#vca`+h 5`\`+i,`3#a#h h8FX$hi2ahBJh3` F{%8hpGipG Ʉ 0 FȄ#vpG~pGCi DCapG@ipGhpG`pG-O`F F?? 9O5,F(F!FKh+@🀄K(FIh hBEr)!O1!F(F!F=(ѨF'F0A (@@F9FF@F9F>F BzrFCF ( nBnA0 ,a{.+F F@YJhYJhQ @X!eu FXF!$@F9FF(wNKhe"K9F`@F* |EKh+?i.?fd (m (k0rO?K8KhCZk?H8o0ADRF3F6J wi jz mC&{ ,& K` F$KKh+0 (0K"`F FO oL`uiFE0ꮇ%,%H%~%\%%D%%% -OF F,w O8F@FQF GFTFrKh+qKhABOpw FO3:F#FgKhCcG3F(`KhF - - (Z (X00 (R^M@0F)F(0F)FFF@FQF]?F03C ()(:6Kh6KhC4 lF/ cxagw0U0 F FK`XF KhKh+K"`#BA!0F)F (, Kh+?"#0F#)FG(?* %,%H%D%%\%%% ??pF F!B ( (4E KDT4E0(&KTpcc-OFF F!FF(F;()ۄ,o#3#F F F 6  FF! 0FPKh+} O(F!FF0IH!OJFoF??FFELEuA(?v" !($kj CD䲼D_/AhDF /p>Kh+L+N@Ibhk h2D+l݂BNMh)Fm"!F .D>D F0KhDB/N2F!F (=-_(Dlj+hhD9FwF((b+Kh++'+RF!8FH;P#B;m>F:%7FJFCF%%@%%lc%yX| %;h+#RF!F0F-CƲQLFF0P#! 0 .HKhj+ #x00 IbF0d+:FCF0FVFi`2B5Kihsch #hT`-0+Рlj#d3@`:FCF!+ +0Fxb8FAF+ѣlZ#DBd@`HXH #IF#bFdCFd#b(Ѳ%@%%yX%%8%Lj+b8(F%@-CF2LF08 ('#!i`Bfheh0+ im!H#h" HO #`KihB Kh;Kh0+#h "T"T3#`#h"TTT"3 Kh+и#h "! TZT3T#`T%@%yX%y%y%lKh[hp@"ppG%@ Kjz Kh+#~ `pG8#B `F pGZhh\ `\pG%@%PK"b"apG%@??-CFFO0FF(?FO\ и?0 h"U3`-,`h;BP(o9`h4}F%@% )-GFpFO0F9`(!Ohh<Uo (F<1@h#D3`-лh;,`ѹ?,(1 2; D DBټh h<  F%@% JB hB Ah#A[b#%KHh*J!`!`%x%4p L#j+3d+#bpcj&&b]0BH1F,O3% K!F 39C < K JbbB  ! b3 pG%%%-AF(L%hBBA*۠jphb#aXh`{(Fx@Fujz#hFEbj!Q`[h`BB-hj'beBqFFFF'1F(FcF%WK-GFhF&4F??)pNL%hB2Bs 2EBd0F!F-hyB`b#h `cEr9s( bРdYEu KF*F0F!FPOExI9$%% -CF_TF F-FF??.0BH:F+x+m(Fl9H(F7Hx++xF, Fo F3g .8F8F(   @F#HO T2KHF"`a O(FF(PF@F0F<!D XFF9JSFYF F0F3 HF$u%-%4o-GFFFFFuF@5H!O5(F1I FyF/H)F.H8 F5,H2O4(FQ(Fp! ??rHEy!ۘFFBF8Fy8!  N )K "`9F0 ,4CF9F0>wa%%4-CFFBF??F4 F??O0 F$%F."F+FBt BF;F0FJ?? O0a+ H"A+ؠ'H!7 %\.(?$( '(Fб2??H!^(Hc` #aKh`(H! Kb`Jh:% Jh$L`K`h4Hp%%x`%y%J#3 5+pG%@ nF`mF(FKh#`p%xlF F2?? ДNeKh4p%%xpQhKhKbBDbT?? B Jh$EihB2F)F Fp@ƹ(p%x%%`@KhhBH!=O1O0%x}K5"h3BC :pG%K7 Fh5H!0@("(K`0H)FKh+H F K`0@Ϳ Kh+ H)FKiF Hh%x%xcK"`%xKh+ JhSCJ!JC`pG%yCރ%`(*0 x.+1#I"K`#!H!FIXH!FKO2`K`Kh*KHhIj(C\0*  #< HF%`-OUKh+ JhSCJ!JC`pG%yXCރ%H(*0 x.+1#I6"K`#!H!FIH!FKO2`K`Kh*KHhI (C\0*  #< HF{}%HO FF@ F HiFp(pK`Kh+p@!HF&nF 0Fp@?F?? F0FdK(F!Fp@h%%x%`F+F + K`]UKiFHhcX hKF"`@Kh#@H8%$%(!(7 F/0 xm+M+h+!=+L h s+w+L55L5T2(F `0 L5T L5 L5 KiF HhKS"0%%m0KhOpG%p(pGF0D,'ؽ@K"H`!HHHHHHH H H F%x\w%;c -CF-}F55.4M$ '#F xF10:ֲ .bU" BE$04;,+р,&K`c K Ih DT HiF8IF Fn%| |$;LFQmp( F0x3JpJp]Px8x*H] Jp(F J K Hx0Kx0#0xxa08(H!ܽK"`pG%xKh(޿KhpG%d%yFxFFEHiF,F F!D!8`FO!xi;hK\)cxS4;;$)#+p.0F@(%0xBh+h FHJ*!H]*!JH%_LIF F F%(hS  pG(h ЀipGHpGKXk8 pG%KXkiFH<]%FhFFMx-+0""x0; +FO F0 /.` ##`@B$##`O0.HiF 08-OFpNpkȱh+ +Ci G#sc Rsk"iF `OFx*\x-(ZJ$(,(٠ ڲ#@ F !V Fa =O O F F0F,q+icHa+(#c!#F F(x++%02j9(/(z$n(;h+ n$z$Xx-(3+(@3%Ha O O !xF=*hh**4H5L30H#hZ* =)2M`ci G(A[ ! `в O *Fxtc0x +iRF$(x+"QF%%%(J%x𵇰#@FFF(FcH-hY$]H=ZH**-x* hZ*1Ae_-ci+-   G@-Уh/jѣh+`+`#ih+;H!e#i!h3T#]O-B--"ih[ `2-2- -"ih&N&`)F!&V&`*F+H!h---!+#i`#`H!PF+ -?LhH K"`C#iih/:y%4FhFFxF0; +FO  9x>F709_ +J;+.` ##`$##`O0. HiF "3+PCKhKh(   pG%%( H. x K"` L#x#i h`h!ciFG$4*%(|(FHx FpGBЁh ;B$0|(-O$.MF#FFFF*xR+?/MВF#;`PFnh$5"1hHF#e#, A8(ټ- YEYE 0hFF#F@DBDAh*vh"# `+иF|(!H6xK" "!">oL#1XKh1J#B12h+.h#+O0J131+ %%~H!%hFd]Fh2F(FF0F!D4 FJ+F!FF8FW8F-F~ @0(F!F ~@0  q P0~F8@Y8LEeBsD~J + @1a  q P0~8 FA.Qp N M2hT K"F)Fh+  ^5`BK"`p%%x%4pF M4##4 N K2hB3h FZ2`p#4p%%KshK"`pND FFv-44(F% %4%D(-CFFFIB`@  F#08F!F #"8F8F!F"03= #.QF F.@F-#<)Fmʿ-CtHtFF# 0 F !4F0.8F-#<)Fm`-AF F$x F%(_34;F[xn+s+d+U iFhFphF"DUk (jFb ( Ђ*I@Խ@۸F"OF"JعAB ? S)כ!כככככMכככۯכככ%%x%fZ%x%xb _+?ή?ʮS)ڗڡכככ-ככAsככہככiכככ)h"B F+`"p??(Qq^Kh|)pYKh+93`1@d ??xYQ uR9`})pCK9hBKhC@8h8h8hQоK@+rK)p9`(#@FF??F F+rPFIFueFQ FK@+rF FQ 9 (E"> H H8h(kHH%%y%x1%&K!hqKhKhd K K KXh KXh Kh Kh9NK"`%%(%%yX%y%y%xKhKhKhK9h-%yX%y%yFF#FFhBgBqڢB dBvF,Fd[eABv4F)FAFBt1``pGsFF F9`hh1#k`T FA !Fh`l F`DB"KI` hұ) X`pF1F F (O0"F!1(" Y`%%|-OFF F*6*3F!   S$0FXHs0ESE>VE  HRFi# '(#h`hpEEXH|CL H%E ! pF`hCHp  4F% hh@ @h8 K""""pG%K-GFh ^M $#+bKh;P F F??F PF8F1F FTF0;B$%(%%}%y2K-Og??V-J h,KhQh #O&Kh O TF0;Bܺ1Om FF?? F@FB{ڰ??ЏBv XF)F- FO DDFcc%}%(%y L&F @H#j [ #b@1%b8Fh@K ` 8h0(F%H H88F FQ Ki8!BBh   -OF F## 3jHFKh@#??МBFw+ tȿ 8F!FĿ3 5S F FYJ FF??hKhc,,dBo2F+FPFHFAF(@^J0h*#S F FYJ:FF*"BC*OLJ h*C FIFF F8FH FF FN !I 6 DK"`NM/h3hCE+hB+hJ3s[`5 K"`b Kh 7% U%4%yX%y%x%<-A!F FF@F0F!D81F`k#wa F(F!D$)FakL hBK""`#S``0P%$-OFSNMhQI:F0u/LMHFO vF  :FOaXFFp8Fh+w3h F+`#k` M0!+BFYFHF(0 + + mFx+F )тYx+!FyF FJsh`C``hp`3`ZZxx^*3xBЂ,$*O3 !!F\*33  P1%$)-OFð F CN*,O`фKJL`$$O"FOqB(fP-P|KB Fv. yHRF(x+<,ـsK(FS$(FF8FFPFF@FLD4! DgISF:FFE@F0paIHFvtFHF0h,VJhB3` #s`hб8\ +T0FJKB Fv(#3`n Fn0 (013I!pxFF2(03@Bx F1E3PhFH3 A*x23 P*FF)13I!pxFF2)13IF+*23 RO 0++x+И0+(F((FF@F{h`C``hx`3`  %$PH1% KhI F< I F4I F0I F*퐱I F&x! F$(J     PfZFF Fi( ( (H!@i}H!H!8K-Oh+eEU F)FO! FF,KhL F)F}V FF6I ?? !H!!DF=F F)F0+BF;FHF1FkK0FFFꀹ03 F)F\+ +DF=FO4%F%$% !%x IF%4(F O* 4ChBаh43F%: %$P IF%4(F O* 4C^hBаh<3F%: %$PKhpG%$KXhpG%$Khh" pG%$!HK(`"`$%0pG L h "w( 0#0(ѝ%0F(@(7(/(? pG8+)08pGa+)W8)78FhFFhx?(F5*F?( )hBFPD(0@4AA F *aKJIhhLhB K J@ hh IzDx#x ]%l%dP!-GR$N!FO|`V[p4,Kh+ XCK`Kh0K`h;hHF:hiT(FUF.%4%l%%Ѱ%%%d8F F#`KTh``8F "B`FJQh`CKS`KphNmh (F(h1FVF(Ch;C`+ ڴC !F F2 phZ`x F(%<V-CFULFdF#j+7+Z+@ej%5`(Fbkh+hIFcjb h DIzph#c##bh!@J@H?M(>IjXcj%chce#jAF8FFj3b+:x#*zxn*a.j @3`cjjhcb%bjcm:x#*Zxn*"a:F@F%(8F ce#pj3b=F#3` 0 ( %@Faeej##b(hhB`b?kpj3b.#1#pSpae%f%<`%pVLmchh Ch;C`+ڴCСm hZ`x@ %<-OFL Fm#hhkchI yKJeX3eK"c#f#cfPMmCh;C`+ڴBСmImlnCF@"k Iy|hZ`xmHE p` (;дp0۱H~I k^耱{I k@XzHp4sHl #p0p4m@@EдnH!k(F#ehHp##fcn#h[h#`#h+hch c+X(!k [K F [I[Ky#cfchxObPHahNHObo"k OIy!kOb(!kOb `(z\FvF `zCJSFOa(F^o(Fm@EдR9I(F`e(?BB m Ch%fb)I k>e( !kH4#aK\#f瘱nD< + E#`;F0Fn*Fj 3b #`#%<H x%ͬ%ɤ`%ɬ"KA+tcVɠF., I"F yFp F @F. I"F y2|8F F.w(I+F"F y"8F N F0h.)F# FlF;F)FF0` Fl0h%Ѭ])M)O&khB&Kh@>$KhBh+5>h.I"FF y #*hsCX+6h!;h@hI@hdF(OR#F!hFRF FB;h!hF 3 ]%Ѱ%ɘ%ɜVsFMF(h#I y`+i" ``h libF2H( h^IF yj p %Ѱ-CFAL FAO0DF[ij2B AjbiDba"p&-,\-Qx8h 0@09՘ \*&*Fij2B AjbiDba[i2aBF!"iOR Jh????Эij2*DB aj)DbiDba"iFJDQh*F1Dhi*DF+D%ѰFBhFAiF*DFSBAAai a `/*F1F#c`D@2D"e`ZU-OJ#L`H!3#cKh-A#d .ih*:3h+юKhshB `0+n(n-h+ bk"!kph8 +KphhxBxA`hh*ZhyKhB#` d h+ak!k@h(Ыhh*ZhiKhBgKh`+dKBhhBY*[h+h+bk2F!k@h+VK@hhpBpA<(+~=;>+R#      -  i      G                  E  [y      9 lbhB! hYCZdG `fh #"h!sC(i6Px`d`f`%d%Ѱ%%4#! 1h˹K(ihKhkC ёM!bk k+h@k)h Ql+k(k+ek5&kj !0F #cA0Fbc#zHI#yIwH"B## uH#rIsH"5#lK(ihD#khȎck:hjKB<#03 fHPxC0s# `I  p(ѽ*0+0"!&C06B9hSH9h$ <9h 8;h[KhkC 9M!bk k+hhk)h ylbhB! hYCZd+ `fh "#h!rCki'khjiRhB i %K`%K%Ihy@ck9FHF#F(#aFkibk5к#i @ʀ#i!kH[hz#Cki8Fj#ihZ9D#WT%ɘ%T%%d%l%$O #i#BB "i#9FXFRh ki8Fjz#i`EB]DO h "9FHF#*F(R9FHN H <Φ(Ϯ H<(>Ɯjaki[hcN!bk k3hvk1h nih(B"hC`Bp9D#"XF#iO Z3ADh`BB2ADh #"9FHF("k+3i3Or@ a0a0kihdI y.ki iZckBki"]IiP(h+?#`miik+ki3 (iOr@ a~ha0*i hi,ckBHI"hi$(?g"m"CI#CH=N 0 <Ϯ 0<6Ɯ:k+64?0+Joi&kh* 2DB$3x\;f3x\(0K!B #"1F #"HF#@H"! R BE 0F3 K IhKh%%%ɘ`%P%d%F$ (HFn1S 0DN H <(Ϯ H<(6Ɯof%Kh#"I#H3h`~{) Rih%4%pF FO6Bp#~w+{+s+ciiB(cih I xcia$h`iC"ifa!h`i`-CFF FF -FBI x#`@Kh`?I(F\`Oe` FX/T0FC-Zh`B FF+!*!Т<Ȳ( )h(I2F xxB`hQBhBhB:*h+ +x+Х`#0hBC`/ch+g`:!HFF(#;0B+  HF ae%0KpFhK``h)Fh+  #iSBSAh(Fp#iB̿###iB###iB#iB$h%0&ʲ"0FMFrI*F xiF 0 I xObiF FP F M0` K : * B² *IԹ QppGH I0;0+ B0Z "ppG1 H 2L!Fh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@j%8K0hci1k]x](x K|~ɹY}ɱڹ0+h@,F+F ( t)!v*"Zu( &%8Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p%8&-A3L#hZi5kC#h/J![ikL-N%-O3hB.#)Jh*B"hRi( "J!L#"hRi, J!L#"hRi40H:A ¸#h[im)FOh J!L|#h! J5[iLt9F@F+ѽ&%Ӕ%Ӑ%8FH`3I  I0"FHJHOqM, F8 !(F#p+x3,IHNLH.%8CsX%H( qF"Hx?+Cx۱0MFN! FO0 Fp/!D Fu(ЀhFS+ !F0F& F!F(F h#`! x.'qT$IFH rKD |<0BєB4KFIHKh[i1cxB [x;IH@K,IH,؄@I@F H,I H"F I@H%8&IFH 7F F"` F#xx<#`O00zh"+@0O0 FF*hiF F0I"F xp<#MU#@Bݨi^XBѢDBȿ"D^~5@K! l@K!@ eOq _Oq@ X@M! R@M!@ KIHx \p"L%h-:7(8==nHpI""! IO09O0@N0hB``0hB!`0h7@ !`+Y a J0C/B<##`(Fp%%%%Ӡ&T-OF ,bKhB@]iS$@,W#! +@Os=EDj#i FG#k FGi*@D0 P#1O O O `hX   h8x+@yK&WF&`/i*0B@3FO F^E^F !XF (XFNBF -o   mBBF 0 H 0XB * D%uR QDB!I#*=0 qQ F$@0#oz| -  J\@0P0)D3B"ےI i@SPN(F<(R( C20r1F (FG BРi@Դ DBD゠0+ݢi;RԴ Bfj&lI lhM(hBF(hB#FF8FCVF(bOEdAF(hC8h>z0FB&FO +FF+ E68h@7"FSK8h@2+F"!8h@,"!8hI8hGt 8h<GK0h3x(@|@F>>@FD@F@8h7' *  +x+q9K[h;D=E0+?6  [R#s"ri0EjB `p3D7D"rB:FBؿ3ؿ[x(c?z(`(x(8a80Bi[? (8?orD(ie[R&X&Tx%ӠȠ+?ܮR#?( (O{piиB@0`(F<&v( @0V@0SzP#P i7 jiCziD0B+# i7 jiChiDx`h*q#c`%0BQck FGi%? ja?%b is?=hh;posZ FGA?(еsi7| j0iC j?%biD(i?#a,KiS'@t 8FNiPh *i3D]`3x(d(? <(>(?YF dq(?qu(PE?}ڰ?vos+. K[h;q(?VE"`j]F?\@SB%ӠKiS 0YpG%Ӡ(KhBiS pG pG%Ӡ-OFFFF*$ PB*F $ FD!tm P00S$((pFhAhAh%FAC# HФ+ؿBqBؿO#B+FBĿ FBԿ@AvK@jIF;H (F(X. (t((4۹,@g*1R=K1'FFh/=320[=320[?*-=dD?, \#HF(`.0F1FF FF0! 9F"DF\=*L9F FQFD FXZF!F&T@F  V..0Q#u -O#M`F FF(?0FF 5 "AF(F`(h #`9FhFe0IFhFe)FhFehFB( F(1BKPF`)00Ff Mh ``h)(``hF  K*(F`K*.;\FKhKKh@f &.$&3H(H I @(Op@ <;\-G -M$O3+`r Fx(? !F+h+5B'iF +Y!#]"  F(@ހ F(@׀  y !F^ !F (,`6JqMFh!F(h0?( $ F! !F (h!0)(!F `Kh+ B+h$A(6F4*hX VI2 (v+h)(k(f (?q_!8)5F(VB"p"7B.'E<F/FEHOOp EGӹE1Y ((R (!AEE(U!@B1Yk1"BEE(p3U"B2U' RH&(F)i._77W h0G( D#kգnczRnhR1 [h !&.t&;<&,`0, FObF IOb 0 Ob `IOb `" 6Fȱ ` 0FI#F"F D%DDD!F(F , 0 a 3.V36 FObhFIObhFObiF Ob I  ` `iF u  ]3.VKK0$   ` F ,F FɲQ((9#H((4!H#Fx XKMhE0"F!F(hH(h5(hE&iF w#_"Z! p! H HF HCm!#0&.t&;<3M3X&X&T&K$`     F  F Fɲ(#Kh*!$FiF S#`"!F F6#0&.t&;<-OFOE D3x3FF+ **O 0F ( [E 3DD6@ F!F ?@1F!H4@ H>a 4@E(h@j!"bC(hAF0IH ~!4zFFh(h7VF F7(h>6F F>>" FFG FEV Fp&T`4 -OF- F F1 "1.XBFѮK` F}1 ԲO ̬LZFI#h뱟I"FF"h*ћIHFtI"F#h+I"Fx2CFt(@ "F!H! F&J; ƼƜ)Cs)&!Fw 1^HrIBFXn@PlIBFJ`#0hI(hH@fIhBhh 5 bH y xñ 혱 *hFZHH wVK"`EUK/)F(h{ )hRH4QK! "H` FN O45FP C h C` T UFŗ#QFOpF (t3h;@FR0`'z #Z" @B <"8F)F'H7T-#K h3SBF"FhK `h t45<tptb4F@f[*4Wʚ4f&!4j&.$4I4|&3kL4&&. ڿ@h+.%#" FB*OrBtrCKhAK$`<f @`E:HLPMh)5IF(F%#T)F)Z+x+?VR1(FD3h#@F|0`(F I " #0h)F>^0hE.1+x{[- ͬ p0<*?OrB?߭ `&&344 0#"2%K!" S#1 #IO3M I HR Kh HL )F! F 0@W@4& -OrFF(S+!\ (HO0#0iOpG3I(|tF0Kh(/J(/I>*I(oF(O OW 8F(F%0Fg?F#cU {B(ػ F(|#0O50Fѯ =Kh J(I(F F9F(BF(5oV&44f-OF'RK !F@.@I"F tT'-6)F !0FF0F.5 FOAF(FI2FID3F@F@I0FpB x%+@+*!:0+x'+5<*+0/!PF F#pPFJF/#;@FC XF0(@hEPF(XF:nI(Fd7.5x-D'P:h-ˀB>? >8&?P@D@@ƀ;hB?!8G, >Dn%HCh;C`+򩀮Fn?5.?MH>fHh3`TD N(hj-? OpGF\&T0ð@Fx0c.!F0H"C0"[HH"!F%%-GFhVO`FB# F#p_-и/-у k20#)F@F[#1) F+FJF45DF!FFF"CFА"!(F I"(F/a*F1F FF F,F F%pM(FF@)FF 0˱) )D<.+(`I@HI@pHp%\%%𵱰,I "@0i`"F'HH'I "@0iR"F"H8!"FCF$("!LI"&I FF F"腹MN1J"OFH1F1)F"0F=FF"!F0F@i!%i%%%(i8e%e4-O6]yJF ?( vKhuHluIuHh @y( ܡ`$F3x+@FDFE 6ROs02#"S,:QF0F1FF(Fv#QFp0FZKh0D[Y sOp")F04F FF(Fh ( 23 P,(F((h(4r! FO4!7OrF(@݀ O?OrFV\J#x FZJ#w FF(\8# \8Ĺ@OJ#y F.tKJ#z FIJ#} F\8EJ#| FAKBIx* F.r?J:>H9F< FF SF FW QF1 q:C%I;2 (?HFM8F(I ,S #X6sKF&>%5L5P5M6;\J%%%%%3&;^5T%5[3:9.@y)av "1F!"1FI0 HOA(J# F"\6+J# FAIHFF(qIF0F4I F0I F,I F(I F$JI F[7+ÀJ FII FI F FI JI (@𬀐K?JOq?HOAO \)F(?Op'F(?􎮁K JI(@؀\8~J  C\83PE "yH (vH !#psJ  ( "pH (mH !#piKx+\8C\8fJ  ( "bH (0s_J  ( "YH (VH !t#p0+\8C\8!(FN8+x+\8C\8$II FS `x1Fy+x3BH&F@Hm@BѕW5CI F%=I F!:I F0#8J F8I8J F8I035IF F3I FJ F#I .H-I.H\63,HI+H(F Bp&K(F&I$HI#H%;;&;^96%;;%<B<Q<(<36M6P%>>"D}>3Q>@>S=n>]>k%w>𵅰$FFH"F!D0 &F(FH!Dr0(F&{ I(Fbf LF0FG (F&m !F bXF4#I 0 ]~]# 0I]~-O])FFR٣I@i(LѡIh F(?(hIF(>ЛI.@Mb4Ob)h1I `b()hOb `1fh0F Ev]`.]/a0BXahOb)DahOb)D `H(%chFx)t|Kph.@ر0$(nh0+iIFGFHd0$a.3h%'U"0Fr bxOcG3h"U0FroOcG+@\IbAF"ai"HNVIHFTOT%TF.@h aF( bhJI/0Fq(\)Yx3} `! gO SE(F ]8F1ر18F,1L# Fph0SIFGBFp3h0F0G  wa.$(h0+IFGCF$aNb(Obah I `bahOb?^"AFVF(T;\X&;<"&3>e4`G9F0Fh AF0FdIF0F^бI0FZ騱I0FT週I0FPX" I%"1F I(F$I C @->e4#S#Q-CO $ FF@gJFF 3F(K;` FR#Y##"0GF#F;`F@FF8@#;`+h(F0G0@F0G$Q>-O]%Or F )F:`)FMOr~¨)hN)̿!!F0h9BlHd0h=SLAF O8,׀:Or`"ZJ`O2`" O g &0 ~g `(O F gFO :G E(s :OvP#KmK`oC"2:OvP#KcK`oC"2#!&16 :3O3GF\ D O7 D IF Q0FQFO300X?pR#0vz#"O 2#~<*F3 ;FCF8FO30 P)8FS"p(0F,HyFOp+L"OF"'K`@F ]"F3O pOO `N F%05 3p!8  IQ A"02 8FFKh*"o`&.t&TH&;<`"B`ӮEЮª&M`Os# DEڽKh+1ªOs$Kh/@K"!Fh#T }1(`0U v(h""0p"!FHjL/h 1\ $,!01CC(,!48RKC!R1#R#b$!+h(!!)!*@(L $^ ,0 (q4,8qRyCR!~I$!*Ѐh'WɀRBAÀ@𿀣tKO O  X "cF!8Fl+hkIHF$1h#!RBR[lcKhH*hbI2Q$1hh+h$1hFXh SF!y H O :  bY O300+;@Y/h(?$h0G$HO7>!F0FX>Fq}1#}1$1c10F,1L#$>F3` + K:(hh((?y u+?s+h$!hR+hM!JC&;<&.t&3&#&.x&>"K"M""R (!#h!!1( ( #@H@8 pGsXBXApG pGB-O L  O30##h*!*@𬁓)Q-@ОJOa3 `I `"]`Op(𔁕I b !|H#hJOa3BJHBFHK!\ B!F8F p"FK h@h0hCE'p"Yh#Xahgk C/j*:h8F3OcxBkG(w;hO "8FoBkFOcG;h"8Fx bkOcGcm!@++;+d+ʀ+< m@݀*ـDI c F%7/l#mAF##e#m՝4 FPB"F(FF@#FDBc(Scn#)J!(I'M6Icn#%J!mC!"Ja#nC!Jam+JI+ FIMlI@ KFJ&;<??;\D?Jzj???D?????}&.tm;"n*SCJ!BIMIBIMI;IMI4IMI-mJKM) FFI !?)!B""F!''???S`~@ ?Y@@?a@(@0?l@<??1?t?=-ON3h*QeHUXIHOFIF(F3hI3F@Fl 9hH^!F FI0h)q/ށx01F(L y|a뜩HFaI FHFF@O zIFE4dtI #(k0Fa=FXF%Op:!xFF8F%%dI2F FYcM+x!(F8`I FN_I FJ^I FF+x#XJ F[I?#ZH#F~(gVJVI F.UHUHTH+xSHRHRI  F <   Op  [ 0jhC j+km+k +m 3  hB،+hk x"#h#2OcoBFkG+~(O+O km +W +[R#7tO&;<@@&@@@@A4'rAL&.FBBB8BQBs[BBBBBBBhT@A+zO QOKFQIPFB()mKIFlKH@KJKM2F\0FGH CF0FCHF:FF>H0F5F FF 6I1F4I&(K(F&IPFO #԰5k `ObAF$K%IBF F3F[ kh*[BIbB FIHO RKFrO |KFlKFjN F1JBsJhT;\@P@J@o@X@_@h@A@FAjAAA@{`~@(@-OF|M,@f,&̂UFU+AF64,ѪJI6v!60F%!F0O4 F MԂLH Hh`HK(lcc H,eTDO  ZIZFIZFxKIZF;~Ka``~Iah~K ;84vKD8F%(F I"PFBFIF Fx 21 \5dQF F0O5O5%O5"F#F#`iF^P) hK"vO0w-CFrN] (`4h 4Fh`` P ,{!F &lOI!$('yh0F10F,1L# QA"0#YB#4vE h #kr (FF(k8F$ S@C>K"0 4T##$0#C4KC# K81C ##F F Fh(F F ]}0%@-O%FFF/FhBp!(F$0`h'POp FO hCEٯB  #hjF9F FlG57#hjFAF FlG(3 0h#XD#Y xK"02hZDmCe3h7[Dd Hh*Tb"Zee e f Zf-AFR!PKjhh+*O|"Li5,)$>rFD ЉdELAD !LDAHAi#F IF(FA+)2BdFD$%%8 FF! F !F(F8@ 8-CF@Lr@K`9#?H"%2$*!D Q`)D!DB @  #71D H < L HaF@0FfDFHF`B8NF<8FHFVB8NFL8FHFLB8F@F8NFD!KJB8FFF88FCI K K`9#\`9 #%@C FiFJ8p@XBXA& OAJxI K"!H`KJKK J!H KH]ڿ ]&.FD0&4&3&#;F&"&+OA0LT2C#K#!3(FT1JC  A10%8H !F MtF(F(FI - F F8@$kDUDZ?FR[)Fd" I*F oxI#F $I0@pGDnD O3n( K J L`! J!F HJ!FH &4&!;&3&+MHiFv. I*x I*@ M] O0 ;\DMHiFv0 M] ;\0 O3+$ F0K JIxF(K"M!H`KJK\ K J! HS KT&.x&4D&4& &3&#DF&"&+ O3( K! J H K* KJ! HK" ]&#D&3& &"&+J#3+ pG\ pG%LJ#3 + \FpG%L J#3 +KD 1C 1pGx!%N%@0Q#0Xh K) !ؑ D !%@KD 1C 1pG%@ \} 4O(r! 4#HG#!1I16! I81!4FF+ F F \}l%@ JF HDAh*) pGBh) )0%@l$#H#F|  p FDL#h+I L##`&4D0HL"MFhFDa"hF( K+`A0 D# Ip9`"/!"0(`E %@&<EE FKh!F&. R]pG7IS[H'F IF )F F FI 0@pGQE(E5B7IS[HF IF )F F FI 0@pGQEREcBIHxEE( HF H@(H;8 EEEF( 8I D"@  KSFIBH FKJ(FFK.&"&#&,FI(H FKJ(FFK.&+&3&- ) F4 F$(NM( BFA "9 ANO10h1O1(h1O10h9(hO19 0h7(h70h@$(h@&T&-FJ뀹##h$(#IHHEE0 ŰF"F(F !(F#pKhKp:DjQ IE0I&<%@3Dh };H&:L"F F FH4Kh#F3J!p t r"t!.Hr ,I < pL#H"(K !0Ff&K #2 #"1#1F O1F\R(FO3\2B p$! -p:!JJ.H"F > Jf }F%@&<MiYFhFEE FH0iMpzX8F1Fȱ0FVF@8F#>J!1t VpjHt!"qOs K\( bi, F7 F? %@F\ih!F@< iF O3/]iF O3"]hFhk#hXhf"## 8FLch*+ !h)(F^ z84lJK(FF&#&4-O/IFЀ_,O-NȠO =Fİ(F"FQF mHF(82h[F I ;%O (KO gF FKI"FS%@XF(ѝ0Py+[D0a#0030 Fd&Fg&4&!FiM&.([-OF-F$K4$!F0FF)#F(z$!0F>=FF,;3x+g1F(F_ 0F DEE^4K@3J4H0   "` V+B Z! ;D $!F  "HF` F V*EҤ1F(F%D"FZ+@(F!F_ FD$!HFZF,p8F FF-AFFF!FF#FAF\8F)F"F?FG(F#m FA#h-pC F-$!&oIOD " F`& V+эB p$! FFHS+]pGHuFHS+]pGH@j Op& F.peFIFF&@i#@k BF|K}I}HBF|N|K|I0F,F_& +;+3(x8 Q+) O3+DkO;x+jL#x+3x+hI `_ `axdI b3F(F c`I"F;F_Kh!\N@g ZSBtSA:F|7O3cUHz( + CJ!F8F|7۹JH]Q 騹{GJHK)FGIF FF(F_z@ =J8Kh:F!@f O3 3H7' u+3L#x+?b2O;x+?]3x+?Y"I `_J `a(K bI(FF%I c"F;F (;F*FI I b `F(F_%GIGFGX&<G>G &.x&4G|;G%4hF;kGc&5&GGMM iFH!hF IjF r M]GM iFH!hF IjF Z M]GsxM&0=% + "E(F $x` y(F<IT  p \GKt+H"t+K`HK`HK`HK`HK`H K`%@H &<`H&@H&FFFO i6,+>rFCD1 (O ++2*+(aa:PFF UFD 1Ԉ #i%Ichcih"h!F,F -?,_G IT HF! F&. H&!FZ F ]UHSIF(QHNIF((JIF(zDINF(F F@F"7QF 0F:1FFFXF0=+%IF(F"FOQF( F(F$JH"""'|d鈹(F!OpOp@F(O4F@- FvFE(`J:JR8 FF4"!F*FF FF@[8@ -CFFF04"!|thD6h6p# F#FZkp3BE0Bȱp!h`"F`%Op ckCE pp"!F5Rp4B pGh0Fi 00  %hB#h)F FlGP A####5G(+s#h" F#G8" F!F F)F(F"F(8@Fh" j" h@"-A%Fp'F#hB #p'F"hB"ؠh"`hA"ch35k՞n.0Fw h+FBbh"3nBhbh]"Vk+F3h0 0FG h+FBbh"3QkB4"-AFF2HPCF YFYF+HU+IFF FZ8FW@FU&IFF0FZ8FW2F"I FZ0FWJ)F FSF FW(F@.IZXQLW,I" F8 IZ(IZ(VVF==>>>"D}>3Jx>@Jj M$OcFF!F-CF:F1F0 Ѹh(F` F(F M FF"! F N'"F1F(FXB yC ha`" ` h" d| FI@dz M$OcF!FF->CFF;F"F0F F(FBڸB` F M FIAde0hD#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp"^ pO3 0pGo 0pGpLk, ыk+#p+##,ыk+$#+Ѵ23"+БB++U#`.МBт"M#@p+ F!#cccj+Ch#h hhkGb0#h hh[kGbjlhbbkZeke%$)аP"N#Bñ+V#Bcc##cc#c+ сBOs23"+ pF @Kk+ ыk+#pG+ ##+ + г ++#3###jF F h *!ac#hchhkGb0#h hh[kGbjlhbbkZeke  :*K"ac@# 00pGhp!-OFh"FF&Op hhBؠh"i#h`hc`KhOh1FlG8ch$#BСh JEXEъl2 Ѽ JmEp"8Fc6p7 jB3&3-OFNk FO YE ܵ0+ۙBݪiRQԽiO  h)Q.AQ*IB *IB)IBв *4  %JBj{ip!D2h3kY{#{h+JB0Flm#ehKESEJB3 JBЫi;DhCE#hhaihhnG(Ѷ)C7!h-OjFOFF;h 8`p#hsCD ;k.ջk3+ѓK"hn\hniB8$FOpFIJFCF@8F-1i*hKDBs C#s1.chBҹkH hhlG(*hwKPBѩi 0 h Dk@CsiK"hXF9F "  PFIFF F3C } K "9` r2 zhF DP+urh+n(03Opax00 qp0@QBFx;Fh DkOpBBFx;F h#0hmF;hBF dFDO#kG8F*K B,ٝpI x)  #$Ii-@#f,F3 4  pixL-#F  ' I #-K%&.pKj%KK-CFLFF0+@@yOO 20BOp$0B@{0BOp0BOpz0BG m0BH `0BI S0BJ F0B@}80BOp*0B@0B+hhhZjBE&030iS,/kk+qh]IB#\IB \IB[IB[K ZIiC𗾚j X`0B/[/Y5D () Op0 DI)@@>K"h=Kh0 8Ii-t3K"h2Kh0+K"hq(KGh0h$IBѫjpi @  eI#F:F0F-6IB ѫlpim@IB&ѫlpim@%!KK&,&.pK7)C_IB ѫlm0 [Ii[IBѫln0WIB-ѫl[ns@i`@QI2F#F(FOJ!Op!/GIF0 i-(F!VB *K0 >Ii-ll;Ii-ll8Ii-ll_5Ii-ll2Ii-ll/Ii-ll,Ii-|llZ)Ii-tll%IiCA#JBѫl30h+FP!S+hhdBFiiG+h "hhjSjFݝKݱqKKKKLL LL L(L0L5-C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"İh F0GO1#Op"3# hh0G D𵋰Fl$"(F1# S"#FO1Kh#F)F+Zpl4'x'I F꠹#+v+m#+e 20 R, F FF///#" "+v!F!FlmCegB0 F%Kl J !"O1 #Op3+FL_l`dXf(F 0K-O% F!!HF(tOpU'% `@J a@C, b7O"/$-@3$- 0`'%K@!%J%H/['0+/D 0 і   5!Op"D F#"2 !JM 3"2#%"1#!FQF(F F!\ L>LIǕ@Kk-C+F ыk+1Fc +++г +! !F()O`%FW !5(aE ˅Op `@ a@ bOpK"!F0#M 2J3"2# "#31F(F F!Թȵ-O F h%`h+Fp&(B-ဈhO O  2"!0Fgj#hh2"!8FgZ-@P"F,R#hhh0P"F,#h8h#hhFXhF@@BFg,!+FA (B EL ! @ P CM"hCJF C "h !=JF@F- "h !8JFHFD F@F0F:(8 F8F2,O-̿FO ZFF,3ؿ#3D r  -! "F ,RFP!" FJ. *{J !(HAh"3k@PFHd&,%>L}L-OF- FKh$8FY 8Fgeh !@F!F(ЄF"BE-FOs sQ%=O3BF<@o!S@KSA#1#1F#.990F!` FSYF "*! 7[F6OK 8F(K!D|$D<8F>#F aORO3Oq#-A F aklO@ZkVh9FBu9FOOzsCCBu#XCBu@C FA@VOCOCOSi-AF F+ahhmG+hihSi*JSBSABL(;khp!h `+h1`i h wF (D1F@k  E0#sK`ca3c# FA; R :69Dbc;a-Oϰ FF"!(PhD "'8FO E [m+ +O O  EO 90[jDHF F8KhO †F@=  PMFͬͬͬ@ [m+ + p¼żŜpEO# 0*FHYj#B@4FE@l 05PF0lGO2F hh 11  0"G(F #!###"#hFhkG"eOp "RF$ X @żŜ% #SVKJF!F TK7#19F##F8F HFJL/["E h L D P P@ka#SzKa 1"`"¹"3@`rJ 3C,@oC,"#,nJC,[#kK@jqkJkHDF3B @a"ZeJ 3C,$E#COpaKBF_KJ#0O3]H#F.Bbڨj Fb <1X@1p'#j)F000@,nBO O3FEѺ7.I F F(T#h0+a Mh 081P AF #* #H+  HH@0  +#hh#hFXhJF!FOp #hh#hFXhJF!F # Fo((FШj O#jb O3b l! FG%aiLLI}]%;\F`I@/! F}:Cx p;\-O?FV`L F !)`!1`WGW[=;Ppkn#+`pZ RI"RH*8 #+`.#3`"\%KKBk\JIBgOQ!1BbGIBє *S۩YY TBL #+`#3`,Z#??PF8LG#!FOR[_XY ՔB )*,IR"(Q # )#R0-S03`!Lo!KB !KB!EE$!EE #+`#3`LHdIFF F(Ic]b/+FA L?M7%3T 8T%%0%w8 T&;\-OF- FFxHKO8GF@F9F "\FF#0 &"x*G+.RF[FOA 4&M+.RF[FOC+.хS+.х+*ѹ#0cx+Ъ-OMhF#im5 Ci #(F OC  (=#h FlG&h" KhBrF F F# *F0Gh+޲`ҲF@FJ!-@a6J! +D۲ Op4@ 'pB@KR h! hF>S !F=T !FU !F.X-M>SoI3F:FH8F x 0F (F @F bK%hS+s[F+F[K"h\J!XF-0+x+,UI*F#O1( "F#0B )FXF^(Rkx+@)x`)@B#h2a9 FlG(+2!4 B #"##h F0Gvs;CF Ox 8 BF+FD Ip4D E z  c BA #CKEFs 8 JI[t a6J! I[b# &.pM@MN&,MZWMmMEMJ gI  L0" FFAF@h"6 V0AaF FFAFPF*0V" FFAFHF:JK!phObF>ObIF>FHFo73F:I:FM>6I+F:FF3I:F B B  R(p0#" ##h Fh%0G*F3FP(^ FV FKE s   jh ePFIF MO:FMT&,MjMtMmp F h#h#S e[BBp[b# p -OeFDFFFEqI G hoGhKhdH/@9##'F"0`ѸOO'FF&F#r0XF0G#YCFt IK h bQEA  BEu ZH aEAڛAEu FF SE Ak9 1&.pWM@&,MjMmMEMJ0XF`%0G3F*FP"b.KFh2FBByOpFBs @Oz2 D L OOra=Ho=IF(H B2F!F(AFBB (F<)FFFPFF( 0=+B,B)J!DLW$0F$Nd#H:F)F0h I;F*F0h@3OaHFnhI"FF[ 1F0F }0h0In0h IHnODE(VOH&OVRMOd`F0 FQ#0h0T#0NOraO8h0 I2F28h~2F I H2!F(F0 @3NaO&OOOOKpF F-#K#FhF F,ж0@5U#0(Ѷ0OrU#0 a OpO(Ѷ0 OrU#0ap.O K"`N %4-A°'F F"9F 8F7#OO8iF hL+ ѵ0OrT#0 aB5+I J9FHJI (JIHI 3x#I2F !@G0@5T#0&%O&$&AP&P7PFPkPOpĺ8F F10J T#0ha8&IRFF@FR(PFFPFOs@7d~F0J CF h(?n@3+afOs(w#K$Lh:f"F h= h* h:Z#@E2JF&!JF"!o2F9FF Fgh&p&<&$&%&A&.tPQ&QtQ?&X&T  P-AF1HFY0I.NF(94h<@FK+IF F%HCF&H(4 K#J 3H2J0h8*FI0h"I(FF(F@ /F HHBI*F Fv FJF Q&QRpRRQR R6Rf!!npG pG-O% ,FFB ``.=-;1 DBt B Ez Ew" B EztsBBht .6`v Gv@@51Kh"0pG&B-OFF Ez 2UF F\F F*2vs#"#.w:F3F(F!FCq3FG0 E:FU%DBu F=F4F# JO \Eu EPF 0FObsE7Br   T  I,I<3BE.wq3FG0 E:FnU%DBu F=F4F`М *\ *XSOC BBIBADیBu5Bu:E2A\B.wq3FG0 E:FU%DBu F=F4F\Euc#3 eEBr!  [0%###"U#"( (F)F 0rpGFBh I F@Rp FF/!(F{4FH(F2FFй5Djx`*ٴa:BaBp034O0"H0Y * F("HF 0FM+h'(`r#BA 0h)hB##" F  \(д +hB 4#B+a\ 3 &B#`FFFB,= K#`ppB.+O$Op ` !t&@BBt R$`ER1DC@h;` 532 FR8OrPF!0& #P`08$ N M F!,]#",+`W$0 5+&xKh H&x&-CFF FE3PF-$3FFEܸ@a4ؾshJ(F  *E  gE43 % Fqh%Jtsh JJRD*\RF0K@QJH@h F@RS 8FKh ]J#Bز83 2"+ K"h KhB (4Bx2F&x&B&B-CFFF0'~0'O38#FHCF@>h 8t+h` @ O FXhi 0he ph&`K"! @FbO@C"!HFbġ 1FOp  2 ;FvqH0$1hh,0$1hXh#@"!FO #r+h0+H"^HOq`!Y`@aZHYaYHh(Y22WI b@b#@o3133o O3GF HKb0F0F+++\$&F,(FG(##z0:K" O4 F-+h1F(FlGp2C !#h;+46hB؄@ F8#Kh)"HX(FF(F@+h0+!(FG\B\A+?Ʈ!(F&;<UbUv&.t&  80 1 9&B A6 +&Uh"hhO1Kh@!Cb@!O 0Ft+OE'O$!(FAF(?X(zaR hR4 Ch(FQ$P4 YhB0F_d -4BO$$&;<-O KհFO{ !hO2 FF(k! FF8@FF&PFU! F (@8F@F,K hS" + 0BY+Nѕ(1+d#Sd,L RcErWO !IRBR F[!b_FOpZJFIO FPX26H@J` C0+(G( 3 rK hB.؆$[BO5 @BPO 0NFXF5FOp(!H1O 1F  THD! Fb @iT! XF^FPFZ FFT%D 5D(FFYFFW\XFO F! QFFWLPF8 F   W< F F"B,K@Q,J,HJ F#"AF232F33#O3HAF(FB6 O R#Eѹ F8F@F k?(FVLF[ F&B&BV IV sUv-C'MF FuH9F/# p 0p@nIOb F^ xx[gJOaF F4!'/! Fx@B"CBFx;/) F#Sp(ڱh(F&Ob1F F$oӱ?#&F0FFpC O(?ѱ>#`*@20F(*0/+ !*OaBFF F*Ob FO0F(*Ob1FoOa Fk(#x/+0 fx&v  FF*3;DDoFIOb Fo*Ob Fo}(F( ڱLh(FF`/(F F M\;;\MOp! F(  @ F!@ "iF. ( F^ Z *Й@ B+ .-OFFFsF(?иO&(Fu0(Fs8FC+ I" FF(I#FRF~0H 7?3FYFHFO7V;(V-GJmHK"F@怜H(fH(a(@߀H5ObF((dF($I( (@H(8F(чI(ObF `I( bIF I(ObF `{I( bvIF zqI(tIF qF(@qI(nIF(FdF(@kHObF `bbI(_I bF(FKF(@THObF `JSI(!F `VIF(tPIF(F)F(oPHObTTF `"GI(XFX; `JFOa c `0 b;FQF 5 -$!@%0F Jm(v($0I(%ObF ` `zFX(I(I b$F(F#H0ObF(I( `BHI(F F$J cI(?V.V7VBV^VVVRVVVKVVVVhVmVvVVHV\; `pG# `pG# `pG# `pG# `pG0Fii, FIBdDK"hFJ!(F<K,h7 6  !KP"FFH@ Fv 0&.pW&,&(-O@F# h 2C 2XbhC#k:գk3#%kdћF 2Sch YBOhH K@F J!f %Z[0hkh0G8A 'Op O3cshBٷh wk3 ! 0BO1c50@F lG (2EE1cmw K W^K"h]K]JFXJ!t# O3FA# AQK X h "O10 ## "HFWpBKF x >@%+e)p# O 2KG#3Kh2(ۣ%CBCA #C00hhlGFFKC JFOCw3I0=DECF' 3 D#kD##cC0+Qހ 2XbhBAր Bp FW&.pe.M&,jK CHFhhKh,1WWW) Feh#p&FFB9(G+C+ F, P!%J#F "H* !H- xJF!hJF. lKJ!H)hkԉk1#2 , ++ LP"F L&,>W&xBh!-A2Fjj!9NO FB=7IO@P#C5#a1Ka@b0Kb1#c/Kc#hv#g hhCE$#OpE/ Fvj(ۡji j( /k3p51L#ClhjFAFlG@G kRh\g3 ; F EE-OF7FFFO p' E6ѹlp'q(a0IF:F30 Fi1 x#"kih hb####ice+je8@ii D hjB6* Ѩi@x1bHk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  iK-Oh F F8F$/ eh! PFF(]I #SE-FOsOsQO9tpżż@o"1F@IKA#2RF##t0F8CEmahj1 F(dahOp b  h0(Tch` D1Fbh)F  RFAF(F  # +c8Ff8Fl#hkc F[ 0ch3c`*O03PR8F^8FZ:&;<# @-CF FOp 0@Q"O1+OkD/ #30 /+ "2/#0eh'B>ij hF(ahp'hq^(bh`!bsa:F  FJ"hO5!Bc"c0Ba" Uch F3c`(Fh 0耹Op!F`(F2}7&.t-O FFF!4"0F #%`Br i IBEA  bB# p!``g`0KhOIO(r-p#Op B rj(Pm3&3oO0K'!hO3E򄁫j+@O WFh+hRE l(FGp&E F١h1Dk2ѰO /|@H"2 *@ /z0XBz(E@;>B<` LHpp'_C FYC!DH u!gE"X PFE@Op  X @h-B OgE@/>E;U!)p3Op Y  Z B0I` EBFDHFq FbFU@iJ J`bhB:>B<@QPLn FYC!D @E~۪BpچFFhY  N gQ  {OD Z@@ E{  0;LE{3ahBkB@p$ ` *FSDJZ`p *q!"JZ`0 J"0 kBc##&;<&.hhp#hO3BDjUccPQmA+hmkGhhCDb!hhjCDBZm**kB cj+HhIXGh@QPCQ`h , *chB8:F7/* I Fvȱ IFpHS )r T R"T "X *7jhBh 9FlG(h+++# 9Fj#F{'l QF(FGh+ #Br  [ BEA #FQF(FT  l\9)?hEE學k2BhιY2A^ ЖE| ЭQB`Op  k2­BhW 2AG B`2AHpEp BB8 2 P 0 -g 1pYOpD4 ` DJkC F FYCCDJT`J;\W-O%-FLhF(Fp& #B#-u(Dp!+F(npFO p70E"ӤDPԮK$\CBTЬK@]QJH03nJk՛k35Sh0pBp" Fbnc#k)գk3&ѧpO p4 p" FJn.lhS8IhhlG0##W<[hEp4  p7G`0! @~Kh;O`'hlG0F 1 BBO3  &TF4F0B| BEOp `d ``)pV@oh 3B @? icoF XXXXXdFOpFF"FhF.3&4@LD)O`T# 40V@I"hF|3jc(0K"9FhFr"1FhFl,6B6IjFi#A@/O"0dFhF*I"hFP3jc(0K"9FhFF"1FhF@,6BiOpcjFI(F#i@ hFi@ #iFi@ ciFiOpiFi@ iFi@ #jF4K`XK-O }h+M$F(h DP(+h#D`R/A21Phx2BD#'SEr hܲqp8&*h~C"DlD6I2DP k*h&DIF2D d(@ҁ@"YF@F)h@"@F1D7/+h#Dj+ ݎJ9F<B@"+h#Dj+ ݇J!,B@"+h#Dk+ ݀J!B@"p+hB{I #D3F(@ FOaYOx+h#DCCDXIh)rC"!C<!XgJ+y#n#@"B6+hCl!#DCDXZF+y#n#@"B"+hC8UICD#DXTK* FSJ!@"B +hNJ!#DDC|X0+y#n#@"B)h("D\RAJ!B@")h \R:J!~B@"+hx"3C`#DX+ 0J!jB@"Ox+h#DCdCDX+&J!R@"B+hChCD#DX+ J!@B@"+hx"3Cp#DX+6J!**&@&RXYY YYY.VY<YCYJO=YRY^YeYlXXY5B@"ROx+h#DCtCDX+:J!@"B<+hCxCD#DX+ 2J!B@"(+hx"!#D3`S3##&J@"B+h"IB#D 3D6 x .+h"#D_Q1Z`Fl&082B`R/C23&x2(qBxlB K/D4B }YsYzYY -CǰF FNxF@b@9#FJ!TIKF"F(F#G #!1z KBR!OH#^NI"FYYY<#YC-GFPH}kh;+р# N1s@I"Fi H}G𐿔|1Op@FhWX3hx-чIS`3h9F0FlGx1{S'0cxSOpFF yJ!H# ##H0#"9F20F"2#G(@phI""1FdI" ""R"ik#h+? xXI& `@Fhd0i;jS"9F&"QF,7EbjHI0FOp<!z# ##FFi0F H}@i 2F  F#h+Тh/I&{iv@  2F(F1 OpD###h+#lkOpiIF F H}Gk!Jckh#lHal$hlG#J## YgBYY[ZKY`Y4HO #h+?t6J!`YРD W<["9FO舨"QF87E`Q/B 12Fhx1Qt|@BѸaJ0F!| O piKBF )2*sJ!Z"YYh 4!Fx"~"Oc#@##gTd!@ FIZJrF!b##`# 3O3#cTd!@ FIzZpF6Mʰ F+hX @o! "!)"0(`0+M =CI(h!Fr Jp4#"C$#FO1@. j(@/&$J! #"O10F 3#Fu |B |(` Fj,O v#k0@1& `O0dpBNO3 F FsjX @o! "!("0"pb0 +`"DJPV\/K$\`pj)F p*K"Z` +kb@! +i@ %$J! L#"O1(F 3#F |`B |\0`ki@ %i@ %iOu+j @ % (`O0&xd-OF$K%FhF*F (  0J!XF#"O1@F+F0HFS##3F:F)p XC1D&,W&.p0pİ +)+28Fthnz$1#"#FO1OpV FDp@K1"h,1<@A !~O4 k[ c$Kk[ Kc$81#"#FO1@B mX@C&$'J!f#"O10F3#F{zB{t(`m\Ov n`@E&Kn[ Kfnh@F&nl@G& o[ȿ# gKo[ Kg &;<d0p Fİ +L08NVb #"SO1#@ #{/+ ")F QJ!(F(FJ8D#{/+  sDp1[ 1!*BKth,1<@ !O01[ 1( 1[ 1 1+1+$1uOv$(J!#"O10F3#FB{B{(` 1+1+(1u@& 1+1+,1u@& 1+?z1+u01u@& `n;&;<d-OmNFF(FkIFSO [ EF ` $?Qh{@ himB 4F*FTI8F" @ hi1mBFC '!bIKDhGJ!(Fh@ idB"FFOphi1mBF+ 3F1[ 1s 2J!F(Fh@ idB 1K13$1!'J(Fh@ idB 1K13(1!J(Fh@ idB 1K13,1!J(FhOpidB 1K1301! J(Fth@ idB&xgBK&.pW`d-Oװ#F F!J03`OO >hH1FOKhSKh3D[hkK/F6B8h(𳀐}1a3;hB@>`0F$P|h0G$}1 }aC O Kx"Ch3D 2QX)XCPRXAh)rO 3J!OGѸ<uJOh0 Dy1S %1#@,OU (18!"""0:hJ Op:`OrAF  x a  (OO}11F1B11V,V-S>hO< 4i;.@D!BAI*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #DhIED3h#Dl!2!MF((h(?mIhF0(h(?cI"F]кQFHF(h@# 0O&3&[[&J`k;+إhݱ1{"2Op (^#10K`0Kh0I*2k#:*  ,0=!F !F %J %I2h2#K#J#K"J "I2h2 K!J!K0 F{J I2h2KJKK JIcih#KKo&x&;<&\&R gE c1 r ~&R w9 c u Y&R fa qm q _Q&S tQ d q5 _-A%FL")FUK%`hSTI "FQKyh0:qXhhBkD";P! 3jHJ" FH3B(F,AKh+;@I "F(3=OFy9h0;Jh"hB!41O D"$#hm&<`?&S\-CF$AF,)'C\p OF0%$&h6&6#oG I Fx1S%Qx1C%`1+Ŀ31 p\8F*I" F逹(I"F (C+h;l!:!X` I" FPI"F h+h4I" F`I"F +h+ }I" F@*hrI2#F I"F (8o\[]?]C]$]9-O]NFOR `!lL+ЄOeD;h+@oO4;hCOq #8`zO;h+@ruO0+@[rK"O O`1XaO|a O`fK  1Ox a`_K`H X``1Xa a;hJwYI  3Ha`PSI`S03ap0"`d'<"! $ a*F @sDK1FR"CKCKK#2#OpoAF/`h+O0 ]Oa ~(L8`IH! s(X8`UJq g8`(WS`!12 a0F0Fh+Kh$1+Kh+Г|!jOp (!F1&x&<`&@&F7#h AF FlGB 0 BBѷ?GFhCEط?>FOO7&x]d]j-O}FFFFJF`4F(aI:F `(_I@FO F(FO78F }(.UI"F@F.CF ѫh+PHIF4kkj`j`#k+ackka#@0+bB0kbclbJN'@ILYF0"F(F4*F;I8FF9I8FFB 7I8FF<5I8FF64I8FF02I2F@F0&I"F@F0,IJF `B"!0FHF\0 0B BO# (1*2F(`Q`" 20"QF@("@1I@0F  TE R (ؠF1`v\([ #0ZK@QJHHMJAF8F(F ]BFF8F%0[ K@Q J J J|(]dy d{]]DX?d|h\jB$ $jbCX@Bггk#B 3h#h8  0+ 2*s K@1 J H IBs IBs! Oa@!^]8@hkBF2Bp" F  8  -AFNsh ,x,h'GE$ F )F4F<6(7,F&F F7I(FF8 "P` 1I(FF0 "PR+I(FF(!F()!(ph ` I(FI(F( ("I(Fx D`"I(Fn(O9FF(+x+N0h()FZ#lrhC#d6^^%^+^1^9^?^F_0 #J(IPI">hLM!F PxP 0} )FxF+# D^R0#O;(" FQ F@m Jx!F F!F# F@K@1JHpI,>aC]gBO+]  FOTEF# 9B&3@B1*F2 hh*F*-#p @B l  *FFhXjB jBCXF"hF1FhFiFD1*F FFhO FbF" TkkEOkB kA&@0` k W\kBuF  0;0 h TkkE_kBkA0*` FFFFĕeF#0# 0F#"# ##"HO0K@2(`hkB-@u # BrO#F -K+` F00*F!FC0 K(;ih3`#[b #0C03k+УB " 0_-AFkFF#FB#+i-A; 1BBL! Fй)Kh;` @3B0#0!"!F04:F#AF0#(0C0aa F)FA4 qBBL0&3pFh p#kFB ОB %*K`(F3P-0й#c04#)F{(h;`#[B #0(F_Fh  " FF(-Od]FC ЏK@JHKh#KOqJ P IF d]Kh J q(H! F(IO.0<  xI O L ('`p.F nIXF4F3C+CiI(Ms C <0k@08P0+Я4 ;FAF F "!@FP.QF,$//Н`0#NI""AF "!P F7 "!P )AIV@ c|;IH8s C o +?l4I "H頹 k! Fp + sSHF(D0`"9FD 65PE0k[  (E#PC0@ 03 0"@`Z]&<``"&`4`R4``;m5$ 0> !X0  0 0$050#D0Ocr0pF׹=I(Fwh#\C FF(80F(FHF;hZk(F #xF`#pb#;hk00+@I(Fd(4FFCE0k(#GkBBсk*#kBB !F0Bc"V4d|+Kh Kh8 &<&@IpG{ {S{{zzSzzӈhJ ]>@pG FhFF @وzrYz  3 B-CFF FP Fz Zz  ۉ0sxs+x'F"iF@FN#*F F9iBsxl+O&F"iF8F8鸹#*F FqiC7/jF)F Fd67.-G FFxs  QF Fk%(F 7&I"F 6 5  3 2 1  . a ( ѝ0 00**+DONF9FFP#c˄QF F"  O5>3pFpL&"F@!hF6hF4G. p-OF;zF B{'O P-o)ХUBUADaD B^гBV1DBU M MBSKSK%R-E{OO 1.)'D aDBiB(1FB fDB qB s1FB( FR 0@B( F-7/,O0y y pG;hhB, O0pGO0pG#4;B2#:F#`|! 0CB A."*+h.`+DBO1AmAdBv 1)fSKF B0D3O0pG&SH(؃(8 ( ( pG8(4  pG(  pG pG pG pG-G$xFF#F ʱB 4uD$G4-*8""3+ y%.= оСB v#D+F45-"(r` pGFJ Ńy)+0@ pG pGJ# 2J] -pCFFF!"1FJ(FhF0 K#`0F p#(k*BO18hG,# `pG-C4 &FIFO Fx$" /*pDEB 4,O ) Fi,ТBBBA2HF(O!"-OFF #a p E 3 ARF*uO.FO3#EvU BR 42 KF(E ,CD z a#FJ0@RFv 3BDs !FCE Y  #Bq (5K`&`oFBv(F #BBt11"  Y8 Fh;/ * pG BJ* # kFJ] ǽ kFJ] F pG# kFJ] 0F#hMFF3"!")F I h M0#6!Ocf `0d{4ڿ-G@4FFF)63B6KhTqDzCDO~"^[rDlSsХC FnkCPF1F6K"hRO3SEFFr FFF+FHFQF"F;FF\CD2DLESE6 O IFXF(@3B32D@p !BBE  @3 BԿ````4  ;(&;<-OO MOJN,hOD !  5 #F 4D@FlU<  FJ`_O3 d3h sdshCG ѽ&SHK&8 F KF[h -5-4- H 8 c +R# ÷ _ _ ÷ _ ÷ _ _ _ _ ÷ ÷ _ ÷ $HD"HH&&&SH&v&,Lch n`h&-CODMFFJ !4  D/DHF@mJ(!F8F FO3d KhQFUYh1A,d&SHKS&KF[h %KD 0Bh F@&&SH!FF0"F Fh"Fah#(y`a+y+#iC#a*+#iC-OFFFO O vyO06  BO , FѸ*+Щ+2"HF3hxa3ia3j+b/2EB -AF dFF"0F2}"hD"B#iC #a2xa2#a(2#b7#b3y+>+{Z*,1991+1;+++11+1++1++1+1+++111B+Ђ+#!+د+"Ю+ٸ++++ ,Ҳ* +"a+#a####8(  @ K@QJH$]dxa.8 Mhh#Op^` 0+hx;##p8&pdh%h) p0yPh(FbhMchD#<3y(FJahT3R#!bh(Fb)pKK7F[h F  "(F(`xK,@ `$ F0LD!Dch+0F&&SH+#J4] Ƶ0F %h hjjCX@BѸh!BAA)0 h 0hjBCX@B Ky+8 pG pGpFpuvU  B Fp@pCc) F!)rKO^qJH.BB LBrOb"2LBr@""a`a.8@ F*I@6BFh5F&@Xl2R1JBsڣh`h" h3#h1F FlG ¹Ob"@BqXA2@ @C"Bq2hO&;<8@8uF8a@"(FL2 F 82F82@CFg+KOdq*J+HO2q F(D&K`(FLO3BO9F ``0FrO?FFK@2#Os"`#cCcO3(F21iF%P222`! F F `a.8F Mkh khB K!"D B021l* 8&&SHH8 ^ pG&cH8h  hjCCX@B%hz0+  3bhF(Fj 8 -CMF cuFF!"r+FJ!d,d$.,(Fxh###(8khCEhAFlG( 1BB 1BBѝ AF8kh&*Fo3FGF FF غйJ1F(FLFѹ J2FF(FJ1F(Ft axa.DX?-AFF'6FC+hiA Kh#` q+i ``B xc p&3-OF,MF$FF!Or8F`@F Oc!FO8 FD#1 c)F#XF2FMTѵ1JU"[BMPF2XF  p@"!U#1oU1@F ,M0F.F(#F2FXFM"BBF q Or@(FID HF1"BBбy1*+Е1+*+ѕ1+ѕ1+WF2FxB$ s"HF  E,^"#DBX $Oq &F(OFO@F * 3)1Щ) "2"D"" ))"ER@)"XF D"aHH<FFOFCFg6K@16J6HO2q F(:`(FTO3BO9F ``0FrFF?"##"Cc F`O321!h4#F(F0 F $ F Zh+1"Bs#hjF!lG(((#h F0G`a.&`2S11111T\BodaqAFF-A y.h,,Ѕ,8B,8Ьi Op/ `'BD$LhA@3OAXhAA +hCD\`7+h8H+h8(h 'BZ FwF \ ',%1)OGF82$B тAAAAAAAAA+h9F8Z3Dq4BF2 F4i+?wJ`t2F2+h43B(2+ѐa.ba-OFFFFFΗ 4 Ėxi +s(C" FF4]T.,FEF03+)БBиO@FF@DB" a#F@^B0p !F #FA\aEc()8bN2*ѸКK0p'9A\I/,)КE37/bNEn1*+ $ ` 823NF  $!0F O2D2$iB8 F B^ڸ?mrKF{"O )2") МDDD Et FE~ 2*2#\) *3+PK@TaPJz 1B sڸ?Op q 1D B t" CCFA F(?.2k @BF"07F'0E1B&K p"!(F2BO3 ! v \  , 1)K@laJH*D@A DBOp1?@ab]d a.F-O4 F FFǼǜ #+``i0K@JH`@%O0K+`#O8Fr \F3++ +(-@ )2D4q!D! +dEz] CEzOh h JBA-@8BIFt F2 1D "1BB [Ep  Bs"Oq F(T-?bJKhd! CZEp ā!FBz+F"QF[@B\l9F8F:Dm0F s v yrE?#0)*"*@`3B ES1#12*:" F KCBr; jJ# z QF2+FM[@B Bb_a.bv&3Y J!BpF2" D J @`Ep`z+FQF[@BLE22B sOq @FwESr1#1F22  -?T+@OsQHF"BqFh"2i(!O B{@`i *(B"a #FKB0p !F#WDYBBOAbB' +F4"qQk<@B <"p!1%K#O IB zD3+O t!%yU)/ -ТE?014)"1?F@ Bp-?@ -CFFFk4 1F@FF(Kѹ h0G#k+ k("FZ2B Fw" =F3F'Sr" S=(# F # ##:F!K 1F@F(#k˹Kh`h #G c#+r k(hP2Gb!I#`h #G c&,0-O$m FF !!#OcVO4 F $mrI0H6SCs@"!2Or!Fc2K13aK@!`JaH vO  Z 5psppqsqq  6ES2OBF O[^+FXF1FF Y*F8FL@E|B,8FFPF\`HFXL6`+H6+PFFF @3E(FO(?1pp? A8pFF@3E(FO(?1pq?Aq(F5F0F*F8FL$FEBh Or0D*F1F8FL F0F OsE]EO4@d]da.FR5K@ AJH,)FaFFkCK@AJ Bp"a4+F@ @1ba.bsF0K@k!JH4O3Ov]#ah6R-Cb kh0G8uvvU B`h Fp@zba.Fk Mh0G#`hOc!CFЧh!8FF8F:F(F0FO(F F M-OFhFF0+jOp5MG0*FP!P# FuCF>+*O0:FP!P# FuCF+ K"hO3R[Er FF#FPFYF+F0FkCEE@:1EF! @13hX*FpQF#FGP@d&;<-GFKFFFO hRL58AO2B|`FFo-?, Cc"V@3?$%B F;`3hP@@I92BEs  җO MNFM+h[3 џI  +hCK+^(ЕI LKh+J )! EJ;sKPFAF](}@0FYF ]J@0 q(D {+{dOd [F{KhvK*"-:Dh B* rKsI (DqSnJ[ nJD#QFBFFEp+@# 0 qX_J1DQh`h9t#@0s:A ]pAK@0)p9 c۵ \@0 P0c"$ z/CSO"p,J # 8Jd X qR*KD)pmJw; Ts۵AEp N%JQ x! % 3BR _+#d F4FF@YA.&x&p&X&&` .&Pm&Hf&hQ&cff f-fB.y5J9F FD+ qX0JD/K *FhCp*Jb`\@FYF\#K@0! p {jB?p OaaFJ9F FDOaa0Fx F+ihcai&a&Jc`&`h`+Fa0F SFH!@foOrF!MW0Hc"H 1f~K-CF@M6ZhijD"RZ`ZhX"B"Z`ZhpCBZ`hPjdZh.Ե@0CC`!ԕ>((D&0 HF(F4FIF F/AF0C30(0Cs0ip FFFQ kH0I F3 Br I F-)F"#FF##b03 "r D1@?!p@p~u~~mF@1FCS@11[hh+j1\hp+DP#T1;T1+DP#\1;\1+DP#l1;l1(F,5o2;2b.b(F,5[x2;x2xb.ttbsF# FFF%F(9P1F! FL1P3@ B@ B B2  FB BB )FB B 0#P#p@"pq"F(0Ц#`H!@Ӽ1+ڦ7#AC(#1#FJ@f hFD1 I@L03 Fr F033[h գlKI FJ@+F"~~~x!FbI^#jF?FH"}x1+~033F[h F@ %(q"FT(0Ц6#` H!@3)#FJ@ag M0ObiF$C Ѧh6+H M]#I 0hFvgb#DpFC%H%!Z)Fp@޻(1D1Bp18\ "Ta=H Q=Q-I n; f+ X1 #FJp@庋mZe "pg$ɠH h#j F/dhjp+% p030VTsSC#C L O(8 F F pPErCC1hnrSCD#C% psRC0F ~$T%usBCvh   sF6D!QF.CK@[1h F%("(=Ko0jh a CБԠF6X !F #!0FaAFFH!#h1h0'#j+$ F H FA 𸺬B+jk33[h0"1F(mhH AF)h-AF FF F Fd$F F(Z#j+/0 3` F)FAH F h1F=I FA:H)F9I F8I F 030+Ycj"! F F0ѥh+*H-A"A! FA.7#j+ !HmL0۱&oMhF)F2F, F"oBiF(F@#j3 FI F #js FI FN FA H~ag~FQ ;F5XllBbj/ F@Ȼlp+hF<03P=Cj3"!D1030ݱcj030; F;0 H"A! F0H Fp@x%FgF F@-OFhFFO tV(HF0ع#j+,?0YF F302F F)FKFBF F FE BШEdh( F dE F2F)F F/+𵅰Pc FZG!(FvW( 4"08I9Hq(+ ((-(33H)Fp(B(/J/I0H--J%-I*H"D12F;F F)F$J5F%I"H$J5F$I'H "J"IH F6L!d1)FP14JIHHz0H"!O0d(ܒg~xG7@W_iq"F 4,AFH#@1F (I#H!F$gFjFF˹#bW FR F9 F@ehlF0 H#j+10#;C2C0#EPgK-CFFF(FcF8#`0FjC FHEI Fz2;`h F&`J`O2iFF(9HO6E!F.F`vO6#`8h(O8F IFFj# 'Hcjkb> > >0+**. jF9F@F+j(F&2˱`h`#c`1Zh``"Z`#jKHIF Fj F%Fz`2+`h`kz`h"8-C "FAOqx0KILH#%IH$Ob5OzqF(F F)F@F7ѥh7+Хh +7H)F}Y# FF0.H  1h5h0F, Fvoh 50F)FG(*FO1 F=F2`h `2FPKF"!&r`1h`Zh``*Z`+j+(FCF:Fh(L[  UFS0ѥJh7+ F@8@h +Х<hV+н@Hh<-AFFFFFFp- ٥ 7#&I `%HAۿ%"B#j+ H ;F'>Em**F1F0#jñ<#AF* 9FFH)F<#0F9FF H}>PF**F1FAܼhNW-OFhFIFF0F8I"HFOI0FH08A F8!FBI0FF(KF`#1@ "f(@1@D1#CD1$ I0FF(G0C0 FW$40DDEXFF(𶀂F&FE-&!FvHF lF FoKqJ4F`pK@F9FKlKBFjJ%OD1DFCCD1O $W&6FZFPF`DCO D ;k) N)4)6)&U)JJp) x) n)!J JZK[$& 0=K hEۣB 2FAF C*D6W*XF(  04(K hEۣB2FAFHF0D1#CD1O42W*XF( `#`  SYI KhCE=(FZFSF1Fy&,<<LUjiW# j1 chKJ !c`3CE۽#SԱKhCEW#j 3CE۞(FKBFh;;F<8F> Fб"* c NK Dc`F> *PF>D8ǒx1pFF+NYJF(3Ђ(x1?SJ!SH.=ѕt1%#NH3Ff\0%+ HH@ F# ;$$h+9I=H] (9HT|A|&pxA>03H 63h1hlt1+-H*"1FfF>0 dh'H &Ft11F+ ""O#FF&(C  "!,jDFIOr(F!0 I Ht1+еPd~mh  Kh*hQ`X`pG&FF(9`S-;eBp9@0h0` Q nS9@0 c`#𵇰F 1FP)F0FLOj +hB~hhR`B `dD:``;-GFFFF0.KOq-J.H|L,K@(J*KB*KOq$JjL,kD FO04#i"hKEciSEch S`bch`(Fjvhj `c``bF#*kchB hBChCh`D` hGhU;hpG-C FyFFF0-K@I,J-H|*'+KOq(JkѤ #`(F h`hl1B٠l"\8O5hB'hld3dh2Z`Bh`#h`X`h `3D``Vy"a [(``h/%#a#uGhU$D##F] F0K@JH|`KѤ#` Fh3O4#`hBhhb""iZh"Z`$*O2`h$uD`GhU7FS-ڤb#`O00hJBBF;4#FFFOzqFFjJ(FBsK KC1FbMB@F0K@#!JH|j Fܱ&hiBgiB'iB gh^w`gh0>`okg`<`lc4FbGhU0K@7!JH|#AeeGiU#epG0K@J!JH|dCdGiU-K-AFF@#  0'K@n!'J'H|v'O$DDkB 2FiF 0O0 kS$0;>+٤4X P(,C@(<$DDkB k"S$04 EGi3U8X! WFX %0 F,F F8#FTC _#a#FC(_b#FC0_cc#ce8F#`3 hXhj%k5l U82+Z`Bh` b`2+Z`Bh` "a2+Z`Bh` b23Z`jh(F` bcF F@ w-CFF|'#m۹`0;0Xh#l+alGQK@!PJQH|jh`mf Fh+h*22[Z`jh`0Gck/`k``ecb oC"#mF#}l+."hFO Bhh?ShqK`Sh`#i`S``"a Fshc`a3`h+ ;FcFSiC6"u*FhKFHBF Ѥlh+?}fh@B(?s%h-?oik0>h2[ik.?_-hki+ШiGh30+h+(iGGiEU&FHFBIF }8Bc4 F-AF#OmFF43DOaCF2FAF iFF F m--@- ICFH2FF4BF1F(Fs$R]pGM FFF3F*FOahhF8F(IjFF F` MWR]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpGKpGpmObiF CF ( lNO4#` F mpMI4#dmKpGK@  v8F M"Oc H)F\"1 ]4V#`O08  MF F F- h F@ FBоCо1C F@ F"!hF "hF#hIjFC0 cb$ipF FF!"hF "hF+hIjFrCн0C$ B I#(hjF0O0 $p iiCjFГl3`000 @0pG pG-AF>PMV#O5`(F-٣7#">FF"CF"=2ѝ0>0F#C0<# F HK> 1F FF(є> *1F h F dhh F \dh"DFB ;3+*$F, p FF#/x+F" F( "1F(F(:!(FF(]"0oC !# "c;V`O0p3p")F!Kh.F;#Z1 R5oC"# "0F#!c3px.+i+oC"0#! "ac(O3 ccO3c:+|-O۰F F#!Orb OC {FH%P Fpr0 љH8F a/F8F[+## 0[x+]4F(U=h}+S S%p5B%  (%+yҲ*#iQ.i+-+-и&IRF  %##  *> 0DD1JB ] FC0HQF@ # Fsizscd@ F*0#L0clccd%b F#c`{h`d`4|`_@0 FF1$hdB#`(F0$E R( F0i+dh-AhFFFO4(hpb,`hah0FhSx+ai2 i01i 2F8FcF! $hh(#` iB@h1hpGCj@h0F F"!hF> "hFU I# hjFJC%0 h#IjFii~FOi /+ i#'DT!h,#` F Rzh* - -*FhF( "05%"DB,D#iBdhF;0O0 I" 0I" 0O0 ظ30F82ThP1Dɲ8D!08PT`Qh!aQ`Ph _ `!1P`Ph_!! @P`0!)"" 0-AFF FF0H(FTAF{0F H F 1h"(F1[xHH F ]8F Z3hFZ2`@#pi`-OFFFFFR3x"+"<"+@Ҁ86@π5x%#;%O FE"Ӻ5ܱE ##p1F F3HE٣7#`O01F F(FkE,1F+\*@rxx*m*0*]b*!*!n )P!           "+F>F, ", ", "+J hxP1 Ս xP1J 7 ,"! 69F`FF0*رBF ѝ "!F,(" +F+F?3%5XFxF2 + +pG+FpGXxCx + +pG?FpGF FF x; 8` (` /!FF!" F # # "F3H!FgO0%)F ?(9F0FopH1F/#<-8h M(`-OFhFFF(?HO&=!FP9IRF9H*(FO Ӿ$p(FF/D(F PFF(С"8F[(L"@$Pb``XF @XF FPF&FXF X #U4:FQF Dp0D4W$)FXF((ѹPFF(HigFh% `i,'#j`Bi,' Ufj%Uj`B `j I# 355-OF1;FFF~+Å   -:Eu!,7[fq| & &  & & &|  ) & &7n & &1 &    &K < F R \-A f / #7 %   ( 2: j t ~ z4'-G(FGF{F *F!Y(@L"P1Z(L6PZL& @# 0F0Fh$+h 4-#4%0C0[-40HO5KKhB K!#*FFF %6G #H1O5w* 6(#*F!F0 x+I(@% #1 4%0C 0-)0)Fp"%4E0%C#0*Fp#!FFѐIH!Ժ!@.*юHO5#Ⱥ4ch*##%c`C#%c`}0*F0#!jFh~H4R%-̇40F80/!8F#p*F-FN/#3p(r"F)0%#CS0P#334%0C0A-l?" F(F 4 I +̀)FH|O56*F#7`q09GFHU(𪀖73ŲD348QD7S%-!,!(FFCx;)FH@O5㸅B0j90#!EѩHO5и4%08C0ø6"0B8$#0p "###"#"(FF,#;p, FЍHO5 8t@Fn( /ܢ 7#`84 #D3; 84D349P%:D8j89FKFBF D0;0G(%X4ShCsS`-(x(4(hx4(AQS`+x6+kx6+0%CC00-[?" F(F 4 H +)FJH^O5-:40X*Fp%{X4%0#c#04%0#C0- &,!(FF(F @F F@'HO5ǿ>p+F#JAF%v0p:F1F0F 40C#Cc0)J%tQ%I(F@(#%t1 I(F4%tQ is&I(F(#%t1k)F8FF(?x K(H%X)Fx%|N4%0C0C=41#%2:I(F84#%2-I(F84 #%2 I(F(ЧI(F04%)FHcO54%0#04%0CS06#30*Fp#0!BFыH&پ0S%#cC#0̾4%0CS04%0#04%0#c04%0C30-˃@1?=3vO:`d1F8FBFKFZC(0BF1FKF8FZ5(}#P4Sm-@1? 3飖O `vd1F0HF:FCFZ(X:F1FCFHFZ(JPO::FCF1FHFZ(:p4CF:F1FHFZ+-Q=!(F0,HO5r*I "(FFع40 BFO50%#sC0I "(FFH0BF0(?I"(FF0BF0isI*.3;R[vI"(Fn됱I"(Fh`I"(Fb0I"(F\(J@FHF0HO5O G BFF O0 #;p RFIFE0 #0F;pF( 4  82F9Fz(pJF)Fo%XI"(F 똻 BF!0?I0FF(?B O( 4 82F9FB(?̬)FpBF%4}I"(F9(zI"(F "Oc#Os"#"@FFH +?mHAFNO5jI "(FF/!@FFK AF "F}(F@s "##" F0FH +^SH9FO5𹼀#0)F p"% *Fj(/!(FdO3 4"DH1Z(?D6% H@#  D&C`} *F<(t/!(F6O3 4"<@1Z(?<6% @@#  <&C`O-z40?`*Fp%`94%0CS0. 4%0# C0 HO5_4%0C04%0#04%0C 04%0# 02!P%0##C0#2 "@@0OR!KSP0#S0#T0KsV0Gs^04%P-Ҁ@1?D1#4Sd6`&P(?2h+)FHO5-4T (FT(HO5h-D1 30zHO5U?" F(F  H. S`4%0C309#*F!( (ܿ#r(ܿ#r(#cr)F_HyO54%0CC04%0#C04%0#04%0C04%0#04%0C04%0#C#Bb0#-w7HQF'O54%0#C04` d4!``-кX(FVF#;F:!(FhF(y" +oIO FHv F(~HO54h l44p t44 4 HO5lB^is4$ (4(FF0)FHO5L?"p F (F H$ 3)FHO53pF({HO5&=!(FFI(F FH8FFHHO5f FFF&{I(F F88FFVFعuHO5IsI(F Fh8FF(FO6&FgI(F F8FFFp(aHO5F]I(F F8FFviFX(WHO5FSI(F FǀC@ÀMH)FFJI(F sFFGI(F kFvDI(F cFAI(F [Ff>I(F S(?8HO5 F(>*FCF1FMFl4"|1YP"H(F O5F6|Z&xv@3`U`%-?HO54%6#6x4%0CC0l@isZ=U4%0#30C4%0C#C 074%0##0--?Y(F Xp2+!)FoHwO5h%p24%0C0 4%0##0-?-(FF(#;FYI(F7HVI(F TI(FPEe@@P.>yLI0Ft0KI0Fp(~mDD0E%P%e4%0Cs04%0#c04%0#CBr0#4%0CS0-?0#*Fp!ACF&H4%9y4%0C0o4%0#0e%c6-O<>HAF"! FBO5O-?{h, HO5Ao--O LFFF F&OY 0@6g.@1H [j+Ѻ HOWLD9FBF(FjOi`tF I \F H&(F4 I shBb Cs`#-O3`6C6FP2_B0C0BshCSs`SBshCcs`op-OF FFF+D$K"`930#xK@10FTJJKFGVBFO ""J)F8Fh"F2(Fm00"r!ABA 0 FPFO <ji&|i-AF F)41+a1+k1+g"9F0FP (@ $T `fd6+c` hfl6+ch pft6+cp |f6+c| f6+c X (FA 1Y7(F ' 1Y7(F '"F8FF(Km T"0F,6Ld6;d60F,6Bl6;l60F,68t6;t6ph6 6;60F,6$6;6-O=FF2F(aбL2C!D"F#"A л,#CcB2CB#5 0 C+C0#00 Or#( 1r@1n,! `HcIO2? ӃIHc@F =#d6OO    (P`6FhvO, 2d62`dl6 pBhh$ pvO, t6 pB]p &#h6l6p6t6t"&x"66O380FC =8!OISH 9FyF N c BF!0F#FYF8D Bx + +<\+44D<[OsB0 D",8BF0F$D[  'F!#I yfF  +?/UIXF(| (hкXQF$' - (++@AF0F#`&oqWxF 8D Bx + +<\+O9,2F(LmC3IXF0(?d/a BFQF0F[FJS[ 0"B #s00@F#0Vo40B`pG pGB pG pGO0pG-GFKxF FCpFB6E  *FB8B8 (DE٨!G*EEҨ9F(FG @-A FOmF/K!JHy#H*FF!I!H*F<% FH&H*F/H*FbofHK*FH*FHs K*F H*F p@ 1Pe&F0K@[JHx p p@5pH80KOqJHxu"F(FFHF(F "! F F(H F85pS0KOqJHx!K@JAep[8F0K@JHxhF!F(F8pdF0 K@ J HxCm@ Lh@pIpkF Fq0K@3JHxppBK@5J"(FFTF"!F(FNF6cxBД90B(F!F FHv"!0FF 7O%"FF(?%!F !F0FBР`8F F(P#!"!F0FcxBF+:є90BЫ!F0F!FHcm0+30#SROQBB!FHF!F 0 Ѡh+Рh+PF FDFpp ^pPrp(K;!J Hx`Cx+Р/#`  {p(KQ!J HxFCx+Р/#`  {p( K}! J Hx,Cxc+@h@ `/#`  {pF( K! J Hx @x((XhCXBXA>/#` {pF( K! J Hx@x0(XhKXBXA /#` {q -AFF F1K@mJHx"KOqJCx#F p F+сyIC1F FJ 0$@yF"F8DA83F"F)hxA:q8 FF0K@JHx!KOqJCxKx`xkxB*x#xB(F(: *(") D8@ F,((F'( 8 q'pF(!K!!J"Hx@Cx+Bhʱ #@;@B Рj#O4` Fpb/#FN1x)"!F#0#3p(F} K@'J0p{q.&FCx F+0#p,%F!%u*F78F! OH2!"rz=x0F#;pBKOqJHx/#`O0bBXSB"{U=p &q:0 KOq J Hx!K@JA hC`{qH8LMT8(FqT$-FF F'O~C;0! O wwO3KO 3LO hB'0K'0LO O hB4 O|")h `VF OZ̳l`O0T;;>+٠^7Y  Q@,CA@+٠F7Y  Q@,CA@<hhhh3FRI  FT0;Kl*?+9I FG0$-?&@61+@Y F FWCF@R%H'J"'It F0_ 0+Ci~~~~m #.7pLqqT[AXFF(?iB`"FE T FxI 20?P"YFtJ FrI0DqI8F(|oI8F(vmI8F(pkI8F(jiI8F(?fI8F(`-?`K`J)FFF^I Fn0? \I:F Ff0?0F%(F>0h-%(F?0QI FO0?- ? 0+?0+? FEI2FR0?Ϯ F@I3!B06O:F5O3J8I F0Ѵ3h1hG%*2I F 0Ѧ8F%(Fh F*I2F0?! F%I 0ъ-9F F50?1ZY*Ѧ O%CF@F(?k F'm~~~]fq8F h(FCF F8@8FFF **ѳlZ#JI+ F1F(FO40$/0cZiRlB}1F(F0O4 FJ$$4~~pF pE< NB"1F F4 FkF F0Db#`O0-AFhF1BT1F:F(FAF=H F:I"8Fn8!FA!3H ;F$pBF*I+Hb$$O.3i {0F069F@F6h(" F^0 џh+IH# O# IH(OsB dI"FF H$qqWBh8 FQFH@ Ԩh@BٟT#`O0 F8!Bؓ F`!!!Fx$K"uF&F9F; +ѸBХ>"n#` 2F0B*2F)F*(dh5)FxDi F)FFDiJ`F/#pFhF FԞ:#`O0Fx+Ѓ)F1x+x:MA8А"! Fh FcgdhZ \c+cxcwh Kx+ыyoC@ghXBkkg`ecm ph8-h0F9Lx+О#I`e(-AFxFvuE52E AF29FD:xFF.8x2F!D2 +D2%O0p"FF !8CF )FOs2FF F,F Fp𵯰FFF!!"8F"! "1F I @@u ,ٞN7#`O4 "F(F F/i pG pG pG)JFQhhz pO0O3`"I" F3#OBOq#0IH#@"#Oqt0 I H #""!f0H D0{j#18FQ(hCи (FR#18@IpF>`ư FBОO5#`(FFpOr!hF "hFOCB02FD)F`iF H *> FDiFHiiF`LT  ( {|1 KOq J Hv Kh++L@B O0N{CjFАlCXBXApGM FhBF##gD#M00F F("!hF")FhFjjF IJB + ")F FCXBXA 0 (i8pF"!(FbT k"!Z"!F6I *p i:-CF<]F1K@!JHvKm#K@!|J{K@!wJOb!8 F#pHF1p31caso`#`.-F=GhB`hC`FHFWxsmXihC` hC `hC`h/Cso`oDCc`2#jC#b# 2h"! ]um^hC`B 0i.5x1F"0*F-W=E5.Dh /N /F 5ǜhY 1F(F:F/K?G7=Dh F 5Ϭh 1F(FXo2Flꆳ>F65D*"!F0O0 <]C{%IF-p(F:FD/?G7=D''&{)-C$"#BFF!"F#!4D&0O4 F/(M,F(FD!CF(F ,FLE##DE ؞#`(F O4h@/ "F0F,zF H. "AF8FE@F#DF{𵑰Ni FF@"!hFV {"hF1Fh-A0h00 "i 0 IIK-F@#jF8F@iihW2Fk# 0 FC 2""!2x-Gm6FObCF$ (н B Н#`O4 F m0+ѝ0++++w*<,6(Fx0@𶀝hV<O4+*(+9C ѽF(н 9> :0Kx+++Kh #Zx* [h#  #Zx* [h# 6@"!"1F AX0;hCI0yѝPh+НJh1+;I;H 0+a;"(F3FyKQ(I0;+; O1 !(F_F;(3F(?!:8F F(?8@/::.BI0+ xJM N0 D0F1#FV0+@i{^ KF#!3 F0{+  pG+#`$`V#` F+ F#` F$`V#`FF+I"O0pG{-A$FF!FF"@@! eF(M`(I(HF3``&I0 нѽ0c H%`hCз F$)"  I`hj0I`h b09F FG(I`hV0 a`( F(@@BqBlBp@Bf-OhFFFO#`eiU`hCF+FhsD Fh2RJEFeFhai rDB- B hFYF(F9hB`YFJF0F&5iUD%DciaB!hC`?HF"O9!jFI]Bgh-AFذF+)#L5FŔ x"hш4(O3jFO!8F,I#6b#`O0X4(O"O31F,#8F"{ЀB0h%-O5P*P䍭 !P @"@h 0!F@hhh F@!Fv0O0! Fm0I`h.0O0 B~pʱh!MDBo)x#`@@CpF0k3DFVű.؝#`  `(Fmx` hBٝ"#(F#;`BhhB9`3,1@m[h"Yhmv#e@!nK h" nO3#f03FT$ F@8F0P33[h,Ր>0+(D&0ke#h1h8B0YmkmB Rh>0+ H8@ 2033[hԒhepF F OqF0`X+ha K0#h+0#pOppOr0 0cSc-OFŰĐF!PFF$F3gѶH ; 0VOqF(d0 `ñ*.h( B "JBљh ћh`#+p(0> kpS+ *p [h0hs.0..OCk *" q? Fp(Os+OqPF0H KOs.. T0k`srH$@/D,DB. .d9h0щhBк*@C#0$00#)@FCQ$p$DB.Ѓ<0k<,@m6#p#q<0 0.f;+8##p#cpEKS BB 4(1x:3BD=#;( F x2Z(1x0D+.&јW0923:B!<#;"1 F1260D.'.=.:#;`#E#Fq+.ћ843:B+#;8$1 F81280D. .S.ЇcSc[h ;+@ā2##p#cp04D<0;+@3##p#cp0 0 +@dF7#;#0",2B;O`6,3d&rEc 3FR(? R, #ɲў0BОP .Ѡ:)ټB^ ,232x)B&ДBFS( S,#Ҳ|BАPB .ѡ:*ټB+,3 ;03ИW0 ;+@9##p#cp4$ 73+?Y ?3:BM#;7#1 F72 70D0D1Ԙ0՘Z0 :*@Ԁ"FP!cpFBF!9a2FsH!s0:BQ#`p#pЙ2 Cpa#p#q+XFU .%.4.2Џ #[hY(М;FB#F !YF`pF F[hZ ՘^0;+kt#fp#p4l953:B^ء#;9%1 F92r90D6+?A_`;;+?|##p#cpx6 0|66B\F#X, B%cx3D+ H (FUO0 +XFX!6,cxX,3DDcp0;H Op7-OFF *؝#EKBНV#$` F%,F+F/F*F,lB  `+_!FFBF˼PмQF BБ Eؼ4ѻxGaE]DԱB)F2DF!FFDZF+2F,ѝ#`~F|cSc FFF0Z0#x #pO0#`] `FFi0.Hn.KBBABFќh+%Hi &9i  H"FJ(hBC!F(FJ H(hD1E[ 5# #F0P F+8` Hc"F0F ] PHWg|} FFF08+h #`O0 FFF08+h #`O0 FFF2AKOa@JAHu0 bihh1#` L *: b`)\С`3# *F3F8FO3`:#*F3F8F##a;#*F3F8F#ca6#*F3F8F}#a!F K@QJhc`i`#!*F3F8Fb0 h``#*F3F8FS02c|pF`m\I"F>e蹜h+KHh03 " O0p I  Hh.h+FAhJ {G|W -8#FxTpF(2F)F#U FpF4F-OFɰFTI@FRFF(d(hZFQFF(mЛ1FF@EH 0FIOúOr3F0F6#RF[F(h4# RF[F 5FU 0#0,0+A.@ѝ0-N=@#+JOq8F ,G`$ICF*FHF1hGPF(HI$GBICF*FFHF F~;hNdG.ICF*F`HFNG `| @-OF%M F%NFURFO, ,52, B%p%B&F,ѽ0F| U,XB 3BU,XFU ,jFHF6,5#T ,@FT,5XF0F|!)*-OFF؜R#`) FB1F u\0 B O #DBҜ."#1F u@0O0*O!FZF\D|GpCFIFF0F$0T GdQFF0F0S*FF M؜#` . F]Ḵ,Ѫ(OchG:9FF0F0&-=1F(Fu +F@A0 I0F0 M#`1F u0O0mF02S0[ h# +F0-OFF+ehPp_0M՗o0 0hZF#AFF(@IT0@Ӏ%P0_0hZF#AFF(TP "EJ0FGF(؀T; Q L 8G9FPF(50hZFy#AFgF(ЀK+#%B77{h0h0  tHv{hCc{`(F ; +ٜ#` O DBҜ"#0FF(?r# '!F &DO2  T;B  B B O3O <#t0# 3 HF  8IFPF2(%x0hZF!#AFF(?!KE0  Y< +0FmFO5h B0B 0BO3! 1#cg) @CO OsB [oC#`C@O#C 3 FH C 8>!FPF(5F K&51-O}F0`FFF '4# h*F[FO'0'd _ѕl0+@𸀕,0+@̀#hOO, #h 2CE׀0OO, 3`0 3d6CEǀ#hOO, t#h x"BE2, #3, h`2B 0 Od6CE @FGI:FF0FQ0O0 }# h [F*F0# I:FF0F60# h [F*F0 (i@GzI:FF0F0b@F GsI:FF0F0Ѽ h GlI:FF0F0ѭ'0?C#Or@! laI :F0F0/'0?.ZJ@#@! ,VI :F0F0z(5Y,< "P @@O, dB? 0 ZF)FFx   h7J1F:FrY,,}* *!F} 1F: 'J:F hR , 3 ZsE20 PB hZF)Fh0:F1FK h   , Yj|@ {8FP5 F#d8p"$IF CF&#2FOq0 FO4p Fp"! F0OBOq F0# 0D# 0 +h" F j00-O&@Fh$ hdcicciai#bhca#ifa8# IF(F o0$`jFFgZF1FFHRO3#cKdD1@񜀨I(FdL!OsC `jF1FFH/O3#cK@0 Kd#kZ `j 3F1FFH+ؓH"1F,##ck z[ G{' {{zck#k:{{ z#h+;cn+8`jhB4єh00F#k1FF{H*B wH1FG{' {{*zkB#k1FnH:{{* z`jFt#k1FFbH^li+h aii iBxk+u#h+rXKd#kZu 3##`@0ӹ0i OH1FRFbi(hOrQFci0HHQF0h` [񗀡l(Fk(hRFIF(F(#`fh0(FD120C@iCaii iB.(F`n0VCF fk&HS(FO"K#h+ !K!K!bk K(K!k K!"k #H1Fl&.Ii_H^|  M (F(v@1 H!}J+FO`~ e-AF@F "hJ(h+F"!A׺033[h%v! *[!F #(hAi;(Fcik`jF> F(Hv(Fg2F!(FI(h+F"!&(F{h&`Eif@cidaif#b03 R(F,i)#3cb030"b!09F(Fcfh02q-OF`@FF*VX(E4 0H՟JsmH#:F)FVBF"Жh@vO:O (F0 AFCF(@𵀌H (hKF!xB3Zh*ѷ~Kls#dOzxlO`Pzx(F(4 0jJzmHmzgjz smv[@+@#xB3Zh*^Ksn+$"F(F(?}$?w<9к??rRJ+h@*D" C"   "  '" ""F  0Y;H \;O:8F:F0"brAF3J Fba7"b"E""p`Op@"!"rg" FvOrbmCF"FOaF F6H Rh4+1+? +hD1I(F0(h+F"!O 7+?`|DzCDCJ! 5Fp&P>`5 h#F"1Fh0 T6K h1FK 02 q F@1FF Hz F@sH C1F JJ |mEJ!8 8FP+h;+h#F J!hjF FH%# F+`0# Fd8@8 _J! Cp PF1FH=1Fk*kH hJ#!+`#FK#c Fd0p@30"b!0x J! FP`6h# 3F F-(C0H #hD1T,I Fd@ҿ6 F2F9FH#hD12  H@9F F!m2F9F 2F9F(a F0K@1!JHs  #hf+` (ah Fz F#$ F@}8J!D -CF` F hhiBrjBY0F(h3Y {ĀFIFF'H hiі@ ! F)F" FF!%#F"!aI Fd'P2"B#"R RC#h!y(F h"!K%a A0FhD12=#F! Phih" F*iZ'#+`# F F 0i FQFv FH F 0@+8F0P3 FFȹ HI Fd8@ (aH F8@ 28-GF`60@mhP#33C23 vCFѱH(GoJ+F@1 23ѩI" 0PmOq (O3`fP#"!i +`KPFd#+e#F 8{h hQF\(#(1{heԘs/A78F(( 1:F0b#C_(([#  FvHP 'qdhw07U F(G #h|q(7p(1"Zp(1  #h(^0>p7xv(رp*"(1Zp(> 0>)*# FGHGHFH (Gw:C F(Gd3;C  Fh(a+ i:F FFhaE r:C+@!HR0#+k3 hipF(@y?? *k `rEw H h#3kbS+ckk DkckDc}D k0~E[}Po}cScԑ0KE@р0ʀP-ˀ+h+ǀp#+`7d0C F8[H (G`?v3C hjET FPH00+h+0KE@hjE< FEHu Ff h#F2F!c02CЕ@ r h9K !k F(G h2K#iaE0&#3h*9$+i F9F;#@0ki 9F( FxFȱ@F ha(?hBF+i!ofah0Ch0 h\hK B?ݮ#3h+( F(GD(h cSc8 PF H Fh0 FCh0#d8@8 0FP30Hh0Ch0# Fd8@H FI hi 1a@Ա"h±1 rdnDhB"I]Kɸ]KpGa-OF#F xFPF+ jmKhBCF:F1F FF%> **z(#j+ 9D6۹ **XFX IFPFCF:F)F FidhA-CF FFF{B DI DH+F C-! F*FD-e'x@+`cz+]cBZ+UBQ T'½ *EDBBӽ D*>ѽ C*:!i" F F  h"&T'ýPp!F`p9FHFB E F H xb:1@F}jdp]`Fmh#`hBBiF FAF3hC H  IE(F1 ]phiF(F8`.m,W}vp" hh p@ H!0++p@m++p@p}!]0'O RF FZ`:F!` "a :`"Z` g$:`"`0n "FC H !]  F}Fh!8F@|iw`ithq(m Fj,h1h K 0"O32BдO32F#280h+Rh7FP50b00z>1(Sh%C#S`#+ +ShCSC#S`ShDCS`02c C F0@(C#CcO`z  F Hgjz R0; h*FK!0Dz 8FP#Fh!J Eh0+ h!8@8 -OFLiPͱ)h(knB  [H F# FXIkf F30F(ѳiZA)hñihBER FKHn033[hw F3 *0r!+h ++ Fv F033[hs;C F(&Ci-ki aokia+cj$'O FO /  Bji1i2Fx(њ2@*ٚz7/K! hd[l FbXx0DpqaF"в2pG[B F*pFٚD#`O0p&F`!=dB*F"tDU0F( @CO `@@O opGO@pGHpGXhHh hBhhBhJIpGh@Bh1h F" F(dh1h F h[h hhb@h"Bh1h F h[h hib@h"BhHh0+@n8 pG pG@ 2O0 ciPiӱ(Дhh *ñ( J0B O0( *XBXAFcSc1-OhF,O5#jpcj YFXJFIF0FF(@րdh;h+їh0+{n3KOqJHrYF:{nh+ F9F(O@FznoCg2@9{nh1#)F90"F00("F00F(Scj%00 FF(#yn81ynX1)Fr FF"FrF(?b)FoynxXCXgX)F0F`B+(F8&( hYF(?f")F!F@F{ #AF|0+")F!F0Jkx+(Fh88FF0FF0FF")F UE9FPF(<  $B +  ЙB"QF琹hC08F<" F,H F/F(?Co<CCg7iFO3/iF8( F[dg11X"!0FFHAF0FAFEE9F0F"!F(9FYe}qpĠ?h aj2 0ՐhC08F<" FH^`4 ,F((HOa Ga`2h`"a` B``3h`DF0h- FJ! ~3hhBѹ0#aai#a0;3!FRF(F7F- FOظ}0-GFh O Աi'h.hp! RF4CF0F?cKYFO I="(FpF(LFxF32:*FO<\4  3s3FF(̀C0FZHF(F 4MO`F(c#[ ((FO5o.-#"0F# OFF,FB)ObIF0F"0F  +TЙh(FD`o"O#OFKD; +ѸQ``8 & Vl-OF`F0FF0+@QNH PF qH-@#0(F !PF옹Ch;C`+ڈl (0hZ`x +0"! F1FhFqF `-'9F(1FhFq:1F``hFq4( "qd(x+Ѡ`E1FhFq ( "qP(x+`YFhFqa(YFhFq(YFhFq(1FhFqa(?{1FhFq b(?s1FhFq`b(?k:!(d%n%l& k K[h L"OcFF0880( & &XF KFFF[hc"+FFFgH %`( `& FK 8D& 8%L`h%`e`8& -AF FFF#F*F! g K84F P  @& JOc0] &X-AF FFF#F)F" g K84F P  @& JOc0] &X8@P@@@ @@0pG-A4F N# u(F !'F09+F% +O8FE-O FF AF%G@?F@D&WKOz hZhFAFD CA9FCD QӢB ӴOغ_=#cC ?XFiFFF&\FFFFf9FF 0F^1FF (FV)FF FN!F@F ,CiFizihC(D#@S@aJi30B P#@hiC)D"@b@aka3O30F FA Cc"BF#F0,ЄB)F00јZ@"h](KhlKIGKz+У&\-AFMh3б+i( P/iF8@oi?B8GD8FFB`Ѯa>Da F0 )j"F D$!F(Шa Da&\8? M$?ii#DBӨiDa8 F( &\Ch#Fh+pGhhBFh ChBpGFpG𵇰KM$0+ILIKJH&hFFG&hFKGJHIHHG&GJHK%)FFIFJ/z( FEHEI&h/FDHG*CJCK))FAIBJ(p( F@H@I'/F>H?O&h8FGjiF&h0&K'JF8HG(kiF&h&!K"JF4HGiF &hKJF0HGhkiF&hKJF,HGkiF&hKJF(HGhiiF&h KFF$HG`hiF%hK!JF!HGK$h HFFG&\Q:$ '6GTW\Kk hcpG&\Jpil  @@@"S4`uBeO4 D0D bLbTYi DZap2&\-OFFs?+@  ј`$0lH}\iM&h2BO`@h&fcfd@d lccA9dYaf@f#jh%j@cafY#"g2!a*B"ag1agbo@c`'0CNH "#3%g(Fg` (FOjc*"cm3em+@ԀB8#c"kciқ#c k%Pl e(@ʀO@F $MXFF (?b#;p]m.[A9* &,7PW`o{"(.LSYhw}##r6##&00##%0*#"lkh2B#;k`kh+?3&\ Ͽem;em3#$0#h+;`"lh:B3h+;`"lh:B3#'0##(0##)0##*0#0#0+hFKQFG?6B#c#k+-#)"k)F(F#mh+?)#T0&O#KT0@ pG&\p/L%Kp{Dh&mPjBV'#mh#mS 0 5!k0&\O<Kp/{DhX hpGNh$"F2 `#`ڱ4`%&hh*h"`BhO4F+F]h$Q``hhB4Thl @ci@"caO3D $0$0&0"*{oB 030D+D3` `;oBO QjHjDa2D2`i2jB !F@F3j!F@FaiBcia{ h!F0y&0K yi @yi FG&\0$BKlD0v44&\JFopGiiBhpG@h&\KpiB lC@nj& DBЛ@ Dihp(j@hF@i&\-CF\O;i%B :lCh@ $P%DBy]@ D/iBFZ! Fji`31Ѹ$DJ\@jiC Pka"iCai:i3aB-:hB##;`h)F0FCO0K#L4 +JOt@`C@ AF+8)F+9hB=`Bًi+8W8)FCO P@*FZ!*F!FhF"FFxwbiZ! i kc#`&\t-CF>NsiBsi;DBn9F F(Ch3*$ F0%Đ-(F)FX,iFHF8kc+`oB0B F"9FFйEFFh F3i@FB,,F&\epGpGpGHpG HpG K0h3pGK0h3pGK0h3ppGK0h3pGK0h3pGK0h3pGK0h3pGK0h3`pGK0h3 pGK0h3@pGK0h3pGK0h3ppG9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpGPٽhF;+`ڌiB (]K h\ `p]KpGipFN$V4(Ff Fp4 , K +KKhG pGF0 S pG0pGhxK0h@ pGR0O0pGXK0h30o O0pG@FFR;BpGFpGFV FK0h3pGK0h3pG7Fx M K*FhLI+F"FH{0L%FK(9 xH+ pG pGHpGDJK3(FFpGRF ;A,A 0, 3۲B(O0 KhBKhS HpGxмXKhBKhS HpGnpGpG pG F Ht I FmHPh IFH{`I o\@HD0R]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBЖ#` I)}F`JF 'h"EhFhB x46@d(ݚh J" L` x209*( "`&FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00W]h;iP!0xCC@!0pGh`K3pG&Fh FF2BY!QB i"1FMt F !@i=C"iYaB#PK}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhF#i(i(LP&`S+B2C,ZjB2ZbBѪicC"DD+iQ-AFZSBF FSA'0ip0iF FG2BҔtu(J)8YB;x\*GZx|*D0iF FGhKiBѣh #`t0+]Дu!bh#hpB5 bE1ٓ\,ѓ|'31#`x|*xBoiF FG3)YBxB[xBBٓ|3i)ѝᱚB! Ft0+  FiRiOA Fc Fi DOA!3OAi Fi FSRi"OA F3=&F%N FF3h+ Os#B-#@\ CTkK52hh* Op 30B#@\ CTKh30B#@b\CcTj"j1M 8F !@[jbZb PP-AF5hBhB,xB lx], O0 ! F8Fi#ii*DaF FFFhi.ݶ ##/ݷ !! D+>n{9Fa2+FROA F;F" FiOA FR)F FRA"OA FOi" F95"OA F@AV+FrOA F?iOA FR2i)F FR"OA F&i" F9 "OA Fi2F FQ&Fz2OAR+F F^iOAR)F F=>?Fe)F F5>F^ F!@pFN$V4)F4 p , )KQ<GFpGF)K Fh+ Os#B%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6P-OFhBhOkB"I(FFPOA F_#h3#`"I(FxFO A#j@"hh1M( ! FO7#j!h`j`@"(F#jiD#c2Bx^)3#`#c#hB x]*3)F F#`l-*fN1Bx]* XB-*[x]+, `)F FR2Bph+WK3m-*[*сBZx:*=* F1BF؀:F)F F+ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BFYBCx:*@Zx]*=3#`z2"`:F '|F(0+ Os#Eij"(j1Mh !QFXF ZF)F F7kj(bZjb h #`f8&P3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fu#Bӣh #`f2B YBx=*Zx]*?yh+#x-*$ZB Yx])?"`-& FFWE?0+5WEݣh #`f0+ Os#B ںE:F7)F F!?3#`Eik"(k1MJ !kk(c #p3kcQF8F(ݣh #`fO YF8Fw( QFXFq()F F  vZ"`x]+􊮣h+#k>#jiBkxCkp/K h+F O|O gE6+j+?kk+(j>D@"!(FBܭ"jh;`#`:0\ AB3F#jO@Q FhOPj FpFi(KI h1!I h10Be F#`]#0#0 c` ue pIOQ F p@۹h-AS`Fxi\-@BhBӃh #`K3#hZ"`x@)GuB`[-*-.-𗀣h+@ۀ#hՠo( F"jOA Fl_d /:Fb2B YBx\*[x)+)"\! F /OA Fid:Fd2BYB@x\*@Zx)*@3#`Z.ܵ#ڵݧ0Wt<+BFO`Q F6WWt, F1jBFOA F(#j"Zd.w"OAU@{Bn ! F #jiD F#` c`^#0 #0]#0#00BF*)I"`3FiOA F25iOA FiOA F23F%iOA F O Q F"O Ah #`/K3!! F i+?h #`&K3!Bb\)`Zx{*]3 F#`1BF0x,*-Z"`B+J[xh320Z# FBFݢh "`J"*F1F F2BYBx\)Yx}) 3#`+FOs&!`#hB YBx\([x}+ ! F)РoFp FA"OA F:"O A! FG{+| F2BFx,*~Z"`J[xh320Zv FBFݢh "`J"*F1F F2Bex})b3#`I&Ȣi3FOA F2iOA FiOA3F2 FiOA F$iOA3F F2iOAi3FOA F2iOA Fii1F FO"OA F]i" F9C"OA+FOs3#`#hBx}) ! F9h #`K3&+-O" FFFG ЅhB@mL F KB FF%!U&0 F P"1F=DVR t0xЙKu`!6"O5OahF"" " R""+Dag#B #K32BQ"OahF"KaaaL8``( !hFc`@chIFMFOF NF0XFP xC@_:Kس_€-سo𽀳_׀kB)>Fc#k!cO1#u0]K]K ]K!ZhFxP*F)FhFF_ _kB@)c#k>FD!c)F)1OسOسO xJok-@O3#c%O^гOOXJسOFXF*xJ xCOEгOBгO#jC#bk-@@ !@`cprC_Bjk@!0;!(FF(^Ѧc`k(N#cc0O pB OгOGkB)c!#kD!c)F>FUUT -&  ѳ8Oг@O-_F5m))D%h!c))DRhbcdV+xG_+B%u#CU~AF!(Ffc0Fj#:@#3B+F*FWWB9`:`B2V# B+ "F'0Bj\E;:FP#B@#@# V#09h3EGGB7ӝB0F`h"F0PxAO5бO4бo#jC#bME##`#ld @0Oe#0#j[!hF@FL&#BV" k+?+"3B8F; F)K Fh+ Os#B%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6P8FK Fh+) k\A`@8kӱ K4(F$h3(K(Fh3w8 8@oP-OF-Fȴ FzBؠE🀜)hO NhV#xBOF ز _ ز_𸀲_ʀ_}"@_B" *@KF0O-ز O(OOjiB[!xJ0  _)P*iBjhhBFJ0 >_);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEh("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@Y*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOKh&xF???.Hh Ѻd ?$FBDB?hJFD Fn(FFR# 3BLDFBF!F(FzKFN&xFDi7C'@iS' B?{!FC'@&xC(FBFz.(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F#BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?<LvOвOвOѫh&xFh(FOC !Fr`BFzKFF(QhDK .Ǯ[-O%2F @ (FFFVE FP& xCO4<س`_0!س_}س_gг_t6m _|г@_Ѹ AF(WO سOгOcгOHOгO OJسO سOeгO #lOгO8O0س(Oг0O+@O EDC+x,xL% DC B$ Dh!B?e>% @^,xLDC CR!xA DP!xNO3 ,xLDC P#0xCO?4 L,-OFF_0F YFjk # 0o(hF)FhPE(iPEhh@L ( F "hiPE""O6`*BRF ,}(hi } .FOFr@hh~(hoojaD|hhyO qhh\I  9YF(hyFѸla](9YF(heFlJahrg?0p/@_ D w0(vѦ_xBxAB{o9YF(h6FoO4bghh(ho$ .(hibO OGFO OFDJ h0_,r _);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEh ("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@Y*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOKh&xF???.Hh Ѻd ?$FBDB?hJFD F(FFR# 3BLDFBF!F(FzKFN&xFDi7C'@iS' B?{!FC'@&xC(FBFz.(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F#BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?<LvOвOвOѫh&xFh(FOC !Fr`BFzKFF(QhDK .Ǯ[-OF2F F )F F_E F\'0xAOACر`_3$ر_ ر_sб_75 _𙀱@_ѹ IF#(ZO رOбOбOa]LOбO`]id OZرO رOOa]) O!бO-8OBر(Oб0O )@O a]E]CU?&\1C!Tx )?qlif\0C`Td+?a[]#xN`]CUa]]CU(M)?J?=FD]`]CU#xND`]C6hf]!\1C!T&xF0D>\&`xNOn0Dhf]#xN!\1C!TQ xAO-OFF_0F ! 2Bkk hFRi"YF F"o hF:"hFRihRE"iREbh@\"biRE""O6`b"hF Ri4(SF -y"hi y .FOFq}bhz"hoojhDxbhuO pbh\I  9YF hLFѺfhY*9YF h8FsJhhqƀi 2){ѥ_}B}Aq2 *rѦ_BBBABxo9YF h FlO5fjbh"ho$ ."hijO OGFO OFLIj h1 _-q FIr h1 _.oj?Jhj1 _-r?zr1 *r_.oloof%"12)3_.\"*:"hF Wi:F6h E* :F F"h RiF5F YF hoDFq12 *_-3a+x  -OFFF FO B F3hO XhP%0xBOвO"вO!#xG/DO N5ز@_Hز_Dв _A]F!xADP'xLO/F/FOBF+F!F0F BF[FFF0FEE 2O𙀲OPвOѱh#xCh PZ`4BF+F!F0FBF[FFF0FE 25JF!F0F+Fz0+FJF!F0F_LFk%FJF!F0FzB%F"F)FFBF+F!F0FBF[FFF0FEz2hk=RhR "xBD:F!F0FZB2hiRhR!P%xE DR% xBO=!F:F0F_);8O@O*iB!xJ0  _)6liirB0 @*@_.Ѧ_ B !xN0(@𤀡_qBqAB E$ F+BE4"wEhL("h*iBjh?ajiBjh*iBjh?QhBjiB, * iԸjiBд"xjiB*&xr<_.@Y*iBjh?&hB < Ѿ_ . i jh*iB} H2 _)?n(l_.h*?O"R!]jiB]"x * i Q0)M_*D3 "xBDV# xAOKh&xF???.Hh Ѻd ?$FBDB?hJFD F(FFR# 3BLDFBF!F(FzKFN&xFDi7C'@iS' B?{!FC'@&xC(FBFz.(F;&xFDKFBF!F(Fz(+hYhQ& xBO? Dr ^h&xFDQ&0xCO>h&xFh!FO(F#BFzKFF(hD*hRhR#`xBO?{ زOвOв`_?<LvOвOвOѫh&xFh(FOC !Fr`BFzKFF(QhDK .Ǯ[-OF-Oe"Fh&B@hME"!hB@&j@Ii h i)"i@\*'+khh  Ej)bk*8k8DEv٘0R#0+n= B@ɃB!bi  ;@1(!#DDD!d#kBۨE8FO RFYFKF({cl+O RFKFFh3F qDqE&~3 xB kB@F (КEF[FF~/cl+C 3 l0 &` 3l"Bb blcCe ZFKFFYE 2 KF@F(F KF(O/Or#Os0$ " lB)  8 eF(B C?2PlX#3 ZFKFg+0%(pai*' )F+vkhh  Ej)bk*8k8DE`٘0R#0+X= B@xB #+ @33#k+ۨE8FO RFYFKFc(cl+LO RFKFPFh3F DqE3 xB kB@F(КEFћ[FF/cl+Q 3 l0i s & [W0F 3l"BZ blcCZ ZFKFaFYÉ 2 KFF(F KFK(//Or#Os0$ " lB)  8 eF(Bю2lX#3 ZFKF +0(nFFm+khh  EBj)bk*8k; Et٘0R#0+l=   B@@B! @;(!DD#DFX#k+ۨE8FO RFYFKF(րcl+? O RFKFFh3JF sDqEZ3 xB kB@F h (КEF@[FF/cl+D 3 l0 +?Y 3l"B[ blcC[ ZFKF蹀FYE 2 KF3F(F KF(/?/Or#Os0s$ " lB)  8 eF(BW2lX#3 ZFKFz+0(FF6&$ &"&  i[\#0R B,DD [\#0R B,DDf [\#0R B,DDpGpG pG v, pGpG pGpG8#MF`+x %`8Oq(FUL( &7FM+xD 0(%`&Fhx[@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!Hv~HHo&g ( pG pGO-$MPpL0WH0` ` ) I)APd@0`0@P@PT0030#W00S 07Y0*:# 0   0 7Wp  pq $Ѝ 0u7d0 m70 h7@pPp `L  0 P@0K $Ѝ( \@O`Pd@@-QM@b ^00 VP R`0ptЍpw`R` 0Npf-00Ѝ0s 0 0s` XO-M0hw@0h[ PA  0YAZKW  0 0X%  0 0V<  0 }0 h v0X q0tЍVY PZ, P \0 W0Z  P0 K0KЍ P >0[  70W PX PV P PЍO+}}}}X}h}(}@|}|||`|`|{O-@QMĄ00R㸤 p000 `P 0400 P R nR a BRrMT1   oRl "BPM Ѝ  BPY U000T000  BP[Y U070T070P APY U000T000 APYU000T000 APYT000U000{ APYN U080T080j r@ APY9  AP  AP  AP_YK U080T080@ APp  AP  APJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l 5AP T .AP {{8{zz8yyy\y0xxxxxxhw,w,C-dM0@Hp>S@` @@@@ `$`(`,`  7"`0P! @3@0 p@$ 0 5p@ 4p@  ̫p@`C  `4C`C P㺫CPdЍC00xŸO-1MM @!`D0"$H"Ġ "( 嶫p C.F DP4pW;@D8 (@M0Sn ȡp ıp Q00$ P %0!p卫t0p@ !0  0SP Ꭻ0S R`C@001ݍЍXC0S PEPU Rᐫ PXp 0g8D<4! @P 0 00 R 0!0h,RhL gH@㺬1ݍЍ豫uuuhttt0@-M 0P Np@ b&p@ P 0 0#Ѝ0  Ѝ0A-@@`v. PP0P0 pp p>`p0p0B`Vp B``p`p0p0B 00p@-@PCM4 /1P6 @@㺪p@% ` ᭪PB000u5 9 C>P@0FF0 0 4EP@J60S@ VS 00 SCލp|@@0S@0P`0` @0  P@1:hB@?00@aB0@0Yppp@-MQM@P4SZ TE /j1PB QP0s* N?P٫Qa0P `RpQ @0 @A:pqH L upA ۍЍp)0si/%@@%10p" +-:@P0 @0  P@1:A@?00p04@A0#S/p@ A00A@PAPY(n@XnXMmlXo(o0@-qP`O-$(PY,pR`@0U*00ï 2W0 0 020 R0*00V&{Gp &Cp@tp4 2x 2 r@pwkP@s`U@-DM@ 'P- 0j jB0p #ϠDl+@J^b-0@?o2S000  ` @00< ̌ ̌@ L 0\S   00 000S 0@ `P 000 0 D^/KZ 0-0@^?o2  `y Y 1 `Ѝ 0s000`Ѝ0@Pb (P bP (P0 )P0CS 00}`0 ^41000.P0S00S #  00000S0m!S4  ..FR( mSq .=.0GRf L<Pm PY C@8P Q X ~=P  Q00 R pp!@`=P QDW=P i ,B,@cNM=P QB@M  Q ;=P  J0.S000S00<0S ;@ 0sS9 TAT@sN=P Q0S0p0 A @N<P Q .S0 0SQ0 <P QA <P\ Qs0 0  Hli,hhhLTh(gxLXffA-@PU 7UP7UP!A`FQFqP ``HP 0!Eq1pP 02PO-MD    pu T `H0ݽ @ݽOX /L0  /`0   SB  a WgX !0C3Sf  ]ZYf  |eF wp|7VC4@21 {tQ >00,1SC. 0=S 0qS1X"R 8 Y8T 8>@01S0OX< A  %P XPL QE0qBLp` ?XP`u0 L00 tX0" T `00q!S?QL0X͟qaH0X PA&* 3!,!R\ UQ X" RP ^XL0R p <L 0XPL h` X 1 3@TЍ 6Ql<00X2S$R: p~ L 8Y0 h1L`X Xq SI@ Ql1,Q qQV+ 0nP0W: pR LpXP; 0L ` 1X 0@PkH@(00(0000,00,0HXP,0\0# <Q0 0 =S%0@Dh02$0SXP"Ex(XP A PPH@pXP hH@fS@ XP E SQ#XP!E SQE# &XP(0$Z 00 <P00=SH LL^X\0 0Dh@0XP0S <Q  LXR\@D0h$0XP0$0 0XP0 0$0SXP"x(0XP0(0,00,0(00(0XP0 000(0XPL0P dS&ȡl0 d0` E00EEE 0wXP 0RQAP  3@0D hfX0\8 #PT p0v> 0d0?`0l00T0?P0h0<0?80d0D0?@0`0L0?H0\0\0?X00XP0 0 Z 0 0 0 0d07XP2/0 S0*Q00 <S $ 0 h000XP0  0C0  CQ $0h0  XP h $  0S 0000000XP00$0S"XPxXP0(00XP(0$ RXP0Q""BP""@| #Ό0P00"x0hhxgLg4feetedxPd$0XP2t rt p p uXP 0  SM QJ#SE & E%`H S;  PQ/%8< &I# & 0(0dR0S@D  0h0 6 BQ0 @00D h0+ 0C 000 00S \0 0 0 0 J00 00S \0h0,  0 %#7  &  MP # 0S000sWd0  j6d0  d6$ O-Mp:[P0 0:W00j X 0< @0  ?0n`P  0v> 00?0000?0 02 l*4 0?Ḁ8 000000000000000 000P 90\0PA 0TP 3 dP 1PPR0SOʴ RLʠ RIʨQF00 0S 00# "0S ES}>  0 ::0p GvnL܀ `F⼐H00 00 00   Q 0R`00pQ p0\0hl0 ^\dplp` @ SYR R|\pVlXh0SdW`0S\0 R{z  RR~ڠ70>C 0C0)<2L0P8 5@0(<2@0t0pP@Rgx0S 9ppt`000(, \( dPJ p0l'l?0   P 0 0 0 R1 R?V0 0 ! 0`05l7vA Hp0/ PQ 0 5 Sl000h Rh0{9 0 'pwq`  0pqi90S ZPR@ʨQ @T X9 00 ߍ!P9\ !{q/ ) Q R<Q8 RTP\0 P0,P0  PZP S 00@ 9\ 0P 90S0000 X ZR0. \ P_PԴ \̴ \Ĵ \⼴  \ⴴ00i 80SR XB(hQ:  @`Q5:03PM~0Y`P@& @ MdSal0 ]ZP 3y0v8\Pp`@(@(,3Pf /v 0" K0S" P=0Xt 0V0 4T@1 Z@T @PA%"0 S6L^70  "pq1   ptF8#00C80S Y\|9 RM<0,"2# Zÿ sQ 8T0080Sq!8!Q  @A%" 80 007T007T008NrX@-@ᛠ aBメp٠֠ӠTL00P 0 0R/P/ /D[`[T  DP 0 H Sp@-`P P 0@ #  TQp Pp /D0ZZH  P/j.0 0# /P/Cx000@-PP Lo>O@ 0" P0 0CHA-@P @`pP@0% P PPA-`X@@P jNpP@0& lP PPB\A-`X@@DP H@pP@0& QP PPAO- MP 0P09 P@ p <P P oN` @% %P P0Sp * Ѝv 0p@ T 2   p 0pSBLAPA-PpQ `@Q P@D 0DB(000S  y .a@- M`ppPP( 6  |00S@ 60"S" 0p000S0 7/ Ѝ60"S1Ds\0pT000S @ Ѝ1Ds$ 4 . `-`d@-@ @肠O- MpPW  pp2S `PL P@T Pp G <P jP6 0nS# p= G%@P00Q Q LP  H^ B" \0A 0 0@00oSpl000S <:` Ѝ<  /-``(?+^O-BMM@p5d 0 0IP:$PP 0 IPr0010P0 C `JP@@v0 PPip o0P0  0PP[p |@P$ hzаD 0 dQ`k`V`} pP  r} 02P @PP0 PapT Q P0Y5 00BލЍP/U `  P XpAC50ST  P`-BލЍ W-0H 00PPp@  P5 P00 0;-p!0 (0 0 5L 00 0(-(P`40  ! ;O00 4 00 0-PPz4 00 0,PoPm4` 00 0,PPa^t^h^''],[\`[[[|[L[DZZZl-M 0  [PЍ-M 0 > FPЍ-M 0 ? 1PЍ-M00 0 6<PЍYX--( 0P    0/ 00>|>lp@-Pn,U@pC4,,0 ? P  5/p>Xp@-PU@p+4,,0 ? P  5/p=X@-@P 0003/=dX@-@P 0003/=$X@p@-PU?o@20S 0 003/p<Xp@-P`^UV00P00@Sp$ 0P5/p<`Wp@-PzU?o@20S 0 003/p<Wxp@-P`4.@Pp3((0  @p@/;WLp@-P@P p 0 003/p;dW-@-M  dp@(0$003/Ѝ@ Ѝ/; V@-dp@0003/:VO-$M`Pؤ@ 0 0'0Sp$ЍJ30 (P@@4/$Ѝ:UO-$M`Pؤ@ 0 00Sp$Ѝ30 (P@@4/$Ѝ9pU!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////V$U,U(UUUUUUUUpU`ULU4U UTU@TTTTTTlTXTDT4T TTSSSTdtO-DMP`h0pU@@0l0 000 S S S F200 DЍ>00p0 S0pG0 00KPZ0G" `0` U0SXU Y p00C` 0 <0 P00p(V `@ B@PE PR> 3 4U *$0 0G  0 00$0P P U2<3 7[`; YI Ih XR3"^P<^P `0U4@ YDX: Q7V `@ BPE PR> 3 4U *000G0 0 000[P $ < `Y `0<S Z>0304p0S000 DЍ PU4@ Y,P U4 `1 `! Y@@ Yd;00-X;00)Y p0 PA $08 (0 004,< FQp0)Q!*AQ S P @0S Q0} FQbQ 0 `30 @210 0[0 X 3 "R Y$0(@ @H0PE 00PS>0304U *000G 0 000 P`PU`2<0307 0SD 4 P=S @ZA 0 ` 0*Q)P$0(@` BPE0PS>0304U *00G0 0 00VP 0P U41!`Z [P U*`0`Z ``0fQi  [ 1< ` L,.[ X3"^ l:.,  @22, 4 8  L Y$ @(@H PE  PR> 3 4U *,0 0G  0 00k,00P`PU`2< 3 7 R FS 0,0,0S80G, 0400LP, PU0`0,0 `0`, <00@P<<PQ(($U4$FSY@0 0,000S,0 P<R00S(00(0$00U 4$0 @ZP  0*0S)P$0(@ BPE PR>0304U *`00G0 0 00XP `P U41!Z [P U4<0 00@Z7  0*0S)P$0(@ BPE PR>0304U *`00G0 0 00XP `>P U41!Z [P U4[1 0S.Y$00(@H0PE 00PS>0304U *000G 0 00q 00RP`PU %=03104 <00,0"PU=030480G 0400OP<0PU`0 X00Sh 0X`:Y$00(@H0PE 00PS>0304U *000G 0 00& 00RP`PU_*#00,0, 0[) 0S&Y$0(H0PE 00PS>0304U *000G 0 00 00RP`/PU.*=00PU0# 0%=030403 05PU :0, ,0 0,0 0 #0, 0,0 0 `  0<00 ,00,},0 0ySPT+-M0 0 /Ѝp@-MP`@0 0 4/ЍpG-PRM^  `UpP*a@/P T1< 0p00p Ѝ80S 1< 0 p00pF.0S ЍĠ <.0S 0 @< 0< 000@ pp!.0S. 0 . 0 TA$@\ pC|CP(@- @MЍ`ȀO-EM M aX@PE`p+& mH0P @)T 0 aH@0PT 0 A P  UEލ Ѝ- 0 Eލ Ѝ- 0 A@-`@M pP%P+ /G0SP 0rS'0rS00P 00 0@P@Ѝ0rS\ 0 @Ѝ0 Ѝ@up- 0 AlAA-`@#jp@ 0P/S /GP @0p S  0 SZ %@p@-IMM@`PP ᘖp 0: S p0 0tp IލЍp-@O00IލЍp@IލЍp-@00@t  , @@KDA|`0@p3  W0 S8 0? P PP Wt  ,0000IC1  00 0Q, 0î Ѝt 0 00r(404 0@-00 @?P80@080r@-@?P80@080-M0 Ѝ-M0 ЍO-@iM?QP0ȁqaԱ(0 _P`?`( K͌U NP?( K͌T =P>( F͌(X +P>( F͌(W PH>( C͌ V P>J( B͌8[ P=( ̌1S P l=^( B͌ 0`3@@@ 0S7800PH0`@P@P@P@P$@P@P0@P@PH(@P@PL(P@P@PPPx@P'( @Q780 T0x100C<0S000C40h0P0080)0P080a* ,0p `0@W 0g1p W.00 `00V0 `OV, W 0 @ `d少Xh` 0V `Piߍ `0 1Sp ,000q1S D 0|0 0w>p004,0P0 A,00Q 00D 02!!@ H4 , @ B  0S% 00p 00C10@S3 00   0 X  X,000 0S,000p,0W1 0X :P@0Sp80< 080R5180]0PX0,00@V0P0 001D0O4 0P00X0B 0F0P0000?P0X40 0CR0P@,00`0T d!@PX0 p0$0W 0 p`W0T,00` pp封W 0[ P00@0SD@,0pD0 , TH0  0q{0D |I000=p^O P  0\@ `    0 \` P  0 U a P@  0T c @  0X e @p  0W gJ @`  0V i @  0[ kD @R\,00@d R+X000 400C $0R@pP$,000,0 WH 00` Q ʔD |p 000<p1$0<0 10400C\0 0 00XD40 0CRJ0P @,00` 000T d!@PX20 p000W 0 p1W0T ,00` pp封W 0[ P\0 R0-X 00 0 400C 0R P< ` p,010 0 W,00H 0@ a ʕD |p 000E<p( D00 0 R ,0S> p,00 r4X 0h1,0S+  80 P 0H0 @0T000 @T,00 P @a,0V1B@ T  0 @0Pb$040 SG40 P 00C, 0 [# 00` 0 0C10 S2  0 D 0 0L @ T  @jT,000 @,0,0Z0`01~@ Z  0 @0P 0S< p< ,01X 0h1 0S,  @0 P 0P0 @0T000 @'T,0 0 P @Ta 0V1V@ T  0 @0P0`40SW40@ 00C00,p V$ 00 00C10@SA  0 X 0 0T P U  PU0,p00 0 P0|,0Y00 01P U  0 P?0P( T40 0 R080000StO-`YMq0tcSA P T3? 00K͌ u0S3?HPK͌Hv0S2?p`F͌(pt0S{t2?@F͌(蘀w0So(2?pC͌ y0Sc1耍?B͌8 萍{0SW1? ̌ 1s0SK1?81NB͌ 80 @DYߍ 00u0Sl HPv0Sw p`t0S @{w0S pty0S 耍 m{0S  f1s0S N ^]4@-M@ @ 04@P$( ,ЍZ(@-M@ @ 04@P$( ,ЍY(X0T 0 DDQ @Q$00?H/Yl(|(L0 D D 0 R #@ R 00?H/X|(0 A-0D   R #@ R# P?HU`p@V,010 0D C  \(  @T  00X|(0 00W(d d0 H?30\ -<@ G \<0@0G/W|(0O-SH4M 4ЍpP$|   L0!100A9|@Pc 0`D0 R P`@0PR0 T HP V@ `@`|X9P! ?3 R #@ R< Dp H0L |" 00( 28 8`P0S R,@PR @P0 9 R0`SV4ЍT `@000  0`Pr @|`W |(0 00^T(X0X 0p@-Q0P @PK!ppT(0S p@-P@P5 pp/H 0?0- \ @ 00\R  |0D S   R 0S 00S|(0 00S( 0 0 /֐O-MpR@l2P0`0Vu T2*PP0LrL 0@2@Ÿ8,匒002吒嘂  $ T X  \ ! ` 0h01 0i010p0jpp 0@z0刲 0匲0吲0嘲0$TX\`hij  1Q0('0 0 0 0 iЍ|00 0t000x000`0\0X0X0T0P0P0D0D0 @000R$l X (C-pP∂M@ e`P `2@J0P P 0""RRRdRhR`P"S PPPPSS3PU S pP $pK |0p R\ PR0 PPP(P9 0 PPP (P. p* L#p& p0 P'P  |&c$000S :3S Ѝ|P &ZRk2SP U`Ѝh0S%pPbOt$A-Z`p|pP YBB2S@ Tsq000 R AS A NMT@- M\Q`X+ P@E_ 0 S*01|0# p!!!- Q!!!!> !< !^ v : !' !_ !| !o !* !! !f ! R |1 R 0S8 ЍQ  800 Ch0 T  ЍTL(tD0h 0 S/G-M0AO@J@ <J ^GvD#Ax:>';#8 #5H#2p-/-,`_)|&o#p ryz{@|h}wЬJ4lD̄A-o\PP p  @ 0^(PU 0(`D,ǟ,7O- Mp7 0EJm`&0ᄢ  &  SW[  p p PP  pTPIS  Pr  aR$RTL&0 0 O 0  ;0 $QPBPq 0 ;0p t 0S 4 0 s0 0bR44 $R %5P  0Ѝ p PP' 4P 4$0$ s 00bR% 40 0 !P0S 4 0s0 0lR4S4  40400AR0SW0yS jpP 0@    $ `004S 4 0 q 4QPQ040@Q  000r0  cR$W0< SS p: 4pP 0@  N  $R `004S 0040 s0 0bR $4S4]0"P0 0Ѝ0  ;0p4S  20 0#?cS  |20 0` py L20 0` p 0 $ P 0 s0 0bR 40 ;0yp1 P- p 40 0s440040 s0 0bR44Pl1 $0$ r0  aRCo $4100 p 01$0 r 0 aR$z 00 0#?c0`000`00000e00`00S( ! h0d00 * E(ެބxܠ0ۜڈج 0*- 0 0004 44PO-` TDM4@P8 $Q0h v :Q{#R3Z 300S v 8 0 0P @P`@-@P% HP PFP0S)[P& mR R@0R0 1BqQ;RS S0 CmSr ;S R0 R S0S PS0C;S q Q0RRR O-@0 M uSp`e`Z|P DT0ɍ<` 0rr I|"R 3S(0$00 0B PK?T0 HTx7 P ?X 0SL$$ @$ 0|"44`0T $4X 0 4S0300S7 p0S4 4S. 4S 0D/q @T㌑T2l" 8PW 00@l2Z& L[# `P P v0`U SV 0H5S4S 4S0?o2@8Yp2=3@t2 P[ 00@t2W>3@x2 P1 00@x2h Ѝ0 D $l h $ <% p 0$0(0`W P>0@l2Yo Pl2<l2Zn Pl2?;~0l2Y P<3@x2Z Px2?;~0x2T Px278x2W  P<3@t2Z  Pt2?;~0t2T  Pt278t2|200S0X00 0rr G|"R1S0& 4S"VL%RLZ8p2=3@t2^8p2=3@t2Q6 X  0 001800- $ Tx Xl h  \lT 0p 0tx"| ~R1\804  P X0 0//0LO- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-刑\ Q |pPl0@`P QV00` tPE ,0 R 0"00p0P00 CP N0P  H  ర帰 就帱00S0L)<0 800w/P 4 $A-P@p P P@ `D@D`0 ~2V P@0 p 2P p@-\`P@U 0S1 RU0S@@[0SVp@=G-l@`pS0 SV0S"Q0S 0SV0A-0M`@@᫻P. , 0 @S@j @1 J~p † 0|" QU  P*# [TۍŽhŴ 4X \X - LM  R  ʂ0   Ѝ*`0 Q0@-@L00S :T #l/*0 0A-p0S :P#CRQ# # `0:@P #Cc## B`0:#!BQ##*T0 P-0M 00S ʃ0  8 Ѝ)0804  P T0 0//(p@-PN|``p@0@ 0SP0P0:3S 8 L40 0D0 :#p(O- Mxt3E hs`0`p0 *PL3B0 (VU p p PQ p   r  `R  01Q @R R6 RV0B S l20 `hpy  @V `  Ѝ R l \  Ѝgp P ` Ѝ@1q lRQ  S7H @x0 ` 0  S, (q 1lRQ     Ѝ6p  q`RBoo000#?c p Ѝ 0X0 T00XƧ8  'xd($ 4G-@P c 3`pe 80$ RR a ʌ3S23SyX " R &8' $ЍP Q ` *P  0:# 0`x `  000 000 0<00  (D@-,@@0S00@-$@@0S00X@-MT@@ 0S Ѝ<  000 000 0Ѝ $@-MX@@ 0SЍ 0 R0 0 0 0@-$M8B82@PQ :3ST03b`pp0Sea` 0SO1p0S@ U0 0 B0)1`00|PQ 1@ 200 R 8 G 20 0X200 # 03,0 ppP`$Ѝ0`00|P @ <0 R0 0 20 000@ @8 Q2004 p@-$MP@ ` :@8@@0@tV 8Xp0@p@@tt4000:3S [ t$Ѝ 0 000:3S/I T0T 00:3S 03@-ppP`/@0< 0@-0 03, ppP`<0< 0@-0030ppP`<p@-@QP0P000 |P t0 1h000*pxP 00 1(000*Cpp00 p@-P *C T |Ppd  10*p@xPp,  z10*Cp@8p P0 p@-@0:R P% P PpP 0 R10p`tP D0 B10p P|p0 000:0S,01/Q%0ϠQ\0CS Q0@-,P Q (0@0C 0 ^ S0U0//Q%0ϠQ\0CS Q0@-,P Q (0@0C 0 ^ S0U0//\ , 0 B0/\//0@-PU,Q (0@0C 0\S0U000@-PU,Q (0@0C 0\S0U00Q>@-\^5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@P@@ N@ T ^Q/0 p@-PU,@Q Q(00C0 `^ S0Up(, 0R S0/0@-PU,Q (0@0C 0\S0UP080@-@@ S0PV$0S-00 04S,ЍO>0@0S A 0Q B20RP 0 P0C0K V !P 00C0>0S  P8 @0 C`QO-M000P0S@4P 3S-0S*U> 000  0@ 000@Q k p`@ ȯP @0S 0ۯPJЍD߶P 00 C40  (ЍP0PtP0  0 /x D0M@ 000S :P ЍЍ/lH0MD0 0S :P ЍЍ/400 000S :P /H0MD0 0S :P ЍЍ/|400 000S :P /$\- T M P  P 0 Ѝ Ѝ0 0@-0@T J 3$S |B0pQ 7@-P @"x804 000S :P g/X PT 00 R0S *P@04//000 000S :P /8L0L 000S :P @-p @/0 0A-0`V* Z 3$SP! #Rp@4S@pp3Tw A|B0tQ R7A-,0@- @  @Y000 000S :P h/00G-` M pW#   0 lp @nPP  0  `p@ 0 @٭Ѝ@DP  P L/p@-JP 3S P`4`0P⹭3V崭  0s3# S00!0P |2 $R 0X0S L03 |20X #$03pppp p@-jP A3S @P4P0@t3Sp@XqA-`P[ J3S$sW! P<#@P03R4 R)W lAQ , W00p, # \ BL| @ WP3PSSpP4PSfpp3Upp@-@P X0P:|"C0T0XppG- ̀\,P@p  `᧭P LTL!VW R T VW  @000S8 0ጭ0 0|O- ML0 Z>p`XP@6P ( T: ЍXP'P T% N  P 0 0 W XP  RX #@(P P Ѝ Ѝ0 00 |0@-?S0P  p0P0\p( @``& p@`^  00PP4A-@PQP% pW0!  0S0*,(000 R   R   R  P l4 `T `TX *P Q Sp QW02p@-PP X0@:|b0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S 903@0SpX@ '|(@ 8Q 0@0ppp@-@PXa`R X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  @PpL00008P@078@0p0pP0P 0 0S P@ ?# Q @080///L($0Q 00/($0Q 00u/(\0A-0TPR p`@?dG@ H(X0X 00 R X@07|8@08Q@0@0/(0 00(0 00,(p@-P`0`0@T X0:|20T1S@0?;@0S<000080S@078@0{p`(P Q@0?30R @080///Rb/R/p@-PS @ `@?LppP X @0*7|"8@0 8 R #@0@0/P@/0p@-@Px`P` X0:|20T1S@0?;@028000080S@078@0pߤ0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/Xp@-P  @@0 0p@ <(p@-P@ p@p0 Ql0p@-@ 0P00R ^ p@ p@(L0L0p@- @ P#pp p@h(p@-P@#pp p@p@-P | @ 00`#ppT0 T ^ @ p@@(p@-`@P#ppT T  R @ p@o@Rp@-P@00S ^ p@uW p@nO-`6:94aP1S00XP P  Y 0 0( 0000 0P0Q00 w<ЍXUZ<Ѝ(P 00  T 0S00b , 1 0 0(*1S 0P 0  0CS00(00P 0P 0 00@@0S0 0H00010S @ @⛦Pj  [   @0CY(P 00 0(0 0帑KY?3$0 2[002K0ST Q 0C (  P 0 0C000T ,S  (0!   00C0<Ѝ@0 0X0X`RT0Y`F V8pPV3 zPp<ЍT0Y80  0 000<Ѝ:0@QHd 0aH[H0L 00!0/ R ,0|10 D0K00 0pT0Q 0(00^00Sj H00 L0 弐J 0J 0RZD0 |0pQn   S,01P0Y%`D0|`00pz H P L Q E1SI00 (00Q0 0 >80 [  H100S0P080 N I00(00Q0œ   C( P  00C00 T0R0, 01 080 0000 S0C`C00080  OXO-M@ 0@,0P 1 0T,0`0pW% P @D  0   pT 0  ۦP0p  p000Ѝ4 00 @-M@0@Ѝ(- M0 ЍC- Mp@00`(S,P 0HSOVtN0 r@03@, @P P9 (0 `Hoo 0b000S 0 P 0D3@ 0 P`VS 0#"H078P0P0C R  000" ЍPP00S0UZ ЍX0PXp| T0RpG0 W耟P`W 0 `P p0   T 0S00 , X10|80  080 000 S0CpCkp@-@`PA pp 0p@- M Ѝ\p@-PT0 M@ 0 `" p 0 ЍpX(\0\0X  0 08Q Q @0<@0/6S/(< <0 0001S 00 @0<@0/̄(d0M` 00008Q Q @0<@0Ѝ/6SЍ/,,0, 00001S@0<@0/\0\ 00 X0:|20(Q Q @0<@0/6S/˄(0 000@/(X0:|20(!R !R @0<@0/6S/0 @ /A-@p|P P`lgp e<000T 000S0| X80  /804 0080  Q/(T MP0P    RBPP0T Ѝ/|(8 0  Q/0Q0 PBPPT //,0, 0000P/P/ȸ,0, 0000P/P/|#3 O-@0 MPU d300SH0PS@PPQP0nPIIIZ pp`IV ,0S 0   1  }`FJV@00S/0pS0a!0封[, D | 0 P000Gp ЍTYppGWp  B RY 0  0CI0YP r ЍPaTZP`JVJYpa,0S1   0   ` X Z 0pS a0[, D | 0P0q00p ZPZ0 P0CcZ0JS@| 0P0/ 0Ĩ(0Q /@-@P`Pp^0A (,, 00^00@UP 0S 0@//P 0S 0@///// ///O-P1!0D0, 0S 1H``?c`%@ p0 @s'W0 8| 0 0Hp@W00C @ P @0@h 0 00@(X ?o 2 R0S P/01 //\T\$-(^,0R0SQ!R@O-M1 A0@000S1蠟, @ p P `0S! S#A 00 `0C``P  (0R0 (000C0T0 02/p 0P@S(0 0 ЍX[[XZ(0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@k (0@SpP0@-0^ 0 @ 0 Q@RYxO- M@PZTppHZ1  0 @ B( T0@0 S `+,0 1R@0p @ⴀD R`Dp `|p Ѝ0 @0@ ~00 S RP Ѝ, P ,0P `0V 0 p pG0,0C(p1C,0A0 T`0 0`000Dp4ؠP ,J00 @4 p` 0Tp `0Dr@U   PB  0SQQ 0 0$ PC 00\R R 7@U 0 B 0C G-@P4 pP5 0PUPAP0S%X0#P U 0 `P0V`C ` 00 RF `C`V` p[ t1 $p00S9 0PAP807`P,! R ! P3 ! R. ! R)  R00 0U+Q*P0U `P00V ` `SW Ѷ`x0 @p 0 $pL0XPU0P`W`PEP (0PD Q P/$ $\/ P/,A-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U E\pL @10 0 QV$ F 0R U EJp:   0F  Q SC$ 0R U E4p$ 0*$` P0`00BTP @T 80@Tp` 0U (A-PP0@P@pQ`@@T0* $ P pX00@T  0W@\ P. 0S+ 0@- \#@T\8x ƌ8 t ,@0@PU 0P0U00 S00/Q?X?A-P$@`V0S2 0\-@ 0T `ApB 0S#0^ 0S0pW F?@ 0 0 04@U/80Q@0@080/0A-S 0@ B( P`p0,0,0CA@1` 0S( X @- 0|B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QM 00pR<[@p`@Pl ူ儰到YP,g  PP0d Y4' Z0 `8X00 `0@`F 800  p$p<@ H | L0P T`8 0\ 0@` 80d h l p ЍםP49  0P=  ʂP PHZpp V00PPʪPЍ@Ѝ@gdb@][Y0@SQOM@A-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,.PP D0 D0RH0!b pH000$`P@0RЍPЍL@-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ@@HP 0`JUp`_WNVPED 0    PI L1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aC`Y Ѝ00H00H0t  P PEP` V IPIP ЍP @x|(t0p 0l0@-M @  B0/o"  mPP 6Ѝ0(H@- @  0M0 PЍP-00 Q08SM$ 08Ѝ8 /-M 0  0N NLN ЍO-$ 0(0QD, 0!0s0 S^: 0 "@  t@T,0Q0@t@T<0(00S20 R (Q(,͟  H͟LL P, ,R(  4 ,!0 !8 <  , !  @=$ 0pH D0|0H0000Rp 0H SL0HP10< 8 ,    V, 8 Y Y R `R F Q<08 0,000㓉(0 #I0CYڸ T0D0o0 L R Q0YT@o00PP ` P 00`,0 0S0R0S0 \ ɟ`V 0HX 0X op 0 00 @P RoP0 P ` P0 V  R~  ``$QUD PO A0 S04 ( R(  4  R( Q4  *#r PPQ 0  P0  \(,  r ,P  ,.P !0!!Q@Yڶ000S, 80s js$ `V \V HX~ @0P@0 L  LL lL\oɟ`VJF80 aU 0T TDD00 R 0 R PP!YR   Y $R 0E0x 0p   0E j D000$R $ 07  jD000!R@ Gt <000V 0 A B $ P=0 5# X0:d2>p6$ @ Q< `0P8P, ` p u'UP0 @000pH 1`11qWy 00S4  <0pD P 0 5# X0:d2<0V @ 03@0S  V0A 00C0 R d1SCdЍꔄ T VUQx  0  0 p,$$ R 00S0 ?3P D`Fp@pP@`@ 0?3T 1pGW1QEP `p?0D000L00@ 0@0 @  X X @VP 0P X R ?(080 w <00 $2 0 p`dЍ80 0 @00Cs00S$2$ 0D000h0S(00S2<0 (0 U#0{< 0080@080^7Q00C\0 Qʘ@t* "(1$ 0, QKp! <,\`@VP @ VP  P0@,p, `Q`!J @ <P,Up@WP  ..|&8$$, pP W@ P0 @`, A,\,@T q, P@DNP@X "   , ` ^,00,0Q0 0, B4 CRR<0804 00C, 00S<,04 0 @ 40 0 0@00,000 S @`f` P 0, !Yp, 1@S @ YpL `P00 0  0 00S 00 0 0S40C04 R00CQ8( 0 0, `Fv5 @A`i0, \8 p(@0<0 0 ~ 0P`U@0V0S 8Q004CQ0xV0F0<00DPA ` \p <0`pHU0L H2 D| p3$  D0 00@Q4 R1 dP.  +P d1S $ |4  tPp:U U0p` 5`FV 0EPE00EUP'00:  ,0R<0Y0,P 0A040 0 0C 0p% p ,0%80 L0H050@0 0 G40ș p0RWx R  Y Rp RtR)0 SG 0PU`@000P lF@@D ,P lFtTP@ P0E0PE0PE 8e00 00C,0W<0p,p0,00 00R:<0 0,P0 h 0E00p  0E  JD000P4B T@,,`H0,0 000 0 0WڅL 0S 0 @CD0T0 <000pP4Z pQW S4S Y4SQ H5S4  8$`P 0 `[D 00p~0 `N00P  n0D` 0 B00| b0@ @10 0pU0 @%'oSPb4SG 0 D000N$ :P 10  `C0` D000ȔY  5 0 \toPY D00  TP    `(;$ DP0` 0T0 D000H%RQ#    `;$ DP0` 0HTPO p0SL 4S 4S Y00Q0S8 L5S;  `<$ `P 0 `mD0 00p0 ``D000P  0D` 0 B00 s 00QP00`0` 7D000P  U P i$ =P L0   D000P T=$  80  R! T 4>$ PD0 00$1So T >$ D`P0 0@L5S] 0 0RXT >$ PD0 00LTD`t 0 0L@k0P0PU 0``U @P @0D`0` 0HTZ @0HP@, 8:0@0e 0 I8 5 6 5p@-@PM0P`0 R    80x  t000 000 P80  D000! B/ 0C?00  Ѝpu` 0 00t(C-M@`4P0pሐh l8p\` d0P Ѝ80 800 0 pCB`Po`_PЍtX @-@P @TO-P1!0D00S0H``?c`S,, p !@G'T :!| ]p@W 0 R( ?3 S 0S1S0 S x s 0 00rp( 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP @0 @T $0`U V P`刎Vp`0P 0@PUpT` @pT @pp  ! !@-@P@YT R/0A-p,SP` @T @CT0`PS RQ A0@ ", "Q//A-pQ*`@P 0D "! "U0 "! "T^ 0N "! "\^`@WP@-@@@0S $0PC$O-M:z*0p$P؂  pPt `00^b S`s`aRX@lH\0 04@Y @A@0 @TE Qጰ@@[@T=P i``FF\S0^0  | aR\ d`Q'TQ"  @CP(4 ,4QT S I@0S  M$ 0P00B$0uX@0C,4Q{ @CP ^^ S\ʈ80,40SlthtH`@0,0^ $P, 40@P0(@0S  00 CR( ( pp' : 7@00p(`Y ʨ| `nR`F`V00P0SZ  $ 0P00B$04' 00Q4 70, '0 4(0P0J0 覟F @& $P)0Sl600S00l0S# 0 S & ,40Q#0 l,P0S  0P$0@P$60 RЍ6 0( $0(0\GEe@` % (00 S:$%0CP (00xP0S S$0PC$@%@ 00 0,@(@Q 4000X\ 0Q[Q $ Z $0 0C(@,00  00C S[ pH40,@4 0,0104#0zd4`000P ^% $@$#P@ (@i0 Rv ,U, q  P+ x#  l# (@$@?QWD( , #\ $6 (@  P 0(@$ R  $@ P  @ lP " 20,,40 SN  L2 0$ ܀0B@0S  p$ 0P00B$0܀$ 00P0 ! ı 00(`S7A@ 10(`0 V0`F!(`0 xP0S 9$ 0P00B$0|,@' A@0S  &$ 0P00B$0 h,@pndXl|@$Dlpl|xD@,(    ` X   L  p X    0O-LsL3pHC@0 P ጒ400040c`(,P Zh34@2`0T6"0CS 402P00S00h0S000S200ʔ 0@DS(00S0 0l0S R H" 4204@,P0T0hPr RP0 @P 0( 0CS P1 P1040 ,( \ @ P,P@1(`0 R&T !P @T 0 R 0 P'  x 00 lP }@T00,P0 0( 0  4@0S\C,PE@D4@SPL04Pk ^00SL004Pc8|l0 p<,(@- 4 00(, \(@- 4 00(,(d1d!0O- @ *⤒Y8!O (!0P[& Z( 0S!,p`pGP@0   R    P0 P00P0`SY@TP0,AU0 0 0p W  QT_4 0 00 08QD0S0l%R h%R /!R!RtP/P//] 0 000 0P/] O-`upP2 T5` 80s5 < SD Pr @R !S5 0 40P\`  4 ]0P 4 T400:@ l0 @ l%R h%R 0ʀh20 d"T0s% |20T0,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d20SL\ RnVõpSS Rz_P|SI RPPS? R_PS5 RPPS+ RªVêõS# RPP@S R*@S  #Y[=.0 0 C C S: Ql" p" l200 C S! 081: p" l"RU4 1OaLO`PU* 0S X100S H0Y 0H0,  Z000 0 0 00QYPU0 0 !R 0ʀh2d0 0 !R 0ʀh2%R t5S 0ʀh2\tp <0p1P0Wd PRP/L QK\I4@- 00ʃhœ\ 1:p“ @T" pƒn pƒn A\ "B\ n@T pƒ     /WP01P0G$ 00` PAʀ: h2πS00n200 /@P)#0000CS 00/00/00/00/000000000/Up@-P@M@&\\ nf Ppf rf0 P |P 00 b(0 GЍpTpPd-X\\ npr /S00 @- t0 0S X00081:lƒp<00 RS< 441 @-00*h"R @!@ R  (1:/n"pB00 R @R  AR R\@0 000:d/QDp@-Pl@l0@00:h2S SpH0000Pp00 ~$ @0 0@0pQpP1A-0aP0`S: !03@p @  "0S1H0 h"R+ R  #@ @0780@01M: @/QBn23?|20S1 80AQ:|20t0p1M: @/Qn23|20l30 0AQ:|20h%d0 p0!Q g0!Q P| p/|0| 0p@-00@00C0S S p0 S P00.puPp0N0p@-0CS@0 S p0 S P00ptPp0000 0p@-00P@pMp@-P @p 0|  JQ S@-\,AQ0/M((0J0P\@-\,AP /0S/p@-    @ BJR@P`,PTa@@@RA  Qp03O-0PQ`$MC@ 庅pP 0 0C Syrp @,010$1S!00A 0BS000(00\0ř ř!AI"R} T 0JI T0 $0$00Y q?3P00 0 P.Pz 0Y0 00 W0(@p  H0 DW T@( "D0( 00C P6$Ѝ$ЍiT0 S80 D 10@  B@D T hp`$ЍHȏ$Ѝ 00C! Y| @ D0 |0p H0I002 Y @T @2T @ @^ K\0 00 G(p@-@Pppp@D0D0p@-@  @Pppp@G(O-dM`p宄60$0PPqy @r0P0s  W0pp40Pp0W000@0@STI6+POP0pPX0@00@D@TG00000PS040/ 0 00pP@0@DS1B-,40T R8 % 040 S$0$0 P )I P0000S00U0pE=PPE8HPP0p0C0- 0P0 00P0 0@S4,00! p@呃(, @Q0ر@( @ R 400Q@!0CJ2S X 0IJ X0 $0$04 @0T00 P04,8p, 0@ 8 @O-S$MءLP P`0U pH 0@TF !  5/ 00@T8 $T <RH!  . R !!! > 0Y 0 P  H 00|00  HPr 00 R0S0?;@P5/@TY$Ѝ H\r 00 R0S@0刀0@P5/@T= @ Q" @-@M R ! R "R pP^  0 0@_Ѝ /@-0QM   S S PpP$@4R @ 5Ѝ;\00- M #Ѝ@0<< -M Ѝ:|t p@-0B\S@[ ^S:  @%  ,S'Sy cS{e%!E"0 @ L P >b>0 r a00 } 0 p000 % 0   @, ,L !2b{0 r *PUB 00ES941PuP@P`00B 01 00C  ^00 , ,L !2b0 r S\S:S '  00 pL 0 @a % {r :O-M  ~\PP 0H'p p 00R0pp  @` 0,R3Ti 0@\  @0 0 0 Rg  QS%R +0@GSSQPNMLpoIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! > 0 SPi& 00Ѝ0% iP@ 0  `fv`00 0 R!.Q R*Q0 00 RZ@0 S\0% p@ 00  00dP% @ @0  d 0 0 S 0@ 0 00000 30 S\@  00     0 0 Sm\  %p00 00%@@0c  a 0 SH\ %p00  0 0% @ @0c@+0 0   / 0  @   0000      <    0@0@D0 00T0 S\R$ W 0`C0@ T0  $ 0  <  Yl /000> 0 0 0S0\S 0 S0 7( p@-@PM0P`0S PS   0 00Ph 0 Q00QH  < x0 Ѝph0/Ԑ|Hd A-M0@HSD!00@0p0S= `X0 E 1N;AƒKa1#cL 0L0 8 g=M%02#cQ}P 0 pW$P@PW 0fSjPЍЍ 00 Ѝ. tA-M0@LSH!00@0p0S= ` 0   k<7@ƒCa0#c!01 3>C120BQ#P 0 pW$P@PT 0nSPЍЍ0"0Ѝ-@ O-M0@S!0 0  0000S- Plar*sE 0 `Ï⊡  -8 ?C01N;A08 g=M0: @P 0S  R p$0W% M #W =W =S`P` n0000`@c01 0ƒ120B P0B `@00=$`Hs +(0  " BĠ,bC 1c 00 0#3#cqMP $0tS0cS0S|``@m00` 000< 1`0S[{   0 ќO-p`@P0\ %\0pS sS lS@ 0\TT1DW 01 CR0@CUPO-PQ侟qM P`? 00S040H  l@    H pY 0  R VG p^@T %%T ,  RA*Pg  4 @P@Tp, 40,qߍ@p%T =:T,,P `0 TI 0DSECB@?>=<;:98543210/.-,+P zP" 400P,1S+ 0C-11@ V4 00 `3`,Q*P 0 Shp 40P4qߍ00f0\`!0D]SC2Tf !x~}~z00D 0 7Pb@0A@?S:T;X0Ds R S񏐀E~}|{zyxwvuE9rqponmlkji.gfe5cba`%I@ZNxPQ 00040ExP,I 000VK -00\.00 `\0l ` @:  P`160@00`-00.`OU0-1ऐ1`01@P!R) 0BS11`& PB=&@DQ1VTlZD2QU PE=!TQ10 ~T0OUo !ऐ!PQ0P@.@10Ds Ru-1!ORTPX=P1=1 !T@1Sx -!0C1X0SX 0j0V!@40` RX*, Ra  fpC 4 P040@ R   ?R ;R  pR %R0 0@a0Ds R A0DS"13 DOS  !ऐ!01Pp!POR͍0S'S ! 0S'S'S@P@0P@Sl00l0 0St00t0ATz @D=PA1P OT=Q1@A夐P@1Sh 0C-11@ST@#,Q*P  P4 @@p1S[ 0C-110S Rf   ?R ;R eRQy  pRW %R0 00     00C2"0OQt͍0S}S  0S}S}Sw@P)AT @D=AA0@a DrQD! 1N`V`SVP |`L`&I0``DVP``>P``9`@oob4P``/V, រ`(`@%"QA@PQAA DR 3@DP1@-1 1OS_ 0 'P wP! 400P,C0?oQ2yV0 020vP 04 ,00T` `2,v P 400`, 1P00@+!T00 ~T00R@!00#Ð`00&@D0Q0VT񏐻^mgaXE3~}|{zyxwvutrqponmlkjihgfe P00@00 0 00- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/(A-PQM`p@ 0S WB uP `X'  x00 X T~ Ѝ#PPT00g 00ЍT  Tp 0 0 R Tp lPp0S T0  hD9p 0S R s0r (0 000ST00P K  p0(0P K  p00PૣT<ॣ0ࡣ  < , H l D P 0R@-M  E0S@ ( Ѝ0A-pPP% U) q0S`$V  PR |㺾@P0D^V to mPG-pR `Q s 0 @ PPR % PR PS (&0 GS  uP   0?s s0 0/r R0 /r R0 qQ0?s0S y0?s0S W0?spW$ pPL [u$p%tP !tPtP 0pⲀḏx$SP " X$ $@ 0 Žqp 2q0nS0y sS fSi0p@S UQ0 pP: q^ 0 ?s0RSq!U ppqN q^ pP op   1@⡏pqPp V0?s0 q Ͽ|QZ Aq0U ?pQs0p pWP·Q| Bt sP$uV@ p03? UQ00@@0Q?s0S Upp ppw0p?s0C-PAM|!`@p 0Pb P 40010S= `Ѝ@P ` 0 sp R 0S 0P` Ѝ` 0 1$P @P`L004@@+@ P *@PT $ O-M Mp00:S*0:SS@ 0PS:S``"E#P  [ R j;0  0dAhP 0P:S ۍ Ѝ@ۍ Ѝ$ŸC-P M@M`pt_P? 0/SO P{P d0sX PE AP 0 ۍЍC`50P P! p raP40  PۍЍ0P 0S/S {pP {sX0 ۍЍC p 0dsYW P0L 0 $ۍЍ404 0 $  ݰ ݐ x t  H G-p`@P  ]0@4sT  SP h@Pd@ @ @P PU  $ 0 %%GP, -@- M@00 Ѝ@ Ѝ/0 Ѝ@ Ѝ/@-@rrr@rr r0r@60 0p@-s0?0@ 0?0P @000pp@-@(PS:pS 0rP!p=<;:Y^76OW3210/?-=+*)ESO0PpS@ Sn4 400 @ 0 @P$`4   `P00`0PpCl20 0@` 00P0p`0` 0`0` 0`0` 0` 0 00 ``/t 0 S00P.0H`<0PLc 00L0 ^84 cT<0q0pGPTWH`pp0pq 0 00 00s0 PWP p@t p@t> , R 0?s0TB 0S00 R0 0 0S00fP. 0 &tP0 000 000 000f0 P pPu0 0@s 0 A P00P 0 D l \Ѝ?V` J 0   h0 u0 mdL f$ ($ p ZPl ` h  P/$P  // 0@-M@0 PP 1N;AKLBH gMMl1#c 000%#@B4dT!=PЍ0 P0`0K?// H0@-M@0 CP k<7@hLBCNCl0#c "0K20#AB@C1dPЍ0 1P00?// h@-M@0 -8 ?=<;:9876543210/.-,+*)('&%$#"!  " W a  !00 (ЍP00 P 30 0WB> 0W9!00 P00 ~P{ D30 0W0 "zP 0SN !00 cP00"200W 0 aP 0Ss !00 cP00ڄ20W 02[D +a  DPV  cP00n020W 0_0 "2P 0S !00 cP00XW0 " P  qcP00`ڌ10W 0!B0[D2/'D" 4JP   XcP00,W0 " JcP0000W 02/'L"P 80S 3!00 0cP00ڔ00W 02/'L"P 0S !00 GH l H h  X  cP00$00W 02/'L"P 0S !00 cP00ڈ00W 0Y0 "}P 0S !00 cP009002[D 0 +a W  `Pc  cP00&ژ300W 0 NP 0S !00 cP008300W 0 5P 0S !00 cP0020W 02/'L"P t0SP o!00 lcP00t20W 02/'D"P   YcP00g,20W 0W2/'L"P G0S~ B!00 ?cP0010W 02/'D"P  ,cP00ڀ100W 0 ` P 0S !00 cP00%$100W 0 r P 0S !00 cP0000W 02/'L"P 0SJ !00 cP00d00wW 0B yP1   (  x d 8 l | cP00400W 02/'D"PP 0S !00 cP00ژ00W 0z2/'L"6P 0St !00 cP00@00W 002/'D"PB  tcP00D10W 02/'D" P%  acP00Mڌ10W 00" P P0S K"00 HcP0010W 00"g P 70S 2"00 /cP00_L200T 0a W  P  cP00t30W 02/'L"P  0S$ !00 cP0030W 02/'L"P 0S !00 cP00%ڬ20W 02/'L"|P 0S !00 cP00H20W 02/'D"bP  cP0020W 00" PP 0S "00 cP00ڠ10W 00" 7P 0S "00 cP00@1000[DW 0   P v0S q!00 ncP0000W 02/'D"P \0S W!00 TcP00 p000W 0i P B0S =!00 : 0 P T @ ` , ߨ L ްcP00000W 02/'L"P 0S) !00 cP00ڔW0 "X P  cP0000W 00"< P 0S "00 cP00810W 0{2/'L"yP 0S Ϳ!00 cP00ڜ10W 00" `P 0S{ "00 SP 0S !00 202[D +a W "00 |30t30l30W0 /G"$"00 830030RW0 /O"q"00 n20W0 /G"2c"00 `20#0WhV!00 S20Y20pW0 /G"E"00 B\20T20W0 /O"'4!00 1 20W0 /G"g&"00 #10X10hW0 /O"!00 10s10W0 /O"!00 t10l10d10^W0 /O"!00 010(10W0 /G"2߾!00 00#W0 /G"kѾ"00 00\00W0 /O"!00 00|00  \ ޘ | d ݠ  D ܼ d ܔ  ܬ $ ۄ ۄ ڴ ڰ ڀ ِ l H  H  ب ؜ 4 ט p ٌW0 /O"d"00 |x00UW0 /G"q!00 n0000p00X00W0 /O"W!00 T10r0W G!00 D810W0 /O"9"00 6l100W,!00 )100[D0 /G "ZH aH  0/O"W"00 200W!00 8200W!00 h20*"00 "00 20 020 0A v PH T @ ҽ"00 ͽ"00 Ƚ!00 ý!00 !00 귽"00 경"00 ꭽ!00 ꨽"00 ꣽ"00 ꞽ"00 ꙽!00 풽!00 ꍽ"00 ,P  [D0 /G"BvP !H H  0/O"0Sk!00 h10 0p10 0^"00 [Y"00 VT"00 QO"00 LJ"00 GE"00 B@"00 =;"00 86"00 31"00 .,"00 )H oH 2/'L"\1 00_81 00V1 @@v0 IZ0 h00@ 0 @@`80 3 @ !TD- װ t ՠ , ֬ 8 T   0 Ԅ ӈ 0 Ұ x 4 \ D H < , Ѱ t d T | D L Ќ0 00w40 00YX0 00|0 00-ꟼ!00 0 00۫0 400ҫp0 T00ɫ 1 t00D1 00ⷫh1 @@0 ફ1 @@0  1 00┫1 400⋫'2 T00₫<2 @@0 uvp2 00l"2 00c2 00Z?2 00Q93 $00H,$3 @@hT0 ;eX3 t002C|3 00)3 00 3 003 00 4 00뼻!00 /;R@-MPLOAQ"Q@\a\` 00 Q P 0;B 0` 0ЍЀ;BЍЀ3Q Q 0ALL1l1 ^pP0X0n(0(#67`0{F q p   ;BЍЀ D Ш/P 0S $0S 0S P? @4@P//A-0Pp`8P& , R( 0"0, 4000R40G@BV@1 سV @D8 ѳ,0400Gʳ,0400(@  (8/P840, 0S004R000@-P04 R 0    $ < @ S. p T P  +ˁ0P R $ R  R S /0??00S" 0??000CSW0S; 0@8N?0 QO?0(0 S@0(0S8 080t090K5?0U2 0PE@Tx0S :00Q?0HLQD0ʆ;J?0\T 10T :0PE@00SU0 pC0 0,0 SP<@@B0S 0P/S30 PC0W0"1000000 00 0<0? S@0@0R0 GBRR<,0P0US 0S0 0T)<9 0 <0 30 DЍ M R S R  ,P0 PpB0Se 0 00 C0 S 03C0U 0PE@T0  CQ1R00S000 00 00S 0S($<,(<0$(00 R 700Q?000r 80B4 R@0,5 00D 0R1P! BD  A B\000D0S0H?0 1UR0070  0P<@@0?/S ʆP<0  @@ ;TU 0PE@0 S  S S @DA?00@T80PE@TULQ{L?0QI H0 @S0 0CR*ʆ+R 500Q?00 pC0 0@P?00 pC0 0ld h ^X0Pr00001p0T :0PE@01p0WU Q 0SU 0PE@T 0S 400Q?0U 0PE@T:D ʆ0@D180+D0]Uy 0PE@T:0ʆ!H0@D80H0;uDpC?0W U0p1Wp!W[ 0  PE0C0000ƯD00CD00(Dpl `R* 0ATU= 0PE@0 Rl @D0ਁ:R $0(00C 8 P 0l0S>0X p0P0tXp0  P 200Q?0/ R=0 U 0PE@T;0H?o20$0S0  $,0r ($B0#22cR0S 100Q?0 0G$Q   9R D Up1p!WR0 D :/ $ R D ;/ ^$ R$0\4 @Dʆ8+aD?㨁@D0kD 0B (8xp<#0#W" 0400Q?0xQ  8@D;D _ 0;??0K?HL0I ] 400Q?0[0@DpSB?0D 0 S40P0;T0G?0U @DZw0PE@ZqUH5威@D00Q?0-8tgx| p⨃@p ^*:l0wp 00r0⌠pZl :@{ 500Q?00@08 (4890(8(:0;D600Q?0E?l 0Zl0PE@ZfUR? 0 0C00S` 0 0000*p8tgx|p⨁@pp41q岠pT*U 0`4`UK PE@1q岠pW0`8Q@D{@D8D I?L0C0 PpCc 88(9m0+@\8@D 0@Dw(J0F?l0w0P 0000< 0@@r0 0`pC3( (0@DR0 S(0!800Q?0FpS>t0φp0P0 X0X 0404P( @900p.SR:@ 3 @00w??@0Va8 8(90 pCp \ 00T d \ h P :00p0:00Q?00威 @DpC0 0d:00Q?00SG?0z0 pCp@-@PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-P@Pp` 0R>/ S  P00S    0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@Pp`W6@ RS?Q 0<0 1 B p 0Q#4<00M@0P00cS  B R#2^ S 3#P0S S?R[ @ 0<0 @ R1<00l0pW\V H R 00cS  Q # 2R S 3#R0S  l0Sp0pCp)x 000 0P,04hp??0x p0 0 0 30 Ѝl0Sl0@@@ _P 0S $0S 0S P?,A4 BR/A/Q /@o/A-pPWPu@ 0(+`3/PPn 8XF ( 0(3/P00@b  0 Q    +㙪P04 Sp:oSS0C0P0T00C0T0p0X Cp (0 8#{8Pp0 Cp0@0 0 Q    +ZP04 Sp*p0 C p ($03/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?00@C/O-R|M   080⤰ 0    0x ^0SCV0pSQpW  0 p p0|Ѝ:0`\`VX@~;JT\ 0W0P0S1Z0@05P0^s00R  0xS0SPRCRT@!V0!01P 0020 P0S|Ѝ|Ѝ0@ ?o2,0%R00S020$0@0(00$(0,0@?o200 0  0 B  400pP 0S@3 :^N $0%3!`@3@!(0%t@&!<: 80C1 ( R@P00F#3 0S C 0x $Q Br $ARVG  ` V  ^ F Z(  V F(*xQ B\   L\ R: 0 Q  Re, %Q  R_4!LAS @P  401 00 ,0!00 , 0$ (0V 0O-DM0C000 C00S S 0 00p0  00 `0O- M,Pjt@A?E0C01^]00SY ,l0< SpBpG:08 Cp l0p0C\ SAl0 Bp\ 650S7 l0 t8 0t t0Slp8GXT H 0 :# 0H0H0D :#4 0H0 @0᳀ἀ K0GR6Q1^&<0R*lPtPR *0C!S8@1@! ৬@F ЍR*E0C8S@1@! 㔬606 Ѝp@-@`:P UP!Up  ~ 0  0CS       B 000pO-@tM℥Z  Pil` p8Hp X`T06#D`04H00 @pQx d` 0S,0LA?C0CPR`0Sch0S4 8`6& `Vƅ6ƕ &!6ƕ909&6R \ l0R8 LFl0\0~ l0t0l00@tSЍt`0l`@h0 Ptt0 S R S Sl` p0x d`00lSx  Pp00L SR0`0d0 Bt`0L`Fs0 `Cr |0C,Ġpvs0ƕSpv  !" 30җ1Ӆ1  x l0t@0 Bx  HHtVHl0:8HXDp4!T H@᱐ἐ00xR0Sl 0h`0 \0S B80l0\000S\ tEP`ux lh Rl0 S 1 #P&0 &RC \ R8 C0rl0\00PЍl8  R&0 &PV0&PV) )h0\ R8 C0El0\0}00SЍO-L$M t1Yl08H@XT D."@ 4H Q0 , CA/B BP`PF ]p@&0C#ps00@F#D0C@s0S@F !4# 30җ1Ӆ1  6 `tQ06I Yt 0l0 R080EU` l H 0U#@H@0 Sl0\ R8 C 0l0\000S$Ѝ8&6 &!6ƈ909&tl0QIt0l0 1Y` /t0!SZ R S, Sl0mR /l0`h @4pD` H0A `l @P5! 0H0  `0 ll R1#\ Q \P B800 >l0\0v0P$Ѝ\P B80 0+l0\0c00S$Ѝ}` 0, 0CO-S M0!@0p00Zh6o` *01VPFt:l0\``C 0 S[ P1[ESoW㫲_SW 0 u0% 0B0  "$A0A00 CV V0\ 81!  ሢ\` PE ` 0C 0 00\`U  (Z  B P P 0P `Sl0&R65UP    R\ S6P Ѝ0P `Sl0 , 8RZ06AD,0l06\0<``FV*\,\8 CLl \06&S06l0R, ` 6V`!VW\, Q65* 0C@P!P 1RV G/o"S W  R  PR#P`1`!WG80 P\\00\0al0<AQ0Cl0 68S&06l0R6 J ӡ6,AQ  l00l0&8 v, l0B\0Pl0P`1`!W 80 \00\0Q  PR#P$ 0S! $0S 0S P-* Q90A[A 0EQP0@0@30"Q00 0/O-MP@`?o2P0S|@0S0w S t0Sr0,0S$ RhL0Dp C0 pCQ,0lp\pv`FP0*SVtpWS 0w ,0V0pF*0*  00 P  t0S!l8PLPԅD@p4`H0 Q9* 0H0僠ẰᲰ0t0lt0Sl  l \  60 x0`00th  00Ѝ* ЍA-@P 0S $0S `PppP l0t,@0S@1VTU@80C ɠpp@-@P$ 0S! $0S L`PP0,0`0 S`0c`0S`  *00 00(0p`p 9001p@-P@P pPL ,0D0<00 B@C Ⴇ0 T l@ \@t@ 0(*0|00Fx0`0h@H@pTp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P) 0S& $0S# PpPU0&0R:k`& @bU@40C0Wt20ƈPUPPA-@P P 0S $0S p`P0p`P|0A-PQb!TcTe@p?P0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`诟 0P0X  0@S P X0  SQ^ ^((lPX^ @ P  R"Sv0S[Q gQ 0St0S Rz 0S S > 02#03/0@S0S20 X>0S S000 00#400 00 0  0#400 0 {0S0c0?o20 Ѝ0So= 000 Ss *S00Sq00 0 0S&+B%l0S0 B8@ B0 #22c0# 0l0S q00040S9Q U0 0t0 0  R 0,0S0Q0Q0$ s0Q0s0R 0s000 00 0#400 00 00 S0 S 00R01 00 00S 0 0 0#40,0S0 0E00Q  P pK 0S PE 0SP  p W *G 0 ,0 SR B00|0S00(0 Ѝ0 0 0 0 0 0 S0 S 00R01 q00 ?0SEQ=X  2Rby0SS@ S  00 # #8 00#"0 Ztp 6l8&`6 &!6ƅ909&tpl0QpGtp0l0 WLt0SX# :Xv 6S \0l S B80 l0\00P0S P X X0S? Ѝ0 0; 0,  QR0 0I000S'   0P P0S0   0S,0SQ9: R,0S  R0 0[00$0S,00  $ 0P P0S0   0S,0SQ@:V R0 B0r00,0S!  Rg  S 0 Q30S0  00#40K0q000SC 0 B0=0#  #800#"0 }IQ V\ R8 C0 l0\000S*pt0Z(l 8`pR B  ^L 6&p!6ƅp6ƅ909&6Rt0l 0Ct0 l St0 SX S Sl 8`p0  X 0S!0 B000 B00,00I ^ ^  Y Y Y Y Y Y Y I^oᩒ#Y@K`P`0P&0@ƅs0 ƅp0 0 1001  &6`Rt0l 0C`p t0l s\0S B80 l0\000S6^00 0=0[kPT*X6I &RB \ R80l0 C*0,000}X 3t0 000s B00p@-@,PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO- Mp`8P2Q004<0 08P1S00U 0 0S{ $0Ss wpVjV`F0HSs0FSRoZ WlFYo᫲[eV @(& `4/@Pl  J@2*(0`, ` X  P "L  BPT  A4  6/, ` 8(6/L ` @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0 ЍOv `fp00$0`(0 } Ѝ"40  000&W-M 0 CЍA-P@=PUPn`0@0 0 Q    & 0(3/@PU &@z⹙ 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P- @ R* D SR$ , 8 Ꮩ, @@ ኙL DD ᅙ 偙0  B6  &-0;> 0$+0;/ qO-@Q$M R Ġ 0 R0#s01 #00 0tß0 ` P @ %+  * @ #{0@$qz0 t0`q0Qr01!;`~Pp':~)4~(>6"~r !P%0# ` R `@ A$ XŸ " "P$!0Ÿ ""P$!Ÿ  ,Q!$" P%P%%,Q!$T"   < R14#@0PU5p!0 SPESU(pS`S0x S S (!q S ( Sp'wpq(t'`&v`a'd&.~&.,| ., p, !q,  0B 0 0@0S  00#Ts01 #$Ѝ< c0   A R,A B@P C?@P @@/R#-qHƒ7#cp c!qQ#/>c0   A R,A B@P C?@P @@// ~U/ 0`0/-8 ? 0O- MʀPTR& Xp  1R'ʵ?0U\˞ A@`kẠZ @11: W: @ T Ѝ  Zࠁ?0 Ѝ0 O-j pDM@WP=2P$T4_Q=⨋0OHֲ0P P$ A CYRC6 0 p\0p 1 p^0X㰠60C6X 0R pH0C B  &P0Ȁ   UXXP4 ֢ `[0CP4  0`;D`;T$B!X[PTT;0 R0 s0r0& 0w000`{p"P4SPT$<` 0  BT$!p\  o 1R㲰j0PP!Q=. 0 00100W0000Z0 ^@ձ 0U#606>.0SP[4 Y> 0Ⳟ < 0K0KK0   0GPR0 0 q0CR Y> 0 B[0 00000C01 KR 0PN  @0 0T000s P\ R @00SC0 R00P\DЍW  0= {Q / !02@Z1^PG65#6pQY p I00A-@PA^0RP@D+}n@p `0R- R1|Z000^ ^P0T0 S^ S|^P00 P0P0 S+̀Ұ0000Ұ00O-MpW``PPRO10+=Z̀0 0+=80J0+=000 Rp; W2 R6 p>0 pPn0`N Q1ss0Ѽ00#406c`UQPf RpWr 0`P ZЍY㼆`i Yv` !~:|0 cR(r `C 0`PP`0P#4``06`cQfἆv`:0PcQh06vv`0C```!0nU6~ BSr [3s0P0P00PP#406c0CR! 6W W0`P 0`P R;0+=P0aSr8`As0000`#4060cUS QuP`N0 ~PqP 0PP#406 c 0C^606 0P0chQ0v6v``0C``!0aU6q S( N ~P3s00P0 0PP#406 c 0C^6y ἆ<X QuP Br QPh Br 06aʀO-V6MpS㼖w 4P@0040030 0300300"0`0 cy Rwwp 0Cpp p"$ nV~p~p἖6S&0wp0@ 4  ` ฀ pb W zp&z BⰠ pp't pv pgXw&wpaY taN~bpiW vp&v`` I`pp`&d`v pg^w&wp0CS㎀aޕbޅa඀Აir^wwp` Ipp p"$ nX~p~p἖ `#R~ `d0Cs0yb ^wwp@` Bpp`p.nS>sps6pS἖_ 0c Q~P~"F`0CPP``!0aR!6 Ѝp἖8p἖p἖0& 06Ѝ q q p p p@-6Sڸ6 @@0 #40&006Sڸ&0 0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4&&&&0A-@ s0`P Q!rr  pp pp"$ &b BS10& u0U0U$0Q  00  0 Q   *0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 Sq@q;0PP@0@PP#406c 0C^6 S0Ҽ6ڸ0@PP@0@#4PP 06 0C6S S0ظ0@@6 0C60066@PP@@!PPƂ0O-@ MPp,0S ─&]P+(+%0 N. 0R010S@P j600&6 0 1!S*Q  S030#Z0S&0 R5|2 s000 0"$ &0b B\3&s0 R(˔Aq2&s00 00 #40&0b BQ&q0 R2&s00 00 #40&0b BQ3&s0 R@q2&s00 00 #40&b BQ&qXßk>0➢ MΌ & R~ ~ Ѽ    "$  n NP" Q   1 #O0  P0Q;S ;S <SE S 0R  , &] Pj0S  Z R, 0G.0 0R0 0xS0  0LSW4&&&& Ѝ ЍO0 &0p R2 ʱ006N.V k s000 0#406 c 0CP6@~2 &s= s0&Aq2 &s0q2 &s0  g ex c :Q0@-!DƓPV ƓPV @Ɠ@F 6@o0ƓAQDƃ<  !!ѕ"х  ap@-@P`y1r1FP t3i4FP 4@T @000@pVp,'@ p@-M @PoЍ!@oЍ@-M @PЍ@@Ѝ@-M @PoЍ@oЍ@-M @PЍ@@Ѝ@-Mp`P @P @Ѝ qp <Ѝѕ@<T 0p@-S P@ `0 C&0@"T @p賕 0 p0A-S p@P`0PC&0@T @藕00唕0p@-S P@ `0 C0@T @p{ 0 p0A-S p@P`0PC0@T @_00\@- MP p 0S p@0@C~&`V ` Ѝ?00 Ѝ9 Ѝ@- MP p 0S p@0@CZ`V ` Ѝ00 Ѝ ЍA-Mp@P `P p A; 0S P 0 C* @[T@ Ѝ`Ѝ``Ѝ@;T` Ѝp@-@mP6t3i4FPPpp@-@aP*l?o2FP p !00pp@-P` @P   @#p@-@?@s@-@9@@-@3@@-@-@@-@'@@-@!@@-@@@-@@ @-@@!@-@ @6@-@@F@-@@R@-@@^@-@@j@-@@v@-@@@-@@@-@@@-@@@-@@p@-P`N@P   @pp@-P`<@P    @pp@-P`*@P   @upp@-P`@P   @cpp@-` P@P   @Ppp@-P`@P   @>pp@-P`@P   @,pp@-P`@P   @pp@-P`@P   @pp@-` P@P  y @ pp@-P`@P  g @ pp@-P`@P  U @ pp@-P`@P  C @ pp@-P`x@P  1 @ pp@-` Pe@P   @ pp@-P`S@P    @ pp@-P`A@P   @v pp@-P`/@P   @d pp@-P`@P   @R pp@-` P @P   @? pp@-P[@$g>t3GP p0P 0pp@-P`@P   @ pp@-P`@P   @ pp@-`P&@ aaFP pUP U D00ppp@-P`@P  b @ pp@-P`@P  P @ pA-P@ g>t3GP @p7`P  @P`x8p@-P@ g>t3GP pm0P 0pp@-P`@P   @ pp@-P`@P   @z p@-@R  @p p@-@"PU l?o2FP p600pp@-P`@P  " @N pp@-P@P P"@? p@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@@-@!@(@-@!@=@-@!@R@-@!@b@-@!@n@-@!@z@-@!@@-@!@@-@{!@@-@u!@@-@o!@@-@i!@@-@c!@p@-P`j@P  }! @ pp@-PZ@P !@ pp@-P`I@P  \! @ pp@-P9@P !@ pp@-P`(@P  ;! @s pp@-P@P u!@d pp@-P`@P  ! @R pp@-P @P T!@C pp@-` P @P   @0 pp@- P @P 0!@ pp@-P` @P   @ pp@-P @P !@ pp@-P` @P   @ pp@-P @P  @ pp@-P` @P   @ pp@-Pp @P  @ pp@-P`_ @P  r @ pp@-PO @P  @ pp@-` P= @P  P @ pp@- P+ @P  @w pp@-P`0 @P  - @e pp@-P @P g @V pp@-P` @P   @D pp@-P @P F @5 pp@-P` @P   @# pp@-P @P % @ pp@-P` @P   @ pp@-P @P  @ pp@-` P @P   @ pp@- P @P @ pp@-P` @P   @ pp@-Px @P @ pp@-P`g @P  d @ pp@-PW @P @ pp@-P`F @P  C @{ pp@-P6 @P }@l pp@-P`% @P  " @Z pp@-P @P \@K pp@-` P @P   @8 pp@- P @P 8@' pp@-P@ g>t3GP p0P 0pp@-P`~@P   @ pp@-Pn@P @pp@-P`c@P   @pp@-PS@P @pp@-`Pj@ aaFP pP U 00ppp@-P`@P  p @pp@-P`@P  ^ @pp@-P @P @pp@-P @P @tpA-P @Y g>t3GP @'p2`P  >@P` 4p@-P@; g>t3GP p0P 0pp@-P`@P   @3pp@-P@P 5@$pp@-P`@P   @pp@-P@P @p@-@Q @@-@R  @p@-@0 P 33p@PPF 0S A pׄ: 0@- @@! ΃P 0R @-P Q Ho// 4 ( 0S p@-@L`P`PpfP p@ P 0o 0 @-` FL G( Fl@-P Q @@ a<0< 0 K( b$0$ 0 B F FH F F FL E m0 0< @-2 Fx F8 EA-P`p 1@P P` 2lppኃP`  @22`$@- V1@P $0 0 0 A-pP C1@P t0 0 0 :`21PP  P `0 ,0, 0X @ D D\ C@-@P @ {m-A-M pW $P 0PF @P0`P  0P:  ]ЍAЍ/ЍAЍ/ E0 0t { C Cl B @-@P ׇ@ :,p@-@P x0 00R0 P00P Q   p@Spp p@-@P `0 00R P00P Q   p@p0 P/0 00R /P/<0 00R0/P/// @-P d0o00QP  00SQ ] , ~P/0 00R/@-@P \0 00R  100P Q 7 00 }P/00 00RP/// }A-PPM 0/o0"0P R Ѝ R0 p 0 p/`P 0 S  R D  4`P W1  00 W | |A-@PM 0 00R ЍQP 0 ὆ pp/`P 0S d P `P 1000( +$0$ 0 1 W { >p >X = P H0-0/o0"^ R  R/P/D0 00R /@-P ot zP/D0 00R /@-P o zP t0/o0"0\ R RP Q $Qwf O/ z$ zP 80 00RP ebf O/, y$0A-SM`"P@U Ѝ0 PwP .pP 0 0 0iP S g0 .@P d0 0 0 @Ѝ4 PSP  84 0 //p@-PQ& @R 0Q: Pp/ P `0\ \0 <L0H H0 4804 40 ,p ; < ;T ;h < ;4 ; < ;p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ Ppp@Jp@-@<PEPp/>P Q 7P Q>/P  p@) 0p@-SP` @ 0S @Pp<P QQ P/P >P  p@p@-<X@P@(@Q Pp$pP  p@ 9 7$@-@P@ 7@--@P  -P0 0, 0 @.A-PQ@` { @ 0Ls0S(<\)0S% !S%0-S 0F?o2-\0S0S -S 0-S>^ 0Ls0S23 /S `(`  0Bs\00@03<0/R>R  pp@`R  0Bs0S73 00/R>R FU  R1QP0/SZ 0$00>S^ Se 0S 0Cs0S`  ` @23 0As0SQ ` @r R00@ 3" =P  R @P  0@s0S<300=P00S`A`0"S0S   0"Q-"Q* Qw`FVt0Sq 0(0u(0Sj0$00>S`d0`000 0`L H0H 0 2 `z C  >RJ00 4 3 3,P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- ;PoO-KM `pL10 000 00A P @ Q, U PPP0 3/P 00@04/P 00 0 P 0SPKߍP@0@;/ 0 @ 0SKߍ 1(G-,+@PE aPqP@`p 0Bs0S/<R1  ~P   ~P  ~P#0 S -S0-S>Q0 >SSS 53 @, 0@ 0D 0LA-PRMePp`0 @T- \0@0W  W[ 0A/R 0CW /RW  CW0 B /Q @C#@ T@! ;@04D .<0* 0 R *$ 0 0qVp@  9U H0@kA0@ۍ;? 0 ۍ4 0 ۍ S0Dp Pp B`p@ .,@-`-MfP*@P4 ,p`F pI pEe0RAp#0 `b00 p)    000ap0PP( Ѝ0 ` a00p  Ѝ@+Ѝ+@Ѝ+@@- @a@@-]P 0 0 + + *O-IM  @T V 6/ p0 PR @Tu 0 R 2/0P`]` P0 p 03/V@ 6/T ]T T @T@- 0S1 0 3/P V 6/]@T 0 R 2/0P`] P V 6/X3 003/Iߍ 0 0C/r 0 0C/i 0 0C/` E0 0 Wp ;l0l 0 NX BT0T 0C/E ) )0 (, ) ) ( )\ ( ' )8 ( ' ) ( ' ( ( 'xp@-P@PP  P $0SP  R P*pdMP P WPP , 0PP ' Yt 'P0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT0 00P $ 0R000 Mߍ R00 0 0K/ & % $ 0/0/@-@@FP 00#  R0SSQ///  @-@}Xt\2p@-S(M@P|  h``kP(ЍpP (Ѝp   &8 $ %@- @<{)@- @@3zdŬp@-M@Pᦃ` `0Qs0* 030 Ѝp葃0"Sp@-M@`ᇃP Ppq  000 Ѝps0"SA-P``'Ey@P =9((pP J,y@P $)zW@(0$ $0 0z, #d # #h2P S0 P \0/S 0 P*/\03#//0P S0 P \0/S 0 P*/\03#//-M 0  dЍ-M 0  YЍ0-M  000KЍ0-M  000=Ѝ@-@P ,0 00R| /P/0 00R /!QQ  P*0  S0 */@/0S R* R0:/ /0P $0 00R //tP $0 00R //<P $0 00R //P $0 00R //MP |0 00R 00Ѝ/2S!  P * 0 Ѝ/S * 0 P/X0 00R /2S! P *0/ S :P/X0 00R /2S! R/0/S :P/X0 00R /2S! R/0/S :$P/D0 00R /"0R/SP/X0 00R /2S! R/0/S :`P/X0 00R /2S!  P *0/S :P/X0 00R /2S! P *0/ S :P/X0 00R /2S! R/0/S :P/D0 00R /"0R/SP/40 00R /! S *0/XP/40 00R /!S *0/P/40 00R /0 S /P/40 00R /0 S /P/T0 00R /2S0 S0 /! /8P/40 00R /0 S /P/40 00R /! S *0/P/40 00R /!S *0/@P/40 00R /0 S /P/T0 00R /2S0 S0 /! / P H0-0/o0"^ R  R /HP/P\ /QQP/ZP/P\ /QQP/ZP/P\ /PQRQ\/$P/P\ /PQRQ\/0p@-MS `   Ѝp$0@S P0-S 0S0xS P T P JЍp%PP @Ao/A-PP@f$@Pp t0,p0P4080<0%P`p @K$@P%@^x  @-7@S kXx@-$@@: ux`j|g|@-@@O-4@T ,p@Dp@Ѥ@T `P煑Q H|PZ P PZ  0z 0  H  @-R 0P< P 4Q ,  D c@0@ 0 ^, (0( 0 U|  D   p p@-M@4 00R<SP,0 S R( 1`V9 P` 0 05P 40, 0C40P0 ?`ЍpS a0 0D Ѝp$$ЍpR p l0l 0D X qT0T 0D @ a<0< 0D    D @    t   PA-@`,p#PP W 0 !&w,P0`$,P0`G-@pMP P  `$00Ѝ!0 `P (0S0 0 P (0S$`V0 0  0nP 0S  `mP  gP X ` 0 |P U$( I$0$ 0\ j p EL<   < 0 0 @-Z  8  0 0 @-M x < 0p@-S \  Q @P?P:p {0 0 -   Hp@-0S h`@P`KPpP p@f 0 0 H d h 40@-S , 0C40P @@ <0< 0B/( $0$ 0B/   T  | 0p@-@PP0S ,  Q<0  0p@fO-p`@40Sb LP@ RP 2P0U"P 1001000`S[00<0 0 00 0SS 堑 # 00R&P P [I P dP P 0  03/P PP 0 S @^O 00C 0S 0PS Px@` \0\ 0J/5H D0D 0R/, Pd @   D h 8 D@-@@4t0,S<SS"mPG-K `0pXJXP@+ 404 S S> H000,  0 0,0$ 000,0, P  ?o 0 2\0S `P*    0S6P```D }@0@ 0., (0( 0. \ H ` $G-`P& 0 0R! 4P 4 R @,0Q p,04 P@Tp:80# t 0P 0  Q@-P80080/4p@-P@X80080p@Qp@-@P 80 0R@ pPC4@@pp@-@P \0 0R@ p`P.00S@#:(p=@lA-`@T 0p0W*!PP \000P000 0@S <0 @ 0@A-`P 0 0R4 p40S @40S,0@ PPppHA-@P 0`0VpP0S P @T @ <0< 0R/@@   ,A-`P /o0P0"Q@@T 00R p @P @T |@ 0 0R/l  8 DO-@PM 3` 0R PЍ4 00R80p Q PP @L`PY BЍ S  P YqP2 4 004Q[ ,4[^ , P1 Q  w PYUPE Pl P P!P_ 0 ,0傁14 `<0 4 0<0| `vP,UF<UHUJS[E  С0 SPP ` qP! X 0,S<SSK PP, P<00`<04Px00  2q[. 1 ,< Pa! PQ_,04  `<04 0<0R |0| 0^/h d0d 0^/*L UH0H 0c/yfX8d p l L $  xG-@S ` VP p P 9 m k00e0 G'  0 0i/< 0 0P L- ?o2 ^0S 00 S/h@-PP M @1 0R Ѝ`@ 80  Ѝ U0P 4 Rp@ Q(*,S0 B!^400C40<00<0h Fd0d 0s/P HL0L 0s/8 G404 0s/  p l 8 P/4?o 2 R0S/00 S/0P D- ?o2 ^0S 0 S/@P/0 000R/P/0 000R/ P H0-0/o00"^ R  R/p@-P8@PP P 0 03/P P P9pP12p0S /A-`@P9pP $P pO0P  pAc dp@-P@PP t PP px`x`p@-@P 0@ @-@0P P 0R R@-P0S /bAo/804 40 $0 0 H D ( dO- 0S: @`P1 X3qPpM 0S" F 0S ?P X0UUUH#B!0@< .B,? +@P0SOX% X@0Pp#r 1 Z W:<C0PQ. Q QH Q Q <Qh =Q$ ff0P Z @Q Q Q Q Q <Q =Q PfP @83`]@QRЍZx`Q 0As0S;<Q =Q *f0P @`Q 0As0S"<Q =Q f0P @4`Q 0As0S <Q =Q pf0P @}8383083 P`Q 0As0ST<0ASe0P @`Q 0As0SJ<Q =Q e0P`Q 0As0S;<Q~ =Qz e0Pu`Qq 0As0S"<Qk =Qm e0Pb`Q^ 0As0S/<0ASWe0PQ @83F83 83 830 `Q: 0As0S0<0AS3@seP- @83 `Q" 0As0S<0AS[eP[0<SS80S0P 80`Ѝ83 83 `@0S <S`6 S @ 13 0<S S ` 0CS@0S <S@ @ CR=S0 P 0"0<SS0S [ [<S``h Ud0d 0X 7 d t  H  < d t t A-`P@P dU0 0 0 ppP  Ynp P@HQPp@-P``PY@P 0`0 PpPQp@-`` @PC`P  ,nP:@P $l0`0 Pp@0QPp@-P``P#@P U0`0 Pp@-@P T0 0R 00S P000P/0 0R /4P/0 0R/ 0P `o@-^P  ^^Q m/Pp@- 0 0R@U T `P  m@pT X T0T 0x D@p4 000 0x 8@h  P P/0 0R/0P D- ?o2 ^0S 0 S/hP/@-D@T ?o 2^0S=o A-M$PU@`P !0 (P 0S6Ѝ 0P pp9PP 0 0 0}P7 0R3  P, pW- @P6 N0P0 @Kt  Pp 0  0R0"S | x0x 0 qЍl@P P#t0"S_  T D /P/< ?o 2\0S /0SP/p@-4@4P@P 00pJx0S @-@<<T(@@ @<@@t=JHJ,@-@P (0 0R*P/0 0R/hP/0 0R/@0P D- ?o2 ^0S 0 Sm/0S /$0p@-S@ P0 "P 0 P ttp@6@ @@pLLL@)@804 40 4 ;tH;@H| , A-PP@@Pp |``@`0,p0P4080<0P`p @@Pm@@-@@ @-R 0P< P 4Q ,  <0B8 80 _(0G$ $0 W t  ( T PG-3 pP0`W2W@ 404 SS& 0000P,0 10,0$ 10P-+P* # !  PP@ <0< 0( ( $0$ 0(  ,  p@-M@#S4RP,  R S 1CaV1 P` 0 0P400C40`ЍpR e0 0< ЍpS L dH0H 0< 4 u000 0< 4 X x TA-@`,pPP W 0 !j,P0`t,P0`00p@-P4Q8 @Q 4 ,040<0Q0<0pPp &0 0P d (@- M`V& @Pp :Ph00 Ѝx 0 P (0S T @0 @=P  Ѝ$ B 0  0` , 8 D H Z0 0 @- x 40S 0C40/ 0 0 @- , 0p@-S \  Q @PvPp Z0 0 ~( @p@-@P t0`0VP0S R<0  0p@$ ] 0  0 } ` A-`@MP40SO P@Ѝ DP d10XpP @10041000@SB00 0< 0 0S /0 03/@P P 00C 0S @ 0@S PdlЍAL@8 404 0,J! |8 ؔ p ( ܘ SG- p&W@ PU 0` 0R EC00 &P U 1 G 0 0F/ z 0 SRA-PP 0 0R4EpP 40S @,0a, 40a@T:8 408 pz$@-P80080p@-@P 80 0R@ pP0@pyhp@-@P 80 0R@ pP4@pyp@-@P \0 0R@ p`P00S@#:p@xA-`@T 0p0WPP \000P000~0@S <0 @ 0@m@xDLp@-P@b80080p@[p@-P@V8@S@@pp@-@P 0 0R`PC40S ,0AT :p@p@ R0 0O/(wD ޠ l 8A-@P 0P 0R Pp`8040S !,0X  ,0QP<00<0PjPD @0@ 0S/, (0( 0S/v ݬ ݔ D ݈ \ p@-@P H0 0R@ p`P=@pu|A-PP0 0Rp@4\ 80,0!aV! \ ,0\ <0L40<0AAD @0@ 0W/, (0( 0W/u (  ڜ0P D- ?o2 ^0S 0 S/sp@-P0@PP P 0 03/P P P1pP)*p0S /p@-`P@P $0S p p@ p@-P@PP j PP pn`n`p@-@P 0@ 8011/A-\@`pP \"1S 0 €  P 1G0P !`p P 1@0B< <0 ,0A( (0  D ڈ $ ڠ@-@^ P ^(QRS  T00QNRS"  T  00 Z0 0  ٌ0@-@R,MP00Q! P! 0       DY0T?o20S00,Ѝ00  ٜ ِ- 0>   \-0 <Ͽ \- 0    S00000000 0  P /p@-@P(MP`/ 0S, R00Ui$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  MM P0V00(Ѝp@ R 0S V00 ׬Q0000 00/@-@xp00T000i@-@T @-@T000 000S/@-?^t000 000S/@-/^t000 000S/@-^ht000 000S/@-^(t000 000S/@-]t000 000S/@-]t000 000S/@-]ht000 000S/@-](t000 000S/@-]t000 000S/@-]t @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^  \#-$,,0 02#/,@0 00#/,$0 02#/,0S@-@1/00/T0T0p@-@ P`0S Pplp9]t/@-0]-@-000 000S/@-]htAo//- M0 vH0 Ѝ- M wD~Pp ЍQ- M Q Q k 0 Ѝ Ha Ѝ^ B[0($/0(/0$/ 0Y.<+ < 0/(/$/R/-~x` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@j P//-~x` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@Pf8U%U%E 3 @3C0"!@11@  /  G): S- d S V Sb00Z !=r -  w- S^ >S-00 @Sx00:  r0-00w0-000 SD !S-00 Sx00"0r-w- P8 P2 P8 P0x     Ss00 ! Ss00  Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-^a`pP8 _P3  ^pP$ 0A0^`@@T  bP0=S AP` AT BU! éi_x^Ai 0 xC-PM``"\2X 0D$PTm X`pP ጐP吐唐嘐圐Zp@Z pp Zp@e $P7  0p@] X0@4S8040p0<S@40040'4''0' _<1< 000D000_x'X %}i0S dp@ Z Z ^@ЍOoBЍ@Wi00 }Z xZ tZ Ɍ Ɉ Ɉw ` ǰO-Mp`@ dP-TPm +T @`0 0Tj Wp p㙙 㙉 㙙A㙉Iǯ0 8Z 00Z P  @00Ds \a0DSW0DA0DS70DWUX : PQ S \ hP"00 0U00S 0qS 0F0 0 Ѝ0S U0 Ѝ@0` 000XS00 C R @`0 p0 A BRWppBD0R"\04 0Sp@-@PhT00Pprp@-BR"^p@?@P{hT00PpO-Mp`@ cP-TPm +T @`0 0Tj Wp p㙙 㙉 㙙A㙉Iǯ0 nY 0fY P  @00Ds \a0DSW0DA0DS70DWUX : PQ S \ hP"00 0U00S 0qS 0F0 0 Ѝ0S U0 Ѝ@0` 000XS00 C R @`0 p0 A BRWppBD0R"\04 0Sp@-@PgT00Ppotp@-BR"^p@?@PgT00PpO-M@QHP@@0`U8p P<0Dgg L0Sog g R RW   Q0:0[ 0#: RV  ЍQ0:0[ 0:R Ѝ"  Ѝ ЍR "  Ѝ -M000 0 0 000 0 ЍmdO-$MpX0HS3L0 x#@0 000@ 000@ g0 0d`Pg0"SB Q, 0b CR!{~ 4$;RP ` 0*S* xS( SA P"0` @P$Ѝ0 0 S`f"0`P0f !0 PT$ЍX0 00T0 0P000sP00SA6#0Q `PU 08Z0@P 00$Ѝ!0` P$Ѝ?/%1R5%%;R:*%6R$0S` P 0~`Pd 0``  P u~< 0``  P jsm p x @-M@" | d@ 0S D <0 0 |0 30Ѝ 9iPi `\-M( , Ѝ mD90 0#0/00/G-`ApBP@Q! Q J /XP 0 U B P10 XO-,Mȟ0x8  p00\8 @0S 00@8`0S 0(  (   {YP@0+0C< W Pp  q 0 0A0B0 S 00PU- 00XF0-SPUHGYP0-S0  1 0,Ѝ ,Ѝ60p p -U0 Ȧ:U` `< 0+ B R eT0P0 WU E :Ro 0S000T6T0H60`u0v`,6 0  ,Ѝ 60Pu ` 00PEPCP0 S000500S 0:S }5? 0P;R0S00BX0>T5 008500S 0:S (50\ 5W 0 0+ C :R :S?k:i 0S0`  :R 00X! $0 0Ot40h4 0$ P$ 0 S~ = S0P0y C000Z pP `@p @p@`T  \0SB` 2PQ z  Q Q ` 0@RpT0Sp @@z `S 0RZ0S" 2 00S 0:S  X0 S2 00+ Cea0JS0S9  00 SP0 S`,Ѝp @ _1 00S 0:S  < 1?0 1 00S 0:S  vZ 0 1S0$000<1 00S 0:S L \00C 00 S 00 00+ C0 0 0 00S 0:S 7 t00P0+ C10gl$, $ T@ @ D`D 8 ( D L D ߘ O-`2pȒ0 R" P@T60㘢 0R1-[@Ph-T@PB T"LRPP |RP -@uR0P  :R8 2 0 0S! 000P@P:T0S! 000100S 0:S 90 0?@0SX1 @ 00<P ,10P$1 0 0:S  W 0:R0@ 0S 0?@ 0000|0@x 0 @ ^L x  @   H ܔ P D  < J@-@-\ \ \  0 P010 0 0 0 R 00 0 RϠ @D^ N 0 00 Rub 0 nbT 0  X ` $ 0 A-P @` 0#03v00aVp BT@! Z 0 0R010pP   Fa0  p`QPA-`M`! PpP@ P& 0p`0 `` 00 `0@P VЍb@00Ѝa0P<:@aPa@P1aPt0 0 XW(0@- @ @XWQ0  A0 AQ;  A@-M0 0@1PЍ0 Qp@-@ ڽT00QUPQTp T00QUPT00QR !/A-pRP`@ @T T0 !3/pWG /p@-@PT 0p@/pA-`Qp@P RwP0开pD00$`,@ 00(P0ROa 0 A-P`p@P> 0U0! V WppP`P`XwP) 0 㼀0@ 00D $P,`(p0W PpPpV W dp``p`TPPH``a00Dp||Xp@-@0`MP1S ,0S  Y$0S  Y pЍpO-0M @c`pP 200S 0S 00)  0Sy !y?P` `0S{ 03/ !P`Y0 S 3/ !P`000   P    @ P 00  00 UPYX$?UA`pP@T1P!$0 ,0 81( 0 0ЍYL` 03/?v| 2P Pa0 VЍ/`0S +`Pg@@F`00꼰 @` !$P`St,0@-S @S0 P @0P 90 0001 1 00S_ 0 p@-@0`P1S ,0S  X$0S  ~XN@ppp@-@R00C0S0 PRpP--M  z?Ѝ Ѝ/ -- M0 0? ЍЍ/0P0@-$M R P@0S$  S"I[  B0!0 00 0^$Ѝ008[L0 @0 P 0S$   8 ” `P 4000S$/00//, h 4A-`l!Ph1P 8M00400. H  Q ^  @2 IWZUp  @W $@ZpU 0 0 40 30$8Ѝ@p@ pW  \P` 0 T 0 @2Zp,@p@ M04L3 0 p- M ЍC-!MM@H!0040 40p,1P0 0<804p{0P 0 0 <8 304 !ݍЍ0 0  p P@T Cn P`4 P8TzP[P @T@ք҄ KdK `0!A- !MQ@`0P0 <( 040 004zP>44p pzP2 0  pp PP!@T Cn`4 P8TyzP>[P @T@0S x t\ H0 0 <8 30 !ݍ400c$ J H\HO-FM M@$ĝ`3 p0YT0d40X (d 0K00;xP0S 0K PU  0 wP(00*AP $ Pv Pq$Uh ,Ph(, AP 1$U ,  Y "2 0 d4 30Fލ Ѝp 06P1P ZPZP: / wP@ @U  e<V= VH 0! 0 00 }0 tAPtth0$0SP / w@!0 P  00! 0 0 0y00  0 0 0l0 n+g$` ||H F < d t  D , p  T 8  0p@- MP0 `000\ 00#@P00uP0ݡ0 \ T0 0 0 30 Ѝp@\P@\PG CC0@-@M1P ` p0000H\T T, \@/00 0 0 0 30'ЍU0000 @@P@00luP0ݡ0i\P@d\PU00P BBd O-MMP`@`"%ĝ5 400ܵ0|404 @ 0 P9T`X`\`P0)p@@ 58px00@0$0380 |@P! : <Pq;\00S. \0=S0`S/`V`X`V `ሀ\P[0#S PU  @$x4 0 |4 30ݍЍ800C80LX[0 @x000004xP[ @P x 4 xP 3 $ S$ S0S800C80w  0<0PPp`8#80 TW upMW0W$0@@pHP00y[ pPھ0 $0xC  0PU0Py0SW SU (P!W B,PW ;0PW 4 NPa< R% 1J0@6[t @07  7 <080<0 S  P 80S 01@. 0 <    `BwPᣒ P្ PmZ0S  40xhS\8pnAhA< < T?  | 8 p P 30 X pC-pq04`0!TM,P@ p L !t x0 00  P!Q P,P[PRP0 ,@Ԁ` P0 0 L0 30 TЍP庀@ ; \P:0 -MЍO-p!1\M 4P@`0x!0T00q0 ㈐倠儰Y0    핀P80Q Q,P\PJRPCP 0S 0 @f 0 0 T0 30\ЍpM0  @P?@ ,m9  8x x -MЍO-MGo#03 Ȳ 0020g0 0-0-P HPg 1 S Si h#@ \# Sc  0s000 S SU S0 R R R R B RQ@  BQRS 0 S1@+S8 -S\QUp @Uo 0SQp 0 c0 0_op`R0+S6 -SH kVPPUpw\ WPXm Pp@ S S 0QUp @U4 0SVQ9 0 ,0 00+S_opR0S @S0 PP E_opR0S @S%0 PP`  ,_op`RpP pU3| l0 0 2 30ߍ UPPhdix7l7x4R"O-`2 ŸMM@0 yP08006N M.0A 0;IPY 0SV ܰ + P0+ mCF 0 c 0 { 0Y P @ P3H0: S8 1!0 & > ?!d1 0 8 30P ލЍPPP 0 `P 100S1 0 &v P \0S  S 0 0 &0 0 &H0 |0x 0 &0 `J3t4 0 , 2( P (ll    A-0M`p  0   _~P @T@T 0 PP ?~0Ѝ @P8~0ЍP t-$M 0` T  0 (0 0 0 30$ЍX/t/H-$M 0 XT   0 (0 0 0 30$Ѝ3..A-` @Pp B;W0 00 0Lq ^aLQWLALQ7L \  R AAQ  R C R ą`0C0 S: C    G-0\@P@?0P R7T!/*0$q. pa ?p??` RS*"" P* U Q0*S *0U000?0Q*00x?R`@0p1?p# '0S0 ? S*0:  T: ( A-P@@`<0@p,00 ⣃@+\@-M0D@ 0@00 0 0ЍT -,Mx$0 0 0 0 0 |6P 800 $  ,Ѝ ޴@-@0M,0  0 (00$00 000V6P ! 0" 00ЍgV 0 O-`0TM!8 L00 00000000^|taPPR d@p y0 p@P< 0+S+0S((MP,0 $( `P0 $,$U,0SP 0 0 L0 30TЍ0  sP PU 0 ) t(d!1 O-IM0p010QtlPPQ \@` 0 `E@P; 0+S+0S(P  0   P   0S4 0 0 1 30Iߍ P RPU 0 ' &0/< 0 0@-PQ0M@000 @ 0 @" 0S0 0L @0 0 0 30Ѝ0!PP % 0%h @-FM0 M `@p00d40㫄!5PPd@!ᯄ+$ P U@8U R@< 40 0 d4 30Fލ Ѝ%$\@-Px dMt0@ p`00\00l ws0 (0 0 \0 30dЍu$#x3w3@-M8@ 4@L0 Ѝװ ~P1Spp// 0 0@-PQ0$M000 @ 0 R C0(0T H0 0 0 30 $Ѝ0)LPP !# }t"G-p!P1M ࠐ0 e040$E4zP90D U06p;t0& T AcPP   -T0@To0IT@mET@  0 0 4 30 ܍+3T@W/TU@ 0 PP;LPGⲽpx`|@"!<- M0 Ѝ@-Px dMt0p @`00\00 A0 (0 0 \0 30dЍ T 0 ,0O- M@P\@<0000  @0\<9\`:E`@p  Pb-! Tp* p!p p' PDndp,h } HPjPP !L lP gq( * ,pፈat'`& .P%PP )͌ hxP!@$ P " +읉plP%P p( p|p']pi  } ,@$@@ !@eQ@)M.gq ( %* ( 删͌dA ' `& +(!썈,l hQ $  " P!P&`*)_`& "``+$`/ *  0`p@ `* ,  `& ". @o-@$ (`/ )`& `&`韠(/ .`. @ +  *" )*ꯠ( + @$@a ,뿠 ( @$*$*0, /ꯠ (+@菠p' ꯠ( k!p'띉 p' ,0@p pp͌`&,p`&p`&`P%p! pP%p'@pi`P%}PP "@$ @$l @$ )O@@0 ! $0 ` 0%P. 0#. Pgq .0# (@? 00, 0& 0#- ;>F`P' ❉P%!b! P!$ ,` ,p.p]i. ".!͌eQ@,@0.. .) l$` @$ $0@ `%`& @ + +`+-@ `&뿠(a,P `&$.❉ `&Pb!o``@!P%P% P% @$i` @ "忠P, *`*(Mn*P) ꯠ8! ͌ &`dA !- !. *l_PP ,⭊ &! !o`` $!b!P P&$`P!8`@!``)`& `&, !j_@,P P"MnaP% d * P.(͌!P%P%0@ P @$ @$ @$ & "lO @@ ,@ - ( .P. @)@$4a*80P !`!_8PP, @P%$P@b! & `!]!nA(`(! 'p ͌.4p.p"$0. 0).,0 eQ 80 .0$ 0#l 0-0| (Ha 0@0 `&$@`&`&0 o ``b!P `) P `&`&0P@柠`a4@ 0P+ P%@0 0@08(** n P%*=_PaQꯠ  , &`! !`-c1 $$@͌!!``O@bA   0-*@ ! ! `+Ꮰ P(Pl `&8`& _baP P0 4 0P%-P%0P%? 00`Q 00 * !@!@ bO  0 .0. 0,@.͌`A/0  $0  `+ 0!la@- P  ,P͌ ! P 0#P(P .P.0b!l!] ? @ @*  .M.eQ +`` ,,쯠d@$@ ` `& @`&   @@n@ M), `&) o  (j 菠 佋 P%p p*0p' P%$p' P%  0! b*LdA``D`0 0͌`0`0`) `&k0_0`0m0#0#0#0 0 $ .l0 0#0#0#_ 0+(PP0#@@ 0faM)P0 P,((pp,pn菂0 ,0 ͌`&`&dA`.m .lp'0 @$@$fa @,M,n`&͌`&dA$0.` .ml @$@$fa ,,n`&͌ `&i@P ` .mp' .l  )p'0@)fa(@ ,,n0@`& `&i .-.` p0)<=)L HP㍈cPb! "  "T0p8 荇00 0 0 30Ѝ P0+ EF/N Iv 2A!#L  00/A-1`Pp00>!؁ "0%0 0%0?S@@h G#0hS@H"p ` # *0S@@:p`F AG@-@ M1`P 00 00R0 0R1130 0~? S pp 0~? S U PE "0 0R1<308 (0 0 0 30ЍH f\ fD  0 0@-PQ0$M000 @ 0 R C0(0T H0 0 0 30 $Ѝ0)<PP  eP LG-p!MP1M ࠐ0 (e050,EiP:0E U07A;t0' T CRPP!  AT0@To08N@\4N@  0 0 5 30"܍Ѝ+!N@ENU@ 0 PP)FP5@៷pp`|@ - M0 Ѝ@-Px lMt0p @`00d00 >0 (0 0 d0 30lЍv3 E7FN v$I2 A0 13L /O-|M8 x03?0R+L Epph @%.fˠ80!n0` ```&`pek<@ 0%T@ P0#P @@0@$PP@@c9 !n *8@aD@ꨌ#[ ) c;,i@\Hfk*J ( L jp荁.e[ ).i@ɀadK P 0(0#h0T< dp!.p `H ``&a`pX꫉lˠh # )p\ PP隈P%l` Pc;]@.fk@* .jPL艁 e[,` ).̀di`a0tdK  (.h0X` ph8p !*` `l`&j` pp=F圇PP%tPP P\P p+pL`[g p ppdKp'` pt| i, <ˆn*Xꨈ`  ! D g{!<` PlkT (@ P,`@@XjdL , paT lɋ P !np8 ape[\` pp` p'dK`p ppip'lˠ pP +gydanh+ l`XPi fkP@dP P P%@P+ a[Ig{lh i,L͈ h  .` l@*  .` ꭅ dKnp  a " &pf+!<`, /Hy`lˠP8PP PPn P%`* PH `aY@l `&j0 0)g{\@霌`j!  ,de[0M)6lɈm:G & ! fk`iX````P $` !pp,lk !8dKn} . H jXP , P.< ẻ`['  g{,l隄a  ! D@h@dɈ@ @)d @i  @$H@. `! ,lktdIa (pn p ,g`{lP$8PdKP% a[l! ,D LaɎ(  !` Thi  )*hj ak ! , @ ! @@lˠd t@@@p.l@pn@p'ap@{) @@ (\P@ iP@@$ hLP` jJ! P P*TP'aPj`P%PP `(` `& `@g{] ` 杉h`$ *`  +p`&` dK0b0 % H "N0h SJekc<p  j  "`  tb,@$ i ,#,c;{@8͆ @ @@$L@`@舊P @"k @$LPbK   "g{ (-\eZ,lˠ` `` `& `P"#3 0 0 8 30 ލ Ѝ9p PPT >T" @D0*@F5`FX p@-+,@@PPpNF0PpC-PDAlM@0SH  EP?q@@p@B`B$0`(`B @@*P$@@@B`B$0`(`B@ @^P @@@B|BlЍlЍ'&x @- MPZtqt1@p`PP@@T 0Q |P Ѝ$ YP @ Ѝ@ YP"0S- -S?@0 0000 `  V RP +R@@D!0DSX YP0S +S!@ ?@!@ C B z X ?P L0P00 1 R/@P/!R/P @$0>R0 00//@-MP `@ p6pPU0D>S 0!31000 l6Ѝ>SL 0!31000-E00)E00/-p@-M,@P@U0 ` ` +Px0x 08 R;0Ѝp@Ѝ/0 a0( $  ? ۠t=QC #XA\#\ !  +A /qR   /R  +S -S =S0P00@/R-@+"     0000000@- I@@0RuS#WSPX0CSF5 +0Q0R \PSPQP\     0 T 0+S -S0O-LM`臟V 8@(P 0(0`,00040 㲬pᰬ  ` D @ >D@T1\7 `000000" 0 pa0HSt_rqpon9lkjihgf,dcba`)C00C@`C@LЍS  "=X  R"   P:0@$`C $:>C R$ " 0务@`   Y 0 S:$`C@ $>C0S 0"0C$`0X W     X ,X +X@ 0-S0=X00|$00 0P@ X B R񏐖}|d]hwc`S  Z0P$`9C =2C RX$ " 0务@`   3 =Xw +0HY?o20S Zq 0W0 X00@ Z$`C P=B0S$$0"" Ⴁ@` 0 T000 ~W  z ;xI?vI0t0rW  n |0S 0 S2*-/ +  @ LЍp'}C~p =X  00$`B P=B0S "2 @$`x}$`B P$ =B0S$ 00C`01DsP~qB00LЍ 0{+\-L +0B XR R  +0B 0+R XR  -R  X@PPQp-M0  +p`ЍP 0 @-A/o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`0+P0U PU  0 YPu@P PPr[P X000fp@000AP帩嶩AP 2P P n0p@-0P`@T 妩@T0rS 垩Ppep@薩唩P0+Spp@VT冩@- M@`PrP 00ps@0p0 ` @ Ѝ00pb@- M00d0P0L10 0  <100S6"p@( P 60 0 00S3000 Ѝ{0 0 @/}@@6d0 00S d00)  @@ Ѝ(tr$ &, & & &qql@- M8A@! @0P0 100S5p P 0U0 00S)000 Ѝ¨%@x0 00S@ `w00嵨峨@@ Ѝ$gchtpPpp@1@!0@-Pp M0S) 1@T2 `0`S@% 0SV00+ 0S$`V@0S' ;pP P Ѝ|&t0@T0S \8@P00@40 0 k t\o nnXG-HM`00 0Pp ͨp@ HЍ@ pP 0  p ᵨp@ 5HЍp?0S @W 0P Rᛨ@O- G1@00P0 (0 40h0Y4P0,0`  X;0000S0` LTw 0 ;`T00V0S (04  A3T0h0$02 ``0 `HC0,0@0d0:Ϡ 0 ,80i`V<Ѝ200$020$0~20,0000PGU%UE Pd@0L0@P@P|2@TPQ0` 0 :`Q0V0 S 0Sr(0Sd0 :  `0/ ,0$0! 0 ,00 `S8 5HQ1>O0 0P00Q5S0  40 0(0710`00P40d0(0,q0 40Pd0(0#:00Z@< 0( (0A8,0ӝp P25<00@0SZ 0 F0SK8' 7 0 0 30Ѝ hs?0t0h 㸈p@ 00' ᔝPTpR0' CqQ0#R X0CqQ0#R Y0CqQ0#R ^0CqQ0#R~ [0CqQ0#Rw Z0CqQ0#R; Q0CqQ0#R  P0CqQ0#R O0CqQ0#R6 T0CqQ0#RN U0CqQ0#RD V0CqQ0#R: W0CqQ0#R3 L0CqQ0#R M0CqQ 0#R N0CqQ 0#R 0S:V 00'@T R B KP? 0p'@0000@'@ `0 MT@5' R@&4 0'0='4Z0ST 0 400 }4V0S @40'0ޜ'P4P0@Y0 0Z (30 0@0@  ' 2 0 00  " @t@'@2 0 00  " @t@'@0'0gp@@p84L 00P00q< V0S d40'0凜'@^4@ Pm {u @' @fl%|K4000`00Z 0SCV @@K ${@0' 0F0@B  @' <00PP0P8040!@2@I0 4Y0 @0S@P0S0  ' `00C0  ' @4@1@.@{*|P   @ RT ` L- M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFSpP yP Ѝp__G-p@`@0S%@@Q0)̀\@@\ U P p0 R * ნp0 zp0 _p_\_<_8p@-p`pP`PA@T T0T0 R@@5p"P00*;^h^H;tA-`Pp@P@0S |@@. R"@`@+P0030@;]]:@-ț 00 ] C-`\MP&@P- 0S8|0V $"  UpЍ  ɮ0P  $ R%ЁpYT T 0N꤁|0IE|x|?0R1 0QG Br&Q&R-.4 ꐀp0 Wtqd{ SzڙHv d \\    x   \ \O-BMM5%005 u0 0p5 0040   +0 ᱕P 40 4,P P@\ P 0S l400#S \ P 0S 4d44`0`\ P 0S d4`0`\ P 0S 3 0   \ 0P 0S i30\ 0P 0S i`30X3@ETcP0L`+ )@\ }@P 0S -P0[[ .P200xS0xS0Sd "\2 0 4 30BލЍhR@P\ GPl 0S <200#SE \ 8P 0S 2R0P\ *PW 0S 100xS0xS0S" 10 0sS)0wS&0S#|! x1xQ0P \ 0P 0S hD10\ 0P 0S h10  ! 00P00 $ঔ 0000 00'.P TZdZX hY Yt TY8YXXXx -5W WPW $VV OVp V8V UU UU Op@-hPP0S P@L@@p@`@` 4P@TT l  L$A-P`0` 4P p@@-P YP@0  "C0 p@0 0 .`-0P0 00 0`0 ` 0x O-M"0  "  p a @T `4 2!1 0 2 30\ ߍPW 0  p L  `P: 0S;p00P{`P* @@0  ᫖p@ 0 ᐖP 0PpW*P< ">0  "C0 ኖp@0 0-`-0P0 00 0`)0 ` 0PO-M"0  "  Sp a @T ` !1 0 2 30\ ߍPW 0  3p L  `P: 0S;p00P`P* @@0  p@ 0 P 0PpW*P< ">0  "C0 p@0 0 -`-0P0 00 0`0 ` 0(p@-`H@P@ VPpPpPwP p@-`H@P@ PpPpP`P p@-`H@P@ <PpPpPIP T0 00 Δ-H- M0 S0 00 0 00 00\100 M\  0S08 00 0 0 30KH Ѝ/D-H- M0 S0 00 0 00 00\100 M\  0S0 8 00 0 0 30KH Ѝ/\ -- M0 0s'--M  C--M  ZA-`PdpQp @Q ᶾPD@( 0000Ac0P R   0//80ǟ ,7 (O-DM00<00P6f/0+A  000S* R 0 :R|RF  @0 P0"h X P 0<0(PvX00X0: {P % X00X0P E @p0<(0 p000p5 0,  pp5 04 dE @P*H?<50  ( p0 % ,00 D @(`80 048` pp840D4@0<4 0px4x 0pT4T 0p040 0p 4  0pPv3 0pTk3 0p `303p * 33 |3x3a0`0 0,00,400,̠( Ġ ,!!0"",4 .$ .,8  R ; 0@sqXC  951-) p00    p   p00  R $ p $'p p00  P L!0@q 0p `0C\p2"4",0(  )@@t@p005T0hAW5V2H@00H!x0 0 <0 30DЍ 10p!  ='PX00X0DDDD T 4 vD  C Cl 0 ۀC LB ,f4B BBh  ڌBBA @A A Ap AD A t@ L 0    c P>>dyT> p@-@PA 0S, %@T :T8 0R/Q T&*0CT$ /R0C/QT 0C: B0PU0P!Tl00p\@@PT; 04@/S@,@@$@@@== .= - -A-MP@c%X0PD L!0C`0 0 0   $! 0b0C S1;/.-,2*)(4&.p`t)0 0Ḍ0S@ 0S 0Sb)0"S D'@pЍ T1r0:P) 0 Ѝqvp{v [p@-PP7 0S0 $@U3 0U/  0C/Q U!@# *@0Q/S B3@T@!P; P00pU B3@T@!<@0@0/S@ @?$ +$ + -DM0  000垑p 804S DЍp@-`P4 p@ P Vzp V U ph Ԑp` ᰑ᭑᪑V@ِऑ@ D P?o?o 0@-@c^?c(0C^! ^ P@`c5$pC&5'&`c 15D0c 00Q!  "0Q0 /0 @- / 0%D00D0;B 00@ 0/ E0 0%D00D1;B q1@ p0P/E0? ! RP/o/o A-@@bT?b( B"T# T `Ppb6ŠBnj6Ȍ&pb 16U b 00Q ,!/!.1R 0 /0 @- /  0#D0  0;B 0/ AC0  +0#D0 Q1;B p0P/AC0 J@ @-q@ J@ @-q Jz@ @-wq Jo@ @-lqPP `Ώ@-'00?0/R//R/?0S/R/P/R/p@-MPP`V @T x006 Ѝp :   p@`$ Y=$< 00 R Ɛ=<#:87-,+*)(Q4ih".z%1c00000; 0`0Q `DЍ0PP0P000@0(p,@h08 $ @CPp#! ~9P& P U$0SA $ 0(p,@0$@CPp! c9P PU$0S* $ 0 0`0000V$却z[0P$ 000 GR. +R -R -0 `40ppS<:^ >@S4R 0c$00 0(00`450 `0rU0[0040000000 @Wa0`^ n144 W400C0`0Q0004c0 `0Wp AW?0 007 0`0P0P0W%S,=W) =0 s`0o WT 0 ;0 P 0p\0 S 00W00`0 00O 0 0I`00 0000 0 07`0000/c0 4*0S`0] 0d 40/"b2#40 0000004c0 4 0dS40v>C 0C40`0  ` b040 0 0PP0P000000C SX`0`0W0S 00$0$0P 8P P  8P` 00`  00 Sl4 W2# 0 dWb P 0 0 S 0p`0SQWR 0 0`0G00<450 `0  044 400C0`0/000}7 4l4v40 v>C 0C0`0000i40 d40/A!b!b0C 0`0# W0 00  RV 0s 0 p0 00 00@@0v0 PP   B0`b 0$I"I/A!b!b C0  B UR ZR^ R   @T P10(00 0$0 0 `(p,@PW0` 0 `(p,@PW0` `4, E `!bK/) P L@"(@bQ1: 7 0@bS#3  1 0!" A!0  40DSd040ե0 MRn 0P^ @ zR 0 R#^ R z K /o0"Pz[M 0P]jXS Ȩ  ` $ p 0000C<0Ϡ8 0 B R&̼ | ̼@|L$@0Wo^ oO0@`F_O  0 OG0@D V}0<08 0 B R$@ 8*`P 00`00S@ c0 TR R3  `@(0 CR}  ABLBq`| \V4JR{!P 000 0c$00(000P400N!S6uSs1?cd0c;S40k<0#- P0P000@V@ B\ NB QM b $ P00> 0(0$ (p,@$`(p,@$`400 @/ R, @( R 00@! 4`0 pp0P 4 P 0000C! ( .$0t0`tp p0 0P 4 P0000C ! ( .$00 0Y#0`  0P 4 P  $ 00(00c$0B 0 0 0Vp@-P 00M `00,00 @  P00Q Q Q }! 0 x p0 0 ,0 300Ѝp ,H ,H ,HVV0@P/ P @/G-X# p`V@P0PES  R D PEH0V R  SS0@0D@R@- 0BAs@ @ Q0C@R @O-` My8 VPA @P;  pP< 001Sp Yz Ѝ00PpP 0 0P X0 0 {=00 t  0 KTP0@-RQ M@@ .PP TU 0P Ѝ0P Ѝ0  0 Ѝ0G-p!|1M Mp0 050?PL` Pᛈp> @P<@^X0pA 00tAA0O}00 TAXA\A>6qύ$@0ˠP (@ @, s@P P p `0 0 5 30ݍЍ@9 @004 @00RtRdQ\0-  P--M  Ѝ Ѝ/ -- M0 0i ЍЍ/O-R M@ p` R00?w}00P @ P /00 P ! !  ;X\3?OP9  aVP WB V[X0 SPpp` `/!1 00 Ѝ`{pP/ PSPpPp`00C0 P P00 Ѝ`f ` RpP V KpP `PL@-@ M(0S2 0 (0 pp1/`vqP0  0 0 PUoR <0PUol ЍP`TP 0S  0CPoW`:P00@-P MB(0S< 0 #(0 pp1/`vq@03  0 0 @ToR <0@To(1`PV ЍP`T@ 0S  0C@oT 0   0  e2R/p@- @Tp E2 Rp 00R0  P 0S PcP0 00( 00 0 S,P 4P 8P p@ӈp@-P$@@ᄱQp@}l@- @@vQ@p8p@-,PPi R@bp|1!0C-M0 @`00S   0 XR0  S= Pp@8) X80C0IS50 S0QT-* @DT)T' @0 Ts0X   "Q T #R.S 0a A 0C "T #R ЍP0@J$4  R  *4 8/ 0X\S 040:8 R РS /JBx@-Pp`P@P@0@D尀 U   فჰG @-P`@0  @-Pp| PPP P q@`P4vn EpcS0000 t0070000   0070Ds0 00Ds0 20\A #o  %Ao&Ao=Ao#4@00&00   & 0W0Cs0;T 60000k 00 C10@@0?Q00 Td =T^ T` 0@000 F 00Ds00W0Cs0 0 T TJ 50000 - +  00D70Ds00,̰B H501 0pS;T cQ(E(@pdQ \1  PP0 0SV400000DS0100C000DS,0100C0-Q ^Q00 0AnS~|{zyxwvutsrqponmlkjihgfedtba`_^]\[ZYXba`_^]\[ONMLKJIHGFEDCWA@?>=<;c9876543210/.-,O*('E?$#"m `WQKD>#T 0 p0A0002000N 0@00@D0@000000000\000000 00 00 00 00 00 00cQ`dQ00dQ 000<00 0000 p0000 00G  pO-P` MV @ p@ 0 H R2\L 00`V0SS\ 0D  b 0 T 00W0 Ѝ S\0 0L 00F 0 0  00  ! A-@ap`PUh /C=1"#BbaV7 0S$ RP QP0S! 1003/P P $@-00V H!P0  $@W00 P100S) 3/000PP0S 000S) 3/000(㜿000`3/P VPWSP 000S=7PP0000   D A-@ap` PUh H0#BbaV7 0S$ RP QP0S! 10 03/P P $@00V H!P0  $@劮W00 P100S) 3/000PP0S 000S) 3/000(00 0`3/P VPWSP 000S㮿PP 0000  hؤ  װA-PPM @`P} rpQi  00Rc</.#C="#2caqV/ pW  PW[ $00Ѝpqp0S`100S006 81003/P00  $000Ѝ``0S 000S. 3/000(ㅾP`0003/P 00Ѝ3/0000S =P0000,hը`A-PP| @R`Px qp Pf  00Rc</ "H#2caqV- pW yPWV $00`qp0SP100S004 w(1003/P00  $000``0S 000S+ 3/000(P`0003/P 003/000$0S 㑾P 0$000@Ӽ,l$SR: G-P0p`00S 3/0Y @IOP , T0 0 0 0 Y @IOP  TT0 0 H H0 0p`P   /`tѸ`SR; G-P0p`00S 3/00 Y @IP T0 0 0 0  Y @IP Ѿ TT0 0 H H0 0p` P $  /DTИ@A-PP Q@ zPP@pl`@P jPpW W0"S ᔾOP00P@O-PM M Q`0 0 Q /QE P.00G PP7pp/Q/ Qq @0/SS.Q8 0E00 0C S$ H/0 D 00 0xp 0: S-  S/ A/o" R`/QPPV?00/0000 'ލ Ѝ DR .QRV  u/RWp30娐# 0P4 00  R(0 j0/Q0#0PVP/0000ލ Ѝ i`P `c00>0000?0000 p@- `QRMP>  CHA@009 P? 00@T' 1`0@ @:T `\ 0 \S 0@ S @ 0:S@:T T00Ѝp\0P zL 0 Ѝp. 0 `.84@$-P :P0SP S:R S0@S0S S@P :RP:P000/h@-@A0\  \:^|^00^0S R B|\ :\\0 O-M M7 'pĝ 00D40t4!S S \G@`V 0P 0(  oPP 00S D [ &  ಪ0 00 P> 0~Pv0 0 ` R0@p`0 S Wp :S \Sp S Spp p0Ti*R0+  p~ P 0 `0 SWZp@ 0#SS  ^ P500S0 5$P0040000= pP 0:RPh P0Rt4< 00 0pX`P/ vV* v):00e00Z  0S m00Lj:SZ @0T:H @Dᮻ P @P`< 0:R` ` R40 FpG CE 00S:S:0 00H IZ 0 D0 @ 0<PC 00EpT@DpTg$0H@D pGPEhP @pP$$P 0S }, TD0A0:(0P#2 0 D4 30ݍ Ѝ0 0 0 <PP@ EPPz @M2@00S0- 0S$`宻 0SRN e@᤻a@00 }  |} <@ᐻ00S00S\S00 R{DA P0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S0@A@ @M0S't!D1 0 8 30H ލ Ѝ  @P 0 0 C1 0 Z P ^@P @@PP P @0 0   0P 6 0 0Pm a @ja# "$ d < ~ p@-@D`P` P @0 0$0 0p@   G-`= r@P dVPP 0:SS   d: p \S0@* QP 0:SS ^S0S:S Q0@0P P@ dP 0Pd:SSQ @0@A0n0S:S 0 Cr^6B C2RBYU?PK<;:9876?432802.-,+*)('&%$#"950+000Cs^/!000Cs\@!@ @0 0 @0} @pz 0 @0v 0 @0r @o @l0 @0h PᙸP@" @@ @ @|@ 00wA-P= `P7 d㋷pP9 0S:S0@@c%0:SS   \0@Ad_dP p\A@A p`NpP@׸`@@@͸@ 00p@-@# ^P 0Q 0XS  <,00AaPAs ^U70AAAW0A^RppO-`d pAMX# M0 S ( K @/004 ePPQ P4T   [z900CS6'43210y.-,+)('&%$"! t 84 z84 yL y0:S 44Ss0S00"1 0 (0 30o KP( BK4T J0:SS 0&100$ 8$   RBK@; < $0I<$ 0/C0$| 84 $0C 0$C(1BKJP0u 4 R:R0Q1 A R0  0R!010@0M@ PN  y0:S044   00UKP G #000 p \ @, Θ h 0 00 -H-M0 S0@0 0 0 00 00^100 M^ @ 0S0L00 ay@ 00 0 0 30KH Ѝ/Ҿ84@-F$@@00 ~ ~O-`"2P @0,M0$00̤x20Za = 00pv / 0 " KGP Z p P p J  J  PP0 S"3#:   V(100s# T$R , @$&x1t@P@l!00 @դP0S?"8!1 0 $0 30= ,Ѝ 100S  V0s `pP Ƞ _P 5SX0( ,UT00#    PP P0S  }@ }@  |@-M(@;0@@0<PЍ  { { {G  {// =A z {{ {G+  B`{{// =A  { { {G  {//=A0@  { { {G+  B`{{//=AQ@-@0M P 0 0#$ ( ,0T P 00# 00Ѝ 0Ѝ-$M 000 0wP$Ѝ-$M 000 0wP$Ѝ-M 0 0 0wЍ x x0x/C- 0sM @Pp0^ `010X0pA00tA`0O✢P0P0P0TAXA\AH \ 0 $@4 (0 0 1 30sߍT0-   O-M$0?0`00301S01Y d/0` 0, ( 00 0  pP0(%Ypp + 0S0 R .> 0 3 30 ߍ P0 b P 0 0C0 S!0A`0zQ0fPLKJi\~}{zgxwvut0r,+*igIb^][u``YCT000`0C0 ^PD 0S 00 0B@00S0  @DT = DP0  P 00C0S000@ 0D S*v00D00 SL00`I8 @L$+< H  4  BPR (.Z 0vZpC0Pj M1W`` ` Pp!p 0P+@MQ^f\dZY?SRNMLKJIH654321A@?>=<;:987654321(/.-,+*)(!  UMP00C0S000pWP0  PS XR    0 $ 0$         00 0P0 0C0000 S@000UT @0 P 0@ S0 B 00 R @P00S000000S0I >. #RR @00T00C0 0 >. #RR 0 T000C0 S P Y 0 00+ E  `P B RV *P@NU 0U0`P0C0SRV F*P@ XRl  B R P?R*P` PP@0@40 P8D0U0 S B= RP  Y*@@ @P`0FES40SF %P 0@PF0C0S 0400Tw: `8<@DV*T T@0 PT0j 0$0`0P  j$00 h400S P0S2 0$`0 00000S  @P B RT *P@+ E `P B RV /*P @ DP 0 @P0C0S IU `P B RV *P@`W(00S H00S0WWp0CSP0 o @@PPMXYiU nU `P B RV *P@0S񏐬Q.0ASK0`P0C0S@ p< P0V.*@P(UN0`P0C0S @p% PV*@P0NS0`P0C0S @p 0@0<00 0C  SLP PXU@ @@H0@0900 0%00   $  0$  㰀  + 00 p wL s r rh b _p0 P 0 0C0 S <P `0@000>0@0<000 0@,0^T0400PP@0400D0 T 0%Q0>> 0P8>04`#C00000@ 000@ 0 00@090 0 0q00@0 0b0 0@0\ @40Sn@@@ULP  M PL @PS40cS; P 0@PF0C0S0 00 P0C0S0R*P00 uP P0 P4`V P40@0 mP 0P0C0S Y*P4`V P 0 0C0SP0R*P``gS꙰v00D0?L0@c0@P0C0S0T *P0`0H PT* 0@0P PT*`PTXpTP`$0P$0\5000 V00S0P0S$T@ 00 0$@P >. #RR  PR  B   P 00E P0>>03SS 0PU0C0000P0002 0S P PYU Q 0$@0 0000@0 0CP0P0 PV* @PZ 4 P4 R*`P  P R*0P00 eRP  Y,*P @YbV$@`PPP0 P `V0C0P0P  0S OP 0 $@0 0P0 P0PC >PT*@PSlxTPX`$0pP$0040  P >@0CIv  0 ʯp P p0S P0SY4Y 0S0 00 0 ᮯp ᩯ>>03SS 0S0P0C0400400S PUVS*0P0`@0" 0 H ᝯPC >`0CFvo {0 f 0p- P p R`408P00 @ PT*0`P00C PV: `8<} 0P T P B0 R PV*pP)U0@P0C0SQT0*Pp _0U0P0S0@pP0C0S : PTr:@8 `<7 P=V;*0P040  P R*400 PcYa*0 @P PY@@5:؃` 8<P L0T: `8@F<@` `0F8`<@ `8< `8@<@` `8<@D SY C P SSTd @t Y]`؃@8 `@<؃ 0Sa `v YZ<-@D؃@`؃`k08 `@C<`?+40 SP@!@30UE$P 0ћP 0$P0 0 @P!UX$0``$0X1000 00P p>>0 BC  v 0 婭pq P"U@DP# 0S0%TU P0 T  P@DP Upt0C P jp U@D`0S0 00P S 7 VA-@P`p0 bPA-`@P@p0P0 NP2pA-0P7 !@00S5 0`1S010g C00uP0P! pW@0PA )`PS 0 !0 @0 C PC000}0Y Q  Q*RQ) <008 @    BP0^P00`0s0 P ;0?A 0B#@ # B0 ;7Pp@-@P$ wP&p @-M$ 0@4/@PЍ@Ѝ\0 X0@-M 0$<0@4/@PЍ@Ѝ0@-$̜M $@4/@P Ѝ@ Ѝl0@- `@ M $̐ $@4/@P Ѝ@ Ѝ80@-$̜M (@4/@P Ѝ@ Ѝl0@- `@ M $̐ (@4/@P Ѝq@ Ѝ\0@-$̜M 4@4/@P ЍW@ Ѝl0@- `@ M $̐ 4@4/@P Ѝ:@ ЍO-Mp`@@D0PX # 0SP $̒0  ;/0$ 0H@ 4/@PЍ @Ѝ$ (@- @MЍ< @-M$ 08@4/@PЍ@Ѝ\0 X0@-M 0$<08@4/@PЍ@Ѝ03?1/@-Pp`IJt@t0@p@ ṙU  ᵫ@0 ߫$ ⦙P >0 Wx 0lO-,MpPP pE@0P0 00Eʿs00H5P`0000  @00! B b<6>  @BUP @ 0Q4BN3L0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #        0 Dr R R P R \00T3p00 01@000@0@PUI*,Ѝ $R \0M 0 0$pP S^@0?000  P 0J ZS0  0J ZS 0-00l10000 ,Ѝ0\  r  p0\  s  p0\  a  p0\ S00 p0 0p0\  b  p0\  t  p0\  n  p0\  v  p0\  f  p{ @嫩0 P^ Y0\  @pl` QA-@p`P ᬩP=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 Ah G GA-p@`PHP_T !0D S (0D,TS 0 ALI&23 $0T"@%0 !1 FO-p$'S7WM P 0瀁0T106儡0401@0W y @-0P(0 b`%0P,0 0S00<0g 980P P  LT. (`000P@Tp` U T 0 1 # P0?0S0Y P_P P5%0 b(0@FDA T @! L,`ۧ0P$0  0 00 80S V L0$ 0C BP$0a  5? *00R  4` '0(0R 00 00 00 "00@\0000 tpT) (`,$@T$ 0 7/P @00$H,F(D<B$3 0 T1 30Wߍ@0SP@PR,00,Ҩ 0S 0S0  0S ,0@D 000UM 0p`0 0 0 A aȠa04ɌpPPPPPPU PP U* 0 319<80 P*`0P00!S00S0 00 0@80@ SR 00@0P$˧,ɧ(ǧ4 ,2p0 G0R 0D 0  [P` 00S`* 0  P0`00@00L$ p $`:0a 0S 00S; 0@@;4qp%,qp"  㱦0P0, 0<00~s0200D@$@ 000 0 ya0 0 qa0 0 ia@ꥮ0@<0$0X0 E E E E8 E$8T$T @4 @ @T @X @ @4 @L @` @@- M@ (t@0@ 80 0P@ 0 30 ЍbӀ@- M@,  (00X@ @ 80 0P@ 0 30 Ѝ7(p@-@QM`P0 S0 `PЍp0@-@RMP0 ?0( PЍ0-M0   Ѝ-M $Ѝ-M ($pЍ@- M@@  0VD 80 0P@ 0 30 Ѝ购 Q<@- M@( 0xx  @ (D <0 0P@ 0 30 Ѝ膭 PL0@-@QMP0 0$ PЍ0 O0@-@R$MP0 0( P$Ѝ0 Odp@-@Q0M0P`0 q0$  `Ѝp N-M4 0 Ѝ N-M  Ѝ Nh-M $  Ѝ N,-$M  0 00qg$ЍO-MM9㑞 S< 9 Bq`p @P0 Pp ibi VPp%p PV! ?P 0  SV T d ܍Ѝ  R T W أ@P  9@-Ap@-P!!!!@ᨤ0P0 @p$0A-S`P@:T0 @@T(0 & 0U  @@0S! 00( pG0S$ @-`QM@ Ghpp.  80<RP @0DRP P00V Ѝfpp %hpP@f@ЍgPPЍA-`pP9@P \0 00X0 0 0P `$05%0`!@P\0X0@5@-@M0SXPK00gP[0: S S_  SЍS P gP /0pg`P$pB&0 `\0`.S0@D`H08< 0L R%0L R!8 <P\@ D^V0 0U :0Ѝ]0S \040.SЍ0$0  Ѝ 0O-4M `0,0(,Pg ( R ,0pBo Rr @P00,0 , 0P 00,00, 0A /R ,0   0 00 $00K0L00000p00S$  0 05000W000p@@ v PP ,  0.Sf  0@P [@0 0,L000 0S% % R R,  B $000S<R\ 00  0_ , R0@PS0B0 0H00CPS0P0@u@0,0 0|0 (PZ0 S ,  0 000 0KR\0 00 050S 0. S0 00,00 00/  00 0X {0Si,0 0 XS 00C 00 0,0S (0XS 0L0S,00S X7 (0SXj4Ѝ0@0,0 00@ pW p? @,0%<,04Ѝ 0,0 @k 5050 0(0SV p4Ѝ ,  @/Q  , 0S  \R   B  0SL0S0 \R   B   R00L Rr 4ЍOu(0S@0 p5\0$0S{0l  Ps  ,0p<%,0q 0p5lcePa< 0$0 r@0O- MPp0ᩡ@Ph 0P(S,P~ `P0UP1S Q3PP]L0,  PR `0L0V{ PPP`V" 0PG  ,w`P5 ,\00 LP05XU0P`P``VXY000P!, RP , 0P 51 Y  ЍPU @ Ѝ00@00 Ѝ  ,0 PPXcp,00,0,0 P P @ ? > u\0p@-SP %#L R/@T@L 0R᧡@T @塡TP 噡,@ @㓡p(tc0ldp` kcᄡp@=@aczT 5@@A-@Ti P,,e5S S%) Rz ` _L0Sw 5S0S@`T`OL0s ,0 @L0S,0 $0@S005` 0BSR@ @ D0R\ 5`V `#V`05`V    ,`V`P@,0  @ P@ 50 5$ @T 0   0S00*S,0`cP|00\p ,0/P Ws `S 00 00@SQ /0, \B ^0  }@5#\,0Y! PR ,0<,0 P,0 Ubp(V 505x,0(ZcP;(Zb0@QcP* (Pb@, P 05,0@<,0U0S ,0  bp( 505G@@=|0x x0 ZZp(bp,0<,0+ 0%$0 0%$0 jT p( oT $ $ $R%/@- 0 A-L>Pp`@,0 <5 S; S@T @T V,0``<,0L0S00/S , @  app 00bPa 0 @a mx0x 0p@-@P0S 0`00S᭟p@a(I(F(D(塟0t(1(0A-P (M`@P @Ppp 0 00@徨 P' 00CS(  p0 0 0 S0;1:(Ѝ 00?G0?G "00(Ѝ0 " ! 0 0 h0Q/0S/S/O-Mp`@ <P-TPm +T @`0 0Tj Wp p㙙 㙉 㙙A㙉Iǯ0 0 P  @00Ds \a0DSW0DA0DS70DWUX : PQ S \ P"00 0U00S 0qS 0F0 0 Ѝ0S U0 Ѝ@0` 000XS00 C R @`0 p0 A BRWppBD0R"\04 0Sp@-@PGT00Ppp@-BR"^p@?@P4T00Pp@-LMpP` @000P LЍ`0 LЍC-P!M1M `0p00<0Ȝt! @PU h1 0S 㺜P(1 Ê  aP( sFR P $PwPP 0 0 < 30'ލЍ o9n5G㨀R 0 P PP0SP @P(唊(0n SIPpHtp@-``@@_p@  P@P p`_`p@-M@ ap 0: S  _p  ^Ѝn 0 ЍЍO-P-$@$M @D300P0pS?o2p{$10 0w00v e00`@P T *@E PP` @ 0 G0 Q`p@D P` 0S8 0S~00  pY* 0   W 1V0@JT@@W5ἛpP`0 `FP`0@ @$ %$Ѝ0 !00 000S0@p0哛P ? 0000  00 q0 1`V 0 0SZ` V  0P S`0 ^^px0 @p@-P Ĝ @T @徜T0 0p  O-Q MP  e`pV1 1* @ 7/P 0 T VK:0 0S0 ЍO-RDM4wQ@ 400008P P$ q T0000(0t4` 0@D  $P0( 0 0@ :/PppV*000k000 R`c,@ `0P@P `U :/PQ 0Y` BES*0p P@0PU* E03/P00 S 4 00ZpE$ pp 0  S ^0* 4@ 0 ,@0( $@ 40, S ,@DЍ$4V  W PHP0P@ ZV 0p'Sw0( 0S 40,000",S00<0 00  0( 0,00S$  C00(0  0$ P 0 00C, 0 0 0U00U0#Sv `:/0P @@p`pS:/PX @Y0V0 S0 T 00T0003 0RP00 R0#03Q0S P0S 0P 00C0C 00000 0(00 000R 00y 0SPp 0Z:0 J 3/P4 00 @PJ$ p'PP 0SIW0 `0@  S` ^0* Y`PP @ ꉐP 0TT:/P@P [00P5P10p1 * @:/Pp [:P0@V0XSZ 0T00T 00 03P0RX0 C0T 0T0@D @3000@ U  00?P @IT @00:/P 0TPP@pE ᛉ) :/P p PU@0P00 C0T0 T0@D @3P0@R 0 00P R P0 0C0C0  C0P 0PC0000 C0P0 C000<0, 80 ( S1 $0, ,0$ ^P( 00 M$8 ,"@00 $0,040$0@p@-@ PU 00S  R Q Qpn0P 0  P  pH0H 000S@-@(v0(@ptp@-M @T TPT @TЍp0 Q 0QP ``0` P 0 RЍpA-M@PV`p0S$00;00 `^  k\P- p0 P': 0 Q 0 00CR0 0 U S R 0S$0Ѝ$0 0pP0P 000S@-@(0(@م`tA-p`@PP0 00S (ÅP   (巅0S `nP   v0S(坅0Stp@-M@ 0 !P 0`PPVp@ Ѝp@0 S@`Ѝp8ŸC-p02 MO0Ϡ8P00051E@`la<`Bdd `d@2aCd0SӤ R@PW6!1 0 0 30\ЍTӣd@D0R /S  R5 U*,!-00Q  P 0S0 QPW 0@d 0 @V0pT @d0 @KU*0SP  PR 0C0d0  04U*0 SP  PR ꚟX    $O-M,? (/ 0 0000$ S  )㏂LetaEIrI((H,  ᫚ ᪚Bp( Z 0 @00S %SP 0@zSzxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPOWMlKJeHGFEDCBA@?>=<;:9A*Ce/.-H+A)(1 4Q<Q# ~W: Zn D,4< 0 0 30ЍP @DH `8 ϠL<0#lΠb(@l4 ' 4P @4 0 ^A!/3bc0m1#c[n13:0cPmn1013b.c0 mA #c[ 3nA3:0 c2nASm1@  00CL``C@ @r  ^<04H8 VS gS 0800 200 S 0! Z J 0P Q 0      Q0 S0C 0 B900|P/A!b   孄 Z 0 S  R 0Q  @9 B00|P/A!b   卄 Z 0 S  R  0    V0Q  80 0|P g Zw 0Zr  R l 0@    0_ c0Q  70 0|P < ZL 0 SG  R A0 ( Q7 /00|P bbR    Z, 0Z'  R !0Q  70 0|P  Z 0 S  R 0Q  60 0|P  Z 0 S  R  1|P(0   D& 0 σ Z 0 S  R  1|P0   % 0 嵃 Z 0 S  R  Z 00ZC000Q  `5 0 0|Pᐃ Z 0 S  R  10 |P$ 0( / bbR   o Z 0 Sz  R t 1|P0   l$ 0 U Ze 0 S`  R ZUPUP00S  ZJ 0 SE  R ?UP 0  P   PP0 S0R05% P|P0P00T00X0 0\00`00d0 0p0n#  Z 0 S  R  000 S 0 ՜ Z J 0R Q 0d00!2 C0C0bSӢ Rӣ?d B1|PR  b0  岂 Z 0 S  R  0z0|P 00x10 Z 0 S  R  04    `0|P 0S0000q Z 0 S|  R v Zt 00Zm 0    1`  \ 8 @ h  t (  | H  h X  0S7P `~pq0' ~pq0 0S-0$ 0 0S! -R? S10 Z J  S ` QB,1<0(|P` "`0a!"   ΁ Z V 0S0 0    N f 0    0 l000` 0Sh `P| P Z 0 S QTP0l 00 00 S0 1h Zz J 0Ps Qm00S 1 Zd J 0R] QW# b# # N<04 H8 ϠB!l 98YP YP 0S SXP p@Xp0p@/p@-P@YPp >p@Y Y0@- MP@XP Ѝ0YP 0S0 0ZTD0 0S /p@-P@gXPpsYP [XP VXP p@PX0S S  /0S0/ R R  /0 /! / CR ! / 00/ 00/ 00/0 0/ @-q/ 0SAS/0-O$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1M Ap0 030ߍ(3@ R/ R  0 2y p0S p0%  0 x 0 y  R P Rꌒe|e , O-IM,M@PJ `t$pPlI=$0 0S S  p(I=$$0  2 Iݍ,Ѝ RJ-  RW# D J=000h0)J=0h0 H<0H H0 H H H H H T <0HP RJ- 0SJ=0 H"0 x:J- 0Sj0S/ S UVY J=00p3x2嚏* 0 000H0,06OPg @/0SF0S 0S0/S S 0S0"R" #<J=UV0  J=00p6[) O  < JRP. 0S 4BJ=UV0  p8p6sp2S ScJ͍0 pp p 00SL2Sp S SJ=00[0  QP pJ͍oPpacc\ ј И 0 @O-`$@4M Q@p0DH 00010P0CS+z5('&%$#"! 9QWX000S R  R RQd#3 0 0 30Ѝ30030H 0 D@pЍOqWX 8#0 hw X1: k 0 " WwpPT0S90S D " FwPT QWX00VT3pVT00P 0Sz "0 wT@@? 00!D wP0Tp!0 wiT 1i # QiP|0xP p0X! 0 vP030#?W@D p0W0 0 v?P0#S@DQ Ġ0⼐P0 0pXp@D 0~   vP030#? \  v)_ ^]  ˠ p ʐ x 4 4 h h  G-p!`1FM 00105 P@p- P PV dPV? 0@Sp0 00q( 0 0 0P 0 0 1 30Fߍ Y:wp0SX 0S P 0 0꩏ZYA-@ 0P`pb0  0P p@-MP`P@@P@T 0S  R0S @PPЍpPPЍpp@-@ppPPp0. SAA0Cq .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0Rd!0@- $M0  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\0S S! R- 0S  0S0S0S/R /0S S S S S/@-/ 0  00S S/ /0S//0S 0@- M@PP 0PB@|0S0S 0S Ѝ0/O-PM@"PdEU 0 O <NA-@l Mh!0 S  > S0  0`V " pP Q 0S @ T S   0 SQRp`Vt l0 0 0 30 Ѝ` 0V      ꬌML@-`QM @PpQ Q Ѝ RR d PR'U0S S 0P R  Ѝ  R RD0 P  00 =\ lG-`@p 2PP  @   @!UO--&MM&̍@0 ,D0=<0!\&40H08& 0(( * , 6 &0 \ \ 0$0,00S,l0F0  : 00 PTSpP00 $03/P &< 00&,00 SS 00R0@0Sq  Y0 L0D0UpE\ ZZ7840,'P0> <@X T00`0  Z 0 PEPS@P_00 $0 3/PV @ 0 0S`SSX@0S V2 &<000SVVV !VN VL p!P0S40S L0(@VH0C008D00S \H0 C < 0 0SP< 84P[0`? @T `|pp T1 @0 (|xuRP <0$r 0S S000 P0S< ὃTU LE0S{ R00Q @=l$<0  2 &܍ЍR@00&<000SV  F'VR2!pW: X:40$0L o!PQ0`S`V 0  00(%$50 %?R 40S; (@H0CA00.XRC@V&<00@P#D0 P@%t0SF =R00(0LDQ0 L y ᶊu00.PRC@L0T %P,0@0SPPaRPg@0L0~o4 0 0QP00 $03/P U00@T 0  L_40040[ P/R~o +R (R4 0 0\ QP00 " U P M@P $8 \0R 4  4S P 4S 808@0 wQP8080S 0R $R R $R 0@5 JJL 3p8E< DO-`$4SM @00D10PP pP X8P0$ 0pZ  3  P~00 000 lPy @@PX 0  ZP97@P\#T3 0 D1 30Sߍ00nQ00 Pr 0 .P0P R R. B/o" Sb d!"S:*0Sp 0 00 00DDQ 000 Pʰ0=S 8Q0S5 S+ S* 0Sz 0sdZi0S %Q00Pցԁ @0  PqQ0S00D 0 _000  Q000S000 0 2 30ߍ``|0 S0$00 $00 3pP$  p$>$0 P0,0P@(p\ l5<2 L62 0\0|0 S   S  Q  RQPP  XPZS|0R0Q0S0 P^㄀S` 0  P|Q ,0 0S Q0S %0P40  ᇆP8n 4 0 B   X0P00\XY 40 4<@@@`DPXH 0S0PS  R R  R ! `P0  0 :`~QQ Q`0S0S`;0S^ 01@>pS0 $00|04<@@`DP8~00SX\ t0(S P0S< xpp70*@,: ( $*0 , $0 *40Y? 80< T 0 d342 D62P |0SM0 S F SRCQ Q : \Q^3?oR@@20S Q0P pPp00 8 00040e?0(04W0@S񏐋0S [@TWt pYG Z 010 @``0@`TV !}0P0 w帠 p 0~@@PP@$TMPP}t0S 0S }p t0 0| 0@P$? 0  dP"| R 00S Rxc  P 0 J0P00 N0S PpP,p$`00|@T0 ,p$``P30DL L0Y?P00D( ?| 0T SQ S ^  Q 003 S*0 S:0 SG >@ (`0P0%0tK+0 0[ 00|PP @0T 0@|@0T@{t0. PpPp$`D65 \ d X"\ LH ,. N >…, (?P1x00x0 {$P@0T00T0@{P 0p PO-LM|xa0 `@     PP00N0PD pp R R R0 T@>0Pp ((0( P00 U pWpW 00 pW0S 00SU$@LЍT G-`MP  `8P p @P0 0     02P <0S0- `ЍnP { 0P {@D@MP <@PDJ 0 O-MP @PP }$0S0(Ѝ ~ @-@ RyP t0  @0O-p"|2M 0020) `@1p! 9P PX PPQ P Qp!1 0 2 30`ߍR0@PSX J0@SZp00 01PY 0 0 0 P ZY0 S 0 5 0P0 Y:   X 0S  XS  P 0 %ˀdA-@ 0P`p0 J 0P :0A-L R@.Ġ@@@O-LM0 H`@00QpQQ840 <0V`$ x4 j7M`0`&0 `p.V7 8Nl0p0p'p.0 4Bgz00(&> 1L臇0 0, '?|5Olň0 0 "` (*6 7D,0 0* p,608Jj0 0 !$u 0"F}Op0 0#(p 0* Fc5   +,p!'D+H뼃 p p'0p #)L4gzOL  "+  \H' 0 ,8"0'Flł 0 0#<0 "O< *@p,yJj  !! #ഹD  " D  bOb% 0! 0 0# 0@ @L= " 4, Q^B˃  #0! ધ 㶩Na  ,  " ]/Mb& 0! 00# 0SD@= " D, 㡨M˃  #! ȫӧNa  , , " Bb& 0! 00# 0֧7L= " , դO˃  #(! ZDa  , < " Jb& 0! 00# 0 O= " 8, ٢oF˃  #! *Ha  ,  + BOb& 0*(6q7H0j 0!4 0# "1=F0ʊ 0" 0#  8=O0a 0*0# D:4J0$ 0,0# ? ;D0j 0! 0#0 `;6O0ʊ 0" 0#p< >K0a 0*<0# >8B0$ 0,0# 7:N0j 0! 0# 0M : " ,@ a *,,9 )M ā  #8 " ۦN b.0 !D*<?A0ꪂ0, 0#e64L0a 0"0# 0D)O4    " *Db- ( ৃ㔋Jl˂ 9p !|Opp0i0[eF 0#08p5``  p " l oHb-` `0p,}doOl˂``  p!meH``00(p 0#0OnoF5``  Dp " f,nOb-` ` p,ccJl˂`` S7Oe00  4p " 0b-0052:=K0 000# 0c˂2 :B P0 P0 !0# +N0, 0# `050LЍ3 E7FN, 0(Iv420A /0A-`!Ӂ000@@hPp0"V>0: V0hV@Hp` L0S@@:p`F Ap@-PM0`@ 00 00 |!7R8 bx b   D 80 0 0 30X Ѝp@}$ O- MDDŸ@2@" 0 P00  p4 0R @  0XS @@rQ<0`Ls00ᳰ T $. 0NrQ)T  0 s0aA0C80BS$!1 0 0 30< Ѝ.R ^W* 00R P 0GS0 S S YQ 0@^*0^0 48 <^*0 8<}XH(- MaP ЍPP!@- 0(M S $  ^/o"S R;/o"S R L 0 0 $0 30+(Ѝ@@    0!0( ^ $0R$B R T0  R ( $Q C|  T $A-p4!01rM @`P0X0100^pAtAa0Ob0?2D 0TAXA\AsP" 0 ipP 0@t0P 0` X0 0 1 30 rߍP u00P 00[| X 0-    -- M0 0 ЍЍ/-0 0- M00 Ѝ Ѝ/ p@- M`V@P @x0`0P0000 @X@0@T  Ѝp d T P1! @-`0M0007p P@  r L7p k6@ 0 0 0 30(Ѝ]6P@pW @@T PU 0S0P@>T9@00{  Dp@-@0PJt(0PGt(P,PCt 0p0PP 0P 00 0p`00 cP 00 0p { fP {l   / 0@-@ 0 0} 0  0 0 [ 0 0 00@-P M @0s 00P 0 ->?o02c Ѝ01 00 0 0p@-0@P 0U0 0pp@-@Ps0PPs(0Ps(P,PpO-P0PY `fPR @000 S S0 S S dUpPA 00 pYp: (D@P q0p00S S S@ 0A S  A+ @P 0S 00 00rP  rP@ @ b yX b4 b O- M`p@,0(Sv: (TZ0 T0V 00SR 0 RL@D@T0PG 00SC000@D@D0P0S, T0X  0!0J0@PH 00S#0AX0偰0  40S000   #0S& p0@r0ppr(0pr(p,p@ Ѝ5rP  (,@-(0  Ѝ0 00@- M@P  0s P  Ѝ00 0 $$ 0 rP Ѝ08p 0$ $3 Ѝ0O-LM`U$`@P0 @@PH$ppPD 0 @@ٵP9$PPU 0`Q QB QR Q( 0U 00S} bpP  `0 @0 p R  R/ RY R 0 @U pr 0J[K 0 0 LЍ   @ Q`A@ 0U p ἐ0  ,  W  p0p04` LW G   ` ``@``> @U0@ @qLЍ0@@qLЍ `^ P@Q  QA@ PS ^ QP @  , p 0    S QARQ  R  P P@ @  AX % X X9 p X) T( QX X X0`` `  ` `  `Q@@   P@U `"q t5A4O-`<pPo$093?P@Pp  p:Z7P$p(0,PZP3P#,PWG0-0(` QEU%PPV V* PV'`U$Y3W' 0WO #(`(R 8P P4PE2PE1PES0PEgPE⤻:`uP4;Pw 0 @pW1!030#-05-0%0Y" #(`(R 8P P4PE2PE1PES 0PEiPEr8`uP09P P4 :0 P0 800@-MK2p/ @3p6 P0u0(0 @ D0@H2t 'U 0Px  8P Ѝ0 00p3Ѝ0)2 0 Ѝ0 2 lP'QA-p@D P`ϒP0 A 00 k / @-\(,@\ \  Q:^: A Ͽ|q<Ͽ1 0  0 $O-\MN @P0( W4 : 0rL;;$`r1-lJ^p1C0 10ᖡa0`  ! ^  008` <9P80 @A4ƌ<ŠaЍ /r 0?qs0 12/13?R 0 0@-S@ 3/@o3A-pd Q㹉7I@P-7I @P @D` T<Ͽ6o` p 2/ BLPV%  L`F$"`FPEf&PE B&V% B`F("`FPEb&PEBQ%L`F,`Fw&T`" @D  2/ 0d 2/P HPEV%LF, @ E BL &"A@!@ B BA!" A@%! @'  蹉 Q7I@P' @D` T>6o` 2/ BLP V%L`F, `F PEf&PEL&V%L`F, `F PEb&PELQ%L`F,`Fw&T` T$ T` l (` 12/PT%T . T* TT T @D 2/ P @D 2/  2/PtTr T T T Pi   \ X T h e e 2D 1 !0p@-`P0 000: 0 ## 00Cd.R 0@  0P0: S@CP P pp0 P  00C 0 BPP 00t@ | p oG-P\4\ 00@  p0@C0@ @@`@ 0@@@`v`V @@p` p 0@C0G'@@`@ 0@@@`v`V  `0@C0N.@@.S 0`00@000@ 0@@@E0C2S20/.-,+*)z'&%$n"! jc ZNJ2S2V0/.-,+*)J'&%$E"! D6 *%$000 @ @  @0<@afp''g`<@ap 'g 0000pf@00` T 0@Dd`00 K @0H0 h&0ಐ00@D `  0;` 80@- M@ < PU R 080 00Y`1S   ;`1S0 dz0 0 PL0 0 P9P P vP&0 0 jP0 0 ^P0 0 RP0 0 FP0 0 ;P`1Sy40S{ < Pp0pW  0R 0YpW 0pW  0R| ,0XpWg 0pWb  0R4 00XpWHpWE 0 PS 0 X`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P 0 d0p01 0Y0p01 0N0p01 0Cwx1p0 9ZejL jXtЍ tЍ 0 /0 0  0 0 } 0v0 ox0 h L W P Wl WT , U UX U T < R R RT R( R R R R R Rd RD R$ R Q @-`0 AM@M 0p 0 404007PP0S V@ 80 0 4 30AލЍ.vp < 0,@- M@ p  Pp7`PኾP 0S <0000 Ѝ00S.S 0S Ѝ4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30Aލp(p ڌp@-P@`Q  @Q UPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0`W00 Ѝ Mp@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PV00Ѝp L0@- MP0 @0@0@T U 0 Ѝ0l0 0PU:H@@ Ѝ0840 P0@ Ѝ0  U L\ MxɌ LQp@-`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@ < K 0@- MPa0 @0@=@T U 0 Ѝ0p0 0PpU:L@@ Ѝ0< 80P0@_ Ѝ0 Ę J J L J0@-M@ ) T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP Ѝ0 T6 XQ TP 3^H1P( 0@ T" QTPЍ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP K K\ K` K$ J J| J Jl J4 J J Jt J( I J$ I I I I I I0@- MP~ O@P Ѝ0 0( 0P Ѝ0 A0@- MPdl0 h@0A>@0@T U Ѝ0O,0@ 0Pr Ѝ0 G FMp@-@ML `P 0 Q@0P0<00 0. 0ST @D T000T H0 0 <0 30 @Ѝp@Ѝ/T.0 .n ҄ H O-MP@  Lp H0` R ЍPt SP -Q0 0 +Q0 0 |30  0R00C<,00d0 0.Q 0 @ Tဆ 㘀@(0 0S #3 @  RQ \ 0 0S #3 "#T$&<'(`0&8 &d((0'<0'4` 0(< p 0(4 000S0`p r 0T0 0S#3 @ \RP 0 0S #3 "#T I 0T0 0S#3 @ \RP 0 0S #3 "#T !0 0X 0 0 0J   IA0 0 0 B    ; ѐO-@Q dM0 R P< & @U|gO2 0\0Q]abPAS0N0L0(1(Ho<0^̿n%seqfq}bpA㢢j2%!E@0W0E0P0><H'3" pBn< Hp8dlDΠp@-@PѰ00C0S S u P 0` PȰp5S`u0 0C0SpSr P 0 /S0@-M@T  000哰00 !R !PᑰЍ0@-   0S&0@0Q R    =0H04S 0@R Q R ,@0.Q Pp@-@@P@0P`0pp 0,0p@X0B PD D p@-` P@0pp0,p@, ĸPHA- @@P`p0p0 A dPC-P0 M`p0sp@ H0  D@ <8 K@Ѝ b2 PxC-Pp0 M`p0Ip@ (0  @ Ѝ @2 \P0 00/ P0 00/ ¼P0 0 ˜PXA-pP0 M@P`0p 0 pЍ tP 0 0 Px@- pMP` p0p@ (  @Ѝ1 PC-Px0 M`p0p@ 40  0 ?@Ѝ 1 hP8@- @  M0 4Ѝ PH0H 0p@-@0pP p@1p P$- 4  Z <P0 R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-MP(@,p 00`PC0S P0S7@000 0 ``0A 0ЍX 0S0 S.R 0 R.00 0  .S 0 \ \  0q 0 p@-P0@S`  00C0pT 0 pO-M<@`PP+Y4* 00T/:R- 谟0䠟@  T-  Gp@0 \  P0 P 0 0000Ѝ 80 P HЍ ,| < < +l@-R M @0ASPAA` p00SA0qp0@ ЍD0cP Ѝ Ǻ 00P` ;dO-MMp/.M͍(0=<0 -= 80=004 PH+-4 0 D;000?00=<0 6P 0SP P㯍@08(0A0 P0 0=H0 =,0S`P=-0 P0PhP0C0H;0H;$ B$0d 0,>0%0 $Pp$ 0 MPgZZ 0JS񏐹Cwt<qv5zb7VwN}a,+~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      V0 P^[ 0S .St 0Sq 0Sn00S.Sai0ZD =400S 0D)0C (0 C 0LP5D0 Sy@  0D;pD+0S0h t`〠0`pS_ 0S @0D+@T 0Z4  0d 0 qP<=(<0  2  ݍЍ词8@0(00 UPP 0 0P 0;=D 400SM.d D;0D;t70t0 2P(0 C 0PH 40@ꯍ8@0(00 P D;0B& 4Q06d 0>0 PD; Rx6xv0p0 0#4$0$0 D+0!800C!<Z0 ``Z0CD+ 4 VH 0 PYZz 0PN 0 0,PF5Z00#$ #(#< 0X5 D0N0C0 . q . 0 0CS0ZC00A0 PD;`0DkV:V`0D  PD;$0F _D;d pd0`000 aPD 0d D0 PPD D V-0D+ D+d ~0 <PD+0D;`V spD;`V0D; 0d 00b0  P(00p,P`C 0 P0  P 0 P=400SD -D; D+  D `,0 D;0D;7 X2 0Ed 0 PfP:D ,D;b0D;`d 00 PMD ,D;0D;0d  0 P:D ,d D;0D;P10 0 P'(0 C 05P `D :B PpPPY Ԡ `P/UF0 0tP0PE0GS ᠲ0 gP :h 9 4 e| j 3\ 2 2, 2H 34 3 &< l 2 / 0 / / .L . , , * * *@ )X )` (8 (D (D & ' &T & V % $ $| $P $$ $ $l $ " " "P !T      X  R` d t   =400SD &,D0d `D0Dk@H 0 P `D :B pPWW L `/Z F0 0Px0J 0GW 0 Pjap`D D  D P:W0 0PV+ZD  =400SD;d 0b0`00 0 P=D 0d D 0 P,D;p0D;Sn*b`D;0D;Sf*0d 00 0 P=D 400SJ+d D;0D;T30 0 iP(00p,P`C 0 PH0d 030 0 JP =D400S 0 $0C + V5D U5EB!?C0 SD0 +P=D 400S0$0C D 0 3P D;0B$ PD )=0 P(0 C 0PD; pBqW4`〠 `V D;1 Z2 4 0d  0 Pe(00,p`C 0 oPX0 PP 0 ^PG0 P?D 00CS H& =D400S0l&0C =D400Sh 0&0C D; D+ D  `*: :J :D;0D;0㪠Z0 uPKD |*`D D w*D87( D0`(` 0 XP V5D U5EB!?C0 S:0 EP=PD40  m0 4P =400SD 6*`D D 1*``2 D;0D;h80V 0 Pp0D  'P h D;`0D P0D  0P D+0 D;0P{D 0 Pt D; D X 0Ph(0 C 0vP^=400SD; R-4 R  id 0`00 0 P;D 0d D 0 P*D 0d D 0 PD;D 0SS(0 C 0P 0 oPD D u)D;D p)D H[D k)H 0H[D;0D;刯+=D400S 0d 0;0 0 ?PD`VD%  0Rp`̠ 3 5 G= 0H+0!H S- V 00B- H 0D;D 0S 0 P(0 C 0P 0 PD (D;l0D;`d 0" 0 PnD (D;0D;0d  0 P[D (`D D (pD D (p`d D;0D;=0 b-4 R 0B. -4 R(0 C 0@P)D 0SmCV5U5E!?C0 Sx0 P\=H+00!Hk᭮- 0B-`D  Hk0D 0 fP=H+00 Hk፮- 0B-`D  Hk0D p?00#$ #(#< 0o2 D;0B/ %0/0C  D;0B/ 00D0Z:@H 0 P3Z 0 PD;`DkpW> tt 0 G1;D010R#}a "3,/ 0;D000;D020!20;D00030;D0S10;D0100;D=0;D0 P]Dk`Dk0Sx>00 0D;D+0S0? p〰0pS6 0S `D+`V 0[6 0d 0 P& "3- 0;D000;D020!20;D0000;D=0;D;D;D "3H- 0;D000;D0200;D=0;D;D;D;D- 0;D=0;D;D;D;D;D;D D;0B, C` _pPWW#  `P/UF0 0>P0PE0GW j0 1P0(,0C 4'PD D /'`D D *'P`P2 D;0D;;0N` pPWW  `P/UF0 0P0PE0GW &0 Pz=H+00HkD;0 A`Hk   d D;:0 0 PVD; 0D;S.** `    @D+@p [0 P9 0d `0 P+K`p@ D;S: 0 Pa0)0C r9d 0`0 wP0SJ `y`D;p0`SD;0D;> 0d 000 ZPD 0 OPZD 0S 0 ^P D;0B( )0 5P[ 0Bd( =H+00HKX=H+00)&xD; p0D;0`P7d `0D0 `P 0 mP0 PD %D; 0D;0PPr=H0 *0Si-   B H+0 H; 0>PX0 PPD %fD; `0D;0PPA=H0 0S8-   B H+0 H; 0 P'0 PD %D; 0D;0PP=H0 0S -   B H+0 H; 0P`0 bPD l%D; 0D;0P TP=H0 PP=-0 00C0H; 0H;0:P 0 P0 *Pl0 !P` D  0 'P0 P(0 T`CD;P0D; P 0 PD; R0 P~$d D;0D;t30 0 Pk0H#0C W40 P[0 PS @0 PGТ j D;0B" Wڨ0 P{2` pPD;WWp ` `P/UF0 0ËP0PE0GWM ᷪ0 ~P 0`0DkV:L0 nP s0 bP W D;0Bx! E D;0Bd! ?WT0 HP81d 0|0  :PW 0 /P < , X T  J    0        OD    $     T     t   L 4  8  h  8 < | L 8 ,( h  x0 Pw8 M[WP0 Pg "30;D000;D0 20"20;D0 003 0;D0S10;D00;D000;D0P;DkpW`Dk <0B@! @- MRA T  ,@0 4@(@@0 0404040040) Ѝ?M- (040 1Ѝ03/,A-PSp`@ V@0 X :@@PU "P( 0 @X:DG-0pW-:@`0T0'0 0 0 @T T P0S0 PUT0 $P" P@@}( 0 QA-M{p$0P@S` 0(01$0,0v(`Vj0Sf(0S$P1,  0(0, S,400@"PZ,0,0 RUU,,  4TP(0T0(0 S5P$PQ0(00,0Ѝ0F JP-, (` , \':, 000\, :$( ,00(0 S P$PU0 "ЍЍ 0 ( 0 QA-My`$0P@Sp 0(01$0,0w(pWh0Sd(0S$P1,  0(0, S+<0<00%PV,0,0 RQU,, (0 Q0QQ(0 S4P$PQ0(00,0Ѝ0G P,, (p , \&: ,010\, :!( ,00(0 S P$PU0 "ЍЍi 0 a( 0 QC-W`P@SA &a0 <$Œ.?F(q@p`PUSA &aU 0 <)Œ.?1:Q `@DDD`DQ Q@P 0,Q P 0SQ.C+S^3/ r@@p 0000s0   0 C@ R0 37 #T0Cs0 \     0BS0 ^037# B"  {A-Pp<U00 PW``W@0x00  H.p\p@ ^0070.2000 S037#P00 \00/oo/ o///qX@-DM` @p0 0 < 2 0 RP?00P@0P< ,0 0 <0 30DЍW y`( xO-H MHH0< z - @zJS% B`Q3>hP>"2d'2#g# C ኡj C0*Z8W@THX 0 @ p0 SP$[ R 0s0  0   00 R@ Ѝ 0W oP 0D ePW  0H[PT @ pM0 OPX xXA-`pP\0S. @>T$ 0D0 .R T  S\R C@D .R @0.  0T  S\R  @@`( 0 $0p@- M@P00 80P k$`P;o0 (0 0 8 30ލpV u u(0-@-@R M00  -=PP * Ѝ@Ѝ/ Y% Ѝ@Ѝ/VPRp@- `@'PPRP0 ?p@H@00pPRp@- `@P_P0P0 ?p@)Ө00pp@-@Q `P?PP0 ?p@골00pp@-P@P  p@ p@p@-@P 0P   /0 P   p臨 0 pQP@- 0R R  s 0 m 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  P  T@T @pqP  0 pp@-PP @_P t T 0 P0 08@0-0 X03/P/ @ Y:   `P V 0S ,0S X $0S 0H'XS200C0s V *X0  L= @P4 R 0d80P L0R00SJ hH`ZOpI[PP 0 000S !烱 [s /oU" R WR0`\ Pl&00*X 40SH0 I@H 0SSQڰ\"@UP0S 0 0X0 @C0@0CXS:0` P冐>80HX0C 0X0CS:w 00$0 SXZM4 0 0 PPh0  VHr0PX CR00SWÏX0PXP(0?$0 S S S y0X/*P0 0S-X 40X@S0@F@ X0R+D08 0R*  X0PXP408040000(0<0M4 0 0G PP 0 Q  V@0 000R05Q*X``0P`X`0 CR00PURX0 `PXP0hP$@< 0@%z> Pb<`֒0@X CR00S'X0@X@003/P X 0P(@0 0@0< P 00 0C00000"=ߖ0  0 %X0 4>u 0 P0!410?8!?R;fX(_)X0P L @Ph0 #  VH40SX@0@l0SW@8 `X@3< %T=<@ 001Q *0X@@0X P= $D0@( 0@02<0P  00 B  4d 4 300SA-@`M07 S2p0 0";PP: mP5 80 0P彣P& 0 30P<cU Ѝ 00S S Ѝ0p 0h<Kb< 0  ŸO-` BM0M 00S0. SP p @0uG#"0 *P @T*X<$ ీ P 0 "2 0 4 30xBލЍ 0     ! ):@PH ڕPPC 8 0 0@PAP 000 00000 00@;T7 0p pIP L00S 0  0pW'   0 ᭕ 0  ; 0  ;᝕ 0  ᖕ 00S SዕC ( 'G-Mp0`g@P0P0 0   0 p`ZPhЍ 0 NPP A-M`pPA@P , 0P (   8 @EЍ, 00Ѝp@-RQ M@``8P00SD 0S 0S0/SA S 0S< 0 4 0 0 0@PBP00 ЍpR R ֔/ 0 0 Ѝp0S ˔ 0 0 Ѝp0S00  0 T #,O-DMP t$0h h400<00 (pf9@P  <`@  @:0  `P PP , P ëPP PP0P@ S S $0 S S lZ0P X    @  P0S S S 0R*P =P  0S P@ ( 9 PM  0B @ P0 0R 0 0?@DB Z@  6 I S 1 $ ˌ0  I؏ [!: PKD@์ [i `H `  PEૌA`Y @5 ḏ[ ``):': 0  0H!41 0 <0 30ADЍ P5ߓ0P2     > ` 0`0 099 0 0 @9 0000坓`00@3A` "X~~l p@-MP@` 80 00ɠ `Ѝp@-M@(9$  Ѝ@-MP`@lpP0P0 D0) 8 00 @  ]PkЍ8H0@- MPP@T p00P   T 9 t@ Ѝ0⎩@T00t!t A-`0M   p  @P 0S  0 C RA0,,0 C.SU 0 Ѝ R0 XR  9S SPE U   RV48< @ O-P"P2,M @00$00 P / 0 h"`2 0 $0 30,Ѝ@"42 0 $0 30,ЍOq00:Q  N Qp $0ܑ 0`0 000  ᑁP 0+ Z@[Z$T  0[:p(VG W0G S# 0sVB 0 _P0:[Z V`@:Qp@0S  0Q:@(0.[0$p WPʣ Wp?   p@-@P (M0`  $ 000 0 p  &P*  L @0 0 $0 30(Ѝpّ 0 s? 8 O-tMP # 03 00l00 P / 0 p#h3 0 l0 30tЍH#<3 0 l0 30 tЍO0p@C0 p01T0p \ "NT ` 0r 0S P r v\P  0`S r| v00 X0S  X``000<0ܑj@ 0TC P U[*VT:00= J0  U%P00[0SI@Tp 0V00S 0SV@p:00Tv `V0 S,*: 0 S&* 0CR00:@-KPX X X00/S0 J P Ẍ80S  0 *v00  ~> `  O-p`M\@ P0SM ڃ(ZD U U U  0 `ӃЍ0` Rz  ?0Z' + (`PP 0:/pq 00P @ P 600  0 0 0ᜃЍyp p 0P  * R + L UZ  0ppP 00 0SN   0 00:/pq 00`Q ÿP <`Vο;X0`v R00ᵀ0 l0P :/{q`0 c 00 0`VÿR <`VοpX0PZKS 00 0PS 0<8`ÿL `V0Y" 0006JL`0`f/ `0:/pq@ 00  P @ P 600 0`Y 00 NP)0S&:0C0``܂`ЍPT` 0S  0C`ÿ N`V0Y0 0P LI` ` @0P 500 0 00  ᣂ`គ`ꀏ 0 O-S,MP   0 0`zp$0 0#0 B0S0 Q6 $ R00S 0B PW  5 P  ` p0 0YZ U  000@PP $ 0SRRV  RR00$ SR P D d00Pp \R T| R]  C$ 0P ATq ^g S$0  P05 0SV1 }P, R0# P0@p0PP  R TP P% P, P4 Y  R  tp0Sp,ЍY 6#00\000(W P PP P Sᗁ4 `p@-@0P0FG p 00p0@@@pb0TS^ 0 pp@-@PPeP P 0 03/P Up@op003/P U 0 8p@0/p0 p@ 0/D-M0 3/Ѝ/0@-0@ MPT T T Ѝ0003/P00 Ѝ0 00 3/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 00 3/ Ѝ0 R R R //00/00/ R R R //00/00/0@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0 00@-RP M@ R R Ѝ00P03/P P Ѝ0003/P PP 00@-RP M@ R R Ѝ00P03/P P Ѝ0003/P PP0@-0@ MPT T T Ѝ0003/P 00S00 Ѝ0 00S0003/ Ѝ00@-0@ MPT T T Ѝ0003/P00 Ѝ0 00 3/ Ѝ0R /C-`M@Qp Q) Q PЍ0 03/PP W P:UR X$ ЍC0  0003/P P W*UX Pd200U URPЍ 1 PpHPD&0SPP<2tnt ;A-Pp`@P  R 0 R 0\A/W 0A/0@-PMSp@`  SW- ᇇ P R`V V V Ѝ W` 00 R D0SPV100Ѝ100Ѝ 1 PpHlH(#p@-P@M`T T T Ѝp0 03/P 003/P  Ѝp0 00 03/P 003/Ѝpp@-P@M`T T T Ѝp0 03/P 003/P  Ѝp0 00 03/P 003/Ѝp@-M@P0.S00Ѝ@-M@p@Ѝ R? ..R0) .Q -S.S AL#\0A QS' .S 0 .Q AAQ0B Q AAQ0B QS  \0A Q-R 0//0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 / P$ M 0  0Ѝ/ 0// 40/ ̠ ( 4 0/O-MpPP^ \\4 0 051E0< j *4p3/p O|I~P{lFO-P,MX0 lt@h4`p0 0([X= *xP @dQ  xP @ PQ㕀( xP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] wPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRQ P0/ $ $ 0 ]R& PR " YXuQ   Z J b"r R ZzA @ Rg .RP`@t0@,Ѝ P` 0D0C  [4:e( 0 ,Ѝ^ 0 ,ЍQ   Z  " \ PXY  P0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYy zz0G-` QQP?*p0S* R6 0@0S0 @S# 0V+T   0s0 0ᔐ   r  P 0S00NAT0S@!@A@0V( 0 O-`V MP3P#VP30 U0p\ @ H @R9 R R% (00 ЍW@ Ġ[? A @ GRP@R\ 40S @[A Y*@T*0P 0 A\ R!"ɑ 40S 4 00- M ЍO-S,MP [   0S  0S0@Q|p @Q` |0PjTp000[$@00P00C00 0@T @0S @SW  0rr X*PT p@0T00S 0 Sa*`VY W N YT R0I S P< ̆(00P0S !R* 0G S 0S $0p00 0AT" _@\0Pڧ( 0 ,ЍAT\0S " ! 0SIPD4?<00 R`v``V0 S~000R0 ABQ AAX QS R0SY 0R ?0)4@0 0Q 0 ,Ѝ[ 000H p@-P0 M `00 1000p !@p < 40 0 1 30ލp@3 , A-P `0M @(q0 0 100p 0 p0 (0 0 1 30ލ3 x Q:/R/0S/S:00/@-\@3$* 0^ @R R R ˅( 0 0S0QA^ R! Q 0Q @-A  SAQ  0SLB薅 0 萅( 0 N/G-p@`0TS)  V WT P@0TS P  b 0 \( 0 0QSp@-P@` P@lP`V  0R p/pA-APUQU@A`pPWڀ1AP( 0  0 ? 0 Q" A@- SBR 0@S A 0 ( 0 /-- M ЍЍ/@-M@ "p TЍR/0-S0 \S  R 00O- M@` P P-Yb +Y0Yc T @Q f2`paMP\2`pMP" [)SQ" K0Iq P0aIQW0IAIQ70IT| V[SQ4+NI0S \0J00 Ѝ 00YXP 0@ \@ AL\T@B@0R"\00 0hp@-@PT00Pp p@-BR"^p@U@PT00PpA-p 0rM @P`0^010X0pA00tA0O00 TA XA\AP@P 04 @ $00 1 30rߍa1 p0-   , -- M0 0 ЍЍ/-0 0- M00 Ѝ Ѝ/ O-QPM@d 0p0S000!R !5  tPP E``#Q<0\*Q30A !!!! ) P6 0 |0U A pQ6BP 0@pQ 00S  Ѝ50T @00Ѝ*0 0A-@P`p-v0 P.v0 0} |XX0 0p@-00Sl@@@p\P\\P@P'@P   Tt  p@-P@ڂ p@A-Pp`0t@t@0h@ U  )<0 r)  A x6O0KH@-@(P0S 3/000S@輂 A-P p@` F  g000 0(@P p@-@PPpp@!1p@- BMa@0PD`040  D %0PS p10S ` 0T! c P ?OQ1AR00Ӈ@@TJ00"R ˜ 0$    R    Rv09n1T90_$0CTu00P00şSXc0  9v+q> p 1vpVX~c0  'v+ao> ` v`[?pGE$` @DP m1T8?O0  cQ R@ 0@ VY@$I"I BqgqgpCc0 u+ >  ur?D 0Cp4I2I( ?B1c@ 1c0X0B03 1I!@ 50.c((H@" <2c S/  0@ 0< d0 u0j > u0m\4-`vc0 & u > u``| :AP@??s c0(q u > puppQ\@ 000T@ @D 0 S@@ 0 @ 0$ Ѝvc0 ) _u >  Yuj<00P<,4P<00PPyT 0 0@- MlP@0P0NP T0S VQ PV %> 06 ?@0R R":[bhv 0cPD F>Y02V pMPp@PpGTJ 08 S Q P P00 V0=B0CQ 0C9p6V FRll00U"R*P;4Ѝ"R 0S*0Zj( *0P;M@PP00C RbUb֬`㸠 ` PPU z @6S%V\G;hPJ? 0h6 0 00T0ʀY} urP0Y`s6S SP'0 @S=0h! /O0 BS s\ 6S2Ek֌JOOnȀ @D}\(0X( "  Q L0SZ\0!1 R0 0 1000&`0R6SBGkFLh@n P 0P& R0 0S+00S(0SH $ p 1P0@  `m0{=02?00cSd85O-@0MP<S S 0S 0 C+0C RS`@VЍ0-S +S `>P p WY 0hS01Ӄ!10 "0Dm0[Kh( !   Y <Y Y 0 I+I RY @Y     R R,R;RQ` .Bd R0S ;R,R R`0\00-l \ 02Ph0c @0lF JF20PhX0c\ @0t c9h&d v bx& l&p&|00+0 @ 0V\hPl@P P l @E0@S>0S; >S``F3`{P</`uP`00c`03&V9` h t b@@h& ᾐἐlpx|倖创 ptlЍH@P  0t X00 !   R R >R B100h0 0 P 0,S|0,0P 0S`)L 0 7  $d0@ (400 8b O({̠ b   ))`Lht0@Ovv0`x0pl6p6 |&*(w;X  W pG0b^ 1:4bZ1 !/ `  cR ( 0``p )Px (,"@ 8@@@@Lu@@ 04`00 @ `S0t"0bS01:0bS010! `0 ` cR c sS  R  10@04`8@j0=1@00)<2LP0P8 5@T0(<2@X0<1@40 7 0@\008@(D@Hp @<`(E  YHc ^,  \cHc[.  ࠳^E(R/ ! !c 0 @?0 cRU0pWP$  j ,`e00 %7#X cR405:\ cR4 000!V  @R -R 0 +Rd 0PV  V☾ d 0Pd  bd  `0`p( 0S8<`@D@0L g>f΂0 08<`@D@000GS1ð1r^0s1#00'8&p@-@@b0S p@[ PP H@@P p0 h0@$T@0 0 0  q@d @ @| O-@Q MP 0SD H@`P` 0 |000STI0SC `V @qVLg@_p``PV`VF|pp h B@@Xm 0SnP`[00 Ѝ)0t0 0l1h6l6p60h&Z0; Ѝ0:S P ]q00$A-`PQP pa mP@@WXnPqpQU? qPPTS xQ9 h1h!0P d  0U00]ha PoOP`F U0P0\  RP ePE?1  PE0?P0S0  1 @ PP0  l 0 W@ࣥXH,U00#Ѭp@ =p <4@-\F<l0 ƒhF 0R  SPp 0 \ F<h0 ƒ 0R Sp/@-p 0 @-@@B@ ;@-fd@8H@-$@@[d.@ :p@-P B@P PPp@qpP0 =p@-PH@@<6d 0 F?,Pp :4p@-PL@`@<d00  Pp 9 lp@-M\`P@`* 0@P 0S V=<;:9q7m3k10/.,+r)('%l#"j QnMLKyi SxuMJ{S VVX0V 0   0Q񏐧 2"00C Q0 B$SiPf u0Sp0V `1!PLp  u0S0V `1!P<p  u0S~0V `1!P,@@p@pz2 p0u0Sq0V `1!P{!  u0S p 0V `1!P{ pY u0SU0V `1!Pf us0S?0V `1!Ppp pz0*S4 0 C @ R00 C R 00B S0** 0B Q0J$R1 uD0SV0`1 !P 5 u50S0V `1!Pu(0S0V `1!P * u0S0V `1!Pu 0S0V `1!Px  s u0SD0V `1!Pg > u0S0V `1!PX p <Ѝ 7 u0S p 0V `1!P:u0SJ0V `1!P- pn  u0SG0V `1!P  u0S p 0V `1!P u0S0V `1!P p] p p0 VO*0P~ <Ѝ@@@@ Xp5b Qpz[ JpT CpM <pF 5p? .p8z R  0! 0p+ @0 V  `1 !0P '   p u0Sk0V `1!P\ C u0S p 0V `1!PGu0SB0V `1!P:$Rz0k  P   pu0SO0V `1!P)@J u0S p 0V `1!P p p puq0S p 0V `1!P qp{ jpt  uL0S \pg 0V `1!Pu90S IpT 0V `1!P 00B S- @0## 0B Q00C$R u0S (p3 V @s  R  0 0p"  V@`1x$R @0O-oM M@X |/H0x? P006000P!R !0{0 0\0c 0S`   Re ?Xp䐍0@0d0>00h0g6@f6Fl00㔐$00`D0TPU @%U PU 0T  `J 0 R 00S0U`h0S @0S @ 0@0S0000PP -= 0 6 30f oލ Ѝ VP    R0s Pb?RNo`1R`OV`.LQPQTQdHQ0@FX /΍PL,\Dt0@ˠ8DFPPPUPPP0@0@00 0T0p` @z0%1 0 0GZS񏐧GY`bdqHGFEDCBA@idN\~}|{wyxwvutrpopmlkjihgfId/p<*[YUkTQPO.M*0 GP 0p%%0 G R$Wx P T000PU`~` <$0 A   SF 1P@q-0z0XP$  000(0PUXPPR@@Tz{P(@L@,@8@4@W qb@`z(@PL,84%1 S0@R00<0S00000`BV}Q 00QzS0%Q 00QI0$S00 R ( PEU \( p00  R1S>  }SPPP~0_ 0@BT'S<0000J040X0$ S@H01 0 0 H040S00|0 7R10PP @0P0CD0  0P@0 |0$@S-0z00s80 p p [P 0 p (0@ $00p0  <$0 (} Z1 Qv $ ( X@z@S00G00R``V@G$0p@CW`bo$0H $@@10(@s0s0H 1pzC+0pz0p` 0p*WE 0 G R~p((0 G Rxp`tpkq00$0p@/^ bo#[W H0$0H0P0 p $@O(p`R <$0 ( Z Q $ (  P@$ U0$0H @100(0 <0H Xx :%! z@nS0(boPT {dpd`0F(0dSU z@@L , 8 4 p `$ 0  S 1$   / ^z0pS 0z0 g  x eh $ߜ  P H 0 $ $0`0(00`SH0$ pqH0W(0$0& X) R0P( 0CS0(0(@zcpkPP00{00 T0{0SRN 0SK plp P0 G R00##0 A R$Q  R$H 0!$00" 0H  0Sx0c 0p`r100(0$ <0@  Z Q  !    R%q $@D20(00p{00T0F4 RR R*@ D ( `B8 V`V ژ 0p `R0 S08PVPEUT8 Qp   V \0 bo R `  0S0(  BRPPUژ 0p PR0H SH0X*XgS`pPP HX0Q P0 S_HX R L$0 0   @BTTڔT`pP@DT 0RP0 S:@DT%Q0 @0 S  P000P<00 `BV{Vp% 0P p@ P@`FV 0R0 S`FV0Pp@&\0`  0 HS0C O000P0Uxf 0@`` p@` PEU0\0SPEU0@ p'Q0P  0 S0O000PX0 O000P X Qbo\` DP00pA0 S D HXQ`00JS  GO000P F0Vڠ( pP t@P@`FV 0R0 S`FVpP t@,^0`0zN O000P 0 N000P 0 N000P0 N0P2 N0P=8 Q0 0rSW` J?000 0   H kP=Q0p0VSD` J?0 0  00 R+    SQ0    \ 00  R  S0PUn@ D ( Q  mN000Pm D0p0C0D  HXXP`dp  HX{0\p0SF @00NSc `Wzʘ|pP0@0LPB8P+3Sz0j{\0P, p R R bo( dp0! , 00g 0PmR o N 0Pn M000P0 @?  QH $ pH p\@9:X (0S $$  (0pT@ :P (0S $$ (0p{L,P \ R .8 L4 { `h0 p@, pRXQ XHJ, 0 B0, Q0   S0  M0P( PBUPU ژ0pPQ0;U@A@TTڔP  @DT0Q0S@D T4 ^0@0 =M000 P=0S0  ,M0P,S0udY(bodp1>0@ 00@g0TPP0  GpCfUo 0@`` p@` PEU0\0S L000P0 L000P 0o8 (10R0bB+ S- C S)!ھl@ @ cS#/N!b2n00  A A@A00\s00BJ/ 0\0@0`0`0Xz0(0x(0P@p0LP(0O,P8P L0P(Q $" 6(Q $" ,SH$01HS`-0z0͵X$ 00 0(0QH $ H P l P  e IL0PIz0@ p,Q0P  0 S0}00/(0@pOT0PL0,0400 o  (Q2 $($ Ϡ   S $Ϡ  H  QH $ H Ϡ  Z| (Q $($  Ϡ  7  S- $Z(0T{$0p`We@{pzT0S 8  B0S0S S8 0( L0T,(0(0P@p4POzpu0 (0{0 \p,00( `$ P\@bo080{?<0T0(8<8`` 0 WZpH000H 0S T  S  R^ 0 WP0@Ѓ(8`P eK 0PeH< p{0,00,bop(T dp FK 0PF p RP  0p@0  @00^S]P0 (\ $@($ @1(\ $@($  @$Q $tS $XH0ϠH0 TnY 0  0UY 0  0TH$  H(H$  Hp(H$ H(H$ Hp( %I 0P%Pn@d SH0$$ H000 0`0j ˔pȤ  ݨH0($ H0p0H0($  H0p0H$  HϠ(H$ HϠ(0L0,0@APY 0  00@00p0 G RFP%%0 A R$Q R, p(  SH0$$ H000 R p$PR$H  $$H   X0p6 0 X00~p, RH0H0 P$ P `(A-`@P@pK0P0 PK 3A-@P`pK0 PKO- M[T0p/ zPgo_D  ЍO 1[D a `Y: 0D @0S C BEX0S  U #R   CU&b # 3S RUY *CUR"W , W@p@G0pS.@GZpU00 E000DT ЍY:`?C0C01 0 ЍO'1 0Sp 0e@ SRA멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 0̈́`wO-@TM4 , 0{VSx0$0 @P<00PV`QųP0000?G04  @ \  R0Sk R000 HL'@P %H* 0A@0\ %A&0;B;+p A A{ Z`HX@A!301 ;Z[0H000(0X0a(0(0 Z0C(00h406`P LP0SQ p0,0Dp@0S(0C^HPP6PeP0P0 ( R00[00S R0 0PEK B( 4Q 0S 90P0 P  @:P X0 0Z0R00S{  0`S`(0P0(0U,[300SWe0S1 (0SX0FP04`00 0`00@0 , p 0 PK 0XS0( ( Q Z! 0@S0QrW0 , 00 SPb  @P [   `P P ?҇coCa?DPy?Ɗ(`ȳ /j<``TЍ00010 UP0070\ \ $TЍOZL C>0 SA΁@0c 0c7,33A:0@0g  !&L[0000(0X Z040ZJ0PPC0J_oѥRS 0S00[000(000,0 0D0pW`P 0SZ00WPPU0 Q1  01!"C 1 +0 0+R 0 Qa  0 R  &J W:+B8# %AI 2;B0P{S201;S: p00s a K qK ; R5 `a{+: p 000nJ+t 0U00,pWDpDp,Ն00{00 +:+A+8# %A+1;B p a MJLP 0R?0S0S>0(P0H 0000QQ`4`p 0S WS XQ Q S`4`@P 0P9X ,01 0 $ TЍO2dbP 000$00 0Q PTЍ T5 b0B"1++`b  500Q ` Pb  $4#@PP 0 0Z0R00S01 `H6W01, 00Ӣ? W a p0P00100 0S U 0 d@PB+0 [P9P +@P3  00S0S0ESp0S7 S 9@P vP) U0EV3  s9RP  0J0W   [P 0S,0P000@ b% Q  ; P `{:+ p@ 00ss0+;q +r ZP@0U0S x 0Q0P0T9p 01P ; ` { + B :N pN@ 0CB:N:00s00M R Z RE R p a <*9  EVj 0r9SP 00. pPx `PPq    !LPeRE{ P0 0C0J@PR 0SD0Sp0J0Dp Dp?W" DQ1;0:0C ` ++A+8# %@ W 1X+0`S4`3 9R0p9  0000000UW3X-Q0PP~ 0S0S0S z0?G0SP0Xp } 0Sy0S0S r0P s0R 00000001000_ 0P0 D0SpX0J0DpTwp4`9R`4` W<`37P/0#S00/\S00//P@-@00@ R P@Rp@-@`0P0PR* 0PpP R 0 R VpP0 @!0O-MPS]PE@1a0p0 0]O V`&:0 @@F0 0[ W00 *0 @0 S 00CX:XPE* R P  ~P` 000PW 0*!1R 0CX:XPE* R PЍP0.- UM,@00L102K 00 00 00lL 0    CC hP@-d@-t@-Qp@-P 0@` R  @P  J00pQ ``0`p@-`MP@P  Jp-M ЍpFF|~pqm1hpqpq1`p- M ЍP/> 3D-@"M @Ϡ#90c 0 Ѝ0 00/ -M 0  ;p`Ѝ -- M0 0R ЍЍ/ p@-0@Q r P p0 S!P00pl PP    !QJ @0O-M` p  AQ P*5[$ 80Sw SP  @P Rs Q)Q0<0   dQ" $W `W `h Ѝ @ZTQBQB @Q A [<0 P   K <0`0 <0 QEW  `V0BoSQ?  `b <0V :T P a PP- @ 2 j P! P   T @@\   2  ^ 0  0@l{` P 0Q/ R  B /A-`0@bSP)p`B @@AT  D0 BT   3`UP0 pg3wp1@V * CQ B   AP M PPO-` -@|M 0?0 0=L0 l`d 00p $P -R-+*)('&%$ ~ 1&000R 00B S0080bp@ '#T0pCڜ!"T0Bl@ 00B S0\A , EPJ0 0 l`0l00+SJ -S(0(00l000C P0Sll00S 1CP*0Cl0l0000C ^ l<,00C ^0L0@P<Ŏ(P<`<0dS0` d|Ѝ l0X<XU 0 ,d 0< 0S B(  S ?o2@0zTg @X`` X У T<  +0g 1S B0Z 05SX(0S (0S_( %0hS(0`Ht`00XS PlP 0R RGQl000Sd00d0R  p~ YiS IS NS(l@^ P l 0000d00(S 0p 00nS 0p l`d0 I:țd0P 0d00Sh 00C0S p~ Pp  t00C t0 0/ - + L) ' 0 t0Rp *0 00S S S, p  000 p @ BAR d *0    N00  0 b3"  0Sd 80S 00P0d0N"00p X^   Y B^Tl0 0C P, Pl 0l000C P(t`H`VR  T81J01 `0Z`Jh  Pp9 h t BY`t` t` h`t` 0 AH0S0Q00FY  pRh r-0h000800 St  H00Sp00H000$0 00(0<, S?<0 B $ ˰LL@ PP    !Fp0`P p0   !Fhpt G @P Z p0$0<0 < C0G$pP pG0CppW00Z 0SpGHJ$0S GQ&(0SXZ  @P  pP 0S0S  @0PSXn 0 S #) Z H00 S0d0 pX\0XY HR [Xl0,P0J0h 0#tR00S 0D0I `\% PL \Q[pB 0 p} Pp; 0S A ^1H00 S^hAh YIh t0D0, CoR㪢Z K x!)I +Zɋ/0SK xvtr `PT l`< `f  31J01 0Z` V&"2HC0 0?CZj0CA` 0 Q01J`1Z Z:R?C0C`46 1J,2a 00 S  Qa v000l0 R8 P00V&"G1HC0 0?CZ0CA 0 Q01J`1Z Zj4oF6R`F`D 1J,1a 00 S  0S l l00S 1CPwl0C0,0P 0 㓧'l@Pm l00Cl0 Pl00l000000p d0$p ) Pp? h0 0h0,<V 0hs 1J0<0@ ,  B 1 d000 У` PtP N QZ# 0,P0J kPp A ^0S h 0h0Q00L@P 0P,0 N,0`.<=PP X0PP+pPp H00CH0t00Ct00 .p00 Z 00P0Z{@0S相 zI8 S ˋBamUPRd00Q00d0q @0AprPp t0h0Ct00IN00p0  0d0K"0p 000000p@!0d0 0, P0J0(000@000c@0 ? ;[R0l 000p0Pd0p Sl`0`H0p0H00t,0tH,00"@0J 0d000P XH PpH00Ct0 0h0Pp&TTTT0S,5\ <kt0 y000 0 0P0d0T A0[( t0t100p &t `00 `0P 1J5S 0@0(!  d  ` У` qP 0[ ,0P 0,00 bP :相[,0R0,00   IXSS0 R!X 0ӓ!& d1d 1J @0(00hA1!  0 ` ` У` (PK 00C.P 005 `S0!0d0u 0AZ a 0S| h0p |sP0j0 00 0C  h t0!0d0UZ@[!0d0L0H 0R0EpP BP? t0p0Cht00d0Pp3 0S\@  000p d0Sz Lp000000t0P0d0`0d0 [ 0!0d0 0 0#R00Sp0 Z^ a0d0 3S 0d0H00 dSp0! d  R0S80080GPp  h1hPh00h0!0d0 t0p0Cht0 @-00 0G-R``pp@PP P0P`q Wr"(z*(00A#80A#8 G BW`E   3aVFA Xr0"(0@#80@#8S 0U 1 PP e`P    !JB@P@3ßO-0M@p 00S 2  10 `C`0  000Sl  0Sg SB0S00XS 0QZ P@  Q R^T#3\QcTPQ0 ^  \<0QR- U00\0S{Wc* G0V*0F@S3 F\   H0 RVOWM 06S ЍЍT@DPD@ Q09 Q0Q l l> Q:00XS Q0L)ARo^& 0 0 S 0c1# 00Ѝ QN0O0l 1 c0R:v00Q )Q 0 tO-MH<0@ 8P00S  0 0P//O B0@0P 0SQ^p`0G PP`0 `0Q DS ^_ 0[ 0S S SL 0`Pb@0@00 00Vp@ !GT Pe q 0@SU0P000`\S S 0p \Pe R`  BaPPd S@0D0CSڣ0SP] 0 0Z 0 RWf* 0TDX @N S0T0@ T 0 BB! Bd0PDP{p00S 0S`CU 0S S S GP@"00ЍRr  BaPP@+P{ -P  @\ ࠃ5@ L^ p>,L pLW[``@ЍPM 0V@0Q 0pS00t LS S80S %000 b@00 0SG"00@@ pP D  p212 Qp `o\ `\  ^ B `@W 0 0Si Sj S @00`ЍqG PePi z0`0Sa G@"00Ѝ@p @QC@E xPK 0`Fp 0W@FpT  p 2@ PE1 4@pB0`80Sg80S 000eUU E P 80S800c8080S pT0+  RP!@L80S J80SF  @`V~ \w j 00pdp@^  BR"@["P1 5"@!@S) Pp%# | P /A-9C@ R<ϠP`pl3 ^P W0@00 pU @@PEPU 0 BP @` pT  p0 BP0U@0@-M@PY U 0 B0C2S   @ JB@ Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ E0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/s'(sx&sT&A-@T!`Q1! !0U l2,p(  U2,0DRA!1! 0R 00000U U0D1 CSB100@-@MS: Q @  R Q y@ЍA-P q 1p0S2 U`e@T`* 0S00 000AT !0S 0x`e0!@ 0D1S  000S 0 t%@ p@-@P00p R pPQ`00App@D `80 0QApp@ t$@$0  0#10/sQ#8sQ#4#2#10 0// /A-`P@  100#@Up0p 0S1pP@PApP    !&=` (0(R8421S/ /@-@P0@0O-M0[pp  @S0P0= PaU*0 F B  C0 X0 *0Ip0CY0003 0[P^   p0>00 Y 0[ PT@T 06S 0@ЍG-0䁟@p9$A QPiV= @ PU ` 0P+ p@d10S~PP< 0S (11PU 0C  pPp00Sk`P 0q0i000S x0wd0riV0S 80pf (0R0i !t@k`G-P`塢0`@Tڃ0T*P# Zp !pC0 i )  P2.R0@0C`0P003 `PpG P `F-0P1 0^$23\ *G-P@p0@DTH1  0\G*32P =:P  @a P@0 0S 0SQ 0 Ap BQ 3 3 V  0 0S03#V FS B  02NS @0@PpP 0!A-`@ApDPG P 0`0V @*P 0D `V1<P 5%&1 10;BP%0&;BV `5C5.#110;BC C-` MXPC@P XzX0W6Y0 W 0 C.G B 50c 0 Ѝ 0P c   2# R WC>C0C01` Ѝ0S0/0 R /@-?@aPM`?@pPP2 EpP,0 S Q3 ᮫p 0: S:XP 0uPP@0 $0,00 ( 0 0ЍAO00Ѝ\PA 0 ЍA 0 ,;p@-@400C0S0 P4pP  B R /@-0rSL wS aS@ A 0 @0S e C+Sr0. SR# 0S0S0S0S0@S@0p@-S4 @p4P00 P! !& 0S 3/PP೼000P @ P 00 `00aaU4?`` 0pt1P,AP 0000@-@!R !P 0C 0 0 S /1p@-@Q1P00S3 0  GM 4000S9 0"$0 3/0:s00P.p00P @ P 00< R 800pV0P1hD,N1P00s0u2p 0@0  0p@0 @0 0p th-Ѝ/@-A@QS S S @ 0 6@@0@06@@0@_6@@0@J000 0 0000/4\SA-@M}0C`po$!RᢏP$   (PH ^^(1\{ ₀ R (Q\  0 0P Ѝ谀X (Qu 0⃀\` P 0u ^S0S ?^0CP ` A`(Q$! 0$1$( X  R$!$(1(Qs 0( ^\:0 W P?p,Ѝ \  0R(1刀$1(Q $q0 jP( P@- 0At @?C-P M ! a5`0@`02/A/0@0 Tp^ APMOĀmp[@Q 0pcPM`Q 0pcPBQ 0pcP8 Q 0pcP.Q 0pcP$Q 0pcPQ 0pcP@Q 0pcP T Ѝ Ѝ0?O-?p,q\Qp@-P P4ATp ~ @P 41S hP0p@ ?@A-4!@e `P31S L6P@/4!R =0P0V0SQ MPPP Qp V>`>`>``@-@P 0@@A-@`*P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V L>PBH>0PO-,M  R0 1 p3/,0 (Q0 P `@P0S$Pp LZ@ P@UXX 0 w`P] @\0( PUJ[d`pp,Ѝ 0 gPPu@ $`hPZ $ 0 N`P4 @\0 0  0P^ ^A ^  倠Q PಐU`I`@(  aP0 cP @,Ѝ0  ppgP ,Ѝ0 c@P00,Ѝ$`  `P(@HT 1SX(Q $0(1$ն`o0@-@ 0! \ @[=,U=00,1S@-@0 @F=00,1R@-@1  0@3=,-= ,!G-0―SM ; Ppw`@PK WQ    =0S 0 p=PB<ލ ^P| 0 p pt 0 Xf 0Sc A/ 1p APWPae`@UR@ZN<ğ  ! 2/@PF(PP 0 a0D!NB<ḑ !X QW0Q$q$p4qfPP lsl3l`hdß ` @ TCp`` `pލO婤}0|< kx<Q~bs< R bP 8P  4D0 1<@  <X~ Pp`V4`P P3Z@ Z Z@c4`8P3]5 D PH 0 $&aP&E:PB,P<0(8?Y5]PP\ <@8a4P  8P D0 1;@ ;TPP ;P00 PU P;PP;p_;HP;; QHd\t\O-@(`10p1SPp1f( Rؑ"P+ ( `,0VaD aD S 1"1 Obꂡ KP ر   J1; ؑ@-@ 13/, (Q0@-@Q J*00 2X; 0 O-SMfp `+ @Y ;00ЍSS 3;@00Ѝ [^@ T 0S05  @5 0 PPa   0$A!10P@. 0PSD0 285W00$50 050 0500 5005000 S S :00P p @Ѝ[ʓ 20 2 00npp 0 0Y 2Z 00 20120IؑS~ 1 S 0 7 I7w? @r R 0 n(P0 "m  (P 1Sk0Sh1Se(z:00w:0Ss:` }(P  w(`P pW!0 10! 0p : ;) 7)0 29 20 29 20S 28 2 Rs <2@SYL0ppb 20 2m 000z감 Y3Y#g1 10%(0 ( P3P;0b "@S  "@  0 "S$ S(S< 00 S( \$,0 $( ,0\\P!PP "#Q%QQ&'R)RR,*+ S$- S(S<. /0 9O00Pp0 d0@0S  Z$0p, 0BRs0 0010C0SbP P0U\P 0ooob10C0S  Y 0X0  P0  P P0 R`,C Z~ aY* p 1V0C00C\8ap VS 0F 1 PP  <mP7 P x  PP 0R` i PP1 |0ⴀC 1pW0:1 0P10 C P1I PaU[0%0700[H0 0  `*  P,PA 0R Z qY  WR q0Y 0G 1vPP B1[pKr 0ⴀC 1   `PP p 각w1H ⨀Hx洀! 刀 pG10 BPP-M0  0P ЍQRO-KMMP " $ $wpW @RQII T/ P /00/p00<"42 0 4 30KލЍ b` 0[XSl> X000 I0;r00& Z#Z! J0/S  0٘ 00P0: S j/ p00 R I R_/?004 <0 0U" -bp#L/0SY 0`C0 S00R0F V  WP4/000S ᗘp pᓘP /ppGorq ` R Q0P:Q0Q:'@- 54@-@@ $ @ 5 p@-@P#i+P$  p@H0@-$M@0 @0[S 0P000 00 0 p 0S$Ѝ0$Ѝ0XP 00<p 0S 0    [0TH 3O-\M3adFTxF @0p`P $4@ (0@D LPk@eG$@ y,0-C8p<` HP     `Ƞ ! P% @$a .eXdHp`  "0#lʠ b*c:n! P% @$ ae\dL` p`p ``p.p, "  P%0#, @$  <dH ,eX `lȠ ` 0#  pc:. "n , al̠ " P% ` b* @$e\p p` 0#` dLp` .` `! "\<,r ( ,00 48 p<`@DHP$@LP T y"00-"C p$`(,0P4@8F000  k0e4G0 0\ЍA-@p 0XMP `00T00  00   "&@  0 (0 0 T0 30XЍ p O-\1XMT!0@p  8`P fj   000 0p. R+ X   h @  0 01 < 40 0 0 30ЍY tp@-MA@D0S |QP@P PUFЍpʿD0S8!88 PC JP=0D0೿g `d #E)`^  0   p@  #p YTp @⌿ PU DЍpB~Y - ,ht ,p +@-M @( 0T ЍaЍ +@<" Q82 O-M0P0|00n @ 0Tj !1 0 |0 30mЍY` @ 0TR @K@ p@ D U0 1PEX?%1Z  @@ 00 0S000Z 0YX; E V   ^0(1 0C00110C0S 0C s00R0!01 B C0R{0岱ᴱ  B0r P 0 01X C2 {沱0റ 0 h     00j 0 (P 0 0 0\  00S 2"KSp00S   ( , #DЍ0BP0 *s0 C0 @ ! !`p(       500 p00!BTG- `P#@PH `V4 2 R 0 ` Q0= R  &  PB 1` 0C00C 0N P#0 0Rp  pW 0 10C0R p W`0 R  `p`0Q ` HP ` `C-P@$M`pQ 00 WW 0GS ( S񏐟|TxQ0GS&00$Ѝ( @  0 Ap\ 0S  00x PK W W W(0XW p  ^W  P/ H⨀Hx弁KW& WD,0p110C RB0q s0x 01p崀ἑ- P ,0p1! B RN 0 Op0  }P ⼁pP T0 00(0rτ⸁ 0p0 (0P=`P 2 00N  I0SB 0S? 0 X:弁3WZ r긁0(0弁(010Cx0X`W, p  W  P{HxM꼁, 1 Pi 0WS>q W0G ,p弁 1| PO X10C0xX X0H1 0ⴀCሀ !1 Z P, p p 0Cs 0 각 0H㨀Hx0 !1崀 p2 Pp@-@`PP {0 00(0`0Q0(0pO-Mp@,0 01 P> A@D@T. `@s` @T P @DuPP+ 0P 000 10P@ 0V PFuP 0d0P 00Ѝ 2 VQ 10C0S  00`Ѝ Q "P P  ᴑ@P 뼑0 S 000뼑0@ S` 0I 1 P 0YAAS !0s0 0B!GQ  2 00\Q` P` 1@ 0C 00C1PPN La0 S000 F@VTe :a 0R? P0F 1P_0P1 010PC1 0PV @T0*  ?`J D `8  Au1@D @`@Dt@@! @ PE10` OP1U @D0PEt@ @C1R000/ @-@P H  0( @ 0z# O-MpP`(@T"$@   \ ?p2D p 0 pP`@   Q %f#"," ! % d!0  "d!x1 0p`0 094NP@ ` 0 @^ l!!   Š!`,)! !, $ⶠ0b+b+ !P 0 0  @ 0P0@ 0 P0`0 `Ѝ`|A-@PP $(`p~8 "0(0 0`0$0d0H 0EL \ h " 08R(@R )@ b")8 ")8 b"$0A-~a@Pp @f(XO @$0刁@pG 0(0$ 0p, ?WE@`G(?`@``@0@ 0 T  "<$00T 0?pW (qM"p$p0 0?W@`G?`@``"@@<$00T 04$0 q0$00 0`R @-/ M@-@P L Ό 0( @ 0" 0R @-p/ )p@-@P X00m]`\  0P !  p \6O-\M(@p0@H`,@] < @0@(@4@,@8@L$P@<@ 40P0@` 0` $@800(00`` ,0 0 @@$0.wP80 0PT  0.9 7p!,',)7 );40#p p 0 ", !0&$!( p '$ 0 &q+0 "0|s   " 0!$p$,p##p) p' p 000 040p(S, 03<0@<H090@4N`@0:>I D0 0(H0$P,P   0H00=<;:9876543210/7P 7P 7P$X0Ġ 00iP13P{ 3P 0#0 0rp dЍ@ 0  +0#0 0Wp P* 0 # 0# ,0#i@0Ġ 00P 0# 0#0t0h0~\0 H྇ F0# E0# D0# C0# B0# 0#h3Pn0 00 430p[ <0#g G0#b0 00 4p^ 0/: *0#F )0#A (0#< &0#0f 0#. %0#)0R 048 0 0# 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0#0P4 0# 0#0P  0#00040 0# 0# 0#x0|l0xd 0#H0n<0jh8(8Th@lLG- M`p@  0000 0VJ QP0S PPL W`A 0S7 P= Tp8 X 0S: P8 @V ,! 0SP010PW 0010 T 0@@0 ຯ 㢰 Ѝ WPTU U @ U U \00YY @ @ d4 ` H ,  p@-0@T 03/@TcPP 00@T 03/@T\epH00@T 03/@T$Dp  @@-MX@@P Ѝ 0  pЍO-PR MpУ ഁ@  `880 S" 0SJ: H 0 Z  0080 S 0Q>0 2 0 0 Ѝ 2  0 0 2 0 @8@ @ Ѝ   P00 0  00 0sP00 ЍP   P  000 0@-R M@P Q\   0 013/Ѝ0s/r?  8P10@-@@ T1!\ 0C B  S P @Np@-`PV @1@!T 0N B@n\pSVpG-`P @P0pS:ؑI Y `1`! p| O PU  @TpP pPO-M؁p0PH 00p& PU   @P 0U `1`!  009W0  PUp0  ЍЍA-0P @h P 0 a`F ^ P pV @D: P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp01H0 (0p0S(00S1!R00:X Z \c/ H c/C 0p0S 0 Z0 00p 0SZ0Sh00@2S70< R,00+ 4P`(‐\ 0,,0(P40 0 @ p  (`V: :J&` #470|(7_V04`<X00 S  0 \ V Y P% ` PPX V 00S <  Q(( Q >P00S#<Q 4Y2 @`@ [+ X`D 0SX 0 PZ【PX 0SPc/ 0 00SO ZD 0 SR@T 000S $0S  !c0 0S 0@T `6  P0 SR @T ]000S?00Z【 \c/ H0 SRr@T @00 R 00o"00$4 0 2 30 ߍ p <Qd0 SR@T 000SG00Z【 p\c/0z@ Yw10 S $c`\Pj((\` X`0^S4<00 QS4<00   TQ`0 @ )A0 SRH@Td `00_X ` E%H"0`P0S$U V`P% V`Pa `<@400 SR1@T 000S00QO0 SRd @ d@` `m 0PP ` S<@T@.@ Xt s@ >@ 0 SR @T B000S@  3  , h - ` A-M`@P`@p`@9,0 0000(000YP+Ѝ O-Mddß@q TA7S`PQqz q8 @3 0d0@`0T ` Q` 200  0S S @ 0@"2 0 0 30ЍhTŸ <qAЍOsT 04S:`W 0 P~. Pp`   `X  ~TpK`PYH  uT  Q\ ( Q  ` T 04S`WA p@~ _X` `H`pN`@ T W`@ T~~ @-@4VDp Y ! 17DpU VYp:q?oT20S` P@c0m 0 ^ )< H  (\ (0 D L0-  “ ƒ:p@-P@Q 0P !  2!0 2pp@p@-@P` VPS p0-P@  P 0S RP0/OP *0?c0 ?oPP0/0/0@-0 ( 0@-S AN  0!AR 000 4O-SMw`AP`@pᆁ0 0T> S-Pj 4  0  0 PQR 8$R PVS#@` 00a000S0 0`  4 S  $3/Ѝ S   0`0 aS0 0 R` 0 0 0   0000Ѝ ( 0 " 0 O 0 0QA 000/0@-S@  R   0 B0S=p@-P@T @T 0 Xpp@TxP`p  0S S/P/O$(0c03?c00 R  0 !!!0 ?oP// R Q@-Q \M@PpVЍA `  P` F `Ѝ2R 0T `@0 0O-0SK P} 0Sz pp`@* 0]T B< B S  l R!1 @ 0 0C0  ` B R T`p@`p@T T,0 1 !3/P`@D0CPS)  T 10 !P0XQRf,03/PZ0i  `@DBX T0@p`0T  6P@<Pt~0S *R *0 00PX @DX<X  T  R !,03/ PDRi* @ 0X:r0P3  H  0 Q a0Z0C00000VP 0 O00C000@0C B000=Pu 0@00 0 | 0 0% p@-P`V @`0@D0T0@T ,0 3/0P`ʼ0@00pD0Spp@//p@-@P|00 V0 PWp9P 00, @ᔢ PᎢp dh @0@->R0M@ 0 000P0 013"00 ;P0Ѝ00Wp0@ @->S0M@   "00!,3,0 P0Ѝ00@-@ex@exH-M  0Ѝ$0$-0 M 0Zx Ѝ xR0 q  Q/S/0 0@-@00S- 0 ,   0 P @P ߴ0 0$0 s0 00R 0  0  0c0  {$5 @-@M`ppP` p wP0 :CRo; 0  S L   80(0P  Ѝ ; 0Ѝ "2 @-lM0@R0d000P C 00  "2 0 d0 30lЍ 0`0S pݲ0Pq D"D Pp0 0R ppKPP0000S$p!@ Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00  00 %  n 0SQ ` 0j ppp  00 p@bP*  P ( <p@-@0MPZ00Ta\V( b0T1S O⫠0T1ST0`G00U TX!\!R Ѝp@5\!A00Ѝp@,00U\!X \!X0 000S/ 8t0 0p@-0PUp@0 00TQ 0`U TQUP pX1P0X10T0`X1  th0h 000S/@-@00 X10CX1S @ڟOT170 @ӟ ht0 000S/g t0 0 0S/p@-@0P⺟U00 \A\Q X! BX!R p@⪟`帠00OT!00p@⟟ t\ \0 -4M0 0,008 00 0 ,0 304ЍA   ,D2vO-M@QHP@@0`U8p P<0D L0 |  R RW   Q00[ 0# RV  ЍQ00[ 0R Ѝ"  Ѝ ЍR "  Ѝ -M000 0 0 000 0 Ѝ $p@-P@P P c@p@pA-p`P@P P NP  *P@3* @"00 @00@ @00Q:// BQ://01G-0(000 A!@0p0Q9 P``Q0P  QȐ  @P  P  0R@ )Td@0@S 000  B BG!H `J JtJIp@-@P P8PpU0 =Sp=Spp\p@-,@@@PPpp@uHp@-P'@P $0 P0@6pH<0@-M0@P P3#ЍHh10O- MYp @To p `P FP0=S] @PTZ^ A@PY1Y04 S@@@S*Y3 Q<1  0    ` 0S:a  D! 0 0  @ Ѝ 0Y   RS@  `Z 0S a1S  Ѝ PP @GGTFF@- @t,  p 000 A-PPh`` p\@P 0=S SP(0@00 ,@-@P~ 0@ <,@-؝@Pp 0@ ,@-ʝ@Pb 0@ @-@ppcrP%0T0?P00:00p@- M@P` 0 0p0pRpq 0: p0pЍp@r, 0S0<s0 Ѝp@-M@pp10pq::0Ѝpp4r0!!Q- !00000000 0#0, 0# 00!R0Q0  00R000@-@1 MS 0>P"1#Q 5Q /  R% @ @1S 1  S( P  P    Ѝ0\ y100 Ѝ0@o000 0/A-`Up QU @ @E7/P@G-PTp AT P PD7/PX PPHPG-PTp AT P PD7/PX PPHPG-P@Up`L1S @P@E 7/P/@P@ @@;X; 1Q`0000$ 001@00a0@00 0 `PT!R% 00! 00V000 @0 @10a@P @@@@0@ @` `010a1S Do @ 000Q0 @-@"P 0 PC^0 0 R ^P @/ p@-P`@T0J \ W Rp   T0"f \ ` `R````0000000000 0#0 0#0000`001T^ pp@T P `T0 ^00pp@AR /oT"!0#00#00!0 0QT 00pQ  T \0 !q RC/A 0\R#R! R/R00 B-~x` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A``!@- 0(M S $ > \ RSB  RS@!0 0 $0 306(Ѝ@@     0!0( \ 0$R0$0B0S 0S ( !0$ R0 H 40 0 $0 30(Ѝ@.  $ ` O-Mp`@ P-TP +T@`00T WXp p 0   0 0?0X 0  0c 0 0  @Pp Q 6 P Q  S  R- Q 00Bs ^a0BSW0BA0BS(70BU%| XZ  P Q  S  R "00"0 00S \0F00 Ѝ@`r00XS00 C R@`0 p0 A BRWwppvBD0R"\04 0;p@-@PT00Pp p@-BR"^p@'@PT00PpA-`@PuUTp 0S *P@ fp$S _T@pꝫ@@XpT@0 0000/ 0<0/0 0000/ <0<0/0 0000 / 0<0 /0 0000/ 0<0/0 0000/ p0<0/0 0000/ ,0<0/0 0000/ 0<0/0 0000 / 0<0 /0 0000 / `0<0 /0 0000@/ 0<0@/0 0000/ 0<0/0 0000 / 0<0 /0 0000/ P0<0/0 0000/ 0<0/ @/ /H-M 0ЍA-P`p@8#A@W 00@-Ϡ0#M0S " ! Q@, ! QЍ  0S RP/O0?c0 ?oP/G-P `pR Ve S@ RZ Ql 0Bv ?o/o0CS 0c14 CPV  p pR( /o?o BR  0b14 CP P?O00P ?@0@^ R0V@0CP V 00X% 8o h:89/o?o0Cs!  R 0b14 CV   V 02??o9@b>1 4LP)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO 0@-@ P  000[ 8/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO@ 0 ///Q R R  // U /Q0 R 0 0S00/ 00/00/Q@-@ S Q \@ 0SQ0 @ 0\ 0 @00Q0@- @% TS00$ L0 P@D ^TNPPU QP00Q S@Q0 0/ 0U0/Qp@-P! S! @Q0C\ S@ `PP `0 U0p PQ P0@p0@Qp@-P`# US  QPEP SU @` `  0U0p`Q `0pS PQ U//q 0/   // R0  S 0Q 00S00/ 00/R Q 0 / 0U0/ 00/0/R - /P00 0S0/s R S   0 /U/ 00/ 00/R S Q0 S00  /0 /U/ S00/R0  S 0Q 00S00/ 00//q 0/Q- S Q R  0S 00R 0Q@- S BR0C  S  @ QR 0 0U00| 0 @-M0@000!00jj00j j4 ,0 0 0 30Ѝ  Ѽ0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/$ $0 00S0/ 4t@- @p@-0@ ,ppPju0Pp////// {$//O-Pq4M`p@T v10 (   0 05/4Ѝ50S,   ᰱ  p'S㶰0S S9 3Sp0SQ00 W00Y00Z0 0 \ 00!" R 0S@L RTX00 L0 0 S00<H4$/Z/[/O-MX+0QP; 00008;` 0 0 00%SSppS- 0P p 0HZSZ.XW(UTSRQPMXJ~}|{zyxw?>=<;:9876v43210/.-,+)('&%x#" WR ~YX P$$@ 0pPpP= W# Vp4 P, ^Z0ƄS0C\ V0404 R*d 0PCUPE_Z 00ƄPU*Y00H 1!00H S_f  ` 000Sq0-ph 0p0p0u 0SU00@P  U0N PWPA<; p0pu  RU  P@  U0N P{ 0J C   0@lX 倐pP0$0pQ *X 00H SP 5%00H S+p0P0` W pp@T, u  0P' 0CpUPe E0 p5x00pu 0SU00@P |(500< pp 0 0puS< 0 0@0! 00d0 0C E L7 V04 U V*0ppZƅ`` PAQAZ0ƄQ*AQA 0Z 00ƄQ* 0 Q00% 0!P%: 0 P@w 000i 0pdU0* 0P@C0C 0C E L @00 0 d0R00 S000D 0@AC E Lp c  0pp00n j 000 0  Q x 0pp 0 < ppp V00F08"$2 0 0 30zЍ  a  000?0| ppprp` @P000 ' 0 @qpZppp0pm4A@e E0p00@ q0+00005 0 @q 0D@s0@0S@Q  0 I0PU0PPnT0 0t 4xs4r L`0` 0A-`pP@PU J0PEX@S 8/`upW x 0SS S 0R / 0R0@o/ @-oO-` !p1CM M@P004400@  0 @0 44 30*Cލ Ѝ0`p 4 p>P 4p 0 dpL+ >  09/z xkG-0S0 S,QU) X&p@`V 0`S0P@4 S0 S 0S0S0S P PU@0D\  0R!R $R R RO-BMMp0 P  U0Hd040/ PE @PU(:0 TpP@V: pp 0 YPQPD 80 0 4 30BލЍۨ hO-AM M @TP0 0 $10040. 0R+:0`x0(S3 0pW"WpG/ @U: pp 0 00 P pW:$ 0  oPL D0 0 4 30Aލ Ѝ0x0(Sꄨ O-mMM>x .| 0060w @>T080> 1S; 6 SY`1  8 >@@ X@00x |5 @0L0 >00S/ S2vP⸠`0pS PP$ p O 00;dP0S1Ss:P @`PT00ST^vP`㲐0Sqs`V0@  ^ 0S @ ,D,< hl 4 ` Th0@0v? H0x0T00D0@ 0d SD0X1S0 00S S00\01D 021|0P0ATY0L0S|0$0x0<0@00SAT| X0@P{ H0PPPzy 0;<@ $ P @0P.P  D0@ @0 @ TH D0 H 0 `  ` S L0S40SB < 0 x0 S00L0T`PP*p6 P004/P(*: 0 6 30mލЍ0h0 00d0 u pW A@@PH0Pz !bH0P0 + <`0$ @ raP u40 PG yD0`S`0c  `@0 0 pVG 00 P`/e B 0 ( \0?0 00  F &9aPP8 U0I$  QO `1  8 l80 X040b&40 R 24040u 0(0 90SN0@/,ᐠS?N9c<"aP 0S @0P $8p'@& 0 0 4040P1 Q!  6 $<0P0`1  8 6P0 X00 0 0 1 01 040`1  8 @60 X0sO00 0 0\04Pb80%D pX W@000SA0\0B  0 @000L0040oQ @U`D   1qV$00p 0?u0AWU11v#3 QU1("0#03 P BU Y10 #3P# 00< E@U@  V(@0V2 00U  $0v` ˆ01 00@0P /8#@,#, 0 (0h00408 H3 X0H08 3@Xӌ8"@" 0ƌ0 AQR `1S 0  Z P4 ]`!!! QY   L28 @X0 Q 20L RZ X AT vP*`x 0|Pp4/P񏐾?r0+S .0CSk@i0PWdPp8 d1L @ X0040c v_P0qH D f0L0408 0@ X00`!`Vy A  xgDf( c8c,b ````^X],\D\\\d[Z[(XVpVULTUT@SSR4RR0Q|QXPPPPPPTS0`01SX 0d0d00S S00 0f0㨠(0 P18 d0 8`P0 d0^P(101<@PDpzllpP 0 00$00 ^0PopP 㸰D TPD Br DR ^Pʝ0h0P0@1@ h0 6S(0S 0(0$lVPI0cLpv D T0D Br DR  y^Pj0h0g@e0Pk ៝8"@" 0a^W $0 0R^ 0`1  8 3 X 0V 0  V1 UP  Er R000 Ƞ T Br DR  R ,#(^P8 3l X0Y040K8#@8$8 0 8 $4 X@h0>&0R  1=U 0PF(@0E(0U@ (0   0 V00L0S<0h06 h 0 D0 P  0Z (0h0@ 00T_PdYP 1011S1= 0  0 8 68@" X@0&0R  08 P6 X0"j 0 0 0p᠜8&0& b8 6@XYK IPG0@KB@?0h0<@:0P@ t8P'@p'p 063(0+S .0CS!@0P Y8'@' 0 P 0@ C8(0((( ꗢ58L(0T(T / /M-   0 C R1#0e(6, Ѝ /M- 0S  R BC0S N  Ѝ /M 00S 0 0 0CSЍ/RЍ/0@-$MP@]P$Ѝ0 ]P0/0$Ѝ000 $Ѝ00@-$MP@]P$Ѝ0 ]P0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-!p1AM M00 40 PH dAPPC @ +0WP7 0S4 `  0S+ 00@ JP00@S 0S0S 00@ K@ @< @vrD ,0 0 4 30AލЍk N   O-# 3CM M4p@0`d04401 020$020,00$0D(00 0D000S000-  0p   P?QP0(d400 PM004  !/ S ,$$ 0 d4 00|P0   0 0 PP P0. h S, h  104430:Cލ Ѝ0S0Q Q# Q h  $  $ R2 0 Th h ꜠ 8M <JJJG-`\!X1AM p0@040 400 V < 0RVP PP U.0$P@0I8ĝ 0  0 0 4 30Aލ PP P@0.S@4 A>PdE0  0h9 JL 4I\O-#3BM Mp`0PP0$40Ph@T9 0.TP@TW@S5.@D2Oo1B1U, d1#U0#01S T4 00j0P0[ 1U0) T 0 '0s"2 0 $4 30Bލ Ѝ0 Q[PN $PH T4 0 0i0 D D@R000& 000SG .SB T400P`0=S 1SA S5 S6 U00[B 0sK0SP0S g00d1#2PPU>00& D D@R 0 0! 00000S0000   R00S0000< 0!T4 00P]=g00WP<5gQ? t p  p@-@P`ZP p@Vp/O-p0\MPX2@0`"T V a0US#:Š@Č&Œ0/O 0pR 0 \Ѝ!0/7/ 0  ÅV X0 F0 0?fP0wpsff0崠SUPP   B RX00 B 0 fP` ffff뺠H\Ѝ0 `F 0S0  sfwf f0sf0S  0H0 <LD8C-@0 Mp`(P)@D T@))yfXpsf0 lf if 0@00 Ѝ  ,$" "BAG- p@ᶂ`ẒP E0S@P0WU!P8f @4f, >DGp,fD!Al0O-䱐 MP0S5 @d@??X@?>>@>0> @-@(MXxX|ÔP 0 %  0  0xXx(Ѝ>@-MAT  tX0000 00XЍ@@٘ 00@- AtM0T0l00  VXP 00#0~ @ 80 0 l0 30tЍ0@@ꃜ t A-@PW1 !01n0SvOPpPp Vp0Sp@-@QU x3s|p 01P 01000pVcCXVxVP //4P //:G-P`@>V%0V@Q\ 0\\"  p偣 pp p +; O-bM0MP@060c0p+ @ lT =0H `@01%,d!0"d! . 0`1111A0500ᚓP 0ʏ D Jz@p", d1 0d1sP P8 `@ U`0H SD@_r S\  S S00 Q@0S S R: 0CQS0 C0SQ00000|9|P 0a-$0o$F e-a.F t"o#G i$p/F t#i,F8 v"e#G4 ". ` "(+ 0QP 2#S;S 0 S$ r1e3GR} 0 S> 0 S 0 S0 n?R00sS#2 S S0D( n9R"2 S S0S00 S S SS@@ `0 ṁ_AMP @(@04 0S? r5R&20 S SD00R00S 0`0 S S00 4@t@0S S ,7O  05   h`C0H wPf\@ RbP 00\@ 00R`R0`N00 $ S( 0d10d1. A U| Ⴋ1,|zVAp 0τ`0S [ `0`H@DSH .S0S[ P`.KV00[0S 0 0P % *0%004 0 6 30)bލЍ08 S$B T T$0 Sʬ4嬔0P0H00?OL0 0p P9p 0s^$spspU4 Z 00K  Wp% r$@$4l#pt"L("0"48(! H Lx 4 `L0HP1O-0$M pW I*,Q P1+nA!0@ 0 ^O ,@ ^/? 00S@  @ 0}0 T0 00Z @ :P,0 0 0Z@ R 0X$00 $Ѝ&&&&h(0 $0 @- f{y ip@-@@`V 0 CQpPaP  FP    p㲋P 0`0p"@-@00 R \\  $0!0D0 0@  ( $ TD@-@PL  0S  T0S@P-@PP/0d 00 0Q,0/01P/0(00$ 0/(p@-@P0`H 0(0 P0S  1T  0"00`pp@-`0Pj@P  PeP 00p. h A- @0S  P p00   ($ 8PP(p`P0x\:O-0T*4M , R{ p44: +^0 ,0 ?0 :p:`I 0@ P^O ^?0P0}0 0 0R0 P `\ :R,000\ 0:S Vf <90 P090y00(9p009000,0 H4 S  !$RHXPSQPOU^ , Q h80( R> X800 R> H( 0S  !R (8p0 p(p$ aGc@(`P 0!P4 R B  B QP70 pHp'  ( \'  X 0 HG @400 p3 0G 0H0C(01@$`,0 S(0$00,00$SaSZ(@CQr @T  B Q$ , R  @ p,p p$ P  P p  B RS RA 4Ѝ50PP @ `%0 00  t% 00@T:P5B 0P<500,50 P ATg4000C?00 P$ ,p R*#Zq d$`P@(p  P 1 T @ P$$$ `R " @T8 Zc ` $@0 Z (0pp00G3  0$ Tg |# 0$ a1,TC@ 01$000Pj ,0$  ,0$ PY  B , `, b$`,P (xP S0SGOP( 01 (0wPP$ 0 $,Pa1 0$1,P$ y@ P$ja`($ 1ag(@ P$|xP 01S(0=l1l!0< ^ς}0S0 00@P +.000@P! /0:\0   \00 Ppp;g8 e!8!0    4x88TD< ,dd @@-@PA00 R P !$0000 0@  ( $ p@-l@@`VpPPpdU01pPEP1Sp  (0$ 0pdQA-pAP@T`QV0@P 0 pPP``p`0(`,` @A-p`@PP T   0000P   @-@@0/ 00(/000/004/00/l00/ 00(/D000/0008/008/A-x``PU pqW@P<0< 0 ,(0 LLK/@- M404 0 $0 ЍL 0,@-@0`00@@-@Q k00 2 y 0 G-`PDM@pZ 0p TV 00J 00 -00 00 000 0$00PP9 0 2  < 2R"  "V &= " 2I p80 00 00Gpqo W* W+ (00%0@٩V DIP@Ѝ00@T0-00᳥PP  02 2 2: 2( JP0 0? 2< 2D1 000100(10 0 10 01001001007P 0 R00   0T 0 2 1 3/p0SW 2: 2l wP 2 @0 2@001P,00 U<@p0 C-p@ MPQ r00EPEUC\A@E=2 2 X b0 R0S 2 +13/PP"?o2R03SF APA (0$`  ( 2 00P3 Ѝ(0 $``VP Ѝ;P00 Ѝ(0" $``V000`V "V00"?o`213/pP  Ѝ@-`@ MpPQ 00U,0`V( 2S * 2 P13/PPF `P 0 pv 2 00P Ѝ  ЍP00PC-p1P MS-:b V%*AY ֝ppY  ` 0< P Ѝ 0 1 P`V: ЍFP`W 2< 2 ЍO-MY:*p00QaP@唝0p@ X V`F`PE P0& ̱1PE PU0 2< 2Ѝ0  PE P P  ZЍ 0  P Ѝ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 Ѝ᫄P"! ЍG-rMW Rb"*^* 0@0\ U@0 Dg PpY U 2< 2ЍЍЍG-邀@`ᴑP 07 pv`p IpV`F1wv`010 R 1 ^`0!B L\ L| R~ 6 S!2 B!0C2fpp@- @WP ` PP  NpPp@-`P@Q @00T T O 0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-`P4M@Q 00 Vv 2+ R3 13/p* 0 000" "0$ 0 003 p`0 9/P 9/P E0  ^ 4Ѝp$ 0  rq0 P 2: 24Ѝp`?(0 0,009/P ,0S0S  Q S$0 00S$0P A 0S?/s0 Cr  0 Ѝ ,  0SS(0 QS<A A0A@0@@0@O 0 1Sp@-PM a@tP8 @0,000^P8Ѝp߁Ѝp/G-P8`4"M M 8Yq 0 ?@w^  0R1X<0)%R@ZV`` ? B2< b6<b0 `"npF YP`8T! 0  2 K؍ЍV9`PJ8 08000S "! !^40LL^8^0LL\ Z0J Q CR$ Ctpp>@08@0 O 0 ꦈ > =O-P ` @P H1⫲0p1q  J  0000N`ⴜA40O-S M@0S0040000 P`$p 0D7s!`A B  6W6cM^ V LW0 \U 0 SP r  \  0pS  `s"`fR0  !2!$0Q0A$0U@ 00UY QSQ'QqpeWa 0 ܣP 00000 pAL0 ЍVDU$DN @ppA W PUi1 PpDD00CD0 0 10CR? wpe0 B Qs0"0aR31pwp!P@A0 0$ 10C0S0gWPX1 A 0 Ѝ0 QpP0Sʅe P1p WD wp D PU PeH pD  BD HthO-P@MpQ %0P峐ീ0Y\[@T0 P> @Q 0SQ~ 0P @P0S 0P%@P 0S0 0000SV 0 NP 00080080ЍO貝Ѝ 00008(8{40PЍ`00P0 C@0p W @q`M 0  0 峐000H00ಀ0@` 0rP 0P  p@-E> R A`$P@@@0D @Q$0 A3@D@N0!R T00t2 @@lRDAp@菣7 O-0 p\M@/WPp T0P$0X 0 L P( P $wp0 000 000 00S,pH0 8@0괠\ G  p ||ɽ0 0J0  0Რp0000@ Sڴ0S3``G $J 0 |P L8 <0p0s00 ,0Cs00 ,00A00Ⴠ$ 000( 000\Ѝ0,40$0`(0@At@Q$0(`0 000000CSv@@ᴰ[ pWwpQb@0@0QD QE[Pu  0  }000@t@Q@0 0pW80S@BAD ៜ0S0QD Q'0P0@ 0 00G 0000  =0  7Q00S 0g  00H00 000PL0S0 H0X0 P0S 0 `00nF40A@,0A Ts0000L00` 00P 0 p`W 00wpS 0,p 000040E 04,p00D00S 04,p00: O-\p? P0`@S@L$P } |P' Y  0z S40 p 0 (!S$10$10 10 0S0㻠P  0P0 S0㫠P  00S 1$10$1.00O-P@ M Xp0``Fv`O 0V0  1` !H`Fvv`0 0|s0 0 F` 00`00BPPo X[000Qc Q 1 !rZ  pG``Fvv``K00K000 Bೀ0@`@000 0``Fv`W- 0V0 1!{ \`@v` `Fvv`Ż0 pW0ps00F`0A`00000 Ѝ@0000 ``Fv`sQ0 Cp Ѝ ᳀ PP @0000 ``Fv`A-0p`@PR"  0\͟U@ :T8 0PX BQR R\ L0Ӳ0R |00Ŵ 0 0Ss /00C00 000UU800C80O-P0( 0S 00Cs0Z@ ,WPI  0S"g@P  0 S 00Cs0 S  p`V S@  0ྞP@@A-`P 0@T@ Tp Q Q\'PTG-@`P 0S 0S  0Q@PS# 0 00ᲀ\S= 0 BS5 P@ \0 P  0 (!0S%$! 10$10 Q՞P 0 㾐@pᲀ 0p 0 S a10 B\ᾐrp ᲞP $1 0 !$1(3 0 O-\?  M0P@`0CpS@L P Y{ zP& 0 0  _P 0{ S0  Ѝ0 0S0eP 0 0P000@- M@P p10 Ѝ0O-M 0`0p  @DHPpA I P- X@  0  †r 溠 \Ჰ Lpഠ0  ``p0000S XЍ 0P @ C0Cr 000P @G-`p"l2(M @0 0$00w?0Rp`2 S?:0JS< 2PP{ 2 Sl1L PV: CX 0: L01|  p<” 2 0„ 2 X!P1 0 $0 30K (Ѝ P@ ZP崀 Z r  B0@ 1x ᣸p#  0000`0p 00 p喪P202 p i ! A-p@MP`Q 00 2   Q `:1Q彸0" BX!2 0 0 VI WFEYBAG?0PU: Q * 2 13/pV \* 2<00@PH\0 : 2 I E0P VP V$P 0  ЍN 0 Ѝ0PU Q:(0 $P0PUP`wP  ЍxP 21 o\y@--M  @000 0;hh  0ST000S 3/ :t<g0 \8 80 0$Q/$$0S/ Ǹ D0<<00 R/( 0S/ h L-AF hFF #x /! FD M)h1 J#F I H F0khBF1F8FAG5x--AFh FFI ^EO0EL:F)F0F,CBK@Lh,4+\jF ! O@3 d0L6I B(Рb+7+544444444"4444%(,1"Fb#3#ca`##b#,4#c`##`#3H!X#caIFH 2(FCbhC"hC"iCbiCп H(i&Ѭ<ɠ&|-OFh F\I ^K$JFFF&F!8F)FJCKwR()G((Wп!H8 (Q  a Y Y Y  Y Y Y o Y O&X(5Рf)) \! ]  i Y Y Y Y Y Y  Y Y     Y  @O gI hB:U" -ђEђx ; `]Kh/,кйWI O&gO dOFF`6&FMOMJJO&&FlU#XFFDIZF  F0?I"F%1F"@FVF(Y9I hP : *$?00<<"!F0Fi-8Сm(FhFFG!j$H^ AFOFXF^AFFXFxO0FF(nhCI@O@F'<`x`&|-OFL FhOI &^zff)FJF8FAѧKh/ݢjch*+I v(e(R(KG(+ܿf+R#MMMM%MMM+M1MMM7H +R#MMMMM Ma( fh&a`yvhs$pm(j,g#ChC6]Itk#i+ ##h+#C?`  c `cX'@BHFYFo HIZF h+###HFHD/  0B,/*0 6I0#H'0hS2H Z  -H 0@ h+&J*U&*,pCObhjCѹ/#JI# O Yg:F@FF(>FFOY8F|(3 \/)F<4it'&'P0;+`^61FFH)jH&+a0*kDoۣH\9Fl*j,ٹ)5F/!2#PI#  /*,/*/"+OpZDo FH9FFFZFFJ B O }KhB/)-УhP8F$F3X>1P BB%1T BB*j9FkH"mhpCOq")FHF\jbHY`O0pCO#RpCO*j9FWHG! pCO(س_ˀ_(F%F(I&1FF!O𮀳 Ol+Ё(FbhjPC ѻ)j9H")FHF<Ѣk4HSco@"1KOq0J1HfLq8Fv(!j+!)j:F)HHF*F(Ůh+l"I ,RpCOz#`ZAѣickJ;c+R#/K@?J!pF(z'(N)Ыm8Fh0)j#H*Hch+??pF;ch+?5pF1HF0F/?pCO#/jCch+?#C?߭U&*0ݭU& I `-GF- FhI ] J!F(F0ЬI jKNh@8LK`90̢H0+0_ԠI"`F ( I F`k#cKdccHv"mK@+jUj^00! #m@!OrdO@cF (c"m@ l@aOOrF[h`kG#kC#c(cbksH a00#ica<2C,2C#mCO !cl lZC"l1ik DG_N#m@^IK6#@Bq(FD6(j1D, a(ч1FQHPI ,NI OSKHf`#`h0Z +61DJB@#m Bp`i!4 ##2C  4k-@!l(FiG0@h+,I1&mBP SnnEBrҰ !0 [jGPrOs.ф49F 4<   L` x 0  15A ++Cq ]HF/00"j6#GQPHn#m6 24 B2##3B##m]62# #2a62EB40 C20%m4 I2#3B#40 C20 "3A:"FL0 D01GJBѿJBܮeU?j! i #!iDf#Caae?ܮlkhG0I ` -OFl]hF4I ]\LXBF1F8FZE !kh#j)C𥀂IXG8-(+.DJM #&047F!%I P0; +rIqqq[qqihj (-j\b)FF@F##a@\VI"FF li3kj+?++.R)jhj\@F!&<mDEDWDEi+Ѫm(")F8F#;Ci i+h+?y)jHFiӱP0i+#+h˹i 4"j#hC?](j##`>Vm(N i!,(Di+Jh+?h+8F@ ii3)F8Fr##a*h+?$h?+?h+љ+? \)FFPF ipC`O"(F vF8i{)F8F>##a#j+?u.r(Fm`O)F(F0(bO(F jh(F (F(Nh+h?+h+-GFh Fn2I 2O\&O:F!F(FC,KhBO9*O D%Tp(Fp(v("K& (!h@F%;h hX.O /!PF8Cx+К0#CPF (QF@F3F;h+PF0EL<!8`p! " O#"  $ XF XF nB7  L ! p \(``Oܿ#c`JLI` \XHK8  #(ŀKh++'+шK"% ,K"!" K`#~Kh+JzJ6 *uJ! +wKhJwKhtK`)qKh+ rK"`qKh +.#cKxdlHkI#FkJ(F FsFT F;eL hCh;C`+ "hhY` "_HpyhZ`+:#MK6 0kGKxS'SHT(f]#OK"`@K0+cAKh+_ =Kh9K(a7K0S8Kh;AKh?K`v+ .K60+:H5H%8K$L ` n#1 #K & SKF0+(H#X#x+x+#`M$&FU 41Fz,ѓI !\1p!!T! !h! !<G\2x2\!1!\FP-GFhptI [sNtK$tO`3h BY#9FPFFPF4EkJIF(FB2hR(.cI 4a+R#4494949444$! (  PI $$MI (KHJI (HHGI v(EH,У+h3%=M#=N3hq+F(@6I)عL*hh#x320[ FVFF|!F#3"1F F aH!FKI (H @<@www`@ tBw@thw@twwxstgx&|hZ p -OFhFLI [M$FF&Fx(`oSBSAJk`K!@F9FJCKѓK иѤ+6NйGЉI R(%G((*\H8 (Q 7#66666667+67O &h(v(f(!@!O &O O !&FO33,EkhW*+<:!XFBKLW*@#x3#+&VI F`1F"@FzF(@OI .!XF(IIXF0FEI F0XF F 0=I"F dkh ``P0; +CBBBB2BB2B=#"!F0F0F4F(h+9(Ip[ 9F'F%HCF!iG!jPFp[9FFHl'[FCF+ j>H'HH8F!x2<xxx!&|`T-GmFFdLaad5`5 ad:5`5`dA5`aHHF('|NBFQF(FBѡi)@؀wI" 0F8h7yh)qI2F toOA6+#9)-15TPj~#/𙀻Bx#55#5#5#5#5NIHF A-JIHF@@GIJF0hF0h "!J?F ph"+2h=I m0h "!4?FaXh"+2h2I0h "! ?FFh"+H(2h(I#0h00$===H`==t=========d============hG==lp===x=======A89( #ka### "#2 xha( [I V#d2t# 2p#2l#2h#2d#2`NM$NNjh4U0F, a#2J232D#2AK/!@FF# ;0C:@F~0W:?&/!HFF#;0C:HFe0>: ? /!@F#p0+?:@FL0%:J#h 02:I( 0\I 3oҮOc34$!<f&|!>J 0 KF2I( 0\#BٙI*X2x/!HF pHF HpCO0ayZ8/!@F`iCFIHdHI L@F6!  yH@F  : 0\BEVslHriHiIOR@F fIE`H!ESB^H @F )s#2#3VKh3SKh40QIOKh3LKhFh`JIg[+?ޭF 2k2# CC"C"C,2;M#a:H"92#2#6H2#ki33H.?fW(0+`d2k(h @pCO#d21C3C2Cl3&+ !!d2(h+zO@C:Fe((a\9Fh+RH!!h! m!ވ&|&4$]!,db.#:'2F:s!f0YF(F:!f0/`wFH/`(OХhF)hH(i O3+a" h(a0)hHHOrH7O\wTk`L7P'?+鈇"2j!2銇(e+i`mhv(FY`(oяI*F d2(i: (0)hHV#1OqH)hVW+F@CI AQ\2T72P7OsH72L7nJrI 0)hpHiJoI(i 0)hlHf@F9F.@!@1F F`pbH(i .a_J! = \J! YJ9`r/3232 32LM\2 #SC#)\]FXD PObB\"ZBX2QF( AFJ+h 8I;h9 x 5In*5JYxo)39#1LȀ`!F `bF$hz ܺ`ܺNJܺAfкC!PFB@Ԁa"+Q#c]aa%aa%a%a%ba%a%a%b a%a%a%a%a%a%ba%b1b9bAa%a%bW oA "!J6J Qd+?J G6HB0KK >.KL :,KJ 6*KO -M1'K"%,%KN B?&K, KM KH K!M $ oA % " !(hKd0+t*hI  KI KB =FF7x`"7a78a67"0<E\FaO7&|a`6ІKzOT?ȮkܺC9кBLкa{Ml ?S*bb`y`y`y`y`yb%`y`y`ycc`y`ybO fM$eMޮm (خH0+ӮI0+ήO0+$5+?L (?}F"h@Fk0PI#hk;"SCX8)FFIJJI,F F FCF&0F0@JAIq Fa8((8 +.3wKEuKh x+ EoI nlN0h6hFEfJh3`E#ObIHFP`IHF(_IHF(Ѱh9F[(hQFs(2hYFFXph* rhPI (bOaq`F JIq (#3h +F (DF] !FB=4-"8   "J 5    Q]   v    %       O_   o~  #=hsI(F&(qI(F (@ځ# 4lImH##`#443z#4u=hdI(F#4hp#"###9h"\HSK`\#"O3#Os9h"UHK B?I:hQI P;h4?#"###9h"IHy0#"oC##9h"BHi  #"O3#OS9h";HX$#"oC##9h"4HH(#"oC##9h"-H8,#"O3##9h"&H(0ch=h+H(FUP J+xh320YI*F(FF&|"!nJ<@_5Xc*8"HoC)F##"KY`#"oC##9h"HK`s#"oC##9h"H4c#"c###9h"{HwK`T#"oC##9h"tH8Dch=hkqJ#qI(F`oI P`3mI(F#@4*iI(F@"fKgJgI (=hfI(F0D4CD4aI(F D4C]I*F8h"!0 (:hWIoBO3##9hOBQH-QKC=h(FUPMJ+xh320ZJI*Fh (F =h:!(FPTt /!(Fp?I +x =I#T4##$2Zh*""$t"1O7!t6`<4^XXC@)HX<4x#6<$Ih0#IZh <4Y6H L @Ifv"%@p4jx$"%3"!4,кw,t x"!T"!@FhZy4Os4FX2C@>T FF(I"F FOa `bx1FOcJ(8Fb}J}IT0ThpCOuJwI $rH!oJrI !rFkJnIiI"mHgO{(F <hL4[h4$1F[H!0(YJ_I "[H iIF( IOr4IF8F( 8F IJ PI C`4;#X443+4FI9x2+02C8JAI䦯AI;L8FvX#T4#;I8Fl84+T46K)J6I6I8F\(4KO6!Lz*x2{KS#Bp &I+Jh4XYC(F2 DD0@X# I#"F"%o"!(""!d(<S`'+@i> a(Fl0ѲH!FOYIFOpWJF IĞ!ItQ#zC"7D$*ݢH:F!FOz+wW O0$$4T±+e)j(KEJFw (FFJBюIgw+F+O0$ѱ+Ob0$OS$40o$_5|HORZ-:C-D=-S%!IIIIIIIOgIIIIIIII#yb=--S%IIIIIIII5SIIIIsII"0h`Jx2+?9?5ZI #443(#4##"#QH##1h"KKY`#"O3JH#Os1h"K B?2hCI#"#AH##1h"w#"OS:H#Oc1h"f #"OS2H#Oc1h"U#"oC+H##1h"E#"c#$H##1h"6K`#"oCH##1h"& HOB#1hK"&&|<"*8Eh5X*fv 3h(4x+`I O XO U!@!V0ыI2F4+F dC"4Lp /z2Q4"6J/p pqIOcpJIF0FakJkIJ 04eHJF9FbJcI8!vF]J`I/\I"_H]K> <"TH 0(QJVI"RH hAF( HOr4AF8F(8F0BJ GI ( C4+ 4 AIB1f2C4J=IdCI̺##p+t h+*8F1H"0HD %I ^t;x*Jݙ1ENh  sIFF Hd2"B+?h?6C-@@A~8#1L0LDyM#1#3`#;#<4#; #0+@2B`2;dBKaʫO2C d2h?𐀚uըhhOzr# FSCH Kp @@  Ճ ݄"DAh2#3 C陣2c[ESTꈰH z;FF@Fy2Z +,(+7; h0kHC;&- h3ScE:FFф  }I;hC UH;IFTH&MKCKD+h 32JHh8F?Kh?Įv&ꈰH z;FF@F Eh 1K   "-K +. &Hf  B  EnꈰH z;FF@FJ !hJDzHD NTchE&0F HF  L0#3(3^#<ɠ##BF1F(Fm(?􇭉H#BF1F(Fb(?|ix)ЃHHkHi#BF1F(FO(?i)y~Hp#BF1F(FC(?]yH#BF1F(F8(?RuH#BF1F(F-(?GpH#BF1F(F"(?NbtĉĜĮ    EF u.6+E"IJFXFH.?UHNHJFYFBֹ &H[FF 5T Z H.0 H+O0#3FS}\(FTFV)W/DDd(X UIF $I Fn(хK"@Z`d+)  #&O DtDO;h  DdDD4D$D$O XFG(FHYF(FD%)F FaI .ў(F(RwphUKhb "!QHUVI2F UTN[h "!+NHUtPI2FLHUn-7MI+F2F UKJLILHU#HJ#HIHHU!Fb! ^! Z! V! R! N! 06I6I2F!O00h+0H/L!hF%J?F(FU(I"FF  2 & !O00Xh+H .HJ)F FH0F6v$V?D;+Ѥ NF$3`+~r+YR+i+H t+x+  O V)ObJFQFЋS#+d0%BF;F  LE ki+  2JL*sj:HIHHHH jAICHCH#"2a0h3q&1.\(FF;HW80 F#)FC(3C<0Ct ^")F FO⺄B1F,HzFF|h3++h+xg++%LlCl#I$Jh( F!HRx+HJ+.#h+XhFH: SSSSSSS0 ~j$xIxY@D0-GFh FP툹OL$:F)F0FCѶKh.v TzIF D(CРb++R#kkk!kk)kk1kk9kkkAkIkQ0 6#$6#(6#,6#06#46#6#86#<6#@6#D6#H6|$&B<&4 C"<&,&28&qHpr4&r<&Z0lJmKmH)FF^`U#PgI(FS(ZeK #D#xh`If(8]MOjO W(@M #+p#kpVHSMP6jhCT`FOHPHHS! h+x++#.FO 0F45H F(FpO 8`E_l*Jhkxh320Y<#XCKX`P&BD j ۲20ZԸ:6(3x>"h"$+?K J`.$&|<^VH1m$ɠP-CFFIFFLJF9F0FJB0џKLhv-8.I$iLI Fp I Fj pLMJF9F0F(C:eiK (. @3B#a( t(#i Kh#a%玱#i{?hW  > |BFyIzHyIBFwHt(o@(A83(S ao{z(eci+aOsci+Z#ca:ci+S#ci+M#ci+G#ci+A#ci+; ##c`#a#a#ci+*@####`#`(h##b`ci+Osci+##i+(hI aJ(#cbo$< &|zv:-#j+?ڮchh+Ԯ&i--ͮjI0FXhI0F 0gI0F( -e.--̮=-?ȮS%MMMMi-W)P h)F(NI*F ZD@-Ѐ-i#"jih NAMAN(cAF?H{i##"jih 4(smhW)W)cj+?( ^W)YY" 0(HJ??#H.>OBFH< F"5JHٲ2 C #B"(&`j(? i)F FJ(1F FF(AF H ` @ CR-OMSNFSO FO2F)F FCOKhBO9(, D8&U/0F MR(f(O#4O D*Oa[ :I* nd a*.(@ `(>pCO@гO5 `jF! )(> d ZFOa8F48F/Kh+H9F F0!F*PF `jF! ( `jF! F( H aZ&v*]$<``z-OtML%&I ROghKH8X<8KDX@8KX`XdXhXpXtXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8cHC #8FF:F&B? RVI*FF lzL Hp K<~HhFX}IR(@oK"T(XwIF(@€gK"XT(qHHcK x`K`J,^Lh8C<x%hHhXfH.(dId bKAMJ_K8(BHFM&`h$wdhAL%h.F \BF8CF@8L#F".GK|hR!# <-d((F#C   (N (@$hR.IF*F6-I FRjKTM*I FRa K"h(E&I FRW0 K"T(X(9!H!F4I F(=K"h(7$[$(F322333&3.3\3k3u.3Hɠ<4fZ`363b44D+R#IɅQɅɅɅ}ɅɅɅɅaɅYɅɅɅɅɅɅǽɅɅɅɅɅɅ1ɅoɅȣɅ5ɅɅɅɅɅɅɅɅɅɅemɅǕǭǵɅɅɅɅɅ ;IwȝAɅE#8H#X8T8#%qJHH,<H_HS%tH%QHFɠHca`HaTHH@l"!$(pM pI,ť 1#c1H-C FF3IFع2K"`/OJF!F0FC+KhBE(Kh(<`%Kh5&I(F($I(F(K"`c(9(0(08V(JIHI*F d(Ol({``#`JIH jF! hiT?+ѵOp%x<OxOwKQO}Oc-C FU;FLH#a#cax #calIp#a `r*f> 'i8F;BF-/*oILoO#;` 8hlJmK(FFP-ܑ. +hx-*+*[xKS0PU UIF>@F(@F;h+TK"`SHaxCQHax NKaNH bx LK#bgj'KH!F. hCع(5(hF9F@F 5>F@FQ.!( 3Kh;2KhiC1H,0MW!  !+h++K+Ih((H! X(h!!s(!?? Kh#c&Y (%x,7%(2'%< CL[%y %r%XfZ%`-OFwL F&hrI Q[f`JF)F8FC*mKbih2CU# 7""m8h(?W(@#`K!h$^H(\I u(`(G(DI(FE(;UIFFUH (?=H8#a5#"F@F.(?-PF" C"Eig%<<%4ɠ xM&|,-OFF IN(ڷI 5F,ĕ0FK@/! FDJ F#xIh320QK#e$ICFHMSK,@𐀢O&F%FFFDJAFHFC@𦀜Kh X#$[F@ (I0iij\ `0 0*Y 2(F"F1F$$J$uI,",R rJ! D#zI:FzHsxH"!$wwH"!$ruH"!$mӱsH F(5oI8 DznJnKoI(FnJFmH:F> "x-*ghx-*abxe*i.Yx,Ui*k*e*NC\JCGC Ds( P( E(?KI(Ā-(Ā$Q8"(S =================== =ڑ=ڭ=ڳ=ڹ#9h(H#9h'H;hx^-[x+??+e;hx^.ٮ[x+?ծ?+Y%8_&ʲn&|<@th%dIT5/F3Ft|&;hx^,[x+??+9h 9hH#O O }#z%x&v$t+`0+ ii*0\0 I0\KItg/-O$FF&FJF9F(FC/PK -8.J0FOK(7,C F$FM  %CIF(5W) 0;h`6OF3C7 8FF0&#adKX)Fa  0Y]I(F0PF*0P##bP(F(sUIpC_(##.-LIJF #IBF DFGFOzV+RE #Bh+ V ?! &HFP, F8FBEFBFFFO 5 fe-O;}(OFF+`OhI8F`F8H F ;}I8FRF(IHHO*r! FOK! "81Kh1O313n3413B!0 +F:!0 , 00##-1OOGF @1HFSF1FTJJ4BKT 38F0@BD1C3D1BHB0 FSd!h1F#FF FEF(@@1@0B؁nK+!nJ F3D1C3D1V(/M(6(?(4(#aKON8(S WmswSKOsf8(?p(?mS 9#s9?M9Kh81=HP5KhH2# /;L'G(-KO#@1'Cc@1'g# ##@1? H%#mKOFKF! FE(2@1?8H#]hb ji&l&|Zti< )@𤀣H0B)F FE# FFV!EF(FKF! FEgF ђHZ3d&`J# a@0шIHB.`@p+@)FE님PPEnPNЈ"BB@B8nKhBP`]iHBBubPqP`X ]A "0[I^HB` +?ʭ F0D1)F0 C@B$)+P#D1G@B D1JJB?AIH0@IGHBBr(@;IBHC3#CCSP#CCa?$jho8FJ( $9F`4HBu$+0K1J)F/J+! F2;F-J`p)K! >'K"'IBB0I!H8FVCF+9ظj+sfh+nHB'h ~@!#^&)? h2wFHBAFXF\(Ѹ??YFHBI  ! :8FU0? 3 c+݌HYFB+h+ІHBи3 +i+`21ʀC`3 C 0rV#@ea1 ԏ30rV#@T3 a!Fr@I0>a[_HBB2FIF F@Y([HBP2R!C"@1!UKB<0RISHQIRHRJ#FA0B( FIIHjh+BIFHB*a[ ^h+AHB,Th+?|Nh +?v`#`a27HOq0 :h+1J)I1HB0H@0 *h+*J!I(HBUlFXHI$HB?#HB;"HBk1C J!I!HX HBa[@рI " B08HH|d h $3AQfH\0m1;I " B]0jGxPHb@1 Cc@1 41#FJ4A-1+? 01J#F0A 41#FJ4A-1 !R0}HB. 0xIxH,1+ !80,1+qJqIrH(pHBA@@1C@1iHlFhHB@1 FC@@1UrFFYIaHGD1Ԙ FV09FV#?<0NIWHV`2V TIV"TRJSJSHTPKRKBy0@IOH:!@s kOqG0IHBHJ#FAd!*D1Y\CsD1h1 FB)I:H # d! Bh+0*ի`0IT  B F@D1[*H>h!R#BFX PFh1S"B^ 3 j+ @Fh1S"j)9[h0 1 =hɠ\&-@ Lt\pE FB D1^ F@ ph.?`XԚF2 /PN՞pJQP4I   BC@)FD@p.Nh-?+j;3F"!Amh 0#2FIF@F@3jC0F@>0FB('vhph/:Fj 2Rh*?!KAp2s`h F`Bph,O2pPB` q  Q/0@-0 tl P ^0wYqd@0 , 0 010 3tl 00/p@-MdPP@T Ѝp `H0   @  ^ 0 @WDp0ƒ S&* 0@- "@ R P@ 0\ R^H00"@<0 0 0^$00"@0/lT@@-M @M+:++Ѝoh  \/X-M 0 p 0 S 0*0 Ѝq@p⟎{ , /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/0*/)-*/=**/'*/$*/"!*/*/*/*/*/////^ */ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ t*/*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/ 4T*/ */6 */*///*/@-@W@*/*/*/*/xGQxG狅xG&_xGWxGIxGxGTxGxGp?xG矑xG+xG\0xG瓗xGH,xGxGxGxGxG*xG7xG'nxG ..., where is one of: %s: %s not compiled in chmodddedlnlsmkdirmvpaxpwdrmdir-shsttychownchgrpdkctldrvctlfdiskfsck_msdosgptifconfigmknodmountmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfspingrrestorerouteshutdownslattachsysctlswapctlftpcugzipgzcatgunziplessmoretsetchrootT E @LD]PIS"V$Y$_&b(%?(%f*0+j/q0p0t3fb6z6-6- 9@1@DJSWJY\_ŌfhylqqJqqqJqrr1r1?7@!!DAA$5-q6=&FaFAiJiMѕRѕXѕ_ҝdҝ'i5n1H 7%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'%s: %sfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s -> %s %s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory ta D xA Qy9,I@@ }@ 1@@  ! &   @@ Y@@ unblock and -DNO_CONV?M5 oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekprogressskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblocks%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %stotalUsage: %s [-] [-ESsx] [-p string] [name] %s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp file unexpected end-of-file& no previous commandp invalid pattern delimitercannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input filecannot write filewcannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\invalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxES ? interrupt? warning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopno matchnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw.%lld%d %s: %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too longout of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodirxz+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2filedereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdateverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sMODEGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s%s: Fatal error, cannot open %s (%s)usage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryusage: %s [-pv] directory ... pvT T&T8TBTNT[OTNT[OVZTrTTETZTTTU#U U_U ^U FU <U >U5?UHU[PATH= 4^t4 f?^d^^s^ c^^m^^l^^r ^Z%p^Y'n^^v ^b    EOF reading here (<<) documentccccccccddd daddd"d)d0d5d=dEdKdPdWd[d_dfdm@ccc\ ccWs!c[\3}`c"}-+?=5If\@fbfgfpfvf|ffff@i[fV[[[[fXfXabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'!p0h!1h!1h! 8h!\0iB!H0i1!40i8! 0i?!0iHis B !: G2deTw `yH9 V[D  Kii !t(6 cEfVhi                  j<j<\=j+Yj%SHh[j=_*akb>!k k>k $k}Iʚkk  kyk%y]d>k)omk,oyk4Eak7qIG[~1k@)6kEfkLkQӁkYk`>=nJkfmklWktkn5kykivr knAlias count botchalias %s=aalias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld getcwd() failed: %sPWDOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %s-ewrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4f0.0Pipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode ELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misused/dev/ttysh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld Done(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d /dev/nullCan't open %slpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(()(...)<>>>>&<&>| && || ! | (if ; then ; else ; fiuntil ; do case ;& ;; () { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)secondskbytesstackcoredumplocked memorythreadthreadsprocessnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPSc, offCurrent option settings%s%c%c%-19s %s set -o default %c%cdefaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenonoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallvixtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntildoneesacend of filenewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)+-%s, +%#xinsufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<<asyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXIT---pUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=[]missing ]unsupported expression when built with -DSMALLeqgt>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'%s %sbreakcontinueevalexecreturnshifttrap:unsetbgchdirecholetfcinputrcfggetoptsjobsprintfreadfdflagssetvartrueumaskunaliaswaitulimittestwordexpPPIDIFS20220122 BUILD:20251006162410Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedrr `rr&rrs s I sH s 4s vrr:Dj sUs /t /t   t +t Wt$ }s t,t0 Vst4Fmt;t? Ct&  ,)tD=tJuUuYu]uaFN#uf3un#ut3u}2u|3u3u#vuuv u@u@uww uuuvu vu(vvE u0@u6u<uBJ4uHuNvovv t~C$tCtC$tCttk tttuutttut@t@t t utvt@v u v0tNtUt_t^tdtjtptvv v@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sflushrprntdiscarddsuspeoleol2killlnextminreprintstatussuspweraseillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeed%d %d TIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscolumnscookedeverythingextprocinsanenewnlostartrawrowsspeedttylitout-litout-tabsopostonlcrocrnloxtabscrt-crt-newcrtkerninfo-kerninfoechoecrterasecrtbscrtkillaltweraseiextenechoctlctlechoechoprtprteraseicanontostoppendindecctlq-decctlqbrkintparmrkinlcrigncricrnlixonixofftandemcs5cs6cs7cs8-parityevenp-evenp-oddppass8-pass8creadparenbhupclhupclocalcdtrcts-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.userfts_open@@@@@@@@@ @ @@@ @(@/4:AIOU\bis{ @@ǁ΁ԁځ  '.6<M]#?R]}['+08=CIOV]aggmpv=DNXahw~[ç# &:09@IR[dox['+08=CIOV]aggmpv=DNXahw~[ç#['+08=CIOV]aggmpv=DNXahw~[ç#changing %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashdmrumpdmd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsyesAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQquitrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] +Usage: %s device %s device command [arg [...]] Available commands: forcenonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'5<Ov   A ] <'L`u !#$&1234568#9)90:I;c<=@ABC$DKEaFvGvHvJLMNOPQRS"T+U3VKWe\oacdefghipqstu5vw;xOk|)Ie 3Og„”° )1">atÃÖáë%7Qa|ĞĞĞķ "?WuŐŬŴ5PƆƱƑ,?oǐdz8/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]@<@`~?=ˈ'rː˚ˤ'xˮ'˾'''''?j '&2Breturning to single-user after filesystem check rq,%s-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sexec %swaitpidInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbinunusedVersion 6Version 7System VEighth EditionMSDOS4.4LFSISO9660bootHFSFILECORENTFSccdjfsApple UFSUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware VMFSVMware ReservedZFSCan't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s Can't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s ** %s (NO WRITE) ** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors reservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock4444        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dDIRFILENAME=%s %s=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%s (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ffs ***** REBOOT NOW ***** beleAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSER** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'%lld BAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCKf** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d) (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)CAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK GROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODE (CREATED)can't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %dw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-     !'!0!Y!c!!ˈ%l$%%%-%?%S%a46T44455(5D5\5t556l555668 ˈ'rː˚ˤ'xˮ'˾'''''?j '&2B''''( (,(?(f( ( ) )1 )M )o))),)))**=*Q*f*|** *!Қ#Қ$*&Қ1Қ2*3Қ4Қ5+6Қ8+ 9+9+:+2;+L<+j=+@+A+B+C, D,4E,JF,_G,_H,_J,uL,M,N,O,P,Q,R,S- T-U-V-4W-N\-Xa-sc-}d-e-f-g.h.i.p.qҚsҚtҚu.vҚw.$x.8.T.e......//2/N/n/////00080P0m0}0000000111(1K1^1m11ҚҚҚҚ111131222"2<2L2g222222233373O3m3333344-4H4~4ҚҚ44c4550Қ5C5sҚ555556 61UFS0eC>!haHdInotNeedEFI>>*s(ҺK>;>?Qn|n֏- q+? ?Qn|n֏- q+?&?0Qn|n֏- q+?=?FQn|n֏- q+?W?bQn|n֏- q+?pB=Gry=iG}?t?M;t???WmCĄ 3KOO?c"yD¢<#*=(??РD3h&?? \M}-??-ıܹчH?-ܹчH@IZܹчH@,I􍂱ܹчH`~@?I􍪱ܹчH?@JI2ܹчH'r@e'S@ۿ )Ѹ`@r1*@ە )Ѹ@&1ۏx )Ѹ@@backupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdecCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%jumbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]swap4.1BSD4.2BSDunknownHPFSADOSLinux Ext2RAIDVMware vmkcorePrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'removedab:i:L:s:t:remove[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] a:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%s: %lluType: %s (%s) GUID: %s Label: %s NoneCould not find index %dDetails for index %d: Start (active)UnusedExtended Pri GPT headerSec GPT headerMBR part GPT part %lsUnknown %#x[partition not found?] %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5d show[-aglu] [-i index]type changedab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-la:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changed-agpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.cstart_sectorend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXentriesGPT_HDRi <= INT_MAXname[-o outfile]/dev/stdinFi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDGPT_TBLgpt_arrayBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endstart_headstart_cylinderUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsYYYsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatus'b 6printallmaindo_setifpreferencedo_setifcapsViz8@c.iyknknkn7Xr;,c6knkn7[<&;Xj;Pa;xZ3;c=7`b:\cFQ7Z;cW;cOح7cVح7cucccc ccc@cccc c0d@dddd!,d% d0d6 d<@b 6init_current_mediasetmediamodesetmediaoptsetmediasetmediainstf6GfAf6fLfSfZ'b fAfZ f6fZ`fbfj@fbfjfAfZfLfSmedia_statusmedia_constructorff"ee<e#f"ee<ef"ef"PnA7n?8nnu7nT>kJnT *7?hn>n>ln7n?nn1 *7n>i>nmmmmii%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sinetnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflagrc/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLnot a broadcast interfacedescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedmetricSIOCSIFMETRICSIOCSIFMTUifcapsifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATASIOCGIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPdownifaceiface-opt-familyoptional silent familyopt-clonemiscifflagssilent familyiface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandsnonewait DADlist clonersdestroydeletetrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6arpunnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cmodeunmediaoptoptionmediasubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types?malloc media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkbackupmasteractiveno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0x%s: getifaddrsaddress:link%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tag?NONEAES-CCMPWEP40TKIPWEP104AES-OCB...SIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAz{zzzzzw>zzz{{%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s (%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupG^}.j}2 }: }B5P}H@}P}W}\}e}o}s}x} bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node egjo:r%s on %sdevrdonlysympermrumpgetargsextattgensmaplcasecasetransnrrrripjolietrrcaseins"%s" is a relative path.G^}.j}2 }: }Bf\@fb5P}H@@o:specified device does not match mounted devicemount table fullincorrect super block%s on %s: %sreloadforcedevmtimerelatimeWarning: realpath %susing "%s" instead.G^}.j}2 }: }B f\@fb5P@?}H@"ruserquotagroupquotarwsuidunionhiddenautomountednfs4aclsposix1eaclsatimesoftdepextattrG^}.j}2 }: }B}H@usage: mount_kernfs [-o options] /kern mount_point getmntoptskernfs on %sG^}.j}2 }: }Bf\@fb5P}H@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:stat %suid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %sG^}.j}2 }: }B5P}H@kc @%,4:?(C  "@I @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvConflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%crsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimerintrnfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %s5PG^}.j}2 }: }B}H@usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o F9V}Bj=]%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatmaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %use `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big ...Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device where fsoptions are: Bad inode size %d (only 128 and 256 supported)sector sizesector size `%s' is not a power of 2.block sizenumber of inodesVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: open for read%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s%*llu,%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @BCFILNOS>aOb_cje~fhikmnor,s=uN@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:X@@\@h `pdp hplp p `uz @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorsCan't parse timestamp `%s'sectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'bytes/sector"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u%s: unknown standard format1601803203606407201200123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()okgc_[WSOusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /tmp/option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: out of memory no filename match. glob() aborted. unknown error! cd%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptywarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d seekI%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYM`y9YyGgUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkchangedstexpirehopcountinet6lockrestmonitormtunostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecFPFP*0 XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print01Y1Y 1Y%1Y 21Y@R1Y_e2mt331Y1Y5- - '5 1Y  !1Y  51Y  E1Y  W1Y c v6 1Y c 1Y  1Y  1Y  1Y  1Y % ,1Y E [1Y y 1Y y 1Y y 1Y y 1Y  77 1Y 0 51Y C J3 [++ z1Y 1Y 1Y 1Ybitmask_scankCpw|%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s???%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worlddpswpriority=nfsmntpt=empty mountpoint%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytes1M-blocksGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpfetch_ftpfetch_url/0 0+sendrequestrecvrequest666666***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. r+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129Version: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistoutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernamePASS %sLogin failed. Account: Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sAccount:?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. MLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicftp_proxyhttp_proxypagerpromptasciibellbyecdupdebugeditepsvepsv4epsv6exitfeaturesfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepdirplspmlsdquitquotercvbufrecvregetremoptsrenamerestartrhelprstatusruniquesendportsitesizestructsuniquesystemthrottletrace'%s' macro not found. ?Ambiguous command. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s] Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initRequesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandQUITCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't connect to `%s:%s'Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR RETRproxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEpassiveUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpasshttps_proxyno_proxyPAGERFTPPROMPTFTPRPROMPTsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. loginaccountmachineMDTMREST STREAMTVFS Remote system type is %.*s. unixlinux215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEATlostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): USER %sPassword: Login failedACCT %sAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for on[set] ~{[*?$`'"\echo %sfork"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dlink downunsupported speed %ldConnect failedescapeparityphonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraectbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zero%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busyPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5d n r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizehostphonesraiseraisecharrecremotescriptsctabexpandverbSHELLechocheckdisconnectlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzxyx-S SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data&1nCannot allocate memoryLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESliCOLUMNSkrklkukdkPkNkh@7kDhcxndaticlcmsovbbc|^ crsrNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE/dev/nullHOME.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]& There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~\LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ %*s Line numbers turned offCalculating line numbers/dev/tty (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadshifttildequoteswindowmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by textlabel%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE%lu \abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set tois%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i0080&;@00&!0&30&+11 &.11$&/151=&01_1j&#11&"1F&11&11&21&511&1&.F11&.(1&.x2&42 0& 2M&2%22&42722&#2H1 &%2R1&&&2`2h&'22&$2F&(2&)2&*21 &621&&72&822&,3F&93&973 &:6collect5L=5P=:F2=ˈ'rː˚ˤ'xˮ'˾'''''?j '&2BNAME=?=`~@D@      !"      !"#$%&'() str_arg_substget_available_cdsˈ'rː˚ˤ'xˮ'˾'''''?j '&2B edit_fs_type_ext!7)Cqݝݱ1LQ_ljo}edit_and_check_label ˈ'rː˚ˤ'xˮ'˾'''''?j '&2Bdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdt       A   Y     A '      A %disklabel_change_geom0 ]@outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default&R&R&S&Rpm_from_pepm_whole_diskgpt_freegpt_create_new| )   } G ) 5  o  a  }  - E i 1'r??>>>`~ ?t>?`@@ ?p!`ˈ'rK`n`q`v`{@`~`````?=`Q``?jD@(````@`?pgpt_get_part_devicegpt_get_part_alignment !' !Y! Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eC>1UFS0eC>!haHdInotNeedEFI>>*s(ҺK>;>?Qn|n֏- q+? ?Qn|n֏- q+?&?0Qn|n֏- q+?=?FQn|n֏- q+?W?bQn|n֏- q+?pB=Gry=iG}?t?M;t???WmCĄ 3KOO?c"yD¢<#*=(??РD3h&?? \M}-??-ıܹчH?-ܹчH@IZܹчH@,I􍂱ܹчH`~@?I􍪱ܹчH?@JI2ܹчH'r@e'S@ۿ )Ѹ`@r1*@ە )Ѹ@&1ۏx )Ѹ@@ bbc1.c"c-Ac>cHcPcZcjcz ccmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new00$ ʕ s A E  ǝ  S  ;  m ɑ ! 1 } Ϸ ߉mbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_freemsdos/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages/sbin/halt -q/bin/sh -i -E/sbin/reboot -q <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noexecnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionendavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.# Script ended at: %s sysinst terminated. # sysinstmsgs.TERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certsFTPSSLNOVERIFYsysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease10.1_STABLEevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv7hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mountdist postfix.tgzdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hfeb/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script fileLog ended at: %s /tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etc/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF /sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/%sCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %sudf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s%.*s%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinstmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICdtbetccompgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c---%c-%c%c: %s %s %s %s %s%s %s %s%s %s %s %s/targetroot/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOs,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdatexdmlvmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%cr%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%u%s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%llu%s/usr%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %s (vnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing cat <%s START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zero/dev/r%s%cumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalse/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tablev7sysvv71kv8lfsotherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmwresvvmcore/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0parts != NULLWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDLinux swapNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************&fofsfwf{ffusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading input%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiBcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2Y,1dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionb"c d)eXf-gh+ij9kAlmKnoRp_qr]sdltu vtwx{zyABCDEFGHRIJKL-MNOPQ STU#V-W7XAZ~1P4Y6bl|}~}q5yuZ(5?PNWU]jpv~/default_configread_configrt_compare_proto Gu Gu E Ert_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt F] F]rt_buildrt_delete E Esa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initx,%4-script_buftoenvPWmake_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osovzif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DC@CDread_leaseget_leasedhcp_openbpflog_dhcp $-dhcp_bind9BJ@R Zdhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceSTOPNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d timed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningkillwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurloption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptenvreconfigurereleaseleasetimerebindpersistentinforminform6timeoutwaitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbindownPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.clo0%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASbridgefwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigreading standard input%s: reading lease: %s%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s not foundviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedUVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B    & %, =2 U8 m>  D J BBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~PXP` &,28> @DJ΄̀|@@`@ @&A,,Ap2A8A>B<BDBJCtc/etc/group/etc/master.passwd: (malloc) Error in munmap(): JjhPUPuVvXxZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctupperxdigitASCIIUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error C00incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k1.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist