'Vph0mbNetBSD/earmv5 ramdisk 08*h<  *hT#.}t t*h@@<@T 08*h<  *hT#.}t t*h@@<@TU *ht00`A*h*h*hA*h*h*hA.*h*h*hA*h*h*hA*h*h*hA*h*h*hA*h*h*hA*h*h*hA*h*h*hA*h*h*h(C*h*h*h)A*h*h*h*A*h*h*h0$h *h*h*hmD *h*h*h (08@HPX`hpx$|*h*h*hL$I*h*h*h (08@M$*h*h*hHPX`hpxE$v*h*h*hEK!*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*ha*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*h!*h*h*h4!*h*h*h!*h*h*h!*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h B!*h*h*h B!*h*h*h!*h*h*h"!*h*h*h"!*h*h*h"a*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*ha*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h!*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h!*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h !*h*h*h!*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h?\!*h*h*h>\!*h*h*h=\!*h*h*h<\!*h*h*h;\!*h*h*h:\!*h*h*h9\!*h*h*h8\!*h*h*h?\!*h*h*h>\!*h*h*h=\!*h*h*h<\!*h*h*h;\!*h*h*h:\!*h*h*h9\!*h*h*h8\!*h*h*h:\!*h*h*h7\!*h*h*h6\!*h*h*h5\!*h*h*h4\!*h*h*h3\!*h*h*h2\!*h*h*h1\!*h*h*h0\!*h*h*h7\!*h*h*h6\!*h*h*h5\!*h*h*h4\!*h*h*h3\!*h*h*h2\!*h*h*h1\!*h*h*h0\!*h*h*h2\!*h*h*h/\!*h*h*h.\!*h*h*h-\!*h*h*h,\!*h*h*h+\!*h*h*h*\!*h*h*h)\!*h*h*h(\!*h*h*h/\!*h*h*h.\!*h*h*h-\!*h*h*h,\!*h*h*h+\!*h*h*h*\!*h*h*h)\!*h*h*h(\!*h*h*h*\!*h*h*h'\!*h*h*h&\!*h*h*h%\!*h*h*h$\!*h*h*h#\!*h*h*h"\!*h*h*h!\!*h*h*h \!*h*h*h'\!*h*h*h&\!*h*h*h%\!*h*h*h$\!*h*h*h#\!*h*h*h"\!*h*h*h!\!*h*h*h \!*h*h*h"\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h \!*h*h*h \!*h*h*h \!*h*h*h \!*h*h*h \!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h \!*h*h*h \!*h*h*h \!*h*h*h \!*h*h*h \!*h*h*h\!*h*h*h \!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h\!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h!*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h !*h*h*h!*h*h*h !*h*h*h!*h*h*h!*h*h*h$!*h*h*h4!*h*h*h!*h*h*h!*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h !*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*h!*h*h*ha*h*h*ha*h*h*h!*h*h*h!*h*h*h!*h*h*ha*h*h*h a*h*h*ha*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*h?\a*h*h*h>\a*h*h*h=\a*h*h*h<\a*h*h*h;\a*h*h*h:\a*h*h*h9\a*h*h*h8\a*h*h*h?\a*h*h*h>\a*h*h*h=\a*h*h*h<\a*h*h*h;\a*h*h*h:\a*h*h*h9\a*h*h*h8\a*h*h*h:\a*h*h*h7\a*h*h*h6\a*h*h*h5\a*h*h*h4\a*h*h*h3\a*h*h*h2\a*h*h*h1\a*h*h*h0\a*h*h*h7\a*h*h*h6\a*h*h*h5\a*h*h*h4\a*h*h*h3\a*h*h*h2\a*h*h*h1\a*h*h*h0\a*h*h*h2\a*h*h*h/\a*h*h*h.\a*h*h*h-\a*h*h*h,\a*h*h*h+\a*h*h*h*\a*h*h*h)\a*h*h*h(\a*h*h*h/\a*h*h*h.\a*h*h*h-\a*h*h*h,\a*h*h*h+\a*h*h*h*\a*h*h*h)\a*h*h*h(\a*h*h*h*\a*h*h*h'\a*h*h*h&\a*h*h*h%\a*h*h*h$\a*h*h*h#\a*h*h*h"\a*h*h*h!\a*h*h*h \a*h*h*h'\a*h*h*h&\a*h*h*h%\a*h*h*h$\a*h*h*h#\a*h*h*h"\a*h*h*h!\a*h*h*h \a*h*h*h"\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h \a*h*h*h \a*h*h*h \a*h*h*h \a*h*h*h \a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h \a*h*h*h \a*h*h*h \a*h*h*h \a*h*h*h \a*h*h*h\a*h*h*h \a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\a*h*h*h\ !*h*h*hi!*h*h*h!*h*h*h!*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*h a*h*h*ha*h*h*h a*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*h!*h*h*h!*h*h*ha*h*h*ha*h*h*h!*h*h*h!*h*h*h!*h*h*h B!*h*h*h B!*h*h*h!*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*ha*h*h*h!*h*h*h!*h*h*ha*h*h*h a*h*h*ha*h*h*h a*h*h*ha*h*h*ha*h*h*h*h*h*hbpf!*h*h*h $*h*h*h$>*h*h*h$*h*h*h$s*h*h*h$*h*h*h$*h*h*hA*h*h*hm*h*h*h$*h*h*h $*h*h*h A*h*h*h+A*h*h*h,A*h*h*h-A*h*h*h.A*h*h*h/A*h*h*h1A*h*h*h2A*h*h*h3A*h*h*h4A*h*h*h5jX{8djW8:ݤ5= pY"&4JT-^ rHh :)qaJW<5")53'q2WOir3qYai<%X9`z)߼BfuPX=(} +J"4)2+0DO:BNֹ#VM Lǧ/ Z>O_[YcrwRs-1;/stş'n !OTbdd?)c>OV &xDF'"$jo;D$8 s%lsARFwB:!]u4'"#B?;WasOEZn ˺S"9mk8JG`9UIfuE#9ҤkkES_]I0-ui9<1A{E:VecDbfF@&5gWq ?<:y75ES t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4 4 (** %%uHH %%NetBSD@ ;PaXNetBSDearmv54H H D0P/!p@-@P`C`F&a03/T@p=$$A-`0`` 0PpU(pGpG@Pq`P03/T@0US s0=$`@-lPQMK \!\1 P` 0 R: 8 0S  /S 0SP 00S5 0pp WI2I0@3)1*03/ T@p0pWH2H0@3(1*03/X@ sL0d 0 P0 0^h<$(l8$H$ $x2@-t ttPl@dphP Lni@`POU dP @55(%7dP@-@sH0`  BR` pR RX X/x%%O-pP  b 00CS0w p@ [E0S TX 0S7 0T0 R0S p ^|16@' 0@ LA`p000`00<16@0 0S @16@ 0S $p @ T T 0S ^p Ip0S TMxp -tp @000 ^jp T?@0 @%%[L9%x%9BQ9O-@Pp`0ĀĠ00S 0AP  0Q @P p0 P00S Ѝ @0 P0=T0`00 x%%flN9A-1Mfv1 Ah$0pS&h(0S CP0 S(0(P UP$ 庙$0S;(00$0( $PP  \失00ЍD'$ d0PPUx%%V9%9BO-P`q`a@\1tHTTTM$H00SE 0gAP0@tH$H) j R S@Pp`0: S Y U0 P00SЍ6@P0 P0e0s 8#8T ;Tx%%f9o9@-0 9(% 000/ %G-؀P t0M@   X09`p   0 PЍ %Y@<(%@- M @00@0  nP ܰ Ѝ<A-` p1V0zP 0 @P@TV  PD 弰 W@V2 C0S@ 媰@0;0P W 0XplCV pcC0-S T`劰@@p ,P@0S W ,A%<< %<O-5M R  @Px Ѝ Lpp LU@@5X`0S 05 ,500 5Y0S50S+ D$PD00CS0@Ĥ Pp  @YT *@0 @00CS0 0 Y(0 fp4 00Op pP300 80: S3 +pP  p* R@t Y0@@ 0, 003($05y00000 R00SQ 0 0  p%pE  p @ 0T 1(#I0 t 0P# xx堯@  P T嗯@|0S IP X劯T@! (+(" 0R@D 0[0TT$@  5p00 R0S ll]1 0S 0 9( 9 P P @T f@P@0 ?oR20S 0  0 0R0P %@(P ll@0S L%P@ P0Rt00!RP 0%,A%9%%%%,%(%<x%h(%$% = %I%<%@%0@-MM@P  p  ;0U$C d&P TTծۍЍ08 P ,(0P X1=,A%>=I=$%Q@-@ TP DD岮,P $ 0P@,A%>=U=$%Q@-@ XP HH哮0";P $ 0P@,A%>=`=$%@-T0 Zj=(%0$/'0$/`&@-D?@-Z?@-q?@-?E>@-1   0 0 Ѝ?'@-1   0 0 Ѝ?`&@-1   0 0 Ѝ?'@-0   0 0 Ѝ?P'@-0   000 Ѝи`&'@-0  $ 0 P/ Ѝ?0E%@-1  (0 00 Ѝ?X'<00/@-0   00 Ѝ&?`&<00/@-0   0{0 Ѝ&@',0C-`A!圁!ᘑMpW0 |! R0B=00 B  T埕0L!D!7 Q<A 84100ЍPP =5R 0HHGH<00S ,;$0@k(%HH'H<'A-P@dp`T0S P 5!$ K '(%HO-`@ ؀P0S p0 T T R R 0plP Ѝ PP P   P Pp@ '8'@''A-p0`!S@RPP4 0嶻 @'P6Ļ P0!S P 4夺 0LL噻L@00S 0卻T@G@YYk(%HH'HO-@pb00CS01pW PU>ءTpp0pp00P"M4a W 00CS0Hx10 t@p@P0 5 0p0CS0100 S0 0  X 000 0 0 0@ 4 tC 0`00h0 P`0W0$0T P 00 x%$'''(%t('@'''IIO-PpP0 SPEUP ЍE P 0C0 X0 Ub000eP3ƹ 强 00C0S.20 & 0 0CS0T200 . Z0 P CPEP 000S S  `V% V000P c3w| xmt 00C00 0CS0D100 0.X 0PFjP 0Z0 CPF V(崀VPP0PP00ԶP !35t p+l_ 00C0m0 P0CS0<00hj00`6'''(%t(''HO-P@`p oP`T $. 0PS fP 0@^S00\P0S \ [ h!P @P@+0P001IDE%6I?I% l@-T 0@D OP 0S( 0C00S 0C0 Ѝ('ht@@E%P0 R  QQP0R/@- ('0G-P`P@ X 0S@ @0S @T@@DT pP 0S 0 0 ePЍ('HIG-@P tp0S^`[PUP 0 @+P @P0('X0000@-@Z 40aA R    0/%QI('40000 0h@-; %('QIO-R蒟@ 刀p0 pWp0#s) 㼢0`?VJV$ V0 00 0S0 =D 1 帟1@s410"S00 @∀ FQu SUUUThUUDUUUU ShU STUTTTTTTTTTTUhUUUUU^V^V-Vk @ 0000@^V-V00@R v1 p c1@s@l10"SR 0.V@0 @R O /Fo@P0 R00R  G@PR 00;V0 00 X@} T0Sx('%'hI00@-@00 005P 000 0 00 ,R;R 0S  S   0;SRp(' p@-PD0QS@@R0p`VP 0C('p@-P*@P 0, ($" p 00ꇵ(%tQ 0Q\S@-Ao/`@-0S*  0@0S! PV$pP +PP @P ዳ0 S</R/     0 ('YY|II( Q 0@30/@-('00@- R 0C30('A-plA1SPR a00S S P0!`0`00`0S00 S@P0.S0 S 0P00`P 00CS0"0 l W  QU0圁0CS00 pP('x%G-AP 0pRpGWR0`0`0$!` 001S 0100CS0H89 pP00CS0' 0S  `P 0Sp`0 0`0R00 00C0p00  $`p('G-p0A 0RSXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*Pz`('G-A 0`0P0 P 00CS0-0 o& 0FSSp P1S 0p10 PE0CPPBSP0('O-TB`0pS&#P UC0S0001XPPPPᗲPE 0Q0CS00LN <*P[00`F`0^P/  S P) 0100CS0G'(BP; 0堑0 S- S   QP.岴 娵00CS00  0堑0CS00  )0Py('(%tA-A`qW ڬQ1ECe R1 0 C0|00PPL.` V00CS00 t 0q0CSQ00 \R `R `('(%t0O-D0!105P` Ѝ0S/T SPPP  媱P- X TP500CS00  ^0Q0CS00! P1ȃԣԓ 0 S*"Rʜ0Upppp00kP 0r0CS00 ) 1Q !@o!S/ %S pW U 00 0<P 0帱0CS000!000\Q00pPR# QUpp0pp00 Pb 0q0CS00ik0p 1 1S 0S11a0S S`l   P5 0a0CS00<>10P!pE S:`00  1S `X(qP ʼ10PE pBR    Pp|000埰P 0q0CS00 ('I(%t'4HI( Q 0@30/@-G('`01S @-0@!S @)P /P /('I7@-A00 S1 RUWʐ0\00JPB,嫲 塳00CS00- 000 @P R0 R P Ѝ00!S JP HN0 Sڴ 0R0CS00000  \00sP 00('%(%tII?A-O0 R P%Sp WS ! GYPZYRW~\~m|opuu|o{k(llhmn|oDp lR? 00 S1S"%('IIJIPE%LE%J/J,'(%0KJ`J,HHtJ''GYYJ'@E%hI<J4 Pt" 0"0" " P0PPgP\p PPW0S- `V0V PPp0 nR pR lR 00 S,1S945P0PP0SP0 nR pR lR 00 S P0PP QR000P0P0@l `P 00 00 P0 nR, pR% lR& 00 S1S0!S |0S1Sq bWW 0 P0S0P0PP1S 2SqX<0S 0l0C0S 30 SL P0010CS 0nQ( pQ! lQ" 00 S3 00SK$'` `S@p'0"SY`w 0  P0 nR pR lR 00 SP0xS uP0PP0SPNP0 nR pR lR 00 S.P H2S~$P0PP0P%  p-@- 00 ЍЍ/','-0^S0]S0]S S]S[S .0A0S>30   \  R]\0G-霁`Pp0 SS'PG(!RJppU``0``0,0@P.c&w0 ,m(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A ! L0 0pS G 0',''(%t('K@'p@-!0 PJ@p P@01S?0A0S S n@P P0P 00S|`0`00 [P0A l0X 0̴0a0aP`0%߫, (լ$'HH,'K'''(%tO-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00$P@ 0A0CS0p10H 0P \RI0P 0 S 010S P/ 00P S)  R [ U   P00%D :n00CS0L00} W0`00Pp8 P'`'tJ'('''x%(%tA-@`@0@P X0@ p>P" 0 R00R000 1BQ$@ @XҒ@p$0"S,@gR000'`'hIO-@cMpS嘳嘣00 0GS T`s000T3TPPPPXP$幪( $寫 00C0-0&SM0 L\  DQ<Y0 0C@p \  0+P 0v$努l h倫d00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW  B@ \  ҧP AQ 0 T Tp p pp  寧P p BR   @e0 P0CS0,00 0 r`''('(%tO-M0@ ]0P0ߍT40S 0 L0 000(0pP@Pd p0 S pSx 00 0(0Y01 Y  $ DP$#天 嚪|  B Rd30    BR  300S 0 0  0(@P#Qb 0bppG XxlY 00 0P\:#N, (D$x00C0S0 Y( Y 1  ϦP1 #. $X1  B  BR p100S 0  [ @ Q 000 "2 0 0(0P1 0 0CS000SUW#00 X00S 0 L   <  0S@'`''(%t(',KO-pᰡA0M0CQ` 01 00C S00`Op   0PЍ5 *P!` 00000`P00CS000  [  }0S00CS0x00` P  P0'<''4'HI`'('O-RB0M00bsp 0saЍܑ0ԁS 1 7  000P@ 0##⩟ɐ Y Gt10S 0p0000000CS0D41<  \$ \ 0 0#0L\ 0C000@000000 0C LN "8'LE%<'GKt''''('A- `P0 0Cs 0p 0 h0 d   B 0CR0@pT s@t'<'LE%8'G-@p0 PR` 0 P(S%0  d CP _0 ,U(ͥt'(%t@-;0 AWK(%O-eGM0PS@pM$Q403/P DGݍЍ0: S!00W +  P8:!?0℧P0: S 0SlP0: S 0S 0S 0/S&ZP7_0p0pP- ucP 0#vݦ PvO+0P ]<#Pɦ]"P ΍/+P/+P 0P,I [)H Z& U9.0. 0PT:.0. 0P@D!0Q\ PT1RP o R00S$ 0ST 0: SP#PO 3  0G=00 04K G=00J0SP/ HqXG 8X700CS0p Pp  pYW CSX0 X p00CS0 0 y0S APP 0 dn R;c 00A'x449L6Lm*L%]Lx%(%jLxL\\0\\X X0p@-@P@@DDT` U H H0Rp@\\ppX 0Xp@-@P@@DDT` U HH Qp@\\ppX X0p@-0P0@44T` U 8 80Rp@\\ppX 0Xp@-0P0@44T` U 88 Qp@\\ppX X0p@-PPP@TTT` U X X0Rp@\\lppX 0Xp@-PPP@TTT` U XX Qp@\\QppX0@-t pX0pt0\@ ^0@\\<X @-0ptX pt \@ ^ @\\&5S %R R S R SSh -^L^S R 0/0/0000'O-QM\v @ `u @ 0@0 @0T0@@ @L@P@,@0@D@H@<@@@4@8@5 SS$Ť\ Ps0 !00`V0SE 00吐0T0S{ 40D0800<00@00$0S00( ,00B?$x❤x,0S  @?C000`$0L0x0P08D0儤x 00$x|x$0S00D00H0#0xlx,0S  @?C 00 0S 000 0#xSx0p#xKxy0 \ C@Q C003/040 0S 埢Y\ RS0 00 R0!0T0S XP,0x |S00L 0, 00PPP050L5[D1p0tQHD0 H Q (4.Z(.X 4 4 8  8 < 0<0@00@0 0Sf QA 0 !`ܣ`0$0Q= 0 !lңl0(0$ 0S0( 0 0R  P <X0j@0S00X0 0X00ҟPPA\0.S}0Sz 0!0P$0 Y0P(0 $W0( Q R X0HP000Ѝ'/VUUU\c@ZO-@a!80S TPP" dpW  ЍO<0Sp|倡倱B@P '@#@!0SL H50CSꄦHԥXԥԥX\>r $ 5r00L0S \0.S0S c@0S40S hb <0?oQ20S X S040 Ѝ'tLL:o;G-po㩢P0EL0 cP0S%00D0H0IP0` Px0  FpZ\5T H0J0P 0 <9P D5X0 s0X00 00dt |  ` `R`S Y I( ?R004(0x |0R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z  000Ѝ1@GPꨪĬĬĬĬĬĬĬĬĬĬĬĬĬĬĬĬĬlĬĬĬĬĬxĬ0HĬ|ĬĬĬĬĬĬĬĬĬĬLЫĬتĬ$$<T`p\Ĭ40PPL0 P 0PPH0LP PTPFX0s0X0 0PPLPTPHP<0 00PPLPTPHPX030LPP00PPT0LP P0`P\0%0\P`0!0d0``0<0080 `000DPh0lP 0DPhPl0004@p`l0 h000  L00S   J9L(%m M'''$0\ 0S 85'm90L0S/0 000/@-0M0S 0 00!pxLpЍd0d@ `0R@X0 0B?q  0Ѝ@'''[(M8M'MM'P `00CS`0p S00 P0S X0X /Xx%: S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\屠@T10S H10S. 00 00,10'p  ╠@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B?  0eT00S 'JM''[(M,'' '''BM''s@- P@@P `PU00S @GT CЍp0t  Q \0 \0@-T (P@$UQM('0'p@-P@Tp0 0C0  ,A @G-@0M㯆43030S`V0Ѝ0 0C0w 0XPS !,ٟ0S 20Si  4 "; $Fp  ⽟⣜0 0 p崟T20S 8@嬟 (0娟,20S  $堟0 : SG( 2"6000 0@0<01"$0㌟10SP 91 100O 10S10S : S0: S x`|P1Pq 1Rp@1 B? 0 U'Q p 4 Al^ 4800S00S 0''''jMJM'[(M,'sM'bzM''' '''BM'''1O-0S,0@010S 10S40 001q 1000PS ЍOXa0PQ 0P 0 `0S p QPPU% Ѝ  B 10`    0S[  L0  ,R4   V ''' 'TE%'dE%0'010G-S,0@010S 10S40 000 0000PUG_p0눠PUG k0 0C0 W bp0S,4  `YpP R`''' ''TE%0G-@0T,@0@SP 00S40 00@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S,4  Dp` ''' 'TE%@- M @ ዜp ЍT P 0@  QQ  00sT P S  %0p@-0PS``@P P PA}@P4 P孝ṛp'G;M9C-CM@q ` PȐ`T *F 0pPPCߍw ? P@w0S ?@ԛP?oP@%@- 㗛M(% 000/<'@-ַ0 ܝ㆛M(%@- MΜ0P ! 00A00P!0 0ۃH ^pу  Ѝ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx "$ 0P @000 h0h =pX   DHk"$  (0k<' NNNl<69NoNkN#NBNO-P@PQM ᴛ`Pn ]0Sr   僃`P 0S ṜP s Qd00CS00pp/`Ѝ0S ᚜P XᣜPᑜ`P`(↙1 44 Rt(tpkx0) 0 p W ̓00CS0 p pYW 0 P 0S  tgXlP `0: S P8X] P H`0: SpP` ߚ`Pb0S x ǚP@ PςҚ 哚[ , P 庂0˯S ,!00 j 1d 0_.! 0 p|Op|吂ᔚ80H0 ŚP 8~x tšP J0S q`0;`0`嶚P f屚P 30-S  Y]PTលpPh`V  <噛M`<'X`wN<(%x%l[N9N9NY@< =NNNNs@-@ `PP0P UЍpU ܚٚ\@ 0 P4ȚŚ@`OhE%oOYO~O\OA-Q~M0pSM @0` x0`[P\! p~,⻙P 4!j1@~܍Ѝ0 0`=P ~,➙@Pʃ ~,╙P `0 0PW 5Q \00 00 PY0$ #1hE%mOOOO(PXP00CS0 כ0 /O-D`LMp h000tTt$tt000 0000SPV04`0p Q 0SI\#)P0#0V 0030p Q  # P0 00d#0V00<30 #P0#030002PkP0"00 0LЍp(0: S |0 S%l KP000`P3)0-V'V|ЩVrX2PUT  ?0M1PP S0 0 00k qpn0S0 0V00R V 0V 0d1\!00X!00@@D!S9``T`~<0V 10S0C ^:ˠˠ\:PV0 ~,0 e~\P0 P ;  0 B\U0Y 00V T0TO-rM4M R0`RX0@FP}0 0S 0  0 F0S(0S l  \"婖X2p00 08"✖>00 "#╖Tq " #>~܍4ЍT 葟0S =! !}!0`#w# # L0S1p1 00c 0@!^>0H!041 Ph0D0 3/P2 0S 0 R 0pU0403/ +A00S Y'P0h0CP0PPܴ'д'8'L''8.'Z<'=''T'0'H'\'P'2'@-@@P ( (=0'Z@-p @@  (9Z@-@ّp 0 (@MZp@-MPJp@ 0S  0C0  `4p 0: S `S NS Ѝp@C-MpPЍa0H03/P0 03/PxphA]P@ 0AS0@0 a3/PE0 0)P)3P/P \P0/S0P A0 0006@ L p (0(03/ TDZ~ Pܴ'8'<'='%x%bZ\'O-MPЍhe0H03/P0 03/PPLx,5p0S 5}P  %'40SD]7P 0(03/  0 P 0AS0@0 a3/Ph4C00/DP 44 C$P40S  GP 00  <P 0R S "`Qd 03p Qt 0pP\P H9SP3` Qd 30/SVP  AE 00  P0SU 0S "`Qd 02p Qt 00S "SB 0H 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100`"Qd P  t1 ,[ T RP (1|0 Q I @ 9/0S 0S 0S 000Y\0C00,4S 0S 0ܴ''I%vZд'8.'\'8'2'̴'<'''2'2'='''L'T''I%H'G-Q@zP@T  T 0 &H03/P0 03/P0SB0 Y Phhq 009XaMP P: 0 P0(03/P@BP 00 @0S 0 00QP@! Rh;P0 l0S X0 0S LPY }Pܴ'Z'L''8'H'T'/U\'|'ZT0@-0S^PP 00H03/P@'ܴ'0O-MMDp$0 PP0@4@~z=0 CۅzT 4n6 8u PF@$<P>4S(4R0(4o k$hR\00 X0S 0(4| 00H 0KލЍ0p|'k'''I%6U`I%h`'_``/O-p@M W 0DP 0S08 0<000SPP0C080pG0S 0`S * 0R 08 0 x x/  P8 q@0 X2@ @?^Q*b@0 ,0嘰 R P` dЍTT ꆁ D ` `@aa ''a('$'Rs@-Ѝp@ 0@`PQ08  P0 7aP'a0@-@MPP600<00S  = J" Ѝ0P'G-z@M`Q M Y #P P 0P 0P=! SR J(?ݍ ЍjPJ8| = $ HL0RP J(DP 0PQȄJ8 NaPcaaG- AP ]000qPU+`00CS0pU 0 0S U 0 zP 0 SP P0SP 0S0 0 S P T'`'4I%x% 0 0 S00@-@R00000S0@000S `qP LP40P谴''T'' aP'p@-PP 0Sp `H@Pd O@P0/S0080f R P@@@@paaT'h0 RX R  H R/< R/ $R/Q/ ;T'Ĵ''Դ'l0A-0S X0XP@0P`PpT R S* 彄0@P'T'(%bO-c@ 04MS0S zBPP P0 0P@4Ѝ50C S5%`%(%`%$@%`%`%T%T%L20S 0X0(00!P0 000" " x  0!$!$! 0!=C X 0($ * RC 0  R<  R)  R08 0H! 20 J  !)1<@P@ 0 R  R0  R $-0400S ̈́!!" # "040+04 P0< 00  T'P''PuS+<  RL'[bbbb;@-@XM="p:(0 XЍc7@-@Pp GP Q Ѝ0 0: U/ Ѝ0@O/0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq/@-0CP0%S*0 ,  ^Ό!0W0CBPBb 0  0ΌC S*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 B^00 C@ T A C@T   \a0C R  @-0C0S0" ^":00NB\Bb 0  \@ 02W"!N ^*040@-@T@@  輴' cA-P0q0`Q VA-QQ@@TQ S AQA蒅:TP0 dd?@ 0:S@ 0S000 @,x'\%Fc(%]c/s@- ` P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* & 5#P00PG- 0S)`P |0P  T@R p00T0pT0S ,1@Pp=,PP ~vcc'cs@-@dPP0@l C300Ѝp0  R R00`a|@P 0 `F |00ꀳ'@-  ;-~(%c0 Rr @-/I%@-4@4(-(%- "--~(%QddefO-pဠ倰 @ 0P0 p`0, Y/   `&gO-@lM/`8밯PIPP 0p px/xx_00 \?\/~pL?H?A0s 4/S XB\   CRX0`F>=~zP񟗳$9\73\79\7\7\7\7\7L9\7\949<9D9\7\7\7\7d9\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\788\7\788\799\7\7\7\7\7\7\7\7\738\7\7\7\7$8,88\7\7\7\7p98\7\73,8\78\78\78\7\7\7\7\7\7\7x66\766\77\77$7,747\7<7x777777777\77><P q,PM>J=0 -R,Q0 00 0;h= |=l, 4d|PX(, 0! 1 <,:;;;P ;*:*:*:*:*|:*p:*:yh; d;yT;sH;_@;Qp:i00pL T:p'7'<;p9P440SP ; W S%)00py00S!P50S D9  0STI0S 0S  P 0S|90lЍly40X0CP0P(Py0S 00@00PX P@P90Z ~0P0T Y# U  RL S| ` PPYU``V C|(P  0S  P   ,| PU`` V   |KP |`  P00` ` P P@00HWP/P0U0C0#P zPNP% @@PmPPU @ dP@g tf~`P jP $PjX PdpPX] CP \50S  o 7P  P@p5唵00K 0% 0[p B;X%04 L50pzR񟗺GAAAAAAAAAAAAGFAA G,GAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@AAAAAAAAAAAAAAAADEXEAEEAF FAAA4FHFHFXFdFAAAtFFFAFFFAAAAAA@@A(AAC 0C0 0B 0 B "0%A-Q@pW :qp}qqZq'0G-@T pPaV@ U@ 1p@P Lb @T SR0p 0`@'=q@-<@0S $#qP> ' qO-1MX@ $PR4 84S00 {040 < 0`[ @ 0SY $P ^ 0@0T o@P KP  0000A rx Ѝ d  x$0R  0CS $00 0qq' q 0A-@T:8$R4 CSR [xck!AT0WV0 $P ^  @S0qAq' X0A-@T`D'L@PU pPqqUT'p@-@`V!`pPt{ @pd0dP \aֻP0p@04  bs@'Grt'p'GrI%Ur@-<@ 0S $-pP H 'yr@-<@0S $pP3 '=r  @-o`O-aM0Sq K0p40S W00 $p p0PP0 0+ P UY   0Q  PPD 0 ZY00W00S nP5 0 " 00 RQ3 0S0 V0P QP LP `0 nP 0 `0 $`040,  Ѝ "'rs@-<@0S $xoP'=NsC-d`M0S PHp0@T " !(@PUЍ'O-M`P$ %!0@pDW%  @Y 0 QPQP (0S0nP 厌P `!! P"(Ѝ KpЍO2'=sA-0@T `pP1AT  RQ( QP (0@ 00pp'=/@-p0M0PS`M 0/S PP ۍЍ(m@P  pT ۍЍ@oP 0$p0$!#!0 00 @ ꐳ'ss'A-P`@p娀TЍ000S$0S  00 0 00! !A<00S woo@''I%I%I%C-`@Q@APP@p!@ WT  0q ! 10d0` Ѝ Y0p`G-鬑M@T- `P!ApT t0S! @T m@PM 0D0 0Q@ *P2]" 0`! Aލ00!!QP  w P    P ]"\ ıD Xo(  'GI%tt0tPtot1G- `V@0P TpY  l@P) P! P AZ j@P`dP nP< nn@'tttd0A- @T`pH P AT9P @'Qqp@-@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSB 3b 300pp0 S  0 - R 0R$R:/A-0A Rh1\pP.@0MTaMQ 0  C0/S' 0 ! o ,P3ڍЍ *\0@C ?\0@C ಀ 0pC00C 0 0 o P 0` To P 04 $o %u uu!up@-`0Sp@e\ 1e #R@ NPm000p 0@-,u 400S  /'0-p00@^SQ 0Q00P' Qp@-!0PS   pPd @t Lm @@T@p00@kI%VuG-`p娀@PPP  0tE`0X d@ P  BR 0 $ 0 ugI%uuu'A-`PPЍ4"R:0J840K0CS2 `60 01 -  d_ (lX <tS @ |qp}  C=/ 0$  4 =CL2P ! 1P) ($5P/^)040)($84K @RKP  $ p++  @ 04(4 :(40/S04084(49)($ q++ l$' $'C-j@EM0@S(zzz{{zz{{30S EߍJ(hJ(J(J(!L 0\ ` @ 3 30QJ(| S7000-00 s++  10>L  Rp0<x P J<p0@ P J11   0 ypP J =<Ҹ@ZTYE   fXM  f} 0 QpP J} 7P RP$PP P "P 0$p pt s 00bR c7P'xgxxxxkNxxx9y' y[y0@-PMM@ ` =X X 0P U+@0  $ $ ,  ݍЍ0$ KO'p@-@E PP hp@*yA-0p-S0S) kPP%i 0NЍ0` S0 BP@P,0U P` /yx%By-@-0@P   |#Ѝ@Ѝ/8'p@-@ATp@0 R P8P ` `tP`p8'-P@- 00|0 x0 t000 h@0S X0900L0L <zj ,O|$ "9 Ѝ@ Ѝ/l''L'H'(%|'p@-xrh@PlڝhPP XӝP p堞sh000S  pcyYY8'д'ly -P7@- 000@ 0 000 P0S x800l0l h#j X{T!iD 8j0 8 Ѝ0@Ѝ/l''L'H'%|'(%@- jgy(%@-M@P" 0/S42P|/2P Tip \Oip 0RP 0RP @ލ}yn 000/@'@-鹃 ijgy(%A-q`@ MT ttilAPD00CS0?3@506T0U00CS00 S 0pP'p'܆L'K%0@-S R' p'A-pP`V@ q@P*Pp@-XPk<@P hDP0P 0@00aT8@pG@'A-ppP`0004@40 04000@0CS000SAP'L'p@-P`@T PV 0@p@@-PPG-0%P=P" P }SPY SU00CS00 R 0 0 0@P p ` K%K%C-3Sc0@  mt30 0" 0  0004 Bh p3 3 00`G3蒟 0p Ѝ/RAR R7 C%1 B&P0Ԟ̝dT8P0=S@  "?R 9R:BP\@Hd|R' ~R$ ^R  h; @ =R= >R @ <R =R @ |R@ 0&S@ 0=S@y  0+S'@p 0-S(@i )e&c#a@ ^%,' (' ' 'R0@- '0s@-0P`0V0`0@S P 0R@P@  dP@0S00S 0ST P000 R  Ѝp'8'J%Dx @-L ^8,D4lx4X\T @@~, \a \1#P?0 C c0à?0 c0àΌ SQŒQQP0R0R0P0QPQP !ׇO-`pp딀P @%R? &R X(3! /[00  0 PP@@ Ѝ'@-0@!4Mp T` 0 P@4Ѝ0@P SWP@V P @0 F2P@$ P@c UT'/p@-@P0)Sp'O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D Oc S! xz! r0  0@@P! e0  @P\VS'T@@`@P, @ c  '8/O-p`M8P젟찟9!@ 50 X@0DS '00S^^* PU @ 0 V 0DS00SY Ѝ` pUU 'zC-`p  0BS00@SP! @ 00 TPP@@ Ѝ'G-`dP0@S! p0 000PP@'@-@MP#1`PLC0P  IR NRpp 4PPEP@@0PS@ $01Ѝ'JPG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@z0PH0P@ 0,O0h1[J%J%$'8'9@P/- 0/SSS000'@-@PMލ0/S XEbp @bp 0RP 0RPp@-`\'0@P 0D0p@S0R00"SP Vpaq0'fp@-T` RpH0@Q 8 *PP /pp@0'J%}O-pW,S 0S)P _ C000000000CS020S @T   R  RS/#^h2hb0d00@/SpG/pHHDPR0S 0/p0CS0p@0@ppW000000pA0P00 _00w/ Q tQ00CS0P10S 00CS00W0@0 pR0S/S0@D00U0@0W0 P  R*0000t/S0S  P 00CS0p@20@pK0S 00CS000@!0@000'P'L'z}J%$'J%A-`p00@0`P 00CS000S @ 0P0CS0X00S 1X @06 R0S U$0$pN%P'L'J%0'G-p2B`M}6&0@T">R@P$ 0SM .S00.S0 00/SSC10 - PPB| ePpZ% ``VTr)PP@ j` g.` Ey0E\XP]@`0-S0S0@T@@QP.g`P0: SVP >PЍJ%@'ID|0'@-5$0Q @ ~P @0'}Ĉp@-L@Q50P000S LTPP 0S{@@L 101M00CS00 L 0 L0py_R6@'0'K%$G-pPp@R` V101 {Pp tPp `R\TQ @0Ti \0DQS񟗀PX`hpx@00CS00 JL 0@ 0 @T0S 00CS00 3L 0 0SX00CS00 L 0 L 1% 01 @0Q  0BPA0@D@@@ @ @ @ @ @\@K%%9$/A-@ ` PR 0R 0S SKp0S0 R >L0S  7LU  !LT,L^ x&Ly Td@00CS00 K 0 AKK%<''K%c9K% 0@-P 0ѩ<'@-@(0Q L<'@-x0@T   @@@@ @8]@00S 4060S Ѝ<' 'J%-$0@- R    똶'-@-   0@-똶'-@-0@0 H@-P@` =@-@-   3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ 0H P @-4 4lK,P / z;T'0/`'p@-@]PPPP \p` \`P \p` \`ps@-P30P d0d`6 N 0X0@T P|LD0 0@ M@Ѝp@'J%B `''A-`P0@S'z<0lP 0垌`p0 ! R]06S 00S P0Ѝs @0t0S0T.S `'N@ 0    /`'@-@TЍ0Ѝ0CS꨾ȾȾ  000 P 0 3@ 00 0@-@M PU PP 0Ep ++P   HPP 06p  , ! Ѝ0 A[0 0`'J%AJ%@-@P 0S0S 3P 00 0 Ѝ'G-`0S q0P00!#@\T0PQS$@d&$00CS010S *Ѝ00S P U[\p\5  R >)P00CS00S U@0So[@ Ue[Pb[@P'L'`'C-s@P`^PM( UPG*릐) QdDh\\xxxxxxxxxxxxU2$PP^0S2 0S@*T ^0S2$ 00 *|20S G0S X2$PPPU H^0S 2 R$0S20S -E@ P10S E10S Eo^0St1 R$ R @T$@L10S D(10S D10S D00S D  @06 $0?o2$0-x0$@T $ fd00S D 4H0[H ЍJ%`'''K%G-PMp@)0 :`㠀堐堠>PP Q*Vx0$`W U ^0S W ?P 0`S)Ѝ8'K%J%`'P8PG-P* `0@00 0R0Cp0W S `S0p 00 PI*G*S p0@B)PD0(00$6* 0$ 0$/J%J%$'`'A-P`@耟0p00}^0S 0S 0S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R SR 0$`S S`'J%O-P࡟$M^`AV $`*)pWS0嬱p0p0✁0WY 0S, |1k2GlG G00CS00 rG 0= H00CS00 `G 0 BG  J ^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 ($ЍJ%`'8'K%d'C-@$M p䀟( 0 0`@T+ 0S0 PU@ 000pP 0t 0 SP0 0U$0 @ R^PU $0($ЍP08'`'J%G-P$Eo@p0婒S' 0S$ 1a11%G#GZ/GUG00CS00 F 0 FtaU000 X&PE U04q$0! K#$  A BPP00CS000S 4@00CS000S U0S0S<0<0F1FDFG0?FUpJ%d'K%8'ŊيP'`'L'p@-(2FM000000 10S 00S 1 `11FF0Q@T~F1FSPP% t1 1@=0S @T D1R lA@_F4]F 1E0S  1$ FߍpA 0 000 0?P00CS0 0@ 0 00t0 F=00CS0 0S *Fl(FL0EX00S I@00S CD'J%d'8'ŊK%H'`'P'L'0@-00`o00 00^0$MSP4P @*'000P; pC%P 00S W<wW0 p000CS0(00S .'$ЍJ%P'L'C-@?kM000@H0?_00?0,@0P@ &\@`PჀ00`00@T`0p@0ho dP0h@T 00.P0h $00\0S$f&\0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S pd@nT@ tP H0 7S 7S6 D>0S700SC (.000E0,0(00 0l(0P 5=&0S(7S%00S 0 0S= 8  h=, Wp@B PS 0 h= hJ8 T= ,=, R , m&,( Z$Pi000<=0ST RV0 0`@GE.P  @J$ 0 $ R 0T@=`<`|0<Q/DdPU\P4lUH0$l PUX00CS00 PD 0 ;1DCT 00CS00 :D 0@@`P E00CS00 "D 0@mE @PT 00CS00  D 0@WE @P d?P @P07:|0P PP@HPX:| RP00P0$ 0P0S `-V`-V P0E0R9pPP$ \ B$ 1 0 H$0SP0077S 0C8#8S|0XX)SS ?708#8S@P0 Q A!Q8| R05 00 R -Q+Q( -Q R0S 0?X(@00CS0 LV`880S ╡P 480S',0VS78$7 d0 I7,,0( +0000,0( "0DG$0(0S,$ 87 @70S 7,0S lUpO:&060S 0 @0 v?PFT<0 0<0$0 0C0 0|00\F000T6 8XO00CS0060S fP% 060S)T0SXOH8 50 5  5 5 Ep)00%:p5 0 |0S 'x0R%C%0 EddNI00S0HE|M80$0C00|00NCH8 4D  4 4 1)00 0|4 T0S\$00CS0 ,4 R   0 4D0S#$$kߍ940S 0(00S  4 @  (00(00@030040r3<0000L0n@Pfp3 83H 00RL0( ;$0SP0077RSdNF 0@#000 000 (3 0 #0#00$(0 3  101|03/$0 2 QC2" 2" AL0S G8 P2 $2 @ R- 4 0  ( $nA|0(p"SS1 @08 L0H@G10@0@0S 1 @0S1 |1$ @0S  `1@0s1| R#0SJ1   B  ?@0S @0S7S@< 0 00S 8@,0S0  ?;,0Sd@Q [Cl0,0 0H |0D@T(0S?l0 p0fS,0 06'<'`'8'8'J%{'P' 'D'L'd'K%'H''!(' 9K%@'L',\%K%K%K%B ?)DD0/`'0 /`'0 /l'0/l' 0  /`'P@-@&P<80QP cR   X`'0 S0/`'0@-0M0/0@0娼P 6TP 0: Sl  S` PЍ0!TP0 : SO" PP'cazjp@-Px@x`M$P)00S H"0`;00``00!`l"$Ѝp`'@'@-`@P$8&0S0S 0C0BS00 000`'//C-LMo)8u8 p@<(P@0` D, ` 0@LЍ[K%A-@P`MRpWU 2K! 00' pH''O-pWC R``%` P0S:S2CE@А @0S,W@  @L0T/S/00O0 00S00P R:R0:SPPP@DO=!S!J%J%'@-P@/` 噻P*  0 PU0 "U# "`VZ0S  0 o0S 0S P;! ~pPP8> ER~  @ 0\딶'A- @PM`RllP1000  Rp !XZU l?? Q T?P?Q<? 04AS 00CS00 e? 0* 00CS00 U? 0 ЍQ ??U P000^J 00CS0P00S @??4,'9K%NjP'L'ы׋ۋp@-P@@Pp 0S%SpP @ꔅp@-P8@Pp 0RPp@- D0D0S RP P\ 0@J%'G-`P@唀0吐00p 0S0 S0S00 PPP|U00CS0$00SG<pP''@J%L'G-@Pp0`0帐0 Q :RQ :QR``R %Ru #$PPP0T:Sp0  4@0/PSu`P''@J%A-`P倀000p 0Sp00JO@T`|V00CS000SAP''L'0A-pPS R+k`a@T"W p000O`0 @0 0 M00CS0H00S `P `@ꔶ'P'L'p@-P$@Pp0P0@@-L@000@00 NO00CS000S@pP''L'O-PM/`@ 0唹P @@@ (QP00š0 0S 0S 000w#   P@ P @cP: R R R 0S 0   " R00 mpP B0000S. R  pl" RZ0 RH"00<0  &pPZ Z 2 @d 0=00ЍQ  0S/R0SZs "P pP t"P R  R (fPP0 * R; R 6,0@@DQ P R  fS@0000S R    BR <D R8 c6 t'@J%P''K%kJ%L'O-@`pM2%PP2*0S*[ 000`"0  p0Rz0#| 0Z8 RhB<01 P<PЍbPEUlHtHHHHHHHHHHHp  `@Q V  00X!W QPYXV H1 0 0 Z0S& 0s1TP P*W 00SY0 [  P 0S$xXT 0s  P ha=T@''K%&''@J%p@-`P0000S S@$H000 00 00000CS0p00Spp@bP'L'0@-p@M0 0000T0P>00G 00CS000S CЍ0P'J%L'@-dP 0SGO-`pP@lM$P0cS    <ApP` vPP VP@ 4 RrYcS" 'U;آ[4P VP   R񟗅 0R @PU_@;%U 0; P% ;;[ 00S A00CS00 -; 0 0@ T Ѝv;/ζPVd!  [ZU!Zy;v;2NPUl;U~MU U UU/;0  g@000uy@'R[|Ì،K%'`?+f#.KO-p$M R 90b@ @T- TT:T"  T /T" 00CS0@  @0D Slllllll =$Ѝ0S R 4a@T00000@0S?@PL=P@ @ T ~̰pX `=W 0 0CS00 S00CS0 0 00CS0 0 p00k00J%'$'J%IA-(A0S 0PS0 0aqP0S00 P000YK00CS00S |P 0SRh`hp0P RP0005K000CS00S W'P'L' 's@-0!S1Ѝp*S@SP``00P Q0C RP00C S@r `_4@k0S00S=STT00 D0 R 0AD1U0 0S 0SJ%('H'A-dp`0PS@  R R00PH @'O-s@0M00S00 00,`000Т00<000000C <`0 00@000$00CS$0C0S00CS0(20S PJP(0Z00(P K P bJ(P 1X0 DC{0@0CS0t10S uЍ0SJ$P 0[0. [`+ V , R1@ 0C\A/@`F 0SX  BR  R  B ~   B `FAQV  R@ @'J%P'J%L'`'$'1O-0pSPp0 Ѝ@`1吱  00Y :[V0S @ xQBP  `V' Q`:00Q@  @% Y0S" SP P@P P DoQP @@` '' 'K%3A-XPX@X`P0p00aI0p0CS00S 'P'L'p@-P;@G60@ p'@-Qp@0` 0S*00DP@`P@0`SP Ѝ `P0@P0`S@0S0O-@p [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xPS@ R0B$x RP R  \$Ѝ$_IPX:$P 0U0/Sl 00E区pP $0S/00E0S``0` xQP /000S uV/00D x00SR00Q: 0 R @?ھ0P . B/o.Q" R  0P V 0 WE$'&L'0  Q0@-0 @QC\0CC/x^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0So P $$$F0$000CS0L00S 0S 0P 0'P'L'p@-@ PTp 0@ @@'G-p @00 ST@D0P ̀`V `RxP VP V V@ S`` S =RR QU  e0P @ 0G-`@ M G0P eb(q000e U00SV-00E@`PIPE@T Ѝ00CS0@$'O- R@@0`-SPM S! C R000000t00`?So @Sy 00C ShQ0 0 =/`I0S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P6솟p覟ԖW@A0S 0f0CS00  P6FBЍx6P6l6X0000Q00S 6 pR&V(0S 0 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 R L 0ppUppW~|0m R  R9 V} WHs 83 BR  BR j ~  B Rs `2 BR  BR  ~  BR   _ ~ Y   0S  QAQAQ   Q.)    ~ AQUd Ra 4q B R  `V~paQ 00S T 00 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00H'('$''H|L|J%''J%'K%O-,M0$00 060=```V`p 0  L600`G6 @ V 0@P 00@S0(00 60P@  R@@0% T A % R *R@R Z  JRG tA@TZ   + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S10@8 0&  [ 0 0, Z R$ CR 0S 0[ 0F 0[ 0 0@S30S0@000J S񟗷#d" "T#T#p"p"p"p"!\3 BR  BR  ~  BR  ~  K R  BR ~0 0  BR ~0 0 (Rx[A0lT@ 000SS @Z,ЍT TL aQ00CS0)0 儁$00 0I0 0P 0C A 0001 10AI0000T 0 00LP 00 0a@[@R p R0 Rp Rp B\T   R0S '$'$'J%J%[('O-0M  P0 4400̴̔0@ 0~Q  0 pd匤0@Q Q#:Q =Q Q Q     BR  6P AA  p A P񟗁X(%x(x((%% 'p&&X 0S@ЍQ Q@Q =R 0p(0  BR  pw w p    BR  u  l u  BR   [ ( R  0BQRQ B  X  BR  v p}7 v 0S Q AQ~@AQ  RX ~     A@@ P  7@P)  ~R&=Q0S! 00   @'K%'J%$'8'G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S000`0`0CS0!0 0@p   0   0  R 0m00e 0p J%'J%$'J%8'8' @-0n@OJ%O-XAX`0$M`F:P2b000r0Sc00CS00  0S 0X0#S #> P  >P}, 0 00P0 P   PERP S   BR 00E0CS0000`0L00S H,80+`QDJ%H'K%K%J%K%@-L@00CS00  [p00CS0@RH'@-T T@08     00000 0$00H'DJ%A-P`@000# =V |`0Pڐ#p0PS  D0  0000CS0 00SAP'43DJ%H'L'@-4ap00MP0V=@P >P(0: S$0  0  9=P  PJ=0 000 ==d"T5=L00CS0,00S ЍP'ՍL'A-h@Q0P0`0 PHpP,<0`00CS000SAP'H'DJ%L'p@-`P@00P0"P H< 0S00A<0X 0000CS0p$00Spp@Y$DJ%P'H'L'0/DJ%p@-@,`,P0SpSTpfDJ%T'7p@-P@0SpDJ%T'p@-@Pp P0Pp؟"0@pDJ% 0 R/LJ% @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0 蔻'5rOLJ%A-R0S20SP`AR p H"3<pp"PpW* 1N <p !" 9P `< 0P ~&&&P< qP <p۶<  8p,϶< 4< P <p<  8p< !00^&[&X&`蔻' 'LJ%cyNJ%<'|0S/p@-@PP1PDHAdP0a 0(00R 0S"0D@N05#0s  0C?o2^0SP'~p]P o<4P p0S *00CS0p\00Spp@ Ao PQPꔻ'Ȏ5rOP'L'p@-@\P0P00 :@00CS0p00Spp@P'L'O-@`LM R0 LЍO)ؐY. PPY   t0 SPs   0S0P0S PP PQ 00SЀ0S@LЍ0S|22 F! 0R+  p  !R -  "o)p 0 0T"c) p0 sR ,80p) 00CS0(0p W (e Z 00CS0(0 00CS0(0 | 00CS0(0  Ѐ YZr(000v  ) #40  ( (P S#4X;  0 ~0p@ gp  (Jzp0㓉(ЀHp0'LJ%5rO*38@IN]@- 0 SS0C 0.^\Q0 @  C/o "P R O-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S @@1@YZT X@|1 r9 002#00S 0S 0p?Sp  P T"@` A Pj P D \0@00SJ R Q !" R @LJ%c'rG-$a$w0S Qq0l0@S @ 'А㼠0Sʰ00CS00 W' 0 (0 R  0 S !'ꔻ'[@'5rOҏ]K%A-pP`AP00Sʄ10P 0S hjPp pPP gP`W@ P$1@@A~'PV QPU, 00SJ h'0 a'`00CS0 &0S 0 0 00S0 S 0 0`$p$ڏޏ@''5rO$LaK%40@-@T  ^P@@d蔻'8 P  /Q 0SZ//ᔻ'G-Qp0SPS@00SoZaP000M: 0@C$ @p U0Q000CS0\10S Da000<>,10S0000000W@00CS000S 0S @`VZ00萠d@ e0 Z7@Ꙃ! P00B R @ꔻ'P'L'J%A-`!@S1p@!P [u$Tp1@WV2 `1N0SN U 0S0Pu9P}8V 14p8 `"]"060S$ V"S"P"Ve$b$U 0S PP7\7P LL_WT 0 V 'D'''J%LJ%KNՍ08 N R S  0S  P J%O-`R0pMxB0  pP I0S0S ЍP 0@000 0 0!P):T 0S0 10S  160S  0TFD RD B100CS0h10S 0S  02,   ^ \ 0Q R0 ~. ^ {  No[^ Q  P 000Q@V{  No[^ 0'P'' 'J%K%L' G-pPK@P EP1N0St `3@H8T @D83p7 a`㜠@0S0S 0S0S>`@Y 0 X 000 HJ%LJ%j'A-@Pw P PT0Q 0S ZlP@ pP@ ZP@Z|06 R0S@@Q`` 0pJ 0 0 Sk*@'9J%K%O-@cs$M0 PPT  %P )P lnU pUT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP p㴲jY  \   0`P 0S00Y 0STP a'$260Sj0`00\  \ 0?o2? TW ='\0#Q 0 !X R8  p"P0S 0S00 0 RZP S  R 070TpP/o" R 0 S0C0 O6 p0SYX X YPPVKP'Oe.'@'@ZJ%p@-@5``Q000 R 0S <1 2p 6!0S 0 00D1  S  Bo00P0R ` R\ `` R00 㳠0S00CS0000S tpP'LJ%D'5rOL'@1A-Q40@SM#P`q0SP00CS00 " 0 $01p 5.X!##PlP000T0@0CS0800S 蔻'9]K%LJ%P'L'@-v @ 00[@'@-@ k @[p@-`@0 0 p 0Qp\ PU"00p蔻'qO- 0@LbLPDDDr0U0S  U"0PE0P ЍS S =S\ 'S " C 0CS __^@`____^$0!PU0 R$ \S0 \0 0S0 @ P   0@ P0#P"0!0 P  0  @}00 S$0)0 !"0T 0@ 1 }SP0  :0@"00  ꔻ'TJ%A-@dcdsdMTZ 0SW0Sapcaaa8baaXbbbbbcc`ccc,acccccccaa R0S  "%#00CS 0S2h"!\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8 Pd Pa P^ P[ PX PU @,ꔻ'@ZDÐȐ͐АR?ԐؐvdPdZ Κp@-@P@`TpUPU 0S G@lp@-Pt`t0PP6 R@N0S@2@@0S. @D0    p 0 p蔻'J%A-0P@`Tp R@ 0N@T P 0S@@2W\0HU 000000V0@  'J%LJ%A-P`pp P@ 0 A30 O-P 0qM00S 1a б100 0000 S  @PЍ~0SG 0 RS/Q h C93P 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S+@/$ @00CS00  0 ( `0SH0 @ܧ00긻'''D|''/J%$'=K%J%A-M`$P4q4A0S M6V@oP 1Ve0^0  0P!1U00V0S^0SP60S .0S P'P P1ЍP ^X8 0P0C?o20'J%K%K%K%L'0S/p@-P0001@P00CS000S TpP@T` `@V0`0T0@0v 0S V00T00p@P'L'J%p@-l@0P000P I00CS0 Sp@00S iP'ՍL'p@-P@dPUrbp@--Pu딑@-D/Pn딑p@-Pۦ@n.pA-@P0PS`~Up~0000 p 000CS0h00S 0p00000PC0P0CS000S J%P'L'P @-(@0 00C00/ᡑJ%00  0 00   /J%$'p@-@tPt`0000S0 000D0 00CS0p,00Spp@00/P'J%$'L'@-D@ 00040 00CS000S@P'$'L'G-qA0@0000I?o2 V0SPkPP) 00>0 000E000PS V 00CS0l00SGs E P 0(` 0`PPP'J%$'L'T 000@0A00CS0/00S/DP'J%L'p@-PPP`@ P T @Dv@p00C0C0pJ%$'p@-(P(`@@Dw00C0pJ%$'( 00C 00 A0C0/J%$'-A-@P(MHp@`DpPVP u 뎥T(01 0P @ @`@DPpU(ЍAЍ/T (01 p@-0 P cpꬑO- 0@4MtT@0,`P3P0S pV@ rV00 dV000T P {t!3P h#hhC p .P w0\Q"\Sr 0S!.Pi R Q X BR )  "p JQO Q 勘P d冘P~W p P{X  BR    圦P  BR 0@ ! P R   0 00 h1  `PApW    pAqJ0 0Z* 0S  @P,4Ѝ P oXPJ Wp X =  BR 6  1ɑP'@'ϑT3J%J%$'D|A-PB`Pk̂000.p.00CS020S 20@T[UU  r0@0w 00 C@@x 00 C@0@0  0Dr000w  B0x  B0 00 Cr0P 0w 00 CPx 00 CP0P0t0E 0G`A01 H `ЍP(5 1 000 0 0A^R0@ 0QS$ 000SPP Rp,00CS0H00S UXL`. <$-UUP'L'@' K%y% ?_O-f@P`sMS`P>Ls0SC<30@TDUP3X . 0 @ @ythX   X 0SB01 `ЍSVP aV HVP@ 0S4X0S UPP= p 0/S9S W:*00CpïS  垘 P 0 ( :6.p-L 0 መ @0(@T0 S 9-P|-0Sy㞇0tS x{tg 0 M 0P]ꋒ{@'ڒ#eK%3O ˒'(9 BR00/0S0/@0S/ R /0@-00@00C S  RR R1\0* Ѝ蹓000C S0S//QX0 0@- ^ @P U@R000/J%p@-`@`P6N0Spv@Tpw,,w,$,@r, 0P p@J%'oѓG-pP@R`Q7 @I`r0S 0 ^ `V@A00CS00  0 @aq匁 Q  R  ;@TPP,aHqH0 R R %@TP@00CS00  0 Q {P @1@ST@Q@`Q hPGB`V0 8J%Փc#F K%D 4  00\#P0@-J%#&0S/p@-@PPEPp@**A-@1Sc`p@DPU 0@P00` P_('G-@P0LaL00 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0P 0T0cP0 oP0S TPT40@@T0SG('D'#:J%A-P B00`0QՖ 0S 00S0S006X pWP {P6p60S0S60F N0 B/oS60"N00S R 0 0-S0F0 1 Q0CSRC0SQ 0S! P0   000S 0 0^0 PA. R   R0 0('J%N'PG- @@P0S`p0C 0 XZ0OA0C R 0 0CS0@00S 0S ])\('mP'L'P0 @-\@000D00S 00CS000S dP'('L'000C S/ @-P 0 ('G-0p RP 0S6Q 0S!0@ 0C?`C10 !1,b``@ `Z0i `` -R \ -Q0S 0`@T0:SE 0R@/T/:Y  @`)@T0:S   @`@? `0 :\00Y00  T@0 CB!0 4$@ Ѝ@ZK%[P@-HD0P  Q 000CH Ѝ伔('8' $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0|@:T  ($('ߔp@-H@HP080Sp0u`0CS0` 800C80K%$' 0R @-@T '0  B   B /@-@0S@p@-P@0S0ڈ0@0 0B2 ! ! !!  !!p@-@    @K% 0S/xQS  00 S/00 0/0S/0/ 08 0/=P/P/0/ 0 0@-0K%p@-`R`@PP t0 0Ppd0 Pp0-S0S0 0pV ($00080@p''ƕK%O-RM0p0p R pl"l2lb @d 0SXy XR00CS0`2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B R @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { k KpHJ%d|J%J%$'K%0-0@ P RDM`V0 Ph h "  MU0L T<0< A 0 01 0 K%ԕd|*@-P@M0T 0P0Sp`@T*vpPT @Tq%PLP @0 PЍ@J%J%T':Hl000S p@-XP@T T D0T@p8040@p 0/K%'[\ 'HJ%x'@-0@ꌷ'p@-d@dP\Pp P 00008  P8 p@HJ%K%=IG-DR0@T @ B 0S 0 @ 0r8 0 00CS00 `)V*V V v va G ` 0F Sh V@0000 @\V. |V ;V&P @0 ;P @0 N@0U PpFx&P@0 ?@0o|P@0 6@0@0@07p P  00P000K 0 K%HJ%H'L'G-pc0@0 T T+P,0S)㰀" PP @ k@@`P  0RP @FDA@@T 0 K%|p@-`0$P P g 0R$, (@R   RP9Pl    Q  00000S@p 0 BRp@ W080@ pK%t@-y0 000K%@-@oPp@- @fP P @0 000p` P 0`@`K% O-鰑`P0  Pᔱ@APp0 CR00S00 s0@X ',100S @%X U _@P@W W- V- O0@PpGWPV oVP 000 0V p0S 000K%d|G-JM0 5@0 0 00$040040(0D0p`P $0S $$  40  |4 pt$0000$`SH4 `$К,4( ($00CS0! 0S$@PU3 0RPPS p10SP Pv )30S l3p@p3p0pH00 0S  0 |`PPA P5 \P p'200pm PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 Pc@0000 Y@ "00CS0O001@@PsI n@m1000S 10 A0 SGl!|V@0  0 @00C0,000.#0$000CS010S O0 0 0 0 02 P B1 0R z0u`@0PEPUZJߍ6~00CS0`R {00K%D'J%P'HJ%L'J%$'0O-̟̯M0ϟ0 Q02202280?_@? 000"`00/20S@0Sʷ@ 2Pt4h|lL<L$/Q00S .00CS0.0.Q00S 00C00000Pa210S9xPpVTP"PF SPMpM vU0@#SGThhhhhh8hhhh4hhhhhhhhhhhhLhأ p00@ Sr0pG A0@Sr7pGa0@SOrWpG[Jp0 S00C0t00  P ('P 0p@W00@S p p p p pq00@0pGSq0pG`0@?o? @2;R0Sp _\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp000 S0 0C0~0 0ĕ@00C0pW'*00C00'60'3?00  R~   B  ĕ?pAp000 S00C0~00•00C@0W$*00C00'90'6?00  R  B ~  ĕ  B 0'3?00  R~   B  w$00C00'<0'9?00  R~   B  ĕA0'6?00 Q~A•W?p00C00'?0'02!R \ @  }P0S h00C AQ 0~00@00C0 @!$P "P1S 0~ 0C00  B \  @Q0~0A @00v0Q! R00C0w00@u0`"0p ! R !R0S G0`2 5R00C0v0)0!Qp R00C0@R 1 00C0v00 `@60"0 !0`0C0w0 1 0`0C0v00(P05(P  0 B y   "! @ B 00pS 21 0`0C0|0000C00  00S 00C002  B )Pp( "1@0C8#8S10`0C0x0000C0p 0 j00S210" RR 21Sx0pW 0 T0 00CS0S82pP0@@21S80 0#<R00S/ 0S(?0@SP P1P0U1 UP>X,UP0>P0 |P000P$@; 0ЍP0 ,  0P& 0&P00 0<P_ >P &P000p0p0((0 @ -P 0(0  p 0@0HK%HJ%$'J%H'L'Ɩ3O\w''J%%T' U}J%  {P B@ < } p l {S  D  B p/#P0p*}P0$  @@   ? }P0 V0 p 0O$  @ Pp0H! , @ BR #@mx!0  = BR@ Ĥ0U@0Wj%S` :S/ #S0[ 0 pA0C Q @ BR @=W0 0 @ R,  B 0+0>G$p0ᜲ ᆈP H02!R1S p0HS2@p0 pXp~ $0X2 ` !r,!!m00S Go}S㫲[| p'P023Q w0 00"0 `!b$0 0 @ B "  0$2  `!G-`ЀР0@T@@0PU @ 0S 0 0   B/o"P`0p 0S 0 ^ 0 0 02K%@-1P0@-2_M0$ 0 Q< 100100啘1x0000CjPI@1x 1Q @<00! dr 0S $Q. 4QG Q (0  400,8  (b000 0 0 0 0 0 S00_ߍ0  p0 `0 H0 D0 H00SiS,0 0D'J%<'K%J%H'[ G-Vp0 00 P" 000P6꼾ܽ  Ⱦ    xxĺ   H0$00p@^P 0 R 0`     {0@0S 0 00( P0, RP[ 000@ 00 00 R, RP4 D00300 0000    BR   00r` P 0000 CR Sm 0 P P`  ``{s 0 0008 @0C 0 I00=`0 Sp啔P \0 R   L000`0S0 R Ӻ00P 0 R000' 0  rP 0@S P 000e `@` 0P00`P P0 000000S$ T 0S 0@000@00S0P0S0S 000@Ѝ0$00pYK%ΗniK%J%A-Q@`Q` @ p0 P0 0X@p 0P R$@@`/R ( W% R"pn0 `4 oP 3/僅`P 0 08 00C0%04`Ѝ Q  0Sj0 00 00 @ 0K%HJ% A-P@0 P/ 000`P 000p0@``@@{P 0`0 U000 PPe``0SU -PK%J%p@-@|PP 0 @OP P 00000Sp ppK%( P/0S/80 P/0S Q/0ꜿ'p@-@ `P?00`Pps@-` P孽@ PP Ѝp @PZWTQ N ? 0P/᜿'RQ%Pp@-@ P P ` ]pA-P`@XpT@Q00C0V P@ꜿ'p@-X@X`0P000000CS0p00Spp@P''L'p@-PH0@TpU@`V P``ꜿ'@-@h 0 S000C T DEP K,0O@dA T @0@@K%gfff'p@-`@0 Sڌ S  $PPT 'p0S 0 S P0S ꜿ''p@-P @:0Pp 0  0p蜿'@0@-@ P  Q P@0ꜿ' 0 P/ R/ꜿ'C-00`t!`d!t `V&qP5P < 00 V U0S00  vP @# 0:00CS000S Ѝ"@| T  OP` 0YP''/yJ% j L'Ap@-@PPP Up  |圻p`U p0U  ppO-`PppW@p  10Ù`ȐȠȰ0S UT  O   0@  U   T 0S@@ `U K%; [\}8@ep@-P  @spp R  jpp dpp ^pp   Vppꜿ'ęp@-@PpD0 0RPPp03/FPp蜿'O-@M0 @ 000Pp`@A b`2@ 儲|U  0Sp"p2 0Sd2X" Ѝ@0SD2 R@00CS 0SP P  嫺PmǒP pT 0SR PMt0000 S}L1 0R  p) B R$  a P 0S  P  v0SP 00CS0X00S T0 0 0P_ꜿ''K%K%K%'P'L'O-`0@@#@SM<S0SSxd R 00CS0I0 - \}@Zǚp@-@0TP R R R& 1S# 0 PpR!Q QT " "D0600S0T0S 00S0ꬿ'P'L'J%@-@P ):P0   @Z' QA-@ 00CS00 P `ppp B?U U P@U00CS00 `9A-@`ptPt@0000S 00S p`V@40`00CS000SAP'''L'L0P  A?Q Q R:///ᬿ'@- b@0pSM10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 p0 0S" UEoᝀp$ W`RU`90@D>T000 000  Pt0N R  DTR 60SЍQ Q2 1 @D@ꬿ' 'J%<'hPO-P@p όP `ɌP ČP 0PEpSUpUX@@%` PPᫌ`Ppl44坌PPEpU]X P$d$t$ 0E0 10ST@ T@P@UT @Pcs1 R 00ST|z@ TL@P@UT ,@,s,Q0S 00S hY@@T`X `Ȣ娲pGY P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP PP 7PP1 }` `0S[  0E T0 S R0T00 (@1 R = U@ ^00CS010S YP嵋`PP@ᘀPq0S 000T 700CS0t00S 2@@T00lt%iDv K%'d$P'K%L'G-PP ?p0@`吐 D0S 00S Eo0D0@000CS00S pW@UGꬿ''P'L'p@-H@P02`S@20CSp~V02p謿',0T0SP/0S//ᬿ'C-p@`1010r!Q0@S10C1 ЍqXPU X2YP᳸qP 0S ꬿ''@ 0P/!!R /ᬿ'p@-8P\2Sp@xur\Bp謿'0-KM01`"R !R X"R   1 1d"1!d2S (_Pd1( (^P H!(000^@P$1( Z@T0d`0P( U @T 0S [P900CS0 ! ~000 0$00D>S T00 Qo"J!031ꬿ''D'P' 0@-`"d|묿'p@-L@E'P|0PPp0C/U00p~p@-T@TP0 0P0 0 0000CS0p00Spp@P'K%L'A-p`@PU 0PPEU` XD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S `sDP`0000 0C0'P'L'p@-@P@0SH00Spp@00CS00  K%0K%0K%@-@)P@Ѝӛ-@-   Ѝ Ѝ/-@- 0  ЍЍ/K% -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'`{P$ 0S! hȄ0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 ~K%0RK%@-@@K%@-0rSD#0G-@0 p0R(0帀P0=00;z=`7z`F@V@p@DR000 S=S B`` R`ť` @G胁PJ%$'J%0@- 4@ 00C00 0 06Ѝ$'H0P P PR /0@-PP@^ ^ R0L00/ A-鸀' 0S R['p`@PU pWp0 \ 0S 0S   3/P@P00@'0SeA-@ePU p`pp0S'SSP@DAL'yPP(  EA꭛Pkh9klA-P0`Sp@    3/@PP@X "W p0@=SPUP00 00CS00  0 00CS00 w 0 T @K%O-A0Sp 00P̀ 0`V S 0)u@PU* ЍY   R Q ʁ r <0aP`0 l$'@''0@ R P=R/=R/A-Pp0S=SRpGp'h0h`!0aU@`T 0S  IQPU``@$'@'@-1`0@S @  PPV 0 `0 K d{  `C Ѝ@"@q   R <0 2/0` 0R , R  c0a00 0000@!L @UP U0 j00CS0\00S  ЍY0#L 00P P J%rP'$'L'@-@P= `&P pTpP {pp0  BR = T   `\ Ѝ00@0ꅜ-X0GM0000oZP00$0 0  GߍD'p@-X@P0`y @0U<) 0U`00 0p@$'oѓ!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ^$Ѝ('<''J%'p@-@`TP000T 00CS0p,00Spp@=@P'L'7@-P@T@ PP0 P00p Ѝ0 yP 0 @)00000 00PX~$'A-Pp` 0   0 @TPUA@ 0@00`@' @-;@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =v@@d'O-p@`0QrSP W 100S V'>nP pPW`0I?o2V0S Ep`VD10@T0  ЍOf @0P=S7 P( PW0 00 0  彯`U 0 X  ЍU0 00 U 00S -W KP,BPPPP@'ޜ@-` pk@P@ Ѝ0  R@ PR000 00S x0000     0 @@DT@00S ҮP'D|L'A-`pĀ@TP0U0  l  0 R R   0 02/0 t 00 0000$'K%J%A-p`P@P 0`0PPEPvT` eTp` fTxTp`X 3@V Y@@'PP@- 儮 bC-ؑp000P0`-S㰁@TQ @ 0@00`0CS0d10S 3 Ѝ @P=WuP 0 @0 00  0 00 000000  RP 00 00=S l0T 10=S010C0 PPPP'$'K%J%L'  $'p@-@PTpv@p@-P@`P \NP@ xP@ IP@(P(P0 P pW+@'00@/ 0S0@/s@-@0 0P`څ0S օ0"S U1r0!l%*0S`0T墭000 @0C?o2R0SЍp褝%@-M@ % P ލ P@D0 SQH0PP0@-M@  P ލ P@D 0RPH0PP0@-M@  P ލ P0RP 0RPA-@` P13@ 0SC P UA  PPPpv PJ! 0RA @- 0-RS# 0S0 00t  Ѝ0SX0 0P0S00 040,P$Ɲ~0@-0P!S@M0SPЍ0P{ 0SxPUo U U wPo U I P? 8 PPEUR 8HXhx O  P  P  P  P  P  P P p0St00@ T @ 0(S0)S 00qop@-@`P(P} 0Sz00CSt , < L L L L     $ P |    MoopEP?:P/`@+TV$@` VT`@V0`@ P0`@P0`@V0(Ebt0S0!SPpp(S0)S0S pp@-@P̀PPEƀP.U)   , 8 L 0op=Pp0\0!S0P p(S0)S0S Sp/Fɝӝ@-堫0VK%@-$0$0 00 H됶'K%*@- @} R1P\0* PЍ詞O-P@,M U0pE `-R lRF 8R -R| P,@P 2 000J @P ],pe pGW` (PpW ````F %RX rPPx8+pW3sR RP3pUP`/ RpE@@W1 000 ~PPP@U\,p *,P hϪdl㭪X1D@P +@P0S0Sp@ꣂ  l| PY0Q ƪ RP!p0*Q儂 Rpu`  唪TT{w[%lޞĞK%Dx*0@-DM⁷0   0@@DPU#E@0 j    0P x, pp LdDЍ0=qP "kT''-@ZK%T Noѓp@-00S 0x 0t 0l0l l@0   PU L@L0L D0D P p PpH'H'P'`'K%'K%K%K%K%K%p@-@0@噶X 0 0@0PU@000l@0\ PB0S00CS0400S rp@i@Cꄶ'J%'J%P''L'P/p@-@PTp000@p@-@P>s@-0@0 0 \XPX`Q P 0Ѝp@00  P.Y`O-Mp:kP0ԑԡԁ0 @P1 0S. =jPP00  UKc[pyP 00 \a8i[L yP 00 4yP 7K 0$00SЍl[xP 0 0o[xP 00 xP K 0(0 `Q 0 SxP00CS J0 0 0SuLayA"A0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 8 /@0D 9K<@0(080$00= 0D00<00,0/+$@~x0@-0$ 0d8 Ѝ@-@4凣000@-@4000@-@(0(S00 00,0Ѝ`t p@-@MPPc부8崀<岀@尀HPD\`⬀U\妀`, 8,`DV0,0p`@-@4=8H0,0@-@438:0,0&r;Z@-8F@j( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ qP u= Ѝt@-dPh=nt @-YP]=ot p@-0MP`0@-S00(00P0 0  PP 0( RT  0 0 S40(D03/Ѝp, $A-Pp`@Q`-VPQ{wP 000 0 `nwP-V 000p0p@- P@@0P ,pT 80$P< D0TP$ <0<Ppp@-$@P0S Q00Pp'p@-l@P`V TpQu`HV8|0y t000p'S9dQ+  0 BR@-  M| 0- BS^0@Q ^ 40 ? 0 C  / /@Z''LO-M`pA PU &TP XP tPW `PU  PDoT<†pS Z Y X W@  U PCT<p S @[  Z Y XW   PT7pP X W P T;&S) < S/ 'S*  S% 6 CTy# !W)  + 05:?T`P($F$vPU;ЍqIS@TgZTbYT]XTX5CTS5CTN|TKl5CTFT5@CTA<5 CT<$5 CT7 U@T34CT.4CT)4C~T$4CwT4 Cp$ B 0gT 0S\X_TL4@CXT44CQT[JT 4 CCTZ<TY5T0TW)T3C"T3CTt3CTXLH T<3CTW TW@T W@S@ S2 CTWT2 CTt2 CT\2CTD2CT,2C00 d @PpЁ0SU ⋙t≙T   Q  0녑0t  P UltjP pߩ".5<kCVJQ¨˨֨ި~ !('.54<;DMLU\dsrz^RZƩϩשZ@-7 >_(%@-,0, P 0 0 .$'+ߪ(%s@-@`w000 #S@$Pw0S  0900S 0 9Ѝp9d0S/#Sp@-@,P$p0P 00p$'+s@-PRP@ p`p 0R" Ѝv0"S0SO 00SS  00@O%p@-h@P0S 0S 0SS <<< U   S(000P0p8'#p@-Px@Q d39sP L0    P     pp@ @긫$8'0@-@PPM 0SLD00Ѝ000 0tP0 0 =T'UO-Pp`llM 0S h;$ , P 0S TߍP/1 Q 0S H@s?0   P P@ P@0ST WpU: 0S  P# 09/PV/` 0 `8'kUų@-u0S S S8 4 ЍS$ Ѝ9,7@-lP$ R\d8;@ Hl$0S p (\8 P8 Ѝ08'0'?p@-@P 0S DCn0PS 0P0 ᚖ00Spps@-PD@D D`DpD0S.00{ ꬮv}(%'@-TiPL0 tp@Vu0"S8Ѝ苵8'@-ThPL0 Yp@;u0"S7Ѝ躵8'ʵ@-@PPM 0SS00*`/`0 ;P$ /Qp0` `0 0+PT 0`2# 0 0P!00 00Ѝ =T'8'G-@0  R2!<#|( t`, hP0 \@8 P04 D #4R," ( "4S "4S !4S !4S !P0S p!T0S THqh刡P8X, F ЍGe0S> a`` ᪧ 0 0 0US, !S  13 t0USS0C SLIILIIIIILIIILIS 0U  V 0lQP%18?FMT[]fox3lBlO-(Q ,@Q 0QtHP Ѝ4QPP>PQ<880S,00 80<0S804 <0P=&PP=P1 QB":`p㴡崱8W0aS R   <0R hP 00< S  P0pS;`(pQ (pQ @P0S0 BS `a 0h R R * \*a 00`0(S0<꼶˶ܶ `8'pJ3tڷO-;$M p*"bP 0$S  ߍS P@T[D@P 늤40 婫X ZS' ("$0f0Qf/ jn,2!S!R !SS0䡟1,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2 S 0 \p$,"b"!4b4##> 0"448#8 R* 0S 0p jX P 0S 0 p1Sq j3  @@1S jP f/ jn01T T %Hl 0'8'ǸVEW}}WEV[P'%A-P@`%Pp5S$ Pv $0f0Q h+5%R 0R00000( 8'0'ʹ`'p@-0@P  P $p@HQ 0@- 0S, P8'@-P  `'O-@:PkMM 00(p @gP @\P00@2@00SP : `P( A@00p(0dS (oP,X 80i00(0( P P:HHἂY9 0  ,0P,0S( ,02 nP,吙吩,([ 0S,00 !( P,00  P,00  P,00,0 @ nPฟ,& , @P(,0S  S;ƑZ0;s 00 0P, 1\  `@ ((Y= 0SX8(0 S0000(0}nP () snP ( jn P00(,0hP,0S ++RP0 (0|g$ pOn P 00(,0MP,0T0 4?n P 00(,0=P,0`0 /n P 00(,0-P,0X0 n P 00(,0P,0\0 nP p nP 0 0,0(P,0d0 0mP  50(,0P,07 m P |50(,0P,07 m P <50(,0P,07 r xm P 40(,0P,07o b <m P 00(,0P,0x0_ R m P 00(,0P,0|0O B@0 aH0 S0S _0Y: Y0 h*/(0TLSH &H 2(0S 0> |^ 0(0S s@|pݍЍ30"000 00S D $0yk  QP;$0 7P$04\  BB! dk ( 0S(0 0SO 0C RS[Q[QQ\Q[QQ\\QQQQ[  0(0 R000S0 H 0 ( d2000"0,0 0 0 ,0P |@,0!S 0,0, 2 N(0S P E(0,S Blw:(0 S Pm 0(0,S -l& (0S\z(0 Sr PQ (0,Si lF 8'sU^DyALQ'=`'_nGh'x'˺Jۺ';VvT'=T%ƻs@-`0PU V  P*i@P haЍp`PD!j 00*Z0@VT ?$00S @- o00L%p@-@5S4 0PSP p@cPp 0S 5S 1S 1|Pp5S T \Pp< HPp(( Pp|18'`'tQedArdA=@-$1$AP(000(p;ge V5 5S Pn0S n0S 005S  P`0PR*5S ` ЍX XkPL` 0aPWEV8'fdNmd_L%a`'gdp@-@P f/i@`' 0 CL%,'md0S/!  -3@-PP {P 0S S@@ xP@Ѝ0@ Ѝ/x%p@-4@4PQ#p@`  @ L%@-t@t0MQh  `P0cS CS SS 4sS00ۍ00'J@-\@\0MQP  HP 0nS yS0 $ď00ۍ0'Y:a0@-MM@` PP 00YSP ,妏ۍЍ0PPp 0 p'%@-@M0 XP ۍWp@-@$P 0p@ O%''@-YMM@p ip\YލЍ<0< S <f%Pژ10YS<0<0rdA@-PM`p@(  O 8`!G  bЍ@-P0@ 0$S0S ^0`Sp8 TQ-BQQ-y4t10S 8@0 7h0000 ! ЍC0ASffff0P h %0P 0P0 0Pp@p@ 0xr@dlp@weU@@˄PptcidyararbmngntsB99 @0R/#B%B$1 4! 8</@'p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @@'0"!#/P/h'A-PT0p(,`|_@x_,0T@@DA??@@@@'?0@-<@< (20,20Z]P0  P*0 002@'> 0R//G-`0(,Bp P:] E<_@PPW ,20CS(20CS G0@'p@-@`42SM%^ q E@ 82<"j 0 (2,"cЍp@^\Ã<"82El@O`嶃,"(2H0DX"\4Ѝp@>@'\M%BPZzQs@-P`a  0SЍp00S@a0"S1Ds@-$M@\00  0 0>[(%A-`0p @Tʰ!$P Ϡ~,0d  ? ^Yqp  RЍArL`o0S`@D@,\ Ѝ\M%2@'A-0ሀ`Ppp@hc!14P S@ D d" R S R 0R@BOU@'mp@-4@P0S( `0B1p@'O-PLMx0 $0|0#(0p0@00030儠s,4000S; (2,3($ 0(` 0[ 0<8 ?[ 0 0[ 000  0 [8 <0,<bd"P c# 0$ 0,(0 (D`巁 0 RD0 $R0 S h2000#1-R0" ,D⊵D`P@(9Yp0P00S cP  cP  cP% D`}0D00 S< [0g24 hhE%KUD1(A$5\"0h[P@\2S@0p0@XRp0 XP@p0 XPU@p0 XPU@`D`$0U(0000[ 00S $0 0(00 0h @ PLЍ P @@'\M%'x%*s%3JO -s@-@;m00CS0 P` Pp pp"0 P00CS0m0 Y@oЍp@Ѝ/x%D*O-a pf"Pp?C$@0eO 0Wqp Ѝ  R ЍOt`0S 0 Wqp `BE,Z z0S \M%J@'p@-@P2S 0p`n/(2Z1!41#41U &"U 80U p@@PC @ _@Tp@''f'G- r@,?Y`P !` VPiY0TLE J$C,^U 0V!U ! [EPsO@s ZX2I $! (! "4! 1"8",1!#$sO(@, "!"",!0 00      0  0 0 04 8 < 0@k000@'wA-\P@PAds 2F Z t B B$wC00C0@'O-P0p0Q`@06 0 4 Q %C?C0V$ 021S 02/ .0 1  Q 32 $4 (5 , T02SlN Y) U'PL 20 0SR00P[# S 0 2S Y 7P Y 200@@PA`0S Y0S S01S 2SL-PD Ѝ`b/. $0(1,SR[#ZY  0S^   BN R@1SO148<$B00C0@@PA`d!R 00P !$(,     Q "R. Y 00a14a8a<0#d1a#h#ʇߍ@ hQS/2SrW#, p` 0 ಟ00  0`p#W0 002Rp`"{ p wp< T"QP20H"h[ 0(`1 RS Q0S!Q10!K Hp12S  ?01DP& |!Qp10l4!1?h0,2S02S 0 0S>0)S Z0)S  "Q  R  Q !P500 0[J0<   0S<(@'Yȑ8Db[q\M%6L84<\U~(A-4RUP@P@ZЍp(0PPPB1P@TaTaTS <ЍA0!14!8!< 1!1p  11!1<0  1}1 ?0w1!1<0d n 1Pi 1@?0ЍAa@'[>N]nO-BTd:\& "!R &/ .0 1  T 32 $4(5, T @\   Q R P H2,0L2000&0S- 1S* 3, T000P0  00ST0!14!8!<!14!8!<T0,@0p,0`\T (`0 S( 21S$ / .0040 81 <T , S  PT 32 $4(5, T0\,0000`P$p 0 0$000`zzS 0 S00$000` P  HW[ $0P0  "X 0S pL 0S 0s X2 0 RS  $0倴xo((0 E 4 0 8 0&4 0&80 &< 00p `0 @2Sc RU 0c+P[ 0 1<Ap 0PP,2`0C 00PP(2 00p d? 0PPpp0`Fa ??`1`<A` 0 PP,2`0C 00PP(2 00 0PP? `Fa?`?`` 0SY 2SPU PUSJ041S@'['KaQ?L9=h'pO-HBp42MgS0~yP(r(b42S  0P:U42S 0S eyPЁБ 42RSfP:Vy42S]1!$1(1,ЍO0S `Sp t04rdW2S 0`lp ؠ0OP"PR S0SЍO yM@ D0ЍOSP 0Ѝ@'; h'@FM~&b@-0@M0@ pp`Prpߍ\ OR0  0dP \ Vt02S 0S " ` PDK!SR 0PB@'0@-Xa0 0LAP d2S8 YP(!p! 2SP0U  $pt" Rp\EU$p0 00P d2SP P@ Ѝ0P0!!1 \M%@'mdeh'/f'QA-@T2 @PlSP gSP bSP@ `p@T 00S p`V@MSPD00S @@@S@P(xM%A-Pp`[ @8 5 000 0@@@A-@pT` KQHQPPo 0@  @ @BO-MM0t4 P@ T\D RP @ <RP44 00(04QT(0 ,0 4@ 0#0@,0S @@((@`@,0s0000CP匃0P@PP0 l!41P430 (3Q,#  $ s4T0> p@: PE ,0S ,<(00S<(00@1 $@P'0FSʆ` P0S -S@= .DP00 @@Pg,0S ,܍ЍA0 4P @R8800  0 R00S' ,10PAPQPa400C0 !C*T0S0ST0S0S C 0S C C C$0# t PS<(0  P([`bV8@dN|M%me|0/(0/(0/(-@-$@   XS(%G-P`pT@0S  0S X| U TY0S 0Sm@ (Q_-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @Pݍ Ѝl!r1p@P=0LLD@rOP,0: S0RP0 00 PPnP81: S`P% S  R  rPPpPPPU r2PP @P(&(9@-0P  0 00$Ѝ  (0@-4S 3/ 4(@-S0 @( 0$/DS@(@-S@eC"DDyS@@-p PL`@@0 7/P0 S Ѝ HC00D(O-M M06@  @  @ P0 0PI L@pPMG 0S>$f vY0S0S0 p0 0X@OpT  0S" P%5 %uP嘅eU \ 0XP0PP.@ލ Ѝ 03/0P0  SP P@` ] 0S0SV SV tP0O.000; pp P( ep M(40@0Y0C @ pW*p 0  0 0000 0p0p00 Y!  00 )0 $0gJP$0 0S pOP厧 Z @P ZG Yp Z`k0S< f Sp Sm pWp 0S 0S @V 000 !00S# 0S,aQA00CS0" @ T 00CS0!  P @YT Y@DOoB 0Q   @OoB` 0 @0  0 0 SNT`(x%%Y0@-M 03s0|c00@Sd 0S-PP R%PP i 00Um `Ѝ0S 00S *@  0S\0Sr\  0/1@ \0Sp 0!@u0 @Ekp 0S0Sr @\0Sr  @"  @0Shxr @D <P@ @0 @ `0x P|"%   T    P  @@``C 0 @` xG H D`(l(d(&*@b $VqG-0@  0P 0S< 0  Q*u  oPPn  ' 0`P `z !URQ 8Y l O0 p H0 0W40p @P C u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0 pP  P 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`-0, 3$.0 (/0,8 001 42 00$4 `0rG00 QP  `Ѝ   0P P y`P1S1S1US1S 3S3S3US3S, X P`P0`$ `<3 043 1,31300`0#G00 QP     0P`00S !14!8!<<0!14!8!<@040  0F40  QP 8  0PA0O A0  gP 4: 졟 0R  1 eY^\ZXpW P0E\K 07#;;S``XP $ R,0T T0,0T0 R$C=KD0P 2L0#1\0\0Q 0P 0L0000P 0L000h00Pdl0d@a*LhmraRRaArrAaU$G_x@-p@`P P00 P0>F 00QP  Ѝ L0P< !@ !0 P0 F 00QP 4 0PaLs@-P` L0@ R0!0!0%^l00l0 ~p00p0Ѝp^ P ^3# ~P L ~H00L 4I ,LP000RaMO-Xp `P P 5 Ѝ00! 0EQ P D$ >X0 X0 PVuO-P,M0pPlP$0`P P@BpP $Pi :M$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p 0 0,Ѝ8(| L0 Q$2 q(@,"  P "  @P*"*  P0P S "!"0  0P@P $6 0P s s// /'#FaO-`P@M衟 0P0S Ѝ p W  G r0A E00 s0 q r w qpp` TP0P@0 `P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P .ab3~R0/0@- PBU02S0P^0A-p`|Pw@P  PmP P0R*"R0R0MO- p`0P\PPX $P  qQ 0 0Q\@T(2 R@0 P" R S C0BTX t0D s   0 TX  R 0 0 n pP [P  J BPTR2 Q PERO-X`0pM@PP`Ѝ J0Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/CP vF  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0!  0B0 QP 2 PVO-@`Pp㤡失P0S00S <q.p@q8WO$0S  0S 0S,0 ( 0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0NTaFG@-?`XP\@#@3P@T@TpW @@T`Lp(O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2"00咡 0A Q P P 0W:0 0 0A Q P PLJ  P<0T 0qBp(O-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:<  j p( A-@/p0%B?kP0Sp pD0FS `C D@@0T?  C0p(0 PK %/p(O-` 1cMV, 0. SP0 S@0P`00D@H0(0$08@\D0$ R! X0p1#r#@@ ,40A@04 QP r0P@8`00D`H0(0$00` p0C##  ,PW  q2<0pGLL0< SD00S   <0@ 2<00,040@@04 QP (100  RR R0(108H0L0 p0L0F A '*P1  (1 0(11 K  , 8 0B0 H0Pcߍ0H S180S  S:I@(1  0I0@;+ 塚 P(10(10@8 80 0Sb 0@ K /oD000"s R`( $00P `, $0H000$0(00$0D0SD0! 0CD0 0D 㓢"X 0X  PP  :X R: U$0`(00`P0 4h | U?0(00`P^0D\Q U`V$  (   P`( PK/\G h0x!P0poQ P P0S*0hQh  01 U(0$0 `P0l P P0 00 , P@`  Q .b A0 b L L b @G?LL0CS \Q*V 0 $L0|!s0<80|1 0V4 8 <1 , u?000000U\`0& V0 0$  \T0P 0P 0(00T0 00 ,@Vt 0$ S1S IxQ1PP|!hR \@8P PPL0sPP|! ,0I|1@|QUP0U* 0" 00 0x 1S \P@ 0I 0000@1lhHDPP 1|!R1 @,PP 1@703 0P 00RP U$0`(00`PH1 SRhDP0S 0S \pVR P0S 02S 0S0S 02S\V(\Q|!6xQP 6PP 00I@P s\ ; |1P 1XP PPPPPPL0Is0PP@1K@I,hCP=PU `|1VS P@ |a``L0Is``@P !SP hPPO 0 1|10|1#40L0s_?00010PP<6 K/\APP05P'U U0@Ih00h0tP0U* 0RPd01S\0!0P %4QP0%8%\0 P0PEd0U03:\0t(wP P|!d1 [b" :0 0|12P0P`"< ,<0P I 02S0P0 S0 U$0 P(0S000 000(000 ,@ D00S@ 0,40=@04 QP<0,R80 PI 5P0cp(q   & Mp(   &   > { R j   % R      G-P p@r W p\aPP Pp $PK/ED08QP0Q:" 0PS00  Q poxPh`P 80"8 R 00 05 !$xp( 8 \ y   1  p@-@5%SQ% 5 %SPR UUQQp  0Q Q0p(A-lP`5p@ @ 0% Ņw@ŕ\p(O-POMp(P> b5S5夢05ET0  AP05 ET `T 5d 05 !dP 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0g< JQP d |d0P Eh0K/0h0 D0 @!r,qr0d  01(?  j C  C,10,1#40L0sK?000/1001001#40>000310 00 000T0 C<(%,5QP Hd  d0P{ 5 p(r  "(? S c c{ @-@ P 0 5p(0/"(0/"(0/"(-@-$@   㠙(%G-P`pC@0S N 0S X|E  U T:Y0S 0S@ *e"(Q_-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  6C-@M Mq` @Pݍ Ѝl!ryp@P=0LLD@rOP,0: S0RP0 00QPPP81: S`P% S  R  rePPpfPPPU rzPP @P"(&"(9@-G0P  0 00$Ѝ  &(0@-4S 3/ |"(@-B0 @( 0$w3B@8"(@-B@2j3g3B@O-PMM@`pP<P0 P: S3/(MP 0rS B00P 0#0@0@@ U  ?P  P PU B00@23MP@ S @X帰张P60: S)^0"=P@PTP X+ S R"P-P U Tq@\ SUP@-\MP@ U!PXp!t0#PU0000 0 +@P  PB0S3W PPth0 PLPP pV80% ܍Ѝ   F F F@ 0`( "4`#/ p@-"440 @"440 P"440 "440! $(0 $( = XX=ddhhllppttp p@-"440 P"440 @ !!!DD~!@@x!HHr!LLPPTTXX\|`\ `<p` p< p@<p@-`@"QUpf@p@-@PE!B!?!C-!->CBX?X\<\99>!9>:>C!?n:>CF! 0? AC> !}C>G!mF!EnF E~G  0X J~X pW  $$((,S>, }S>G mF HHLLPPTTXX\\O-P ! "441!"441 $$((,,0@4p0T`4Vܑ\5 S L5spTԀ0,$ $Q p W %wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx9 0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P0AL 0 0 0B0  0? 4 0 808#<4 0 #4 0{1 $!4" (2 !8!"2" Ѝp@-@0Sh70*(00S 4 /'( 00S/'(00S0`( "4`#/'(O-M P02(2@0p00 0` `0X  #1WQL00 K W0B@ RX *10S@Ѝl10ST@Z000@S0@0 ppg@`P0AS4T0  0W (,\SP @T P( 0@T /T @@V@TD00S 800S0PS E@)('('()(8(()('(2O-0@4p 0 0\0PQ8"R000U00S.  =`P'0SP Ѝ6  p X001P``` 0(00,0S/(0, ( ,R00Z P000 `0` R0( ,0 0Q  0R000V00S  P0P`(0`F0S, (00/PS0P, \b6 P P X00 0'()(((p@-@PD @ P`,00S }60 0pp)(G-@`D8@pT@@@@u   0@S( li tPp崐0S N600pD "T 4 0 0( 00p0 )()('(O-M MP`p X @8<0H儆0|6[<08p|0@pD`LP3[t.[R #,6_ 0.0 I?[0E  0 -0 Q!D 8j 000I 0p`5@[/ `pX0P i0Y I\1R1 U [!     ލ Ѝ 0 -0Q% ` p !R   8800$( 0 00000 0S 0允1Ч0000/, Ȅ, 00,004004 P0 C# c.38,P000 0S0 85  0@5 0L0 ,0O0S $ 70$0 (A0S 7 ܢ ?000 Sd:0 0P2 0A40\1 : a8:Y0\85   @5 L0 ,0 0SK  I&10S; ]0 0G 0 000$? 0 88a 00 0( 1( ,0(00h,0h( 0,00U    0 2P0@00 0R Q'' 0'P_ȄP8 $(?4 p0 1( P( Ph@h)($)('(M%'(((A-P`p@o4p0S i40S !SRp^4p0S X40S!SRPj@Pc@A-P`p[@ `$P`PS00@AO-HMQM $#0@2`0F/ Ϡ _0 ;6Q%6P(0,P\r 04PA`P `(0, 0S_(0,PۍЍ20S,  1qVQn8.#4n4#0 44.4 40P 0 0(0, 0S_S(0,P0```00@DQ"R0 P 0 00 @Є0 03/`)  0 0 0 0  000 0C c0〠* 0\l040S b%0 0|>$)('()()('()('('(@-P@p`AMM(h$c 0 P@ s3U0:t0 R0*d F$#@}0P M40  P,, 4$AލЍ@'(=Uw g7@-0 Ѝ0@-\M`PpX @ 90H0T0 `'!D0DPQp*QLt% P\Ѝ$)(PA-`:L`p`P#3RP3R#\@A'(O-M`@ ) P0F: 0 0@40P$? 0 n622Q p{ q B("(sQ0<30<420S0 P2pQ 04  0R  @P.( 0Z1б  0 4 Y: 10S0<00D0v`e2 `0Ѝ 0*1 0O20S I20S 0^` `$824200/20S 7p&2p"2000 & "g'('(M%)()()(O-@PGMM X `8p:0 5 R"0倅S? 0S! 000S<PZ00 1000( 0}5pH0 \00`0400Qp"Qdth2 " 4 0Y"/P|4GލЍh"0S$ @ L000 0t HP $0000S oZ0  03.P0K 0 E r@ n  0 0S 㜾 s-[  P1 (E"$.P Ѐ袟 L000V0 H   00`02  0J$1  1008r10SXeT2r0"0H000H0H 0p 0 S 0 RC 3#004 S 0040P!YD 0(  0( 00  c  0 0(000C00 S %<   0 0001    0000 _0 !0vs  0  00S ؽUw F'()(P8'(M%U_((i*('( 1HG-P`M@zHXpAZ 10S t10S 00 0H P<ЍG(@PEU> 1 RP1H I0  PKG/V08:‰ V- PlYFp 08,80<00<0S<00<0ЍFFFF`F V   R0K Q  Q@'(x'(T)()()((()()(G-1P 0p` %0  0^0@ 0S 0 0 80PS `P` 8UH0ZP000PS01`41Q$,$ (,`(P P8)'(@'()(@-@8P 080@'(G-쑟`0PSpM 100 B?|/ PBP 0@8◶@P|1 ?<%h10pA0 G   000 0 0 Z` `1 `#"p(,0(pV Zp`0PQ*dз0S\1@@ 0XP\   0^P0d000 A)('(*( *(*( *(*(P0p@- P?@$800P 0 !SRp*( *(p@-X`0SpL0LP@1D@A0SOM000pG *( *(*( 00 /,*(O-H0MSP` M 003/ ލ Ѝ40 pPࣟ00 +0H00@0 t0 /  S 0V 0i$0X0p3!0S' `3QhQg  0  0励0g0Z0 02+ 2R820t0S32 Q o   Z`"$H$+P@",2 R  ! ! t R1D+࡟W000c1 Q5 10000S1H  B/oQ" RK \!B0   +B@80)P:!P R, P T 10S0Q 10S 03/     0P  0p`V0-'()()()(p((>bp((0O-S0 00㨄RM`PV@#M (, : SL \p(5R<R  P  RSV !0 ,-x0 PB?6#0`s 0 0S0 0000 0Z[ 85x @5D0LT 0 b32 Rbp((@@-@q!SP80< S0 80<  D ,p@-@@PU DK.P NP 0 R0:pp'(@0@-P@80\U< S0 80< 00p@-P@ 0 }U0p81 R0p8@o0P0S 0Sp YP0SpXS00S p|K0S  0\B0S(Np@47'(4(()(@X'(@-p@`MuWP 1  P  p`V( vR 00S0H0S 0 0 P0L -00Stt, +a)00Ѝ@L&P0S 00`ЍUw '('()(@((@)(((0@-@PM \"8 ザ7)Q Q0 $0ASЍ000O-d5,Mp0 1@P`D T02: SR+ $0Ḱ0 !%刡  !  Q0::` V `3 V `! UP @P(0S @P(0`S @P0!0 0S:R 0a40  `(`!\Ő\  ? 崣 ? '0嘳 +0S30m Sm p3 R #R TH3 R ,s( ,3  R0\ 0㵯 z 0 " 00C 0L40S$40 0C$0娂*82)|20S = 0 : S( S,  Sh000 00r+( 2p ZN *o0N0`S 1 00|10800 0ˏ B0X0 YJ0T @ 0`; < 7!000L00S 0C&  ,Ѝg*P( 0ˏ  d ! 0 T @ 0`; 뫴 h$*('('(((T`*()('(U '('()('()(O-2@ 0lMp`P!\P  ? 園 ? &0 *t2t0S0 S 0X"S 3S @@X <.(20p`R 2QpQ\tQ`Xd   X 1 R, )P'00X0S  0 0 `0\ *L!00ST06 0 !S0\ 0㵿 '0 " 00 04$0L4R0@ 0$*002(0S PN8 P& PlЍSq  ^l'($*(T`*()('(U B)(@((@)('('('(O-p|2t2PU@P` 0U0  Z00 Ѝ0k Ϡ?R f4F V@WLQWf TU A0 %&00100 @ I* @T`T0pGT Q 0@`K 0 @Q `  T 0D >0僁 0 %P 0 (0 ([@` 0 000x000 %0P0S000 0U000{00'()(dO-4Pp,MW pWhb`p0 00`?00S VA3@30000JT D` 9 @000) @TT00T S @@S  T 0  0 01 0PV pP 2 000`?0l20SA 뉑 0 '00 'Y@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0Yld= W  $p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 IP  ,Ѝ)('(@-= D(%s@-@P `0S 0S 0 ЍpNO-EM` MP0S 0S PpP P 0SPލ Ѝ000S  P k0S 0S 0S M0Sy 0Sx 0Sdy0SP)0S 0S0 08Sd s/2#' 00 " " 0D@1 !! 0& 0&d!! 0&0 lpP0SS "04 0 R0  0"? 0 ,¯ R*( ,4ï0A80/R%' 8`<0P V Y0" |ű0S lhbPUt x@0S H嵱Db@PUn m,嬱0SP@PPDPRH0S  `WCn* lxl/%|0S llL0p00S0P0E% 0,0UA:000S 0S P H1 H0S 0S,0S P  l P   000(㪰PP 0S뽯P DP ?PP FP'(eo>\}H]4/(q&bO-H0@Sp`M W0R0: 0P 0 H"p`0<"0 S0 p20SW VLЍP 䱟䑟  BR 0S#/  !.V  R.. P x!`T  R0 H  gP  @@" 8 < P8 <`aP0 h P 0 O$ɮ RP `  ^ V UV U #*('()('(!0'(((J''(00S 4 /'(00S0`( "4`#/'( 00S/ '(O-M,Mp @"P:$Z 0  0`SEZ ` p+P% %0`VP!00 0؍,Ѝ0 (P  X 0`VPh0S  0l mh P  G0S, @@$ 0; ([(+Z054%00! ?0S S00:00/0S 0 S00 :0V00#03  R00S :0S;  0| 巯6t: 0S R` P 0@4[< Q0 4`?0: :R00^0 B?QP%90S  0  0 0 ` 0IP0  90S, ((P$0N$0  ZP00 0 S_8Q<90S8 0 V0;R02*h0S/ 8((d0 #0 (P `l80S (00 0(00t 0`' w@ ((h 70Sh0 0!7'(5S[/V V:'<V  3 #P  RJSQ< !0E D U0$000(p i0 U47PP0X 0ZP] D'000q@0P㐪P68P"h0S0P%Q_!1Q 0PQ^100 U0 EPP P00t @?1#R 10S0>0 P 冮 Z$0S 10000S p50S $0S 00 P0ft ?#w$Q  40S $0S  K Qa 04 0 S0 0 0 0000 08$000 0 #600S040S T4 PP `@pt3SQpQLtQPXd00H00S1 0S p30S* \}P00  0,;(P 2 2 0\00Q&&:0 @00x0S828040/<0a0#PQ8`PU'()()($((Y#O-p868F4V4f|M,0S&40AHDLT! T0FX  &5 $00P尥  0@, RG5@|Ѝ0\."Q 0 P0  0/ SRQ0 ?00`1>`U`00S 00p@30Pp7X$\5SR%Ϡ<# LD ?(0 O! 40S40F SF 4`V0`@0x@S td0, f" 0 Ԭ0030SC 30S? 0 S( 3 S? T!. 0 / s\@T` 0 Ń># 0S  0 S\000 T @T`VT0? @`1 020兑A0[ 1QS  0TX ᧧0P0 0N %000Y 0<* 0  0VT0 pW`@p^W@ R00!03SQ@1:0Q@4a p0妩 00  P C0TS YP 0 0 媨`P 0  R00* A $`$*('(T)(p'('()(`*()('()()(((%'('(U P((i*(O-` @ 0Mp̰̐ 0 0  BRЍ PP U QP Y` @ pQ RP Q @p*('(! 0`( "4`#/O-plMX 6$0P`X0L1L0H1H D1 0,0SlЍ0S @d0,  0 m00@ܰ 0D Rp`T0#:P 0 ARpQ R\tQ `( R @PL'('()(*((%'()( 0000@/00S 4 /'(00S0`( "4`#/'( 00S/'(O-:M`PV`@@M90S 0P )S0*`00#0.唉Y  pP 0 WP \)X PP9p`0S 0S ) P00 8 #R0ĸp0,S000008 00!"441#0"q    0P@ fcfj00C0U !#100S 0z  P 0tM0 S$ 0S '0h0P\7}`{60,S00000B7 00!"441'p0pp00ppP*0S  lPe 0 1`]|`PY @ `  80< 0 80< 0@0C0ş l0 00 R.*0S  $P  0"pWVލЍ0S 80< 080T5 0< S @D0 00$001 u`P 0S 80< 0804 0< S D`0 00$`S!  B("(p P ⴁKP 80< 0 80< m00C0@' 80R<.PSR# .R #P$PP3P`080<>L3 R0* 300|P(3s 0 0ppW P0Sp000AS񟗢l@@S2 002t0S04000^P H2 ;#R0w|2 0#R0mQ" 0S0S@ 0q 8Pp  : S000 !0 #R0 Q   0lFQF?\!\  010 S$ DC#R0 š!ʡ0S  0R 1 0 00p0P``000C0WIPpBn % )()('()(W ((p'( *'(%6E'('(LA9_O-WM ME0AS񟗁p`l4 hP X7 zD' @P k(7 007@0  6qP 60S  60VF6  X  0`06`00圦100V4:6 Rpxxx0S/@6@`aViPVo`Wލ Ѝ( .P*P   p 0S d @5p FLu 0 p§00@(0S Shhu`%kp;(P* 4 0  B, ! ]50SW 00(000]/0q 0S cBp(0G0(SF @pQ(Aa,p d4p0(S9@0W78O,0 S1 #0 R( S000000W!"!"+Wdx&hp2  (  ]/&  ,0 S1 #0 R S) )R * ؀ p0 S( R , "2 pR)@ W(,`0@'x aV!W"Wdxh A aV @0 (0S $ 0 s00Q P0S"0`10S x10!)!00C0! P0 00000C0!" Mpq0S@0 0 0C0 00@((')(*( *()('()(   ) E (%)()(h '(4| '('(  0`( "4`#/O-Pܢ1EPMQ@Tߍ0S `dp@EDAG@D0 xxp+00@   B 0    S,"[ "[ "[S[ P0:000S 1a  1R R@0 S 00"P X100C@<P X r X ! ! Rph0QbT0 e R\tQ ]` h00!{P\ p00_ {000 *(*()( (%'('('()(8'( _@U)('(!VO-40$M⼰0p4 `@?P#\P  ? г ? 0 30S30X SX 0#S 3S p2@ 002P00 00CSFTY! P 80R0L003030 000?,` a2! Q,S Q0B*2t20S P/ P@B P$ЍS  = Pv?00 1>!W 00S>>0Q#b ! RQ T30 0|!S`0?00 ?S  R.. 0" !00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L30  ^Z 0ؠ< 0Pp1'($*(T`*()('(U G!'('()('('(00S0`( "4`#/'(O-`lMX x2x0tB0,0SlЍ\r0S Pd0,0 $$6000Pp@1 0 0D R`T07:!AXpX\tX`Xd  X  @RGܦܦاX %P 10S  0Y@PPP 00S  0FQ SR  00F x X! 0 P  H 08L'('()(j!(%(()('(!![!!!O-oMM@P00 90|2h?0SX0S $5SD0SY8PZX0S $XnS X Rg>`0Vd2 P\20+! `" d" B1d"\000Bh`$lPl0A^000p21`t2\B1l2>V 2l20CP0=SLq Q\20B   0S 0 8$5@> * > >0S <0 0lS0$5  B11  !`0Q00B1- 00 S  ${܌0S%  봀 -⎀Ḁ$1BP`R!B@ LhPP d ]` PM 0S  <P| *堀j|<p<0S o0 0/`0 bA?P0P<5A?\0 =<0T0.L07 ;0VHQ RX0h0@ @0 8 84<ϡP b${ S Q,0 Sa?^ @P= (;0S @0 # "@0A!" !@0 ! @ @0 ! AᶡP: @ @0009J*:8t:0S T0 0؍ߍ0<00<``!.Q  R  `0" |i0S pd, 0 HH 004y+\0#Q  0 X ?蘟 /0phS90y Sy 80S 0)S 3S 0S 0 080S 8 0S@(0 04( 0Y $8D8o;\Ş&"\ ` 0 0Ϣd h pB  `bnj"36+?H "D H D 08T<XTRXX07T `V=S((0H 2T0VpC p,00C S=Sy{S  +\0#Q  0h倆 ?eY \|670S 8P#50h $60S 0%\Q\u5P50 S555;o\Ş&"\ ` 0 0Ϣd h pB  `bnj"36o@f ?! |"$5S8Zx0 2,2$2(0 W002,0("W04200R0V82b x0R"2 W 2$S\?< M 2t$Sd??P BV=SL5s045 p`?ൟ0S/[ 2#Sd2?/0?  (2#0C(2 2Sd2?/0?  (20C(2`H0T SD0X 02 0d0DH0^K <0ASص 20 2(2"0C(2 2S 0d2/0 "!`pV0: 0dϠ ΌdP \^̠  L \h qzq08\\$20$2<0S4 d 2!S\2/0?! ! 2!S?pPu?`rpPXd먐 0  0 \000$5S `0t63 03080H ` H D /D L'($*(((('(")((("3""M"e""y")()(O$)("(%T)(" (($(()(*(#=#(*(8 )(a#'(~##'('('('()(#(('(4$`*(#U $R,2 ," 2, lSh2/0^>0Q0^0/I$5St2/`0hppWS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0P3 !D0 R  "0 0000 0 0勞P1  "b2* 2,20S ,0 0T20S _L dP 2p"S\?"0STT< SP VxP2 L 0"bST 2"TS\?< {0 0<30S 2@#S?d?0`#S\P P  CP 0#S\ 2#Sd??P cK\0 0 p0S $S00pW`@$Sd2?/0?`$0S0\0000p`\ 2R`嵟` 0V $S`0?0$ 2Sh2/0^>00p`Y7 0%S0\000S7囡!"TpW`l嵏X7 0%S 0\000S7囡!pWO-P`@DDT(zp u W @.$$G-A0 5 Pq0#R%%r`!00 0SP 1Q0a *|at1h10S 0 0U/03Q0S6 8A 5*< 5m000S r0 0@TP[UGVPt0Up Pd0 0S L P<0 0S '('(M%$'('('($$$(( %0/*(0/*(0/*(-@-$@  7 l(%G-P`pC@0S 帜 0S X|寜 wU >T夜Y0S [0S@ 唜Ϛ*(Q_-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  㠚C-@M Mq` @VPݍ Ѝl!rp@P=0LLD@rO=P,0: S0RP0 00PP P81: S`P% S  R  rPPpPPPU rPP @P*(&+(9@-ⱗ0P  0 00$Ѝ  v/(0@-4S 3/ *(@-G0 @(< 0$;@ *(@-5@+@P/00@-0@S 圛@ '(0%0QCoS  R7 -S SP 00PP0 0x SS  S R X0X T0TRP0L 0000/TTT8 (('()()()(T 8t0 p000 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/)( ((T8 T 8$((p@-@P0000 0 0022=p 000=000X0X0<0<0@0@0\0\0@H3H3L3u/L3P3P3T3T34 0h p@p@-@P0000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4 5 5d0d00000P5P5H5H5 @ A H5h H5S>S>p@0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//)(O-4M@T t儤儔儴pqx+l[ :PdP0_ 0 @ @P @Ѝ`\XP0S. 30S30S   ?v0P } P`\2P3#0Sx t#S4l P `0S T/0 CS 4s*0S 0\%R\\5 0C?o""20N`h YT2 0S#P0Pd 4 02 ? :010S>,A!Ϡ\<# P  0Q ? 0SU0S 0弑h 0S 0p\%R\P d10S%X~PQ- D!0 08! 0 *` 0S g0 0 0@0@k4Ph`Ġ``IU* 0R A ((*('()(&E%)('(X%,((w%((%%'(%'(8 T)()(%%*((*('(&'( (($(()(R&h&O-@9*@0MM08x`幘P :N 峘ލЍ80S G:P$8 p坘 0: S T fP@888X04HSP 0)00S  ~00 7 7 8   儘 8@ yp8 s[WppTpPpT7WL P 7@T ݖP  ~ԖH8P 00* 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p(np2S )P )P ).[4PZT-`Y 4[ 0S0A<관X| V.+0    0,P %Q$ f Q춝C ?G xP`u 2S<4$040404哗X02P#W20AT2@02 r0G    0l  H  ?p0l3& 8 S20#"20#209P` 2Sd#0P\@Q=S00P 5@ ) 2RT0 S @x0S JC 5*< 5e3 30S j0 0@20S 0|3 0 S@ T 10Sd"d2QXk 0De3 @= C ,0"0000t @DO.0 @7'4p0 @S葟0S0S0=S0S p/8000D p 0L%000P%X30,q  *+ 10S G0 0)( ((&((&,(('(+(&&'(8'((*('Ս&)(*(&'bS'\'''''$(TS((()()(r(8)TZ))'()&))J*****a++((+++,B, (((,)()*p*+>+*5+)(g,)()((('('(,,*(,-'()(1-((V-*('(*( *(*(*( *(}-)()('()('('((=S%0S& <0 p0P%<<00*X30O0 00S T0 00S5 0 >0S ^PLq 5*N> 0:#: 5&p1s $10S +0 000S(:P0q0*1S 10S  o0 00<cQdyP 0`r<0*p23 $20S O0 00S0L%r0L%r0H00q" P 000cH00SPFP$s*43 20S 0`# 0 00L40q"  400cL00SPs*330S 0$ 0 0t4pW. 4E ^  \pWR 0SPt*Z4T40S _0$ 0 0t0Q,%R0%45S R! lm004E0S|PP**`5w50S /0% 0 00(0Si xQ$ D0Sx < 0(%0S^,P*6K50S g0<& 0 08%<5HSR$  H00850<S6aP*6|60S 90& 0 0@%D5LSR$ t L00@50DS3Pp*7470S  0' 0 0 7 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*K880S P0) 0 0T PYd P4TQڨ0QXڌ [ 0 0S Py*9e\90S 0) 0 00S3 6 !/0S0QQ*P )0 0Sl wP`z*p:3$:0S O0* 0 0 .0S .0S  .0S0+ Q^ NQ L .0SQLd .0S{v<Q .0S .0S .0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0*fp<$<0S k0, 0 0<0S <0S(L*H<<0S M0 ]h 7< < PRL PM\= 0SP @PL [ `  pd娭@PUVʸ= "0PPQP_PPΒ.P 6   ,P~,>P8) 3@^ S;H.00 0 S 05x>> >^>pXPW>ppY@>@000PEUP8HLd  BL 0b03"(P P Y) P?0S   l?8 H4L0d P B b"30 S?0S   k0`00p^ P?[@ 66P l0x& 5000h60S 1S P P @6 86 @FQ$ 1V @ 0`P@@  04 8 <%c#!$c4"%S 50S BP 0 0  ``T0  0 0 0 05a(!"4a#Q  &0SgwPh0 $"448#8 S 0SidPj0 $"448#8S t0SjXQPk0 $"448#8V:QQ  /Q R 0Sf4Pg000 4000 Pz c0SdPe 0 40#40ht,0S 00 0 0 00  $,0S 0 0 000  0|,0S 0  03000 0  0pc,0S 0``&d``000  0`pL,0S 0@00o0  0 1 1Q1Q,+ 0S ŐA 5< 0 !00!@0|!0pCS #0p R0 !0B88#80WP 囐`@fn0PhUP0Qc R E/ !0!Y pG  Q$*(-'(((S'((*(8*()(LBAL- '(-Y#.<.R.o..E.5+'()(.*(*('(*(./[+|00S!4!: S  S :C / S : S 0P/@-1'('(F/1A-0`S lh@ ܏T L10S@10S0(1 10ST00S p@00CS0P U 00CS0 P PYU 㝏YU0 P0  0 0 SNU'(Y/',(()(x/'(-((/x%%p@-PD0@0`S r 0!Pp'(/'O-,1 $1 100 ᶏP`p0 ` 娏P 0P  ` PPP(> @ 㒏PT00 ZT xX t  [P @@` 000*(,*('(/`*(8*(*(O-P1$M0H Ϡ,"ʼn  p~P ` 0 @w h,0@$T  0`P$Ѝ? 00 ?  V P 0I 0 0?QR0 0# Ϡ?0  <`0@p 0*(//)(/O-pM0P8 0PȀ`0Ϡ,"  Z 0 Ѝ 0|x@Z ЍOw ? P  ? 婎0@`*('(/C-P`U@ (1 U P0 PP0 0T2`p܀*0 L@D0T@S   8HLd  B 0b13p@" }0S   0P00`0@T Ѝ*((0[30'('('()( 0S/A-@p d`V F0 fP2Qf00 SR P00@00 0` PЍ'(1()()(@-0P@T@T3d pL `l0p `̠V W @ 0 0 0P00@@000 Ѝ*('(Y0p@-`P@XMX   `P @XЍp @-Q lddH0@S T00S H")000/(P00'(p09|00p@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍT0'(0)('(\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,TP440S/($0G- DP4 40S0 40S, S0SB 3`3 30S@=S= NS*S330S X0D 0W`XSHSDsPUU00Q AP 0S ??@qى׉P`"\R0"00S7 `r002Db0S) l00S) 0R0E>0*X42910S U0 00S&\P10S & 1LQ X1*P1 D10S )0 0D10S 8& $1P 0*000S 0t 000S d0P`v 04 0G)((()()('()((('($1'(*()('('(8*(`*(*(]1B10*(,*(Vt1  ((1)($((1'(1(1O-PPMp80S#C \/ " / Q @aV``  [ΑYP d \P  ?8 , ? 0 2r0S0` S` 0!S 3S 0? 0!0! !0!S`0 0 0` U\/0ϬL3 80S30Ð0C03` 0S300CÀQ"0 0P*00S ` ` `Ѝ kS  ,$0 0C$040S 4 $ P@ P V'('()(T$*(`*()('(U G!'('('(A-Pph0``ATR @P<M0S @ Q1p0A*(180 0 1S/ 0S/*(`0 5 /H0P 3S P 3S P///'(^FPO-0(P,0@4p8`N P P0P` 0S 0 S   000 00 00S 0 S L0 v0    p p'(1(*(Q 0`( "4`#/O-`@8 0P1 008Q ЍS ph Q 004 0p8pQቐሀ@`` R|`<( P/ 100 P000 L0 0 @-( 20` Ro/ 103/C!000P3/@-4 20` Rpd  /!  / C! C!/! !/@-D 20` R@$  /!  / C! C!/! !/@-YQ 2O-$5S[  l@`hT00! t pbR$ B,Y  !$P p  R !U101Q+DP 1PAC0 2 @ό R&@@00Z   T   @U  @ Ѝ ^000 0S0 B0O-pRMP`b @P Dm@4 7YPpߍP(  Wpp0S n<08 (00,0 000040!04 04$0D0(0P hVphsp 0 1 DY 8Y ,Y  Y Y p  p   ̇p 0p?pq8SڷPr 0  *0*0@0p : 0* *%2d@edA<2T2]2n2z222zd@2A-PCMMPp`;8 Sp@P  P0<P:U00 ## CލЍO-PMM@`pPwP0 P: S3/c P 0rS 00P 0#0@0@@ U  P  >P PU 00@23MP@ S @X帰张#P60: S)^0"庆xP@PT<P X+ S R"ẅP-P U Tᬅ@\ S吅P@-\刅P@ UPXp!t0#?PU0000 k f@P  P@0SnW PPt܆h0 ׆PL҆PP V80% ܍Ѝ   F F F@00S 4 /'(00S0`( "4`#/'(O-pp1`h10P0ɯ 0 X 03#ˠ121@ R` 00P As00`RQq00S" !% 0%3CC(0ZXp000Z X00 <P00*('(1(2'(5+*( 3 (( 00S/'(O-,Mp0`P@ᐱ0V000,Ѝ000/U0$p$00 0t000P$00S [00 ?u$000 0 P00T0SpP8P7p'(^F'(M5i5~5'R/G-P `$ 0pP@V` 0I@`` V`@&!D( `G-@0 4Pp X00000`0 8#8#$48#8X00P a40 "% ?Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@Pp02#U 1!L `R ` J U c9# S!V Q V3  P! I P` 0 c9# S V!Q V3  P 0 P$` U P `` Ѝ52 50A-1àQ`P |0| ||jL0@Sp࠱ P$` p@QL ࠁ PQ 5e 5p@-@P0080P 4 PR*SpL0L LS@04 <<1L0C800S   0~ 6 5 5,0S/`0@-0@  L,~0,0080S 0  L0@|~1( 6 6 5,0@-S ,0, ,,K@TP h~@e~96 5O-dMPpU`@@ %88S0@ @84@D2@D1@DS@D50  0 00P+ U0#03?b[[U^{@D `#0P$0P5Q HO0$0 ~CD 0XR @|"!$"!L0<p008p$0 0H(0 0 `,0`4  0 4$zKHP $0 {Pd40  000h"P  0, 005RSUSP3S` ,4,$,`UQ~{V  0 00 D040`FH00C34`80E%DHPQ@0 % 8 ,P0e@P,P|3Q 0Q+ 0CQe 0PS %T$PP@ }T@dP P0:{T`@V !X{}P` !T@O0`P`p0?L00T X tPT X\0RP d|` 0R3<0<0S@p L00 (0 0 P  0( [R 1!<#! P <`z(0 0#!40(  00Q80080p0ȿ0T`0 S2(0(0S@p 0 0 P 80Sʼ0 0C800S   0|`~O@  = ^$@$dЍ0$01(R6LBAW66(|5669 NBAW=7 7L 5^ 7G-0,0S0 5JP@^z`00qW40S*|Ѝ!  0Q@P   l@Pp:6p$ 5A-`0@c,0Sl0l llIPpᮘQ L0< H 0P@DT@:6> 5]7? C-`0(Pc,0S0 Ip@ၘQ |0l x@PEU  0P !  0 P P Ѝ:6O 5]7Q X0sC-Ђ0@ P@` 0 00 0~ 0PЍp1()(s7X0sC-Ђ0@ P@` 0 00 0} 0PЍp1()(7A-0PQ N@`p0P R   T0! }@P 8+4P{%,((1(71()8 8'@-,@P,0S 5001(@-,P ,\  D Ѝ1(p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp)('('(27@-0S S+,Ô2 R0 ELh `Q tp PC{aQ* Q( H<P 4,B 5*< 50d30a3y210S ~0 00@ @7.Bp#x3 Ŝ & 0P xzXPA 5*< 50d3D01$10S I0 0@ d3S+ CQ+aQ# 0AS"NP S0@a3d3*|0dp00S 0 0@S Ѝ04'(1('(V8'8q8'('('(1(888 @- 姽oFO-0p M"##0@` @ 0$0wԃ ᰀpPs0S@P-# 00" qp*$~z9lU tU bU0@p0P)$D @+ P80 ( 0 @0S ,00(# `!$D P P0V }ЍVp FpP` 8i prP `P0V:P0V" cP pH0P0[0$$0 !$ P l2 0 ! P@  @0 00$ 0S Y(0,  $ 8yp Cp @0 00$ 0S Y(0,  $ 8\pr \ @0P`  @ P0 PbFF\%M%FFFG,GjG@ZGG-p@P` 0P V  00 000G 00`000O-0` mM$0P@䄟004080 0 pp40S+ mߍbW AW LW x8Qy4OycW iW0p8 4@0 0@4: S@ @0(0D08`,0000400P  P 0! QT| 1{p 0Q= $ 0! $∡匱@P 0V$0 0/S  <<Y, `x`0"<'P0<0$v`P _yP%< l y jyw <xVD <"$x 0#$0@0P!SF `VHzp 0 n?C0 n?< n/ y0Pp < 0S `0S   B/oQ" R 0S! m0$H 8HPp`G0$pJ 0$ pC qp:0S ,( PQ S RPQ \T G\%N%Hzd@H3HmVHHIwHHHHO-`Pp,ML$`` 0~p@)$0S0$020S($00 P W 00 PU 0 0 0!%fT AT PT lZ@pT$gp@,Ѝp00` 0pP , ? 0o 000 00  0 p p@0 00`#qp p V@p@`rI\%xIIN%IUIG-Pp`l }p@<P10S<  p o0< 9X $$ mp@- `&W00S $$ n\p@ Y``V @fT rT GX`$$ Q ?p@$Zd\%IIJ3J0N%OJ @-  oFA-@P`pP 4}\ XyT  @@~y 0SU  Asy AH(%T@- R0ЍpP `@JGP 0 R SR  R $Â!!BRP0 iP , (P/00#01"$#9O-`@V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! 0O-P((@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR 3O !700O-0P$`s@P 0㘹z'0 0bQ P u@ Ѝ tvPC-`$4 p咓P`品(@ 0BQ P Ѝ 9vP404-@-0  Ѝ Ѝ/-@-00@';w 0 Ѝ@ Ѝ/-@-P 4(w Z} JwЍ Ѝ/O-MPp`@PЍ {P P 4S  0DruT0P$ Q$YP 0S 4S $ X0P4 S $HuSG0!!p`000 0 0  @ 0P 000 00 0 0 |P 01 T0哇* P$(` ,`$`V$R ڀ 0`  O0 @0  "OPb 00pP0Sp xJJJtJpJJ9JO-,MXPp\@Po 2R 4S  0t,Ѝ 0@Q Q0 '  PS[  "S 0X000 00 @ 0Pt4S 0S6  00 000 @0 0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3 1  #  0,$0@S4S 0$R  @0 RS 00 0 000000PV P0P 00000 0  P1p>$KU0KLKWKjKKKKG-`pMMPr@P\ЍTC^t# E@0$4$ 00; Ꮻp+Pp uts@upP @4$$: S R B., up $4S ($,40(B. up E0dR04<($$4,40 K>؀C$$0  0 00E`d$t؀E0  P0`P 0$4S   0p 0,p 0p p}p p 0pp{ P P 0"Q Rp5M*pIg Z0"KKKd@LLd@.LDLZLvL@-@P 4B BRP =up 8\4  fЍ@sЍd@LLp@-@PP PP \.p~4PS4 PPM1MVMA- @pP0TP ` Xp@0 p@@pMM$$ - Q EAQ0 "(  0T 00 /$4 0T0 / $4 0T0 /O-`P@p M6`=P̀PP `00000t따 V:Ѝ 1 00 0P0t`P1 0 0tP UP3wM[M(%McC$$0A@-P@- t`R@`mЍpP ϲP 4 R 0 X,MMMO-Pp_o!R0`@|MR(0S00S "R0oU |ЍP P`U 0SIQF (0QSB!RS R9"R S R0A -00S00P0#  7/p  7/p 40  m0$80'P P ᄴP NA-@pP`|P 5/p 4 5/p 4 NC-(00pS4` Ѝ$T@ 0 0 0dP 00  0 PW0 )N=NvNO-0 0`Ppp@ᜀ圐吠T Ѝ0  0P 0 0S Gp o@ 0 ,8@=NA-P@ ` p0 r@T=NO-`p lP_`@`T吐  00  Q   @ T[=F O-M80`Q@<0 00 PЍP P0S* pFPP  00000 040 0004 p  p#p 04p  NNOO0s@-ST`@P ?o00SP  Ѝp,M@- iR sR aR p` V>Op@-P@P (`5Pp cp,gOp@-@T 40`PNP[pp,OiR@-- 0 aR bR LR( GsR% tR@P 0P0S`100p`(k0 O,O p@-M`@P`8P0 0͵0,q0S q fqЍp[OG-Q@PM Q  ЍA~␀ p$fn`P phB~00 0 `PP |oOBOPO-$M@P`HP 0P`$ЍpP 0 0 0 $ Y># P0*Q  p0 0?Y S0STp Y0 p G00 pW 0np $ mP 000 00 lP o4  \$  0U,S( 0 P$`4 80qp{ Ĕ$'!#, RP P T P R*L0Sg 0p^ L004 0 000 0PL 4$$   4  !4 "4 $?.p6 PLPgPPPPP00S  0@-@C^M E$wpE$$0 0  P Ѝ0 @x("(!\p"`#XT 80  @NpP8Kp\%HN% RR'R9RNReRRR@ZRR0$ 8O-PLM@p4 c1嬑嬱D0 Ltp  0S$ ! R p!LЍfR lRJ  I@1` 0S  P pP  M n蠟 kP؀ < mZ ¤ 0p @  )Z  ᯤ ` 0 ` 3P` pRR\%s,`N%x%ORA-p`(P@lP0 p!`P @00 0$0@-@P$0S m@mO-p`$MHLPPDT   V  \ D@=x` @SR00 Q ^00S P UP 4 0 T0P 0X0$0sP UP000 P1!!U111}@^P 0yPPJ QPT0 0X0$0 00 @R P TP0 \ 0 0@;0 0ZS @R PP0 V00IP  0 0   0R00 0P0@SP@<.4$$ЍSS=tSTT~SO-4MFTp0X\,! 0 Y0 0 R0 p 0 H0 0 A0 ,0dVL 0Sk     R b A  [  ]00[$000(00$ 0S 0(0 0 0S 0H 0S0D 0  T0  0  0 4Q% 0 0$ ( 00 000 0,00`4ЍT0$(p 0(00$ 0 01#$0 R$  0``O-M<pP 8EJ@`MU 0S 0 0 0@   0@`@ `000Sp`.  0  J) 0`VT@ ` T0 P 0,@` 0T0 @ `0 00 S0 00 Ѝ f0  0 _ J)` T'U@ ` Q  R0P UpP0 0S 00 0 0 RU Q T0P|  P0 T@ 0000Sp@ `/TJTnTTTTTTP/0S//P/0S/C- `P R Q  0X0 RU@-@,MP@p`kP<l,Ѝ ( p`lP0  4TO@-錇X@P HHH0Hm@@@8P8`@zT+k3wUVU(%V=SR R R @-@$R R/////V Rp@-0@P! R8p\\\\\4\< RhDLTpp B R"S@d d:l\0 T pppppp 1 ppV1(V>O- M0`z@PPЍ0!S R oj8P0p (P\4S 0P0$$8P000 8S JjQ QP0 4S ڠ0"S1 @k0  <03/p 8 H0 0($+P  0P 0 0 $ P (, PpVWEVVW%W>V1(O-0P`p4M∃,0   pp@`30S,`wP 0!  pT AT fT K@4ЍsT0 0,Sp00 00@ 0>qp 4 `0}p0ᴠ0 00$04S 00Q-$2!0  R8 +R.R+ꈇ444444444444444 R@d!dj\1R R8 0S4 0S$1 +10` 0`Ypps po 0oO@@ a 0Jp@@\|oX 8 H0 $0  8 Z$ (, `DW\%JW|N%>>dWV1(}WTWA-@ĔQp Mp  A^PP`|t`RP \%PЍpP ,0 .PBWWWG-@`pP& V4 t" Anⴐ崀 ` $$ 0 P ! p" $ppP  H00p$Bn 0 PBX;XG-`@"Mnp ЍG20SP<`pPx $R 4SЍ4SbP R 0d $ RQ  xSPP 4S P P 0Xp 0 0 08  0 P ,9!?o  0W0 00  0 \pP9FRP P  V0p 4S 4S  0N%\%[XrXXXIIUI Y@-`C$P Y H5 ЍPP Y00 w9PiNP KP0$$FP @ KPP KP (0FPl@X0 1P $0  BQ4 3P 4P0P 4 P] "0P000000 0S000000S 000$0BKP p>K0P(0 dVPP TxTTA`P&A$1\PP, 0`qp   R$4=,, 0qp 0`A4 2Pd 4`BP `,P @ 0PS XH 0PM @0 SD00H0 RL0$ 0R} ]$4P `$$v]$4P`0V J`P" JP P&JP UP0#8,0 )A`P )AL&?  0`Gqpu p 0P2ppro  0P   0P  0P   0P  4 0P  h 0P qP }0P  8 v0P q/  t0P r m0P 01S 0r/Ss?, ղ Ѱ  V0P s/ O0Py$$\$4P(IUpPܓ{ @`P @$$0 ` qpS p0g< 1Pi <p<P < Hj < 1PY <,P  0PN  0PH X 0PB D< z1P $ <8 /P2 8 X*05a$ Bp $ Z\Pp$4`  0Mqp$ D\W$  H8 00\!08 00 $00,`(0 000$040P0 0$00P00T0 X0$$`qpU$$\$4P0 00 00"0H00`L0$4`  0qp0$$[$4P `꣛[c,\%O%_c[XPcucAbbccbcGbc;c1c^Fa d9d_docQdIabUqd-_MbXbebtb}bbbbbbdPddde0@-@M P X  ᕌ lp< <J 4>]p$B0Ѝ0@ex'ix@-SM@P, *0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`p D Sߍi@xiy!iy@-@    0`( "4`#Ѝ1p@-0MS1`0`SMj@ A. H01P A!Ax\P 0`0?oS cP 05P PP(t\0 0A. 00`0VP A A\\uU\0 0A. 00`l07P AX XA\=\000D 0m82\ލЍp7(2([ y)y0y=yKyxys@-;PP TP M M`@T,ЍpP  00STV ) [@Ney0 R !O-M@ P~p7p # `P"  Z  VGP+ MGP8GpP MpGP Mp -0P0&h 0R0 0  p"$ -Px 0SuhQr @ [pgl {M0 00! R R R[  0PW p [ \噗X (p@㐗W 0g0S, @ h[P@ `|[pd HQ L 40R !*01Sp0S 3/p\ R 8 X][p \ 0S 1@ `O[p ЍXexysyyyy9yyyzA-p:F@P@FPU O=`P IF P ;@E=T -FGP@- \.P ЍA-MP p,@P00#p`ЍpP  40 Zp !0  .yi@-@p @A-P`sFpP00LP@?0L t FA-P`UFpP00bLP@:?0dL V F@-( +,P00 Ѝp@-8M@ (P,P1!% FP# 8L0 Q0s0S00KPP"  _F@;$`8Ѝpl u  K8 PEF`:V zbhezTzi0@-@BM M 1 Np 0S 7  /  0(TP(@0S700$0/ 0h (EdP(@0S Bލ Ѝ0Y@Y@i^zzzp@-xM`EPP KP@ VP0P PD%K   ,pוЍpTzzueziz@-@M   pЍi@-M @I+PC|0| |%t p 0!Q0s0S04 1p`Ѝ {b0f{iis@-`Pp@ @@+P0 $_@PhuJ P@ Ll@fEP 4 9WЍpU{b;f{_{q{y{7@- P@<p\ \LTD PH08 DD$0<808E ` Ѝ0Jfy{{{y7@- P@pd d#0PHD P<0( 88q$  E ` Ѝ0Yfyyy{{p@-M`DPE0P0ЍpJP@Ux{T@Pd0 D'p<ٔ8 P@ PP V{{{i{@-$MpeDP00$ЍqJ`IT@Pp 0 XpL婔P@ P`@ p$㣔wVC ||i7|@-BWX Ѝ[D|0@-M00 0  PuXp `T@Ps ` @dXpp P0 `pR00bS W2V_VU WXPxi P|i||9s@-@`)PP  ,p <j0:V|p@-Pp@`@@CPH0H HH#IQ P Ups{hf{_{@-=|@-M T@)PD0D DDZ#08 0 p$h>Ѝmbrf{i|@-M T@r)PD0D DD9#08 0 p$G>Ѝb~f{i|0-M $00 P  库Ѝi{@-@8NC P,0, ,, #$C `{{f{y00@ P/a CRWC/A CR=C/@-00@- M@ 0( 0 px Ѝi7|p@-` MP@CP $I Ѝp X{    H( PKC@7$`Yvi 0@-,M@ P(P0 " p,Ѝ0 0R0 s0S 0   0$ yHPP  0C@7$`}bff{Y@-PM  X@@C[ 80oP0 0 VЍO[?}}F @-\ @n(P$0@0Ѝ  p@@  @=}f9@-q@APP 弒mpPL``P00 00Wt0@`Vm`Ծ\ PX0d0X @ @@@@VB7T03/`f4}P%[(}.}O}(%}////0 L0L0/P%0 T0T0/P%0 \0\0/P%0 D0D0/P%0 d00d0/P%p@-@pzP 00p00D S 0A0CS0$P>Pz 0@pP%@-p0`2( 0`P/ R/P%0 O- 4M@@!2T0*  D`Upď P(0$!pSڰp D@T PoS@ڀAP`@ vp00L\pP` R  P Q R/6 0TS $P\(P  1/P T@0S  JUp "SR(0 Sd圑\0 2/P W0 [ { S`2(oɚ;6e}O-MMPp  Y p` % s pP$ 100$0 c-'U ⚄ NUp; ⍄ AUp Q d U T8 p$<Q ,T$_X@T fX00@0 0UPT@_ 0 0N ,0@4@Tp 0P0Px0t 0d 40,@TpPj 4HTR@>PT!>y`P \PPU D1O0S aS44QW 4P.Z  -P' 'P! K0S 0 L0S 0M0S 0 N0SO0`S PPV S  |f`2(%@-,MP@gpP ?P`( x p0S hm H$P00< <a0 $S,Ѝyф7(8i(ۄ(p@-P@~0 P?G-@>PP0 `@ Y㔀DpDmPP  kpp H H@@@P@/\;p297(s@-@{>@PJ00ЍpDPDl@P <` kPPu z7('s@-@Qv>@P|0| |1DPDl@P T` BPPu( iЍp萆\Hp97('A-@"G>PP0 `@\DpODlPP ~p< >FJN@@@\Tp97(@-@ \$PP0P PPL 0 S@@00 >00Ѝ荅b]p97((%0@-M@=P=P =Pp=P d0P P P P1 4PMp )Ѝ0z/7(7is@-@}hQ ~P LQHPH`~ P! ,QЍpQ@9e8@O-M`@PK Qp pP"(     Qp% (( px" <@T t8PQl2P\Q UR TЍ0 P( KN@P㥍 $@Qp D}`Qt 0R WQk)Q QP ``JQtqttt` R#Q\=Q PmEP8ЍOAOP\ 0P   Q1   Q0! RS| QQ" P0P R ` V 0P `\p\\y@qx8i(ilp$ۄ8lQ?PqF [eDpZcDPp@-P`@;P V  =`P 1`1J 00p;Tp1p@-MPP700Ѝ`0 00p0@ 0 P 8B0P 0 p 0 `P0G-@(P 00p(  P1r0`*0PU!V0"R0 "00"SЍ40P 0 , vp 0 @0@-@P 11@ {O-`@pP,(0V0S 8KP$P$P 40S 04S 0S(0p(`8P0S$0(PNO-M00q W$000Ѝ`Q Q 00 !PP0P XU 0"jP x,,,h4@[T /@P00 D0800@00X5{8 "10#Z0 00o 8 ]@ 0YPpG@T 0CS0 0 xC0X0^ :T 0CS00xC0 xRaDPW@DADP7@D@S 00@D@ TSS0Z`s@@LTh l  ;P/U8 @ 0 0 0`08@Dxdžrφq{{A-X Pp@`}P+00(0P" 0 p 0 `P0O-P`,Mp@ P 0Y: P X 0  0P` 000   0P#> 0@R xYF/ Z R # R # ,kp 2 sJiO(%_A-@0%M0F/S p p<8* Gp- 9`@08p`N/8S^` Ppx0 pdrP0,0L0kP0,0T0(`$0N/K%ݍ7(KiDx @-&p Iip@-t`tP0S /os" R@ ps LJ Kp@@pP@@V% 8(O-0P@U` 00Sl1 000xSP@ PpD<1 Q Y ѳP 1 @ `GR B`U     @ Ѝ W:UUp@G  @ TA̠WL ΠL̠ 0 B W B,B,  G%%͇QA-@Pʰ00QQ00S AK00Sp0 000xSXJ`PpVJ`   @0%M%T p@-`P M@ U U( U0P0 Ѝp0 00TPTT@ !!0P!!`xFPP  @▿ ` 0A-p`Pp@ @P(φ  z AJxyp@-@P`M   `ЍpO-MMpPP!㪆p`p!t /pX!` F/   <1W8@000TrݍЍ0P0  R P 8&)0  !4  bJp0x0@0 "' R R000O/00 0 P<1S O/,Jsyx'i7(0p@-`M@Sp }0+SЍp+P  $  ay R #; <Jp ^01S Z0/S 0 iG 00S/@-@I2(WA-P@`TpVP @ 0SP V(%fA-P@p `P  dPX0 000  8p`W寅贈%:i@- M @pd d夅 X0P00 Ѝ0, 1p包s9i@-(M @p { P00(Ѝ ⻺00S H P02 , pUsx9i@-M@ lp 0QS S  IЍ͈Ԉ/ 04 8 <` S $S HHH S/< S 4$0 ,/(/$/PPG" PP 04 8 p 3Q? FI0P 60p 2Q8F8  p 0S0 F8 pu p p p 0@ T寇PpD2Q <FBߍ10S F10S FF0  `0000p}FPU0``0` Rڬx1000 0:S R HbP8[F`p$PQ RFV pWP ,F+DFH0S L>F E~9FW0F`0Q *F E8i(i&i-2(7@J) Uci8iiit]ls1%Չ{ 0@-@PAZE-XE9 O-`MM@ 4ľ0P4 lPgE7EPx屁7U'S 0`@ 0 @`F( 0RtPy['V: 0: 0 : 0:0:0:09YE(@!!0 P 5V0 /C BRV  0  00=C$0Cɟ"!``F 0^l d9EIcCP S@BA`p80P0 p` E!0@"0$0$0S= D0 P0B'S 0؍Ѝ h(S   BS>C0CH(S  $ȟ"!! CR   ##9C0C"!% 'S>Cǟ>C"" N=C0C00Q0g*S SS""!x#!!!#2SK Sp 0SC R< )SS0C'S񟗶((H(|(((((((((((((((((((((((((((((((((((((0S 0 th t0`iD0$ 0 B$ @^ R `0&S,p$WD  pW> D R0 0 ED`0S p~Ѝ4bt=r 0 /X%/-@-@ M,00(000 P  Ѝ@Ѝ/P00  @@@@0-@-  NAJA ЍЍ/@-@7AA 0S/@-8(-@-  .A*A ЍЍ/-@-  AA ЍЍ/@-h0M0S@ 0  0000 0 Np@@Ѝ8(@-@@H??p0XAmp6H@-tMPP2 P0S 0@P 0 0 00 0X p LiP@@ ((@,P0P4P8P8(rI6G>X%m/-s@-P`0@00 0 SЍp@Ѝ/0C>Sع`!031 0@-Mt 0>@P \y| <LPP @ (@@ 0+P 020Ѝ0X%8(@-Z@0P ,@  @T>(%ߑ尶P@-d0 !X !T@0 60\ (0000/^sPh0h@-`  !TD0 60\ ,00 00/^sP-P040#^4<\$0000/^sPD0 40#\00Q 00/00^sPL- 0:# ^4 0Q$0000/^sPL- 09# ^4 0Q$0000/^sP 4 <# \,4Q00/00^sP@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00^s@- 0 00=P Ѝ44X%A-Psp`@WЍ ⎵P ስ3MP@ p7@-P@U0  (o< Ѝ0zn@A-0@nS0oSp@ plnP``;P<0nS0oS/>PP*>PP'8@@-*Y0 /?<F(%O-MM<(0<,003000 S  +  &  !  4Wp~@m$0Sb  hP\4O:04 0S@ @@p``48  0PQp0 !0t1P0A0000S0V0S0S =@0 @=X n=V ,2=pV$ p@ PH P ;;Vw$0S ȡp@<$18 P0$#$#4#= HRʈ0vmp0Q -Q!@ 10=ԥP00 @@ $ P k;i;@0S r=V ,<<0<p<#8B8b8r4000 <x빶0S  #0S0S40 #<8@80@D0; > ,;P(0T0(00 VqLlꃞ9(%O-`@ Pp(,*000 嘐嘰00 ?p0@DTq oP\0 NhP< w?h9 O4,\% b,B@-M@A>0 0D@00 l0 :p10S SH *>: 00,00 v8WĞڞp@-@PTPp@(8!0/Sp7 p@3 겜ǜ@-U ;8(%O-`@ Pp(,垳000 嘐嘰00 >p0@DTq oP\0 gP<vg9 O4,\% b,B@-M@A>0 0D@00 l09p0S SH 9 00,00 @vJ8bĞڞp@-@PȊPp@( 0/Spp@겜ǜ@-  (8(%O-`0@P(,p娐娠娰0 >p00@DT oP0 AgPPu2g  7A+BO b,ؠ\%B@-MM0An H 0P0 $@8p u76p@-@PVPp@(: 0/Sp9p@5겜ǜ@-T :7ѣ(%O-P@M P0ឲ`r"=p+x2 0S00)0x0& 0 x`1p0 +00*`&0`k 59pY juuPfPMP9 9P$ GP g@PPOOOOdPPOPOOOXPP|PUP|0 0|00|0|00|00|00pt`x0 ^fPuOf|Pw[,0p0Z00t0X 0;;0x0U3$00|00|000Ѝ,7\%h,B-MMJNP0 @P:00 |08p0 `t0 0N/0 4 m0@00086j6TlI7@-@P 0Lo S? 0 t Ѝ0腤@-@&0P@+@-@+(0P@@-@ 0S 00S0?  xtЍ藤p@-@PPp@(0/Spp@겜ǜ@-Zt<@-R40 0,0,0(0(0$00 08T6먨֨(% X7@-P @}P00S\ 0 -t Ѝ0=p@-@ PX0 %0(p*RPP(tP6p@5x9(4O-@H `pH 4崬000V ;p60`FVQp 2@FPVVUUUUUUUUUUUUUWUXWdWUUUUWUU`UUUU|ZUZUZH[UU4[UUUUUUUUW8WLWWUUWUWUUWUUWZVZZZ@[UZ[40S = 4 40S 4 0<007aE08:d$0000000D30@90;g)d04 0I 0(80@008 0dPUs0@B (Q  Q@       c20  xc0$000 Tc0 000 0c0$800 c0<:00 c08:00 c0@900 c0,000 |c00000 0c0909Rg01ra0$000 0 0tT0,0wM0 0xF00007000+0ϧ40 F ЍdY%Y%,\%:(:(:(BY<:(@|_enxY%A-RMMI>0PC@P@(0L BH`q匁( `L0m5p0KSh0  R< (Lh0=4 T05%0 ,r( h0^/P  0kPP 00 0,@.0T0@ ȻP 0\ $00X 00P00\0|00x00t0 0p00l00d05RݍЍ):(vTPƩ֩p@-@PoPp@(S0/SpRp@N겜ǜ R R @-q/ߪ0@-@MP`p 054000 l5PPЍ0P0 0 0650 40P Os@-`/P0@00 3P0 &>Ѝp 0`( "4`#/s@-`@PἮ00!  P@d00SP`P @៮@坮 05@Ѝp9((002P0/0@-@CMP( P41010 0000000 0P l4< 84eH00Cߍ0Cߍ0@o꠆O-M`p8@@PpЍȠ,̠Č Ƞ,Ƞ D<4$03 00<D h4<408 b0_,\D0(00x0@E 00K@`p PH00@DP@ PD 49(_P^*O-M  ,P@`pP0ET0<0p0Ѝ 0 3/X0p 0PP 0@ `N P* 0:4PH D @03/ppPp0PTP@`P꠆3,C-MM`p/D ܨ P@1L#Pd8$#4d4# N41D0@@ 0@00 0|@ppߍPHڀ@Td$ d 49(O-`[ 4MPS@2@P :@P`o4Ѝp p 00t 0 @P  TX@0D 0 00$00S X0S00000 wpp cP@0Sp!0!D0D00X 0 000  L0b"!4b4#@0@@ 000<0@:(I)v9(@-M 31ܬ(%0@-M 00@08 ܣP  jor`EtЍERO-P@M$ 0쐝S0p 0@4#400#@0@@ @#17p3 0BPa g@bPh|h|h|h|h|hhi0i|h|h|h`i|hj0 0%0@0 qp To" 0 8E`P$o6`0  0>P0!`(~(0 S Q  n  !tP   n_^"! p0P0 `(T(0 S Q 0  sP     sP  -qp 0p0W+ ( Y2p |~ 0S 0DpSH0p0000S0@ @Ѝ,B\%e,kBKr@-MMCN@800 0@(00 01p Xn 0 2"2!2("0P( l 2,f 0P , T20L2ލЍ41(16ۮͮ7@-@P Z0Lo S? 0  n Ѝ0腤@-@ 0P@+@-@!0P@@-@ ,0S 00S0?  mЍ藤p@-@PjPp@(N0/SpMp@I겜ǜ 0`( "4`#/ p@-"440 @"440 P"440 "440  $(0 $(I XXEddhhllppttp p@-"440 P"440 @ ʊNJĊDDᾊ@@ḊHHᲊLLPPTTXX\|`\ `p` p p@p@-`@"QUpf@p@-@Pᅊႊ|pA-P@M4Q->Cm->CBX?X\<\99>\9>:>CW?n:>CFR 0? AC>I}C>GDmF@EnF<E~G8 0X J~X pW  $$((,S>,}S>GmF HHLLPPTTXX\\O-P ! "441!"441 $$((,,0@4p0T`4Vܑ\5 S L5spTԀ0,$ $Q p W UwTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUxy0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P(>( ?(?(p@-Pp`0@S     •D00Sp "4400S "440pY%>(R/s@-P00S"0@00S |000 Ѝp@赋 ?,4P0`'V , 0$X-$+Ѝp>(>(:( ?(?(8C-Pop10MSP(?(>(>(@O-C P dϠ 0@ `Ìt0 10S  i0@c0S 400  B  R\ ?0!.0S  I dϠ 0@ `Ì 01 0$ R$  B ,0X0: 0L, p0  00ïl!2\%`R 0 0/. `x 0ז`0 C c00 d` @` 0`b:c0 0o 0P!\Qpx 0&0sS ((XKQXdPDU-xl  00 ЍO ꍖ0tS ppЀअ XАPUxP,?(>(U _vTTt0p@-0`S\[@ !L00S0000009B0E03p?(Y%PꌅpTH00/1000/0B10B1/101/ D,꠻(%O-ԅM  dϠ 0@ `Ì0 150S  20t Rl[PU[\pЍ4ş P` ` b5B?0L RW@QWbR3DP/R`(Ї\ D " P D!!D!$ " P "! +( 080P0 U PPp裟  0$5S?00 1>lV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00030SUd 0@ `?5ᆟ0"ST0T00  B 0"PSX000Y0.d 0@ `5?d먠ʿ 0] 0Ϡ,00 01#0  0H ! ?@0 00C000 xS p10S  ) dϠ 0@ `Ì0 1! ! N+J40Ak80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30?(>(U _(%Y%+O-MM̵p, Y 5O_R0ePS yrሢ儒 ?D 0S``/~D? 0?D4PP p؍ߍ52.*) 2@ŒD 0L 04;2 0d04 0^0 00@4T@:T @:T @9T @ 9T @8T @8T@@048#8p0)4`0S7x 000 00p 0 0`  0S 0X  00S ``a , ⩢ 0#\0Q?9 4<D 0?0 8 @ (,0PHY (0@Dő, L00 /4;0) ) 0d0H( 0o 0 R 0r `W4 p({S< yr /~D!""#0ODD@HL0 ? 0 04^0hl 0@DE0 L 0/4d;0 0 0@$ @` 04 <02%)(Ϡ $$%%9 0d?`hl400&0 # @őDL  0?$+4#($( 0(d 0@ `Ì00 1uY%:(?([%]%Ao>(>(TO-)MM,0=0?0$8 0(T0[`  b0 RZ QZ" Ϡ  ! 0 0S  BB00P`0/2"0$ 0 ?V`1V`#T0`10F 0&I ? B@TP 0ἐ똀  00B1  B[!0`0Y3B 11 0S B!I0B ?0 `똀 0 B[` S2 B Q 0S 7&Or @P`x1H F084<ĔCP`0S84<$-0BPQ,`QɑRB1ȁ@L0 0 0000<20S|0` ?L4 0H4 0 01{pt'U\#R2\3PPT``0 S.aH1(\50? A00!#4t x0W0(0#T a2!, A3 31 0  JP ?(Y%Y%Ip>(>(̼&Q|>(Ͻ.b>(>(Y%>(>(>(>(^F>:( >(>(;>(?(S\x%ht@%?(ο>(T?(T>(Y%U 04 P ៞ 0H$4  R$ (  B, @%LV.  R*h  <  X ! \ ! E.?.XT+BA.B,-8 HU P9q0 @40K Pjf0 ,p B8d i A YZQ0 OfZ 0X R A  pW?΄$t<4Q?D480P@04 0H4(0Āp 2 R 5#< 523儂r0S8d P QDQ 3S 00 d AQ\ a6Pa`$Ph$ @4~PP`zPzQ%Q 3S008e 0,$ 0  R0:1P000\P2#00@P` @` 0 0yp00 R00\׿&hD0 垝0S7d R^$ vTP0 dy K  eZ⋰ 40Sh 0 #$  ne 0+V. <50S  ; 0=S,O0Sڨ}0S0 0" ,0 0CÁ!%\^   0 0 0/d A! a,3 1 <&0# H6HH p $PP04SP0 0R0 S  B S0 8$00,00P0F 0,0S忍 p开8嘥ȿ+" < Q \%0R.@(00 @DU`40 @4Ad|70 @R40 `0```0T0(w 0 崜` p7$[0`0 I9pQ80< 帀 P0x0 0Sx0x0t\0\ 0⨁  B`[dڐ HQ   h ` lS2  B±dd 0R娾%WU0   (0 C00 0 0 R , R` ` I 0$5S  l01` p00090S2d!0)ST0T00! !0)SP5bX0`P5`S(0dᐙ먰 ጙ  (000080` =Q d+H0H $%P+H cH0-ᴐR㰑 ,  BU 00<0000T0 10X0岁0= LR\ ?0 d 0  B  R\ ?0   00C 0  080 C  C 4400CS T00C@| 0`4 8 0 RT:  $5SdL $`$`(0V<0S ,4 I d,04  0,4 $q 00`  Vj=0S   0帀0 X#` x0\M`} X\># P 0d?། @ `Œ0 1| @=\%R M0SP+n\`/ `ƌ$  $ k0D.`S`0  0$5S  l01` 000>0S/dۗ0.ST0T00! !0.PSX0b``[dL먠 H   B೗00080@$ 0C400400T#*Q`?0@$00$0l0`0@hppT:S $S0p0S $S00pW`@PLml倐H)FmP00@zb8p`0x 1QpZ90JY!@@-ml00 @ T: 呵@$\`Q  @080(0 ) (0d O@ LL lB;  } p0S30S0 000S. 08C 3R3 0ł."\5\S 00 0 d 0/ @ `.3,00  0000P0S2 0,@0P0 20S  0S f 20S $a Z 00l:h*,8dPL20SD#(B C ,20S3030404040p3pGVW*\V.XPaV.GV⟙0S  |10 PS1\5=S,⋙t1?^ E?0 0S 04 B dLĒH 0@ `Ì014 ,$0S0S 04 * d ,04 0  04 )ݍЍ  0  \0E%up@vS`YT>(l[?(:(Y% >(>(8 >(O-pRMP`b W\@P D\@4 PpߍP(  ppM0S t<08 (00,0 000040!04 04$0D0(0P Vph| p 0 ٘ Dg 8 ,    p p [ ᰘ tp 0p?pq8S_VPr 0  *0*0@0P  0* *%2d@edA<2T2]2n2z222zd@2A-PCMMPp`;8 Tp@P  P0<PU00 ## CލЍp@-@PoPp@(0/Spp@겜ǜR/xG-P `$ 0pl@V` 0e@`` V`@&!D( `G-@0 4Pp  X00000`0 8#8#$48#8X00P a40 "% ?Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX0p0\00``PЗ0 0,, 0S% P 0 mZmS aSMSASB0C0b0C S꼼$SS@U@@sS@ @ @U00 0DT dS$ 09R 剗"P T 0U8$UQUDT P 0  @@@ X 00 l PZ0S00 0 000 00P4Ѝ蜰ް/@-O8,@ (Uqn(%vͱ(0@- @   ᗒ O-@0p |ՖPh`G0 00000B_I0V W `B@ ᴐxC(I(P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@pxC(0P  C @- sYco`/ s@-@PH` 000nV @ ^YЍpPC(xC('s@-PX00S@H0`ă5#0404MV @ ?YЍpLC(PC(xC(Fd10 PS/C-PQ@8MPM``8f a 1p P08 0 T:86S/ <6ۍЍC+ 0 P \ ;0 S a8!#4a4# 0^ P;0Tǒ 0+ۍЍLC(xC(PC(hC(TC(O-@BvM`YPP"X 0F050( ,6倢" R 0 !X0 60C 0 x!X00,6&0=,6 0  B 00C0( 6V0:@ !`V0᷆$&,v?r  ᮆpp @ 0`7p0 &$&?ᚆ0 `L0V&S %0: S h0d &ЍO< ((xC(Df(_%A-Xa,0S@FT:pPP  0 @1AT@T P @C1@1 S  W R21,6&0,6   B ! ! 00C 00@xC(IO-@PIMD`?4F@0VD ?`0F  W?0V 15: T*; xW T8 `T 0 LH/PD/U㰠Z 00 @ / @& d &F 0K \ TӰ> R`$|lW k2+ [S!Qq 0BG 0IDD0 S 0008cS05>0$040ᓊ (0/0UC(0 ,P(0,   BQ 00 $0 pF 0M000 60 6 = 0(0, p20740<800`U0@ $p(,<0DHH LP\P`PdP| 0T0\<0Tp5T0S\0oT pL<PU sP4c ( $0L VR0400$ ' \`$  AŠ ^!p11 0B F0D0$ATpepeC 0CP! ;P`\` :j (P@<,"  㑓 000d0p080\00<0<@0008#8(02`40 0C8#8,00L00PC0SNZ8J0 pS` H!*&A 7 $DL ") 0 (0 "* 6 !"0@& 0 09#oPp< i@&60SSx9 R0?0$V`pL00f\0.L0 $0S 80S aP $0S <0S@0  0U0h 04 XC,000`0100 p @|S(0R<(0 x0S 0Sp 0S00 0  0C##@(04,8X $p  PPpuR0 SpG SᗏP@`8 00S qL0S d0 P" 0<4#S + EC&,"= 0@4# 6 Kd 0 #`H t60CT 00C0CS\: B _XW:Ȗ刁XS: ,66(㫱 |B H =TㄢB ` ,6 0<6&$,(6XS:0TSL0S d0 dP UHP50S`V=@` S!PTȌ01 210@! !0 ST40##$0d$0d$6$[:,6 0&4.XhF 0V4#000040 (`P0SMVPEPUI 30SA zV 43PUCL0S \08`0 Y PP1 P# ⑑h3860`0000096 30APp`<=kT tYP `W d28b`0000f & !?<#  0R *d h"P P0 0>PPP$"n v`Pw!d P  6![!PU:< U*!:0U:0 0 p-L0S]_Ui/0p  zލЍ@X0@ S@00\ |YP pt 0 @N-aH@P!< hp P  mYD0S 1@X : SRQ\7   $PP Pj VPrPE_oR00b =ph0P0U p )P  $P@D  13m`Tb408 0 \04 0 80408 QP  80t@ ┌00SPD`A|0 S10S10S00S$11011p0 0 100S|0 RS00 R0 R0S / .P ; 0@S 00 T @#P U0  |;0籉P<;P 1 $11(1000 BT 0`S`Sʔ0S $1S 0S 1S 1S4X0@ 0@w->0  0np^ p`PxC0S L*Mp` p1S?V?`#  *ApT a1S )7pJ Q$1S$A0 48E$1C0$S X0 0 X0 00*00SR3#*:Q0<0S+ @DY<0T Q!zP@ T< l p e "B?;;@ DKP?`|  0QX# X X H XP0S l600S P0Sd0h 0P0 @0D00 ,h0S 'd0S ! T*,000S0 X0S010S"  0C 0T 0#Sx0S1`0S S <t$0S $ 0C$00`01P0S1p0 x0Sx010S(1h0S01d0S41,0S /4z,0P 0&:b:,0P 0  Ypl 0P!* RbR FV000S(dR0 1S01XY$1aP00V`U50!A( 嚇(Z ,rh(G0UH0兇H00S:Zy( s`U  ?i 0 S:01SD5 R 41S +,0 00l000 X P00101$S3#SQ4PPQNU  4Q41S 3 #S  RP!RL X 'P3UP1Q X 1S<11CH0`VX  0D pP(10(00A01 L010t0$10UWP X(: Z8:0C?oQ20S  PPR*? X X ( 02#ΆL t0 X0#d"d X΃6#0\0:pP<0 01ZPL01 !(003 ($q W 5t:( R"P   (! t  Gt(  z Xha X\abV1t 0A2"~Z( 0@R"0P(\0Gq( 0t z0@Q!0ZW*>PcHr9r}%L }/U2^ /?1Ic4d[ZI)b(%gfffOURRaArrAa 2;L9ycS X0 X00Q*$0 ?oR 20$ \  X0 X00 kQPE0!$1$Q R0QH  1$01S$0S001 X0,1$00S03$15$1 q5 X@0 0 X(1 p0-^ = C0 D02 `L PP KDe =C Z(( L0\2#P0y X00P <0D0001|0$40\0H0#40`000#40d0@0$0 Q  h "    Tp  0t0 3Q0Tx0D0 S 0s0S d0DOD00 0hh00,0S( X04qH#W030#W0 W00S  pR804 lp劀0V0S  l pL T  ~ 00S X41  C/oS" R \0 X 00 @ 000(00H00`00000d00X00010101$00@0 0 (1$00(0,1,0>03M?03)0 01 01100 04T"/@!b$ 04v 08 0#$ #(#< 0h0%:0p:>x R,0S00t0T 0o0 00 ST c$&?   p T]  T R 0 Q  0!R R S 0S60610110P LQS*L CQX000| R X  R   0P0 <0B?oQ20S (0 00 25 010P C0024 01000pX@0S(00 L0 H0S   1S00 , 14X0 E?0Z0 \ F?0!0G?00$0 @0S  Z,!(  x0hXQ  4Q  u D0S Q2800S#x 0`( "4`#/A-0 0P@9 <0=`pTM 0R<eA@00@- 44@4P\P 0B"" I)-@=B'U)@-'  (%G-@P ` 哆!>0AP V0 0  'PP G~6pP`0 0PjI0S 4cI0 V I),s@-pP@ 0  X 0TT LЍp P `0  I)9I)@-044JQ    Ѝ9@-$MPp  ʁ @G1 00@ 0! 0 )) 1 p ` P `PDpATV@D:$Ѝ 9EW? p@-0A0MP`  ሁ 0 0 010R  2   $0Ѝp@ R  #   $R [0S 0!$$("( 18#! 0Ѝp@[ 0ЍpI)^ @- pHJ)P@- 0 R * 0 #  @0U)P `00CS`0p S00 P0S X0X /X0 x%p@-`ᘅ@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hudu`0qPp <10C <1$0 810S81I)he%%(%K)O-@ I)@0@-0S0@d2Su`2"R2he%I)L@-@ Ѐ8!<qЀH 8!5P P0`pU1P 4 40g1PЀ(00ЀX@I)?333333?he%O-Dd&> ^"44"P40pRPM=p3 204U*[zD(%@-#@TP P  D  8}  ,y  u (%2G-0@  R R0 `堀p 0 RS000\RP 0SP0l'R"R 0S S>  P0>(%@-@ P l00S\ 0@ !0R3 @00SP P990U* V*U*p@-`0@000P?0@@ Q-00B 0$10S !0 0C!0R3^0  P 0*0 00 R R  C\\ 0@00p=0#0%0&P/0%U*U* V*J(%wA-@P`pv P0 SR 0S0B0Q3 00@ 0  ?fU*U* V*pZ*P 00CS0 S00 P0S 0 /x%A-@Ppr~P  dIyPX0|`|`V :00m0/S~0 R/Sp/Q  C0SP 0`/SS 0FS0.SP` FRyP PEU0u/S`@ /R/\ n[(%k0O-cM M00@00<+0< 0<0<00 6(P 0S0,3,00L30S3S3!P|Ol pl9q 00 8<3 S {@@ 0T S S00 0#=0@C;=@0S+  ;[O/0S3/S:+& @06@P`[=` 0tH  t<  t0 , 0S 0 8xS`S,?S DS #- {000.6vC *@0cC + 00C ++b!T0 L< "gP0? 4  \00?a**i%0@-@0 0o0@0Ѝs@-@P`P @TZ TT?0 00?o+"+R  + Ѝpr(%G-2@`VBMy a@0DXBߍpTW B/ ew0 S'4tx'xpr w@PQ  L1b",4b4#0 440,10S 0S Q0000 {'{{gW:0000R%*0S 囪0 0S 咪0 000R*Q p`f0S H`X0`S ! U*p{**%U*p@-<Sp@ P(r@P0P0[pi% O-l3P0_MS XXITsTC L0D#D/0+b! L<eP L F0?0H @L 1P$PD Zvn dP 1P7P|_ߍU*%U*U*U* i%*YYMa*ke%y,& Z*[9h;Xq*(%m%@- @ 00: SZ*G-@qaP U+ 'P00S 40 S00P R GRڀ00S |pP Y XsP Y 0:0S $V*U*(%&:O-AMM`P@jpP8 0 840 AލЍO/0 009/P) 0`!`  pPQ D D @P ,rPD {@T rPD q@D `ࠟటT AލЍ  0A. 4B   R ; 0 0 yD J@D k`0 _ 0 D kzg*(%\C-M Mp,p0 /R @`㬐嬀 GPP 0S P@ۍ Ѝ00 D 8pp`D @P 0V mP`&*p@-0@ @P P @p@-@.@O-3tM0 S ttp300RS`3 T3T#0PHC0#S<88tЍO($P t   0p`00[@ԢԲ?` X_0@ ٧W6 ! h`V5VW )@P p0 6?0@! $ 巧崧 n?0@ 壧堧/tЍpJ`1P0xSiS@P 00@ 000 0C0X10S 0`S$Y \` Xh0SS   80S d00X0\ 0`0>0P![c0 8(dU*%U*U*U*ke%(%a*1<U*U*VpU*JA-M`MP@pP 0p`$d!d@P TTLZds< 0ۍЍ Q D D< H`PU Up{ p0P s x`0S p T0TP 8 s8 [E3(%?*U*Z*]@-#P@-L@0#S 0,4#S 0#@e%i%0A-@P` 0 P0: 0tpp ?=d0@$aH00S$`],lЍ 0`0V@ 0 0/_ 0` @T`$ U000 0 0($00S0,00S0(0 0S000$0S0400_@0 1S0 00_U*%JU*YY1(%eV*du*U*U*U*C-20MS ģY܂r 0}aP0 009000Ѝ PP sp` \} T8P dpx0 n  @0@D`P fP Kp_ U s1RQ rQR $ 1 RP P0d\0 ?P X1H ! "D @10S0"(  0 AD@(C@\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t"P  U*%V*du*2(%#-OwU*U*Z*U*U* 0`( "4`#/@-@MQ 0 3/00؍/+ hꯏꞏ0@-0@MT[0Q@X0T L0LP H  Ѝ0@Q@p{*IZ*(%0@-P 6Z*(%0@-Q 0@T0 R ||喢!0AS@ fЍH0 DPSog( ]e%V*p{*(%@m%mjA-D@p 0 0SP(v ` PS Pp{*{L0@-  Q0 0P ,00 Ѝcp{*Z*(%@-0xP 00S@%*S` IP@` 40P , $  0Ѝpp{*Z*(%0@-0@S 0$P B5/x00SP`P fqpH0P@`n 0((@ ЍU*p{*U*Z* (%p@-hPh@4S 0SP LL/H0P00080 4Spp{*Z*?iyV**0s@-0@SP  40B3/p00S\0 |pH0P`@|n 0((`-ЍpU*p{*U*Z*(%p@-P,@P@p]P @Dp@-X0XP0SpH`@P P  s@pU*m%p{*(%A-@ 1 a051q0S :p]PP 00@P@&8kP;Pn% 0|hp-PnP 0D 000A(U*p{*U*U*x%cyKN*C-`aM! *L H F 08!  (A(08!Q  0"P/X, ,   F 0`   8#`Rp00"0Ft FdƠ00@ LG0ЍY*%V*0(%U*^ PY*/NZwO-鸳@0EMSP8a  }0 @|00T*0 ?o2Q03S L30S @3 T<#<  b0S  Eߍ0S3 00p0"^0S 0"p! 0 CV V V- Ӛ   0 B B B  0h"p+ @20S L#0@   0 B B B  0"   0 B B B  0!0S  0jP 0 iP. 0S xV V V     ״8!2!p0S       V V V|     ᯴  x p z     ἴL U*%U*[Mm%1ATh 0P/00S m%p{*P0O-dEM940`SM P < 850SppލЍ90 Z 400RSp 40SppT)9S140404$04<X렴堤 S\ B[00  4 S BKPL?Z0 S 0 ᔩ1B)R)  0B. B Y pp phS PHX\ B P PhBhP u $ R B  gU $SR O Pu  P_t/2 005P 20S )8Þ00A,0 S x l#R QPSÝ\U  $   {)a#0)90S 3)k 0S 810S.0S 3 #W3P) RYPER00PES @!U<1<0 @PUJBJBGPEU 0S 14S 043P UB-PEp{*yV**U*Z*(%S3rU*\cF (m%U*U**%KbU*U* [V**O-hChs5 SW0 R_`P44)0SW  0PS9S00P0S 0S 09Q ?oV20SKUNU5E Q5 IY`Vq``ĝ\2 RE R; R< 4<幝820S?,P;< %+BO909909 ЍŁ01 +"+R ! R  tmEUY0+5`LlP d8\X $W`e i0S 3 P7jK A00 ?"bqp V00S xL0S 905 ;#;S T%GK+X Np{*U*U*%$(%fZ*}U*6m%U*AV**@-07M0@SMWPP P P `ۍЍV0S60S 00P 60Si  ""4h42IhI004488<<HHLLIIIxx|]|}I9^EyIEvI:^ErIE""442""442T0AS8xTxwwHxw f Pi PJ wPb|T0Sp40S dda00fc` ] Z!"441SP""44"2"44"2"44"2"44(2=(,:,T7TX4X\1\`.`+h0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,d*d20h0005/(0, d20=S" " \" R `LrVCDS@"@ <#3 ( V!0!x30=00 1R 00# |# #X0/80\ /`0d 0 %0L0<040h0T! AQHy,yyy0L(0 "S e#r0 (#AC5/0(0#R00 #0Q0У dZ0 (0S  @(C#5/0(0,0S3,0P0?0!#0,0@' CP Aۍ<ЍP(0S #r(0#͡AC5/0(0#r0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B 0S 8#R00SQ 00S \0l 9P tlx3  P8P0SV*Tp{*V*m%Z*2U*% 0 Z*[@-@0SSV* O-@M00@b 040P<00 0 8 0a  0@ c@ H0LP Dp`P* ` R  R  R;  R 0 3PL RM  R"  R`60S  PP"L60S 868PU)-$!P"e 050S  P% R P 0 t% R  dd PЍ0HU00L%HHV0S50S  $40S ,  PP 0 0 8_ \   W0 0040S 0 d $ R  8#PU# R  :  0?DP fez 0xo  W 0 0 8  \30Sc X \T 0 TI"0#P0 0020S  32PU-20S pPe' 0  W 0 0 8  20S 0 $"Pz0 00e k10S 403/ F F!PPXW00 0AX10S00S 0 0 800S 0 4\p 03/PU 4   00pP Z*J(%U*%U*U*p{*;ee%x|\t]]{*U*Vd[ 6U**^ `FWA-1( 0  S !@ 1 1R 4S8 !4|q04@0t\a00S/ P0S  R+* RS-;P- !0 010000 QP 0PT 0$M i P ЍPB!0P;C0P|80S050 000 @ 0@0 0V*Z*Tp{*eV*w@-cM0S pplClS0S Y_0Sc0#0,,v R0 2r 5 0500K Pr5"0C590C990C9000Ph|n x巖0S \2d"`2Q090 9 ۍ.p@-0@S g/t0P0Sd<P 0@00` p@044000Sp p@NU*b(%U*s%C-/`O@P p/@D0S Ѝ/SpPP60 8P000@-0@S  0S 0 000h0@0S 0P[`o @044c000S @ZU*b(%U*%@-0@S 0 000d0@0S P,`@ @0004,00S @+U*b(%U*%@-0@S 0 000ud0@0S FP_ @000,00S @U*(%U*/%C-0M.S`p4P4A0/SS 0 0U            p  xX  d V00@ <G"ЍU*nC[hp8@w~w@-,"C-@`PApp P L"0 S000 ЍW00(*p@-BM @P`0E CR V  l?_Pr0FS `0 AS ZP0P S00@$R!WBލp(*A-P@`dZ<0  p\ZW !A(*@-BP ! O 0S<P  ^P!0PP `@MPS 001F0S; 0 00d1d00`NV$@1@a0T0 0d Dop@* s p@-P@U U  0<# $p@N  % P 7P P / //   -M M? /⤐ۍ Ѝ%4`00CS`0 XX0 X /x%O-pQDMDЍOM@x`pP W200 RR00u0PS00C00@@ Rp@T+ W-Y* U U %   \  Xq0.| 1   \  qX.0 - p W8% @*d93<0S/@-@QPM PЍ@c p31Q``ZXW00CS`````````Щ ```ȧȧȧ"62PЍ@M *!0S S/   d0AS&L\dtlH  <840 0SPЍ@a~   0W1hS fS501 0400030020j0CS PЍ@=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q ( xVPЍ@* : @ [I ] |           O n v @    O-@`pR{p N  ЍOL)+p/00pzP XL0S PP/X pv +p)P PpP 000 > @*do% p@-P(@P VPp@m%0S $  R R.0@- *@- (0 0 0 0 03Ѝ@P P P  L@-(M0@ #\S@3@#:@ (Ѝ , 7@-P  Q,XyQP Ѝ0 ŷ@P .OHPP VP**0@-@QPM <1a! 4aSaD@ @$0d@Oo@ 1e% 4eeT# ! "Q  R YP Q ,6QЍ0T%< @A%(T h X7%T @ ,,P" $ @#* Q0@-.Pd0 @X!P@QR00 00蘔*, *0s@- @R`  P.GP ,P0S ,P|Ѝp l0!PU U 0< 4Ѝp@Ѝp@po%**@-@T T 0( ( ЍЍ@+Ѝ@ *p@-@"1Q0P Tp@@  p@0 p@9b4EO-\M00@0"0 0(p @@0$@,0@APP PP  @@0AP``zU]\Ѝ`P0  FX y RAx   <y0P  byM  4\100 0 S00C00  Q4P p0 <p 08pj0M cx`00CS`0 Xo0@T:\ЍO`X0 X @ -x%po%<@-00; Ѝ@-0  3 ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP ЍE@-0@ 00 Ѝ?@-r y#(%@-唬N@-aAMp@0WP M0d_qXaX!0TjL0P 0I0 ,Aލ Ѝ`0001!! B?t0u 9!R  0G7F|@PG wG<T0 <<@D0 H0X0X 0 DD+ꈗ*iwYY}b[*ܾ)@-Z뤜*0@-6S W눗*I@-PyGvGsGxpGm/l`@P" XT  <4R, @IV*k*@- \Q(%0@-h@  0@ 0\0CS @C%p@-@Pp00Sp8PU``p840#U:0X 00rX0X40P80 0X0p`P -7@- 0@P0b0P R*00B0 Ѝ0@Ѝ/O-dM@P UP@DU 0 S xdЍ`p |0 J0]0 0^`=!0 30  uQ0  .0`  V0BwP UP %A-@`Pp尀@"!023 U 0 wpp p wbP@T0S0P   Ѝ蓻[-,M H0 $0@0080000 0(0( $$0b,5?I(%-7@-`P @XT@ R 0@  q000 Ѝ0@Ѝ/o%*jp@-PP@ xU0S 0CS 3 00piU}p@ TT 00 ]Uq, ,Up0Sp **skA- `(p 0>pЍ P u@P  PP 0>pЍAt01Sh0 ` 0X2TpT 0` 0S I` FP `*o%e[F C-q@1MS0`n1SP1SdV1 e묁XV ЍCVR 1S  @1ЍCCV,Ip0S) S S %PX   4 PX  #VЍC   O X ` TT  ЍCVЍ*o%e%9yc@Z Mh \4 0Q 000/ *o%A-|AJM1MSh=`p>C0 `PT c40`0 =p0S JލЍ;X P0SA7J.H0 0A1$HpL  $`0P0p0 P=pT- Lt0S8m!10 *<kG-`Qp1 `S1S@1SHV$1$ g1SV GV1S G 0BVMS0  夠D@d0SVG;1S 5Q 1S - <( GV*o%e% U MMC-a0$MSP@D pTp0 PP 1!@ @0 <p!o$ЍqS   0S  0S0S[S0SpT 1S!0T0  rq 00 BT !10!sr 000 10 0( )00 0 !*]O-hb0MSP@ἐ opTp> ,pS,0  v<p[Ѝ  0[ J0S  'R0S@ 0 G<poMpT 1S!1T p 0  T 1!0 00 0   $ ( !00d 0 ,0 ,   0$0(0!00d00 , 0  , *|C-0P80圐 ,MR/ !!~QAP`,ЍC`@ @M(0`0$0F Po%**&*O-\M`MP@谟Q% 0rS P @0 $ 0000 0 0:0P    RQ  \ЍS @0  0P@괟*A- !10`100CS$$1" =6@P qߍOdoob4S @0404(0 0,0c?0040(00000, (4pH1p;W,qV RT=00D@ ?`P0=S "8 R  x?P 0=Sd "8 R `  D?P 0=S x"8 R  qߍO( T V0@40,@p[VD@70S 1SX'  APP `V-t T 0H 0(0 0,003Ap06/00 HX<  00( ,p0,S(` T'&RG Xqp HG0"S DGX P0 SX0T R $00Sc SW S0G&P00CsL ="7 *no%!rc ? R ^P\s x ?L A` y  @!""a!!!!!C"_"x""""""o%́cJ##3#U#D*kl#~#*0P T0LP0PT0pR0pWWm&000&00' T0&P0.T0hPF0SY@@T T TQ0P 000@L C@' 0@0& 000.00<0h 00؂A`@PV\PP P\0p/p WqߍOoF0S0 0\0f0 00$_0000s@-V@P [ W xS lO `K TG HC <? ,;(%'!(B(P(o(((((t0p@-@PT`5C P  p@07p@  Ԣ*&i()@-M @ ZP   Pۍ9p@-IMM @`BPIލЍp MP0 0 lhP 0S 0S0 r0S  [P92)W)Ԣ*@-M @ PDDzۍ00 R   ;P9Ԣ*H-p3MM@@xPPXY3 P囲0  4BP00S` ? yBP  娔P``V / 垔Pt2  ` 唔`P_ H2P @XBP ,4PP0 0U,00P`0STW J1!P 5J \PP @J1!@ %P\10S P 0B0z 0\BPPPUqWP P 0 cV_YPiP`ZZE_oR0 $P  D4S J P t60 `PX9|))Ԣ*)7a))))))*(%**r*J*O-@M M`;@j/p" P@@@ 3p p0Wp0Y:0S @Pm ލ Ѝ0W@P @puA0P 0Z 0 pl 0V9 H1Z ]P FZ.$ pZP 8Z. 20Sa000Z0 0?0V9 0Z 0P Z.p @)0T:Z_P Z. p$|dreedAԢ*****@-0`0 0 ;PP %0@PT :P Ѝp@b06(PP 2.Ѝp'lO-dM8 4@00iPP0edЍB0P$0  $WP[ U  ИT^ Tb Tf;@07W000 >D00 0S0R0S ,0 @ $0`@T[*X70P7P' 0L7L0H7P0D0$00(0 0ZK*00S 0[S 0勴Ot  䆟 0PPp 4; HFp H P$6@0p6pV01@0`6`V00S@D@6P00@06(V0n>X1Bn80S 04 SA(0 `0(0 0@0 0,0S5 0S2@ ?> D0yF@p_ 0> 0<>0p0o@Pk 0 54< QBfp P4 0p0PHp$?4 $;Pp FL$?4 ;$Xp H0 0<D0 00)@P% 0} 3X P@ ȟ 0=@ 0 = 050SR 0TÛფ0S?(0 0 @C%  pc 0p`H]p ?4 ;PSp ?4$;XIp X0P H@p?o 0X= P0 R=0 00H=000 L(0S 0D{ფ0S?0=  `Q 0`PH pD ?4Pp `;p9 0X@ C?4$;`p, z v 0  01?H008!D04@pW a ^ 0 0( 0@P CϠĠo 0<? 0< 0 <D0x |++++ CJ,S,),D0,D[,++D+5D~PR\,Y@g,(M,,,,,/-5-O-@- ?l-(%G-䐟`DTp  P垮TD PEE$U@X >P00@w>P 0-40 P @ 3MDPE@D*r 9p@-P@Q0 F 0 pN>P @0S \#Pp H(90@ 0< 0p R$# p%`*/~+/lv+hv+dv+ /@-Z3800S ,0 0$p  N*`**@-@L0@@3@00S7',0, 0S00/'3*d**~+ *C-pQ@AP@pM0a00 M0 E1+ 0)=P @0 @0ۍ Ѝ0 000nS% ?S aS@ 0@pS qS @ l0h s@<0 P@0 @@&/`*4/x%*E/%*U/*x/W/$00S 00S/**A-X`0S L00S 08P8@p0Pp00****@-RP`tM  E P RQ ğE R`S% 4p R0`F\ R    TBP ׇ Ä CR ` 0S $ L?  4\ P00@0ß3P [P\ \PP $P  0R0F p1 B!$PlH D RB D^a R @T$P \P! P 00^@\ 1Np$$ l  T\pH 0P P0 P p00$0 R   DR%00 0 $Rk f 0P !F0S 0P_ ]P \PP0 00DS000S+f7`tЍpp1@$pWS l0HS D^\P! $P( " 0RF p1 B!$PlH  R D^  DR R P,P ]P B DRڰ0P0@r00  DR Rx DRtژ,Pu ]Pn q%%~+~+z+v+`*T0PA-@@P@T l-@ P`p0Sl r d0 @ P,0< 8(0@A p%l`*eА~+lv+p0A-@P@p0S0P0`|0 R dX R 0L 0S @"!P@`T !dv+** p%0u+/ /P@- - 0 ?~+0P@-, 0 3~+P@-, 0 '~+0P@-(@ ,000 j~+`*u+0P@-(@ ,000 X~+`* v+0P@-(@ ,000 F~+`*Dv+0P0p@-AM 00@0 0@S, ,1 AލpS> 0S0!C:P 0S0>PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&j04 C:P~+?1%1~+*1/1~+~+41G-1MMPG, 44 1ݍЍP0$Cf:P @4@0 PZ30S Scs x5@PQ / 3@cs0S0S PU~X30S5 0 P/ L30 003 0& 3 3Q0RQ300?o2P&Q20S  2 0P0002@0 0R R00 R P ,2@"000 H 22QT100?o2 & Qy10Su 1@P0001@h, < 0PQ0S0P(,P U Q 0S 0S 0jP 0! 0 00 00QQ000?o2%Qx00S  `0 0BP00080~+K1*X *d**~+*~+~+*1/1**~+W1PG-0JMM 00`0 0`S+ @1 JލЍS2 0S! /9P 0S0s<PP V0  t1t p1 R0 0S0QZp% 41 @T (1(o! 8PZ@#T0 B<0S i@$00 R   R 0D _'l0P05qp %R0@~+41~+~+~+u+`*s1?1~+10 0 0 0\~+G10 0 0 0R~+YY1C-KM MPn* x2 Kލ ЍP0\"C8P @<2@82000(8P 2 0S@2n!. P0 KaQq0S 0S 00 3@P .`1@0S p5PH1 \0P 818!00,1 030S P+ 00 000T   /o" &l0Q00S 0@0P0 00`0@\w~+1*~+1u+`*s1X *d**q+1~+~+~+YY1*1*@-PAMM ) 0 AލЍ@HPP0 +` pF x3t0p 0hphp0+q7Pc0S 0 `X~+`*11~+YY1 0P/D P@-0@i)000 0~+`*122Pp@-@PoU p pQl0l0 pP `@P00 P 1)p `*D#20@- 0+2*~+P@-) $0 00S/0m~+*`*520@- 0i2(*~+Pp@-Q !0?o20@0`Q  |0S 0 tm0S P (00p`@tOP T0 HFP80 5P400 0H~+~+ `*D2*29*x20@- R 02*~+0@- H 02<*~+@-(@(0 = 00S 0 *2~+~+0@- - 02*~+P00P0SA-$a w(00Ѝ AP0q?oѣ2 PP%P00\ Q 0Sl000ȿP ,17`0T0 0R0D00$\(  ,~+**D`* 3 **3D30@- 0g3*~+0@- 0p3*~+P00P0SA-@ (00PP.p`vP 0 `0 S   S  s0S00dZPL04P <^ 0?o20~+`*D** 33P00P0@-S ' 0 ЍP  5P 0Pd00}S`00S T0TDl0HP 40 0, 0( 0~+33*`*33u+m+m+0p@-PP00008@Ppp dp@sP p@f'2@ 0S80 000l~+D*4q+`*4-4P00P0@-S D' L0 ЍP 4 e5P 0 4P 0~+?1R4u+@-M P#' D1 ЍP0! D5P @1@*P0P`p Y0@P*0@ 0 S0 0S P P l0 Q0S  L0@ 0P000$0@~+1*X *R4*u+*@-P& 0 ЍP 0S t 4P 0S0TP0@P ,0 $ 4P~+d4l4t4u+Z4O-@P`pHoᩒ @5PM10S1 ЍO$kUlqI@\ 6@ 0, U j& <1 TD  ЍOjpX(PPQ 1RP3`Z5|0@0 /0 000"P 7@P <PU t4p0PlppUUU@ @ Ѝ<u+`*4|4~+46YY4444A- MP & 2 ЍPO0S!'4P 0 1C4P 00|S _7P P 0tt4@h1d@) PP!@4Q@P@$s/ 3~+6P5p@- M P" 1 ЍpP! 0P 0"#p`1`-g0S@1D0 0S 1(>PH&P20 0S 0@T 0g$4&`,@P / d@ 0@ +0 @ 0@3/H0T 00S00 &~+C6`*666 * *6-+s~+0@- 06~+~+0@- 0 78*~+PA-PPPPU㈀ "00P@lph0hPf00`0 @00o+T,0P Ae+~+~+`*%7~+~+7@-PA 0P00zf00 Ѝ0P!0P%0S0P 00"0@0S 0 S  @"@00+T)+0 S +<"+ 0 /P~+~+27`*t*d*z+v+=7Pp@-@ 0?o20 0P !00pPP 0 00xP0t tS00Pd \0@ظP(0 0ѸP0 ~+**D `*D7X000 0@-S$00 00 **t7~+*000 0@-S$00 00 **7~+*p@-@Pp@0@- 07~+~+0@- 07~+~+PG-rR@PpZPYTP`Q 5-`PbTJ /-@PP[$$ UL1`H1@W <10S $1$!0   S! W U1`0@W 00S 0 0  S  = $ $PKP`pP \P LP Ѝ***D`* 7**7\1; @-u0~+P@-u x0 ppP \00}ST00S H0H e@`P 00 0( 0$ 0~+,8*`*18\8u+m+m+P00P0Ss@- B 0 Ѝp0` 0S P@P ⧆0Q R   L寸 0Ѝp@d$Ѝp@袸~+u+`*s1~+a888Pp@- $0 p0@P0Pp~+*8C-P D2m@r0S424dP80S20S 1d@0 唀 W)0ܑS C"! !    㒃#A P0 U0CQ00CS0F PI00CS0J PA P!-PS0 p` 0Fd0` Ѝ0 `` V` 0哂" QP 000 UQ00h0PEP00P0 0 Sp(0L{0 0 S~+P*`*8* 9\*\*\*x%8E9g9P@-00P0S`  H00ЍpPl  j-P 0I)qpP@ 0 $0$巷U000~+?1`*9P@-00P0S@ 00ЍpP | 8-P 0i)qp L0P0`) 0,Ⴗ0S 0000~+?1`*9P@- 0 P~+99@- (0@P0 @WYY`*9P00P0A-S쀟 00ЍP  ,P 0&0`P PPP 0RPk+@h+@@.p ( D P00吴Ꮄ~+4146lP00P0O-SM  s 0 ЍP  ,P @P@ 0R@&+`-|0P 0'0hph`h@Ѐ0000 0<0 8A~+?146~+~+*11PA-p )00`@P囵P 喵P 呵P@P*p0 ` S P哶@@ @000 (冶0~+9 9`*9,*0* :A-p`P @Pd0 A\nP 00w-4 0 RU AY`*6:*L: A-PP   R ЍAP   R  <@0S00Ѝ@`p~+p%`*[c:0A-p`P0 AP@PLp @AP 00  00~+`*6:l:Pp@-v H0 p@00Sp@000b0$@$P0dPp~+u+`*}:*:0@Sp@-V `0 pX00Sp@H0Ha0<@PP0,BPp=~+u+`*:*:: @Rp@-/ h0 p` Rp@P0Pa D@P0P ,Pp ~+u+`*:*;; - BR0 R  P R O-M$M PQ  x3 ٍ$ЍP 0\#C +P HS@p@3`X ,3 (Y ?&PP@) C&0`t' P0S 20P @B 0S0BH00:pK\"lEa<"0SP$S \S0P0$ 0""  0 P##00C   BR 0 D)b0% 04)@0SPiR 0PS 0 D )b%0 )@P$18` 1 R ! R0 R Ȱ` & %  尰2/ R 0S `0) P%0 0000wX& 0`SM!~+8\*P*`*z<-+%x*66*6*|**@-@P 00P 00P00 -h0lM X00S YH 0dn P000p ?**<`**-lMT00S 9D 0dN P,00p  x*<`**A-@h(Pp `0 0C0S13  0P0 S 0C0SL03P  0 0C0S03 Pp@-`P@:P , 0S1PS !x,p@l,*`.)P %P00 0,GS!0R<CA<p@-@P 500PU ' R,Pp&00p@-`Pp@0P<0 }.0Sp 0h R00媁 Ѝ0 0S0C B R1"  *<P/0S/0@-@\0%\#0S P   R   0W7 0C200W70 0C0%G-pP(P@ /PP0   /P 0 0010S&" d/P0 0 U *** 0 011 :qЍ/ P@ )`@P 0PS 1` P):`P P)_P [:PP000S`U& 0S 00S0 @Rđ-0 Ѐ @P) `# 0S000) 0S S St0 PUu 0`S)H0PU ),P<=!=(=0=*@=*&*[ - BR0 R  P R O-0@!M M P<@8@4@@0D@@@.P4` 0p 0S 0S 40S 0S S@4m!ݍ Ѝ<P0S ;5@P D P 4P $P. )0040S 0S .u+~+(%>1**1;*O-iMM`0\DdMhlNύ,($px@<8t0 0P@0:600I/<p1 $'8('<,'0AM? TN?@DA! $P 0S LP,P 0S#TtT>0Sf~\0s`0sd0sh0s0Sl0s lS?'T>0S0 /3P0'-'>0S 00S01S  0TO\ 0 -=0S ^hP' 01Sh=- )0S Nt)ၯP$->N 0 e)00 Q /p>0S-@> pR*` @,0 Rg%P<0` 00|S\ `;0Sl<0N` ⽕Z N L嚯= = @~厯L,$ <@0S  01RS  S ;+$q 0S 00S M? 尐 0P{ 0Sx s&P#`l{@P@ 0S :2PT#V :F+@PU Ὤp@p0S01S p0S\ < 0 $P$P $A%P  0X!S/1T1P1L10h0p X10L1S 0S TAT# 0S %P  }Su0 0{0S 00S P @c0T1%TIYIύS0000!Ra @@$Q(a0000o'89010a/10>pP W'忭0 |PlPl0S(!$|eR>PTp`HVv  0i_0P0/3Pt90S PP@i/⡔`, t p00S t i?/n80S00?o 2A$PၬP0 BP70S P 0S[%P 0SS%878G`4WF$P@3)(G707P 00@T ^" &P 00@T O" &P 00PO =MpLNDFdP<80l')/P<+60S'Pp@T),!&I&&5u`V;df 0( FY & |忭@6 h席6@T M?0h0,%$14媭@(,!&N50SP1 P4$& &`p$4Q&&p0耝S``\4TTPX 50S h5 hl@ T|&V 40S (5 0\@ l&T g&&p iP40S 4`YPC~040P0+$ 04PG  P 00 R @3000@ @p`P@Pv$@Pp`@"  40WP[? ȐP z2Q00S K[ [ @0P00DP 4P 0*S z`Q0-S zpQ P0000 /R *R0 z0Q@00000S1 0Dz,*@T?^?*??*~+??% 4 @@*u+C;9;-@Z;7@:@[@@&@*@A@G"@[*P*\* A-+x*|*e *1YAkAyA *bP?AA,A;AGA*A12A#?6?AF ABAB1BM`w%%FBVB_eBBBB0BBBC,C2CCiCDCDC1CCC~+*1D~+?DGYYX e hD-xD0**DDDD*PEE~+@BE0E**`*]E~+*~+*P 0, qD0$D0qtP 010Sq LP "PlP |P zPykx00x0P P P B00 "P00S S 0SX @00K?CS3 U 0Sx`2 0 Y 0S  U  [E [(!$"2Sy"02Q0S I?00 t2 HdSIP2 tX0SD30= 000Q00Svz30 00 Q 00S% 30S0t03JW0st04@VZ PoX/0S40xn\hX4\ Rʬ4$v4R P q4D! 44pd0ǟs d30d0@(ExPU>  [%PLx#0 0| 嫑 2| PR #0"0C?o2? #"0 "|0Aѐn0|0|0 R ;R | P 0|0|0 R RU 0S;0S(0?"( ,0".x0S ?$0$.U0 P.͡"͡"..R0m0"R0.͡0 J$`P#PPx0Sx0S60S#PP x ⫩&@000.R08<0#. 0 x(L H&pHL T P%#PPT #P V  R70S 70S7P #x0S PEU0S ThY!1Q!0!PZQ= 0 Q0 F#{8 8pŸx U00R0SG PsPq  _$P   P, Uc e<90Se49 Q `\) Q0l9 DU9#? 9R-sr N-!0xQ3/P0p:@ ፩: R0 4:QL:KFd*d0 0 S0,\*` )d(h')#0S,: 0R.IN0S Ʀ000S 忦000S 带000S 屦00tiލЍ0S 03/0S 埦00Y @p`@Y@p`@s@- P@x%P  r%P0P IЍp6q`P  _%P 0x FU 0S S TP 0S  (F%0PP Ѝp@q=(=,=!=E9;0@-Mh 00P P10S 0S00 0 Ѝ! qQa @T0 S 00S 0s 0 :eP 0 S000Br@ T dP 0|S 00 0S00 0000L**X ***@-P$M`@ M0000000^p0P/S:S T@ụ1 / H `& 4%p0/0+@P/:+`P @v@嘥P $Ѝ@"/000`0 ?@PV@`00l0@@DcT@@00@0CcS1S@;&;]=~+PP00/@-  (0@  000 @* *@-  t0@ d00S X0 0Pp <0000S  @**`* *@- @`00S T0 0Lp w8 10 10S r @*`* * h0@- X00S L0 0Dp S00 101000**`* ** -X0lM@ d @D80 0p . *E`*4*@-0lM@v0 0 00 0rS sS ld dd X P0 0p ,Wd $** *~+EEE`*4*E@-`PP@ @0@s8#80U 0s8#8000@? P VU 0A0T00Ѝp00CS0 S0 S 0 /IO-TM|0xp0?W0 h "? $p0pW 0P`PV0W B@@ 0040RD H 8PZ0S= S0Dg0Y 0  劤@P)o0S k0#S g|0pS H1 R 8aR 0# Otp uTЍ 0 0/`V0 į $2PP50S 10#S@DT|0S "P\0#R"0 0 "*@B`*O-@BMMU@ Ac_? 0a>0@@0`P5 p`5刵P<;00CS00 S(P50S5U <% 00e  N0We S00G00S,+ 0S 0 S Z000S800CS0JPP00CS0?0h `嫥0 @P00CS0 &00 0 s`83 ap0SS 00   00BލЍ@d3@<30S VW@@ c030![30 V S$ " R 5U Q Q$Q V RV"d 0,0H"0O0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U 0   0ZRA@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/ * H ~+ *X**$*`*\*T*;4*-,F~+u+%*-A-` @T r 0 ЍAЍ/0p0$ P FxP  h0h poB0@S yP 5/T*LF~+ * 4*6O-@sFM M`  @  00$0p30(0$ 0,@30P S )0 (@r 3 @30 @,Q(2@@ಟ@aGT  $r 2 3 0 PD0P2d O)P x"xd d0S 00S D 0@d ڣ 7PP d@0S00?o2 P 0@6k36 D01@pp xĉH1pơD0(66S0d00 0d0Т(  A 0aPS qP P  0 00S 0 0nOP@ 0 @0垢0@,h嘢 0@Fލ Ѝ0**nF~+u+*AG"`*@@@*FX*YYT*FF0O-$GJMMs~0`WXg700S00p I 9僢P:X 660 9pPl'`60 0 0H0:97S\4640S# (X6&0S0 0]%Q0*P! R % BR$5N00E0S P,97S9 5N00\h%h0帢0 RS0$000(0000  0 PV 4 5X 廠0000Y4N40܀C XSX t4000C 0h00d0$ 0`0 lT CP $4T!>\ 0h0d<` ((0# $0$c#!$c4"($ <7 $ &R 30 R0S R3""44008'PT3Xi97S JލЍ000 00X0S   0Op,J8'CP\20 0 0D08 0  7pt 087PT97Y^ SЁ 0S [R0sO0010S ;7='0:7<0?70>78T0S,0 00 0<0 1, 'P!1 R  P 0 0ZP 0S 0097S0 勡0S} [[YX  SS000 00ⱠJ ***<*@*F****** G~+`*G5GQG\* H8*H*:G~GGGG8*&HPHoHHHH@-2Bp`WLM LЍ@ WpPk  Ppe 0001ၠ1 0S<0 ?!tq(t ( 0R0 0SZ=9Q ='/?@#b!"/p80S 0#S 0(60 8 pp 0S 0#S   pp 90S0 00 0 0NLЍP4n00** *Mb$I *IH0A-Pr@L0 @2T` R ] B P2  Q  ,00EE?AA?1 R$!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 WD!000hwwe(., 0pf$P01 0#l @D `TE<.00S ,/4$8 (0S 00(3/,*~+V*~+*1*d*8*4*4*X ؙ EI*`*,JUJ~+*&~+Jdv+9hv+~+J%0*hD-3JYY4 *~+?*FKJEJK` /0D`*qKoQP@-X@ L0 X lP ~@ 0 X*~+~K@-@V0 [Ѝ L0 Qp@-P,@P@p7P @p% - BR0 R  P R 䰘@-T@0SHP00 0R  X*MM\*@-T@4SHP04 0R d X*c;M[`*0P  @-t PU @W p`W VN ^ Q/p%O-@p`$M T oTP $ЍO+T @@@@DT#$Ѝa$1  !Q@ 増 QP $ЍO8b 8S 0S P0 0pP  0 P {X 0 j00 03/0 00 et<X*c:cNzhNNp%GN1($Q!QQ% Q( Q Q QI @-Q Q("^*  ^    0!R/\^^ QQȃ((R ( R (@ ^@ "^  Q(/(R ( R (/X*dw%p@-H0H@8D0 (8080$8P  Up$80-+X**@-AaM(8S B0 S 徖+0)DD P p p( $8S 80pP U 0S ,8S B (8S H40p 08{ 8$ 0p3/48S 0S 1 D0R <4 ЍX*@-+x%}N666 X P/@-@P$P  PP@-@@0s,00p >0Cohw%`*O-5%0 MM00/ t {B0 @T(0PPZ@T= P  4 0 ?0 l!`Y0  0P P@ !>P@0I04 4 $ 0 0#``೟ P   ᔯ#Z3000 0f#۔` t ုZ 0f 0T#ʔ`< c00< mf0 #幔0` U  S  RS00 "1f 0;#;Z0S;#;0 d)"?;#;0 #5;0?;#;0@#5;DET"凔0`Sf Y0a 0YP[ 2QW"0 P OP4@P /!, 0'!@P00@|!fMU` 0f0p ,P P00 @R0S"P8d`Qd00CS0+(p "P \Pd00CS0p000S 8A0QPA p0 0 `V`p0 c`Pd00CS0p 0@S P,P \Pd00CS0p `V0 0 LPp@+lw%4R+A-pp@`P@ .PP @P PE P@OoB@+O- d00CS0p0 dL\0p 0 P`, ^00S^0C0^Pdp0S    Cb"c!   c# 0hS<0\t*+MR[P*u+yP]RRRd*`*R8\*%S8S\*\*TS@-0 @0S吏P   P  0 00@ x0 lxP T0 LoP 00 ,fP 0 %zS:u+SS - BR0 R  P R ؐ1A-0aS0P0P3U P 00.S Pl`1h5 \H T1P@  D( P00T,!,!,0 $1$ U 0!0@p000 00000|P0 0pS000P0T h0h0 @U t0P$0`<**8S`*\*`*SSd*u+u+0hv+lv+p0u+* :SSp@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ *80@0S, 0pT**u+u+m+****d*P* L0@- <00S 00 0(p r˯**`*L*A-@mQp0S `0S p 00`P㝍働00000S t`0S p 000080uT  +p*T**~+TO-2AMp2 M0BS t20S Wt tW kpt W` 4S4pW  $Aލ ЍtWh1P+;004P/S +e+aPu pUp們0| 00g000000000S H1o41 1 R100CcSppW000S 0o 000000tWU00\$<\pPx kP0 p0~**+**&*T8T*~+*d*YYG4~+\*]TA-Q0qS0`00@S Q0:P 4P B\0 R 0000@ `ЍPl00}S0s00T 0S$@,T: **u+`*}TT\*%~+O-쑟Q0AS0`00ԁSp4M Q 11:`4Ѝ~PF P0.0lP00X8P" H@P$,!020$A$000 0@, P 0 Ս@ P 0$0qp`00P0}S0s00W 0S(@<9 ?**u+~+`*TT`*TT\*U2UJU@-,@02 P0舃+WUqUA-`P^`pZ L?@P  89@P $3@FzhUUU@-@hPq+ 0A- 0@0PS0p`0P㬀" "P 0S 0"S0x R S  p`"R"^ 0 00m+**~+}m+\*p@-MM P  `PۍЍp:@Phs4/S: @ P;0@TP/PUO-@pP`V1@@P`3:a`E\0P԰ Y/  0T@1PSZ 0 10S 080 R =0S*00 000 Ѝ~+`*@-P0@0 @p (pP0 0SP0 0q@Ѝ`*ht@~+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C**V**@-0 000' !s R Q 0S0000S b0C("( R SX     l    T  d  Ѝ %%@-(A`0S0 0 0 0!0Cp 0S:S50P0S0 0 000 +p0S:S5000h `0PpTq00, 0 p(qЍp0*9V,*YVyVVG-@\〠pA`^ P \T1:00"^ ^ N W\^ \ @2O-p@t`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V% 0V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&*u+m+[m+m+/A-p`P @XP0  T  `00T  0@ R   `FVx`00CS0  PpTL000`000 0 ST00VVx%VC-pP`@0尐Tn6 J 00@)ax0@P`0 \9NL00D P 0 Ѝ-+?`*VWx% WW|*x*O-MMP @ 04`0  T3@`T kP 8#8T $ 30S- p Q pWp +p@0P00E.002 @P E"EPtoލЍ pp0@@T o@ هp@ To010PS   0$ 0/ 0$ ‡p@O0$S*F>C0S  X$ (0Q`$0SZ=9Q =)/?@#b!"/0 0ᆇp7h0S d0#S []0AS  T0 0000 0♈p 0S D0A 0 ep@@q0T4T _okP.<00G"@*'W8:WgW *MbA6p@-@Pp@Y0p@-P`L@,P@ 0&0P@ 0S ,op NDxW@-@:P W@-ZSPW@-@qSp XP@-떢P1XWX0@-PlMQ@00 00 T  40S P C00 P :0 0] 0 PIcsPI 30S @@@`  X P `(P@ 0S  冼@P@    P@ TN T V 2 @0 S7 xZ@P l0@P/T2 PL 02 P …00 PU }  P 0 0PU n P lЍ"/m0S @P@$O 0S @{P@A T 11@T  0P 0p`VPP)000Xp0 0 0@Q XAP@*yP0;H*`**5$5/5X~+Xx%PWXF5P5m+d**\*P* A-+x*|*m+m+7@-P 1 Ѝ0Q0S 1 1唇P !-0 CRtA R hS0R L1P 0S0,S 0"P 0S 10S 0 0]@ @N0 @0@F0 @@0 @:0 @4 0 00S 0P~+*u+X`****X**Xlv+hv+dv+Y v+v+"Yu+u+FDv+@v+˜u+u+*00S@-@0M,  0⋵P0S8Uɵ@0Ѝ0@⿵*W1-A-  H@0 0nS [ЍpX+z%UU`+h+Y@-PMP Tt P H00S@0\A PЍ @P:Z+z%ZY@-@80рT %E ]p+(Z-ZD0@-|AT 0S  0 剀rz%|+@07@-LAP/0P00  Ѝ0z%YO @-@0S S S 0\ \ \R \ @ R0 RA-`@ ?f  嘀?ap  ?\Pt @㷁P@T*\ЍA01 !QTUQ s00 埁w%6Z9YG-AMMP`PbB  l2l h2 \2 X 0 0<r> 044Ѝ0+z%@-`0S@ IvPL0S 0000q20\ @i^+b)7@-0Pl000@h R R  l R  P4w03/ Ѝ0Q Pz%w%+9p@-,AP1$aS 0SP uốAP00pPP 0P P0 P P0 t pwhO0T@T  "  \ p0z%+&i 7b(%ly%+00@-18C8S 0P auz%+@-(0(@ u0@ uh+Џ+`+p@-`BM Pu@0 S0`018C8ST01y0 w0Pn00x0 fuBߍpB/ BR 0yu00P y0001`+z%G+h+ 0?o2 0/z%H-AMMr 00000P00豟a0  DuPڶ0  8uP 0SS WS BSp0 +%u@P  yRq0S _l1P0S0Y t18C8S Ԡ0S R@     |PY 0@^ST00CS00  S00 P0SLwX+W |+Џ+z%++p@-PH@P@pP P P @z%10/@-/uo/A-@PP" p00CS"\ ,] ] ] ] ] ] L] `V PPs&P0 P00TAF 0S P0000 !0S0R 00 cc< `00CS`0p SX0X /Xvx%p@-XAP00C!S`|0000CS1`^ 4^ ^ ^ ^ ^ ^ ^ 0 "S 0S!uu0 0P0 PL000 \qu0"Sp0H0p@,fu0 0P0 ꌐ+9c 0R R,R /0 N@T 0N@T'!0N\!n x^   RC  R RR @-\R0 ^R^@N CcG-@P2 pqp =`P`pPP2 00PF 0P  V @P 3@0S@0SI00@wPP?8P PPP P  0!SPt\cx6+z%A-@MPP\1 At Eu@P `p崀  SCPpu00u0ۍ0 P 0@ 0000S yt  uP00 Zz%c+cp@-`@6PP 0 Pp$PE@px6s@-@P`@TEtЍp r gt R `t x\t(R( dr0PP O<P K(P |+f@ddxt yt +0@-@M@,0(@,0 0 ݔ@P  Ѝ00,\x0 rUPPPP0S 00@SP4e +z%|+@-s (,d+@-@ s' s\okP To )r0P3P xsts h s Xr8o sDrЍ|+xt yt eee0ef@ke0@-4MP3P4Ѝ01<18C8S tsAq 0 9 0o Dq<O4M0 q,0E R! q q8P 41PP n0(0S"=R2s00ESg h g g h h p&sd$s`\XT HsKz%qe|+%}eee+d՝#eeee@-0 yq@2|+-@-[0 R   ЍЍ/ἑ+-@-[q-@-B0 R   ЍЍ/ἑ+A-ARp`P@1T >qpP`@DO-dMP@ wnPqn0P0 0 8,@(P@  p P @ `804 ,0S[  R>,0SUXM HG P00P,0o0,00娂0000U k k k l @l \l l l l l m m ,m Pm tn n ( Q 0S0o^p \p0S dЍPa H4 @` ( 0C,08 PP( QQ H 0CP( ,0( Q 0CP( ,0( 0CpP( ,0zWPw ( pG   ( 0CpP( ,0i( 0CPt( ,0aWP]  PY ( Q P0C( ,0Q  PM ( Q P0 PppCW P?80"(HPJ (0Sm m m m m m m m 8 0(R00S @`(]$Y8 (r $ 8$   $ P  0@0o 0[(8$P8480SX d( P80C ( S  R,0PS(  P0C [,0( X (00 ( (copl@@` UX ef1fNf+hffffffff g-gEgUgxggfO-lM($ l`lPVPP#8@ 0> t 0<0`2`@0\2 @0P 00@5@P 4@pP g7pP@0S( P @p nn $0lЍHp<`@40S( (\o Pt  , 77, 0PŸ4 0/P,0/P<  B, ( p( ,0RQ@(pS<`@ 04P%<0%800%4000 0(<0(800(40\ 00p  P$@pee|%fg)gggC-ap0MS@0P p 0 00qp  n?sp B@0  7p00`9  pppppW0@0 @ <@Op`6t00 }>*?@d o00 S @. @ C< p0ЍCo0|%g+hEhTh[h%$p@-MpP! 0: S0 0 S P@` 000vЍp hnp P @TPT0dHS 8$    +ahihzhO-0]M-SP M0S 4P ]ލ ЍOv/z]ލ Ѝ@p㤄oP$ 00S0W0S 0SR\` @kpP@ ^ Z@pp0: S  SГQ mPP Yu nW ]ލ ЍOWmsoP mtE0v: S+$ `P@`Pk  mP p  0000 00 0S0S`-mP`m`mvD`0S 0 *mP V mP z{ RnyRwdmpPS nPx!1Z[ d 0bmnZnUEmp`4 0S!P0!0v06n P: v?b u 0S -v$mpPv\+P-W)m 0S!$mp<q꼑+|%hhihhfh h i i6i[iieix%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000TP@-@P@@0T0S 0S Dk]5BVlБ+@-jP.6p@-P@njp 000/$+@-@dP 0S`P Xj j UPЍpPU P U0P0$++(o@-@P @w00S@A$+p@-@PPp00Spp@$+A- `pP@P000 PP0 0i=[@-@P P0P00S@$+0 R $+Q A-`0QS@X0S@ p8P8 p{$ pu0S@$+p| p@-B0M 0SB 0PPdb$0 (0S ,0(0iKPj >P^ ,KPX #P1 2P 1 0X00\00`00G?000x000020"00k Y P0ЍpnP X1 KP4 P. P ,1 P 1 K P1 K P+ 0P$ P 0 P 0 P! 0P 0 P 0  0 0 t0 h0 \0 P0 D0 80 ,0,$+`+,7@- lPP@0PS0 P CxP0S00UdPPP 1dd0SP0d0(Pd Ѝ0ht@$+9oL0@-@ ShS0CSl t | (S 0h i0 hЍ\XTPLHD@~P0ih0($+?BEHKNQTW+@-MM0DP 0P00P00m5~{x u3P000tS ä0000000P4PT L4000,P44 , %P004P00430S 30S 4ST4STP 0S0P0 0S P 0S0P0HP 0S00$34P 0S00Tb400PP 0 00404 0000404 000( 04t04p0$0`PPTTPd D25<P`Q0`S PgP !wPpPQ0pS   BPgPta \XP`L eRPP`4`K0PSe 50S 0 ލЍ04,1P 0S _$+DZ&Y]`'F$h`\+[+,P++cS^.YkCb+ fb%i=JOMisw``+/@-T@5SH00S< 000S 05$++Q + 0 $+Q 0 $+Q 0 $+Q 0 $+Q 0p@-0x@Sp d00SP H00SP 1P0S05p+$+Q ++/@-0 @ p$+Q 0 R/ f$+Q 00S1+ 0 W$+Q 0 P$+Q @-x@5 h E5 L >5 0 75  005$+Q 00@`/|%p@-@`P X  @  (    Ep$+Q D0@-0S K00ET@YKU@d+$+@-@05 0@$+@- Bo 0 $+Q A-P/o"`bp2qp -@P UA1p PU||PHXU`X8/pL V@ P@T*U A D m ɚ 0 0A.0 00S/@+pp@-@ P 0s  l1@p|%ݚO-@`嬐0娠T$0P ?990 VYvT00S[   G1 RP g@@+|%P 0S  R $ ,0/8<//@+DjO-騔M`VЍ0(tS,  RQ0$R00:?002P?00" 2Si@V !sr% 0S 4 30S $SeP 4 0 40@!0`000 00 @ ` 0 0 0 PP00p @@0,t(dvyf`p{V0 Z$4SR@ 4? 0 qp0dt1 0Cw RQ%0$0@R*0 R    @ @     "  @@04 S*0MPf1 qM   10S 1[0?0S  f0$ $  [ 8dCB/@+G-pP`@@P#c  BC.B 0$0-Bd P 4040$rTG{+@+p@-`PUp4 @ P@ D4p dT 04p 0 d d0@p@@++ 0P/@+p@- @@0S p@P BbS .S 00CP U2"cS T- P:40BS L+L+JZp@-PP`@ 01S E"0S *Sn0S 0Sn0*S x0sR  dR  kR  0C^S0SP@uR  @@pL+|%0S- B 00P!P* C\/p@-@P& P`PpQ P @tPQV`b-PPN0Sp Ppp|%D~%r@-lddPP0P 0S .40!0`,@$!$Z3dPs@Po@Pk@P@0 0  @P0-P-P x-Ph-P LsP [ћܛP+T+%L+ʛś 0/L+ @- 01SP0t  Qhh a`R @ !P0< 06dQ 0! CL+#eX+ 0S 0S 0S 0S P////// 0S! @-@PPR0 0`aR R S R0/@- @P괣 ̣ \ #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* @!A-!@RQp0p0!? Q0*=#=p00 !f?0Q 0*--p 0!? QP *!p `!\q?`p`ĕ @?@@L+0p@-P@P QT4@pTT@DQ`V D@T0t0S :@L+ @% % Q 0/L+P@-44_,P@P @ $P 0 b0! KP0!T0@T0  T03:T03:T03:T030# S,,A #c!4,!0S ,1 ,!?   $Cx+L+ ꘑ%00P0bA @SP//D%A-RPp @:`TЍ`lP 0T0 0fPL 2P TP00T0 0ꘘ+s@-) @P 0S WPPЍppNP Ѝp@T @P 0S q `(00 0P6brKNImp@-@pP Pd0 S P @<` Rp c@,0P  ꈠP P / asG"+s@-P@`+ 0 00 BSЍp@-P`( @p0` GC Ѝ蘘+@-`@ (8R808Ѝ 8 0 CS  8 0C 8qꘘ++p@-@M8S.0 0S R(0 (SP8`000 0C?URX B(0 8 80C 8 0 CS Ѝp 0P.ꘘ++s@-P@`8 R8 R8SЍp 0d 80 S08O) 8 0 8 0R0S08@)ꘘ++p@-p@XU 8PE`V` D0 p8Soppp蘘+%@-P@`8000 00C?UR 0 R00C8H1Ѝp  0P 00S 00ꘘ++7@-@8 R 00 (P 00R0 8 80 8(80S  Ѝ00CR80S 0Sʹ(08ꘘ++(080S @-p/ᘘ+p@-|P`@l0 R(0p0CR0R: $0 p00ꘘ+%s@-@@`P@T  @A@P Ѝpp@-D@0S PX 8P 0 pp蘘+% $0 ((( ( 80 /ᘘ+% 0( ( ( 0 /ᘘ+%C-@wĀPp0S Ѝ @`0S 0S  80 8808' P tPlP (8 (0L++7@-D@P@;@00S Ѝ0 Pꘘ+0P$/ᘘ+0S/p@-@PP` P ,@20 00P@@00p@- @$P $8 蘘+O-,7,G0PS`M(X. Q008(X 8" 0S0S  P0S08 Q00((XʔP  PЍ0 80 8XU080H?oP20SЍO$Q 5Q' PpP0@Sꤶ ̵  ܵ 8 \ x ض H @ @ @ Ķ eP 048048XPP0480488080 SEC0488S0S S 8S0S S lj0488H04880S "048z0480480P48m0488S 0S S8Sb0S S_8SY0S SU048,04880 S$80 S E80?08<0$48X5X3` @R( B WH`X  P` [H80S 48PS8P ]088 80 Zt2"8Q WD 0`48 D(<8RqDPp4@P 0480 QZ`Z ` 1弁 0 0 0 K Z@0S U P s>P \0S80 S% W,"(80SeVaPZeVN0S4 S2 S! SN SL U UQw'*P "Y 0S:x"" "/S 7S00E.U S`dP$ 0SP0 Pd Pa 00T`P ?V *0FcS, X   0 <   0 0 0 X P  $  4  P t 0 0 , (  0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0SP0@ _U0 0Si U U00L Z# 0;0U $;0U ;0U {P+U U !UR00-UR000@0#P  0 a0CS00 0 P s0 0 0P 0Sa0@S @P 00Zt 9" 0V0@0S" aEQ0<)s90U 90U 90U 0S3 PP 0 /tPUU0E S񟗧 t H : 0#0'*U @U !U<80S07S <70S07S| ;07S0v {P 0#0CS>/P;l0 pqe`Q0 S T'0!R0?0,70S ! | e`0 S &0!R0?0  !R0 0!ı}60S!R0 !R0 0!ıj !R0 0!ıa 60S!R0!R0 0!ıO !R0?0C50S `0 S 00\50S 0 S 0   Xw'x!R0 0!ı en!S eR0d 0!0<0<]P0V0S 0!ıH4 KH %$ A>T40S0S+B @ T4 qP+ 00!R0 0!ı;030<0!R0 0!ıt `0000!R0 0!ıb``000 P0  V1PU(0S 00011C0SH(PꘑQ 0 (Q20H0@` 0P `2R <10?Q 0`@U 0S H0S0S 0(R0SH0 Q0H @`ʈPpP "E E"ETP0(0E7PH00C10H00PP(0p+++У+L+++@-(@(0S&>C0(0p+G-tAp0P 0P0W0S %> 0`S@U `0PS mP 0QR00 0R 00S W 00S0S 0  00 0   0P00SX 0  00p+++++0 0@ /p+d0, R X00S P@0~0/0P 0/ 0 /p++ 0,  /p+qp/G-`P@Psp p倐x X 0 V 0V 0U@00CSʠP FP 0Q@p+P+PG-P0P`Pp̀@ 0@D P "V 000U00C@C@y T dP0 0C J0 Q@ @D 0@DRCp+P+80P/ R/0 0S 0 /أ+ 0 R  +d+p@-L@ 0Sp0dS 0p`$P `r PUp 0أ+T0 0Q 0<0< (., 00/+أ++A-APU  ^%(`P, `(,, RP0`VU, ,0 0 P ^PQ p0࠱ P 0أ+1G-P0sUPP@PP0Ap`@`V R0 XWA V$ 0 0W PS 0)P ` AY0 0 v W0@TP0  0` &qp .@PWP tA ` W0 0M0  0`qp @TP+أ+P+P0G-dpPU !R00 RS@ U W0S Q0*P @P P`@V0 0 0 /0 00r  0@P`Pl`@W 00 H0 00r  0@P`V@أ+P+G-`T P@pl0Vs 0SP@`A P@tu TUP@+00CS0 S0 SB0 /O-0P-SP |6(X?p?X|?P?DAP0S0@ 0S 0S%@T >>r??n?+nX DB / 0 ЍOx`P l@i@ {@H 0A ( ,@><cyJ6(d+G-@` $ PP( gpPP @yz  0Z`p@*h k `0 z(p Tt p@ p9YY <d+C-`qp p: qp@@PP2 .Y T0 0 Ѝqpp 0  0a0@S , /A0@S'0@@- +W.Pp@-1 $P 'P6 Pp srpp^P@P<@050O00pPp\0,\ O  B%@ $,P Q $0ON0@4ppk++i@++0 05S /+@-o0@-M@P P*  000Ѝ0+@- @ sr NΎ004Ѝ++p@-~Pp|0x0N.P ēO.|~@P@BH  $`@P p@ P p+++@-VP ,0 0R O+x0@-5 @P0Q@ R00+07@-PU"P P@ P0 Ѝ000SxX09 Ѝ0@H00S< Ѝ0@0 0$0++|%Ǧ 0 +000S/$   ?A9c0/%@+C+@-P M# @0.S 00S Ѝ 0S 00 0 R000l~&cP0@  0R 000@0,0%+(JP000S/$   ?A9c0/%+Cx+@-P M# @0.S )00S Ѝ /0S 00 0 R000Pl&P0@  0R 000@0,0Ꞑ%vx+J@-@PP  @$ЍP P/00S xt0/p@-`jP p@qpP@ 0p@ +++P0@- S S00 Ѝu0 0 0ꐝ%P/ (0@- 00S @T+X+&P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P;x Ѝ04@P,0  0 10P%L%+T%+90/0+P/ @-@P @DT@p X0X PLHD@<840ؑ+%Q?4\ΨC-PPM* 0&@@@P I5@T@U A5 ЍP D++2@-@P 900o/C-MD@ 840@0rq 02C Ѝp 0 @++ 0P0PPC@/@+0 :Q Q .Q 0?Q  \QR/ R//p@-H`PὪ 0+Q@1 B @B" 1  p+G"@- Ѝ@-  Ѝp@-@DP0Ts 00CSp@@qpp@+p@-0@PS b0C0S 3 0PjS BS bS0 00PmS tS00p000qD+p@-hrdPd0d@;0PheN a,PV]Zp$+X+L%O-dV0`S$M` @DvD0S P X`P@ *$Ѝ:S, %S .S 00 0?S \S000 @ 0>@Y 0 0rxY@`Y LYK #BYf DYF  @aIY ` ` ` 0a a a ` ` ` ` ` 0a La ta ` a ` ` a ` ` ` ` a PY0 P00QQqpp40SPLt0S > P ; Pe4 P3 qp P0 PPYs 0 0TY@AYhBIY de _ c c c _ _ _ _ _ 8d _ _ _ d _ _ _ 4e bI0 SMY Jc 4c Dc _ c _ _ d _ _ (d ld _ _ d _ _ e b _ _ _ He Q0R 0 )qp  82~P0$2 R P B?f %qp]0[P P01P 14P 0 0 S0:P0PvP40 P \ 0 0 S0:0P SA Pu pDPDD0P,|++++У++@++F[0SL%l0@-@d00SOoBL0L0AD0<00A400AA9 0 +X++L%+Ē+Ȓ++(0$00A00A0A!ꈒ+Ē+Ȓ+L% 00@-  0S RP @Q@ R @TP@S@ @  TP@PT0@_100s@-@QP`@ P$P K10T0 /`@@0T T0TR  QЍp s1P  ++O-MDH RQ. `00DPH@@0PE1p? 0@0JQZH0 S50 S  0 000H00D000  0CPЍJo ^P @AZ@pP+X%0 @-oP/ 0     /+0G-0@S ?PT X0 000S@t0 qpp` m @00CSX+++@+1O-`wv@ !00S ЍO00S @ἐ00CSZ# ЍObqpP Z S qV Q @ Ѝ|%|%+X+@+@-4@cP@ - 0?o2 0@n+Bp@-@P0pP0+X%p%p@-@P800 p UT 0SppX%O-$!#ut$ `100@_0 rs Y0 @P0s00V 0S (000X 0 00 :000P"qp P 0"ut R0 @P`000@_ V0`p80?V `Vp ` p+x+0@-MXP @tu 0 P Ѝ0@- 0 00S@+\+A-0Q@Pc M 0SFPI2'RP  /P20S 0S   Pv|r0S0S 0S 0 00 0pP`! VN8qpD1( Pq0S 0 0?0Sy10SVJW 0 Vda~|XJ7S V1p0X  ~| ~|  Ѝ000 0000 0 PP`` 0U0C?o20S 940 P+ +@j\+aB+@++@-($ 00000S@y P++@-(ј$ 00000S@y P++@-^(忘$ 00000S@oz P++@-@P X㬘P㩘H㦘@㢘㟘㜘㙘z y y 1A-@TPP1 ㈘〘}.,w 0@ `Pp!0S0S 0` 0?00Y 40 (00SP+y d++@++l+A-` pP@y*0Up0P آj*@-4@P $0    0 +ꈝ%T+O-bAMM.p+W Q 娢 @P b0S0000AލЍ0!S  9PA>04S S S0\0@S  0 [Q0J0S 0  C}  Q? 0   ^R000 QR S$R 0C000S0`0000\R00000ꈝ%T+O-pQpPpWCM Cߍ@tcPSTp`3`#`C \\Hs PZ PUA (3T UpP 0S @DT2P@  @@ 0 X + 0T@ +T@"0S 000͡P @B?1P SQ@ 4 Pp 0Q 1T TP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S BP>? ^0p0000-T+%x%P+%t0@-@PP |P lP \P *P*舝%Ķ@-@P DP P P(@Eʶ׶O-P1M0SM A0 ЍOm` 100; 0p `wx@PЍ0S  0 ~|00 0岠 0XP 0S0S S @P@PT++P+0@- LLPR^0S @T 0 BT+%0@- LLPR^0S @T 0L BT+%0/T+0/T+00S /T+@-*P 0 cy`+/@-H@ p P10S00PЍ`+FP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-P`p?P@P$ ?0P0T0S@ s@-0P00`a0C@S금 ܈  P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 g \ [@Q`V1!0 f[0F?o[\20S7 @`^V`00]QQ! ]Q0[Qp.GQ 5 p`0W]Y0`QV0 0 f\Vp0[W` W nW \W`Rp0 V0++Hp@-0Pt @R RP D D <@D@ p@肈 @%++G-1`Q@P〡 ``0pW 0 p3PI H1@@1`0 ( @}Q ;Q <,0 ud \ @\\ dB0110@\SS838#0 %=pC P3#0 x< @P 0S 00@0( (pq$ppap2p"0 0, ,_$p W 020"0 20S$000 S(0Q 0Sy @;S= }S So 1!0 0v, 0(0, 00 0嫞 ⧞p$p000p WH(0S  $p Ua , #ppXP (0, 0     囱!1 !( 00 $p,((,(p,p|  d+%h+++=q%cƸܸ/|+ 9jd+>Sqi+;rغ"jƻ%q++0 0 (\<0< 0 La00eݍЍG-@`@[p圀P䘐U@T00S Jl0h0CX0 0S0 0 ^" Pd+++ļ,++++p@-P @%000P @p%@-@ 0  @0%0p@-P`PUp%@P 00CS0Yp ᖆGYp0 >Yl+G-p`dBd 0S2 SQ S$PUVP(00S S i $P$0, n`0000 00!#PQ $00P0T00, PP (00S(0 #R nR0V ,0020#00$0,0$0X P( T0R #R nR   PH \T000(0V0(00PP P 0\$T 0\$w 0(0V0(00 000TPrl+9+@-@X0  0S 0S00CS0Xp X˅0 ol+O-(DMX0`SpM00S 0S _3#X0X0\030 `00d0XSXP 00CS0Xp X咅X c)pP0 p_0 X PލЍP2 *Xp0S @#0$"P 0"P  p4S /#p!0p0p4S \PP XP  00\0!P|p0`0d0S00d0000S 00Sf #P00 2 02,_00S +|+ P0 _+0n+0JjJa#Ja 0x!t" P*"\PP WHo#P\e ( p$ !\0p !! 0`PS(00S#PX50T 00.|0\`0P l000S S0P@ 0 P00 00 l9(00(04l+ǽx%fB++9+G;5YY@-@5P ^AP@-@@P ^Mp@-@P0Pp0 ^Z@-T`@PP U  0*p0 * Ѝ+@-`MQqM0S000@03 0@妛0S ! 0J^ 0 0S S ` 0堊l"@P *0 #" PV 0匊00ڍЍ+++@-@P  0Sx^ `p\0 `  i:0P S w ]ЍЀ+kǷG-Ap0吁0`PU , R:(,=0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0    0 +%A-@P p0R`*W00  0P P 0O-/MO00PЍ080?PU 0PH0\\e R7 0SP?0 C0R 0i Pi PS4 0  PS>0@oP 0 R >0R*$0 0HP0S40P 0 R 0>0R >0 0S> 0RR0S0S4 0 S=0@oP 0=0C>S񟗐( 8 ܴ @ Խ l ȴ  ع ܽ P Խ L0 R: L `0p 0080800400SX<; 800 4\04 0师<0S [H0S]P80S4PU 0`  E⎊P080 A E4 E~0T P 0  004 0 0  0 ;40{ 0 :0R᜚ <00s 0P 0S ~0S 0L( P2S 0 H` 0S0`V: X$ 00@ 9@0S + 0[  H0$P x0 H$0嶘$ [49`0V:( $$ ` 00C 0 0P0 8 0R:`8  0 `[ p |將\8P0  R:H`HH8K @` (1 S:` 0   0 8 0R7 800 g04 0妇<0S IHqP>0800 $aP80STg04 0倇<0S  #80S0p4  H``P <000F400<0؆04 a<0S V 0400<0(6 800 xV04 0I<0S tL0 R: L 5 `0pX00pY R  Q P5 50Z4000  P 04`Z Z 0Z 000 G 00 00 V,дZ0 0RP  0 0 0 PQ@ `VpX 0  `F0P  ßH`pL(L<Hp(L<(0000S c04 0墆<0S E` P/ 000Q00 0  0`Vp P\   `VXp0  `Pa 80S0s "gp0 Y04 0640P0 .P 0S 00P80S0s">p 4 040P  P P R0X3@0`pL<0p<q80Sn4Xk 0!p 0`R l0004 0V^*00000S(0!0  ( S0  0<H ! R0>^P0' 0+++d++0+%%Lht@ l+++ 9[%H++H++0 00$ (1 0X`PH`pL(<Hp(<x0h0<0 0R0((Q 0{Q  d+[0+p@-@P`Tp0wS {S sS 0p |P 0 DX0`@p mP `9G-pP6`kPV00X01@ R P Ā0PW(AGU !R <BPQ   X    :R 0SP0S X00 0P00 0W 0Sp: ᮄPP 000BS ꚽ`+p@-P0@0`T P ǒP# 0S, L  8 l x ` 00C?o2S Pp0S000S000V0V@`+, 0@-MMP@P  P)X ip4!X+ ~ PۍЍ09޾H0  BR R R /x%(%@00CS0 S0 / x%@-,A]0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@bh+0-01S ^00oS^ P0\ S0S Q0S R P0S0S00QR ,h+0@-  `Ğ\ @ T\    %R    h+,A-\A0 5S <0S 300,!<P a q 0U&%0 ! R8  (P  0  ,P  0  4PP ȄA+00\P  P @ 00, ڣP^S, +(%+p@-@0` T  $t呄d lKP`PT p P000ST( @x%(%h+s@-@P 咇P^<@P-@0?SP@P` jp Ѝp/LP@LP 0S S @궓0S00dV_D0@-4 ]L(%@-0@<TQ T00 0001S R0Slp@TX` T@0$ @H4T(8  @,zh+(%,˿տ@-b4 i(%7@-@PQ  H0S 0@T C00 Ѝ0=0"S p`@-@P  p UЍ<0p@-\PP%0ATp \ 2DR "@DwAp0% 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//L0L 0p@-P@!@R0 U0 ,/U001plT,G,01//00/00/00/00/00/ 0  /8,j6 0  /8,b00/G00/00/00/00/00/ @-@g$?,00/@-@YLO, 0  /$N,G 0  /$N, 0  /$N,/00/00/00/ 00/00/00/%00/200/<00/F00/X00/e00/p00/o00/z00/&i00/.$00/U00/3w00/b00/mI)gb@-0  0Ѝ@-@  +@-U, 5A0S04c@-+@-  U,e @- 0IR, LO, @-  LE,J( 5A0S04c@-LO, @- @- 0!B, $?, @-  #>,. @-  "A,( 5A0S04c@-z$?,< B@-rN,< @-  j<,< @-  a$=,< @-  X:, @-  O:, q@-F,N, e@->G, e@-6vG, e@-.XG, @-  &9, A@-JN, @-  ;,  @- 0J, G, B@-N, @-  <, @-  $=, @-  I,$0Qa A@-G,@-@D◍P d 0CD[ 0@-0 |1<lT, p@-C, $?,9;C; @-PPL04S@W<U  \ \K, G,9;C;@-<<_P d(0C  DIR,gR,[@-<<IP d({0C  D!B,?B,[@-<<3P d(e0C  DJ,J,[@-$@EP ՆlT,A-\`)qW 5@P |A0 |jlT,00/00/00//A-P@`100# 1pS021(S%0t(y10 #1Ux  Ua wRb `KW80S  3/1SAyL0t( S0FK`e btDllO-a@0MP3O``&P`P I 0  0G|pP  0 G  tW 0S01 z!p@0SpGpR!  B!ġ C10P5QP6Q00\0S1 10 \P(0 p0 0M1S1S  04t! N H3ЍOR01PE_Q 20S2 0 0P p@-@` P  0p@J@-@Q7d  A50S04c @   |ЉP X03S h CX T T L0< $?,"A,#>,.!B, D?B,>C,  @-@Q:   ( D A50S04c @  刉P t03S |F Cl h hd d`00S  0< LO,LE,JIR, DgR,fS, ;, L, @-@ Q?   , 8 x A R 0$b @<   B .P \03S x Ch d d` `\00S  G,I,$=,<,N,J, DJ,K, ;, L,p@-PQ- H T h A50S04c p@t l/ @\P 3S/ C, A. pU, D Q  $ 0 A8 0 0, ,( (B /JN,9,$=,<,N,Q| F@ 80 , ,(00S  /XG,8,;, L,Q   F, y$ $ B /vG,$=,<,N,Ql | FD \< <8 84 40 0B( /G,,N,:,$=,<,N,Q   ( 0 07( ($ $B /:,$=,<,N,Q Q QA /  JN,9,U,cQ Q QF /  G,,N,U,/00////00//00/00///00////00/00/00/00/00/00/00//00/00//00/00//00/00/00//00// @-@0@d+@-@0@d+ B@-N, @-  <, B@-N, e@-G, q@-,N,+@-{U, @-  s$=, @-  j<, @-  a;, @-/0L, B@-PN,0S00/ @-  C$=, @-  :;, @-.0L, @-  )$=, @-  <, A@-JN, @-  9,A-T`)qW 1@P |A倂0 ;lT,A-@PP 0S v`/P  &/`1S0dP /P 0p RW  /`@-@P)K P | zm0 0[tm000A-@`\@*T<0p " RG\<0d$N R 2%@-@ @K@-@@-@@M@-  @ (%p@-@PUP,HPP( abP  パQnp`;v:v\H@ ? PP , 0@ S< 00p+,%O-,M@0P0 T; R0AT{ 011!0 S01  R01;cP ,0S  R3/00S 3/[1P PP n0P 0 0S_`: p` 0 011S`@S0` $0TwP$0pᴃ$0P``PpU$PeUP$0S000 CL R RڰDPCPE_ C B R@ Rc 1  pdP\ 50 `p0C0CS0V`0Z `1Z0Zb 0 000 0 0 "P P HV`x 0CÀ  S CUPPEPE_P0 {P b 0 00@0 PBG뻎P On1 0 z 厀 Q 7 {:!?@!0CS x `!0 R$VP0g0w0\PP7000CxRP0!R0c !ġ1S 0C" !8C8R11$`V,(Vtpt0 pzP vzf%`P 0PSY &H 5Tn0 On Wdd%\ Pd50xPe,kHV S0S 400C`$aH1Sb !0C B/!?1!1NSRPNQ0^ B08C8xP00S11:zP`PxP@a@1S/020* (P$J @@P8| \ D 0@S$\ P P P P | P P P P P D P P P P d P d3P?P <P >P PP P [vP P1Q9H P yo~1S'ʰ1 *H P y`~P 00P1 RE40S 3/Pgj PP bj P,Ѝ0R0 &a 0SpW 0~ 3/px P 0`G P ty 9j `~4j0010A^:0 b"P 00P000xPdP <P >P qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00P+A(%,RS%,% 001/+P0 R0//+O-p`*@PP [ ! J 0P @ Ѝ0D00 0\"<P 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @+FP/D0 R/0@-A1 P gi@< +O-Bp0 N W l0p 000' Ѝ`(Z 0S grP [00010P@P 0S 00@ Z 00 FrP [0S [00000 00` Z0S ,rP [ [ 0 0 00U0 P0HS0SPPr0 00r0S  r+C P e[PU n0X!0C0S 43 000 PEM[+VUUU% @O-,MPZS  R0@ 0Tp$T`C =0X0 0S 0h }|Wk@qq q 0P@0@00t 000$0. 0DSDU0E0U00ө?0U0 CR C 0ER 0 0kqY 2 Zk 0  B`"0Y Pp} PC ! PZ P P# 0STkpD EhPE@ @jj,j@P0 0 2P? P AP7 0JSI1000 C 0 E$ 0h 0$@pP1Pp1 W 0p00@0p00@pW E@DhPE^|pGT@D¹0 X@P {P@U@§i$0S 0 B09Z00000S 00 0 0{,ЍO0XS +c.F%(%A-pP`Pp `p@p@0T `P@ P P0000+@-P@Mp 0 `T` eP@@Ѝ0 004{ 0 0`p @^`Pu ,E@P V 괵%+1'Pp@-@*TP0Ps D` R :AP 0S@@A@p贵%+@-@D0000+0gn+0wn+-@-@00z   Ѝ@ Ѝ/-@-00 k  Ѝ Ѝ/-@-  } ЍЍ/@-@@9@-@9@-pP@`M,0 0(:  0 00`Ѝ@- Ѝ[O-,M `p@Do@oVrT0 0aP  0Z`b 0S_ L00S[ }P``L00`T`P0s@DO@00X 7 9qPTXWpKЧp0 S0pK0 0t@PE0p00 ?`T0 0P0 0L00H0T CY  ou 4fz/f-fЍP00Z00S 0S Q}L0PPUP#P3PztP 0 Au뜰JIh h C҂0 F0HRtY`pIIphh+9,@-,, ($ "Ѝ[@-P@`$0 0 A 0 00`Ѝp@- Ѝ[@-pP@`M,0 0r($ 0 00`Ѝ@- Ѝ[-@-00[   *Ѝ Ѝ/[p@-Pn@np+@-7@- @tXBr$C<\PU m% Yq<00h@PU ]%T Iq<00000S$$[ Ѝ08,IGPG,G+(%GO-`CM@CPP LqL RPo<Cߍ@ &@ 0@0oP̐`V >| mH`PX [      =R @@ y `xsG(%81@-b0O-MM 0p@{x`P2 |PP* P (HP 0S0 0    :PtP}P 0 Q0 01PLvۍЍ%0P 0 -!0  0'! G&,00S/ 0P !H@-TG,L,@-TsP QP <M@9(F"P@I&C-@M @0S0k7%P,  <0S#|P  @0Sl Y0] )Pe&B@Pa~D'D*B^'ЍP@RAP@)A`P'='P'`20SXAp0$A P|A X  $P 0)AT PP uAP pPP 0+Q !Xp 07'WpT+pAT3q@p0T3:X# $APQ  R@4Q p0Q  R@AP`Vp003/P,00  h0S  R l 410!8@G,lT,DE,90@-M M+@(;w+(iB+(2wB+i('@PP B"@PP 0 ` @@@@@ @@@@"'Pލ Ѝ0B(>8LnG-MM+ v+L si+ v+0ki ?P  >ۍЍ8Ln0@-@M ~1@@#P @  P A0$*!PRU)QW&Ѝ0RL00S 3/P 0$003/0$*@P3P/\P+X@P'@P# 0P 幉H@y  0S 0_ Z'P @P0o,m& )l*00G,lT,?LJL,,@-@M  ~0@@?]#P* 0@j  bP 00*!R00$Q #*@P  [0S 0` 'P%(&*ЍG,lT,O-`M 00[#*0S ` 0B00 SS@@@Qyp @(0 S0 0`0@?y 0 S:uPP@ B 0p00Q %Sg0S iSD %S* dS $$0T !PsS$200P 0 倠ಠ@Z4!@ P %Q0@ 0S0 aR7 cR 03/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $o$ Tl 00S  0! S 0 @S$SS0P @U:U 0 =u%7@-@ hPU K! m800 Ѝ0llAP Xs 3!L m m }( 0$[PG,GYYULeLpLLep@-@Q`T0000P0S   0p@:PG,8,7@-@ PU  Sm0800 Ѝ0PP | =md00S |L 0H[|0 ,c8,GGLLLF,eL(%s@-8Q`@Z>m][}s cgl]cgh cg+:gOc:}i 0 An@Pxx啯 9LP DBDbb ჇE}Ѝp,9k(%LO-M`Pp lo 0 0$0 B"p@5 ЕE  0S  $P R   0S  \$XP lHP {l^p@T Pb(&   V 0B? $0I$.P  .7@P  |%700hxPXxP]; P  4X; ;0S ;0P ; ?00|3$"0ߍY3 <A{ 0~"!031<00  <00!0\<0(    \00wP,0 0 p~?"!!03 l PM |p WU $ |vT2P |O|=:{0S$P0 .T0  (SR Y$W1P k 1 X@U$2@t=PU {  P~?0WC( 0P 0[0 R0SQ hk0S E1P 0a{0SP @ v 00TP@@ $2@@ MTG,t%ptbtMf@8,PG,KN-M. 0 0pP600Zp@P 0A0 0! P:iWy00F (ASz d_dtV L}_yh.0ЍO Ѝ/MMMNlht@,x%N0@-CMlPP 0S .Qmg@P 4pCߍ0 P~p  + +G-p@ 堀堐PB`AT:00Z W ,/Z 000 9gP EQ 0 c@N%A-`Pp p@ w ,p3p PX@ +A-Pls@isopl p0S DQ0Q.SP @$ $b |b + +@-M 00PDP E o 0PDP 7 o Fp@ ( w o tPUx@8*  o```p @q*PPЍ +b 'b`!i +%i(+ +8i(<+c8@O-MQ 弪幪D@Pc``0S rV:=80$d 0w-B$0B. p E p0`Q>d0 ]o@400r0 ,FoP40,   TTr:@WR?, 2p0/Onp x#|3 R0:P'P o P @0a Xn n@P  nP@; 1sS1lSD;"00`&a`P =VP@;s@P,n*0x*0wtsP\8 0\8TY0 yV *0z*0}\8t*0|q\:VT* Q0:$DR@* , Q9ʟP \ʟW艟^ 0/HU>H B0C   BPT ,<T@Y f0X649 @p A\)F0p 0HAEmp H0S[, ,)A0$$ (@P @0 H0@H0A,mp AA`LVp@hv8 u! HuH p |0P p0 ?\6S 0 S88@P =5( +(%" [7S |G 1 P~0'AA\@P G@P 7T'TP\804'8\8P$G 8m8 _dP0&08P 8Hpm8 4MdP00 60&S\880\8P 8Xm80S X&8P 8Im8 &dP000S\80\8?P0S\80\8@n08E010 ~{7rP 2rP |-rP l(rP #rP HrP 8rP0:4X:4SU 0 PM 0$AxP!m@64SP  0@?S @P l 0{BQ0:$R##ßRl#p$Rt#W%0RT# U>N /N B0C   ![0S1 pP 2@T rủnxHHp#0l0S T 0S `"8d/3S3 V\ #C?00N?C0C ];`0  0@F0@`@WP;A?)p@`x080C4r@,0,P$pJR0S zo Y0X6W5S $ ! aoXdXF0S@0 <Y4!S< " 0 t0 Vo i7N8,UN(%xN%%NN +L, o%N)N&) + +E+c+T,͈-NF+(+KRN +e'NiNh+GONOOO8OCOOOjOxO{OOOkPxPP\+PQRZOOO&ilOPRRRMYYRRR S)S4S+l+CScS{SSSTSS0X6S/ +P 0/[C-鿏P@,MppP3S0 `0 0`:00 0`@0`00n/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@TߍDT$T,T@-p`CM|@DpPlP#d0RXPP @ W<0080 `0(PCߍD[9TN,=,=T LO,@-@) @G,@-0  0 P @0@ T280 /P $  ЍN,|N ;,PF,m0@-0@XMP70  0@ P x x0xP t0E@(20/Q   LL 2 0/R@, ,@Ѝ0 +N N,;,G,M,mDD,@-M%RPo@P  j jލ0 00S@\0\ \}@P L0 (0< 0, $=,)M,<,DD,9,JN,TT(N,T@-bCMX6S XP \8lP)XT20S H22\6S 8-2020"W(e2PPr 10 :4S / |\@aU 10 q:4!SO *00 0 Bfxc||22@P) k1l Y\VTSDP0S 4!4I,!,E0S  =  97-4P7\6S 2/U !-@bCߍ 0 B +TT,RO +TYY+T-T{O+TGTTOO + U +$U@(Uc+5UkUUTHUTU0@-P@ T\ ! 0C @TR 0\  @B_TQ  S"#0  @ S! 0  @ S 0  @ S0S000S\RQ @  Q  G-p@PhM 0S'hЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/0 \ P0//!01000/ 00#0//O-ap$MPA@T :l hP00 ` 0S 0S0S$Ѝ@-@MP Mp! *0 `p Wd5\\ SS=S 8 d3R 0 ,0 ڍ ЍTT;VOVO-Pp 0@0M'"pPP rr`ĐĠ0 R  PЍ 0L03/P 0 k놁0 k  @$0S P @Z @Z`G,]Vp@-P`440@0S- 0 p@.@-0MQ!p0`L0 3/P< 0t@T 4/@0p0 Bk 0=k 0@8$0S @Z$0 @ZT `@Z @Z@Pk0S0C@ ,$@ -ЍG,rVlc9P P00 S mS, R ,0S R : 8 80R:P#3///@-M`p@ 噑PPЍ'PP BlPTP0 pP@$U@@+T @ @y0 @PVbV@Z0S/p@-P@ 0000p@ O-p@P|M YP+`P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 100,`00S/0 0T1 00 0<000m0tpP <@DT m m0p0? p؀ܐ0fP 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@$P P sP ,0! 4@F<#iph2P  @000@0"u@0@N?@@T@0S z?0 C,0! 4@p<#20! J l lT Il00I? 0011F10100 d84p1P8( s1S%4p ∠0!i 0Ad 0_,0! <#@ 0 ,0! @<#0h ptVbGVeq}Dl+QNEFXV^[%VV'Q`V@-@M`p @@ 0VpЍ PP  p@@ 0 VpL<@Q 7/PHl@-0 0P Ѝ8` @-0 0PЍ` O-aM,MQ0=@P᧻P6 ni`P - |hiPP- Vl"dT)+"VLb!+bV`gP@``V!aV+"V+bV&-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`FhP 0000!9`P 00S 3/p003/NaV $P 00S 3/p $aV P p0 PP pxb.;9/ 0 PPpxP;".5/0 #X R1  x V c0 0*vP`lqllV b +PPY  D}PQyS+"UbL+?"PPiwhP# rhP mhP hhP chP ^hP UxT U  UP (u`X&PNplT,rL,V8@9|)XV00C-$q0` MPA@P00  >C0 1/P0@0 @P@00003/Ѝ003/$gVO-PUMM.xx`@4Pj.zjQ_8Ik(XpWp$[ Z T   70.07 00P00@\#Pz⌗40,[Z4S =U?h400C2<7\4=1 W =7h400C26\4=1 0 00  000000pp  m044040s -14s[w0 00 00000 0zpp 0440]40s -1tPw003 E "!b5@ UݍЍP =2 ,XL=1຀P0Nc ⺀ h \  pw00$?00[000ӧ?&N?`/'"T4`, 4@ TP40S N?/$"@T4pWH4 0}10  A a "a a04 1p$ ,01(.8,40001A  B6$1 (11S)104 $q,0(84q,0$1#Spy 0 0t ^ pWn ,ܒ@p#a0H$100$4;T2P p>؀Cl Y$10'0$10!H00: 0 0G80C0(1}1S 0}1$1S!> ,! 6$40`040G,,x% R9%lT,L, =,G,[8,,WYPP  (00/0@o//BO-@P MMAE0*!Rp0)Q`U0 $0   P  Pp ,}* (0$0 $(pP l4\,a ܍Ѝp @4_S40Spp0 @0 4p0SW00y , Rv  000x;8,9/Pc 0  x08,;PoX 0Q3PdbpQWppg  blT,WbW&tWZ G,WWW XXX0Z( N"XW;XAXW]TXWj6fXWrXzXWXfW~WWWO-eM0M*Q8U"U&G'@&u n X x&0 t0T AQ L,C0S )qW e4p nP: FP' P < @P* @ pH0X 804pcP4 80p< P OU d@D`@ V p PAU  ( $T0S-   0S # 0P000P F]P #p4080 P 00 ,0ST0 S00 P0 40040804 0SS0 4 0  0x; 8:/0PST0rԢr S S 꼀 , t Sb  SU 0|tr t<0ScP<0PLpLL"@ @ 4,RP Ÿ ,0$ 0  ( Pc 1Pp cP0 0ꜱ5S0+^]x1 pF t0 S\ rT0; i@r%< 00 014s10 5>*' `%^%\%0S W%U% !4VލЍlT,XYY8,XX Y)Y[rYbYvG,BZ[ZuZZZX&XXXXXXXXZ]bXYYYZrXj6ZZZZZ[{OO-@AMT MXp P`L @P`T $P```PP@Aލ Ѝԃ̓C̳ @3 (4@$80DP@<@T@X P \430$3 00 2 $02(408@Y tP l딢娂  _t208@d2@DDAT P2P"PP#P <2 8%PI,2 $ '20)ATp !0 P&!)%0 Zx#P@0SW K0S0@4 000@0x;8 8/P6  %P ![%@P 0   @$$0 S@pW:p@X[rXr[bn N0[B[H[Z[n[n m۶[l[8,XlT,9t[0p@-`M2 RЍ!,^0P @40 PP@xp0 ;87/P  PBl+l+ $0@-"@!P0(@l+@-$@2S 02l+O- PPPB8pPP   `PP 8_P@Ft$र@`V*l ЍD xZ+P T+P    R0SP lpPBND%r@-@00 vP Q P 0NЍ(V C-PJMM pbMc 8Ic@4PTdHP`YP8 Yo`GFWI `P 0 000!00P < 8<1P <08 <@XNo<0S0 0< 8`PW 40,01@ 0101@00 0A00000@ @@,b@0S7 0S'8JݍЍAT|P0 8 RT<0$!QQ@0P 0 003/@<08 S0 S(0S 0S8j(0S003/@<08 S@L,0Y p%h\ 0S/p@-@P` !a(0SQ 003/@Qp@U R 0@-@`pP4M0S4Ѝ0 0L03/P 0@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> ~o[ 0@o/b0 !!/p+10/y_p@-@4P0 `XZ1111pp+O-P@p`АРа0* C  !0  Pa0+S   +S 0P,SR0B `p@P X 00,0` 00000 Ѝp+d @ 0@-P@M*.a1( 00 0d0@00 0T0@@@81 0 000@9P( ߍ0蜔 p+O-P`@p4M 0Sp%P pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+   Q 0S  Y0 0P  P  $04@H0080pS,000TT0 0X0$0\0(0`0,0d0A- +R 0  TPoۍ ЍKP@p PP +X P*+PJ P*+J P*P갈&p@-M@(;M`P9 xk<0 05![ P (G=9(K= _kW!a <C@P QލpZk[\LF,x_@- D@0,SP@ +S 0   p+  O-M @c0 T 0Pp`آ W pP 0 0P0SP W%]P0WP 0 a0CS0Sߍp( a`V2p0008V0S`p R S`0a  0 0 p 0U? s [ 0+ TP0=p000 0S 0  @00t00 00S 0 0&0P0 0`![0R@0O b 0 O  R*? 01BVa0 ,M\t d@edA+jX\p+p@-@PyP p@#pC-pPAK L1`90 < #R `)0 S 071DH<LHa@7ZDP 3ZU `1<P1 -ZU `1LP1 'ZUP1 `1"ZU`1L0H `8 ЍC(0(0`9`90 0p+{[ \@-M@ .P @oЍ@-| 0S lP \0 T0T 0PP0L004 80<( Ѝ ЍvG,^\(N,$=,mM,^<,DD,@-t@Mhl900 0X00. B00 0Gh $0l !Ѝp+p@-Le5@0P LFp@k(\-?@-P @  R , 0$@/Ѝ0@ Ѝ/\\@-0  0E P L0L L@ 0< <@,x0 $@%ЍN, ;,mM,DD,-3M M T=P0  4 [P [o3ݍ Ѝ&6&-3M M f=P3ݍ Ѝ&00@-M  0 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,G,,N,\(N,:,$=,\^M,<,DD,@-0  0 P <08 0440000 0 Ѝ$=,\M,:,<,DD,0$ 0S/ /|+0$ 0 S/ /|+00 0 S$0 10 1/~+p+11<0@ Q !@-0 " !/p+0 10 1/p+@-7Mp*.\( 0l0d 060 P0008 0g@(97ލ% p+0D D *Q/QQ Q/p+%@-@0@ 0 0 TPЍ]@- @0S00(N,]0@-lAMcd@ T P@P@00 0p9,/KAߍ0)]p+U,8]<]@-P@ 0P  ЍPG,-@-   Ѝ Ѝ/-@-\0X0@P D  Ѝ@Ѝ/GE]R]{O-@-\0X0@P D  Ѝ@Ѝ/Gn]]{O]E]@-4P P P]]]@-@WP@ #o2c@-0@KYP$0  P00!LE,$=,<,@-0@8YP$0  P00!PF,M,DD,QA-@@1@#PP1P#T|p|` bP (B(Ad##+B(B::\A\,LF,7@-@$P @[ 0 Ѝ0](%]0@-EMSP@ S JP0000U ($$0p:@+Eߍ0U,G"p+U@-hM1`A SV@1`Pp 0 !  )%L<e!0 00 000H0 0 00 00 00`0`PPpHR0H2D!KUp:` JrX (TS((Jߍ#^p+U,ex 8^| %_^)]@-@P !0`RpzMXP PP t 1P`pZ= T)01K@0HPZ@T 9\ Ѝp+N%@-@< 0@- 0 Ѝ0@- 0 Ѝ@-0@M00 0000 0Ѝp@-P<@0*SpQ WPp@%@- 0P=,N,O-$M@p`P 0 P( 0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ$Ѝv^D[8,eXG,y^(N,;,^O-,M@U$PAIapYPi $4Ip`V30S` &UppGWT X1X!XXI$ 0 `   $ 0VRR  S  R kU 0BPEPB$H0! 0$000 0  $0 VSS00P0#02S `F ZU Ap:U @p$ H`,Ѝ^^A-`pP-@P!8U hPP 6/SAPG- M$HAP`pP Ѝ0 0 @`0 VSSXP$ H-@- 00Ѝ Ѝ/ -@- 00Ѝ Ѝ/ A-`@PMMP\ `\`ep(@ F43T0(3T$$c3TE&  0So 0CS+PDS0)  0s 0S9 0S r0S 0S QN@P% 0 `0 P@oH2@P 000C?o2h70 o0`F(D90SލЍ!~h7SVPg1Q! @F?@Foh!H1PM0 H 0M('  0S 0S| q0Sx 0Su QN@6P  0$0 @P_F? Q. QyFNj[_ik(_ _j_U,P__G,,N,_m_d+%gkD9T[u_fJN,9,_vee-MM P  P  {ۍЍ_-MM P  P  fۍЍ_s@-gP' `PbP S%`x0S й l t | } @IP H@TT6Ѝp_x0t+R/ @-dt+\0X}T0PyL0HuD0@q<08m40p+`U,`Y,(`U,Y,3wU,Y6Y,P@-@ 6@0XLF,p@-@M L(@H@W0 #,0@@,0H 0QALhS@Pp0: S (HOP O O܍p,qW 8mWA @@PP@Dڸa <UPP?8 1!岩8<%DQi \1 08808@TT OoBQeP@10S nu < R t00 00000 00l0pP@ m(vt(0@A!$=,M,<,DD,, 2`^ vG,(N, O-0CMSP0q `@e0!`;/.0`SPW!000 @@3/@P CߍW! 000Z 0SX 0 @iT W  00 0  0S h00S X  L0W0 ! ! 000N,;,LTU,C`k`9`L,`p+7@-PQ@0  R 850 000^ Ѝ0-S  `&`O-HPUM@44Q (嬉 .V$ğ0*S^P3s0샟C0`*V`*# 0SP>FU@c A@ UPtLP \JXGLD@1 U(:$ PP $ 0RP P ^ 0 10S 0S= 0 1S900 000S NP,0pG00 0&2F4V 00 a 0! 0 0R R` 10 1000pXR `0,S RB  0 P a+S  *SPR Uߍ` 1 00000000 .UQ U@P@T Tt {^PG,`U,%p+`&.aeaaa&aaaa5b,,`N,`_A-Ph`hp@TUTU *P  WP` %9O-pMM`\p pP wPP6P  6#@ڍЍ vP vP #P9)@P #PZPP4U( v0:P LP0=Sp  : P20W@ FDVT Rꨠ匐 P  P  @P KTP@wE]9-Gb_b1YYs*0p@-4 P@CT0 Pp@@-G-`P4 0T@T$ `V! p0F&04 p0RSP pPp Pp40Su p OPp@V/0 R/@-`p0LMS@`aP 0S0L0 3/P (0 ! "!P 3/P 0S00LЍ 0  1/p@-@ PSP  p@*@-@ (@A-P@p`p0S 0pp RyAv05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-0pЍP'@%`yp Ukp L F 01`V'0 t@T  \pKPLP <P @GVeq}D[bwb@-@M M`p;@ p  PpGS`wCS`qۍ ЍA-@P RpP` P  0QP|d zd@@-@M Mp;@ `Kp P0 @R`3VR`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP+N00/00/4\80S0 S001/\80S  00@-\\@!SR0(SS QU S!0$0S\  01p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q  0P!SR:p040080SS P Q408S Q0  040S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4  B(B(Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X 000/O-0@p 4M3PPp`+04ЍO$0 L03/P Ѐ0 P p* D@ Z[H * R T Rp M8``pp 0S20P 004Ѝ, [ 0L,O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R0!S,0S p0 p002#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/Pd  (   O-0s(0M800PS`@p0  p00 $ 80s!3 0Lh0@l0S@3p 0d@` H3`R0000ЍV0V*8q @ 0L03/P 2PR b0 0 0 00D0@p,02 ,0( KHL( 004 < K0(0`( , 0< KP23U 4t0p 0P0,080SOP0 L T00SH0S_000q p0,0 8 T8 000 000  i8 I8 00000PX O0 88/K0 PpQXQ Q(0 00 40p` [`\gp ,0a X0S l^ 0$0p0 0(0  00 408p` 8 0(,G,Ic,,sc[cC-hF`0pSPlM^LOK0S0GK0 S?K0S_8K0S1K0SG*K0SH#K0SIK0SJK0SXK0S@K0S(K0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 lЍCD ( cJ0SWCW@ L x 48P Q QI0 \3003 0tJ0  lЍ3003 0dJ0300 0$p3 0TJ0 0TS(0p`@  0  SH0pP0`@SH0pP0`@SH0\000 SH0`000S"H0d0S pP`@0  D"  zP0  a R>0  H0L0  H0L0 ~ H0L0 w H0L0 p H0L0 pi H0L0  Xb H0L0@ @[ H0L0E (lЍCR !SH0000%0P pG d 9/ 000(0W0 (,yz{}~ d  [ccHE,G,c ( c cccccccd dd C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``U0 0pp07/@-M0@ 03/P 0 00000 6003/ލ@-`,MHP E@0 0 0PP@00 RS THP pW JP00P00P0,Ѝ @T@0/W/0  0EH P00P0%0@-$M@D0X  0P 00 00a0P H0Dd$Ѝ0cO-%,M@PV `c\q pT^pHZP`<< ,pVV !R "2 V pP P`!V$U3b$U p 0 Z0 00% 00 0 0000M0PP X,Ѝ` d&d C-40PS,M80S,ЍS S S !S S W@P `p䐟`$`X 0 000 00| 000 0 00 0 0M `PhPt$ ` O-P@0p (AMP U  ! `<#0!(p<#UP <qP D00 P gP 60_0P0ZX@!T 0 0 p `@ABGA0  0!zC= @p0  X!p-3 P0  0!fD)P &`GP@!@3@GT -`KT@D@`0@@< 0 0K-K0 0@`0P 8.㨠嬰l 00@` P)HAߍ!0P0RPN[HE,(,ZddkO-d5M0 04`00 0A000 00``` S;0S 8@P 0P40 0H03/0PSp,0` p p0C@ 0Dp000p`@0St.P p1x'x0(1PP ! B B2P"Q%,0(0 ,0R B0"K, K  P8pP 0 Rp#p0x1Gx10q000ЍQh2  0@0D  V 0$ p0pC 0@D @00ZD 0S , S00000@3<0X ∡0L0 3/ 00X00=C0H048 <0?$xU 0S  T0P/f0 000H0P0 F0PT0S xbAP 0S4 `Q00Q0S 0L0 aA3/P Ȑ0 0&003/f0F0P ! E 0 /?( $0Y(00$0 S(0 0R0$(@0D 000@ RD 0S8X"a` 0"0'000 x H@ 0>x 0 \60  0> 0() 0>Ȑ 0 0l010h Lt0hpI+H&.+ ". - [`*pV 0 TjeU 00 0\T_e0 4TYeT0P0%0 Q030#Q0S ,0 A, 2Fkp 0$&(?00P`3/ !0P`Q/V7P S(0 0L$0 Y(00C8 0>X U T  0=Z00 @800$P<00 $X0%000008< 0` S00 $l00$LL0d00h04O0l0叿d E X Pㆿd <Q〿d 6XM 0 ,Pgd  3 0$X0 p0  @ \ 40800<0#40Y- 0S* P0T?d0 0@0刐T0 F0TP0P 4r?PP $ЍL00 PdP0T0 0S! 0S00Q00`Q0S 0L0 aA3/Pb 0开P0P 00%@PTNjp; 0U%@P@J003/X\0 K L001( 0R, Q ( , Z (, R \ 0Z0(0 S,0 0B9003/ 0Xl1%YQX奾D0 S00 "   D0<D0I1#+  0< ! P$0Z00 00Z 000$0:G,\e!eHE,P 8K>P (F>o&/KFep@-0@ 8M! 0`P@@ 0 *P8Ѝp#>PUJ0 00  0 k*P@oA-P1MMPL 8Q0P *1SC$A T )1S ݍЍ Q 0 1/P@` 0S0L0 3/P ,0pW0wP  0 p xp;H 7/P H}`lT,`0,@- 0P[8,@-0 /PR ЍP/R0 R/R  0emh0,@-@@@-@@ bOe@-PYP@S@@`P  [0p0S  0T O T @L>P  08#@@ Ѝ8,`ePG,je(%@-@ @0qe@-@P@@-M@  8  7 <܍e0@-MP@~  7x  7 L0TsP <ߍ0e@-@_@A-pP;`@P P  !;$0! 0PP ;Ѝ0$D e`0,p@-@P4Sp@Tp$ @Pp Dp`0,eG-pt`DTP <PP@ 0 0|PP$0R04`0,eA-TP4SA p`4@ 4 0_7 [7 D`0,A-@4S0tp4TU TU T`040 >0 4`0,ep@-@P0 p@9p@-@P`@ qope   @-o@-o@-o 0P/`0,0@-PM  0PPt^( (@ 0PPLT(D,P08P0%P 00Ѝ0@Wft4,f@-`@A-A0J?`V=p$X"0 bPPЍ p> C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$alT,9$0pQ@-4宻㖵 #"T R0//s@-(@T@ЍpH80P40 0003/@P偻i/@-tM-PP@" @a0 @p@P  /0@T@pT 0 @ptЍT|0t dl0l p PP L @3N,"f&+f:ft4,Pf4f\f8,ifwf/@- E@BfHU///@-0@Q0T@o?0 \ 0P000@-@4M0  a=P0PU?:0 00U0 00  044Ѝ0t4,//A-pP@`|VT0S0S :PH0P$1U:0U0 00X0`p@4ft4,0SR00/p@-@P}8<0P4`" 6D0# A0$!4pG,HE,A-<`P@d:Pp( F5 Ax4,@-p@-@M @<0 h厺0S X&`P0PP0FV 88 0 $܍p]^$N,fff1G-1`PM@PM/1|!1x  pqpql`PdL@<H0 [ߍ B@P B]B?8 4@P 0=SB8?A@ B?@T@  P 0 h'-P L -<  \3E]3sef8,ggg91A-1P@*PM/1Xp1T P`P`  P  <, ,,1e8,31g;gSgfg~gp@-0M0-000`00P0a@P @T 1X 1T1D 1 SDP1 1 Ѝp!g56 0@- P d+C-`CM P@ `;P pܐ܀0 `0`90S1 1 Cߍ5S  |up pP\ ``X0S  @810 1$?,g#>,6Z,gggh9hG5Qp@-P@+1 1  pU,1p@-P`壸@P埸0 p@vZhp@-P@P P.1 1 pfh2p@-P@11(1 P.11 puh@-ĸ@fhG-@ZM,h-;T+R@`r夒T5 TH Tn20$0@TPp"pp(`pDBhP0Sg Sa  @; 0` 0P@QP 2']PP ZߍP ¿FP !080 05P |!(t1X ( e6 0T!( ]6 ᘿX0101L0qo0!(P PM?00P0@; F; 0 0 & F 0  000 h $@m%4,hU,#>,$?,Z,G,/hh8,%i27h3,,p+ E4+ A-P$pA@P a-@T 6 0ǧP( 0 $#P  0+ P |2@ oЍW\\m P< 0 EiYY8,Uijj3siiiih//O-04pn@T Ѝ@T@T* ^( P@ U [Y  [ XY P$UPE P P@ @$0"/[,O-4Mp(tZ,Pf@ P @ %R000 000V0 050 V0 40A$V@U0P@0 0 000 0 U000 Q0#02S4Ѝ;0 0Z   R& S  P@0     0P @V0V0 40A$V@U0P@ RN RK RH  R ࠡ࠳ $,( [Q$[4UU [ 0Z0P@V0V0 p40A$V@U0P@ 0 U00U Q Q 0   }(0@-4MP!! 0  P PP@4Ѝ0@/@-@ @衽&jp@-P@/CP `@ H10P P `Ra BQQ pQQ 0@S:p @-H@0RH #@-00@-P@04MSd!1P4Ѝ0 P*   P +0R0#@"*S Q 0R[,0p@-@ ^T00PUPU' \$ST ^np 2@Q.^U@P@@ $ $ 0 00C 0p0 6jp@-,@P80P ;pA-@H`HPpFT00ԗ@"T01 PSt4, 00S@- /4, 5,C-麋XP(p,`0@( 0 XWaV V T0   5 ЍАYĐY R  U:0V @ 0@T0  jjM\R\@-@P 0  s@pjj0@-0@S~0d T0"S  @0<00R( T40 4,[,[,G-錑P0`SBp@Q 0Q02@1;1':X 4僴pB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $4 Q 0S T vf/ 0@1 00 00R"1[,up@-P@mP000p1O-0@Sp`P 0 PRQQT SL0UȰС0r 0 $R 0 0"60(Q $30, 1QX#  E vQ 0/0   R @R `0` ` R [ R# Ѝ 0W1Q:P 4,jjp@-P@P0Sr!U @ p(0"PE0U055403 0(2#p4,[,[,40@-0@SXDP0@Е4,A-AP0`SF!U @ p0䀟 SV Ѝ@4 U(05`P `4p00 0@0,6Pp0P ᏼH pQ `00 P兼0'p(0,0`4,[,[,cmk|1A-0`Sp@P0 PQQD R<0 5 2r 0 !Rv?000 RU  (0$0X3,000 1Q\RP 0 00  W1Q:P04,L@- @ 00S T $̲@Ѝ8@nO-X0MSM2"\0@S2"`0Sb2"d0S2x"h0S2\"|H -0ST呸8 80R\ , I0pQSPPTPM  @@⸼`P. @ \00`0d  00h X 뜱;S/ʐ!@0lP@_oۻRݍЍ RQ8 R 妷0:S 000a 1 00 0 0 0C0 ;0CS||ՁPp$kjq   R@Cp[,O-BM MpPT05@P 0` ;`( pPXX0 uPP@Bލ ЍQ  0 0\0 n`0 00!$0X4X00 $00 0v0; Sǹ P|喺P +RQ 0P \Q S0Rʨ0S R4 S / S S"0S000000 000000>P 0S  S, 0 R$ ? ! 0$ S 0"`0S 0$ edAplO-$6#Sp 0 */P` ;+[0/p0 d00\ `0h0|0 0X00 P$`P`l0 (04H=000 00 00p;k@-`X0Sg0 \0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP U &0U Ѝ$kj,0SWV $W dW W W Q 00000 0+0 Eߍ0000 0+000 00 0Sl0 0+0 Q0 @6,yz{cHE,G,cO-Pp 0MS 1Iߍ0L00 3/P @0 8 D00S4A 0ST0 0 0 0000P@T 4/@@10 x+` 0q+ 0` `A0 R .0 00T `0:/P `00S0V0S y+>V F 3 / &>0!C> f` (0 010@0`[.]@6,G,l9O-PM0@0` P8" ݬ `(b0   S00 0+p!0@0 0*!00p@嵬 k@^W宲+@x妬 0 `!ڵf㝬 @p0 8!е4哬(!(p 0ǵ`P0 R  P(Ѝ 0p!r0i `⧵ `OT0 0-p @ Y NT R ` @[HE,G,cla6,ll6,-]lkA-@0P\03/ p`W@@P@ᤲP80BW  \W[0 V  0  !   0 00$ 1 x    l   C`  0SJCT L0L LL&0<D@a6,kg _ o\T lymk s@-P,`@僳01Ѝp@6,p@-0(M0P,03/`90@ S:000 00 0 0 0 p` 0A0dL(Ѝp00j T O-@M4,P  PЍ TP 0   N.< H. p@W0H03/0PS`pH`pA0`0ұPP 0l S"n?\"2I0C 0 0 000 0A 0 0 0岨儥0S o'00 L0P 3/P X0P`Tp`\0p0 S8吱P 80 S ,1 0, S001z40P ≡0L0 3/00 P0mD C-@MPl,0`@`|0@P\  @0H03/1p0`PTY000 Hx0?,@00403/ 0\@!<1p ` 0R 0  003/P: #$#%> 0000 00 060 000嫦p`ް@wְ0S @, 0H03/p,U@<@0 0S001Ѝ%lT,G,$U S 0@-@80q  003/P4 04ЍP2 @-0GM0@00@3/PP$0SP $`p0 000 `p000S 00@03/PPPGߍ/A-@xM`D 4+0Pl00$pp0Ph!@P3 P p,'0d$0\ \+T „P 0X*0L08 3/> 0101 00 060 000pP & 0ⶢ-p0S 0h 0Q*08 @,04/P,qP 0t00 0S001xЍ%(c P%$U S O-@0lM0$3/0H03/2P0`PqTW0pZU ``A0pP 0(3/P^ L*"##$ 0H00 40R! H 3/0L8 03/pB 0L08 3/PP; 0 R8  #1/1L"P#0X 80T3/L0 083/p 0倰$0Y 0㙮.8 0!$p  P `(;/P PlЍlT,O-5P0MS J?0SZU 0S\5\%\\|`VM L%@T dV4u45 0,5@0$505d 0F00000@0@0qp`#w0ps,p0m` 㘤80$4@`z!0 `s 40 0,0000 000 嬧0$10B0\$10<\0d00h00`@ pl0*00S< p0e PÁx ,p3 000000 000 0 0<0pwp` g 3d,0CẤl0S= S@: SN@`$P H3/P 0p0072 |000L0p 3/P '0 00S 00CS@` 0ST 8@P$2Q ]Ѝ@P00SZ 3/@@OoBS k0&00f10@!R|!@!x|pPptРt0S|0X*@I@P TQ 0!@x 0T:x0S@ t@OoB@|0xT:@lT,Em mG,@6,4X \Z R[08kxT T [,T o lT 8,]m>O-UM< D X$S080L44@pᕬP ᐬ`P Uߍᅬ0P00 P,TᲭᰭ03, 040S 0R@ <0S6(1SJ 0J ,HLAP4#0A 4 <#H@; $إե 0@PSP @T "2B 00P 0S 3/P,00,02, 0SU@0%0cD0pt d2R墥| Y8P Z㘥,H! L@H@<#pPpT@儥P :, #@ #,0p40#p ppЪ @q #   , f #, 40,0[,0#P1: 1 !  |zJ @0 000000 0000 00㪢pp DzD0S#0 5Q7[T Y ͬˬɬ0Ǭw ٢f[,[,[jmT immO-p/0JM M`@ 0 pp4PP+ yP) v0S% r0l"`!`\ p/x20P T 0CT *0C/Q 00P'@m+ P:'?0  \P+0: S `V'>00ꨰ  جPJ>0@0/S%0@!ҭ+  S ᫭P+  P*P 0/S`0oo`bS "p"0&000 SV+t P*+ P*᦭Pt'@᤬p'@]៬Jލ Ѝme&I@-b@-M @ԭP(0  n@P c P zw "88S 00b"!4b4#$("(RSЍ O-M` PPp X`p㴠崰q#PЍ0S @ x P0  HpP2P Xp0   @傫mm]naG-|M `P`P PP<n+\@P@b 0 Ь@ #D:@P/+J(J.0㳬 +JJ.0T㤬TX 㝬PP~D4 ᔬPPu$+J0J.ᄬPPe +J} J?` mPPN+Jftpll40 0J>pP 0 .NP UT CލⶬP@Y+J7J⵬PPp0J.)@+# P h lJ>PR mmmmmmmnCn"n5nXBnSnRn%m%mmnTe n/00/00/00/00/0@-0@4M#|0$P 0 P\ P0T0760 P嬢 b@P K4Ѝ0G,\HE,X7,O-AAd2M(0!0PB(0 0000m 80sS0`p(00$00 0?00$0 s 0$W h5 0 \%X500H%`⟫0,0W45 #[ 5P00 0`000 00ԢW D`4D 0S_ @X%SYeP X:000` @@`r@0S 80< 03/P0p80<P OЍpv'80s @0D 0 0Q:8`0S}0L0` $3/P$ & [P Tp|Gork 0$ Wt @3P3 y0 D Q%0C?o2000;00H03/WH0L C  a& 0X` 0  1#`00;000Q!|  (P R`q02;0H0<2Lp0,!<1H0P``!P R0$ 00 00S !P V[0꒘ 40!P+ 40Sp x, Sp ,0 08q ^ Q  Q0 0 0 p0, 哒"000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`SppG,[oHE,e%lT,`&G-QxM|0`Sxpp0 00 P  "  ("$ 0@T0P S"TPu@&x"P@(@@,0STѠP@0(@"@"#Ǡ,"P@&(001 0!00( XTPP(!0P@0p00+0@080s 0=0 x ( oT 7XxЍPU PP@@P ~0!P@(Ჩ 0 h0pP@ 0 400t0S00XT媴00P0 PWP@0(l 勩@lM @8q 3/PG,oa(oco4o%o-o0@-)M@ᇠ0p \*3 +!@,P0 Sf*P _- 0 F  @.0 07Ѝ0!0P8q0 S+P ,P UkHE,0Co7,A-@  "(0M"( 0P`Q2X1200500@1081$ 001@`,01000 1800 P$p 0PUp 0S0p\'Pp,P(FA(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0꤃ 0  O-P`pp400W)ZYp !!'pPR p 0  0 @p0 "Q 0S  i008,04 $0T0 0X01@G$, R,R P Q  `P 8qT00PR840  R RP  P Z0000 ЍpO-p2M04p@$rP`cPP 0  S{n?2@|1 01x00 0A000 006@llgx0ST(ႥPPM p(P01ᙑ!Pw0P(0A x 0`R b ",0~x  Bw `! \! 0 008P0h lվ(0, 040x0?o21000Ѝ0~᡾ើllT, o O-p@ᤁ夑夡,M0 S0 0000 /00㣟0S,Ѝ/S  !/00`pPU0(`P p嘁!PP PP%0(` 1`    0`40T 0 ,0X08`℣0100+ :P 0 0 P*ᜥ`G,QvO-pP@\M4 `儰 0 SpU  0  Q $0S  0 0$ p4P(9\ЍO*.9U P0:0pQ ",^T ^ 08 #0`0000Y(0S`l ` 0 Rp`H03/0`0 [ 80s P\0!0000 SPU0$U00[P 0RP  0 p0 0 P  RP P 0$U$p0p[P0P0[}p P 0PQp0[x?[00S' !P0 !:p000 0RP9 0 1!ƒ \ 0 0 PpX0 0S(  0R 0 0 !0 SP0 0PU pСZ050Z0* Z%Q Qp 0S S0 0 0Q0000 00000000 \Ѝp0  ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R 0S 1 `R <$ tP` $ $mP 0 Q0``T R T  R X `( 0S0L0( 3/P <00S D0SS000(( v L0( 3/P 80<00S (0, S004 Q00 `( sT0\qAQq0[[m8qiP U ^[p8|Sʜ0 :0 F[p㜀  SS 8q 0PUp0pp R 0S  0 p 0    L,plT,G,&`O-`M,p@4 00PVY p͡pPT Pp0Z:`PU`J?ERUA x?x/xxsp00#h R 0  80s0`F`pHU p h0S 00  80spHY pPp h0l0 0L03/, 00Y:pPp嬢p0s0P80\>ЍO,p0H03/,0$$ (08RPP0$P(<00W]:< R3*,0pp0PP UP`p0$0$ PS(0(0$ 2"0$,0 0 Sn@DS g0S 0 `p8P0V`:40S00004000,0(X~ $0(0c1!0$8` 0@00D<00< R:pp8`Qp< p 00<<* `8q ,0,( 0L03/0 00 0`VV0$0$ S(0(0$ 2"0$,0P p0a  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0Pr0H03/p0@08P0D00[q*p 0 `<080sa00^ <0 0SX4p0 @0SD0  0 H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00  000 0W 08  1#'04 000P0 04 Q000 p0 C 0 1/@P0$A Q 0 > 1/P@P 0U:@1S<1@1 @0> C @7PU ,,\0#0<8 00'  0@'00 0 X &%, 嫖(姖00 , (0 0嚖 (喖00  (0'X0凖0H僖H0P00T00LP X0IX0 0008500 %  % %P,  (P 0 %<  5 000000 000 000㰓p 85P,0|XX& 0HSB(> $P A$ 00S H @3/Xv@DPH0L]!YZY03/ 0 0;P0L0 3/P 00S 0SPX003/PXr0PH03/ 0! P5/P%$%$)@0 Q.p@ ZG@-Q  01/ 0S 2"jX$Є  05PP  0 Hp0  @D@0 ᄐY70Y= oPPlѕh,0 SPP p@H0 0H008L0P 3/P `0 0`00@80P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000lT,G,[p408k Ȃ ؂ [, o &o,o 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PWV`4Ѝ R00S 0 //O-X`P@ < b"0800 c#  p 002c  0 S R( 0S% p q' R Q0 2DT 0 < k+800 b"p0p00S    $0!0R!/S01/8,!0 /8,$1p@-S@ x1SP $003/p@x1P$1 0SO-@0`PKMM0((0DpH0S >I @0 0<0o- %"{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,fppK܍Ѝ(2ᩑ(0S*< o !80a&@@ o'O-`0@PMMhh,00p 0S ( 0R> 9 H 00 0 <0.%"@~40kP`0V,p0U 0000000 0 0000000 00 p`ލЍ,ٍP,0S*< !,00C#X0S000C0C0000S0 0,0A$P8, o@-@-?0  !<$10(10,1P001.@-@+0 0! 0O-4M`@(0T`X\d0hpP 2"\ @ @,0;/,0P R7P ᡙPp2CF p W 2  0 " 00 0(0 0 0w`Iᨚ(04ЍO/P4ЍU5p@-@Q-  P 0 Pے40 PpՒ <0dp@P̒80 P<ƒ,0 P(00 p!o"#o%&p@-PBMV`@ᮒ   V ( @ t 4 \ P嗒 0oP厒 eBߍp`僒P00S}0|`x40Ph`r80PSV80  ,X0S(!✛@^ 0PV\0 `0S ↛@`Ed0Ph0S v@l0S l@tp0S@ b@PL`!t0P3oo567ҫ9p p:;@Z=>?@-PAMV`@  & V((  0D`qK0 @0S    8`V@ 0 Pܑ 0Aߍ(0S l @d,0S D @00S $ @l)o*@Z+ p-0@-AMP@0Q* 0  0 H 囑   .q0`N 0S (0S  !  ,`V HXAߍ8w    q0`N 0S (0S    ,`VP W $0/PN 0 PH0 PtB0 P<0 PH60 P40 0 cl9p60S O-@MU M0Pm 00x R# R0p]娥娅qt8`  0@0S D` P `  PC  D  ypW00(0S% $Bi00,0S$$B\0000S$$BO0+ 0 p0B/̙Pp᭠ C"U0S1 `F` J됣0p⇞ 0S W S`,pYV o$ <1`婎 _0`0"  Dߍ@喎 0  0S    `pV 偎 0  1 PS !r 0  0N 0S @0S"@_ ߍG6<0040!00⋗@0Fo$ 0DL03/00 Eppqr0S |!0qLD` 0S  p8`Y0a x 0QW 8 <0RFO  0 B 0@ /-@ 0  e R0Wh 0)  p qQ?rlcq9q+qw3qkl@-x @+0 @0p0d㰱 @G=q@-D @000(0,0000d㛱 @2ꐯFqp@-|A`0PsJMd!   01SB  8 ͇Jߍp@0P 0 0PP@Ҏ`(PVU@@ 0 (⥖0 0(0 00@0Ṏ(8P(8#n,P0`0PP`%o./@Z10p@-aPM,0$0Ps@!   0(✊$1 SP  P$1P$\PЍp 1 ,R,0S$0$`@VTPP 0 020 000 00P0F0<8P088X`@P`@o@<` @`@%o8, @Z   O-P`0` @ T t 0 T x 0 00 P0 PP< 0/S  !0? @@ 0/S  ލp1?o21QUx1N0p,!@<1(0@`1?o21P 1?o2 1 1S 1SoIOVTPP 0 Д0 00 00P06P6 1S 1Sp`JO 1S 1SP`KO 1S 1S0`N TlT,@ZO-,MbPp@UX  㔲K XZY 4 l ( p 0 @Pp40 @Pe@  ,ЍPp&1`SPe 1S !N Q !M@p@d  0PPp1`SPe 01S  1S0I1P/S <(t0(0 00uY0SvU `P  (g d0S `P $ 0 SX2vU Z xY $1 0V!7 H0  0X!pH1@!Q$̌1S  0Q p $ ܏'p ӏ00!15:% p ǏP p Q 0, ($!p p $ ⳏP] 00 8a4Q101S/Y,l,L,&m[r5nArr0S@0@-S@00 0S/l,0O-P̲EM 02@T PP0 2P  v|1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 )pPP2@0S- $P* 0 x0D 0SPU,dl,sY,l,VU,`@l,sA-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T  @T7 @pW4dpW1V 82# @ R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0U,dl,U,@l,Y,k,\0p@-T00P DPPp0AS@  1SA =,lT,L,0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""[,l0\ Q0/\P ^U Q0000@-[,0O-`GMM40X2@TL2V 00 0 0000000@@@@ ~0hMp@c<   G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  KP,0h 0 t0@W 47 `4|04 VH0 <0G, ,"BL,o 8,0@-PDM@T P08 @\ 0@  Dd  a0 0DЍ00S8,0@-@DMP/ P0, P\ 0P  0T   R X  80S0000000 0DЍ000S8,p@-@Q`P@M<Z@P   T0 0SP@Ѝp@茉0 @00 D0U@Ѝp8,17@-@SW( Ѝ0!|P4PP<<0P0<0P0<0P0<04PP<0 S, 0<0P<0 S@  0"{080#{0,0${000 %@-@PD <x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍpF.$ 2@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P 0 $坯<  <Uu $0$ZP 0|! "|Ѝ0lT,[@-80@SP`4Mc00 0*P 003/00$1U Ut  4ЍS0 000 0xp 7/( (0 M\`s[0p@-PQ0M0@$ 0x`0 6/8 ͉`Px1Ox1a1S0C€10Ѝpsp@-@P 0P  岉Pp0S@}p P 埉Pp0S 4! B! P  劉Pp0S huP R 0L v 4qPpp tt`)t7tLtO-uM Mp0 Z-H0cS_ C#0SSzB0S 㘆PBؒ0SzȲB0S z2 P     P x2@    PP2 HD     P00002x @@K @P@ PHPP< ,h@ ,D@,1 01P01P010R0 0K000 0`$}p@  P{ye} 0S10$1S10 0Suݍ ЍP`HPjPi1S |!R |㔧P %8,U,@l,Y,l,U,dl,Y,k,$l,k,l,k,Dl,ؼ lT,L,Z@-@F00S @PmY,ct@-@PЍp$QU 0 `P PP> C  01/P (00 H$L Q>lT,80S @-0 GT/Bm wtG-`@Pጐ匠X0r2%S80S00 00 S80S0|1 P S$1S00 0OJp@-8M`@8  T P $Q$00S U 0 |1 08Ѝp P ቭP P Q 8 ᤺ P u ᾭ <P 8,A-M|P8 hU`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `p;XM@0 803/PDG 0!!0#`' 0 3/P"#"#00 03/p 0` L03/⹬ %Dp` 0SXpHk 0!|1 01!FS0<0S P L3/0L00 3/P @0D t0Rv`p0L00 3/P @0D t0R 4 d00`RP  w00p 0Sw`@8,B wtO-pRMP`b @P D@4 VXPpߍP(  vpp0S m<08 (00,0 000040!04 04$0D0(0P hVphrp 0 P DX 8Y , Y  Y Y 0p *p - ' p 0p?pq8SֽPr 0  *0*0@0号 Y 0* *%2d@edA<2T2]2n2z222zd@2A-PCMMPp`;8 rp@P  P0<PYU00 ## CލЍ /O-uDuJuRuXu_uF 0@-M  Pڔ~ LP p@tP~PЍ0N0S 0 (fkus0@-M 0z 0@S|( &0PXwx0L @808  P 0  MЍ裛mt@-{0SЍ@-@M L{T0  CR$00SЍqA-pP@0ST 0S` @P$P7 #P.0%# D0S(0 D (g#\  ( *@00#@#000@6( d@uuu/svKvuvu-vnCvp@-@P # #0S S |}嬙00 00$00(00,00p@-`00MOQЍ S 00W@0u #0$P (0Vp  P0W D @0W  kW0S U0ąA-P@\^ 0  `04pX T fu0p04 4`X \^  R  0  `04pX ^S@-`lM8PpV0 00! ! 0 ( $PV$8 80R:V u@#RD$ͱz{@PV008P|0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0uvA-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* {PW000 0 0004P 08000 <0S $0R 0$ A 8< Q\00L, \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ p{v@-@ 0S PO-VMM00$ 5%LI50S5%P$ 0}PP VލЍ5 $08|%H|PHnz@P THuz0(,0@D00<0P P izPL 0 ` p`04LvJP 000  0S`PD00000<000<00a@08`0S XU 0 L   _|0U0Q0SpPX X `0S `4 `0 @|` :|0P40 `P000W@0<00D0t`P0(000,040S <`Pk`yPP H{(0S,00){J` Dv00pp<00008``#804S``V zP0pp`0 0S 00PP 0 P0 0C5$0 0!(00,00@0. 0D0`$0500D0;qp0PUP PPTP|P 0X`dxPPT`-zK{0S 4 R 000 0#0P 0S د뼀8 0<$ 0S P 0$ 08000S`P |P`\0S0P 040 Q\8<0 Q\   P`#wtU,.w7w8,Iws\l\t\|d@-鉝 0P 0PU,Y,-0,M$00 0 00 00 00 00 0 00000000 {,ЍL_7@-@ P000 00 000 0 0 0P S  Ѝ0C-@pM P` 0 00 00 0 000sS̀@ żP0㓔$ Ap0lS|p@ ⱼP0㓄$ -p Ѝ@T r@TpTG-pP8M(@ 0S   wP8Ѝ70 060050040030020 0100000.00 ,0A P #00R R 0S T `PP0c# BXP}_Tp@-PP@M `8@ @ `  5/V@@ЍpTO-M@ 8` SFf* "R] R^ Bq/rP X" x:w@-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p8,xl,08S^/x|,p, p@-@ 0(  P0R0PS 00Si ppC-@NMMPp< ЀeX@ @@0 p pr@;@ ϨPPD 9spqq NލЍtydG-xM` @pᜠ堐$P@J!0@P 0S PU 0 R<\1\!\\k>00S 00" !PP0 0S0L0H 3/P HL 0RPPT $0RP 00  x@ 04/@xЍZ Z Yd   ZY < )r @ #rA-P2uSvw_10000“b\œ@FҁL@$H @A- P@ \T@@ 8ž\ @T83g `Č `Ȍ `̌b` ` p PČpȌ`" " 0`q`1~``Pa n00`T08BJP08}?0@ T\ Qp`82S @4008 lŽ~?`?̌p0hx0R @Q2T0S X 22040TP 2SXFxO-P`\M(@p4000PS}2 0\  \^T 0SQQX W@\Ѝkfb(0,F 06!!S 0(0,0 P PQTU Q8b0 RW(4 0 P Z P\ T 0ZbV0V0Z 21 SR 00(040,`80Q!`00 $0rq? 00((2@ 2S01  $ 0iPMW30M@2S P  SR q? r?Ⰰsό(0 8 0 R    X 0P@TP@@ 0S$2$"$i02#38( R,00W? ve< 00 (0$0尰S4 ( 00q?0" 2o0,@4@@P# 80  02 S02@0S qSP ,m@\D0S 1H R0!0Sq?r0 8 S  o0t (, ^\  Rx0 :"0o~ς,ఀpȌ Q 0C0Ʊ#80±W,0xxBTIwlwO-`M40P@p0V00PT8T(TTE:dPV@8:ЍP  0} "UࠓࠃR^PR\ "ς~Ⱀ, 4  0S 0Z000[ 00S 0PSVX7 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@2r/40q?0840800s (8  R    T R,08 S000f0D0jPD07V50Qo_P0"Pyh0S SP kh* 8 @VU 0 o?0 R S+ RQ  0^/ o_S㴒!P% 0 8X ,0 S0000IY0X0\04024 0P*h0S PS khۇB I 0)1! R0 2<0C00$@" ^(P0T0^X0\0Ph0S SP wkh姇0T2S2Z 001jPR"? 01@22]UV 0w?20"S0 L    0 HL H0P LY0H0PSB 0D  $1!R0 P TP XT\ 0 S 0SX0\04"o0P|h0S A<SP jh,<PR#3P8H0 01iH2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0{, R0 V00/yw2yL,UIO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8"V0 P20 4  0 P $P "#"#0 0D00 {P 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0\,O-bMM00 Q@ 00".;ȡ`PPbލЍ -lp H6 P 00@ (r, W 2S 1S<2<"<<v70w   &      0S!?⧻t  0 W d T 9  ePTRU[jL&HRQ 0C? 1Z!*??  @ 0,0Y!)?? 0;gpP  e?XT D , M eii?X T Pd@BwUs@-RU0 6@\`d0T `Š"; P0H0`04 oЍpyy wys@-@P04P00 6o0S  `VRUp i0P 003/8_oiViЍp@htk w@-@0MP M 003/00; ⚠pP pg`P  Hih}iۍ ЍO-p0\M0SQ `sa8Q P0Rj P0bb 0@>S@ P0Aj P0|bQ 0@SP0 0HL R   ? & ?#/Z[\ P `@10d ἐ 09/0P@\Ѝ@ZlT,G-` p0@PHLR0418S ^ @Z R  0\ X0?Pࠡ࠱000^ 0 G/lT,>0@-@0M 410810!`0 P0 0P0P`0 I0PU ! 5/ᲸЍ0lT,`@- I,j@ h@-x@ 0  zj$h[H{(%@-@@0sh,00p ie0Co%,-$M ?0 0 i$Ѝ0-4M 00 000-P4ЍO-pOMfV@70@0pp@-P 4`fp@  eP&f@p@-M@ fgp$ ЍG-`p@T/  PP* P- @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0p AI @-3M M 'p 3ݍ Ѝ&p@-P@@gpPppA-@Pp p` j '0W0 t0WpX U`0\0P P  0h0@ wfЍU0 0  vvO[@-`0tM0F?oP2p@ pf zfp`ef@tЍep p2S_fp D0V4 - fp"ep0p@- @  p0 S " 0PUPUp@wd0 S  0 0S ldjd0S   0 0S ^d\d|@-@0   d@0@-PM 0@     dp||OЍ00 S   000 00P0 PS0 S p2%|C-p@PM$MU `0S@PE8  |0Ps00ۍЍXh700S @ Q@BPE@C0 00p L0S H0#S u@UX |/AS@-M@ 4 Gd0S\ۍ p@-@$`P_aPp0 @ `P0 002 0pj0p@-pMP` 06dp@& $dp!  dp dp  dp  0P <  p(}pЍpyt d꬝|  p@->@P`ypp0D m  ,0lp 0 ` p\Pp@-P"R q@ ^ c01p@@@dq N c02p@px0@-tM0 p@  cpPc@tЍ0G-QM`700ۍ   Y  @`V Cc@pP`A-`R>00Pp@0STa@PT  Q*R@00 S   0 0S0 S *aP `bb l``0000`0 @ 0@ 耛@-@ @E |@-p0M0@M0$ ,p Ѝ X |_p@-P@ `N 08 l, ?U\( 0 0 008 , @1pp@ ꉔp@-`D1P:D11S0p0@Tp 0S  00:00T1p@-S@\1S#l1S.RU9tRUpxbV:tatbp1CaT10CT1T1XSa0X11Ca\10C\1\1`Sa0`11Cal10Cl1l1pSa0p12,P0C2bVabx2,P0Cx27@-@0 PP! P1 0L1D8@ @@   (   )    ,  Ѝ0@ Ѝ0@-b@ bP p 00d @H 1S70qa%_P 010@ }<0@1/@-@`'L0S 5 P 080H0S S@ 'ꪔe@-x!@RM Q|0 x.& Ѝx1S겔0@-80@@[@ P@-@ aP p 004" @ Q 0 @$ }-MM+ 0apd06S , ۍЍ;04@ '}(%ap@- B@bap  Pap@ P 11P p1@ R  &lQPEUQ T`00CS`0 Xc0( p@X0 X 8}%x%@-@T 0S h@G-`P`.H0$ :0 0 0100 & 00 0sD00,PQ 0a(!"4a# : 0 >Q & Pp $W  gk080P040Ѝ 0b"!4b4#0 0S %/%p0p@-8P`J04  :0 PH0 P@p@P@  @Tp@p@-@QDA$:01`%p4*0 ,HPTJ4*0 `VT0: I0 ppps@-@4 @1`  l!1P DQR0$ L Ѝp@%P P 1 p Ѝp@ PU%P P0pPЍp@ 0 F@1)#90 -1S a b 040_p\ @1 9@144&`041 Ѝpؔ|(%)p@-@d @11P`PUp@0 0S%P4@1p@u}@-p0@SPLM 0$M0@(pY 00 p0 +`P  LЍUtP @ t L U`  P10L1?}%C-@pPP`` R  0 "j0 0 VU   ЍCG< Ѝ=f0P!LA-`@x0 P ЍA , 00  ` 0  01PU 0! 0SHP ЍA:ET 0S 80 ⓡP P ЍmA- M@`i P-H`p$a PD 0Sr PPUn 0 P8`V,P b HEt ЍA$dU `$T;080SI $0P   > p0S Z U6 A ЍA U. 0S V ' L0S p`MP  ,p R P 0S Hr; 0S )8b$ ЍA& Ѝ輕וf}e 0@-@ 0PHH0S$ `@l H0p@-S@P` 08PU $00P   @1 08006? $0080S  p, Av p p@}@-@P@O-pP`@టT(  2P 0S!W 0 8Ќ# ~ 0@ X(00U0X0S @#HX   a0@-@aMa0@Dq 8PP_ p0 P  4 ]phhlЍP& P P' P, 4iP5 P!3!,P@1 0 P P` [L!d10B0P1]t tLHkp\ &Pʦ}%}L<E\dnv @-@4p]p X00D1 ЍP 0\~A-` 0S0 00@p-WAPP8 0S,p`p`\P~C-q`@  @P00 Ѝ 0S  k(0 S   0` 05 pPd` @P 0`0P@d\ ~ PP 0S 8$0$0> > >0S **(V  0S T`0 S   0001  @  0S L BP0 S   0%~'=0C-MM000@!0]p00#Pā+ \P`pQv`07S \0 S W T0 0d!h1 `P1 ލЍ Pp P # R؀ؐPU [  0 S   0  pP 0 P1p  P  0S 0 P<~Q`@-@+p07S@e0 S 0VS@P~A-`R@p@M PP U 700 @ЍArP"R 0S 0 Fr>XU$  *;P 0S <0 *7 p \- <0- <$V>P  *@ЍA@Ѝb~O-@PMpP  P 08A ЍO0P `4001x@Tx Z[P1L@T@11@1Ѝ$n@P000 @@T X@P`@`   60 00V`t`J@ZL3T#`P3``s^p$#$3d @11@1kQ NQ@ 6Q`4Q`UQpQ xQ nQ 0S0 0 @| 0 P  0  X S ] p 0 0S@h0 0 X S  F p@11@1v 0 P  0 `` 00b : 0( @10S 0@66P 0S 08  * 0000ST 00S \0P 0S 0000S(00 00C00)!+1A\%QZo@->@T( "44p P`0"@"44 0W `BL L0 b"!4b4# 0@> *>@D Ѝ耼p@-x1PSMD`8"%@P/ T0x18 " V@5t1;0%00`0 p 0%S P  F@dY@ 0S T`sWPHl|A|ЍpxA>0S$ V01@T t1S L j@>0S@ ?`t1S  Y0 @ P 0  @  B.(0h%p(4#t1S FZt9~Ԡ 0 R/ 1/а,p@-@`TP\@@^0S\*\P0 0SZ0 5Pk9 <R0p\@-`pMP@Z (0p``FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$qL1L!L&W@14!<41Z`P(@ 1!0S0S0\,0 0 @T0@T"V@P0\400 (P p`P,00@,@0S  0 S0 0@@=~Kyʚ;/G-@PЂL1L!LL%p0`81(!4qP000S5 \L0Q  HFPPL0H0L0 \ 0 S   00S000@0P `pP0P0 UPV `pX=~IKJ@- Ѝ@- 0 ЍP@-0 J%q@0000Q 0S%0@0 R    R 0700@R @ 0@00=~K@-@^00 Ѝ ^   ʚ;@-0 Ѝ@-@P`p,p0 000"# ЍMb@Bp@-P(`0 $PUPUR PU PTP,PP@4P`P4\pQ@ =#KP@-0 $0TP0/=(7K0P0/P@-$0$ $$$@008< D0=3JKA-(MP` +1U0@0$00 $0p@000 0<0S _Wp(Ѝ8010C>SQ@( ( 03(00@000 0<0S80 0p @=GnKp@-XU@P wXpPV@p0P@ P00(P,000P400T0p@-@Pp0080<0P  P(P0PUHVHPLPp0 S   0|V0 S   0sV0 S ,  0jV0 S 4  0`V@-@@YVC-@PM `rP0SY 00C01@0S D3/H2H"HH#(PU0ST2g0S R,0 S ,  003/40`0P4P!0  P0HS 0 @Rp0z0S v`ЍH 00S0`   R 0q   QR("( `  PP U 0S 0 SIr 0S Yo P0S 3/0s0S 0S 3/а,=YK@-4 0i$@ &p t@Ѝ(%@-`AM4 MsPp W0  Wp@ U@Aލ Ѝ4F P ڣ# "P  RP# 0 ,$@4   V%(%-@-   Ѝ Ѝ/@-MMP`@p0  VV 0pۍЍ-@-   Ѝ Ѝ/-@-  ЍЍ/-@-   ЍЍ/-@-  ЍЍ/-@-  i ЍЍ/-@-  ЍЍ/-@-  S ЍЍ/-@-  ЍЍ/-@-  = ЍЍ/0/%0/%p@-AMp OUp@ PA>0 dSV ,0@0Aލp P 0 4Sd%90/%0@=V%p@-@PPuQ; @s q +VT V00pp%(% V@-@P:9@@rT@-@p Up U1S"@`TV@-@M    0 oVp1$0Ѝip@-PM@` f  0 TVVp 1@ R! 0 p`Ѝpii$0 /H0s P/0 #  //A->PXMUxV0P0XЍUo700p@ `R0 PU B0>000 <0  ,> "PP> *ǡ@-@T>@@-@T^?@0Q/ R0 /RG-`P M0(0S @ P P P:`P 0!00 0   08S0 00 Ѝ080 00S # `pP `Pc0P 0iS.S  `PS4P 040:S%O-[M `F/@P0_9`0PpP G Pp>$Sp[ߍ0S00 0Y 0S 0Sa0PP0 $ P PU0SB0$P 0PSP0SPP@\1S<@d1Sh1 $^P=d1 S S RP@T1SX1 $LP-T1@COoSB@$TPe!P"d $ d0s0$EPD1P `1 $%P@\1SPö@@00STATl p1$ 0P0; @T$ P p$`0P0DQ@PE  ` $ 0[$0E  P h0 S <9`001P d0yTp `0 D000S0 35S S  CR0UX LPS y R 02 > 0*@1 U48#88 S R p ,S 0 S U  R P 0?D0 p 0L0D0}>D0 Pc 000H0@@@eipJ0@-@PDM QP@T H00!p@DЍ0U  UP @0SA-p`P@MT@Ѝ 0S P 0S0Q   <@P @-000Q/P1P/$0/0@-@PM   UP 0 0pЍ00 |Si~i@- ` R@0$Mp0 PR  RU U 1 # 0PP  R@T!@T00$Ѝ R @S@-@p !p !p`/R-88 Q  8A Ō8   "  0Q5ã0ã0A-`Pm@P─@Ѝ P\PPP0 qP lpP F tO-P@d0p"S0W"SpGP Y 0@s` P700 ЍY\ T00W YT X0#0%: T X3#: 0\Sf0`xSmS0SD bS S\ Tn C RlllllllT0 PT 0 0T 0T 00 0    00 `` 0S& T  y90P`0 NRU`0S  c9T0 P0T0` %P /0 S S /S/P0/S 0 S S/0/@-`RpP$M 0SU/ @P 0 00 0  㻾0S h$ЍU I7P~P, T/00DU T7|O-p kPPx ЍO=`P TT ЍOzO@@8 Y3qOkPP  ⠙P9 0QA0 Ѝ ^O@ `@p tN0P! 0 @ !0p00@[   P 0S ak@PC{A-@P,p "O` 0e SP,pO$` PP(0e S$O0(0$0PPO-4M10C`p@XP~S񟗕 $$$$$$$$$$$$$D`x@Xp,,D$,,,$$$$$$$$ ,,@Xp,D, x<,$D     ,X  $$$ 4 @  @ | X  Lh <pp( |Ld  $L d|$  `HUV pP`p $PL P➘P L6P L&$ !xP`0@T\0S\ @U00 @ YpP00p:៸Pn  ,00P,Xc QPH0P50UV H0 XAPL?0P N 0g@PPA t01PKP 0 Sp 0S PM0P1H0P 00U  ALP{UH0P70s 0B'pPgP! .R P^0R77P0WU  0pP IHRPEU H0H1S}iHP5H0P00/U 0P0HP0$ ,0 00 0 O,0SV  PU ,0!00 0 l,0 S@  PU D168`vd0b匒000 0 PPP00 0 P  p@0  @P  RPU] D18`vd0b匒0p00 0 PP00 0 vP  0@H0P:0H &P P0P<0UH$ 0S! /G`P /B`P00 V /0P0 Q0P0<0i000H0P60_U ,0 00 0 O,0HS  PHh7 0 apP 9Px 73P@H08SP7SP-U ,`P 0S$ PUA 0 9pPH0P580  x050,08$ 00 0 ^,00,PY `sP`$8$PhXʶ7008 A $;84@AK0:9PP88 0A  ;{p PPH0U4 0 P 4P 4P*0 06S 06S0P90U1 ,0 00 0 ON,0HS PU H0 XUPXzH0P;00sH0P90mU ` PPe`, pP sI`PPT0%EM AKPGH0Q7;0UtQP< -P0Pt14 %PPtQ- lP0Pt1% Pa xJ0PPx1P|H0P00 U10HP2P0HP2P 0HP2P xPHP \gPH0P00H0P200hU3  00pP>0S;7P0H0P20H0P60H0P;0H0P80U6 D18b`dr00 0 [P000 0 QP0P0P@ 0 @U D18b`dr000 0 2P00 0 (PP00 0 P p@U =PPB PH0 SP P00P<00* P  l P PV  4P   ۽P   սP  ϽPkP|P n p($vpd 00%KN/$C_r9's&i&=Famzä̤֤ۤ-Ir>B8PY-_rEͮخ\}@̦Ʈ?ɥ 'a#; , p 00pP $ ( H,8  5 P  4Pc |0P  $p$ ~pP (( ( H$8   P   P<  PH  ,P,0-00 0/ K,0S` |P P$/г`P萄 $PPV00 ,0 00 0 K,0S  wP  P ($pP/៳P0HD H(0qP| D6$ H! (0D&P0 ($QP/ဳP0H< @(0RP] <6$ @! (0<&P0U> H0 `W+P`H0P20H0P 000PH0P00H0P00H0P 00{H0P 00u(07600P2  *P5P50S00T01=5 =5YPHPUU D10@0P@d6`&P 0SoP:U HTHdPTqP,U @1 800PP(0 00 0 J(0`S,6`( "4`#, ,CH0P800 P P0 0P0 0P0 0qPH0P10H0P10H0P00H0P50H0P50H0P00H,';P,UPH0P90AK&O\0U`0@ Z7 `P<(PAK⚿OAK'OAK⡿OxP  ,00AJ,0 S PzPP Pq=+P;IP PPp`L PWX)IP`PPph IP PPpj P6IP PPpf P$HP PPplD PTHP` hHPi |HPlHP!`Y < 0a0   : Vl?o2=y OW `PHPc ,HP <HP` PHP` dHP` xHP ` HP@` HPh {HPd uHPe oHPe l hHPe bHPl \HPg 0VHPg DPHPl~ XJHPlx lDHPfr  PgW ZP0&, PP$ FPRPP00HPpb bpP  R3  R0 0,PSP00,0P%00 0$0(00XH`  p B@ V dZ`0PP ʎJZ \0PP?Z Z P4ЍU i`P00,0 00 0` H,pYd`PP$ 0  p` 0S:YPCPu  0PH |]0P: FP`&|6xvaPPUB h1PH6P06H0P"800H0P80H0P7 00H0P70U 6P0Pp2p2SJTPxH0P00rH0P70lU `P 00`RP@ KP FPPSPSpVPp 8P |3P~qPpP8H0P402H0P30,H, 4P,%H0P20U  0pHP9PH0P00H0P00PV 0U0F; h}  ~PU \0@T$(@?,mPUwq L:ϥO-pУ`P@80 P 0忽P0| `gVD1\ ЍOBR$ RZ< 80,040 ЍO Ѝt_$A-pCPPH,3&7,00000 06T06⾶D1@!0`00 0:0030؆O-`S0$M; @ 0QpP  80:0D10  0H 0Hp00   |    P0 U  * 00$Ѝ\%no,A-PQH1`Sp51Sp:1pS> PxD@vDTtD`fd6S?`nDhfl6S@hhDpft6SApbD|f6SB|\Df6SCVDXTDAQDPD1pPIDGD1pP@DX  P T0 STd6,`0Cd6l6,`0Cl6t6,`0Ct6D6`0C66,`0C6O-MDM` 0P@ E 00% Ep D +8 0 X 0 00 +0,[0 P#Z1HD1E,BP0`d6$(@BP4:؍DЍ@0t,0@04CDP0/@,`6hv2d62`dl6t SL@,hCpvt6t SFpC0&h6l6p6t6t"&x"6688@ p448!0r@0P 000S <0080000 00-0*0@00S 0 S S0P\S @/@,@@000SS 83@ P4400  C 8?o@20@0<@8@,0@p0%0P I000S)0' 9 嵻PQ0PL Z7 ᬻpPp@@04CP00 0#R00Sr uw0 0=$0忹 $0@00S 0 S S0P\S  @ :0@  l p@Pd0pAlq _Pplq @ D^P 0S 0P  QP 0S 0P GpP@z@0 0#R00S 7P W<0080000 0  0W|0S 0$: 0000{,@sЧ0Q//Q :///G-p0@0P `P Y 0 0 `R:SC3@"X HGoU( HGA-TpW0 T`@V0 H0HS @sP X X| |00 S DD0P 0RS  3ap@-P ᡴ@PpῴA@-@P 4p蠫g3P@-,0, ,,Q 0 T\o3'p@-@P,0, ,,PP p'x3P@-(0( ((mT0S@i \3A-PQP0 XiU0x ` n@T gVp 0S 90S~@꠫33#5p@-@Pp PJPpT0 p@1@-0@T 0@0T0S@-0  83A-PQD2D"DD T0@ pR008@10 2T T'2@Pp t0 t0 x x0R`5PP P PT T0R88wP `(|0 |0T T0RfPt05 t02 88[`Px x0R p,0S #px0S pm0S l PV ἲ(P`P[3RKgvA-`P Pe_z@T sT0pSᏲ@p@-Q M0 = T0S0| PUx0d tPe_`z@P i0 < )A  Ѝp\38O-Pp@4M SP M -@1 0A@1'P  4Ѝ B @ᔣ唳T}   T0 RD1 0800/ P T8p X0SS 90SSPT0e`P| 7 |0T T0R   P  @88UPY0Sx x0Rױ ұ1T r00  XX4P  ưP T T0R88#P gPpK0VS teo x@XXTP8q m@PS ⋱T +P X0SS,90SS(oxPT00S@!D18,*:SR  m p 0S 0S @괆4Ćɫݫ͆P@-;000 0 0S ڹ/00P@-Q000 0 0S Ź/00P@-}H0H H 0S So誹/000P@-D0D D PPp莹/000P@-H0H H PP,0@os/00!p@-@Q0 x RP0 0`S0@ SQ0` k?p@p0 p@Y0 p@c0m(np@-@P0 @ QP0 0S 0S 0P 0R !P BR #p@莀LP HP p@p0;<p@-PP M0  0S@T 0d($"4d4#@c@Ood@T $S ڸ0@0 ЍpӸ/0h`Q 0000P 0 B,H'A-0S(0@0`TPPQp_ T0 0t' d Qp!/IPU00PP L0L L 넸/00 t 0bR 0c30,`NP@-808 88~ Q,0 (!>000\zp@-@PQp>hG-`PM@ P ` ep, 0 3e ````Be1pW`0쀟pW% -e& 0 0 =@ dT  @PЍ00C>S`"P!@03@000C>S`"P!@03@0~~~~-3@- P Pp @ p@Ѝ0@ Ѝ/A-@RP0p`@0S p菬A-0Pp`@S:0SS 0  RT R0 `V1S* bP a 0@DpR: Q جO-A 0MTP` 0 {~C@PA@@S 0@1 0S  vp 00~PĀ xP sP nP iP dP _P |ZpPp 0S ` Bp P61@ R <8p 0@1#?I00 & &)p H0S% S% p D p L p $  p   pw L0S p0$0M0p L pe t0S@ @111201Z9=p M P= z p@ dԳPG0 `dX$kRP|$| p+ W=d p.#p_@t p 0S P Q ᶭZ T  =p  #=p凳P_ 傳PZ }PU xPP sP nPI X00S 2"Q`` Np  Hp %P 0%P0 1`40  3p X00S1XppW@0h1SP,rSᎦQp@Qa a! pT%P `V%R pr0S   pg !tp`p0S   D pS 08! pJpPD 1 R 0S  P6 Ѝ 0Sp pneו(0h=IBDZgs 9lĭϭ߭np@-P@pp p@.RRA-P`@@pH0s  S  U@ p@@@dW0S  R H R U@ p@蠔e(Q/p@-P0U@ST` 200p %P@s@T:pA-P`1pSBT  p@|Ѝ dPЍA!R @00  @`@p@ @bpV 0 !p@y`P  pɴ0S pxh000#40  @LgD SP @: 0$ɇ ڇ@N5 @- @0P PT00Q  ᤱDPp@- 0S @0\`0S4 SP U \ @ U00p.S0.SH0_S-S,  00  ?R4"0T0 00p%P `00CS`0p S00 P0S X0X /X;x%p@-h1@SPUPPE @p B 0.SSPP XP HP 4P 0  .ϢPP3T?p@-@P'U^ 0 pS:0 `N:0 PI:0  @D:04,,)$&#  @       :0  :0  :0 :0 x9p@ P NPꚮȥ,_EŮ̮׮>[=B 0(ƒ -\ tx Q^ ,\ ,@-QMM@pPZp000 Q9QލЍA. !. d0h D9p`0SPE@Ep 0S:0@0D+,%+O-4M\XP $0. S`( (x@P74Ѝ0S  P@  0P@,p,$0,PGY P,p0[1a7Ӳ00 P,p, R P 0 0 9, R, R0S ` R '47릲0 忯P 0 0 p}9,0S0S ,P! "`B,AQ !!!~F :A P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-`P@MpVV:U 0U00E0S00T@D@@%V00ЍPW"0$?S 0[ `W R``V?R0U  P70 0 Y.0 IP0 0IV:D X0 0 @UR  ES`O-@`0p 1! Y*QP T W700 Ѝ%P@pG`  00T W 00  (P     \Eo   ' U/U$y\U0 T WPPT W\%0P00PPpG@`T W PpG`%C-RM MPLp`Hp= @?p5 B8p V=p c> x18pT=    0 LIp P1 Ip I/   tRލ Ѝ     0@I  @pP0P@T*p0S4 p`@T*T 0 7p @ xp   0#$$("( 7pw @  0\#$$(B(   0,!c#!$c$" 7pW @@   0b"!4b$#  ԫI    .0I/P4 I/j7p. 0S @00SP%8[7pG009 Nc@ZFA- @pTPM 9ЍR` R (00L0S 0 -0 0p0#0M0 B$ 0V 0  0,6E_O-4MX@`\00 0S`pdP (0S:0 `pp20"4ЍO 0  ,   p0,0 ,0SCTv ,L&p 0"00m,H44ЍP U0 000!0  ¬ 0,`Pp000`!t8 p PE, 0 S(0SU $0$00 (000 $ 0S *vP @TPP@*@P@z`w/0p@-` (Mn00>0@SP  '0x Bnp0  0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 *TT0S (Ѝp0 8P 0T0S 0PT/VA-`儂VPPFPP2X@p`E1P 刂"20 VV0  2PRp@- P`I4p@ F? 4P3@p@-`@MpP! v (r (X( 8pb4PU@ T700@  Ѝi///@-M @ /PЍ00 3"p 000)003pxx000@ 0T03p@D 0 0" 03pO~.<p@-Q@p 2101p@1p@->`FMV A0P0Fߍp@PF/ 9  06T01 0 `厨 0CP 0*>   9 ii@-@MP4@ $'P P@ЍꐑQ@-<0< << 0SSL`///Y$0 /Hp/@-M @  p000p0@0M00@-P@,M(  |  ʤ Pm3p 0 00S p,Ѝ08i(p@-@MP X ` S ⡤  (PC3PЍp:iC-PQSM M 3 #  T0S2"`V2"@p@"&0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0 L00$L0T@٫120@ 2ყT@@D@@0@L0 X:   @L0  hXH@L0   @L0  XP PUPPEPP@ D$("(0p`Sލ Ѝ  4XH@\8 C-0@`p"M 0 @@ 0@$@p@Ѝ P@ -PP @@  0 @p @@00 ( P| Pl  (ߦ0X 0@ T*00Yg00/ @T@@-`@DM pP@    X!> U 134  4R2$ @0 kDЍ0Ui@i(0@-@QM P ߪPp 2 0"2i1Ѝ0@-]MMPl#+0p@ P@P -R 00@]ލЍ0S0S Sz SS wR@T Hrp@V@T@S  CRPS @@ @p`P -$0 Bp 80Sr S~ S00,0S  R000@0S  R00@ H ` 0[ H⩢!>50H \0H1pY0S 01S XX20S0 0 000 0 0p*wPq>S Se  W@gPa`@PU b [NPK 0H H"O@1Tw?0SG HⰥM P N0\<00S6i@ʑi@-40 000 0⟓Ѝԑ2S/2S00/@-@@V002@-S0@0 @@V0002S ~q/ܑA-@MP`p @@ᡩ@@-@P= P/p  0p X0S p /Y.@! ͡ p0p x i0p 6/PL ^0p +P Ѝ@qB@lBpBfB@G-@p`0M00PU  .0S1P    P崡 00S V 1!o0P00 0ҤP0 PPP0PU:000000x Ѝ@-  / ЍgBp@-0M2S`P@x (⣤VP@0 \(/&00ލp@ B@-P`2$MS0@p0  0*00f0%TPЍ 0p`-$Ѝ@-@. w-@t-@-@pp /p`~B 0`( "4`#/p@-^@P T00p``0@D^"000œ\p@Tp0,R00@- \!Q0 # R0 @0QRO-M@@0{0@0Ѝ`1Q oV00Pp0 , Q :@QpSI B\> \ lP lP U  Z4\[X\T p Q*S0C0 +P 0 r0 儣 0 @S2T0@cSc@-@ 000}P 0S00Ѝ@-@ 000jP 0S OЍ@-@ 000UP 0S : Ѝ@-@\0S \0\0@-@`q0 t`,0`0@-@08T@N0p@-80@P$ >Q! &T01 RpR 0S TT0Q  >0S ( p@,080yTӰA-p`KP*P@00<000S@ (0? ¢@0K0cSc0O-GMⴀĐ@p[p0 00KC*P`PS d0S  GRW ( Q  R `)Qh 0 0000200> 0BS0* uWW 00 RS00T+ $0K0`C8`0$0P DQW Wd\ h P FZ <($/ < 8 FQ @ p$Q DQW R <0S @FT60 0 < @W 0FS80 0 |@WWW 00S 0 84S 0 FS+008$A 8840@W]0  0FS20 0 @8 RN  FR3   Ρ 0FS70 @00 0", Q2`6,0d&Rj I0SZp0 ?0S< , FP081#<111% 1+ WZ W(,  PW:@QT; 0,S P T(, "   PW: ART ,000D0C00s W00FS90 00 C8#<2@73S Y 0 FSM007# 730@(1S 0 F0S=00(  (100@ 0S W02S 0 FS<0 0" 20@W00@1 0 Z00 FR P0@ [2Sa P 0 FSQ0[0 02 0000[00  W 0  ^0 0FSst0p0p95SG 0 FSg^009%  9E@@6S _pp0FSS|00xK †|6S @000DKP8:Gߍ0P0 "9 Q0F R-0   ] @  0FR000S0 n)   B0 000p00, cSc2579";A-PR1!@ `P0 p@ R1 0R00 0N 30 0 0P0 0:0 00P00;0 00P0060 00P00ЍP 0000t |0 00gp0 00[p0 000Tb0@-`0i0 MSPp$M 1 !p I)p@-0S i `*i@ 0 P` @QQ050 00pPE&P4 a ۍ$Ѝ蚱x%$DZp@-`\@T  PP\0S \0\08  p88 t0 |pv%߱0@- 00806PP@ `V@ @T %@P  00ЍpO-IM PpẠPHLL `PR %@P0*IߍO(0,0(600 0|400` 0 ap00,0 PS2 V30a2@0 0 ,0T<`0 P <D@PIߍ@<0 Px iVT` 0X`0T<0 4`Vy<PΒ@O-@pP`Q`,R尰,P2,ES#P㔀U`,@ ,w)Pp), Q 0S, c) `,P0ؒ!)RO-բ00"`p@PT:p ЍT  X ⢱00U *"0 pp0R0    @;0 )p  ;  )p@d@-RM M000 @`TPC Tp@ s00 0'p"  up ۍ Ѝ Dĝ; f)p UPU  p9@-0(P  Q S0  00 0PЍ 0S ∝0#O-04MS@ h@@ p0P 0_0? 0o0  00 0z`P3; 0T0 @ 0P0 00 0g`P 0 $ ( XkpP  ,B$e(b,8_P`@ 00 y0>`P 3 0 0S0@0M Y000⣱  Q*"00/P 0$00S0(0 $0 i `( ,,0$ `S  S S0t0(0s $(,8rP@0S 0h0 0h0  0304Ѝ 00 !0`PS @ NYM $⩜ ,ड़,0`S P@,0$S  S StQ0P !R "R h@p( $(,8P@1[5O-P0M@040`0`p 0 ##p#X; X8l0S,0S,0匒0嚘 2S,08`0嚘 8d6S,0t0嚘 x"R㌂0,80,0H00`2 S,0d6S 9 0`pߍ0 0 0$p $  0p 0 0 0(p $09 0p $9 0zp$(9 0hmp#0z0,@04l0| (40[pl#0k@0"04,0j 40Ip]]dk,0 !P !,d ,hS  R,  P ,  4! 0  0, }R, R 0c0'0P ,  B, 0 0 !P ! TP ,0 0H0 0 0,Yj|@ʲXwp@-PUp@0L0pp@- P# Mp@ 0` 0 ` 0%p$@ Ѝp ` 0%p )X` 0%p  ;00; U100%pG-`@p 0崀SP$H` #000 0 0 `00`0 0 0 `  $8r 0p000d4H0@1y TH"ЍG<0 $8 000 4@0S4H000s$8040}8 S 000800S#Q 3kTC840S'0Q x3aT940S,d0S) $0P%h0"N8 00(]S:Q 3ET 8|8 S0Q 26T 4m$*8 00OH0S0SZ h W 0R<0S 0SL2H2H000s8040 P(24 P28 P20 804 00@0S0i 0.0 0hp #Đh` 0HX"  P0dh0Ѝ0S,1,1 PD1 @18   00S  0R`V dp`ЍGF0p ЍGܲ&.I??iV4ȩ`H^ ؔA-@PT R0A 50p8` l0 R 0i0aP 0S <0S $D7  j? 5`0  `a" ``]"0Hp00` 00`8000   K"00 0$008 % d0h0qO-RP`p@\M@P; 800 #3P 0 RT0 3p` h@@N 00p 0  0 @P 0~L !Y P 0 {\ЍL0S0 0@S@0L0L}pHP 800 B2 R 0@TO|P8P T0dd0S  $ P $0S0 <Z- z 2 0;1C<18#<410,00000400<00@0,0D00 <$@(@ A8`L@P@T@H0"px us V h &hD! (",$0("(  0!  9E  p@ ` (",d `(P   0 \`I!vK \붜04S1SB0@1X0 37S1 ꋴzDCߴDC 8@-`@pP`0 h0X T6S @d0 0 < ` 5 0 Ѝ@$0  {ηE $p@-PUp00CSp@0@ t$5  (000L0p@4_ 긩p@-P `@p800  B\000D I0<0L00p@8 % x$ [`A-P`@ 0h 0R0TP3 t0@1HAp` @P0@!(0 A2P $   W %Ph0h hh 0d 0 DP0 $A굵L1 b C-`@ PR0  R $ RP608 p4  6ip@ R PP  P0  lHI@!D1$?'((700 Ѝ@ 0afH0@-@4M@!(040oP 0S 0 0P 0! 0Q00 g 000 0 0 4Ѝ00 vn4  4Ѝ0@+0p@-8 PR@  \0P   0y,Hp@{Ppp@굵G-pMx0 P@@1D!8 8C0m2s pЍGm0t&x0 2s 3!p PU P 0P`00P 05iH00P0 0a`0  (!0(10LZ.  P(_ t0+ 70I (PF  0 0 `PF L`  ```0 A ЍGR   0|P(+ (1 ( Ⱅ0(|!x>```P( `"(1* (> >Q  0*⳸   ЍGl  ЍG80   0S 0 0g0 ß Q  $ S@000s  i`P#qp 00 P R  K h0 00$0C40 040800 8꤂0S06 PU R  ` h L0&0  P@ ЍG0p0 F|0 $2  #0Sk 0Sh 0Si$2  0  d0S  0R/.0/fO-0M00PS㴐 @pT0`S 0 iЍ> R*4`P 0S D6S<ƚ Hƚ[  S1  @!  Q 0 S:500 0yp00 0  0 S 0 0Cs0tt0S0 PS0L00 (!p 0 3 0 0 0@P0 [0S?60@ 600 0:p0 |0 l ``P L 0 S\ 0@1i@6P P0S0 0<S<0P0B!0 0 3 0 0 0P 0S6[[00S40S>0 @0 PP   fWl00 0P0SS0KSK?3050$0 [ i0 H4 @SS  00Cs00Cs0 > $P 0 0 0S  0  d3@0 R@ $ D 0庒 0S:0<0@ 0=0: P0 P3 000 000 0[P00S* iP )   p冒 @ 0FZ600 0<P0  ^0S * @P ;  pX@1 v000H 0 000 00 3\ 0000@!0S  0  0S S0 rS 0 B0Sq0 00 P0Pc0 8[ / l .ǸHrǷӷ޷ڷHf)@[n8cuRA-P@`/ 0l A`0R/ 0 D0BSpb  0 A$O-`pvP 0䘠1@T ЍT 0S R T0 S> R *]P  0 O@AC-,M@pPP Q0 ,ЍCPE zUZ`0@SV 0SS "448#8UL:`aVH0UE: R1#ĠČ Ƞ,Ƞ\9 U6:1 S31C S0 0 0 0$  00,P   ,aV Q Q%  !V /  LY,Ѝ "448#8 C!B0~d@-P` M\@p0M000 p 0S LL  ۍЍ 0S`V \@T$p@- P@ P<p@0S0p@\0Sp0p@ꗓ@-0p ;M4MP@ p`@ `00<000C$00(00$0C,00U000`$0 @`4`8p07p ݍ4Ѝꤓp@-@PRT  (@1S pRq +02p %02{02p0S 0Sp 7@-PX0C @P 0S0>8 Q'Q'+  A R "'     0 #0 Ѝ0@}gPG@cHG 00 @ 0 Ѝ0zDp@-@P0( Uph0Spp@O-@`PU Q Pd0S  0 40 d0Q} ЍP0.Q 0S 0P -  08p|0 A봐8 R0, 00C0 2080<0  P`00 0 00S $0 pW ! 03 0 0 R0H0@S 00ppW\0H0H   pL00Ĺf$0`( "4 `4#S /0 @Rp@-̓00p0`PQPE@ `r @d@DLd@pP/<0`( "4`3Z1S P///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0S1@-@T P@10S/ R0 " /P10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScO-`1 @TMT. 0S pW$  D PP@0Sh0S d0S4$ *d0 0S OPPTЍ|0d 0|00 00Bd0 00<090 ډP ~p8PP  0|0 ⶉPP$0 00 PP 00d8dXd ᏉPPk ⭉|0d 0|0XxU 0S ~P 8pyP   L U_  P < $R R0 0#  Q  NP h % <   `pP> t0<0t00 0 8dxQY Xv P 9U  pP (ĠZ 0$8 0  h % < K  M<~괆\*hp@-P @p`01S 0S 0S 0S  -0 @T 0Q0 PSP 0U d0S0h0d0p@ 0dP/08 /   0S/p@-@T PP@0pΓG-Pp`P@Ѝ0F @P00 4b@P 0P000000 000i*.0  %$00 pPPX*0 fp0S t00@ s8P  0@R 0 0000@@ܓyhJs@-@T`Ѝp`PV08,*:SR h0S NH$`  P (0Q,0Q   `P ;800000( ,0CP~0S  0h dd0S  $0R  0h0d`j0SHB -N0S/0S/   O-MPD0R8<`@H 0P@00ЍpP P50 U@ UP R R R0 2P!4Y@PЍO赿 p    @@0 0Z)0 0S SY00 0000000Cs ^@UЍOe0S/G-P@M T 0p `倡x00 0@0 0 @e@ЍP/@-@TP@40S   0-p@-@PPP $pP0 00p  Pp@ :R R @\R @:R@,%P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/%0@-@A P:^|^00^0S R  B:PP |P0P O-CMM`\4!SP I SKEpWG X0P 0A@ 9P 00o@@;040S0  00,0 0= zpP 0 R0 :R00H\4 00 0p0PP u 0S  HCލЍ P ;00 0P5PV%0 00㗆p0PP@0S!+ 0P R  0 0SG @끎@P `P0 0 P000 SWB p@DW:SZ @\Sp S Spp00T:CP@D  0ST zQp00@0` Z@S 0#SS XP@@0U u:00h00?P0 0Q :Q0, C B  RpG:R:   H J B[$00 PC P[P$0 @D pG H   0S $0|  @p P D$0r$0 r0h @E 0S  D0A00T*yP 0P:SZv,%X@-0  0 Ѝ@-(@ P I0 0,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ v0Pv Ps @ H Q0P ލЍ v0P P 0@PH0 PP U LsP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0S@Z\R    B{:R|R  ,%Dp@-@PDp@NG-p= @P@ d+Pv 00@^S0S:S^ `00A\S`0S:SQ 0C^ 0@0LT1 0L\TS`ASBC\ h$`($$$$$$$ $$$0$bC ^0 0 0 0 R@Ad>PPd @0:SS0AR0@A #P Pd : A-p= `P@ dPPd0`FZ 00@0S @AdPPd0 :RRAS@A P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P $P,TG-Q0S`pБʯ &PV00b ``  zP00CS0rG Pp0 0 S  EW00S(@ ۈP  7 , 3P P00SW  X  R00S 047σ,P R   S@T P R  ` ЍR ,8,,@0@-0S uP \P,8,@-@SP08G,p@-P@PPpFPp,@-@=P  K(0@87ST,8,p@-@ PS P@p p@-@P  $(0@87ST,8,O-pWP`@P @ Ѝ0S K P 0 P0T  RT1@ S //////0@-4@0P PP,_O-`@0MS8 Pp04@``F0S|Xц 00$0S  ğ0 R 0 >80H@`@C^3A40LC32 0h  2l 3 p  !dC 2ttt 00C0'0DS 0 000 PxP | P,000&0900%040@ 0 R0C,0*0S'0\00C\0!\000$000S0C0@ 0 BR0 0S0C 0@ 0 BR00'000(000)000*0000000& 0  3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00$o Ѝ0S/1>3 !/0S 000/,0S/A-0p @RP:``S * lGP`A 0 PQ0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-@0SP`(0aL T  $ T $ Q0@ 1pC !]0`0sA-0p0@P`MⰂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0T,A-`@0PS<0R"0!31<0S 0R0PP0S! !x000S!!!,p (%F0PA , (0 ,P%%%A-`0 R*S\ ]\ tpPB@T Um 'oPwrPp% R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00,< 08 C800/`Q'Q!//%A-PRp 0@S` * EP 0!r PPA-@P`p0 SV1 V00W W0Stl@t@t@t@AAAAABAAAAAAAAAAP 0 B  0  B  B " A A`0 F  B  B " Az  k`PpG  B0  BZ`FPpG|S`FPvA\p@-P@0`7sP@@p TpQ 00//,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0P`%%%O-P 0R@M m P&  m P 000Ѝ 0@  UDPP ЍO 0 PS@ 5u 0 00<00S*^Q000800R ]R00-R Ȗf0 S*]Q -QR\V0]Sj- 0 S{:0S00L6000S8`V 0000060S|p0@W Ƞ@bS ,0Sh40Se$0Sb<0S_(0x[ f 0(` pc0@`F `@ tUg 00C0b-Q [QR:Q =Q 0pS: Q 0R00`S0`000-S]S0`S0`0t4 R*000pBW R:0`S0`00 S<*R9 :R6 ]R300@  p0p pBuP 0S<0K[$ KCP    qP p$0  0$ 峠0S00``0R00`S0`000-S]S0`S0`0=  R:0`S0`00 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S. W0`S 0`00S<0W00Z0S Z4 0BP   pxbGx400!0pᲠ40 P0`S 0`0 (B(  P  P : [i 0]S~! R, V08C8 0  EB#ЍO5<%,%p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@%%%A- @00P`\UC S:0S004000 p4\U R[U*U .Uy 0S0 pS xeP JU @0p W1@p(` ~0 S *R \R0)S ) \ W 1L  e0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  <t  3 0D #OU &)2U  0  4 000p0^00 00]0000p0S* *Q2  0  BG  B   B0;  Bu  0S> 0S 001006PX\QV {RS0050PS<* ,R9 Q 7 810000  U0 R     0 S *R\Q}Q00 0RR \P 0}S |0<0S 00,000$EoЍ[Ut`,)>{%A-0@pp`?Q $0A  R S$URRRRSPUPURRXU^QO [Q \Q PUOO{Q |Q020W:0S00500 @0P U1@P(` "0 S*0)S  ) U 1L  0 S:0S00400P 0)SP  0  $  $ RK*0?S{S*C\Q@{SP H$ "!,Q  R  $  U   R  #  ?S l*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^00 0P0]0P0 w|o0W:0S002000 <Q >Q xp3PP jT &UO F^{S0 PSp* ,Rm  1000< U0 R  !   00 S*}Q00g 0RL}QF  ] 0  BY  B   B0M  BD   B0@  B 0  B5  B  B " A 0000S 00000,%0S G- `M† PQPEkPL@P 6U: pPp P P$ @pxpp0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D t000Q R:0S005000 S=:  ] 0A0>P  H00Xo p0 P>3S, 9S $S S <0R pQ00< 00u04|04040 .  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:0_0P 08 BB0U0 RB@ Q U B!U 1 EU, ^ 0C\!1LX0RU!U! 0>Q% Q% QS 00 080Se 0S  0H 0@0 @0x00 0  0S b?Ѝ0R 10C/TUUQ,Ll8 8Ee,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0_P`%%%0p@-0PSQ@ʡ@8QD@ p<0S P pP0@H0DH@P(00Ppp@%%%O-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T 5P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0  P4P0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R %O-P`p,@ Q+ V >\# (\ \[ \G \S `P \[ \Y P @\` \ \L \06\ \ \; "\^ \K \ 0M \ &\y.\) *\ \08#8S00 \ yN ^0s00 0@0s08#8Sy[Y00>@4N5>5. P`F`FV0@0>N>0> ^0C|0>@01>3 St 0O-4M\0@0(0000$00; , 0X ; Q 0  PX d  P^ PZ$\( P ``SP  UEF V pR p@_UP\ v H_VPpu\ @_UPN wpK vI _VP\p?Pu p$ V  upvw(ppu vX  pX X0X w u P pX 0X hu v? @_V_U^ X _X 0_V3 Q"$, ZS ( `X A 0PX v_PUPPPU0S 0P0004Ѝ%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0 X7  IS~ S F S 0>#0DϠ2@ 0o800 0 fX IP0 \P 0 p @0P  0JTP 0PP@ pP@06800p 0 -X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0  /P0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R %O-pP084@#8 W Ѝ># R, .R`" Rl RR Rd pP Rs RZ  0=P0 BRz R Rb R 8R R M RG "R Rm RP n R &Rz$.R7 *R R ("(R8 R z  ȠLȠ \    r8    r ("(Rz  SZ >  E   R P RpG pGPp   >  e  ># !>c V  >  !># RHO-4M( ,  4 \0 0 0$ (0 @ f  0 X  0R  ;b0 Rc  R ] PZ   R    ``R  ,09.P0 00,0 UE F V pR p (B( _U RQ v     _V Rpu[ X# (B(   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  X p^X0w u ("(R X pL0!u vS  (B(   _V_U P  X +0  0_VX P R  R5 p  ,0j-(0PZ& ,0 $Fa0 S,0  =a0X  $0` 0Pv  _PU PRPU0S 000S004Ѝ%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0x800 0 oX7  IS~ S F S 0>#0DϠ2@ 0R800 0 IX IP0 ?P 0 p @0P  0-TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-4M( ,  4 \0 0 0$ (0 @ d  0 X  0R  `0 Rc  R ] PZ   R    ``R  ,0,P0 00,0 UE F V pR p (B( _U RQ v     _V Rpu[ X# (B(   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  X p@X0w u ("(R X p.0!u vS  (B(   _V_U P  X 0  0_VX P R  R5 p  ,0L+(0PZ& ,0 $(_0 S,0  _0X  $0` 0Pv  _PU PRPU0S 000S004Ѝ%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0x800 0 oX7  IS~ S F S 0>#0DϠ2@ 0R800 0 IX IP0 ?P 0 p @0P  0-TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P@pMD@0@ #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ(0B(R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr0G0 a>#RN RZ R\ R! WR Ri R>c ! H0 D"0@0 00P0A@7>c pr. pRHHd\&H A T0  (P0a !R@ pH0 0@000P>cp0 A~0 !RJxH A @ >3  0GdP  G>3`H0 00@VP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000.P0` R %O-pP=lMQ W @=QR 000N0 00`0=0`S Q00R0f  Z0,Q{ 4 Rv 8Ys <H[V01S0xs\!Q8pp 0,@004H<@ PP  0TX\  L0`8` Xd 00 SHZ1p0 0 0p,rP 0SD0S p0 0D0p,aP#D00D0[Q 0 0R < 0KS:'P [  0SD0S> 40S,0@m440S 00O, 0@ R0R00D ;0Q0 0D0,`PpD Q*0 J0p0,P 0 0D0pp,P 0S 8 D0J0C0? 00S0@P, "@ Q.:400  R04P \HP XPCC HP 0000 0D0,H0SPHAA0 S0 Q00R0W  Z,Qk 4 Rf 8Yc <H[G01S0xs\ Q 0,@000X40H08p<@P0T0X0\0 00SHZ1p0 0 0p,P 0SD0SA p0 0D0p,P"D00D0ZQ 0R < 0KS:&P [  0SD0SH 40S,0@^440S  004P HP lЍ, 0@ R0I00D ;0H0 0D0,vPpD Qy*0 J0p0,9Pp 0 0D0pp,/P 0S 8 D0J0C0? 00S0@P, "@ Q%:400  R0CC HP 0000 0D0,H0SPHAApQ00R0f  Z,Qz 4Pu 80Sr <H[V !R xr ^Q 0,@0004H8p<@ PP  0TX\L  ` ^ X 00 SHZ1p0 0 0p,cP 0SD0Sf p0 0D0p,RP"D00D0xY Q P < KP:$%P$ [  0SD0S; 40S,0@A440S , 0@ R0I00D ;0H0 0D0,UPpD Qs*0 J0p0,Pj 0 0D0pp,P 0S 8 D0J0C0? 00S0@P, "@ Q%:400  R0CC HP 0000 0D0,H0SPHfAAp00w 00D0C1S 0D 0C1S 0D B! R 0eE%-Ѝ///@- // //0p@-8P00@S PpYP p$,7@-4P@0S TP Ѝ0P $,@-@P 0S tX@P/ LP0 0 0/ /0 0 0 0 0/////0P P@-  /$,P P/ /O-$MPpLWH_ `d@P1!$/@ @ T0030#`W00SP 0MZ0* 9# 0  0  MWp  p $Ѝ 0Md 0M 0zMp@P. `p0H P 0@ $Ѝ`d@Pꙙ'`'\(\@-PQM@(p,` U00 V Sp0`rЍpw`S0p`Ed-00Ѝ00 r0`0EW00 r0p`0O0O-M@0hwh[ PA  FYAZKW  F FX%  F FV<  xF sF h lFX gFЍVY PZ, P RF MFZ  FF AF|Ѝ P 4F[  -FW PX PV P PЍO\%%%%%l%%<%\%$$$$T$@$O-@Q00R0`P00M 04堄堤0 p 0P R nR a BRrMT1   oRl mXPM Ѝ  eXPY U000T000 TXP[Y U070T070P CXPY U000T000 2XPYU000T000 !XPYT000U000{ XPYN U080T080j r@ WPY9  WP  WP  WP_YK U080T080@ WPp  WP  WPJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l WP T yWP #$h#"|"0" "!t!8!(! !T  ppC-@PdM0H`>SHP@@@@ P$P(P,PPP PPP9p "`!@03@0 'p@& 0 Kp@ Kp@   p@` Z0  PJZPZ0 PYPdЍY00O-1MM @`D`  H "(0 p C.  PpV@D;@8 (0Sp p p̱̑ 00Q$ P %0!pp@ t0!0N 3P 1P 0S RY0@01ݍЍY0S PEPU R Pp 08D<4! @ P0 0W0 R 0A'0h,R @P1ݍЍhL1ݍЍFtH gt0@-P@M 0  PJp@ 2<p@ P 0 0dЍ0_ o Ѝ0A-@@`v0 PP0P! 0pp ppA0`p0Y0`4Vp X``pp(0`p0X 00hpC-@PCM4 /GP6 0p@& ` PX000u6 0C.P F @4EP @FPL0@S VS 00 SCލpx@@0S@`0` 0P@0  P@1:X?0@0@X0@0@ p@-QMP4@SMZ TE /hGPB QP0s+ UP $QaP 0`KpP @ 0@WPqpG H p@ ۍЍp'0si/f1p0" +DP@@0 P@0 P P@1:-X?0@0p04@X0#S0p@ X00XPX@P%@<HP@-pP`O-$(Y,PSp@`3U-00ï  0HX0 0 0H 0R0*V&( 00`#`0{0q04 "x " 0xkP@r`U0@-DM@ UP, 0P0#L` ACHP/ @EaS 0LT/1 0S2 0"#DЍ0ꫪ*O-((60 @`$M00@=+@ I\b-0@?o2S00/ 0 P 00d 0 uQS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@?o\2  y 4YP$Ѝ0 0sx 0 P$Ѝ0@Pa (P aP (P0 )P0CS 00}P P p R4000.P0S0 0S  00000S |3R3 t 0S( hRf `#S\ RPV PM 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#4XP(0S  R $ R`d$  Q 0d 0007N# d 01Nd 0.N% 0D%(NXP 0dR  ^ P Q&PT8XP #8XP20 P0:($^0<P0  0=R$ $ %0h00@D0 c 01M0 2  .ΌS1 $0 d 0( M$ Q00 40XP10 P0:P0 0<R$0h00 0XP0  0C0  BQ $0 h00$%<q4 $  t ,+ l'.%""""XP @ D0 0h$% 0S 0000000XP00$0Sx"xXPXP0(00XP(0$QeXP 0RP[ #0\ !#/1x2 d$0XP2p rp t t ZXP  0 R9 P6#R1 & E%E R)  \Q%8< &0# &d\0(0 0V$ 0$0 h00% 0C 000 00S P00  $0h0 C\0 @00D h00 0 H00 00S \0  $0h00$#& 0$$% 0%#PP # 0S !#/10s ad 0 Kd 0 K$O-MPpP0k0P0U`0 W 0 2c1  刀?00i@P/ 0v> 0`0?d000P0?T0 04 80?<0 00$$%0000 000\ :0\0P? 0TP 1 dP /P~0S{ʴ Rxʠ RuʨQr003 0Sd `0?#0S/" ES}> `00d 08P@PD0 E0@ @8 H0X`P`d 0p4 `FQ@ T PQvNNh` @D P[^0`0 0tx|\dPl`p@< RW S S|\pTlVh0SdU`0S\0 R{z  RRzd8@0>C 0C0p0t R@ix0S O0pPt`( 0( \00cPJ p'?0! P ό 01l"?! R1 R?U0v Po 0JL7v~@ pG0/ QP pp 0JRl h0 Sh ~O 0 %qp`P  0qplO0S Z R@Q @T ZO00 ߍ 0QO\ qp0 L 'pQ !'/q S>P: RTP\0 P0,P0  PpJZP S 00@ O0\ ` O0S0W0ZS 0#\``o d`0\P0? T0ݼ0\80? <0Լ0\@0? D0˼0\H0?L0  ¼0X\p0h N0SL R<!pgQ: ß `Q.: ,PKz0Q@P  ß刀dSah0 ]ZP 3pv0psN@(@\ P`.P ?/& Rß%0Q0vt 0W0I 0" Q0P"0V#0,m`V10& Q#Ό3à\!=30S ( 8L^9 0( 0qp2 Pct)N#00&N0SL >\| РR30"c01 2c1Zÿ sR NT00M0S$ 0M0Q 1&`P 2&>`\3à\&=3M0 0} z0MT00\MT00glP)\(\ ףvɻ @-@n LapTat X00 R 0 R 0Q/  /    DQ 0@-0P S@@H  ^ 0S  Q 0#0S0 0/D(H  Q j.0 0#  Q/00Ɠ\ 0@-xPo> 0@" \ 0 0 /8A-@P `p@P@0% P PPA-\@`@P pjNP@0& P PP0A-\@`@DP pH@P@0& P PPO-P M `P9 p젟P nP P @@ %  P P0Sp , Ѝy X p V G  U1p0`0pS4lA-pPQ `@Q rP 0@DDB(000S  @- M`pPPp) UL 0 A0@0S IL0"S" 0p000S0 7/ Ѝ5L0"S1Ds\0pT000S @ Ѝ1Ds$ U,@-@ @O-p MWP  pp2S=`PL P@C GPp G ,P HP6 0nS# p= :@P00Q Q P R  \0 HB"A 0 0@00oSp\000S ;9` Ѝ, S.,` O-BMM@pKL0  0 OP:p:PP  OPn00FP PC @@`K0 PP4p 0P0 0 PP4p h@P! T 0dSPkPU0 Pp` p~ l 0THP @PP0 PgpT XsQ P K 00BލЍP/U ` P  pAJ0SR  BPBލЍ B0H0PP0 [4p>  ]5PJ00 P 0Bl! 0 0 0J0D0  0BJ!0 $U00&J00 P 0B|J00 P 0BqPoJ0`0  P 0Bczd@l,0@-P@M 0 P@ 3PЍ00@-P>@M 0 P@ 3PЍ00@-P?@M 0 P@ 3PЍ00-,M 0 EAPЍ--0$ S   0/ 00l`p@-P BU@pJ?( ( 0P 5/pp@-Pl4U@pI?( ( 0P 5/p@-@P 0003/T@-e@P 0003/xp@-P?oU20S@ 0 0 03/p8p@-P`UV00P00S@p$ P05/pTp@-P1?oU20S@ 0 0 03/pp@-P`aC@PpgI(@0 p@/pp@-P{@P p 0 0 03/pTP-@-M  kp@(0(003/Ѝ@ Ѝ/ @-jp@0003/O-`$M ؄P @<0Sp $ЍI0,P@@  4/ $Ѝ 4O-`$M ؄P @0Sp $ЍH0,P@@  4/ $Ѝ`!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////\d`@lXH0x|lXH8$O-DMh0P 0l0U000@@ S`p S S H00 DЍ>00p0S 0pG00 0 PZ0G"`  0 `00USXU Y <00p00C 0`0 Pp(V ` BPE @@R> 3P 4U * $0 0 000 G$0PPU  <32 7[`< YI  Ih XR3"^P<^P `0U 4@ YEX: Q7V ` BPE @R> 3P 4U *000 000 0G0[P % < Y` `0<S Z>03040p 0R 0DЍPU *@ Y,PU ` * Y@@ Yp;00,d;00(Y 08 P<0<p A  FQ$ 4p(0,00)Q!*AQ V S @0S Q~ FQbQ 0 `302 @10 0[0 X 3 "R Y(0H0PE$00 @,@S 1>03P041U * 00 0 00G04 PPU`<03`207$0SE 80P0=S @Z? 0  $`4) Q(P(0 BPE0`,@S>03P04U *00 000 G0VP 0`PU4 Z [PU`1401` Z$``0fQg [  0 L0 ,!30 ` l:. @3[ X3"30Q8<0 N Y(0H0PE@ ,@$0R 1> 3P 41U * 0 00 0G*40PPU`< 3`2 7$0S 0FS 00000S800<0G0 P0 PU`000 $``<040 0B0,0<PQ0,0(00PU(040FSY0$0,0@00S00 P<R00S,00,0(00U(0 4 @ZR  4* 0S)P(0 BPE ,@R>03P04U *`00 000 G0XP `PU *Z  [PU *<0$40@Z7  4* 0S)P(0 BPE ,@R>03P04U *`00 000 G0eXP `APU *Z [PU *[4 0S1Y(00H0PE$00,@S 1>03P041U * 00 0 00G0,$ 40RP`PU*=00 $<0400PU=0304800<0 0G P00PU`0 X00S4 0X+:Y(00H0PE$00,@S>03P04U * 00 0 00G0$ 40RP`PU]*#00,00 0PU#03040, 00 $0[, 0S)Y(0H0PE$00,S 1>03P041U * 00 0 00G0$ 40RP`PU*=00PU0#$0%=030403$05,0$0 ` <040$e,0$00y,0$0u00@-MB0@+Ѝ0p@-P`M0@ 0F 4/ЍpG-PRM^  `UpP*/a@ 3P T1000< pp Ѝ80S 1 000< ppC0S ЍĠ C0S 0 < @0000< @ ppC0SC 0 C 0 'L@-$$@M Ѝ3O-EM MaX@P+p `E; DN0P@*T 0 8N0P@T 0 0EAP - -UEލ ЍtC 0 Eލ ЍlC 0  @-@` pMPU;P, /M 0RP  rR' rR  P   P @0CZЍ0rS\ 0 @MЍ0 Ѝ@r#C 0 A-`@ )p@ 0P/S /MP @0 Sp  0 S' ^>@p@-IMM@`PP `p 0: S p0 0rp IލЍpB@O00IލЍp@IލЍpB0@0p@-IMM@`PP /p 0: S p0 0Ap IލЍpB@O00IލЍp@IލЍpB0@0h0@-P@M 0 P@ +PЍ080Q 0 080/p@-@PP` K OPP u 2P  p@)YPPp--00 M (0  ЍЍ/P-@--M  Ѝ Ѝ/ -- M=M<P 00  0 ЍЍ/,@0-@- M@IMP  Ѝ@Ѝ/O-,M `@RPP00:A!0@00Ppp0 0CS  PY P@ 0 @YP Mf!,Ѝ,Pp@-(M `@P% (Ѝp0 00 *@p@-`@PLpp p@p@-(M @P,0, 0 `% (Ѝp*@p@-M H0H 000` Lp  Ѝp@lЍpD*@p@-(M@PLp `e%8 Y(Ѝp@-@PT T  ,M` @Lp pJ% >,Ѝ)@C-,M pP`PEUP0R@@t0 0:2 0U @P0 @T HL ,Ѝ(Pp@-(M `@P% (Ѝp0 00 (@p@-`@P#Lpp p@p@-(M @P,0, 0 `$ (Ѝp'@p@-M H0H 000` Kp  Ѝp@zЍph'@p@-(M@PKp `$8 g(Ѝp@-@PT T  ,M` @Kp p$ L,Ѝ&@ Q 80 @-l880@08 880/880 00<P 80880X& t/p@-@0@00S 000 Xg t0PP `00BA.L00p@3P, %$$  @<,O-t3M0@ 0P `k0 `0D$p@ P P00U pp0 0CxY 2ATT00  RG LD@D T]:[ 2 00p0`K  K0 V0 W8 P2ATT 0`Fs 0RB K 0 i 0 Bc0SH J@0Ѝ V0& 0 M J 0 C0pHXB0SG 06 Jv 0 B, 0 B%@ 0 B  BJ`FtZ  0 B  BJ 0 v 0 m 0 0S J00$ 00 P!@p@-@PqJppp@ 0RS00 /p@-@<0<00P  @SJppp@ @808 00 Q0R00 / @p@-@`P3JpT T   p@pp@-@P\ \  ` @JpTT  p@p@O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KD Œ Č Ȍ A`| {@p4  W R ? \ QQ Wt ,0 000IC1100Q00, Ũ Ѝ0h 0 00{t@@-000 000 @?P80@080P@-@?P80@0800-M  Ѝ0-M  ЍO-ϟiM QP@ȡ̑qa  P? `K͌U Pul? K͌T Pi(? F͌(Z {P\> F͌(Y iPO> C͌ 1S VPAL> JB͌8W DP4> ̌V 2P'= ^B͌`=@ 0S078p H0PH `P$ P P P P P(| PX P@8 (P PD (PP PH PxP'( Q780L0x100C40S0 00C,0000h0000a0P06 ,0P0@`U 0e1P U.0q10 `00V0q0 `RV, 0U @ `dp少Wl` 0 Z Piߍ`0 1 S  ,00 0! 1S 0D 0| 0t>p00( P ,,0$ 0 @< 8P!P H, $  B @ 0S% 00P00C1 0@S3 00 Q!1 p WQ  pW,000 p0S,000P$0U1p㔠 0 W oPp~80Sz004 0R0031800S@@X!0@< 0S00!$0P 0S@@@@T0S0 0 ,00C00P0X00Y,0 0CR0@,00`0QQT d!@YP0 p00 W0 pWW0T,00` pp少W䰍 0 X P0080SG^p!f p!:|rQ R 81 R 0S ЍQ  <00 Dh0 T  ЍP|`|d{D0h 0̃ S/zG-TP@pxMk +¹(@($T 〺0CS0S(v3ズP 40/# ଐ쓟薃蓟0尐:ؓ局㴐Г%LȘȓ㸐͠x帓尓H p|xtplhd`\X8TAD`<@Ã4,(($ Px h2101:|@ R 0S 1810S \ЍQ  H20 2C8?Hhp( =/(P U (0Ѝ>A@<^v8#߸:ܸ0'ٸ#ָJ #ҸH#ϸp-̸-ɸ`_Ƹ|øop㽸r㺸y㷸z㴸{㱸@|㮸h}㫸|n`|!y+!%,!-!.%0%`&i%j%k %l%m<%n#o#s%t$%u4%v,%w%x#p#rd"ye"z`"|yDlw$yp@-,@_@k( @.T(Pp wO-pǟM 7700Jm6儲0 `0\W[  p p PP " pTPI\$ 0P s 00bRS 4T D600/O 0 ;0 $QPBPq 0 ;0pt 0S 004 0 s 00bR44 $R P|%|5  0Ѝ p PP'  4P 4 0 s 00bR 444500/1QP p lR Ĕ P  $ $ 0T0\W0yS vpP 0@    $ `004S  40 q 4Q0PQ40@ Q  000r0  cR$W0< SS. p: @pP 0@  N  $R `004S 0040 s 00bR $4S4]0P"0 0Ѝ0 ;0*p4S  200 ?cS  20|"0` py P20L"0` p 0 $ P 0 s 00bR 40 ; 0p1 P- p 400s440040 s 00bR44P 4p!4 0 s 00bR L/o 4"<10 p 0140 s 00bR40z 000 ?c0`000`0000e ` \( t0t0! 0 1Ċ,LAQȄ0 (p@-P@,0 0 P1 T TTp`O-T4P8 `0$Q@DMh v :Q{#R3Z 300S 8 TDЍ!  Ppq@ pzo0@ 00S0:3S*0`00<00 P @ 00{Z }x8F 4!  p9H1D00<00  0*P$8A,0 00@p@-@Pa;ppp@p@-@80800P  @M;ppp@@@- MP]+OpP 0@T $T` @@TP  Ѝ<V>0P0 @P`@-@-P% H-P -+PFP0S)[P& mR R@0R0 1BQ;RS S0 CmS  ;S R R0 S0S PS0 C;S  QR0RRO-0uSp@` Md`Z|P @-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@Q!80-^\ , 0 B\ 0 ^O-J3dS0 dMbUSU^ 3,p0CQ?8 <3 Q7S@0pP 08 ,0p๥3S/| 0P0p3@ 0 00 p) , 3, X 0 `80 =dЍ|B0 9dЍOM/O-*,M0pP2U 0!  @Tg ` @p$ $RTK*:0`SQ p 0 ᯤPP,Ѝ@`00S S@ S0PV%0S/00 04S,ЍO@0@0S A0Q  B20RP 00C 0PV 0 0 0C00PS  P @0 C`PQO-DM 4P3 S-0S*U= 000  0@ 000@xQ k@` p PJ @0S 0!PЍDᪿ P 4A " 2  -ЍP0PHP0  0 /< D0D M000S :P ЍЍ/ᴟH0H M00 0S :P ЍЍ/\404 000S :P / H0H M00 0S :P ЍЍ/404 000S :P /pMDD0P  P 0 ЍЍ/$@-|0| 00@T 0J#4R |B0pQ 8@-P @B̝808 000S :P _/@D0D 000SP:P4@//000 000S :P /ᤜL0L 000S :P @-p @/dA-0 00pW* Z3$SP! #R`@4Sp`3@Tv A|B0tQ 7AB--0    h000 000S :P s/G-00 0Mp W$  ` 0 Ңp @͟PP  0  Ƣp@  0-@Ѝ@꬚P  P j/p@-JP }3S P`4`30PV  0s3$ S"0坠P |2 $R 0X0S 0L3 |20X #$03p03ppph6(p@-jP 73S @P4P砡30@Sp@虡A-`P\ J3S%sW" P@P033SĔ S*/W 0B@ ^0,  W0p,030!C  ! L! \0|! c0000WP3PSSpP4Supp3PUpp@-@P PX0:|"C0T0XppG- Ѐ\-P@p  `6P LTL!VW R T VW  H000S3;0 !0 0lO- M0@DT  =pԡPP5P( U9 ЍP&` U$ @ءP  0 0 gh `  @RYd ` ` Ѝ Ѝ0 @0@0ꀕh @-?C 0@   @ ,( R @@ PA- Q@PP% pW# 0 0S0_,]000 R   R   R  P HF4B`T `TX *P Q Sp  QW02'ꬓp@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S GT00SpX@ |'(@ 8Q 0@0ppp@-Xa@P`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0p?pHT0T 000S P@ ?# Q @ $080///܎@(0( 00Q0/t@(0( 00Q0q/<@A-T0T0 0PRp @`?`,GH@T0T 00 R X@0|78@08Q0@0/ᘍ@0 000@0 00( @p@-`0`0P@T X0:|20T1S@0?;@0]<000080S@078@0wp@P Q@0?30R @080///R\/R/p@-PS `0@H@?GppP X @0*|"7 8@08 R 0@0/P@/*p@-|`@P`P X0:|20T1S@0?;@0:8000080S@078@0 p 0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/ᔊ0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/Љp@-@uP0P0 p@$금@p@-P@e p@p@-l0l 00 Q@P00R ^ p@G p@`@p@-D0@@ 00P $pp/ p@ԇ@p@-P@$pp  p@p@-P   ` @#ppT0 T ^ @ p@@@@p@-@`P#ppT T  R @ p@@Rp@-P@00S ^ p@z p@sO-`0 0p@%tFtp@-APQ@`R }10  R+ 0  0O pp!R!  B(B((00(!C R$C1Sڸ0@ @Tp!Rڸ  *d2 00000S % @T @TUpx00 QPڸ0 Pڸ  4040 B @T F  -M 0ЍC- `?PpPEIP$Y/ P@  N @DT`F࠱V HX $ P 0CA-A1@`P0@00 !p Q% , :! p!t1pP0 0TMT1 0@00@0P8010 R00SAP-  0p 0P (0 0@00 @0 0pP0 00 0@00@0P  P800 00L  @08@00(0 RJ, 008C8S^? 0"  @HDHT,0Q0 (00S<0S (  R( ,  HL ,T ,S(0 0 40,100 180<00,0 10 l=$ 0p0H |0D00H00^p  0H SL0HP1<08 0,0000],08 0Y 0Y 00S0S0A0P<08 0,00 1 1 01IY0Cڸ P0D00 L  /o^" R 0YP@o00PP P 00P P, 0 R S R  0\ ɟ`V 0HX 0X pp 0 0 AR SsP  P ` P  V  0R  `:$00SYD QS 0C00 S40( 0S(00040 0 S(00 R4 000:3s L  RL   000Q00 0\,0(08C0,Q 0,7P 1 11RY@ڵ0  R1 8 r ir$0`V 0\U 0HX @ @ NN Œ Č Ȍ N LL\oɟ`VD@ 80`U 0P TD0D0 R 0 R PP! YR  Y; $R  0E0 p0   0E t D000$R $ <7  eD0@00!R Bt <000V  0 B0C 0$0P<0X *1d"0@|6$  Z 0@P`< 0P8, Tp P$T000 @0pG 1`11QUr 00S400 <0pD0 P 0X *1d"0<0V @ @50S  V0A0 0C0 R d1SEdЍ꤄ 1P VUQs 0    k<$$ R 00S0 d?3Q@A`pPLp@` 0?3V 1pGW1QEP @?0D0p00L00@ 0@0@00 XX0 P90L0S S ?(080 ~ <00  $20 Sp`dЍ80 00@ 0Cq00S02$ 0D000h0S(00S5<0 (0 S<00v<080 @0 80^R00C\0Rʕ@t& +,1$ 0, QRp! <,\`@VP  V@P  P0,p, PQP.J q <@,T`V@ @ D4$,DtptD t L eV@ P0 , PA,\,PY AIa,@IpE ! W   P  X,00,0Q00 , BCR4 R0<084 00C, 00S<,04 00@0@0 0,00400 00 S` @f` P 0, !Yp, 1@S  Y@pL ^P0000 00S000 00 0S 040C04 R00CQ8(0 00, PEu1 PAj0, \ p(@0<00  w 0PU@`0V0S 8Q004CQ0儃V0F0<00DPA `P | <0`0PL W H2 D| p3$  D0@0 0Q. R+ dP(  %P d1S $ 4  tPp:U U6` p 3`FV EPEE(0,,P 0E0JLp0s  0E = D000P  UP00 : ,0R<00,P 0 0C 00Y 0C040~ p(& 04&80 0H0D6,0@0L 0 G40K pRW0P R  Y RH RLR)0 S+ 0PU0a0P@@ a lF ,@DPTP lF@ P0E0PE0PEQ8!00 00C,0W<0p0,p,00 0R0<0 0,P0,0 000 0 0WڭL 0S 0 PCD0U0 <000p]P4/ pQ, S4S Yô4SQV H5S4X  8$`@ 0 `]D 00p~0 `P00P9  n0D` 00 B0 b0P P30 0pU0 P'%PO p0SL 4S 4S Y00ôQ0S8 L5S;  \0:$ @` .0 `D0 00p!0 `D000P : 0D` 00 B0.  00Q0@0`` 0D000P  T P"  $ |;@ 0   D000P ;$  0 q R! U <$ @D0 001S U \<$ D`@0 0PL5S 0 0RU <$ @D0 00LUD`q 0 0L|PhoSPk4SP 0 00@D000$ =@ \0 `C0`   *D000ȔY  p F0 {\o`D0 0H`0UPy D00 ! UP    `>$ D@0 0` U000 D000H%RQC    `P?$ D@0 0H`U0P0PU# 0``U @P @0:0x?/0 -Q, @0HP,p@-P0P`@0M R    80x t00 0 000P80  H000 0 B/ 0C?0 0 Ѝp@  0 00l@C-M048lp\` d0h@`Pp\P  Ѝ80 800 0 pCB`Po_`PЍ @-@P @TG-1!00`0DSHp0?sppS-, P !Q@QT:!80|0Zp@U0 S00? P R!R0 S  l 0 00D@ 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP0 @ @T $U0` V P`厂Vp`=0P 0@PUpT` @vT @pp  ! !@-@P@_T R/A-p0,SP` @T @IT0`SP R0Q/ C0A "" Q/@-pQ*P`@ 0N "" T0 "" ^\ 0L "" Q\PW`@@-@@@0S P$0C$̾O-:z0*Mp$P( , pPx x00^b Ss @@lRXapH\ 00 4@Y @A@0 @TI Q@@[@TAP i``FF\W0^0  | aR\ |`Q'lQ"  @CP(L ,4QT S$I@0S V0P0$ 0B$0xX0C,4Q~ @CP ^a S_ʠ80,40SoʌHh@` 0 0,` $P,04CS (` R 0 KR  8  80  ppP< `' 0(@Z Uq @@lR@A'@T 00P0S[ 0P0$ 0B$0@'  00Q5 70,0' 4(0P0K0 F @& $P)0Sx600S00l0S$ 0 S! & ,40Q$0 lP,0S  P$0CP$(60 R(,Ѝ 60( $0(0\CEe@` % (00 S5$%P0C (00xP0S  YP$0C$@D% 04 0,@0(@Q 4000XV 0Q[Q $ Z 0$0C ,0(@ 0 K[ZP pP40,0H$ , 1 10z D 4@000 P ^$ $@$#` P(`h0 Rv ,,Uq  P+ #  t# (`$@ ?#R WG( , #\ $6 (`  P 0(`$ R  P $`@ lP " 20,,40 SN   P20$ 4B@0S t0P0$ 0B$0 $ 00P0 ! ı 00(@S7a` 10(@0 T0!0@Dx P(@0S  =0P0$ 0B$0}`,0% a`0S )0P0$ 0B$0 i`,0xܽ`|pȼx< @,`0`\ld0,p Է LH8\@ȴO-PsP3pLC@00 S 4400040c`(,P Zg34@2`0T5"0C S402P00S00h0S000S200ʐ  0@DS(00S 00lP 0S D2 4204@,P0T0hPr RP0 @P 0( 0CS [P1 P1040 ,( @P,P  Ṛ@1(`0 R&T !P @T 0 R 0 P'  u 00 lP ~@T00,P 00( 0  04@S]CPE@DSP4@,L04Pl _00SL004P ,Բ`ptl @- ,(4 00 8@-  ,(4 00O-\1\!0 T *⤒Y|20`1 50!Q:|20t0`1=Q,00S|20lA0 0!Q:|20h3h0 s0!Q j0!Q \, t/p@-x0x 000@00CS0 S 0 S P00p|P0<0p@-0CS@0 S 0 S P00p|P0p@-,0, 000PVz@|p@p@-PLz@rp@-|0| 00@0J0Q P R, !Q0000@0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0PQ`@| zpP 0 0C Stlp ,0A100A!R   A BQ(\ !1C K" Rw   IK T0 00Y?3 0Pq gvPP| 0Y0 00 W0(@p ڼ T D H0W D@ 0 ( 0C P8g$Ѝ00$Ѝ>T0 S80 E 10@ᬔ @D  BT cp`$ЍHȏ$Ѝ 00C! [ @ D0 |0p H0K002 [ @T @5xT @ @j 0 00@p@-@Pppp@p@-@80800P  @ppp@8@O-5\M0@p0y`Plr Pu0P 0l X0P,00Y0(0Pp0@STI5*PO`(PZ0pP00PEPUA0 (00SR , *  ` P CpER2C.-,0T R8 ! 0,0 x x4(p0[ԓH0`(0(00S(0U(ExP`FxPJ`xP0p0C0   S `   PR,,(0 !R0!!ر$(PQ,0 0R!1P10CP E" R|  KPE X,0V(0 ,00P` `($,,0@D$8 0 40PU` 0,a00C 0 Sd $ 0 (0C0S00 SRj (  = x0!( Z * 0pH000(0`0Sq P#`p (``(00S0C(0wP 0`F S0p0Co0I! U 0H 0000 1PE UwD0|0 p v \Ѝ"P 0],0T R0P,0 p `~ `v \Ѝ` v P /0 0r@M,P   00ЍdЍ/@0@-\0@X 00 MP p T  Ѝ0@G Ѝ0d@p@-@\ \  M` Pp T  Ѝp@(Ѝp@p@-P@ppT p@ pp@-`P@ppT  p@p0Q /0Q /p@-00 0`@P0 0@\1000C1.T 0*\ /\p0R000p00p00 0L 00O-$MS LPP`0X p H0@TI !  5/ 00@T; $T <RX! "! ".Q  R > 0P 0 0 H 0y00 P  0H8#8 S R0?@P5/@TY$Ѝ0H\  8#8 S R@0刀0s@P5/@T  Q" @-@ RM !R "R pPĜ\  00@[Ѝ/0Q " @-  MS S PpP$R (@2Ѝ/0-4M0 Ѝ䨊@-@000M, @ЍP0@- 0\SY ^S9 %@@ ,S'Sv{cScX0@4Ÿ\C110N00000}00%@000@0>{C0)@@PA 00@S801P00A 0@@100CT00C0 S\S:S '000L0d%{tQO-M  q\PP 0p p00047 000R0pp  0`P p@ ,R&Ti \ @ @   R_  QS%R +NG\ TRQONMqpJIHGFEDCBA3?>=;9876543210/.-,+*)('&%$#"! ?   R Pcs 0P0Ѝ% i^@@ @ `f`00 0 "!.Q *Q0 0 0RS@  RP%p0 @ % d^ @d  @  R  @    A6  RT  @    A   RyP%p0  %@@c   n  RTP%p0  %+c @@ @   < c0     B0  <M0   0 @@ @D>   Tp P0 S\R$ W 0`C0@ T$<0  0  p/> 0000   0 0S0\S 0 S0  , p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp0`p\(~A-@0MS0H0D!0@p0S? ` 0y1QÃ!1!1"b2cP0A @ 0L0L  00210B=P 0 pW$P@WP 0fS*PЍЍ 0 0Ѝ`N\ gA-@0MS0H0D!0@p0S> `4 01à ‚0  @P0P0A 01! 0120BP 0 pW$P@TP 0nSPЍЍ0"0ЍkLܓ >C-@0MS00! 0p0S2 P 0`1H $@0!b4!b H1c$a1c0@` 00  0#3c`10BuP pЍ 0<0qW X $`0sS]P p`VWT 0S oPp|PPЍd-?L@ *S0 O-LM i뀐l YnPH $0$ 00 : 0 @PP: @P 0S  R 0[ M #[ =[ =`P` s000`0||tpP-  [#Vp p  RR soP X,     PnV n0PS9p H0 1$ @ 0h3hs#112cp0@0L@3Dc#112c0A0L06`b1a`@0Pa `0```@$@b,`Hp`V @T 0@0 En= 0P@@ :n`VP00LЍ` 0z2r#!0‚ƒ0p0@ 0200A0!1 120Bჱ@P0I `@005`f0 LT!2H1N $@0!b4!b N1cq1cp0@χ 00  0 3c`10BP 0tS0cS0S``d0@0` 00 0< `}0SQowȏ N gkLl >-?L *Sw O-@Pp`0\ %\0pS sS lS@ 0\TT1DW 01 CR0@CUPO-pQ qM P`@? 00S040H P$   l0H Z0   RT0P G@T %<%T 400 R,A*Pg p 4 @@TP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+pmP" 400p,1S$ 0C-11@ X 34 00Q,*P 0 op 40P4qߍ00g0\ !0D]SCBuw~}~z00D Pb@0A?S@:T;X0D  R S񏐀E~}|{zyxwvuE9rqponmlkji.gfe5cba`%YP`VqkP`Q 00040hkP,I 000XK -00.0\0 l 0\ @:  P160@00-00.OW 01 1ऀ01p@!R1 0BS11ऀ. pB=1&@DqVTwzq^L6$qW pG=1!T0q| ~T0OWq  !!pq0p@,@10D RHp%!R =1X@ BT!g X14 00Sb*,Pq 0 dn0p4 040O R   ?R ;R   PR %R0 0p!OR#0S'S ! 0S'S'S@@pAT8 @D=AA0@a DQ! 1pP1S 0C-110S R   ?R ;R eRQ  PR %R0 0 0000 0 B10 OQ R}R0  R}R}R@py@a0D RA0DSI13 DOS ͍!!010pSl0@0l0 0St00t0U1S= 0C-11@ST@400 Q,>:p.kPAT @Dp=1AP OT=q00=1@Ap@%c`X] "Y(V0QXPKPF@oᨂAP<X9 5@2/QJ AQF A=<;:\a76RZ3210/B-@+*)HVRQ@ Qw, @  @, `  `p`p^$ (05 4(0h(0` p`` `` `` `  (0B(0``#t 0 S00P3 ( L0AP ,  0 80T80( 剑T0IY【pn 00 0000000s0 P]`hFhvHDHt8 P0n  PPG 0S00 DP=0 5|P00000 0f0 P PHDHt0 0Ps 0  P0P0 D` LЍ?V` L0  0po0 v{0 nsl< gl( p( !`Psꜜ Ў   t , P/`$P00//ᰅ @-M@0 0!1l!1"b2c N0L 0 0@@0$@B!A@C0YPЍ赁N@ g P0`0K?//Ȅ @-M@s0 Y0C B0  N\00L 0"2<@0$AB@C1dKPЍkLP >$0P00?//܃ @-M@70 0C@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$$C!d!b8A@C1PЍ-?LD *S p@-0P0M`2@P 0Ѝp\00  R 0S"0Ѝp G- 1 !0 qP P@3 04 S0`0`2,0zPP00|Q``  hVPeȄ`EQ  ]V|0`0ȇ`H007TX7@-@P ^^^ ^$^,^^,00!R  !86 001/6001P//5(@- M`p P0P0@0Ps ᜁP 0P Ѝ 0@P Ѝ`lC-@P,MA!DDH PNp`@\ }Nhrq]HL8/#~\H3  ize6t~-s 0R>*_ri*'?*SRQPOLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  $T "=4<"!00 0$ ,Ѝ0^0 ^( <;0 0T 0" P 0$ 0^0s ~^ :0 0T 0" P 0$ 0c^0ڤ:0 00ᗎTW  Pf 0$ 0c^0P:0T 0 0"P::" P 0$ 0c^090T 0 0" P 0$ 0c^0ڤ 0T"   P 0$ {c^\  :嵍T"9" 0HPj P 0$ Z0c^0 0T"  0(K0c^0ڨ80T 0 " 9"H P 0$ 80c^0`80T 0 "8"5 P< 0$ %0c^0Z80T 0G"8"" PA 0$ c^T  0" P 0$ 0c^0Aڈ70 00ڄ P88T" P7 0$ 0c^0*$70 00ᫍT Pq 0$ 0c^0^60 00ᕍT P' 0$ 0c^0|60T 0"6"P 0$ 0c^0460T 0"t6"P 0$ 0c^0050T 0 "@6"P 0$ 0c^0ڤ50T 0"5"}P 0$ m0c^0\50 00T" jP  0$ Z0c^050 00T"3 WP 0$ G0c^0r40T 0_"5"DP' 0$ 40c^0bڄ 0tT"  0P 0$ 0c^0840T 0"\4"PE 0$ 0c^030T 0"(4" Pq 0$ 0c^0ڨ30T 0"3"PW 0$ 0c^0`30T 0"x3"P8 0$ 0c^0>30 00T" PZ 0$ 0c^020 00T"| P 0$ 0c^0mڈV 0 1T" r P 0$ 0c^0420T 0"T2"Pf 0$ 0c^010T 0"2"P 0$ r0c^0Qڤ10T 0A"1"oP 0$ _0c^0\10T 0"X1"\P 0$ L0c^010 00T" IP 0$ 90c^0q00 00T" 6P4 0$ &ꨋl d X t ( ܐ X ? ď h 8 D ̎ d `   0 X  Ȉ t H G؄ l , Ǥ ( ,  Ȃ 0 4  p  Ԁ p @ @   @   T t   X~ } } \~ l} H} } $} | | ! @-DT~ x~ ?0c^010 0 0㊋T0 P 0$ 0c^0X10T 0"l1"P 0$ c^!ڤ T P 0$ 0c^010T 0"1"P 0$ s0c^04 0T"  pP 0$ `0c^0|20 00T" ]P 0$ M0c^020T 0"2"JP 0$ :0c^030 00T" 7P 0$ ' 2T" !00 0$ l30t30 2T"!00 0$ 30 3T""00 0$ 30 83T"G"00 0$ 408 x3T"r"00 0$ D40c 0᫊T!00 0$ 40각 P4 4T""00 0$ 404040 \4T""00 0$ 5050: 50 4T" !00 0$ T50\50 4T"q!00 0$ 50506 45T"$`"00 0$ r50_50 |5T"L!00 0$ ^6060 5T">;!00 0$ ML60/ 6T"i-"00 0$ ?60Z 0T!00 0$ (60 6T""00 0$ 70 70HTx!00 0$ D70iLy 0ωT !00 0$ ÉT!00 0$ 7" 0ƀPXT{"00 0$ ^ 0ᡉT!00 0$ @80H80 8T"@"00 0$ |801 `8T" !00 0$ 8080F80- 8T"Q{!00 0$ 90Br"00 0$ l!00 0$ ~f"00 0$ xz0P h)al9 nt90 0R!00 0$ dL"00 0$ ^90 0gB"00 0$ T<!00 0$ N2!00 0$ D,"00 0$ >&"00 0$ 8 "00 0$ 2"00 0$ ,"00 0$ &"00 0$ !00 0$ !00 0$ `z bzP  ;G`p 0rP 8;"0S!00 0$ 0S !00 0$ 0S !00 0$ 0S !00 0$ 0S !00 0$ 0S !00 0$ 0Sl !00 0$ 0SD !00 0$ 0Sc "00 0$ 0S !00 0$ 0S "00 0$ 0S6 y!00 0$ 0Sp p!00 0$ 0S g!00 0$ yPs 0$ r0S W!00 0$ i0S N"00 0$ `0S E!00 0$ W0S <!00 0$ N0S 3!00 0$ E0S *"00 0$ <0S !!00 0$ 30S< !00 0$ *0S !00 0$ !0S !00 0$ 0Sm !00 0$ 0S. !00 0$ 0S !00 0$ 0S "00 0$ 0Sj "00 0$ 0S !00 0$ 0S !00 0$ 0S{ !00 0$ 60 0x60 0"00 0$ "00 0$ "00 0$ "00 0$ "00 0$ "00 0$ "00 0$ "00 0$ "00 0$ z"00 0$ t"00 0$  * 0qP D5"  0 qP"5"50 0g4 @@y0 Z40 0Q40 0Ht4 @@Zp0 ;@4T0 02O440 0)O30 0 O30 0O30 03 @@ 0 X30 0!00 0$ 3P0 02 @@0 ݿB20 0Կ20 0˿v20 0¿\20 0๿m820 0ి 2`0 0৿I1@0 0!00 0$ 10 010 0Ll1 @@0 y81 @@0 l1h0 0cD0H0 0Zn0(0 0Qz00 0Ht00 0?;P00 06,00 0-Mx 8x u w v v v u du t v t u lt t u (u lt hs r r t r r q s Ps q r @q q r p p ŸA-P@| Q 0AA M `4660@ pG0?p P0C`Ѓ0\?  P @PX P0. BP@T0 ) S PP0C0C0 QKQ0@* M0  0, l@3<\0 0τ 0|P@056AP@ 0Ȅ 0᫄P@u` p p0l堄 `0X|P u@`@ꢄ 08P@@@0 Yn?A-t ANL\0@Po>\DQ; 00P \QHTL a`0 ^ 0h46P0e0(#67(0a` C 0M A03\ \ ANN1 0QU^%n Tn /P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BV@1 V @D 8 ,0400G0, 0 40@( (8/P840, 0S004R000@-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0$ R(400  0@=0U 0PE@T$0S0  0@4=0U 0PE@T$0S  ($  0  88 (90,K  @Uv 0PE@T$0DS, 0 E0@+@<0U] 0PE@T<($(<,00@000;00SD @x<00 00CS:0S ;008@ Q;0(0 S0(0@080t0 890w4;0U 0PE@T0S  :00;0,@:0000 pC0 0,0S P<@@B0S 0*S3 W 0PC000000 00 0 0#1<0 S@0@0R0 RR<,0 0PUS0S00)9 0 <0 30DЍ  R S R  DP?0 P 0pBS 00 0 C0 S 040U 0PE@T00  BR00S  \ 0S0($<,(<0$(0 R x800 90 00 80B4 R,5@0 000DQ1  P !ADL B \000D0S707 UR00u0 0P <@@I0 (S0 ʆ  P<@@ ;TU 0PE@00 S  SP S= 7威@D00@T80PE@TULQ60 Q H0 @S0 0CR*ʆ+R h6006000LQ`D0ʆ;460\0T 00T :0PE00@SUld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@Tz 0Sw 400h50Uu 0PE@T:0ʆD+1 0D0@D8+Ua 0PE@T:ʆH ;0 H @D;8^Dp840WS Up1 0Wp!WC 0 0C 00 00D0PE0CD00*Dpl `R*$0ATU% 0PE@0 0Rl @Dᨁ:R (0,00C 8 P0l00X0S>0p0P0?0X00 p0tP 200P30 R=0 U 0PE@T20H?o20$0S0G "d2$($B0#22cR<0S 420020 0L$Q   R D Up1p!W)R0 D ! $ R D ! $ R$!  $ R40,0000 100HU  PE@T  ( !X% 100X100+000;8D@Dt00 R  B0 D  0P00lZi i g 6?7?8?=?>?N?O?5?d P?TM?c H?A?L?` J?_ C?p\ B[ 9?:?;?0@\4 @Dʆ+8_04威@D0E D0BT4p(8#W" d400(40:Q  ;8D@D _ 0;=04HL0  : 40040 0@S4Dp0K Z0PE@ZU8tgx|p@p ⨃ ^):l0 0:00pZl0 0S 0X00\050P0;T0500 @D{5威005@D0 ;@{ 60050@ 00l(4890 (8(8:0;p600P606l 0XZl0PE@ZfUx 0C00Se 0 000 7 0pd41q岠pT*UR 0`4`UV PE1q岠@pW0`8@DQ{8D@D+8tgx|p@p㨁T7L0Q0 PpC$ 8(89v0@+Y\8@D 0w@D(208l0P0 0 0P00<0@@30 0`pC( (0R@D0+S(0,80080 0X0S>0p0P0?000pX0t0 04P4. `900p8 (89gSR: @3 0@0J9@0j900900 pC \ p 0T d \ 0h gP P:00p0 00威@DpC:00:0 0S:0:0 pCtp@-@PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@ V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000Ph@Pp`W2@ R2Q <00 0 0S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S3# R0S  l0pS0pCp)x0 00 0P,04C0p0 p0 0 0 30 Ѝl0Sl0@@@-fX=S???:P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPYP 0!(`3/@PR 8X8  ( 0(3/PI 8 (!P S>0Rp:oRS B P T  B T p X0Bp  (08#8@p 0BS.  p 8 d P S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?00@C/O-PM@ @㬰(0/U 0C0 0$SP $Cp`0 sRpW-(0p p0Ѝ0` Q`V00p=J\S 0W0T0S30b608#8P0U 0 CP0S 0SCU\! V ! 10T2 0 T 0SЍЍ0D?o 240%R00S020,0@0000,004@0D?o280(00<000 0 0 0C$0 0S03@05 :^`033N , %0! '05 %0 %!0(P<90C1P RP@00F3 0S C 0 $Q B("(R$AVG  ` V$  \ F Y( V F(*Q BR  BR^ : 8 Q  Rb4 %Q  R\<  BB!   S @1@ <01( 00 040$0$ 0 08@, 00SL I O-DMX03 0\0300 C Q???= ; -LD, qR0N80#8\0@qR0@80#8\0O-,@l0A_DPES8P$MPPPA_<0P0x@E 0P0@^00S| t0`"!!^001@p40 TT* RR 0 P^ ^ ^YY 0Y<Y<Y<Y<Y<Y<0Y;R @oP 0C  2 00!8ӗ1х1&=  tx l0J B0x t HH^Hl0:8HpXT`!Dp4`ᶐH@ᰐ00Rx0 Pl h`0 \0S8 B0l0\000S[ tCP`tx0l h Rl R010#P60 6SB \0P8 Brl0\00PЍl8  Ƒ R0Ƒ0Ƒ !  h0\0P8 BEl0\0{00SЍL$  O-d $M tD4Yl 8H0XT0#D04@@QH0  ,0BA?C0CP`PƘ_p00B8#( Ƙ#<0Ƙ@t30 B0(1I>RD30+"8ӗ1҅1&=  `tQI Y 6R06XP0l0t080T@V` l H 0U#@H@0 Sl \P8 B0 l0\000S}$Ѝ806&6 &!9096tl I Qtl 1Y^ (t0!SX R S. Sl kP )l `f@A p400D`H0` l @5!0 PH0 ` 0 ll R1#\ Q \P80 B0 8l0\0n0P$Ѝ\P80 B0 %l0\0[00S$Ѝ  O- ,0 IY!0 M@p䴟0UYZ0e&P* U! Er:\l`T`F Z PUP!Y /ooW"Z  ]ZW  00 #4 B %B B  0BV V`!0\ 8  ዸ\ 0  PE0CU`0`\  Z  BP 0 P  `QP ,8\t06 A],0l06\0 `QPl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \06&S06l0R, ` 6V`!VX\, Q* 65@ 0CP!P 1RW G/o"S W  R  PR#P`1`!WH80  O\00\0XPl<N^ Al 0&lR &&0R8  0C ҷ6,AQ  l00l0&l8 j, l0BP0l0\P`1`!W 80 \00\0c  PR#P" 0S $0S 0S P0X*SES[SgSqSS9 C0//O-PM@`?o2P0S}@0S0x S t0Ss0,0S$ RiL0Dp 0CpB ᜻*,0lp\p v`FP0*SWtpWT 0r ,00VpG*0*  00 P  t0S"l8P pLpXTD@4H0P  ;. 0`RH0`0t0l t0Sl  l \  60 tx`h  00Ѝ* ЍA-@P 0S $0S `PcpP l0t,@0S@1VTU@80C ƶpp@-@P$ 0S! $0S ?`PP`0 S0c``,0S`  *00 00(0p`p 900&p@-P@P pP,0L D0<00 B@C ʺ0\ 0 1 0|0:l@\@t@Fh@H@x ` p p@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:`k6 @cU@ĠL Â0 6PUWtPPA-@P P 0S $0S p`|P0p`P|0A-PQb!Tc@pTe?P0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`௟0P 0X 0@S P X 0S\\ \((PX\ L\  RH/Sv0S[Q gQ 0St0S 0Sw RH R .0 103/0@S0S>0 X0S S000 00#400 03 0  0#400  0 n0S0c0?o20 Ѝ0So |= 000=St *S/0Sq00 0 0&S+Bzl0S =  B0#2 2c0# 0l0Sl q000(0S9QH K0t0 0 0  R 0,0S0Q0Q0$ 0Q00R 0000 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00Q P p K 0S  0PESo p W *PG 0 ,0 SR0 B0Ztp 6l8&`6&6 &!909&tpl0pG0Qtpl0_ Wt0SX# :Xv| 6S \0l S8 B0 l0\0/0P0S P|X> X 0S0(0 Ѝ0S 0>0 0 0 0 0 0 S0 S00ӈ R01q 00 0SEQ1X P7 R $0SS@ ~S  z 00#  #800#"0 x0 0; ,0 QR 0 0I000S'  0 0S0   0S,0SQ9:z RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:L R+0 B0j00,0S!  Rg  S 0 Q)0S 000#40C0q000SF 0 B050#  #800#"0 IQ#V\ R8 C0 l0\000Skp\t0Z(l 8`pR B  ^L 6ƅp6ƅp6ƅ!909&6Rt0l 0C t0l St0 SX S Sl 8`p0  X 0Sq0 B000 B000,0I ^ ^  Y Y Y Y Y Y Y Io^ᩒ#Y@KP``0P0@&ƅ&p0 ƅ0 01I>  0001&=  &6`Rt0l 0C `pt0l r\0S8 B0 l0\000S500 040\ `B  *X6I &R \ R80l0 C0,000K  |0 0000 B08L0DC0C ᯵t0S*l0\06\0l S8 B0 l0\000S410\ R80l0 CLJHFDB@A-@`pPStPB T00V0SI0S: (0sT Q 1@0@!A00000 |0 `dp( 0S*t l00\ R$6S S L D0 BC 3060@D0 0!1 0Rpplp@-@*PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pSz $0Sr wpViV`F0HSr0FSRnZ WkFoY㫲[dV @!( `4/@Pk * @ 22)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fx00$0h(0 ~ Ѝ@ @0  000'-M 0 0 @ЍA-P@8PUPb8 `̯ 0x!(3/@PX `!@ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/080P- @ R* D SR$ , 8 ᓯ, @@ ᎯL DD ቯ 兯0  B6 0 &-;> 0$+0;/T O-@QM R0  P " !#4"  Pp L` @ *@+)0 @$ %q 0 1Q`!;  Č ` 0#:  Č (9  Č p'4 6" Č$ !Q P%D R ` @!A <Ÿ0# !Q#4" Ÿ " " 01Q"$#00# " 01Q"$# 00#0# !Q#4" P% 0# R#4!@ PUTl RR, 0R., R., 0#00R,. R,.0#00R., R., 0#0PE,4. U#. 0  A  @Q   " !T#4"Ѝ\ !" R !@ -Ppp  H ` 4  C-PRp ` P  0!\0 0#@B .P@18R0  C @$'8 C-PRp ` P  0!\0 0#@B .P@18R0  C @$'\ @-@Plp`hPp@` 0!đQ0 0#B   @-@Plp`hPp@` 0!đQ0 0#B   0@-1@4P\0 C @$!0 G-R (h Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H#7cHN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq$R' @-7Fc20L c! ‚'b "0C0  L A R,A B<P C,0@P @@ /qR' @-7Fc20L c! ‚'b "0C0  L A R,A B<P C,0@P @@ /q/ U/ 0`0/43|5ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O- ş pjDMWP@TĆP4R DQ- NP0P4 \ˀB XS-ʨ&σ pPpp Q-Yp& B&^ ScB C 00 p&P4 À fXQP4 !\˒0C`K P4`ˀXT$`; BXKT$T;!P P PQ͌Q- 1^ 22 ".A `{5P4pST.0J`@T41\0 0 00P 00 p0彯 !Z㲰_Q=0ⵯ00 PQ !  W Y ^PA ׼V БR"S & &  R[P- Y> 0 Ό KK0RPKPG 0 QR0C Y> 00 B 0[0000C01 KR  00N 0 @ 00T00s P\ R @02^02N00 R0P\DЍWP 0 [Q / !@LY0S F0GC$FpQ@Z p J  =A-P@^1RPA@D0+}n@R- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O-鲠 MZ``00RF@P!kΎ  R: Q@1 R5 ৎ@0`0@#4``06 RcUQpPv @P0d1h Q&8pDFh R00Su P`0@ [ ЍZf0p 8ZC8 !.P eR&(B(0 @`p0p00@`#4pp06PE`0cQ38fC8N@Pa6x0UGx#800P``pp0P't``pvApgTGxGx B(Q"(`0@APP0@#4PP06cR!0C 60S 0 S  P[`0@J R+=ʲPpeW6`p8C8000`p#406PEP0cQVA Ui@DH$H0 APP 0#4PP06 cTB 0C@6qppPg6Q0#80A6`00Gp`p!0aUQ6A S4 @DH$H0 APP 0#4PP06 cTB 0C@6r `[0@P`0f ' B("(PV\PAV B("(06OO-ʀ6kn@SMN 3003P0030 0300300%10 Jb ^@N$H@@p@p. BnS.H@Nἦ6S&00H DH4P  p, ! Ḁ@b T H DH)& B @@$D @F @dXDH&DHqZ" tqN.r@jTHp DH'x&pp@@p$D@F J @d^DH&DH0CS㎀ޕޅqಠ᷀jB^@N$HI @@ @"$ &J bX.H@Nἦ p#Rs `D0C8#8JO6S@ἦj 0c QA.P`kNP!``0C0aR! 6Ѝ@ἦk. 06Ѝ | p d X 6@-S k>@@0 #400k.06S0k. 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&A-`*k΂@P8#8 Q.;pNp!ppaS0 A0 0  8#̠  4##<V0 0 ^   *60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k΁6 S#H$(<0  PDHP@ 0@#4PP06 c^ 0C6 S0Ҽ60k.@PP@0@#4PP 06 0C6S S00k.@@6 0C600 6 k>@PP@ @"$PP Ɓ0O-p0@S M,0S ─&]P+(+%0 N. 0r?010S#@P j600&6 0!R1Q  S030#Z0SkΆ&0!2 R8, C8000 #40&0bQ3 B8&C8(K R!"(B(k>  0 #40编0iQ3 I8἖C8 Y("(98C8k0 00#40编0iR3 I8἖C8@! Y98C8k.0 00 #40编0iQ I!἖H30M>0k. !Pn\ N ό Y.NP἖ p m 00`" P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 00G. 0R0 0xS0   0LSI>W&&&& Ѝ ЍO0 &k0! R2 ʸ006N.V e 8C800 0#406 cQ 0C6 C8&!἖8C8἖28C8἖ t p :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&   p@-@P`h0P `0P F@T @դ000@pVp*(@ pyaratcid@-M @PoЍk@oЍ@-M @PЍ\@Z@Ѝ@-M @PoЍK@oЍ@-M @PЍ<@:@Ѝ@-MpP` @P +@Ѝ /p -Ѝ0@-T 0p@-S P@0 C`'0@/T @p 0 p0A-S Pp@0PC`'0@e/T @00ݨ0p@-S P@0 C`0@I/T @pĨ 0 p0A-S Pp@0PC`0@-/T @訨00奨@- MP L/p 0S @p0@Cu'`/V ` Ѝ舨0 0 Ѝ聨 Ѝ@- MP '/p 0S @p0@Ce`.V ` Ѝc0 0 Ѝ\ ЍA-Mp@P `P .p , 0S P0 C4@ .T@ Ѝ2`Ѝ-0`0Ѝ&0@,T` Ѝp@-@lPo0PPptcidp@-@`Pc$0P p!00ploobp@-P`!@P   @Vp@-@>@@-@8@@-@2@@-@,@%@-@&@C@-@ @R@-@@p@-@@@-@@@-@@@-@@@-@@@-@@@-@@@-@@3@-@@G@-@@`@-@@x@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`p@P   @pp@-P`^@P   @pp@-P0`PJ@P   @pp@-P`8@P   @ppp@-P`&@P   @^pp@-P`@P   @Lpp@-P`@P   @:pp@-P0`P@P  x @&pp@-P`@P  f @pp@-P`@P  T @pp@-P`@P  B @ pp@-P`@P  0 @ pp@-P0`P@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-P`t@P   @ pp@-P`b@P   @ pp@-P0`PN@P   @n pp@-PV@Y(0P p&0P 0pgntsp@-P`@P   @K pp@-P`@P   @: pp@-`P!@$HP p7P U &00ppatadp@-P`@P  _ @ pp@-P`@P  M @ pA-P@ X0P @p'`P  @P`*gntsp@-P@ (0P p0P 0pgntsp@-P`,@P    @ pp@-P` @P   @ p@-@R  @ p@-@"P $0P p00ploobp@-P`@P  # @} pp@-P@P A#@n p@-@"@@-@"@@-@"@@-@"@=@-@"@[@-@"@j@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@@-@|"@@-@v"@2@-@p"@K@-@j"@_@-@d"@x@-@^"@@-@X"@@-@R"@p@-P`@P  m" @ pp@-P@P "@ pp@-P`@P  K" @ pp@-Py@P "@ pp@-P`h@P  )" @ pp@-PW@P c"@ pp@-P`F@P  " @~ pp@-P5@P A"@n pp@-P0`P"@P  ! @Z pp@-P0P@P "@H pp@-P` @P  ! @6 pp@-P @P !@& pp@-P` @P  ! @ pp@-P @P !@ pp@-P` @P  {! @ pp@-P @P !@ pp@-P` @P  Y! @ pp@-P @P !@ pp@-P0`Pt @P  5! @ pp@-P0Pa @P m!@ pp@-P`h @P  ! @ p p@-PV @P J!@w pp@-P`E @P   @e p p@-P3 @P '!@T pp@-P`" @P   @B p p@-P @P !@1 pp@-P` @P   @ p p@-P @P  @ pp@-P0`P @P   @ pp@-P0P @P  @ pp@-P` @P  _ @ p p@-P @P  @ pp@-P` @P  < @ p p@-P @P u @ pp@-P`p @P   @ p p@-P^ @P R @ pp@-P`M @P   @m p p@-P; @P / @\ pp@-P0`P( @P   @H pp@-P0P @P  @6 pp@-P@! (0P p0P 0pgntsp@-P`@P   @ pp@-Pu@P @ pp@-P`j@P  | @pp@-PZ@P @pp@-`P9@ HP pP U 00ppatadp@-P`q@P  @ @pp@-P`@P  . @pp@-PN@P h@pp@-P_@P X@pA-P@p X0P @1pP#`P  H@P`%gntsp@-P@R (0P p0P 0pgntsp@-P`@P   @Dpp@-P@P @5pp@-P`@P   @$pp@-P@P @p@-@Q @ @-@R  @p@-@0 P %%p@PPh!0S c!p֗\!0P@-$@@C!͖@P\P 0R @-P Q yo//  0S p@-P`@`PPpuP p@X dX P I0 o@-0 7$ D @-P Q @4@ @0@ a0 "( (0( b0  $ ( 0  @-0< X  m0@-P M`0! &"@P 0P0 `  Ѝ]$ppp №P`   @J$ Ѝ B$@ M@- !@P $0 0 0 HA-pP !@P |0 0 0 ܚ`!PP  P `0 000 ,0X @`  @-@P @ te-A-M pW $P0 Pg%@P!`P  0P[% VЍAЍ/ЍAЍ/ 0 0t JX ( EГ @-@P w@ 2#p@-@P x0 00R0 PV!0P Q ! p@Zpp p@-@P `0 00R P4!0P Q ! p@pꀆL P/0 00R /P/<0 00R0/P///܅ 0P @-od  QP  QQ !/|L P/ 0 00R/@-@P \0 00R   0P Q c!00Ȅ P/00 00RP///TX A-PPM /o000"P R Ѝ R0 p 0 p `P 0 S  R L  Q$ pP` "  00 d X A-@PM 0 00R ЍQP 0 Y ppH `P 0S h P $ pP` "000( (0( $0    T + P -/o<0"00^ R  R/P/D0 00R /@-P ֚oꬁ P/D0 00R /@-P oP8 P /ol000"\ R RP Q  Q /  fP 40 00RP /dd fA-$0`SM"P@U Ѝ P0P pP 00  0xP S ! y@P d0 0 0 @Ѝ4 PSP  *l L 0 //p@-PQ& @R 0Q: Pp P  `0` `0 L0L L0 808 80 pH d  D $ p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@  $@-@P@ p@-#@P  PP 0, 0p] @Z p@-PQ`@   0 S S CPQ 0 S S C^Q<S0S !S0-S0F?o2-Q0S0S -S0-S>Q/S `(` 0 S S/S>S C\P `Sq 0 S S/S>S C\P0FU0 RZbPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0l(0S0$00>S`0``000 0pL L0L H0 0`uC  >R00p @ P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- aoO-d1KM0 `p 000Y 0,A P @ Q+ U aPP 03/P 00  @04/P 00 0 PhPPKߍP@ 0@;/ 0 @QPKߍ< G-@,9PPD aq`p@@0 S S   CQ R@<S,  ՑP   ϑP   ɑP0 S -S@0-S>Q@@0 >SS @S@=P@ 4A-PRM`Pp`0 @T- 0@0W   WV 0 /R C 0CW /RW  CW0  B/Q p!@C@T@!  ۔;@04D.0 0Ḕ 0 S* ɔ>hp@  RU U0@N0@ۍH? 0 ۍA 0 ۍ S0]p PDp [yp!@ C-`MCyPW@P5 ,,p`H pB pEe0R:p#0 `t00#p*  00 0ztp" 0PPЍ0 `jt00p  Ѝ@LЍ9E@@-@ s-@8@-z`P 0 0 ( O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`\`a P0 p 03/V@ 6/T @`T T @T@. 0S2 03/P V 6/(`0S @0 R 2/0P`#` P V 6/X3 003/Iߍ 0 0C/7 0 0C/. 0 0C/% 0 0  0 |0 l l0l B0C/ < Ŀ   |  \ X E 4 4 ; ,  p@-P@PP  P $0SP  R PSpdD_P P ^PP , `PP$ P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0hP 0 $ \00 Mߍ R00 0 0K/K댽 8   0/0/@-@@P 00#0 0 P 0S S R/P/ R0/@-@ `*t*p@-!@ (M  P l  ```YP(Ѝp<  P o(Ѝp脽 T $@-@M)@-$@@)ep@-M`P᪖@0 @0Ps0*0 00 Ѝp蓖0"Sp@-M@`ቖP0 Pqp 0 00 Ѝpt0"S 00 S 0 P:\03#/S 0 P\0///A-P`` ᡌ@P (spP ሌ@P sҌW@(0( (0 'lc$ X ( 00 S 0 P:\03#/S 0 P\0///0@- @PM @ Ѝ00@- @PM @ zЍ00@- @PM  @ lЍ00@- @PM  @ ^Ѝ0@-@P ,0 00RXa /P/0 00R / 0  Q0 R* R0:/- ^ : P *0 S0*/@@/ /  aP $0 00R // `P $0 00R //_P $0 00R //_P $0 00R //x_MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/8_P/l0 00R / 00 0  S *0/ ɒ\* /^P/|0 00R / 00 0 S *0/-  ^: ^P/|0 00R / 00 0 S *0/-  ^: ]P/@0 00R / 0 0 S /\P/|0 00R / 00 0 S *0/-  ^: \P/l0 00R / 00 0 S *0/  \* / \P/l0 00R / 00 0  S *0/ ɒ\* /[P/|0 00R / 00 0 S *0/-  ^:  [P/@0 00R / 0 0 S /|ZP/d0 00R / 00 0  S *0/  R* /(ZP/d0 00R / 00 0 S *0/ R* /YP/h0 00R / 00 0S00/ \: /8YP/h0 00R / 00 0S00/ \: /XP/T0 00R / 00 R /! /@XP/h0 00R / 00 0S00/ \: /WP/d0 00R / 00 0  S *0/  R* /\WP/d0 00R / 00 0 S *0/ R* /VP/h0 00R / 00 0S00/ \: /lVP/T0 00R / 00 R /! /U- P M /o<0"00^ R Ѝ R ЍgtUP/L\ /  JQ\/$UP/L\ /  JQ\/TP/P\ / Q/S/Q\/dTP/P\ / Q/S/Q\/Tp@-M0 P000 00S Ѝp$0@S `0-S 0S0xS hP T CP ЍpwPRP Ao/A-PP@8@Pp t=0,p0P4080<08P`p @@Pc@R @-@  @-(@@ Q͎ʎ@-@ @O-4@T `,@@D¤@`T PpQㅑ ⫎PZ P PZ  0 0 4 H z @-R 0P< P 4Q ,  D D0D @0 f0 000 0 ]P\ c8  p@-@M4 00R<SP,0 S R( 1`V9 P` 0 07P 40, 0C40P0 `ЍpS 0 0D ЍpfЍpR t t0t 0D \ \0\ X0D H H0H a0D D \ a ܦ 8 H  q 8 A-@`,p$PP W 0 !,,P0`M,P0`G-@P MpP 6 0`0Ѝ!0  6`P (0S1 0  *P (0S$`V00  0P 0S  `P  P X `0 zP ( (0( $0\ m xx ( ̣ I 0  @-0 \8  0  @-0 N P 0p@-S `  Q P@0@p 0  0 -Kx ̢ {p@-0S h`@`PPp<P p@ 0  0  8 4 @-R 0, B4 P @H@ @0@ <0B/, ,0, (0B/| С X p@-@PP$0S ,  Q <0 0 p@`IO-`p@ 40Sa HP@ P 2P0UP 1001000`SZ 0<0S 0  R 圑 # 00R&P P [H P P P 0  03/P PP 0 S O 00CS 0 0PS Px@` `0` \0J/2L L0L H0R/)$ XIPHh 8 h D@-@W0,S<SS PG-J `P0pUIU@* 404 SS= G000,0 100,0$ 100,0, P  ?o 0 2\0S PP*    0SsPPPPD D0D }0., ,0, (0.Fh ̞ D О G-PP' 0 0R"p4x`P 4 R @, 儡ᄑ! ,04 儑@ 0T:804 80`D0P 0  Q@-P80080/4Dp@-@P80080p@p@-@P 80 0R@ pP4@pCp@-@P \0 0R@ pP`s00S@#:mp2@lCA-@``T 0p0WLPP \000P000>0@S 0< p 0p?BA-`P 0 0R4 p+40S @40S,0 PP@ppHBA-@P 0`0VpP0S P @T @ @0@ <0R/@@AD A-PP /o0`0"Q@@T 00R p @P @T @ 0  0R/e@X O-@PM 3` 0R PЍ4 00R80p  PP @}`P ЍSP zP3 e 004Q\ ]4[_ P,10Q1 0P0ZUPE Pm 0P !q 0 ,0傁1`4 <0 04 <0 ),XG<XIXKPUF ء0   #P"  0,S<SSL<PP  ,0P`<04 0<0v100 QU. r ,P<PP_! Iq,04 `<0 0P4 <0P 0 |0^/l l0l h0^/yT T0T U0c/o@h80>̖ Ĕ   $ ԓ G-@S ` VP p P  000 Gn 0 0i/0넕 4 ؒ -0P M ?o@2 ^0S Ѝ00 S Ѝ8;@-PP M @1 0R Ѝ`@P 80 K Ѝ =0P 4 Qp@ R(*, S1  A!p400C40<00<0+)h h0h d0s/T T0T P0s/@ @0@ <0s/:  P Fؓ , H |  G P/?o0 2 R0S/00 S/T90P -?o82 ^0S 0 SB/9P/0 000R/8P/0 000R/8 P -/o<0"000^ R  R/T8p@-P^@P 3P 0 03/P DP @`p@YpA-`P @P!pP $P pV 0P  pARo&ꨌ p@-P@PP L QPP p0@{@p@-@P 0@( @-@0P _]P 0R R@-P0S /pP 40S @,0a3, 40a@T:8 408 6pT@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP4@pHp@-@P \0 0R@ pP`00S@#:p@A-@`T 0p0WPP \000P0000@S 0< p 0p>tLp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/.t 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@| P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Px80 0 @ 0 048# /UUUU3333  ?|: S0@- d S V Sb00Z r - w-!= S @^ >S-00 @Sx00: r-w- 0 SPD !S-00 Sx00r-w-0T! P8 P2 P8 Px 0    0Ss00 P! Ss00 @ Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-ApapP`8 OqP3  ppP$ 0A0Ap`@@T sP0=S AP` AT BU !}{.qpA{ 0 C-hh"h2hM 0 PDH L0TPm PX`p ㌐吐唐嘐圐Plp@Z pp lp@e 7$P  0p@] X04S040p0@S400408<@6(4r(t(0[(p<1<0 00D00 0p&(X %P{0S  ep@ ;l 7l =@ЍOoBЍ@*{00 l l l,\ ,\ ,\ Z LZ O-p`M@ uP-TPm +T@`0 0Tj W p p?  0k0 k P p  !ˎ @00D \a0DSW0DA0DS70DURY :Q P   S  R z "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@P^z0T0Pp p@-BR"^p@<@PKz0T0PpO-p`M@  uP-TPm +T@`0 0Tj W p p?  0 k0 k P p  !ˎ @00D \a0DSW0DA0DS70DURY :Q P   S  R y "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@Py0T0Pp p@-BR"^p@<@P~y0T0PpO-MHP@Q@0@U P0`8 P0"0 @`$Ѝ 4Rx"00xP`!0 $ЍX0 00T0 0P000uP00S< 6#R0P` U03[0<0P 0$ЍP`!0 x$Ѝ?/%1R5%%;R:*%6R1!%?RP`PP` `0 K`PP4 `0 ?`yLP O N N lN @- M|id@` @0S D <0 0 |0 30ЍЀ :x( 0@-M04B@ Ѝ0 0 0 9/8mNA00/ G-pA`BP@Q" Q Jv?XP 0 0U B  P1 XO-xH,M@p@0d8@0 S00@8`p0S $( ( kP@0+0C< W Pp  q 00 AB0 0 S 00PU-0 0XF0-SPU@jP0-S 0!000 ,Ѝ ,Ѝ60p p -U0 ` :U`< + B R 0eP00 WU E :Ro 0S000L6L0@60`u0v`  60  ,Ѝ60Pu `0 0PEPCP0 S000500S 0:S 5 ?0P;R0S00BX0<L5 000500S 0:S 50W 50 0+ C :R :S?k:i  0S`0  :R 0X0! $ 00Ol40`4 0$  R<$  = Te0P0x C000Z p @P @`pp@`T  GnPqP 2Q z  Q Q 0@RpT`0Sp @@z `S 0RZ0S" 2 00S 0:S  XD0 S2 00+ Cgc0JS0S9  00 S P0S`,Ѝp @ 5吵80@0$08px s@P! : <Pr;n00S. n0=S0`S/`V`X`V `ሀ]Pm0#S PU  @$4 0 |4 30ݍЍ800C80dm@x 0 P/zPm@ Px 0 PzP 3  e e0S800C80}  0PP<0T#p`80 h  sph0W0$@@00HPlmp0 pPھ0 $0xC 0PU0Py0SY SW (Ph  >,Ph  60Ph  . HP`< R& +D0@P#m70 ( 0 0<80<0 S  P 80S 0*(  0   <`YyP P Pl0S 40pd8pQ <t+ * * * T* <* E t( P ( ' \' < d' |' C-T`P! ȠTM,̠Č L ,!,Pp 8@  #8ptx00000 00  $(NP!Q P,P[PvdP0 @)` P0 0 L0 30 TЍ@ (@ l<  -MЍO-@`! p8\M#< T 4!48P  #8 ሀ倐儠A0000 0  $(,0P80Q ,  dKP 0S 0 @嵂 0 0 T0 30\Ѝp_0 @@厂 4@a : P$ $ H$  -M}ЍO-M蓟 Ȳ Go 0Oh-0P }ZPf 1 S Sh x#@ l# Sb  000 S SU S0 R R R R B RQ@  BQRS 0 S1@+S8 -S\QUp @Ut 0SQu 0 p0_o 0p`R0+S6 -SH WhPPUpwa WP]& Pp@ S S 0QUp @U4 0S[Q> 0 90_o 00p+SR0S @S# 0&PP [_opR0S @S* 0PP` F_opR =_op`RpP pU/| h0 0 2 30ߍ gPPyudE DTR O-Ÿp2 MM0ȍP`&N 0AM.0; PY \V ܰ + b0+ T5 0 H 0 0 0> @P @ P3H0: S8 1!0 &% # $!d1 0 8 30P ލЍPPi@P 0 pP %100S1!0 &%x P \0S  S 0 0 &0 0 &H0 |0| 0 &0 pC | # {t t#  jz z pz` Hzd A-0M@P`p i00  0⦀P @T@T 0 PP 冀0Ѝ @ကP0ЍP -|| $M! 0 0 0 (0 0 0 30$Ѝ& -xx $M! 0 0 0 (0 0 0 30$Ѝ XA-@`p GPi  0 p 0L ^aLQWLALQ7L \  R AAQ  R C`0C R0 ą S: C    0G-h@P?0 @RP:T !2*00a00q,,` pQ. ?`??p  S*! P* UR*0 QS * 0U000?0R*00x?Rp1?p#`@0 t80S0 ? S*: 0 T: |8|4|0|l \ {|{A-P`<@<0@p,00 @0@-M@@ 8 @0 Ѝz -,M$0 0 00d00000 7P !4 0" 0,Ѝ z@-0M,0 0(00@$0l0 00 07P ! 0" 00Ѝ>h 0 < O-`10TM0L000!008 0000 00 00;|<PPS @p`1000 p~@P< 0+S+0S(( P,$ 0 ( P 0$,$v,0Sq@# 0 0 L0 30TЍ0 qP N/P$#g 0 QH P 0  O-!1 0IM010pbtpPPQ @`T )0 ` @P; 0+S+0S(; P  0 e P  0S" 0 0 1 30Iߍ P ydP"Ug 0  h h 0/u0@- 0 0M@Q000P f0 P " 0S0 0L @0 0 0 30Ѝ0!YP@ ( @-@ 0FM M 0 `0d40p PPd@"+ P f0@f @R@ 40 0 d4 30Fލ ЍdD@-p`Ppp0dM 0@0\00㱆 ὆r0 (0 0 \0 30dЍ><44@-<@<M@ ^0 Ѝs , `8 #4`43Z!R //0@- 0 0$MPQ000 @0  @" 0S0(0T H0 0 0 30 $Ѝ0)PP ( G- M砐 pP E$e TP;0F W08p;t0' T C=PP!  T0@To0f0@Ff@  0 0 4 30!܍+f0@/eU@ 0P P]Qp x@|`|vDX 0- M Ѝ@-dM @p`Phh0 00\00 =0 (0 0 \0 30dЍId$0O-@ϟM @ \ a\` ` !`!b")b) ` p@?P+Td+PPh d͌P% PLpbx"n.'t *|bt' n* )fPldA, @`@p` iA$Hh(@Di!+f& e,)h+tf) .M `'`k(+eq `"$x`p,k$"eq'f& ! p*d (+ fd+eQ,P)P|Pe%(}eT(nူd. "   d)dAk(+͌"$g. ,k"  @(읉@l @&`g!,,@@ fH&g!"$D ! Li,fd$@gA .aH!*$DL aD$p(+- `j* +i j+i(P% `&b  8``ia,ah!&dlad&!'@$!_%4P_$! "0%q0 ?p0%0?SP@@g j\L0gS@pG"# ` *B0S@@:`F AQ\p@- ! 1 0M0 00 P@R00 113R0 0~? S `` 0~? S U PE0"0 1<3R08 (0 0 0 30Ѝp2 l Ȧ0@- 0 0$MPQ000 @0  @" 0S0(0T H0 0 0 30 $Ѝ0)PP 뀦t G-p QM稐  P 0E4ejP<0G 0S08C;t0' T DRPP!  T0@To0,`0@['`@  0 0 5 30"Qލ+`0@D`U@ 0P PWQ4@p p@`뜥 0- M Ѝ@-lM @p`Phh0 00d00 ;0 (0 0 d0 30lЍ]봣t0@-@P$ $0$$$A  0#EgܺvT20O-tM@ 0[ p D00HP&0P%0P4Zg& 0. "8 bnf+%0 " <(g+eK.g;@$@@dJfKn"f;,D͠eˌb;$e[ 0#H0cpmvmzNS ꫠa0< ' c)`0a.neL *0g+e; " -l`+0.j;`0#h0c=g;ࠀg{`"n a 荠i,`ak&Dl̠jˌ #j8b  m ` n 3i`Hp,c{n p'p}8b{@P l.b+ b*c@@$gX `m$fi&ak-P3 j+k[%@P! c; j@KlK.0+NN00NlˎYi[m4 6D=30+Li;h!L`L` *k0ꭠg d@ mČƌ͌3kˌf+" d,mČƌh+͌03e;#hˌ) n T0荠 g2 Pfl{ a" a,fk`Hhekb( b,e[P@]a[h& h,aa4bf% f)b+ L뺠+I╓Ij૗Ij k` d *R0 00//~@-M Pp @~G`P`W0D>S 0!31000 fGЍ>SH 0!31000\V00XV004~/-p@-MSP@U@0 ` ` `Px0x 08 R;0Ѝp@Ѝ/0 a0:( ( BT}5 5o @5=Q-C #XA\#\ !  +A R   R  +S -S =S000@Rh-+@"      000000 0@-A @0RuS#WSRX0CSH6 ,0!0R \PSPQP\     0 T 0+S -S0I@O-`VLM 0`8@ (P(0,00040Bp : `5U @ 'O.U@T2h7 `000000$  0pa0HSvctsrqp<nmlkjih/fedcb,U00T0@T`@LЍS!  "=X  R"   P:0$`T @ $NT R$ "@`0 偡   Y 0 S:$`T@ $NT0S$ 0"0C`ኡ0W X  0 0X ,X +X@ 0-S=X000$00 0|P @X B R񏐕~|{d]hvc`S  Z0$`bT P SNZT RV$ "@`0 偡   , =Xx +0H?oY20S ZrW 00 X00 Z$`.TP N&T0S"$0 ""@` 傡 0T 000 ~W  z ;xI?vI0t0rW  n |0S 0 S3*-P"+  @ LЍp'}C~p=X   00$`SP MS0S $0""@ `Ⴁvq$`S P $MS0S" B`01DsP{S00LЍXp+P-@ 0 +0B XR R  +0B 0+R XR  -R  X@PPQp`y @-0@ M  @<p`ЍP 0 @-R/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`AP+AU PU  0  P@P PPrF]P \000p@400R0PRP0 ,"  p@-0P@`T @T0rS Ppp@P0+Spp@P/p@-@PrQ`  0  P<0P0 `@p 0  Ph.0@-hA M@0 @c0P0 <100SGTp@( P G 00 00S3000 Ѝ0 0 @A0R@Gd0 00S d@> R00@ Ѝ(mx   D  @- P0"!(0040000010`0d0(0040000$ rd0+KY0P%Q%0z$0A``0 0A,0@E `0@p 0 `N`N`L2@tꜺ t GzGl  p T $  SQ ̵ O-0 @M Q:Tf PU# U* U T 0^ S^ЍTPU U U R? ^ @00@Pp`WPPPP P& PW P`0 T`P0pW 0 ST:0S#`@0Q @ 0 pP W?[*!]-xE@-M M0čK \ 0@ $03/L D0 0 4 30ۍЍS`L`G-`P``a V00 "5E@P5 pPI 0SH 0p R0CÐP0P1 U  \   1`V*o`Cq<pP Y  !XNN 0   1  O-``ş MMMčDş尠 TDp`0yNT/*0U@@ R R 40B?o2 000TU 00 S0E0 $0S}0000Sl\0+$0JF$0 @$0 2/Z$0 0@ 40000,00F(0 03/P   0S00*  0.S 0 S R V: R  R  ,$0P8 $0* R  $0TP$0 ( CQ/ 31 C10 0 0 P000 0000S  0P80: S 0l" $2 MލЍ Rw 0  R v P }EZ$0x@T  R c0M 04/P 0 000d 0 00 P06 l 0.Si0ST 0.ScP Ri  0@ 0)  2/0S  00.S9 H $0Pt $0 C 0 &P& 0 0NM 0RuC0 aY>M / 0 \^8^*| @h[O-xxŸ KMMč\`pؔܤ1 //\P  @P\/\   W!1 0 4 30pKލЍR7/\2^*`PW0/\ \@ @PP 0   R  A V/R  * R* R 0 0 00`  0P( R @ (0 3/0S0: SW/0 0Ɓ Ɓ^ 0L/0 P0P!X@XO-@ğM $M; ~R0`PM 0 pR  ᘤ嘴*R1 0 @ R ?R! [R!^ 0S0 R@000WS 0GZ 0< S J@V 0, @Ⲡ \< 0 0\ S #0 @ 0  p G0 R/R00B0 4[S 0G*0; 6P4S 0 0CPJR*0S0;R{ W @G 0Gz +@PV t"; 0 2 ۍ$Ѝ@P 0Dj Sq 0]S2!^020 ]R0    -R0]S` 0010 ]R0 @, ! ;  0LXm 0\ Sj0LXg 0\ Sd0@* 0Q 0A  001A0 6Q Y;P\@0  p?0Pd0G*0 ;PU 00 [0!^0 0@0SJT@a A 4 0 0 p P2F<00@0SZ 0 F0SK,'7 0 0 30 Ѝ ps?0|0p Ⱉp@ / PTpZ/ A \#R `A \#R aA \#R fA \#R~ cA \#Rw bA \#R< YAP#R  XAP#R WAP#R4 \AP#RI ]AP#RE ^AP#R8 _AP#R1 TAP#R UAP #R VAP #R 0S:V 0 /@T0S C K P< p0/@0000@/@ c0 QT@9/ R@'E00 /0/EZ0ST 0 E00  EV k0S @E00/0/PEP0@W0 X 0# @ @  / "0   @/@"0   @/@ / e``p@<L 0808Pr4 }0S E00/0/@xE@ Pi {r f@/ dQ6{eE000`X 0SCT |@@ HJx0@/ 0D@A  $=@/ ;08PP@08P<0"@1@I0 0EY0 @0S0S0  / `00C0  / @7@4@1@{-@@t p P?D @  H  0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF%pP P Ѝp A-A@0`S'@@Q0+pPpPP >@P  p0 @BAQA3M@ p0 p0 p@-p`pP`P[@T T0T0 R@@OpIP00DA-P@P`@p60S |@@? R"@`(?@P007D0@|T44@- 00 C-`\MP7@P- 0S|00V $"$ , UpЍ 0P  $ R%pȁYT$ 0N|㠁0|xx0R1 0QG B&Q&R-.4 p0ሀ Wtq{\ SzڙHvP h H4 ܇ t L 4 L Х   0O-,,% BMM $ %u  %p 000 0000+ 0}P 40 4.P P@\ qP 0S l400#S \ bP 0S 444d0``\ SP 0S 4d0``\ DP 0S 30   \ 50P 0S P0[[ ?P200xS0xS0Sd "L2 0 4 30BލЍhR@P\ Pl 0S <200#SE \ P 0S 2R0P\ PW 0S 100xS0xS0S" 10 0sS)0wS&0S#|! x1xQ0P \ 0P 0S jD10\ 0P 0S j 10 ! 00P00 $r0 000 00M?P2  (<  p4, T$/D Ԃ L 4 lt P4L T 4 p@-hPP0S P@L@@p@`@` 4P@0 A-`P`0 $S ẗp@@>P TP@P 'P@0 "C 0 Cp@0 0@?`-0P0 00 0`0 ` 0""O-0Ÿ M  p a @T ` !1 0 2 30\ ߍFPW 0  p L  :`P: 0S;p00P`P* @@0  p@ 0 P 0PpW*P< r ">0 "C 0 p@0 0>`-0P0 00 0`=0 ` 0 ` O-0Ÿ M p a @T ` !1 0 2 30\ ߍPW 0  _p L  `P: 0S;p00P `P* @@0  Jp@ 0 /P 0PpW*P<   ">0 "C 0 )p@0 0,>`-0P0 00 0`0 ` 08p@-L@`P@ VPpPpPP p p@-L@`P@ PpPpPP p p@-L@`P@ <PpPpPuP $p 0 00 l-H- M0S000 0 00  00\100M 0 R0    R 8 00 0 0 30KH Ѝ/(4-H- M0S000 0 00  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/L -- M0 0'--M  --M  A-`hpQpP @Q PD@( 0000AXe0P R   0//ᰶO-ǟ7 @T@!|P;P  00pUP0 B@T@!8@,@0@/S 00@-@PDM  @000пp 800S DЍ0p@-`Pp@ P 묿p V U ph p` ߿ܿV @ֿ@,b ؝ 00 Q?o?o 0C-@c^?c ^' ^ `pCc&Pc268270EG2&1H01./ "(0C0 /0: Q?o?o 0A-@@c5T?c"6T2 7T Pcp0Š7`nj 0E1Ì f2682702&0 1.?0 #ό"Ό C+ C+0c̠0: /07 ? P!Q/o/o G-@b^?b ^) ^ @pBb&`b4')0V4( X4G1Y 1. "( B1 /0@ Ϡ P! Q/o/o G-@Pb5U?b"6U3 7U @ pb0g7i 0G1c h48:4904H01> AOA1AN1 @B4+B1+bD01/4 6:  /Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0///0S0@-#/A BR?R0463R64b0A3QBA b3B .00/A BR?RCA A2" #@A4#a01#000P-+0R J?S$S0c03! 0RJ?S 0B3 B b0,PP `W@-1800p@-P@` ,<Ppp@-P@ !<Ppp@-P@`D <Pppp@-@PP p.P )PppC-PMP`V D@T |00L3Ѝp :  np@`$ żeY 00 R M<,@-700 0S@4 /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`2@ :P PXY  P @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍyPP @@ @;0(@$0倸PO-鰏DMP`00 0P0? 000 00S 4 T/ @p%S{ @0@ R0`S 00S S 00(4//#b!!"AK/ "bQ3:bQ#3P . ! P0 00 0 0 #>?3c112AK? .## .cR 3:.cR # 3 00 0010!00C0 0 0@ 0R PR0<R0@@mWjp%0KUSd,ba`_^]\[ZYXWVUTSRQPONMLKJIHqTy-;(>=<:87 -,+*)(Q4ih".{s(b 00 000; 0`0P `DЍ0@@0@000@0(p,P8 h0$ @PCp1 B9P @ T$0S* $ 0(p0,P$00@PCp0 '9P @T$0S $ 0 `0 00 0V$z[0@$ 000 GR +Rk -R 0400``PW:S 2a2c2SOR0c$000` 0(050 4`0tU0[04000000 @Wd0`nW`pW\ 0, 0 09 0I`0 844 40W0C`00B 00 0c0 4`0@0@0W%S0NW-|=0 `0r WD;0  0 p0p S00W0 0` 0 0 0U0 ^`0 0 0 0000 M`0 00 07c0 4@0`S0G 0X4 ?2c111400 00 0000 404c0#0`S400111v>C 0C40  /"b!!!A0400 0@@0@000000C S0`0`0W0= 0@/ @7P /@  7P` 0 0` Rv40W010 oWm 0 0` S0pYWW_ 0`0N00J50 4`0  044 400C`00> 00 0440 4440v>C 0C`00+ 00 0x40 40\$/A!b!b0C`00* W 0  0 0  RM 0s 0 0@0 0 0vP@ @ P) ` @aJaj B  B0 UR ZRU R   @K 04# @ ( 0$04`L(p,P@ `W0` (p,P@ `W0` "/#b!!"A0K/ XX"TbQ:L2bS0#03 p"10 !A 0  40DSd040ռ0 MR[ 0@^  @Q 0 "#^  z K/o "0P8 0`0000C/< 800A Q`A`0PQ0N#όF0 0  D[ 0 80< 0A Q 8ȴ`P 00`0 0@z[3 0@P 0 TR RO ` @D0 CR :P)\(\ ףU T QO n4O N l'$IJ $$I QA ALA ` \V6JQu8 @ 00 (0b$0 00\00C4PN00P0?2c 1A;S40`2ca12B @0@000@V@ A\N A R$ M a@000"b"b"$ (0(p,P$`(p,P$`40 @' R$ @  R 00@ p4`0 p 0P @0004 0C$0(0` 0p0P  @000 4 0C$00!0(0 ` 0 0P 4 @ " ( 00 b$ k 0 0 0>p@-0 00M0,00`P @  P00Q Q Q 2 0 l d0 0 ,0 300Ѝp <堸 ,囸 喸z$t,t,t,0@P/ P @/G-X# `p-V@P0PES  R  D0PEV R  SS0@0D@R@- 0BAs@ @Q 0CR M1@O-` M%VP0 A @&P;  &pP< ,0p01S Y& Ѝ0%0P%P 0 0P %0 0 ,=00 ,E1 0 &PRQ0@- M@@ (+PP TU +10P Ѝ0Դ Ѝ0!1 0 Ѝ0G- MMōhh P N`p P/p> @P<@ X0^00pAtAȱ0O00 TAXA\A6 q$@P0,  (@ @@P R!P t `0 0 5 30ݍЍ@00@000@0K`0d0   --M  uЍ Ѝ/ -- M0 0* ЍЍ/O-,R @p` M R00?y^# 00P @ P 00 P! !  :1XP<   !VP WE V[X0 SPpp` `2(!(1 00.# Ѝ`ႲpP2 PPSPpp`00庴0XP C0PP00 # Ѝ `f` VpP V OpP ``\@-@ M"(0S2 I 0 `0( `1/qpPp0  0 0 PUR <0PU" ЍPPTp 0S  0CP"P/0p0@-P M"(0S<  0 #p0( p1/qp@`03  0 0 @ToR <0@To{"1`VP ЍP@T` 0S  0C@o{/T 0 \"r/ 0 S"0 R/p@- @Tp0 Rp0 0R0  P 0S P0׳ c (ҳ 0P0 ͳ0 Sȳ,P ij4P 8P p@蹳eEp@-@$PPQp@~@- @@Q@~Tp@-,PP S@p~ A-M 1!00P00S   0 XR  0S= `@@p@ X8 CR71!0A0 S0Q\-*L\)\ ' 0 SX   "Q \ #R.Sa A  00C "\ #R Ѝ`0@4  R  *4 8/, 0X\S 040:8 R РS /\xB@-@`PiLpL0ppD尀 jT  =   ,0 @-P`@G.0 p@-h ` PPPp P p@PP3f]UJUI1 \l00p00 %00p70000   70D3xp2 poo=A-q@p P`Uh !2#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@"00W L!P0 $@ 0V0 P100S) 3/000PP0S 000S) 3/000(p00 0p3/P WPVSP 000SP0P 000ꤟLxn0 mm|mA-PP} @%`Py qpPg  00Rc<!"#b!0CaqV- pW 'PWV $00dqp0ST100S004 ^",1003/P0 0$0 00``0S 000S+ 3/000(yP`0003/P 003/0000S PrP0000h/>3МlkPk8k=A-PP| @O%`Px qp Pf  00Rc<!#b!b0CaqV- pW &PWV $00dqp0ST100S004 !,1003/P0 0$0 00``0S 000S+ 3/000(P`0003/P 003/000$0S P 0$000,iiHiiSR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP ڭ T P00 D0D 0 p`P/@hܘ\HgSR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP T P00 D0D 0 p` P$/$gx<(hfA-@P QP P@`p\Pᇬ0`P PpW (0"S U(@00@`O-PM M Q0` 0 Q /Q P.00H #PPەۅPp/Q/ Qq @P /RR.Q7  I  B R"/  D# P E  p P  * R,  R/0A?o20Sa/Qd(?0 V0 P/0000 ލ Ѝ DQ .PQ V 0y/S0W04ʨp !RPU6 # \*  #(/QpP V P/0P000ލ Ѝ Z`P ``(00 (>00 (00(?00(00' A-Ha@P`; >#04QP0,P= 0p0W& 10p p:W@\ 0 \S 0@ S @ 0:Sp@:W W0 0T0P < <00' 0 0, 0P/:P-0 S\ S:RS0@S0 S S@\ :R \:\0P:P 000/8`0@-@A\  \:^|^00^0S R B|S0 0:SS O-ǟM MtDčpĝ!^(,  ^ LG@`V 0P 0'  `@P 00S D [ & +0 00 ) P> 0Pv0 0 ` R0Pp`0 S Wp :S \Sp S Spp p0Ui*R0+   P 0`0 SWZpP 0#SS  ]P 500S0 005$@00400= pP 0:R@h @R0t4 00 0p<W`P/ vV* v):00d00Z  0S m 00i:SZ P0U:H P PE @P`< 0:R` ` R40 F C 00SpG:S:0D 0 I0HZ 0 E0   0< P@Cʪ00DpTpPETg$H PEpG@DةP Pp@$$@ 0S M, E0AU0:(0@"2 0 D4 30ݍ Ѝ0 0 0ᬩP@P 7@P| רx2P00PS0. 0S$n` 0SRO %0@b%@00    <PN00S00S\S00 R{AP8 0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S@0@ A@N0S't!D1 0 8 30H ލ Ѝ  @P 00 C 10 Y P ٫@P @@PP P @ 00   0uP 50 0Pm @jظ@ DD Ą0 p@-L`@` 0PS y0 0 00p@   G-`= mPP dH@P 0:SS   d: p \SP0* Q@ 0:SS ^S0S:S 0Q0P@ @@d ዧP 0:SSd@0Q @PA0n0S:S 0 C\6B C2RBYU?PK<;:9876?432802.-,+*)('&%$#"950+000C^/!000C\!P& P0 0 P0} Ppz 0 P0v 0 P0r Po Pl0 P0h @ PP PP P ֧P|F# 0P0wA-P= `P7 d}pP9 0S:S@@c0%0:SS   Q0@@dϦP pdQ@ @Ap`ᾦpPᗧ@`@@፧@" 0@0p@-P# YP 0Q @0XS@@<,00A ^a ARA0AW0AS70ATppO- AM Mhßh3 00(0 00SK @`p 0/04 PPO P8T   ۧ"00CS4%210/.x,+*)'&%$#"  ㄧ 4$〧` {0:S 84Sty"0Su"00"2 0 (0 30s K P( BKI8T 0:SSa0㼡44 440$0<4 0 S BKJ;4$ / 44$0C 0$C0$ <4$0C 0$CPu04BK I8  S:S1 R5 0B44 R0  0R!0100M P@@x 90:S084  " 00ULPH000044 P&  h  _ ,^ 0 00 괫-H-M0S000 0 0 0@  00^100M 0 @R0    R L00 ܦ@ 00 0 0 30KH Ѝ/5|dܪ4@-G0 @ @0 y O-@`,M$P:l20 R^ 00@`pR 0 QBHP Z p P p J Y J PP0 S"3#:  U(10 r# 1$4S!1$&@@x!00P @MP0S?"@!1 0 $0 30= ,Ѝ100S  U r pP Р P 5SX0(, VT00#    PP P0Ss<|HTyx\ X w̓ ˠ@-(@M@@0=PЍv@-Q@0M 0    ",  0$0(0T P0 0# 00Ѝ 0Ѝ0-$M  00 0啥P$Ѝ0-$M  00 0入P$Ѝ0 -M 00 0 tЍ 㙦 㠦0㘦/C-@P sMXp0^pAtA'0Oc `0PP0P0TAXA\A\ 0 $@4 (0 0 1 30sߍ뼥T0   O-ϟ MÍ$000`QY 0`/` ,  0(0 0 0  pP0'%Ypp, 0S0 R .> 0 3 30 ߍ P0 P 0 0C 0 S 0 B `0 zR2gPLKJk^~}|zyiwvuts0q,+*hfKa]\Zw``YCS000`0C0 PC 0S 00 0A@00S0  @DT& = P0 P 00CS0000@ 0D S*v0L0 S00D0<0 `I @H<8L 4  BPR '.\ 0vpC0j M:ZWp! 0`P` ` PPp+@MQ^T\RZYALKNMLKJIH654321A@?>=<;:9876543212/.-,+*)(!  UMP00CS0 000pWP0  P)S XR    0 =$ 0$        00 0P0 0C0000 S000@WT @0 P0@ S0 B0 0 R P00S000000S0J >. #RR 0@00T0C0 0 >. #RR 0000C T0 S P Y 0 00+ E ` P BR  V *@PNU 0U`0P0CS0V G*@P XR P@P5R*`P P0@@40 P:D0U0 S BA RP  Y*@@ @P`0ESF 40SF oP 0@0CSPF00 400Tw: `8<@DV*T  T0`0 @Vi 0$0P 0  P ~l$00p400S P0S> 0$P0 00000S @ P BR T *@P+ E` P BR  V 6* @P P @0P0CS0 IU` P BR V *@P`W(00S H00SWW00CSp0P o @@PPXYiU nU` P BR tV *@P0S񏐼R.0ASL`0P0CS0@ p= [P2V0*@P(Uy`0P0CS0 @p& DPV*@P0NS`0P0CS0 @p00@<00 0D@ @@H PXU  SPL00@900 0& 00  $  0$  㰀   +  00Ꜥw ԣ    l g 0 P 0 0C 0 S P `00@00   <00@<000 0P0^U@@00P080800,H0U 0$40A4 >>0@<@pD#C8`0-S ]Sh S\ P4 >>08`#C * 00000@ 000 0@ 0   +   +    )     00@90 0 0o *  + 000@ 0`0 0@0Z @40Sz@@@ULP  M +PJ >PS40cS9 P 0@0CSPF00 0 0P0CS00R*P00 P P0 P P  P BR  Y*P4`V "P 40@04`V P  P00CS0R00*``PeS굟?L00v0D0@a PT* 0 P@@0P0CS00T *P00`: PT*`P`T$0TPPXp$0\5000 00S0P0S#T 0@0 0$@P >. #RR  PR  B   P 00< P0>>03SS 0PU0C0000P000) 0S CP PYT Q 0$@0 0000C P0(P00@0 4 (P4 R*`P PV* @PM p  P R*0P00Ym`RP  Y* @P$@`PPP0 P 0C0P0P `V  0S P 0$@0 0P0 P0PC PT*@PS$0dxPTP$0040pX` T P 0  B0>>@I  vZ0 p P p0S P0SYw4Y 0S0 00 0 p >>03SS 0S0P0C0400400S dPbV`*0P0@`0! 0 G P: 0 0>>` BF  vo0 埞p 0" P p R`80<@pD00@ 00A<@pD`P 40P40 S 0@00& PyVw*@P_ PoVm*@P$00 Pth$00 PV*P@x PY* P800C0800]S0 ,0 P  0PkP80p0H`80v`Yp  PVP0 0 MP400P PT*0P0`0< PV: `8>0AC  * 0 v՜pY P#U@DP$ 0S0&TU pP0 T  P@DSP U~d0C 0P wp U@D`0S0 09P0 S  A-@P`pV 0 Q0@V A-@`P=<;:9876543210/.-,+*)4'&%$#"! #       0 D R R Q  R \000!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0&$ P 0` S^?0@00 0  %P 0J ZS 0  0J ZS 0-00h10000 ,Ѝ0\r  `0\s  `0\a  `0S\000000 0``0\b  `0\t  `0\n  `0\v  `0\f  `| @˜P 0_ Z0\  @`o yA- Q@Pp`! ̘P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0 P0 Ae < A-@P`TPp$T0 pAP_T !T '0DS%(0$"0@ !1 0 O-,,ǟ WMTǟS 4Ppခ儡@ X s@0P(0 b`Ḗ0P,0 0S00<0h 9P80 P  T. (`000P@Tp` U T 1 # 0G0P?0S0Z P`P P5%0 7e(0@FDA T @! Li`n0P$0  0 0080S V L0$ 0C BP$0a  ? * 500R  ` '40$0R 00 00 00 "00@\0000 tpT) (`,$@T$ 0 7/P0@0$J,H(F<D$$3 0 T1 30Wߍ@0SP@PR,00,' 0S 0S0  J0S ,0` 00D0UN pP00 0 0 @ `Ƞ06ɌPp@Q^O  ^* 0 309<80 Q*@P0000 S00S0 00 0@80@ SR0 0@0P$̖,ʖ(Ȗ4 02p00 GR 0D 0 E [P@ 0S0_* 0  6P0@00@ 00$L=p $`᎗0a 0S 00S: @0@:8qp$0qp!  C0P0, 0<00~s0200C@ 0@00 0 c0 0 c0 0 c@O0@<0$0,r r  d < $nT,T\ |  \ t < @-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ tj0j@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝܱi|ip@-@QM`P0  0 `Ѝp0@-@RMP0 w 0( PЍ0@-@M 0 00 Ѝ-M $yЍ-M $(kЍ@-@ M00000h0 @ QD 80P @0 0 30 ЍZg< tg@-@ M(0  0 0   @"D <0P @0 0 30 Ѝ+ ff0@-@QMP0  0 Ѝ0 0@-@R$MP0  0$ P$Ѝ0 0p@-@Q0P`0M  0  `Ѝp -M00  Ѝ -M( Ѝ -M $$ЍP 0-$M  02$ЍP`p| @,0 <5 S; S@T @T V,0`<,0L0`S00/S , @  opp 00vPv@  0 @f p@-t0t 0P@0S 0`00S᪎p@M((((垎LxA- 1 0 0PS`@(M @Ppp 00 @0b P& 00CS(  p0 0 0 4 5;1(Ѝ 0<080 " 0 (Ѝ0TL4 د  0 0 K0Q/0S/S/O-p`M@ pP-TPm +T@`0 0Tj W p p?  0o0 h P p  !ˎ @00D \a0DSW0DA0DS70DURY :Q P   S  R K  "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@P0T0Pp Hp@-BR"^p@<@P0T0Pp@-@0LM`Pp@0 'P LЍ`0 :LЍC-1 0MM`00<0pPl@P S \1 0S P(/ q  ̎P& 1R P$P yPP 0 0 < 30&ލЍ 0娀R 0 P PrPp0PS g@P(D(0nSYP GFxnfsLFuniop@-`T@ip@  P@P p?0Pn:Pp`@-M @ڎp 0: S  Op  ]Ѝ 0 ЍЍO-3$M0@`P0 9;$#;S0 000U00Sz00y e00@Pp U *  ᘋ@P 0G P p@ 00 p P PE U@*0S8 0S00 !  Y* 0 P  X 1T0PJUPX5P@0 @Dp@@0 `$ @'$Ѝ0 00 0y00S0@0帉P D 0! 0 0 u0 1@T 0 0S @ T  oP0 0SZ 0 ΋0@ nVp`s0 2 P,hDp@-P 屋 @T @嫋T0 0p 2O-P M Q   `peV 11* @ 7/P 0 T VK:0 0S0 ЍO-RDM4uQ@ 400008P P$ o 000T0(0u@D4` 0  $P0( 00  :/PppV@*000k000 R`d,@ `0P@P U` :/PQ 0Y` ,@0PES*0p P@0PU* E03/P00 S 4 0pE$ 0pZp 0  S ^ 0* 4@ 0 ,?0( $@ 40, S ,׊@DЍ$4V  PH PW0P@ ZV 0p'Sv0( 0S 40,000,($ 00P<0 00 0( 000,S$  C000(0 0 0$ P0C, 0 00U00U0#Sq `:/0P@p`p @S:/PX @Y0V0 S 0H  BT 0T@30@D 000@ U  00I 0SPp 0Z: 0 J3/P* @4 0PJ$ 0PP 0p'StW 0`0@  S`^0 * T 00T0003 0RP00 R0#03Q0Sq P0 S0  BP 0PC000 P 00C0C 00000 0(0 00R00 00$ YFPP @ ꉐ 0TP::/P [@00P0P5P1p1 * @:/Pp [:P0@V05S 0  BT0T@30@D   P0@R 0 0P @IT @00 T00T0003 P 0R^:/P 0TPP@pE Yᩐᛉ) :/P P pU0@P00Pd R  P0 0C0CR 0 BP0 C000H<0, 80 S( 5 $0, ,0$ bP( 00 Q$@8 <,@%q0@0#$0,040$0@p@- P@U 00S  RQ Qp㐆P ! 0P 0ppH0H 000S@-@(0(@$5xp@- @MT TPT @TЍp0 Q 0QP ``0`P 0 RЍpA-M@P`p0S$00;0` 0  P- p0 P' 0 Q 0 00CR0 0 U S R 0S$0Ѝ$0 0pP0P 000S@-@(傄0(@{2xA-`P@p 쀟0 00S (eP   (Yv0S PnP   e0Sap(?\0SX0p0RT2x 0p@-M@! FP ` 0PPp@ Ѝp@40 S0@`ЍpC-DDŸ M,Ÿpn?2cAAA@111A@<aP00AD?8P<`@ Rd@PW6!1 0 0 30\ЍT00à?d@DR ?P00S5 U*-0,!0 QP  0S0 QPW 0@d 0@T0@dp 0@U*0SP  PR @p0  0׈U*0 SP  PR +0Q0 x H O-ϟ M|ϟp 0S㨰 ` pᔟ` [ 0@00S %SP 0@zSzxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPOMEKJHGFEDCBA@?>=<;:9YCCV6/.-+)(4k^"#}{G E,T [n 4-$= 0 |0 30~Ѝ,PϠl4 @0 P $0(@:, #"0,cR:,c2S <  @@͟ 00C L``C@ @r  ^^A!/3b112A0 <  ̟ 0 cPp<5: cP` ;0!3b112A0  K0 S 0! [ K 0P Qd; Q00dP  ᇇ [ 0 S  R    BtQ1:0/A!b0dP  g [ 0 S  R   0  ``: Q00dP  C [ 0[  R   0  `k 9 Q00dP   [{ 0 Sv  R pd d9 / b !Q Q00dP   [\ 0[W  R Q8 Q00dP   [D 0 S?  R 9 0   ` -0 S00C  B1D8Q/0A!b0dP  ᴆ [ 0 S  R   1 '(0 dP0  ᚆ [ 0 S  R  1 p'0 dP0  ၆ [ 0 S  R  [ 00[006 Q0 0dP  ] [ 0 S  R 0 01?2c 1 R11Aãd0Sâ/d0CS0c0(6dP 0/ [ 0 S  R  08  8   `U80S0 R05p0dP0|5 0 [e 0 S`  R Z 0 0  `,N0dPS004 0 [A 0 S<  R 6 [4 00[^-  0  `! 0S8  qp$   xqp $ P 0# S! -R? S30 [ K  S Q \#1P "`aa!B! #<0 dP0   a 0[ 0 S  R   0  `1   0  `x`0  0S0  P P v [ 0 S QPt0` 4j0 S  1h [b K 0P[ QU0S 1 [M K 0RF Q@UP 1 00 / b !Q dP  Ƅ [' 02X.8.Q+lP)\(\ ףm   ~ d * Њ ` t H t p ̆ \w w 0  n o o n n $Id \~ } } S  R  1 h 0 dP0  } [ 0 S  R  8  0L08008<00dP@0 0D00H00L0 0X0廀! @ [ 0 S  R  0l0 S0Cڜ [ K 0R Q0S  [ 0 S  R }UPUP 4B18" @ $08VS` gS 0 `[ " " N"N Ϡ$0B!l0 8 040c1?2c!1!1!L1A0#/"b!!P1C  ã/ d0 S  à/d0CS0c0l3dP 0ඃ [ 0[  R  o~ P 3Q00dP  ᘃ [ 0 S  R ,4`0?< <$ d $0<  1 $<0 0  dlA-M`@P30p40@0000 0@pPP T p0EЍ" 0 ЍT 0 @-$$@M ЍHC-pP`X@X@ M T~U~@0@0  0 @ F~ Ѝ8C-P`p@XX M 3~4~@0( 0  0p@ %~ Ѝ8X0P @-DQ4  ʝ{ h0P@-X  S H@ @0( (@ ੝{ l0R0 @-\@0@PQ 0 0 0R B/D z0@-@H001UP0P  0!0$0@-@D001UP0P  0!00@-@LUPQP   00!0` 0@-@D001UP0P  0!0000/ᠲ/ጲ000/x00 0/d0P /0-@PQ@0/0P /0P /000S 0 00 9/`-  0  ^^$  00mNAd(   A-`pAQq@#0F P0啃Ï@hC12c` P@RH00p`PPUTp`L_ NXp@-HP@P ?|0S,000@ p@ 3|T$G- p P@`"| `FR00C0A10 0USU 10p   t |?U0T!P 000<10 i100 C0B100UU$0 P 0000 0 P 00000@ ` {0h P 00?0P00, ,\4L D(G-@0`萟#䀟 P #Qp{ PFR00C0A10  00 0UPQ@pG@P H0&&```8800A @^{̜<xs Ḓܬ@-(@@ @N{0@I{蔬G-p`|P# `Q@@PppW@Q`Jd X 0Paa{0OQ{pG00wTaXa\aX@Z_dr 000 D.@-I,@@0@P0S@dA-@P匀@_}`P(p0@aaz0O {ZO00TTaXa\aXP(0( $0 0 @ 0p@-05S P;{P0SZ sX@ 0CR\*{p@T P ZP@{PXl/0$0! 0/p@-$P@/~P +~$)~P %~p@"~p@-@M P$`0.&vP  qP DDN00S 3/Ѝp003/o |o C-$`0DMSP 0(p0 0@0$ <PP 0 (05,00S 3/DЍ 00,00(3/ PP 0S /A-M $P@0P }00 `pP {Ѝ00pO-hdyM(p`K|0PP ~ D|@Po 2 y20 RF y0!$@ !  0020 4L  00 0. $(p,`Z PQ 80 03/``|P"  !0 0 1 303yߍ         e}P } }Pe|P``e&((Xk k k k pk Xk P00/T@- 0UM 0H`0L10Np! 0H1~@{~pP{~0P`p  S 0#< ,0 0 L1 30Uߍ豘%PЩp@-MP@;\`P`Ѝp )^P [P  [P 00 0  PhHO-p`@(,[PP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW  {P@@d P5|00P WPh \h G-`R p@P8/PP @VG-!1 0M@Q000`PS UI U x.0P0!1 0 0 30]Ѝ 0p ) 0P00S00 0}PP  0}PP }0PS@Up$0T  }P3p0 Pp0ꀀp x}pP 0 @Pо0 00]}PꡗD~/ B/0  Q B  /0 R % B   %3 %//Q0 / 0R ,` , `! B  // R 0  B-  ` .$`$"  /0S :p@-@P0C0 | P Pp/0p@-S@ :P0C0 j P Ppp0S Pb"! b, @-@M0C0  00 0Ѝ/0S/ p@- PM0C@`0 0b"!4Pb4#0 PЍp0$00$00  /00$p@-P@[P 0S S pp@[ZP p@Zp@-P@[Pp> [P  [P 0S SyZP p@sZp0p@/p@-P@{[Pp >p@[ [0@- MP@YZP Ѝ0d[P 0S00 [0 00 S /p@-P@5ZPpA[P )ZP  $ZP p@Z0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030p< KUP7 mYP P (! 1 0 3 30?ߍ(3@ R. R  0 { p0S W0% p 0 | 0 z  R+P " R]l ^ ] O-DIM@,MI͍$$J͍@Pp P0`S S  p80$I= $0 2 Iݍ,Ѝ RJ- RW# " "  J=00岰h +4# 4J8#8  z J- 0SnJ=  0p0SO S UVZ J=00p,:0 3 00嚯000J0 ,0'QP @'0Sj0S  0S0s S0S UVJ= 0 ( J=00peYX O < KTP] m0S m 1b"!4b4#"R8VUJ= 0 p[pYpU<0J8 0J=00!| 0 +Pj 8J- 0SJ=  0pS Sq#< mJ͍0 pp p 00SWL2Sp S SJ=00Y0  SP pJ͍jPp.(`\ \ [ |D 0Y O-ğ MQdH4@0P0CS,v6)('&%$#"! 9 QVW00 R04 0S SQp#3 0 0 30Ѝ#3 0 0 300 HDp@`ЍOmVW= "44 8 T# #8By`P'T%0SR0S # $$("(4 "8#8 D)yPT QVW00RTD`XT 00" 0 y 7W* P00Sz "0 xT@@? 00z!D xPT`!0 xiT 1i #Q]0|||Pp`P 0X! 0 xP030#?Vp@D `0V0 0 xP030#?p@D0Q0 p0ĠĐp `pP0 U 0`@Dm    xP030#? \  vx`X,V LV U pU U T Xf T m |T e S l hS O-` 0 IM? P@pp6 %P PV  >P&VO g0@S00008#<tx'' 0   0 P'x 0 0 1 30%Iߍ [: JJ Z"448#8WX 0S UP 0 =0Y(A-@P`p 0 p 0P Lp@-MP`P@@P@T 0S  R0S P*@PЍpP"PЍpp@-PX@tH$H[p0. AAS0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0R00@-d!$M""00(  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S-  R  R R R/S /0S S S S S/@-^/ 0  00S S/ /0S//0S 0@-P M@P>0 PRD@60S0S 0S Ѝ0/0O-BMPdEV 0 껏h4 PA-X!X1 0 M0000@S8 S* v`V" p PQ 0S @ T S   0S QRp`Vx p0 0 0 30 ЍL00 0  3]@-`QM @QPp Q Ѝ RR fPP,8#<8#8U R R  P0R  Ѝ  R RD0 P 0  HD . G-`@ pqPP   @ @ !O- MHPP00P,`0 ZPE0 PT`Pb0  03/PZ @BU0 0  0 2 30ߍ0P0|0 S0$0 0  pP$$p>00@,0(p \ l7<2 L520\0 |0 S   S  Q  RQPP  XP[S|0R0Q0S P0^㄀S_   0P|Q ,0 0S Q0S %=0P40  P8m 4 0 B  Y0P00[XX 40<@ 4@Ḱ@PD`XH 0S0PS  R R  R + `P0  0 +<`QQ Q`0S0SP;0SpW :7pS0$00|04<@p8ll00SX\!t0(S 0SB xpp=@,*,: ( $*0 0 *40 Y? ,$< 80 T 0 d342 D52P |0SM0 S F SRCQ Q : \Q^3?oR20S Q@P 0 @pPp00 008040`e?0(0X0@S񏐎0S Z@Tt`WpV I Y 01P@0P0@pTPU j0P0 g帐`nP 0 @@P@$TPPkt`0S 0S k t0 p0 |0zmP$9l  0;P"| R 00S Rxi  wP 0 !0P00 0S p 0 ` ,p$P00y@T0 0,p $PP` Ѵ <kP1x00x0iꪅP@0T00T0@iP 0p O-xxqLM @ p PP0 0PF ``0S S S T@P `0S `(0( (`P00 U `V`V 00 v`V0S 00SU$@LЍT$ G-`M @ P[P p ` @D00 0 eP <0S0- `ЍoPh0 HP h@@DNP <`PK 0   O-ppŸM  ! "4P ğ* $! ğa @#, P@dğD 0"0#P 0Hğc>  !,$P,$ʃ  $ "0P$a @ # " `!`&@ `ßj "! @ ßa  # ",@ ß$ 0&0# 0pßc> `!,`jD@LSPP"P%P8CeX@ @#@$@#D 0 ,l̈́ 0 !蒟$ `ab``P P%P"`X @ 00#@E0`ጒ`& `xŸfm   "0X"a 0P 0#PX0 ,, @(BŅ@` @@$@!D`dM 0 0#0a `̑`& P`VP0p: NO0hV@Hp` E0S@@:p`F A5p@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@Q/D ̢G-d"d2 0M000L2L"00 P00;  `p0R @  0XS@@ 1B- 0CIR0  R0000#809L>01  00LЍ0 0 0@-S@ 3/@R]O-P@ MX Qs 0`  @`f&AA! B B&"`F`F"f&AA! B B""`F`Fa&AAu! B L B \ᧇ" 0\P3 L0 1 0T0p0`0`Ff&pGpGt'PEE!0F0C!6# G B("AA!0C0C1# B B%"AA!0  Ѝ QLr`0   0p  J K`f&pGpGt' B B&"`F`F"f&GA! B B""`F`Fa&AAu! B B Z0ᧇ" ZP Z Z 0\ 0X 0T00  p}0`Z$Z4 Z0 Z2  0 pl0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[`'&%$9"! 8* 000 @ @  @0{0000BdABdAndA@BdABdA`p`P00 N 0EP00 D 0PEQP0兀ಀ00PE0 0 4A-`MPpM&laa`GQQNHH0   @ N 0*Ѝ@ Q< O-@`!0PPRPPƟ MM|čƟU tL<006UX0P40 0 060D06h0H0t60P0l60T0p0,0D6P0< 0@0 0  ZP?o0 2R0S <0`1  @0` 0` 0V T D\T0h0S85080,0e?Ⲁ|5 0x0``VJ X,0L?Ⱀu@5 0?X& Y08 \PT,0? )R 04d`   VP,4 @+4 0kpp4 0aL4 08W04  0 `NY0SYP W0P40Z0 [#`3 0 |4 30ݍЍo` H0@$]/0S 00SU<0`1   3[  (\#2 0 |4 304ݍЍOYp$开,0!?0"(  \X\2T080XP\`@d[HHX:xT `0!$4$(#d"(dhR&h. V PP[ [ Z0 81L 000 .y*ZH0 HXXP\`@d l0   VL0  P0 @  [Z0 0L 000 .7* UtZ }[St||d! <  i- h hh4 T mt L dm 4y x  X 4 O-tM@@ `cVPPk0 P p 0 0  04$`18 $S, %ἴ0 岕   46< 04 (V 60A>< 0PPU R800 0[`1S   ;`1S0 0  0PL0  0P9P  PP&0  0P0  0P0  0P0  0P0 0wP`1Sy40S{ < PA0ppW  0R 0|Z0pW 0pW  0R| ,0iZpWg 0pWb  0R4 00VZ pWHpWE 0 PS 0 DZ`1S   %0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P  0001p 0001p 0001p 0wt1p 0ZXL YtЍ tЍ 0 /0 0  0 0  00 x0 uLl aT @ _ H ] l @  x p P 0  @-@`0 0AMM0 400p00 @9PP0S ~D 80 0 4 30AލЍ.9rmXm0,@-@ M pp P9`PxP 0S@  Ѝ00S.S 0S Ѝ p@-|0|AMPt 0  ` $ 0 @P +8 00 0 4 30AލprPllp@-P@Q`  @Q VPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝ| p@-@MP`f0S 0 @S 0S@V00ЍpO00@0 PyV00Ѝp 0@- MP@0@0 @x0@T U Ѝ0p0 0PVU:L@@ Ѝ0<00@,0 0PE Ѝ0W H d @] p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@V` HV0@- MP0@0 @?@T U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0P Ѝ0V [ 0@-@ M T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP L H  l \ $ t  d   0@- MP@O@ 5P Ѝ0 0( 0P Ѝ0 0@- MPl0l@0A> @0@T U Ѝ0O,0@ 0P Ѝ0,R Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D d 00 $Po$ 0 JPfZZ 0JS񏐹$?vs8p|7a>^vVi('~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      ]P_[ 0S .Su 0Sr 0So00S.Sbjh9ZD =400S 0D)0C ( 00, BOP5D0 Sz@ 0D;pD+0S0k `〠t0`Spb 0S @0D+@T 0Z4  0d 0 uP8(= <0 2 ݍЍ词@0(080 YPP 0 0P0;=400D S/D;d 0D;x700 6P( 00, BPH 40@寍@08(0 0P D;0B& 4Q060d 0 PD; Rp6 00 B$0#8 (0$00(0D+00pCW``WD+ 5 VJ  0PYW0 PN 0 0*PF5 00W0#80\5 D0N0C0 .  . 00CS W0A 0PD;`0DkV:Z`0 D P D;.$0F cD;|d0`d 000 hPD+0D  d 0 WPD D .D+0 D+d 0 CPD+0D;`V spD;`V0D; 0d 000 'P(00p,P`C 0P0 P 0 P=400SD :.D; D+D `8. D; 0D;`2Cd 0~0 PjP:D .D;b0D;`d 0e0 PQD .D;0D;0d R0 P>D -D;d 0D;d10?0 P+( 00, B;P!D0` C1 PpPU\ Ԡ P`/U00 FzP0PE0GS g0 mPLK   Dh Ⱥ t L 0 d T  0 h \ X 0 * | x l į H  x L  0  ( ̨ $ ئ t VUUU | ̢ =400SD W-D;d DD0 00 0 PD0` C<1c pPWW \ `/Z 00 FPu0J 0GW 0 Pgap`D D  PD :W0 0PS+ZD  =400SD;8b0`d 00N 0 P:D0D d = 0 P)D;p0SD;l*b`D;0SD;d*0d 00! 0 P =400D SV,D;d 0D;X30 0 jP(00p,P`C 0P0 UPC0d 030 0 EP=400DS$ 00$0C # D 3B!?C0 Sd0 'P=400D S0$0C 0 D /P D;0B$ PD 0 P( 00, BPD; pBqWX`〰 `V D;1 [2  0d q 0 P\(00,p`C 0 iPO0 PG 0 XP><0 P6D 00CS l& =400DS0&0C =400DSn 0&0C xD; D+ D ` +&D;媠0D;7Z0 qPDD +`D D +D;( D0`0(`l70 0 TP D p7B!?C0 SA0 BP=P D440a +0 1P=400SD c+`D D ^+`D;`0D;p82 0 0 Pp0 D $P D;h`D 0 P0 D 0P D+0D; 0Pt0 D Pm D; D h 0Pa( 00, BqPV=400SD; R,-4 R i0`d 00G 0 P3D+0D  d 6 0 P"D0D d % 0 PD; D+0SS ( 00, BP 0 jPD D *D;D *D H[D *d c1D;H[0D;D#=400DS 0d 0;0 0 :PDpWD'  1R0̠`` 00000=0 0H+"H = 0D;W00B- DH 0 0S 0 P( 00, BP 0 PwD -*D;m0D;`d 0v 0 PbD *D;0D;0d c 0 POD )pD D )`D D )p`D;d 0D;=0D _-4 R 0B(. -4 R( 00, B6PD+Qa>A?C0 S0 ~PQ=00H+C"Hkf=D+0 0A`D+Hk00 ^P=00H+#"HkF=D+0 x? 000#80l0 D;0B/ #0/0C  D;0B/ 00Z0D:H 0 P3Z 0 PD;`DkpW@ 儯 0 G1;DR5f0 10"300 0D;D+0S0L p〰 0pSC 0S `D+`V 0[6 d 07 0 P"=0 10"3- 0;D0000;D020 20;D0D000D;DD= 010!300;D0000;D0+D200+D;D+D+D=0 !  ;D+D;D;D;D;D;Dz D;0B, 5` pPWW t P`/U00 F3P0PE0GW 0 &P0,0C Y(PD D T(`D D O(`D;P0D;;2 0` hpPWW t P`/U00 FPz0PE0GW ݻ0 Pl=00H+ Hk̻D;-  0 `D; N:d 0Hk[0 PGD; 0SD;.* `X*X   D+@p@ [0 P* 0d `00 PK`p@ D;S: 0 PS 0)0C d|9d 0` 0 lP0SJ  0d 000 OPD 0 DPZD 0S 0 SP  D;0Bp( 0 *PO 0B@( =00H+HK=00H+T'gD;`0D;p0 P7d 0p0 PP 0 \Pxh0 PpD &'D;P0D;0 Pc= H0w0SZ-  B H+0H; 0-PI0 PAD &fD;`0D;P0 P2= H0F0S)-  B H+0H; 0P0 PD &D;P0D;0 yP= H00S-  B H+0H; 0P<0 WPD &D;P0D; 0IP=H 0PP=00-0C0H;0 H; 0/P 0 Ph0 PH0 P` 0 D sP0 P(0 `CD;S0D;PP 0 0,P{D; R0 Pn&D;d 0D;T30p0 P[0 #0C W 0 PK0 PCТ .0 P7 i D;0B" Wtڀ0 Pl"` pPD;WW` 0 P`/U00 F~P0PE0GW k0 qP0`0DkV:<0 aP e0 UPd T D;0BL! 5 D;0B8! /W(0 ;P1d 00  -Pꀏ p L T 8 ܠ @   T $ ؜ 4 ؚ  d 0 h , T @  D t  @ D  T @ ( ȓ @ 0 p l W(0 PnH0 Pfd M^W|0 PV0 10"30;D0000;D0 20"20;D0 0030 ;D0#100;D00;D000;D0P%DkpW`Dk |0B! @- R  MAL  ,@0@(@@; Ĝ0 ЍMM$000 1 2Ѝ/ሽA-PSp`@@V0 X:@ DDH$H@PU #P( 0 @X:DG-0pW::P0 @4#$4T00 ` 04#4 0@T#0T4#400S0 XT0 $( ,0 P@@ꗼ( 0 A-QMp$0PS@` 0! $, (0v(`V0S}(0S0! , $P, (0V3100O#Pq,0 \, l0U4#4 00,004#40,(0T0PT(0 SF0P$00Q (0, Ѝ 0F0P=, (` , Q7:048 BC, H A-Pp<U P0 @x0W``W 0 .p H\p@^0070.200 0 S037#P00 \00/xo/৴`///@-` @0 0DM0<000p2 00 RP;00P@0P< 00 0 <0 30DЍY dO-1P0ਂ0 M )੒ q i C7'r0ApqB$ C@$AQh!dP`3@@C0*T8W@YHX @0  p@0 SP$Z R 000    00 R@ ЍW 0 nPD 0 dPW H 0 ZPY p@ 0 MNPX : %I$DA-`pP³0S.@ ӳT$ 0D0 .R T  S\R C @D.R @0.  0T  S\R  @@@( 0 p@-0M 0P@ 0 80P k`\ P<o4 (0 0 8 30ލpX0-@- M0@R0  >PP * Ѝ@Ѝ/ J& Ѝ@Ѝ/XPRp@- `@P PP0 ?p@6>Է00pPRp@- `@PPP0 ?p@>겷00pp@-@Q `wPPP0 ?p@=꒷00pp@-P@=P p@ p@ p@-@P 0P   L  S nP   pe 0 pQP@- 0R R  P 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  P * T@T @pP  0 pp@-PP @P   T 80,D0S  0 p T@pp@-@P> T 0 4. kl\ ʠ5 6'l 0p0O-M`0@g;~ >p0S @P0 0 0&\`-Q-+*)('&%$ q 000Q 00A S P @1T00PCT Љ0I \ @00A S0P 0 EQD0 0 \0\00+S -S000\000C Q0S\\00S 1CQ$0C\0\ 000C \\00@0C \ AQڼ(Q(a(\eD<01 0[(ZN T @Z h 0&(00 Z0C 04<01$CKk h 0 'kZ 0Sa 0S %0jS 0 JS 000ʙ0 \P\Ѝ00XS1 `\`0Q QH0 9 5^iS IS NS\@?cP \00(S 0* nS h0l $ 0S@ZF$0S `Xm Vm Tm$Rm Pm~"00h0l P\Q  ЍP  ^PA\T0 0C Qࠃ0 Q\ J0\000C Qࠃ 0 JS 0000S 0  S00 00SZ00 ()1 0 j0000 00Vb0P$0 00 (S B ?00 0 0 H0SW 0STX MnPk `nPf p  pn 0S P  gb 8@PaP'7aP`p50S l 70jSk&pBh6 0+jX 0 lPhq0 j`l l l l$@:lP   ! |0t nP`  mP t0VS 0 pB p0R 0C| 00CS`P6 b PEU B0P`@fU`Ff0pX@@00S0SpG@DH0Sd 5mP `l0P(0 `6l(0W`0V`mP` 0SP 0mP TK mPFP&  a 0" 1iiV\( 4liXp4 40##"l@T@4`V 00S0jV0S 4@ $3`P $P3fXp41@D0$",0k60C,0hB@ 03i&i 0@&3 0SR 4PhQf 0ihDF P@#p3`P `k k ~k$|k zkh0l +(Mf 0@PESPH0S `p000\0Q `000S` \00S 1CQ)\`00C00000Q P18<0\ 1401"YMS0S#0! p㨀 h0XpSl剑5Al h1 O-ʟ M MDōtEd倅 Sp`Ppx@$ S S 0 0*: 0 D5 30kݍ Ѝ900(>)0P0 0,0,+ 0 0 P"448 @#8US#X j+0 0|5 0 0 P0 X03/P @U:0G?o2L0W0S(0T X <P X (4(0H0X0H@00 U4 |%80 @8,0T0>D P0 p)0 X03/P+ @ U: p  @T0 X ( R W  R 0G'WS9Z :U X0  AB pP4 R 0d80Q L0R00SK Ph@` pIZO[P 0 00S !烡 Z(B( /oU" R WS0\` P`600X 40S@0 I@H 0SSQڰ S"@UP0S 0 0X, @C 0@0CSX:0,P Jm*80@ XC 0 0CSX:@@90 0 RWZ5}0 0 Pe0  TOX0  BRQTᱝX0$0X> R R R D000X>*P00 R*W 4 XpR000pՠ00p  QX#H 8 Q*p 00٠X 000X0408p040,00$0<0|3}0 0B P0 S  TD ,01Q05S*X@@0唠P@X@占 0 CR00X:X0  @0X 0p0%< pd+ PZ<`aX0 @ BRQ X0@0X@ 03/P X,@ 0(D0( P 0, 0C0 %X0 ++z P00D04!000G8!rDl$Xv)PX0  A pPk0 $  TU40SX@0@0SZ@X@8p @@%< TX0*AD ,01Q *0X@@0X P? *E,@ 0(D0@(0P  ,0 B   P ;  4 A-0S`@M07 S20p 0&PP: ~P5 80 0PP&  0 %0P(tU Ѝ 00S S Ѝ0p 0(\( 0 G-20BM0400 00`S0. S @ጢA~ P p0u #0G(*P @T *X@ <"|42P  0 "2 0 4 30xBލ 0    ! )&@PI PPD 8 0 0@@PBP 0 00 00000 00@J(T8 0 p pIP  00S 0  0pW(   0 0ᾣ 0 ( 0 (ᮣ 0 ᧣ 00S SᜣD̴ d1 1  x0 G-Mp0`v@P0P0 0   0 p`FPwЍ 0 :PP A-M`pPP@P , 0 (   P$ @TЍ0, 0ЍRQp@- MP``8@/0SE 0S 0S0sC S 04>  0 40 0 0P@hP00 ЍpR R / 00 Ѝp0S ڢ 00 Ѝp0S00  0, - `  O-LLğ 00 `P  @ P o"00 0 Y 00 YP'0 S$: 0C 0`㳐ЍP`T 0S  0C`ÿ 00Y 0 0 AI `\` @0\ -" 000  တ`{`ꏝ 0갟 4O-S,MP   0 0`V$0p 0#0 B0S0 Q6 $ R00S B 0S 0W  !P ὘0 ` p 0YZ U0 00 @PP $ 0SRRV  RR00S$ R P 0 Dd0Pp \R T| R]  C0$ Q CTs\g [ $ ڏP05 0SV1 ЋP, R0# P0@pP  R TP P% P, P4 Y  R  p0Sp,ЍY 6#00\000(W P PP P [s! `p@-@0P0FG p 00p`0`@pp0TSl 0 pp@-@PPeP P 0 03/P Up@op003/P U 0< p@0/p0 p@ 0/0  -M0 3/Ѝ/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0 R R R //00/00/ R R R //00/00/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@-@0TP M T T Ѝ0003/P 00S00 Ѝ0 0R0 02/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0R /C-`@QpM Q) Q PЍ0 03/PP WP:UR X$ ЍC0  0003/P PW*UX 0P0U URPЍ wPp HHAP0PSP  ;A-P`p@P  R 0 R 0\A/U 0A/0@-M 00@SP`p SW-   P R`V V V Ѝ W` 00 R D0SPV100Ѝ(00Ѝ Pp   (#p@-@PT`M T T Ѝp0 03/P 003/P 0 Ѝp0 00 0 3/P 003/Ѝpp@-@PT`M T T Ѝp0 03/P 003/P 0 Ѝp0 00 0 3/P 003/Ѝp@-M@P0.S00Ѝ@-M@,p@Ѝ R? ..R0) .Q -S.S AL#\0A QS' .S 0 .Q AAQ0B Q AAQ0B QS  \0A Q-R 0//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C///*0 0 / PM0  1 0Ѝ/ H0 4 /0 48 P @Qa P @Q㈀ ؅P @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] ᯅPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRQ P0/ $$  0]R& PR " YXuQ   Z J b" R Z A @Rg .R`P@n0@,Ѝ P` 0D0C  [4:_( 0 ,ЍX 0 ,ЍQ    Z "    R  PXY  P0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYyꔀ 0G- QpQP>*0S) R5 `0@0S/ @S" 0W*T   000琐    P 0S00NAT0S!@@A@0W( 0 { DRO-P3P#RP3 M0U 0p`\ @H @R9 R R% (00 ЍW@ Ġ[? A @ GRPR@\ 40S @[A  Y*@T*0P๐ 0A\ R!ɑ" 40S 04 0- M ЍO-S,MP [   0S 0S@0P0w @Pa \rTp000[000 0P0$@0C0@TX @0S @S^  0 XL*PST p@0T00S 0 Sh*`V` ^ N Y[ R0P Z PC Ȕ(00P0S  0R* 0G S 0S 0 $p0ATgP0"1 0\0[ 00圔( 0 ,ЍATX0S"  ! 0SP4?<00 R```V0 Ss000R0 ABQ AAX QS R0SY 0R?0)@ )F 0 ,Ѝ 0H p@- M P0 `00p @ !p < 40 0 1 30ލp@4t t A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލz4Dt s Q:/R/0S/S:00/@-\@3$* 0^ @R R R Ó( 0 0S0QA^ R! Q 0Q" 0 ASB @- SQ A 0SB   0  @脓( 0 / @/A-@P`TP' UVT P @TP 0p V 0 P( 0 0QSp@-`P@ 庖PP@`V  0R p/pA-PAUQU@A`pPWڀ1AP ( 0  0 ? 0 Q" @-ASRB 0@S A 0 ے( 0 /-- M ЍЍ/@-M@ %p TЍR/0-S0 \S  R 00O-@` M P hP-Yg +Y` 0Yi T @Q O3p;Z`PpgD3p0Z`P" [)SQ" K0I P0aIQW0IAIQ70IT| V[SQ;+B=0S \0J0 0 Ѝ  00YXP 0@ \@ AL\T@p@-BR"^8 p@,00a@P0T0PpHl p@-BR"^p@O@P0T0PpA-@P rMX`0^ppAtA0O0 TAXA\A`0  PP08 @(0 0 1 30rߍD2k k 0   j  -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/lj QPO-M@b 00S000p!R !03  qPP E`#3?`:0P*Q30A !!!! P 4 0 ଌ U 0C pSLP0 0@pQ 00S  Ѝ&T 0 @00Ѝ 0 0A-@`Pp0 0@0 0l h X(p@-0 000St@@@pdPddP@P @P 0000 0g xХp p@-P@Ȑ p@A-@`P1ppp0php T  )<0   Ag 8 >;@-@P0S  3/000S@誐A-pP@`  @ ;u000@P p@-@P~Ppp@@-@!1BMM 0`PF040@@@ @@1qPpS p10S d!p0@ U P@A0@ P> 1 0/{!0 0 4 302BލЍ=P ;@P  4/P Q Q 0 0{x0 00P 0 0  @T{0xe 0F. "l@V,h @P^QhLl -R 0 P0R 0R R0 C-$Ÿ$20#Lc\*0Sm S} 0C l l;Sàʌ͌fc\*0S[ S@a 0cϠa^l@Ҍ 1C0o 1fcf Qq P@\ pp0T0C␓H` G41@?L1c1c0P0B0P0BP`N4PQ` @PS( 0S l lVàڤ0@00002c2cPÌ l làL l là@)\P ף*Qgfff$I| 0P /0S/ 0 S/0S/0S0@//O-M0 @  S 0P$0@8 <@D0T T0W,Wn౔ŠPnnAD0@4j\ F查^౜NΠ @n nL4jR౸柵ƟL,౜BΠϠNl !B8 < jQx柵xƟL౜AΠϠl 0 A@jPƟ 0@c@sTP0SjQ v f V F 0Sj ` `U1:`X1! R< PEe@Ϡll  pC CP Q BW^oPU< H%@0 c sD0 8j0 ;R~ `@Qq\0&Py 0$ UTY WV] V0 0P@`$0Pp?0/ 0 /?0S BͱV bͱ 0$0  a`G12Bd@3&bCd`@GGd 0ԃ0.0̓0;2T;r70Ctw00p?YZ0c 0 ᴃ0+Q _P  .0㫃PVZ}c 0 ᡃ0+a o`  .0㘃[? `C#E@CP 2T1 0 cQ R@ 0@ V@! Bqgqg[pCc 0 o0)   .0fr?D0CpX1 # ?B1c1c0Z@ 0B0 ,15@02c2c2B !@" "b1C S/  0@ 0Id 050y.0.0|4:`vc 0!0&.0 }:E.€Qk9_u"nScm$Iųyc 0 0*Q _P  .0PPE`0@ 00T @ @D0 S0@@ @$ 0Ѝv c 0ς0)  .0Ƃ ]<00P<000084P<00Pz\ꌇT 0 0@-pP M0P0@=P T0S V ZPLPQ%  .   ! 0 0,. R0 ^ 0  ! Q0sԆ 0 Ѝ0 S, 01P0% V 0? VPՁ0R ,PPQP!V00%. R0R!:∫ RF\h 0PPC F>02YVF"F,l Rl0l0U"RP*;<Ѝ"R 0S*0Zg2 0*P;M@PP00C R_U_`,⸠  `PPP 00R 0R0S 0V0vW2 z6 @S%VCT00S R ;S,S SP0\- 0 (\ 02FSPPE5PspP>1PmpP, P00cP049@Pi@V|hlp崠hpx|…崠 ራ }ЍPt  0q [   10 0!0pS0S >S0C#1 0\X0(0P 0,Sl040P 0S   PTl6$ihƎp60$|ax倆0*;$L, P<@P@ğ嘄嘔00p8p[pT @D bY1:LtbW 1!/ 0Pppc  p0@P8<@ P0 @@ @0 Q0 3#唓#cR01:#cR010! 0 cR c s S R  l3@0 @j, ($ p4 1  @R -S +STP *EX1TP T00cT0W W Y8p0KpP@8<@ P00 8p pPPUS lQ8 X1X!@0d0 T000(aM@@`F T0P0\  R@ d?@D  @D0P0T0S 00 PHP@0 0 l0 00WPࣥTD,a__d_$ h^[@ T^|^@-\Fa`\`at!p0  ~ wP2L! `p,`0 H v1 0UP@@ w 0 0 t0 30%xЍ0娀 S``  {T 0 }{0l 0<0 0\ t0 30 xЍAv ē@R   z Q-D0D 00 @P000^ N DD0@-00@S $000S 3/QPp@-TP@Tp  03/P {@Tp A-h0`0pPM@P UP {h $0p `@ =<;:9p7l3j10/.,+q)('%k#"i PmLKJxh RwtLIzS WWT 0W   0Q񏐩00@0C \$SjPg u0Sq 0Wp1!PK  u0S 0Wp1!P;  u0S} 0Wp1!P+@@@3 1u0Sp 0Wp1!P"  u0S p  0Wp1!P  Z u0ST 0Wp1!Pg up0S> 0Wp1!P `0*S0 0C P@00C P00@ S0`a`0`F0@ \$P/ u@0SWp10P 5 u10S 0Wp1!Pu$0S 0Wp1!P * u0S 0Wp1!Pu0S 0Wp1!Pv  s u0S? 0Wp1!Pe > u0S 0Wp1!PV p <Ѝ 7 u0S p 0Wp1!P8u0SJ 0Wp1!P+pn  u0SB 0Wp1!P  u0S p  0Wp1!P u0S 0Wp1!P p] p p0W M*0P~ <Ѝ ep7d ^p{] WpV PpO IpH BpA ;p:vP0p/ @0Wp10P# z! p u0Sj 0Wp1!P^ B u0S p 0Wp1!PIu0SA 0Wp1!P<$P~0`P   pu0SO 0Wp1!P)@J u0S p  0Wp1!P p p pur0S p  0Wp1!P p zpy  uM0S lpl  0Wp1!Pu:0S YpY  0Wp1!P00@ S0@01000C0@ \$P u0S8p7 Wp1@s P  0'p0 $ Wp1@z$P@0O-ttϟ oM MƍH0@00X !PR !0 P{0v 0 \` 0S]   Rc 0(00D0>䰍00h0>X00@唰l0@`TPU @%U PU 0T  `J 0 R 00S0U`m0S @0S @ 00@0S0000PP -= 0 6 30O oލ Ѝ PsdP    R 00s Pb?`1RR `O\`.TQXQ\Qrˠ NHQ`G0L,X \DPt/0@8DE@P@cP@@0@ 0@00 0T|0P`p⠀z0%1$0 0GZS񏐧w<N_acqHGFEDCBA@cdOV~}|{zyxzvutrpofmlkjihgfCd0h6}+[Y.lT*PO)M*@0 G 0pA@0 G R$WV $@ a0P00U`| `h:( 08   S 0S@q-0z0Z;(  00 @TZ@@RPPUi@z{LP,P8P4PW Pq`bz@L,84%1$ S0PR00S<000000`BVuQ 0Qz0S0%Q 0$0QI0S00 Rs @DT L 0 Rp0 &S8 NaP@@z0U $ PBU0S<0000F040Z0( S@1 !40 S 0|  0   0 X7 PR10P @0P0CD0 S0P@0 |0(@S-0z00s80 p@@`pj@`-pj*`p ``$00(0@0S 0SH0( pqH0W ZZ @x/^ |l@0(pnpPP P @0 00@s(p>PP@P />  pXlP0 9ph 0@ (p0 3(0 | Z& Xn (  @Zz@S00Q000 RPPUR  0Tbo {d @pd`FdX 0TPPzL0,08040+0pz0p` 0p*W0 0 G Rp 0 G Rxp`tpkq00(0p@/^ kWH0(0boH0 P0p (@_pzp`O1(0  Z X (  z( @0(0x0P(UH %11H 0Z :z@dS~0sp `(0p@PWH (0010`H 1(@bo( 0  S 1(  / bz0pS 0z0  'tki\ighfc  c l  0  t D 4 xX} (0`0`S( H0qp(H0W Z( `P  H X PznpkP@l000{0f{0 SRT N 0SK plp 00 G R@@A@0 A R$Q  R(H 0!(00$ (0$0H $0S0c$0p`{*Ё1(0  Z Q !   R%q( <0p{PT0R4 RV R@ D8 `HV`V ژ 0 Rp`0 S08@V@DT8 pT R   V  \ 0Rbo` 0S0 H R@ @Tژ 0 Rp@0 JSJ0Z+ZVڼC @p@`JZ   0R@0 SgJZ0$ 0  Q0   $ PBUUڀD p@`PEU   0R@0 SAPEU$0 QP0 S ]0P00!<00$ `BVV`%  0@dPppp P@`FV   0R0 S`FV0@dPpp%0 \ ` 0QSw0L]0P000Ttf `` 0Pdp@p P` K[0\p0SK[ @0Pdp'0 Q @ 0 S0e]0P000 Y]0P00 Z @boA\@@P`AD00PAp0 S D JZ`Q0J0S ]0P00 H0Vڠ( d@pPtpp P@`FV   0R0 S`FV d@pPtp80^`0zS\0P000\0P000}\0P000 \0P7 \0PBD Q 00 oS:0` 0J? 00  K c  0 R *0  SK0    \ 0   0 R S0@Tb@ D@ P0p0%S` J? 00 \ B\0P00mD0 0Cp0D JZZ p@h`  JZ{0\0SD @00NSQ `Wzsʤ|p@P00L@,@8@)Sz0p{@\0,@Lp @ R Rbodp R C00! , 0g 0 @ [ 0P t[0P00 0@A: X (0( 0 @= { QH ( H yG@:C X (0( 0 }L,PQӪڄ08{4L d p`lpP, XRӍX,  B, 4 HI0Q 0 S0 f[0P0  PBUPU ژ0QP0;U@@ATTs P @DT0Q0S@DT 8 0^@0[0 P00H0S0  [0P7S0yH000H0fbodp!000  0g0SP00 @0GpBTo `` 0P4p@p P` K[0\p0S Z0P000 Z0P00 0q8 (10R+ S0bB- C S)!rھ @ΟcS,/L!b0C000A0 A00@0A^B0J/ ^@0`0`0Zz]@@p_L@,@8@hZ0PX ((  9SH(01HS-0`z0͵Z(  0 0+X ((  QH ( H @r  P k $Z0POz @0P4p,0 Q @ 0S0|005@@pL0,040_$ g X ((  Ϡ d  S (Ϡ 0 9 X  ((  Ϡ # f QH ( H Ϡ    3  S+ (ft{(p`WZ`{pzT0S 8  B0S0S S0L8 T,@@p_4@zp Y 0P J2{0 \,0p0 `( P\@0bo40{T008`4`4 0>eZ0 pH H 0S T  S  RW0 'e0@P40 @8`T{<p, 0,boTp dpA 7Y 0P b -Y40P00X4 00 ER0 J/*!J/00A`0p(x0  4HR !$ p* Y40P002ot @dhh唀`` ,PP`  @DT0\0S SD 8 J B¯Z X 0P bSH0(@@H00mSH(01H( QH ( H X ((  X{ ((   wX] ((  mS? (AϠ 0XS ((   YQH ( H  ; iX 0P vp \X0P00 SXP@@ ~ KX 0P v AXpX 0刀bp 0R$H $H !8%0  P@0 @X0 P00I0&080@@pL0,0_2H000H0Gtp,00H0S 0`c@PpH,P pT0LpPdWp!`040 0Y001 0|Ybo@PcX` H( @ H@H0000HH   H H( @ H@H@(  H@H@(  H@|H0H9SH0(H000( />  pcP 0 {p@* 0@00Q (SQ@0X ((  <S (X ((   -H0ϠH0 0pg 0 0 jg 0 0 iH@(  H@(  H@H@ ( H@ H@(  H@ W 0P >@s@B SH0(H00( 0 0`0}( 0 H@H@( 0 H@{ gfffw LO,ONLs ILp \HdFH(  HϠH(  HϠ@ R0L0,0$ , SH0(H00( 0jg 0 0 0@00p0 G R;@A@0 A R$Q R! p= R p(@7RH (((H +X 0刀p= 0(@pX ∀p2 RH0H0 @( @ `A-@`Pd.d>`.`>`p6L.L> 0`pX 0P  0 <P0H 0@E P0DU04= 10 }P(0DSD8D<.=010|=4 00  ` 8|ЍO5t@@C>0 SA@0c 0c60@DT0A0D00DS0<0  0S 0 (0 0 P00 SS00PC_o0C00P0CRS000P0 t@( 0R?0S @000 ,0h0T0Sp@CN0@6@d00<0@t`P < RQR00 B@D0A< 0PQ 00S7 `P bPP RPP Q+00 0R0 R00S   0`Sy<0`0<00@0TT0S`D0Sc,0S00Sr <0S( 0St0 0,@ B 0, 00  1CP0;  0pRpS 0  ^QppW 00SQ 0YD  @ ,0S@ P X#  `P  P00|Ѝ0S000E 00D0000@0( 0h00S,00P0 0 RS00000,0SPPU (QAژ8  01!r@ \8`0p" W 88 u@P`p 0D0S  7P 0Z7 =,0`S uA ,0H0(0l00 e@|7H00P1`Cfo 0 .&0`^p $%" 0P0PX`!H0U  6 6lp= 0 0pp 0`pP 0< 0 PP l0XPT(0 0DR Ps9U@ PP 000@0Sh0,06000*000 0 5` uA l5  0@PaPd 1XPWt@( 0R?0S00S6<@0`B 0< (0 B0cP00< 00d<00000 000QQ p`pV Y V  R R R S p cP P9W  01p 408 |ЍO 00 @008040Q @|ЍY 3 (0@c010 BDB\ 0`0#p  30`@pS؄ 8^<0@0<0000 PPW~PPT 00 0R0 R00S 001 `,0@ S00Ӣ?D2 (01Ӏ ,0S 2  0P,P`(0@0(0100PV L J0Tw (0 x P h,@!"`$APP P(0 0C (0tP 00Sh0S,0,p@ cP  700S0S0DSp0S S tP P T0D ?aCoc?`(?yPD?<';?@DH1?$@@Qw  s9R@  00C09,0S  P |Pd@0V0@(0f>0 P0EHXz PX 0H@)p`S 0 0`ph0PP@ PXHP p1 0P& 0PB 0X@0SH l0(0`ЂH0`P)2 (01Ӏ0,0b@ ,0[  L2`p 0W& 0 0 0`pZP  0`pJ00P 0PP  fP `@P   ! \P{UDZXv,0S h0SH0(0 0C l03x 0q 3T` uAY0S0 pS 9[p9  `P`q(  ( 0 PTg0 S 0Sm ST  0% 0`p PH 0PX ?UY@0S9QPl0@PX(01X`fl0X(0A0S46S T50S0 000@R 0 0SH46S0 0 v0@ s0R c00 00S(0 0(0100V`؄uOnL `P h0S ,000C0h0#h0,0q00C0 h0 p`19[ p\ YM)0<`=H 0!460/Q460//P@-@00 R@P@Rp@-@`0P0RP*0PpP R 0 R VpP 0@!O-0@MS]@DPqp1 0\[1`q0&:0 @@F0 R0 W 0 *0 @0S 00CX:X@D* R @  NP `00 0P W 0*!1R 0CX:X@D* R @Ѝ-0UM 0,@P.0L10Z0 0 00T 0      lP[P 댢 $@-#@-#@-Qp@-P `0@ R @P  Z00pQ ``0`p@-`ZP}@P  Zp-M Ѝp@-@ P` !LNN\ !@Ap- M ЍP/D -2")2b3c1@2`M1 ЍC0 00/ (0@-P @M  0P@ YHp`Ѝ0 -- M0 0_ ЍЍ/ p@-0@Q r P p0 S P1 p3PP   ! Zu@0O-`M p0D A QP -5Y" @0Su SDP @T [p 0S!0S'0 000p^"00 <0SK`5Ѝ<0S QI@ 0SC Y 0P00 8 0` 0QK<0SX 嫰 `V0KS  T RB<  "!`0c - 0V0=TP  @|TQa\PPl701P jU P T@   "! 03d0 0@<`| d `P  0Q/ R  B / 0Rp@-@P*`0B @!R@ @B@DR@@@3 e]0  `f2f`pS@ * A BP   P]pbhPPO-PM$@ 802`X 0P0|  -R-+*)('&%$ { 0 00R 00B S0p0D0 @ 1T00CTqЇ 0pB @00B S0P `@ EQF0 0 P000+S -S0000C Q_0S00S 1CQ(0C0(000C ^ 00@0C ^(AQڤHXHaH 0|S 0P|Ѝ0[HZ^ 0|00H 0@0 BS< z St ?o2T0T @ Z h 0 Z"$ ;01$C `pX 005SZӍ<0Sz <0S< %0jS"<0pJp0P000XSP ℐ 0R RAQ00 0S|00|0R % F [ViS| ISy NSp@ P 0 |0080000(SK 0 00nS 0 P|0P ` X P BT0/ 0C Q`@ Q` 0000C Q`T0 00000|0 080vPv 0<P0pJpWe0 $, "`pP 05PK `PBpUp  p`pp0 A0S`Z0QP0PGU  R [r0000D0P S  `00SP0`00(000 0 0<0@ HS B @ ?$ X0dd@/P   ! W0$P    !V@p$0P D0 P U@0X0 P@`PC0D@0 @`XPQ0C@D@P@T00V0S@DPE`F@0S$0DQ<0SU V P  P 0S0S @ `  @T0pSpPpW 0 #S$  V`0P S0|0 @T0T` @DR (p00SppW'0 Ph0t5#$(0 0#R00@S0\0x0t E`P\ tQU@  !RPK (0S  B\`0P S (P B $0Se0 \@0@COoWB@T ($(40@P @(4 P 1`pP  0P(0Sv    PD PH pg0 $#1 0 p W'bP$ $30X`" `\@ @"#z56 _EPEHpXP 0"X`\@`2!:?C0Cp4656,0Vb 0\"$P 0`PSTR0 000 Rh 0 0W'bP$ 10X"\"#z56 _EPEHpXP 0"X\`h1!:?C0Cp4656,0V 00!$P j0`P0S` 00S 1CQ `0C0@0 1 ヰ@P 00C0~P08 0000000 |0P P" 000` V瞯< A??Ns0$ H @0 0C10 T 0"|0 0 80P0P0PcB   1@PPP V 0 h00P#$$pfP  B\.(0SK 0 0R0 (0 1P pP 3X$P UPP `0 0C B`0 0$(0 2V 0 $L"L2PPh(pP   p 0#q 0T$\A \N 2-PA0$0aZ`P\0PF  0O$P= P|0h 0|0(0S 00CS(0 (6P8 ( 00C 0( 8 0 d 0 0RW0 00S S SA 000 8|0000 @BAR *0    bX00  0 b3"  (0S D0S 0P0|X"0 0|00Q00|0 @0|0X"0 00(00 |00 ~X"0008 000 `A@P 0@0C0W$0 Cn0 @5!0|0 0 h05pP#$6? 00T0 00cT0 Q PUR08 0 000P|0 SP0P`00(p`0,  4$$p#0(0V@TH @DPP`00C0009P S !l Nl l HlQ`@TPH0$`0P00|80P 7U 0P h0p00ch0X U"7R < 0a0P0Y,060P` $"< 5\ 0T"|0 0 80P @0R0@00 ( B0 RူSqЇpS(^Zq pOP :P0C$0Pj`" <00C1 p@ c\5P`S0!0P|0b0A`nVP0pe (0S 0 |vP0mP 0!0 0C  | 0AVP0pB!0W|06(0` PR0/ pPs P)0 |000C 0GPa 0S D@ 08 00| y 0Sw40P(000P00P0|0p}0|0W!0|0 (0 0#R00S0 V W 0|0 3S 0|0P`0P |pS!0|00 R0SD00D0P  @1@d@P000!0|000C0 @-00t 0O-RPP@ M@`PV 00 0DpP@  "8$8!80Z#8J @Z3pK q WG N@ "8!8P0LL#8S 0[ 0  0 Ѝ @P   ! Q``O-3ß0 M00@Sp 21 `000`C0  00 0Sl  0Sg SB0S00XS 0QZ P@  Q R^T#3\QcTPQ0 ^ \ <0QR- U00\0S{Wc*0 GV*0F@S3 F\   gU0 RVOWM 06S ЍЍT@DPD@ Q09 Q0Q l  l>P:00XS Q0RL)AoR^& 0 0S  0c1# 00Ѝ QN0O0l1 c, 0# Q:v00Q )Q  0| O-Mp<0` H8@P00S 0@0P 0 B@0P 0SQ^  H0PP   Q0DR0^^ 0S 0S S SK pPr@00@0 0c 0W@ !TpT0 Pe 0SUP0 @0 0R R 0\Pb S 0CPPa R@ 0D0CSڣ0S" pP[ 0[0 0 RYd*0  TDQ @J \  T @   T 0CC10B PDP|0S0SCU 0S S S ( VTP@"00ЍSu 0CPP @+P~ -P% 000LP 0ࠃ:L0@^ > L@YPl #@Ѝ000 PL 0\@0Q  R  r KS S80S 0p00 0p b@0S"00@@P  D21 2 Qn\ 0\0C 0 ^  00@Y 0Sg Sh S @0p 0ЍI  PePg0S`q S@"00Ѝ@ @QA@E pPJ 0H0Y@HT G 21@4PEz@80SjU U E-P 0 00b80S80S800c8080S xTp0+  RP!@L80S L80SH00@X \y0l 00f@`  BR"@^ 1P5"@!@V+P(&x W ' A-P@p`! P  0 P  0 PA-P@p`7 P  0 P  0 P0 00/\o 8A-@> RϠP`pl3 ^9 P 0 W@0 p0U@@PEPU 0 B P @` pT  0 B Pp0U@98C- M` p @P} 0  C 0C2S P 0S Ѝ6cz@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ Q0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/خhDA-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0@- !P@M: R @ 0S R0 @ЍQ0@-@@ T3#H1THPD1$LPA2 L+@L+l0n0@- 00 M0000@  0 0 0 30"Ѝ| Q000000 000000 j `i X1A-0@`T@ T P4 T8#8Sp'Q0- Q"q1 q.0R0pQP T@W00@   COPW@ TPZsX@03a2!00hA-@0 Qp`U$; x S V$%R JV@TXU45S 0A-ˠ Pa LRCs\ LU/ rR?0b03 P7  pp„ R ATT% U# \E20  r/>4̠ @@\ \/,Q P AW/pWp„A !  B E@T@E0A-ˠ a LRCS0\8 \TN:x10@o\0 ^# QR<0b035PPA@DT30!#11S!41 #<12 A"LA^U /B \ s၃p AT\ A Nr14L@QPUP@E 0  ]@T@?TO-`9:#:p \S)*P@ M"* 0\R$ 0 S6C 0:  Ѝ> *0\ S 0*p`W03"X  Ѝ4>70 G- PXl X` PD Xa`  P)3QB< Q7qW ?qD0 @)pY Q X Y00    $5;0'% /@pY X``@p@pW0VVA?@ D da2  2 N33. Ϡ갥ԤO-鄢 M! # @dtk{[@0R- P% X@R ?[e0k?0 C c4 4+3 0k# 0K>#@>@0@2 0S 0 ЍO?9 Ѝ X7 PHP0  ?{M`? + 0K# k6,+60 `2 @5205P0 P P0/Ġˌ ЍQ`b ЍO0@@0R P@P 0 ЍO 0RH0H000P0O-Ă M!j# FUu,["{Z@0MVW V0 `T $:S0{:H20Ao ЍVL Y< ?Ze0j?0 C c44*3 0j# 0J>#@>@0@S^ Q 3 #1Q11!01 2  L2!L F>!l"4< ЍOqYA ЍV P Q1 ЍO   V! `I?z'? * 0J# jb0/P P03 !0##1RD$1",!020 C cA.c00 //`p@-K@T0TUoJP( V @DOoUB@T p~T03@d0 L  000V`p@ (  000ppp̛@-@;0SM S^ #  0$", !0 C0c. =Ѝ^ h <$;S 4#>Ѝ(R03:045S <?S/ e ?S/  \;p@-!0@S. ? T5 S\J J P03H:04Q P00Cà0cTR7 ;P39:@ @AA!@aà$!RU00 p@ AABAR(R 0 p\0D?oR20S p@o0pp 04;!0A-ˠ_S  _%F \@ \RH RQ3P:TA!@L,lS^+ CQ03A:0 !00C0c$qaV 0C}@~@0p <?0 \Q AR^\R A0 a[0;0S ;0S P 0/45S 0 ;S l0l !;S /45SP/P @- P/;0S ;0S ?S/P 3# /R /45S @-45S 0/;0S ;0S /R?P 3#P/S 0//45S @-45S p@-88A!:S$&O#S,C>c0&0 PcT @C22 Q-pQ1^ Qp  000p0C?o R20S p RS00 L  000ppawTp0@-0!*P M!: %+ % C!A Ѝ0@ 0O Ѝ09P :#:S % Ѝ04>70 >-Ϡ M\Ϡ L Ѝ Ѝ-Ϡ M\Ϡ Ѝ< ЍG-T!MV#zO\` PpO$ W \$0 Ѝ0` GoP \M Ѝ 0pW 0 0 p P`U&[㉕eQ`ve` #>   0p`0#0 0 0S@@ 0A PЍ 0 ЍO-s!j_,M#J_%V `$@P T T$00ό 0 st0 0,Ѝ Tx ,Ѝ 0 9`V  0  0 -` Š5(ˌ$ @刅Q㤊 E000R0 FP @$N*0/S  #0!:*S0p#!`!H:  1!)0r0Z Sl\ QY0^ 3# 0 Y`FP0 #0#* 0h: 0Q0! ,Ѝ0H,Ѝp?/0P00P 0 0G:`ch!` #  \Zp#|`Z Q Q Yp R0`^3# p  ! #% QP)   0/ ɠ@- ʠ,ʠ\ l!P Q4>70i QP/>@-!  #  ^Q\ \0030# P 000 2 @-!  #  ^ Q\ \0030#SP 000  A-q1pP0S2 U`e@T`* 0S00 000AT !0S 02`te@!0 0D1S  000S 0F xd( 0p@-@P0p R pPQ`00App@D `80 0QApp@D xḋ0  0#10/!Q30Q#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P@pP   ! C`~ ((R00421S/ /@-@P0@0O-0M[ pp @ S0P0= PaU*0 F B  "G 0 X0 *0I0Cp0Y003 0[P^   p0>0 Y0 0[ PT@T 06S 0@ЍG-q0p@9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,11PU 0C  P 00Sj`P! 00000000i0S x0d0iV0S 80 ,0R0i @ <xdq|G-`0b@TP塢ڃ0T'P# Zp  !pMF0  n.  P2)0@R0C`0P003 `MpG P `C-0P!1^$23\ *G-0@P@DT`G !1PG*32\ =:Pp @@  Q0 0S 0SQ 0 A B`Q3 3pU  0 0S3#U0 E B S 02LS @0@P`P 0 0A-`@apPFF 0` P0T 0@*S UV@S  \ SL T 0`7S # 52#10C c2s#0FUTV 053 1?A-@Mp`@PBP @p!JW0T0  CND@D@5`@Ѝ P0 `00 !30 0ST0C@@1`Ѝ0S0/0 R /@-H1HQPP@M?r`P3 pP-0S  Q4 p 0: SkKP  8#800@ 0$  0,  0( 0 0Ѝ6EO00Ѝ<0,E 0 Ѝ%E 0 9 0Dp@-@700CS00 P7pP  BR  /p@-0rSL wS aSOP D 0 pLP0S e C+S. ^R# L0S@@p0KS0DS0ES0PS@P0p@-S4 @y7 P00P! !& 0S 3/PP೼000P @ P 00 `00aa^7@0`` 0p4PgD 0P000@-!@R !P 0C 0 0 S /4p@-Q1P0@0S2 0 EL 3000S7 0!$0 3/0P:0-p00P @ P 00< R 800pI0PkGfU4P005p  0@000 pC  0@00pH5 4-Ѝ/p@-@P@TS S S C 0 pH0p@,0p@b0p@6@000 0 0000/ ?`4 ;`@:AB98C D`? >`E=GH JFI`<''(Op'tKLM Np匀GF`DE`E DpŠ`KF GpJ Ġ`IpHHǐ`I JpKO ƐMLNp`L NOMpp R `p QpESPFpDGp` ^p0P``pA/`p^ APpM_Ām[PQ 0pfPMQ 0pfPBQ 0pfP8 Q 0pfP.Q 0pfP$Q 0pfPQ 0pfPPQ 0pfP UލލAOA ,!aQp@-P P4ATp  @P 41S P0p@A@A-4!@| pP31S L @P!4Q w0P0W0S!R PMoPP !Rp yW?Ap@ABE 8pDPF|H`'&&&pHIJK`L0, p  A AA` P  L0 H HH岰 S+I !!!EEEE,TGPGp'''NpNNNR.FF`&&Ƞ&TCCPC`CpR'BpB z 0AS[ RWI^Sx  a6/@ PK(P QP p 0D A2n0 a!N^ Q'`$Va```04a$ePP   ဃsc@|C 0 0 QߍO58 =y= Rp=[ P ʠ0 "ؒ4 8P0 p qD=@ =`V PuP0 \4S 1R!3Y 80rYYf@4P:`P3w ZŠD H 0 $'cP&80KB<,0(PXpQbPQ =@̠ 0P(4,04 8Pp ` aD#=@ =P(P &]= P Z Q=PPK=WG=@PB=@==@|" at,l\O-@(`10p0X 000; Iq00& Z#Z! 0J/S   0/ 0P00: S 00 p0 R I R0?004 <0 0 U! - 宵p"00SY `0 S00R0J Z aPu0000S p pP _0ppGorrX  poR Q0P:Q0Q:+@-$H @-@@ $ @ 4 p@-@^P[#,`UP$ p@螶 00@-$M @@P U 0P000 00 0 |p 0S$Ѝ0$Ѝ00TP 0p 0S00000 0~ 00t1m긌 O-@0dM\`P `T09+ \0 02+\p P@0D0৮ ` #V*p ` 0  0F p@  ,p KTx@@ @} PyU HЍ 3/[ 8DXT  @-M @( 0T ЍQЍ O-D"D2 0M Q0|00Pj@  0Tm !1 0 |0 30pЍU@p  0TU @J@@ DU01PEX %` 0?P00 02[ c G 0@@0S 0000VUX= <0  0. 0 R     0g(0@ <0 00  0 0 0S([ɭH 40 0 |0 30ЍO輭m<0  p @ @- M@`)`Pp GP:000 U ) Ѝᖭ4 @- @` 0T@膭 p@-P@@ P 0Tpp@v O-10C!0$M BH +(([pᰀ  @`P8#80C 0X  BQ|    Xq 0U P@ X%X  @0H$HS[Z 0`hU&h:08#8!0 1(0  0R 1S0"8!#8!1!U 0 0C01 VH05H 501|%0C0015% U*@ 0Xb僐 X@ H0B$HS񏐉k`V~}|{z)X0Ƞ,Ƞ PW* 0UT X !    s     jL     8P@ 0X%X@oH[$H8#8A08#8[01$Ѝ00 0   8    8`Fh&h08#8L08#8F0 ` P0@YC-Mp`@P&  PP!  00 000 0` Ƞ,Ƞ0@@!! 0 040000 00@PЍЍO-MPp@Pm 0   (R1 岁.@@ ^C f`P0I 10 岁 0@0 0D000d![&~XP@Ѝ ?`P0 !  10 岁 0P 0 001@0 P@Ѝ pЍDA-@P` A!811!X 0 P 0p0SM   L Ƞ,Ƞ P[00  000 0:ЍS)!1 0C8##Ȅ00P ` 50  % P 0 0 0 WA-@AX%XaQ A@ p !Q A!⁀``X  0!0 0E B0 !H8AA#8@("(R  B("(`` PPV0P!80 0 0 00 0QO-DMpP0lp`S"(0$ @p0  P 1"pC 2x '811h 0 c 0'Ȁ C000S[ ,Zpp p 0H 1$(P`PW 0X 08 #8 B2R񏐮h: 1! BRB*0S00 0W ]XW `` 000CS񏐁~}|{zxwvutsr4!qW  !   SR 1|%0C001 0 0<488 0007/ [pp10  0Q 010! B!  B ! B +811+( 0 Ve 0S 2$ (0 00 pP  뼁Z< $ (DЍ^ 0 ! B ("(R  B8 #80P 1A C0! +Q 0岱ᴱ A8#80  P0V0 o! B ("81W10 "     k 00v  ,$, P\ 0 0 0Be2 @ 00  I  U' A 00S 2$ (0]p00S $  (DЍ C !P *("( B0@  101`p'X   $0! B !0"x       w$T 10C00100 p00UG- `P;@PN `V8 2 X 0 `(  pW' Q0; R   P@ `10C08#80C 0 P0 0RpW 0 10C08#8R p aW`0 R  T`p` 0R ` P ` 7C-@P`Qp$M *00 WW 0GS ( S񏐡~TzQ0GSQ'00$Ѝ( @   0;p^ 0S !0!0  UPM W W W(0XW p W  :P2 H⨀H(弁MW( WF,0t110C0 8#8CS  (101ⴀ  P,0p1! B ("(RZ  _1p v P弁pP A0 00 P(0r00㸁(0p= `P 2 00$Ѝ0SB 0S?  0X:弁W^ v 1.긁0(0弁'# "⼁(01ḁ0C08#8(XNW) p W  uPlH(;꼁, 1 cP[ 0WS>qW0G 弁,p 1 JPB 1ᴀX0C08(#8XX0H1崀ሀ!0  1 'P pp 0C 0( 각 0H⨀H(0!1 p崀  Pp@-@`PP X0 00(0`00Q(0pO-@M,0 01 pPD ap`F`h&hV2 P`X%XV! @H$H  @W 0F8P h 00!01@0 @3 0U @EH$H 0f0@0p 0Ѝ " US ! B ("(R p 0 PЍpQ tP `  ἀ @P}  㼁0S0 (c 뼁0@S 0H 1KpP 1 X0C00CR  ("( Q  " ;QP (PP !@ B  B  `P'  Q0S0 V@UT@ Q 0R `0E 1pP p_ pPl xP^  pq` A1@D@@DH$H vP@! @1 0PY P`F@D!H$HV@ `F! Ap 9 p `1 0p1p`01( P  @T *p/000/_ @-@P , @ ($ 0"@?O- p$M2P (@0`$ \0 0p0p pP@ `  %0Ÿf#""`( "$ `$"     Q!  %&d!"d+"!  px10`00h1p0 PP `@  0  0`.01. @Z98#(5#l  00# 0$ b!00#b! 00 0 @ 0@P0 P0 0`0` 00$Ѝ>=iC-@Pp M' $Q`?PU($8 A#0(0 `P4`㼀` b8"#4b4#  0V@h ## Ѝ 08R(@R )P@ b# 8  #)P8 b# 0A-1?`@Pp @f(XI P 0刁$0@pG0( $0p ?W?@`G?`@`` 0$ <@P U 0$ ?pW ( 0$ qp0 p$0?W@`G?`@`(`@ m 0$ <@P U 0$ _ 0$ q0 0$ `R @-/ C@-@P 0 C@ (" 0"T9R @-}/z &@-@P 4@ & Po" 0$$8O-B \M T6  0  ^,  ~?  @00 ( P0 , D0 0 H0$ 4 p( 8 H4 < 8 0P`L@$@(P P`p,0 D00$7)$970#%'ɂ%)' "ˠČ 0#ˠČ<0 "$0  (&Ϡ' .( 0  *  )'& 0 )0冼᧳ . 0<0  4 8 ,  ",0+#)0 0# 00 @ 0Y$04(8300#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,`@ 0$P0#0p`+p ?(P)1 ` =<;:9876543210/.6P ڌ6P 0P#0Ġp 00P0?CP 0P 0# 0 0p dЍ0 0  +0#0 0p P4 0 # 0# ,0#0Ġ 003P 0# 0#0Ġ0Ġ0Ġ~0Ġ h@ F0# E0# D0# C0# B0# 0#f3Pl @0 00@43p0Y <0#d G0#_ P@0 0P0@4p[  ?M9 *0#D )0#? (0#: &0#0Ġc 0#+ %0#&0R 048 0 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0# 0#0|P0 0# 0#0kP  0#00040 0# 0# 0#0Ġz0Ġud 0#`0ĠjP0Ġe/ i.t-@--(-8Qh+d)8)`)<)%0G-` Mp@  000 0PaVJ QP0S 㹟PPL W`A 0S7 㭟P= Tp8 T 0S: 㡟P8 @V (! 0S01P0PW 10 T @0@0   Ѝ WPTU U @ U U X00YY ᦡᣡ @១C C B B B xB p@-0@T 03/@TdPP 00@T 03/@T\ɝp茡H00@T 03/@T$ਝpA A lA (A ,A @ 0@-\@M@P Ѝ0P  0P /pЍ0XO-pPR M ഁУ@  `880 S" 0SJ: b 0 Z  0080 S 0Q>0 L 0 0 Ѝ 2  0 0 2 08 @@ @ Ѝ  P00 0 00 0 tP00 ЍP   P  000@-0 P R@MPQ ! 0 013/Ѝ0s?0r? 9P10@-@0T1!\ 0C B  S P @Np@-P`V@1@!T 0N B@n\pSVpC- MP `@(@ <``0V"pؑI@ T`1 `! @D q T@ p PP Ѝ ЍYpP p`O-Mq0P0 pG 0E PU  @P 0U`1`!000  0 BX0 PU0 " ЍЍ@- M` @  P 0 q@pG t P@D @PPT Ѝ Ѝ ЍP/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:}080pO-Ÿ2 0|M@R0t00P`\ 00S80S `h"`2 0 t0 30|Ѝ4P  P8 p0\ 14p0pn`0$  8 0 0# `[9 P%8pW= ` 11!040 4PU 08  R88P@PX`0 A@8 12480Q8p :s0 S m08PhP8 ᦛP 8 ` 0`P 8pR00N08PםIP8pmE0`0hԹ`eЋ  43 O- ʟ M 8p<$\  0| `Vv 0@"4SlSj90Vn ,000`000P.  ]00\ S|  S `PI \0P0  0CX 0 !>01H0(0 p0S(00S0!Q0:X Z c/ \G c/C 0p0S 0 Z0 00p 0SZ0S00@2S708 R,00* 4P0P\ R,0(PK4`,0(倀К@ 0  p  (`VL` 8D7(0_V$704`8X00 S  0 \ V Y P% P PX V0"2 R8\((\ :P00S$8Q 4Y3 @ [`@, X`D 0SX 0 BPZ【PX 0SQc/ 0 00SP ZD 0 SR@T R000S $0S  !_0 0S 0@T `6  P0 SR@T *000S?00Z【 c/ \H0 SRr@T  00 R 00"00$$4 0 2 30 ߍ p 8Qd0 SR@T 000S00Z【 c/\p0{@ wx0 S ,c`]P((\X` `0R48 0\R408  \P0` @ R=0 SRI@Td `00_X P2 `0 R(S VPR V`Pa `8@40姛0 SR1@T ^000S00PN0 SRc @ c@ ``1 0PP ` N8@P@-@ Xs r@ =@ 0 SR @T 000S@ E  2 0T0 / + 8* A-`PpX@M@`@}000,0 0(000X0@nЍ8( O-``ßp MWA5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @R0@"2 0 0 30ЍhTŸ <AЍOϜT 04S:`X ~> P Pp` $ j   `X  yTpK`PYH  T  QX ( Q  ` T 04S`XA @p~ _X` `H`pI`@ T W`@Z~~ @-@0V@p Y ! 12@pU VYp:q?oT20S@` Pc0 0 ^A<~ @q q \} 0} Lp Po @- A0@ @ €1Jp@-P@Q 0P ! "0 2pp@p@-@P` VP| p0-P@  P 0S RP0/P*0    PP0/0/0@-@!@1 0 MQ020* ^3 0/@!TR*/ "RR /P 1DE0^ R QQ*QQ  Rh `0 0 2 30ߍ0@ 40 0 2 30ߍ0@ ꍵLy lx @x O-p0$M "!  0 00 P0@@ ᠰs#P@ (P P`& 8/P 8/P8/PY  0@0 S00 0 @0Pc8/P`T*0 0 @T:8/PY Y} 0 SYz 00` @TP* 0 0C0C@J BS0!AQ RS Y B30V T0Sw* S:P 0pC 0 00g0SPd0P@t$U\*`c⃠@W*0 0[ @ 8/P Y Y 0 ,  T [0P0U:$Ѝ  00SiY 0 0V~ Y0 00 0 `q 00S0 d0/R$ЍY v 0 S 0 @`YF PSb  BXYu  0R08/P8/P0`P08/ PP 8/P0 PK8/0P o8/P 0 J0P 8/P S  8/P 8/ PP P S*0S : 00S  eP 0 @^ P0 T 0 R0"! RS  B#10S 8/PS 8/ P PPJ8/P8/P8/Pv8/P``o8/Pu8/P``` 00S 0 0C0C @J ES0!q 0 0C0C @JS E0!fR Q0P:Q0Q:)@-eC- 4PS@ M  $3/`t  0  QP` m4P4S  $3/000 Ѝ 0 A- 4dpV:@T@T 0P R 00  0R 0 00 ʕ@P0`0dp@A 0A-`M p@P#0: S奕PP ˅P@ P 0 [ tdЍ6P00ЍPЍ( $$4/p@-P$0r0" @`Pp4 $ U0000C0  0R 1 00 0 p  0% 0 ?l X 0@-S N  0 0R 00A0 gO-4MSx`A`ↁP@p0 T0? S*Pk $ 0  QP So$R PWT[00`000aS0@ `d 0V 0  $6/ЍS   00 S0` 0 aR` 0 0 0  0000Ѝ _ 0 Y 0 QO 0 0Q 0A00/0@-S@  R   0 ĕ0S῕p@-@PT @T 0 Tpp@TAP`p  0S S/P/$(0#   @// / ////RQ3@-`0#03Q00S@PMЍ0p 0 Pp G^ pЍ%S T 0p@0 0O-0SK 0P}  Rz p`@p* ]T B,B R  l R!1@  0 0C 0  ` BR  T0`@p`@pT T 1 !,03/P0`0CS@D0R) T1 ! 00PXQRf,03/PZ i 0`0CS@D0 T0@pT`0  5P@;Pt0~0S *R * 0 00PX @DX<X    R !,03/ PDRi* @ 0X:⢓0P3  H  00 Q J 0Z0C00 00VP  8 00C0000@C + 000=Pu 0@00 0  0 0% p@-`PV 0@0@DT`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 X0 PYpm 0P0, @ǐ Ppb 0@-0M 0 0000@>S@P  !02300  :P0Ѝ;00d0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ00@-@ᰕ@谕H-M  0Ѝ- 0 0 0 M奕 Ѝ4` R0   Q/S/@-0 00@0S 0  R 0  00c0      0R0J0 P @P E0 0 $0 _ 4@-@`p`pPM   GP0:*C/o" R; 0  S  L 80(0P  Ѝ ; 0Ѝ^ C-"2 0lM0d000RP@ C 00  "2 0 d0 30lЍ 0`0S pፐ0Pt D"D p PR00 p JPP0000S!$p@ GPc 1 0FB0/Q/M-,+*)C'&%$#"! C- ##p00  00o 0SP ` 0g ppp  00 p4cPM] ] ] Pp@-@0MPዎ00Ta协V( Ⓩ0T1S O܎0T1S兏0`x 00UTX!\!R Ѝp@f\!r00Ѝp@]00UX\! X\!0 000S/Y xp@-0 00PUp@0;00TQ=U0` TQUP /pX1P0X1,0T0`X1Y xh0h 000S/@-@00X10CSX1 @ T1Oh0@Y x0 000S/gX x0 000S/p@-P@0U0 \AQ\ X10CSX1 p@ۍ`0T1O40p@ЍxX x-X X0 04M 0,008 00 0 ,0 304ЍgW W  {t,@O-MHP@Q@0@U P0`8 `pVP0STA 0ST@!0 0 $0 305,Ѝ  @`:( #<@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@EꇧPA @ @(@ O-p`M@ P-TP +T@`00T W Xp p 0 0  ?0X 0j 0   P @p P 6 Q P  S  R- ! R 00B ^a0BSW0BA0BS(70BU%| X[  Q P  S  R !e"00^"00 0S \0F0 0 Ѝ@`p00XS00 C R@0 p`0 A BRWvp pup@-BR"^< p@0007@P"0T0Pp< p@-BR"^p@$@P0T0Pp@- M@P`0 pdUT 0S*壉P  T@p Ѝ$S T@pj @@?p Ѝ@0 0000/\; 0<0/0 0000/; 0<0/0 0000 /: 0<0 /0 0000/: 0<0/0 0000/L: 0<0/0 0000/: 0<0/0 0000/9 0<0/0 0000 /9 0<0 /0 0000 /<9 0<0 /0 0000@/8 0<0@/0 0000/8 0<0/0 0000 /p8 0<0 /0 0000/,8 0<0/0 0000/7 D0<0/ @/ /H-M 0ЍA-`pP@ 0 8#@T00@0@-@M/" R Ϡ?#0! P O, P!Ѝ  0S RP/0    P/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*AG-Q`pP S Xb `RSW Pi 0Cr ?o/o0CS`00c<@#ÁX  qS& ?o/o0CS@@` 0f0 <#Á0Ϡ00 Q`V@ 0XP@0B X0 0Ueo`P96?oo0Cs !` V 0f0<#ÁX X go0`06@f>0!.@<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /x 0@-@ P  000Ħ / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R R  // U /Q R 0 0S00/0 0/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP Q  00S@ 00Q0 /0 U0/Q0@- S Q0CP S  @P 0@ U00Q 0000@-Q @ TS Q@DP  ST P 0 U00Q 00S @Q U //q 0/  // R S 0Q00S0 0/0 0/0 /R  Q 0/0 U0/0 0/0/R  -/@-\00 @@0S0s R S   0 /U/0 0/0 0/R S Q0 S 00 /0 /U/S0 0/R S 0Q00S0 0/0 0/0 //q 0/-Q S Q R  0S 00R 0@-Q S B @Q R0C  SR  @ 0U00@-0 M0| @000!0000 4 ,0 0 0 30Ѝ& % 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/$ $0 00S0/$ x@-@p@-0@ ,ppP_g0Ppqp//////4 //O-qPp@`T4M U10 0 $(, ( 05/4Ѝ\0S,    q!Sp0S S9 3S0SQ00 X00Z00q[0 0 \ 00!" R 0S@L RT\00  L00 S00dr=<;:9876@43210/.-,+)('&%#") UP.% .|x`\rIRW P 0,p,@``P@^` V Z`4 ^ \ [0ʄS0CP Z0404 R*d 0PCUPE_ [ 00ʄPU*Y00Gp00G S`   0 00Sp0-`p Hp `@T u  ]0P 0CUP0 `e Ep xp `700 `uG 0SU00@P @UP0Lz 0V O   0pp@ p*W 00G SPpQP00G S+`p 0 pP 0`ppV `pP ` 0,@, `7 0``0` 0u 0SU00P @UPV0LP0/, ` `u1 QU*P @3 000 0 3plWp 5p倐2 0 0u`` 0 @.10d0Q00 S000D0@@CE @B 00<y ` `( 0& 0`uS 0@ 000 !0d00CE @}d< `u ``f P00%0!P%: 0@P&0 0 i dT0* 0P0C@C0CE @P Z  04t Zr* 0``[pʅ ^kAQAf [0ࠃʄQ*`AQAU0 [ 00ʄQ*0M` M t 0``0 0|0 Z0J0L"42 0 0 30Ѝ  e 000?0 * `0 `l ` `` `P0` @$00> , 0 @ ` ` `3 0  @0(0"(  0 0@ 0@@@# 000 0 0 @ 0C@A  07 0pPUP 0ZT0 0 q,! <(| A-`T0T 0pP@PU J0PES 8/`uX@pWD | 0SS S 0R / 0R0@o/ @-oO-,,@ CM Mp4čP`0@  0 @0 44 30,Cލ Ѝ 00 00p0 `0pOP t 0h pL+  %~  0 ~/VX     fG-0S0 S,QU) X&p`@V 0`S  0P0 S@0S 0S0S0S  P PU@0@\  R!R  R0 R RO-p0#TTX BM%XMUčHd  0 а @PEPU):0 ,bP@ V:bb 0 @YPBPH <0 0 4 30BލЍ걛  O-dd AM @ MTč 09 0R4:0px0(S`;  !4"T4T8X#8%XU"UPE/ @V: ~b{b 0 0 0 vP PU:t 0  aPP D0 0 4 30Aލ Ѝ0x0(SQ ` O-M MΟt p . 0  @TM 1SJ 6 Sh`1  0 ?@X@0 0p t@& @0D0 >00S/ SA`vPⰐ0pS >P3 p 0 M 0)P(0S1Ss(P @`TP00ST`0v_Ⲡ0Sqs`V0@  ^  0S< ` @, dX Tf0 <0080v?@0p0L08 0\ S<0#P 1S0 00S S00T01< 021t0H0ATX0D0St00p040800)SAT| P0@P{ @0PpPPwy 0;4@ 徚P @0P@Pn 8 <0 @8 @ 0 T<0@ 0X  SX Y D0S+,0SV < 0 p0 S00D0#*pLH`|P6 0  0P4/PX|x*d: 0 6 30ݍ Ѝ0`0 040\0 g pW5 A8@P@0Ppw !@0Pp/0 = 4`0 0Z~P Q0 t P8 x<0PSX0S  P@0U  00P`F $0?mE0(0 蘰 Pf10ူE0( &儰 ~PI [0Z  QP `1  0 80 (X0,0 &  R ,0$0,0$0 0 C0 SQ@0b0!0p?A9c!}P 0S @0P ~0'0@0'0  (,0P,03 Q#  #64 0 P0`1  0 70X0 ,00 0 0  .101 0,0`1  0 60X0 ,0p0 M 00 T5P]0,&0<  X`R8000S<0T0=FEPC0@[>@  0 @000D00,0\Q @U`D  100 V p@چ Q v?WU1u0 1 # 3^U10#03 @$A 2UY1#30C Q# E @EU O V@$000 00S0 @0U  6 ˆ0v`1 00@0P }0#0@4#4 ~K (0`00,00 X3 X0@0p0(3 @X~}0"0@" ~0 AQR `1S 0  Z |, ^`!!! QZ   X20 @| X0Q  #0D R[ YAT *`v|P 0p tPp4/P@0 1D@\X0 I0,0b/0+S .0CS(@&0PP!PQ L|P0q@ p20@D0,@0 0@X0 0`!`V A   ܴd аCȮl,Ԫ4ĤX 8DHؠTX S0X01SP 0\0\00S S00 00ᨰf $0P16J\0 }P00 \{P1014@PD  8^hP 0 (0(0p p{0P`p P 㸐D TP B("(R DD }{Pb0`0_P]0@6X@`06S$0S 0$0 ]VPK0g("(Dp D  T B("(R D0D H{P-0`0*@(0PR 8|0"0@# (}EW 0 0R` 0`1  0 3X 0V 0  ! UPy  E("( 0R00  T B("(R D  R,# zP0 3d X0{0$0@H$H |0,00 84 X@0&0 R h!4U 0|P=0$@ E U@ 0 ˆ20V0$/D0S<0`0- 0` ` 0/0M(0`00@ 03|P\8P1011S1Z= 0 T 0 0 60@X@0" \&0 R  0 D6 X0K!3 0 0 0r06 @X3|6{0&0& &|0`0@0P9 {0'0@<'< |,0+S .0CS!@0P {0'0@' {z0'0' {iP0@ z0(0( {/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@zP$Ѝ0 zP 0"c110$Ѝ000$Ѝ00@-$MP@zP$Ѝ0 zP 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  ?@Ac@0Ѝ/MbO-1 p0AMM0 40pP H d{PPC @ +0IP7 0S4 `  0S+ 00@ ;P00@S 0S0S 00@ @K @v @D ,0 0 4 30AލЍ* t I O-@00ß CMM,čß ß1 Xd$,p000S000- 0p  P?QP0\400 PM0`04 !/ S $+ 0  y\40 0P 0  0 0  PP P02 Z S0 Z dL10,430JCލЍ!448#8S0Q Q/ Q wZ     fZ " , "44 .$$X8(#8"(DyIZ QL DX$@ @h dlG-\\0 AM čpP`04 R< 0yV@ @@ T.0` 0Py:8ĝ 0  0 0 4 30Aލ PP @@0.S L0PA>@dD4  Y DA O-ß BM M`$č@pPPA@Y[; 0.[@[VS5.K2o11T. d1 0T 1 #R T4 00iP 00S 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 QqxPN p"PH T4 00[0 D DR000& 000SG .SB T400Pa0=S 1SA S5 S6 T000SC 0sL0SQ0S 5Y00d1  @@T?00& D DR0 0 " 00000S0000   R00S0000< 0 0T40 0P\X00V@:XPd L   p@-@P`wP p@Fp/O-p0Ÿ\M P@`&T V  0 8#à  #4 : 4U@ T 0 \Ѝ10  0 wVX0 0 0 FWP0x 'xXX0SUPP   B RX00 0 BWP xXuXvXoX ⺠H\Ѝ0 `F 0S0   _X [X \X0 SX0S   0<H0 LdG-@0`P p(@D T@-)/XW (X0`  X X @"440(",40D(JF  G-@`P p崒Ḃ E0S@P0WU! W@WP ,EG WEh(0`( "4`43Z1S//O-0P䱐 M0S5 @@d@t@`p S S0  P&  P0 PI  P00^ 0  SR 0  SRS Ѝ Pd1 00d1 HGvP0 :v  P  P060 P0 v P  P090\ v000<ui0:0  nP  gP090090| XP010r  NP020h  D0P0[^ d@ ?R? # q 0 2M$ )0P0[C @ ?R? # xq 0 (32 P+ @ P010  P010$<P@0POLPDOOČD5`4̋@-@(Muxu% |Ô0`p 8   0  xa 0ux(ЍЀ踋p@-AMT u 0P0 ``00 0Yu 0 0Ѝp@@-@- 0 Q0|MU0t00& t 0p`0# @0q } @ 80 0 t0 30|ЍPP  -A-@Ps 1!01n0SPpvOPp zsp0Sp@-Q@U x3s|p r01P r01000pZsctVxSsP //YP //A-`p@0.V0PVSQ@ PQP  U Q0 0O-P(+(; 0M M060 ;@0,0]U0[T 0  p01)0`,4q 05@ d!A  d!. 0`11110pP  4J0@ʏ$z0 p d10 d1~ /P( `@ o`0D@SH _V S\  S S00 Q@0S S R: 0CQS0 C0SQ000009wtP 0/ H  0+ 0fBP 2#S;S 0(S# 8 R 0(S> 0(S 0x(S 0 h8R 00sS 2 S S 0<(  $8R 2 S S0S 00 S S SS@@ `0 To_AP @@ 0Q"0A'A+S? 7R2 S S000R00S 0`0 S S00 (@}@0S S 50@ @@@@@00P00H06yO 04 0HPdD@ R`P 0D@ 0R`xZ `L 0d!S 0 0 2d1  Aq0 |3ާ1|'spA τ0`0S [ `0`SH@DH .S0S[ P`.AV00K[0S 0 0P % $0$004 0 6 30܍ Ѝ0, S B T T Yʔ4800404(P0$0 0 P,

T800 R> D( 0S  !R $8p0p( $ p aGa@(`P 0!P4 R B  B QP|70 pHl'  ( X'  X 0 DG @4007 p30  0H0C(01`,0FS0,0(0$@$ 00$S`SY(@CQr @T  B Q$ , R  @ p,p p$ P  gP p  B RS RA 4Ѝ50|PP @ `%0 0 0  x% 00@T:T5 B0P@500050 P ATf4000C?00 P$ ,p R*#Zp $P@d`(Op 0 P 1 T  @ P$8$ `R " @T7 c ` 0Z$@ Z (0pp00G0#0 $0Tf # 0$ a:,lC@ 01$00P0k ,0$ f,0$ PY  B , b, $`,P (djP 0SGP( 01 (0iPP$ 0 a$,P1 0$1,P$ z0i@ P$kb`(0$ a1h(@ P$ jP0 1T(0B1!0<0 ^ςS0}00 @P +.000@P ! /1:\0   \00 Ppp<f$ nnlTnnmpb ` |P$ dhDx@,xx`<ddd,dee,ed@-@P:00Q  P   $00<0 0@ ($ $p@-l@@`VpPPpZ0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0d@P 0 pPP``p`(`,`0@aA-p`@dPP T  0 000P   \a|a@-@@0/V 00(/$000/004/00/00/ V 00(/000/008/008/A-x``PU pqW@Pe404 0 ,(0l hU cde/-< <0  M00( $ yg ЍU '_@-@0`00@@-@Q 00 2  0 G-H`P@pM[ 0Pp TW 00K 0 000 00- 000 0$00 PP: 0 2  <R 2"  "V &= " 2I 0  0 qppn W* W+ 000@ V eP@Ѝ00@T0-00֣PP 02 2 2: 2 (:gP)0? 2< 2D10 04100(10 0 10 0100100100P 0 R00   0T 0 2  13/pR0SW 2: 2l КP 2 @0 2@001P,00D <@p08XC-@`pQP M 00EPEUC\A@E=2 2 X 0 R0S 2 +13/PP"?o2R03S HJPA (0$( p 2P 500 Ѝ(0 $XP ЍP00 Ѝ(0" $X000X "X00"?o213/pP Z Ѝ@-@`pQP M K00U,0`V( 2S * 2 P13/PPF `P 0 p} 2P 00 Ѝ  Ѝf0P0PC-1pPS M-:b V%*AY 0pY 0 P Ѝ 0  P`V: ЍbP `W 2< 2 ЍO-rMWb8*P00A̱p V [KDb@P) Á @1@DT0 @ 2< 2Ѝ0 @D  @2 P 0pSЍ0 $ P ЍC-"1`S M2:rWB R"*T$* RU  R00U00SR ^0  PpX U"B Ѝ 2< 2 Ѝ>bP"! ЍG-rW" RbM"*R* 0 @0\ U@D0  PpY  U 2< 2Ѝ"ЍЍG-邀഑@ 0`P? pp Ip (1"(R B!81. !0` \ 01V 0N 0 L Ƞ,Ƞ\ L Ƞ,Ƞ0S0081#810 R2N0C2pp@- @XP ` PP  pPp@-P`@Q 00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-P`@Q4M \00 Vu 2+ R2 13/p) 0 0! 2$  00 2 p`0 9/P 0 9/P  kb0P 4Ѝp$  0[qp 0 @P 2: 24Ѝ?p`(0 0,9/P 0 O 0 1Sp@-@M Pp]aP8 \,0UP8Ѝp_Ѝp/G-@B@M@Mȍ qŸY w@`P_ 1 R2X<0*%@R[ZZP ? B2< b5<R P0[pF YPhX!8 0 2 K؍ЍU9P`J8 k8000S "! !.<L0L.8.0LL\ Z0J  CQ"$ C|ppY@0S@0O 0 {l  IO- P `\@P H1嫲p0q1  J  0000N`ⴜAO-40@S M0S0040000 P`D 0$p`B17v0C1f0V0N ^ V LW 0 \W!B! 0 SQp  R 0S  p`s"`fR  0!1!$0 Q0A$0U @ U\  QRT2Qx'xgWc 0 P 00000 pBA0 ЍVD $ U D N @ppB W PUjp1 PD D00CD0 0 10CR? 0 B Qs"00`Rx3'x1px'xP!@ A 0$ 10C0S  0"cPPT1 w^| 0 Ѝ RpP0Sʅ `P1pD  W xD 'xPU PH D p BD 01 $1 1 lEDDDO-P@`Q M%0᳀Xp0\[@0T2 P> @Q 0SQ 0P @P0S 0P%@P 0S0 0000SW 0 [P 00080080ЍO貛Ѝ 00008(8⌠40PЍ0000PA !C 0 0@! t 0 ᳀0 00pG0 0p0@ 0ZPP p@- @`501@0JJ@0D @$ AR3@D$0@N0!PR T00t 2@@lRDAp@裡, 0O- `ş\MV@ `Pf0P$0a 0 ^ P( Y $h0&h 000 00p000S,`I80@ 0괰Q ` * F   00J00Რ`000  R@ڴ R4 F  "0KP ! 0@0<80  0(`0B8,#8, 0 A0 0$ p000( 000\Ѝ$0,p(0@AH$HQ4$0(0 00p0000CSx@@ᴰ[ `Vh4c&hQc@0@0QD QFPPv   0b000@H$HQ@00 `V80SBAD @囚0S0QD Q0P0@ 0 0 0+ 000  0! 0Q00S 00 0H00 0 00 PL0S0 H0X0 P0S 0 p00l$ 0D40A0A8,#8@TL000p 0&0P 0 `pV 00hS&h 0,`v 000040? 04,`00?00S$` 04000`,04O- @`T @0`S0P p@D%P e[ -ZP( [  8#8R40  0(10S0 1$10$10 0S0žP 0 P0S 0ᲞP  00S 1$10$100O-@`  B MXp0 [ pp ` X !P PEX%X6 0("(8#80EP 0 P CpPK`{ [f0`00pQm Q 1 !(c Pರ K + pG0㲰E0E000 Bೀ0@ര0@000  B W3 PP1! 8 #8 P0C8#8 H(к0 pW0!8#80Hೀ0@0ഀ0 00000 Ѝ @   ಀH(dQ 0 Cp ЍP x`P 0@000@ A-p`P@0R"  0S00 0ᾝU@ T: P0X BPR RQ 0R0Ӳ00 00R00A|8 #800 B 0!000UU800C80O- @ T @P@D(0H$HS(-W Μ0PPI$ TP! @T @(0@DH$HT `pV T`  0 ੜP``p@-P@ 0^\ ^ P0Q Pp\ p pG-@` 0PS 0S  0Q@PS#  00S ᲀ\= 0 BS5 PA 0 \؜P   00(!S%$! $! 1Q0 ÜP @p0弐ᲀ 0p 0 S d10 B\x ἐ᠜'xP  $10$1 !( 0 O- @ T @0`0CS0P@D p M!P X WP' 0 0  ^P 8#8R0  Ѝ0 0S0QP 0 0P3000@- M@ P p10 Ѝ0O-M 0`p  0@DHPpG " P3 X  0@ 帠 ⌰Ự ภ *^Რ  ര N0  `p0`000S XЍ 0 ڛP  C("(0C 0@00[P @G-|xŸw?`0 (MR$@b2 SA:0JS> P Pp2 Sn1C PX: A  W1: 0C8#p#ȅ3 20  2X!P1 0 $0 30K (Ѝ P@ ZPp Z 00C @ 1px'x ⎷p# 000   ` 00 pP202 p sr q A-@pPQ`M 00 2   Q `:1Q峷0" B!2 0 0 VI WFEYBAG?0PU: Q * 2 13/pV P* 2<00@0 PEP: 2 I0 EP VP V$P "0* " Ѝ 0 Ѝ0PU Q:(0 $P0PUP`TP   ЍVP 21 oV@--M0 @ 0 0OWh hP 0PSP000S 3/% 7WXXHm 8 80 $0Q/ $0S/ l h(<<0 0R/$ 0S/ |l p4(A-@T 0S=p`/tXP0P@Q0@ @@XP 0A/P756(%A-`MP{WqA p\p1A,4QSX 0 0 0VpLiBP b0@S<S9HXht ?(00000 00 00,40000000]00tr {XЍ 00 0 0 0 0 p0嶌P[9,%\%B%9(%O-@PMp`z#W3#Yp#x3H RPGPP/ +H@ P$(8PXP f@QQ0@0!C!-\\ R0C0X20pW WT Z( Y ,刓PPPXPqPT! p{`P   PPa 0+0T!YqPPp&Wp`@ lY% B RD\\\\\\Z V  X z 7/ P  R =$ V %$ }V t%YuPZ0S @ U[A%0:,\%@:0u:: 0:9:O-`4IwMpP$y V`` `` Zp8pGW( 0R[ S 00 0 ȒvPePRP&GPʽf0@S,DD8DDDDDDLDTDDD\H0@ SDDDDDD$aP ` ` `` ` ` `$(,S4 0S000 0S000-XU0bU$pG4]U` ' P C```V/V  0001=0SV0S0000 C C0S S/R TVpy0Sf 0&vUo0: S (00/V%00pJ`V  hPpT iPPN0S7 0P0@ /Q50CS$ `?U W$ S$`0SG 00   B R\ L Q,Q p / 0  pPpG 0ph 0  P 0p K/R  S/R/    C  R:  (<#   30SS/Q$ 0S% VU0sX. @D!R\0PT!R\ d#X00: S  CC$U0: S H1: S t : S  Sy  Sq JP9 `6 Sf S0 L0S !ⶌ(0尵0 [ @#  ['8Ÿ0 S802"p Q TP,0!SQ  TH1: S B00[0S 80h!0CS80h1h!hおPQ X0S 0R#0S !⨌0S !⃌ RW(0S0S 00 |Tp!屐0: S0 W %:[\%:;$A%G; ,A%Y;:o;;;;;)<H%I<:6\<9q<:?|<9G-@Pyw`SL&lXpD@6@f@4F/P$60`V0S0 Y `RP 94P0805H`40ɍP0%.(0@P8:P0d `5`%H`RP8P H0@ 08,%43/00P08004 ۍ0 P 0!ྍP (1෍P 0000/0 $0 P0; S @,0(D 2#!H8 01/NKHxp@P5 Thd0S\cT2S  DP0$CP@T `@ p/RZ/ eP ``1  R:  p00  ᚫ cPp[O<'\% OA-`P@Mkp D 4 0 GMP  iL =MP  _L 3MP  UL )MP  KLPl4h3P0`3P P$PD3( 0vP+( pP3( jP7( dP;( ^P?P ( PVP( PP P8$@Ѝ(P (BPFT"(0S (3P(0S ()P(0S (P(0S (Pq0S 0KP!0S0S p X姹`PPa D1R`GPU 0E /R 2HP(aPU  H00,0/003{00CSPdP0$0u00S px0s00啼ꬼH'(%oP\'pYoI%:oG`o 'x'oA-@PKoK`p [N\%h'9p@-PM  7 $ 0CHHPH@IUxITD0 00XHP00TC IǶP30 0僔P 30S S! S  3I d3! l3 00T30S  R 4#6 R #!SR353 3 @20S ( 2 20S 0S'002@T$:P0"w@wB00CS00 5 0 D 50S60016 R0S 10S<bu:0PT<0 01 10SQ 10SM(]x1d1POT10S P10S l1 `1 0S   160S 85 5@$1 I0 1?(   90S0F0S 00Aq0SP90S 00@,4@`|P@1To'[iJ%H''<''P'L'ID|K%K%8'HJ%D'y{G-@MP kG2br@@0 S  NX "LpD 0 L1 0P8| HPh/dx HPP /L8 HP8/T< 0DS 00S8 @0xL H0QaD0@0 0Q)@0SZ L ␏PUia0@S񟗶$@ꀁFP `Q@@LNE FP DP AGP 0@0 00 @LCLC0@0 00 0 dPLBE|*JD0S hx HPT.F[`%\%Bt @ht@t@%Īʪ,9gtԪ@-j-FEO-MpjG3b@0o0C?o`S20#3ԓ @@@yIp#33 X XT 0S9 Z`7 [``3 \尃RPGPP IH@ P(4`hP vP  fP@``k0T 0080 S1 : ᫯P @I A0S #S4I  `PM 0p#?. "0P0  p0p I Gp >0S40 080050C SAll0S ׵}@Pb0S- $ poFp 0 3/P00S t-$ pYF tqp[h0X0 0S D[$'xK%,\%:90'::00O-M M`u4J ^u5 00 5u5005 u9 00墳P kI 坳PPy P㰙yN P:IpQ |㑂A@6P񟗳dt@8@  00USxP CJpQ PQH 0(<ȟS SS{ (8055050050505 ᑼP 勼PH H xpZ0"S d  gp G0"S  Wp90"S P 0 pI0050 00001 00 00m0k0i  ^@ ^  ^ QS00 00055X OoCU5SPP5`FV5S UU0U%0;{pPl%5S 0wEP80: S055PEU"`####"V05SLVOQ4P$040Dp+ yPP  Dd$iBT%hMVy\D00000 0CsPP#2 wCDCD$DPc`0 = 0S #P吀p@'DdT0#S  PCx+D+ e0E?o2?  =C X<ZEPP\+f/߽KyX bOPPD`D單00CS0 yP Pp PNU0 P00CS0y0 VN0S:00S:0S1V51N1S(1S HIPdh!iB%T%pUV|DP 4iKP,0V0< NP(c0`FV}P@ᏀP  f/0 LT  ?jIPN8'g,"@t#мL%\%'mG9YY`'x%GYO9%md_x'PC-V 0P !@㐐`p@XPC P=Y`00CS`0 D@T ЍX0 X @&Y8'x%<LO-P`@dMu$P(P,P0P4P P  Gp4pK[lTT1Z03rTdT00 0Bp0-t$tSPPP@S0',','&,',',',',',','&,'','&,'&,'<'a0@S;Y3P0 0dT5 RT ST# QT040  opT[ S0lT[ 0 0(Y  $ⴴH$ WCp8 dЍ $⦴$ ICpM 8♴8 @P`p xv `[X\@T8 CpD-@-P,",u!` "0P#U!  ^P Q !~.0P 0~[`&0Y@|BtB@#w08\H8 pP0 @,U TS X@` V8 T$0P 0PF.@P0 P 9@ B\%ۍ,#~DD{D+|D(:GVeq}D9&yaratcid(%0O-LOp222422223220_aM$0 00 KFpr>`PpG ~PB 42"S 200002^S R2SW10 dbV% ``L0p L=pP  ``L0ڤppd2S PAPX0: S0d2232` 3`Sd2St}0 l=|wPp80SH D c/3PE/PF1@PC///9P<H1.../`/../.........l/t3............x/01..//.83../.....D3/X3//H3..3A@9PNY007000`仟 ,b,000S0?# y}0d204202020202 @\[\k @.ATaߍ0220202;/`ᅩP000S Xp= 00[ / s`P000S Xp+ 0 0V /aP000S Xp 0$000*2j000 0B BⶉP 000S }3 S;3ť)00i 0 ➉P 000SX"\2RRX2Ti/ P P@PX0: S00z `P >/P 0  P|Z'?`P1'V3?>@p X:{\10$ [tp*?[\ D'!14<(S4?̲03&703!7|pm703|7 P ʰ0 S 0R' 2S$ 2Sp 0s ` >p@&P/ |P 4 f/H7 w0L7TP'\?S@<"820,"(2 1WPPN0 0P UY;P`T |d2S+  @pX&>00SX!\1 {\1X! 0 \V02T7,2P7p` D&H>`%WP YU bGPh brWx 3023,2 3(24T\2S(",2Q\2X" !14!8!Jyy `''y%rdAXedAj&'>x%'*:Tj\M%&Rh''7sc\{1 SR Q  RQ!R!RS !14!8!WP `p+0!` 00"V,00!` 0,"8V? 0,! 0 0("d V(U`W P 0$    ,\2S3 BT02`vT`2SVP# j= 0 0 0 ?U`(VP 43@T0V2<<23S^ KW2CS``_2S _($90 VPL YY_Fg`@ T  @ET   @@ D   RTY Y{0  [0s% p<)V <"20"0`kYP eYP $-0O-tUM M@ 00@00`p0@D@ 04%@pA0000050`Vq P jjP/ PZ4$504P)`CQښ. .a0C 2 0w(,a\%edAre9(A(%(+(EExM%8@[((x(zd@(O-`@pБЁQ i?p%W㰑 0S 0S  p1`VA RP dM0S LGD`V.Z ЍyPmPPP fP bn0@ S|H8HHhG8H8H8H8H8H8HHH00000000000000pspW 0qP !7cP3cP 9X,`(\%O-4$$MpP :P!!9`-90D嬄嬤00```$>p6Y00S 0S 0S XO `L4pWQ* 0S00P 寤0S 婤奤0쳟0W30S$ЍzPOPBP4 FPo P@*P MJJJJ0S v00000,000(00%000!00000000000``!0STSP` #0Y0S 0 -0P P 7PpG! 060XG8X/('(,+(\%8`H/(#C(OLRcM%O-MP8\ST$ PUPEǴTvPlP+HP7 TP3@ ` L9p@,˲  bqp@!0S < <0@[{ ^um@ P Q|QOOQQQOOQ` 4"A=p(2 R Z R 1!, Q (0堯P(0,  R  $ @(0KP(0@$0\$0 -RE 80@0 0  p0@P>Ѝ 00v1 4C ? 040P ?000R0Sp b```8TpV0S20S {000@`p@ @ @P Pl 03/p T v3w,(VCV\%=OVcVeO%@-,@,3@81@DP2(O%tO-@P8M -`,@坱F8 0☱v`^ p p t6 R|,0 P8 /P0T 4P0\80}pHP  F U95VpEh C0IPHPU 0 ?<p(5pO005SO -5*( 0(0,00(00 0FP"PP,%,)tPzZ `Z NZJ (AZ; CZP wpiLa J0RDWUUUUUUVUUUVUUUUUU VU8V@VHVUUVWZ$00!0 0 ( $0DS +XK0L0J0O0ܓ~05{N00Yw 3M0sH0q5$00!0 0 t 唤$0@S. XsI03YU0zZ0QkZ CZ BZKLZ aZGElJZ A VVTTTTT$VTTTLWTTVꨒ.ꤒ,[jmQPfH0ScI0S`O005S) LAP% U( Zp0 (0S  0C!P @P!&@p``dp! #P|! Pd! 0S1H!3/ 0'\@ PH"`P%5("P1!( HR #0 %px( PP 0 ( 0⤫0 p^P%`2(P%ԁQ%2(pP%(Q%\%f4},(P%9P%P%P%JWxys*{Ys{fifiui m@-qP r9@SXq8(p@-D@D(P-@(% $6p@<8(0pp+˫0S > +ȣ /;Pm`` 0V@ sr0 00pp` `  I2P00S` 00 000$000 e( 12p00ʦ0Pa0SJ+S'- 29S!S 1aV`$\%X18(,<9 rS|)zd@edAp@-P@T~p@-P@Tp@-P@T@-p@-P@Tp@-P@Tp@|p@-P@Tp@d0O-nM M@00ܞp4`LcPI 00 >R㰎0$0 0>^000㘮(000 5p@:p>P10x?0S8>D$RH$r R  $t ⑪|00<4A @0<4x00<$ 00p0 |mP ާPp`FB@D4TFpppp8vpp|ppppppqppp\qqpqpppDvppppppq rpTrrrrsspppstPt0utpXupuu00@ᙧP \< $w|吧Pr ll  (< j <$$r $b@4zP ;$0 00  0 <L0(00 0,|;0@= l T;$50 00 0  ;(0!00 P 0 : 0(00 0*:$0!00 0 :(0!00 0 P:,0(00 0 :0:@0S P0$0H: 000 0 $!00  0 :0!00 0 y:0!00 0 l$940c 00 | 0 _$: 0!00 L 0 R88갸@0S 0 x]P5li]~嗦P0@4w 否P@q 8(l ᄦHPD40 |PD40D4Z | C0P00P X@00 1 @1 08C@@P0 097 000  b , G: P P/ P k0S 0T4000(0<4 T!P\/-PFU ZU V⭨  ᩨ0HVp0`R 4S<4Z0 H$L40V]/p`p@?HL4@0S |$H?H5HLX  $?ߣ|5XHL0$4SH$L4R0 %-p`  VN/p  4S@  \P  =Gk  eP`; d`Pd%dV)/p `1: SD < $R-@P  <c0P,0   [P .,00S,0Z3$R  $$H0p!|$ L{ =p409P40 r04TP OP$,03}pL{ 40S0X44SP0S4ڀ2S, "20# *,Pr 0T40S!Pp'0ST4S h38#d\P P3 `s$2S 2H$L4P*pj0 L4H/0#! 0bp<2 C  tj(0) ;Fp̞h  H.P L \$L4H1# 4S 0._X0 ,P0$$4RT SQ  X0  x,p XS  S!0$Qh +S0$:$40 Q$ Qq*4m:(8,>(\%ֳ7#(%<Z(.{jи '%SɹϲY%B`sj+/ش?(=M}Ĵ:($6[nr}S'5b,G[u Y%Qnf̵&8NHL$ Q,} Q+Q +*0$0$Q0$SV 4S$nP 44崀S04144 0S @4S 0  0@4,4S $4R#1ѣ1,4$0 0 0000Vv +t +0S 0+몉p@ P! 0d!|,N]G;+ /P6X+-Q.041$4+T4S)], >-d0"|,;,+++<~,\4$P1H4PT1x0<$+0@ 0F,pekc|℣P;=0Z +YP;=0uPN  Dp  TD > Z,0+- (!O-0p IMM⌙i4, 0pP^d9`4pGs04WY `ϥ  ˥Xa$ 4S<44S $$4R0( +p  `,p  4S P,0S x0$ $tY0 0p 0$ P0$ D1Sf  $$4P_*` yhZU CUwDPEUXppppppp̄pppppDpppĆ00vbPEUUtpppppԅppp8pppphpp (y'8#80( R&0C RJ ("(%h044s04>0 00 0  t610(00 d0,z 0@# @0 00 ( 0i 0*00 +0] 0*00 +0Q 0!00  0E 0c 00 x0 9 <50!00 H 0, ,00 1 1  40(40Sg;d$'aPP$g`+p 4S )PP$t$`0P0#X  L(@P@4(0(p00S0 Z 00zp$#;$` =0妜P0 r04P ⺡P #0Eg3m`$`4S80S4d 1S !10"D 0S4j☡P $3" b}000  $Ĕ!<#G_pX2   g0 $ rpԑz 'P p` 4 $$s(4S 0@*?W  ( $tR $4&S 4%㾠X0; 4 44 W  0)p0fpW㢠X0:S Q4S  0   ")0Z00S )( $!wX0⫱pX0+H?(,\%hC(Ĵ(_%.{jи'ɹϲش$[nrM?(}W,G[uO-GM MPh RD嘤$=.p40PEPEUar@@5P8LXdLLxLLLLLLLLLȍPLLLLLLLLLLLLL8TL`|LL؎LL4L 04000Xw(83 <p0,0p00000802", 2%@ 2D~ 2Hw2"p0L0mx2`"f`2D"_H2("X42 p0V0  2WH1 p0X01!8 1`1p00 xp0B)pp`%  Qqpp`0 S  0p[`  Se0S0Shpl` 0 A/wP"0 0 @x(x@C@P3e Gލ Ѝ,\%SиU(7ش(VrHO-`PMH8 d`cP(`OPTe (P'p j''p `Pp80KD` 8H,pR؎ 0A P  Y .>> Y 'P > OP 'Px<;Sڥ'P`Ѐ Xi $h 0 FW >PWV PZ(  >0 2S1<+02H0WC=0S C@4Ppl$$$$̖$$D$$$ȕ8$$$$$$$$$$$$$ $x$$$$$`lxԕP$,  09 0iȌ hh0P 00R0S 8dU 0;8;08;N 00L<ppGG@h;h00S 0fNP  +;vNP,  0d hEh000S0? <  0< 0: 0 |c@0 0L;0@; 0@0 00 008;0 hh0P00S0? :P 00v 00s 09pꔊ h"h0`0PS t\ hh00S0@S Xec 0; 0004*0  0 0 000* ĉh0 ɟ Lh00S 0MP :0D0W<809 , d P 0: 0 T>!.u8PP9P H92D0SUȌ0 U00̌ ňp0p{"Pt  @c 0@ @ 8 0PUP 0C S0400000,00(00$00 0000000000 000000<0 0o0p Rp PP&봈Wp &r8; 00 d0&pc 8; 00 d0x&pU 8; 00 Xd0j&pDG 8; 00 d0\&p9 pW  |0 x;0z+y; E g0;0; ; '0cy;0z;(0x;P+@OP d0-&Pd;"0#10@00 0pc`QHLe  p   p 0&Plc0S PP c0%P_ 0  00 5%PxRd 80 `&UXpp 0 %Pp,5,%% (!2P(10[[[[,Q0Q4QD 0@PPPPfD<;SʤD%>؀C 0 ?P@f@PQ 38U 0T 0T 0$(cN% 0>P f@XPQ 3U 0mT 0vT`"2Rz 0LPt ' t#t3@PLP30S 0 t' @P 0KP@P 0KPD2 p0崗#p00 cc@+V@0W0 00 DQ%P0" 00S} # P 1 %PmAQf%PlD 1$ 0%bq S~@P 1S 0KPZA@ Pf 0S 0@P~KPD 0xKP I)T){Gz??.]eAy\%,`RMb@A5SqU)ThL) U) K)[L)%K Wv0U)U)U) |e%DL)-C6?dU)M*8~A@L)$@xL)@@hm(%K)vXL)0L)he%U)%U)KS$1Ib|4BSaT 6p/I)%$* 1 ESR  p"@ T8 ݝ0S4 <\0Pl0l00P0p+t"pP ȝ0S ' > $t;D000[ W1 0 7 $$81d"R&RZ 0 W D G1 @S8 2R`2 C8#<48#8S|2!TR?LT!LL0do0 d22X%X  :  xҘx;0|06?$6,c 0R#R 0JRJh DJP# !@JP#!b)*3PU 03  ╘ߜPh2d0h220W`! w60#$# D0(0"(00B2 0BS1 (S9; 3 0;}#`U10#tt4x!'x008C8S!! 0 0G 8(#8 "(_# 0 (5q;    0L;XJ# 4 0V6c0`#$$D0(000"(` 5 X  p0 IX0#dPD0p\5> 0X0[RV <X0 0RpYV50#$# D0(00"(0e&0 G0D "v̖0Z`"0  "0CSh8ԫDhԬ0 :P Q>ԩ8@HPX`hpx" 0`P#0#!" $(,048<0 PN \0 PE Q$`"9S"0 P& 0#$$0(#"(!?"0 P(  5"0 PL  0 P Q Q  p n0 P  z0 P  0 zP  0 qP  0 hP,  0 _PL  0 VP p 0 MP  !: PP  0`#0SH S' S~ V40#$# D0(00"(0[`@ !SpIW0KV pYpBpCp0K pv ! 0\0pG\0W0 I)p0K9+q \0F\0 YpIW0KV\0, <+W  ebPV\0 \ Z!\0h< X{;V3 L!` 0\0pGE\0W0 \0 \0 ;!V 6!G 0#oO-M`P;@0L-S@P0 @,4 $t:%p$+4QP a`F0pP[NPQLpGK.!PL    ]勗P@ T3XC d@P dlx\L@0S @HGG 0偕 0pw tY {\\Z'U`PP`0b 2 R ;  T 0 S /  * U+ 0 @ ! 0!00 Xዊ㈊ㅊり |p4 ,pǙ0S㦉X㡉` p0S뫙P| p@@ 0L\ Vpz`U*\%l9[l9oeO-PAM M@`눧P |Pt7tW00-S% P ᪔P \ @ p H PZ `F0S0 ` @DDA@Dv #p ,0Stb@Q 61 QlS l^P -00 `@Z-00  D0B5S񟗌갷PDP4xȸԸ 00S m[Ph[0 0y긄H*4P a[00k00ht400d t4 `0S \F[ X D4 T00Q0P J  p300S P80$030(000,0-t0C?o#2p R0S0$0PlPP$vx0@  *@DT,3a00@`FrS= RS iS1 tS xSS4!'㠢Ȳ+  60p 0@00@00S y7 0A" Td#0S N'4 _'  4#R0 B(0/S  O' n(0S  0@"'""0S (0S x1 0p0!Xp&S <T' (0S 0 0@!'M1!"3~ 'Pp+@5 0 p!PTWGhGU*@XS,u*e%G\%%(%Le%&8*%`8%O-PTM)@pP4,/"p ? ,#@DRQ0I l@@0SRYvP cP SP- TP0(3 LP U 00S <7[V[ 0S80-& 408.<,@*D(H&L$VTЍ@* \%KN2[U6Xvdo%Б******ȑ**Dx**X*Nf#KEG-`XMP =P y I  p 90`FVJ;c UDP$ b0@SSDDDDD(DD4DD@DDDLDXDd0 60$60(60,6006046060860<60@60D60H6$&R <&4  <&,&R 8&R '4&R <&R 0t't7QhqQLP@87C P PW0S  fP 0000 P&T60 32NPM" P061 c(VUupdmW0+S `DX.4`؍ @ P$Lt5 000 ;륺<00/P 0T& t5 0 000:XP00F0000 C000C2#S0d000 C000C2#d v>C 0C0 0B 0 B "00P00 C0 2#10C0 00C0P00C1# 0 00C0P00C1#0 00 C000C2#0qp4 0P 0PQT+TJJZ2V v`'os`F $P$ 0SU030#:U 5%PX彳P HO1 0P&T6K/r0: 3PvTS0 0R3# G@⛁RPEQ:X!EK/r0:P⌁"E0<6S"46S|" 02Q|" 42t01t\u6S Lp:P W0`W 0 㙌P0 :X,6S m/PP `JAB<6S46S;uP1|Q0@6D&Sl1 0 00R\!  H&PRL! $&R@! 8&R4! 0&@R$!  !Q   @ Q# @g@Ft0P0*,\%z؝*** /%x%!>PR_y #I&)%t%v,AG-P`pIHM {p10PEU& $:HP h0@ S SLLLLLLLHHII00pa 4坈P ` 1!aPP GS L`$@@Ȁ`(` `C Y^P 'Pv0S PxW dVP XS0 0000 Zxo%,\%re*9ʪyt Ct 0G-`HMp09 C S p 2B1 `FS 1S 0$  !RS@$ P+PTaPQ|RxP`PAP MP2 Q:a0@S<@@@@@@@@@@,<@@@@L 00 04044041! 00101@30@3101101101101ДY 000 0wAHЍP PPp  eR0S  D30 `PJPV q V xD`FV R $Sa (08 ]V Z#*,\%#o%*9%C-Mp`s0ቌ@PV  p-6TpF`F5 VE@T TqP DlPI0F,V p6PU 5 `V V 50S aP tP0S H500@V 0S qpG 4IP`V \\ TLtP9@PA@3Ph$,8D\pzP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0¶ B0SZ<0SU00SP嗋P0$0-:FU 0SA 0S 0S;`V UU5}P txP |sP& UH U U6PEU2p0,000TU( Q P! P U4 @U U0000  ^J  U QaLPJ0000 0 IJP  "H _H$0S J H p !qpկ*m@fT ˯ 0"600"$0V$P @P P`B*Ԣ*\%7)*,*(%*X9X|)++!+4+D+[+G-@PMaqM Dp10S `A⼑P R ލЍRP fP74KAP\ /PX@0JdP1 JP/0: S2  S)J KP0 JN@~p 0r4S00pekJ0S qp gJ KPJ K@PJ(Y`-*\%9-+--C-PGMM d0XM6P=P <8L=8X@8DX孀P8=0D80l8"=`{C0X `XdXhXpXtXXXXXXXPXHhLhPhThXh\hxxx8冀PP   P:? 0tOފLL ` qPX< T <k@P DP P@ 屉OoB;p <+|;(8p P ` [T`h?}PdhP`J劎\ +ppT0J [: U B 0܌10 |k  \8T0>0P XP0P[ SWBV0 XiP8P9Tx 81P 9h(p(P 9T(X(f Qb9P t9h(d40GDS#P\h8`Px,p|T ,`h08WT0X8T8P0~8t Jy7~ Dy1~$>y +~$8y%~ 2y~ ,yC|C|||| 0S0S1  i@d288S" @PvqN @+M P: B?\V n081<S{v+t P*|{0: yP 0兆P ah@P|h1xt| lq|MzP]1@PDg|< d|0@`(rxPP0@P`*p@+0(@0@000,`40U0 (P<P8F,8U0C?o20SP ,R  \0,0S ,8S= y,8S [X*DNDNNNGN<NNO_HOx%%&P\%MPXN?OMO,`w%yO(%OOߞ8@OO,OO PI&yPP9;0;C;N;Z;P64PMPc;Pk;X  l kPcPL*X PG-P`3 8Ehh*P03$p2S l} PLUڤ\|PH t处9PB/PE0@ *  pl40pEWQU P4 000`qP (L,!PE0S#4 4# 3.PyyyyLP KvP303 %`px pXl|Pd34Xԗ4S HSLP  0K% P 4SqS:Pl l PnR{,p`bG1/΅<01 1> 110101$19<8y0"02Q$ kp`h Pe Q18C8S bxy`q܁ܑl0V0C?o20S 2P  \\=`S 0 0000 l18C8S 3S P P=?o20 P P l18C8S 0 P `?oP20S 0Pԗx+6cb%cc\%%1c +Xc0P !a0a%^cz%&iz%ecvc+H+ ( bb9%[YC-@`(`PP L1 H@qD p,1QA= 1P5 n00P P 0 cP 9P0P00@0VP   dP0 lP000 0T TTe r0S6+"j|%\%66e(%iG-PC0`@00p0sP 0S00(L埄P00z ա.Ȩ̯ Mp0W* s/R冄P0r0\"2PEP ȟ밂V 0+0C0SPP y ^P`F 0S P $2  P 0S P 0S10P  0S1 0$pW 4pV 0S)PPWPp P`F0P% 10S 10|P0S0PPf P#qp 0000徢둱rPP Б+6X++l+<++ʙ+%+O-`pBPᨒ>0뤂堢v ` .p2 0 qQ Zp PpGzb{uP`P GP( IP) EP m' 0 s  a@P @hdt0000 fP@ CPA \`ͶpPB rP :pDNQ$( P00: S0S00I{`P pP 00SpW?yW  Q[`P P 3 =t3t CR@00PPPLspp0@ Hiv$P )PR X,'sssaT @cP(@_UP,PP.@40(Vn,@P  8lQ00$2"21QY b|P 1 Ѝ(p#,0TP ( 40S(40S(s4PU@P( 0P 0U0 0 0 00 pP ,D+,0(`G,j6L,(N,8,L, =,8vG,LO,$?,L,G,_(%G2HII NPDE,L,,HxI,G,,LF,I   8,L,HE,+I O-`MM, 0PUP Lu` ``  p@$50 CP1YR epP  00I0P80: S* `wpTaTb@DTDT\zT !0 < 0 000 0 0 01  0 00` p 0V0R0Sg Y ((/`Pp  0P 0{  {30P8\(Z0P Ud`PQ> 004 0!002QX C000sH$H( WpP02 0P- P(d@Pt$ $  Q$ _ !<>DVN 4}040!CP 'D r: ~PRc0S .0 0/X0  $ HPK0S  @$tPp,(0  Q   S  R#4p+0S0 q UT@PPp` tx,{,\%9A{{{{ ||(%ht@0||F|[|+|\O!||m|0O-PMp0 0Ph~@P\ T}@PHHXD忢ߍ@P/ᄀ ?/x1?0$20H"2@2<211t122klp00m10㘎`&$0 001 0 p.0 h>p0\0J00 JR181w|0 J1!1q匡H0 @Pb}0, = J0R0 =+00-181BVPMP 6P^ ?PU 4P000p=` 0N@P񟗭`,DPX0=` 0f@PP񟗚 <0x1< |0$0yu|<` 0q131k0$000AC0` 0<` 0W 0 p媿P 0yP 0%$P~ С0 JR޿0 Z@P 0 p凿y0\ 嵡8d&`@0$01@p  aP X100 01Sq@᫿(P ;,543@/q ^Ჯ 8:$0P 1@ P 둯1@ tp  $sp 1$@ 0S  Q0 0  P819:0  0  @=0|) t OpPd P ,4L '11X zP`0S9 (Q90(0 0+(C1 @U``彮' o 8 P} !⌬pL V &XhVV`` ~0S 8央X~0S @dV$0 RS 1S !10180X7"/0 Q<!0 <2s7"/0 C<<2s "/ 9p<Y 104@` EP:!1 01 6 `嬫p-|  PVV``  0 $``#6800%p $00cS$0 H~<Q04&< p !┬P$AZ~0S 1 P~0S\ZI~0SV E~0 SR 1011'zp6~0S h%dԭ``p)~0S @%0ǭ@%P q@ 彭' ŭ$喭k1S $h P喭1 t #(0p堭 m1S #00rp `pW P x'0,A>0 (0t10T$t 呪m1Su 004p1 0($p 兪k,0(t10#t {m1S 4p b04opl1S 4pl1S |#TT PhD`p P 101<F00@@00 $`P  <i0 10 寞pY !1! !" 12'ʰpD ᨠ+pd`"0 !R1411⏮P,% 0$0!$0R0S"RA1`ס1t!ͯP$0!  R !Ĭ$00$0 Q[ 0՘ܘ!v~̜% no\%[q,_yݜ~ %@&(vvO~7i,НM|؝T$3AQfx%YYKNڞ ̨Ϟ%9WǘΘ-@Lt\1Y8 x1 R1pW41!( < V ?= :0徫5ၼ1`@T 0S 0  @凩@ 0S    0S ᐟѬP`p P ( RV  R   1 \@X0 S   0K`Va  Q/0p@-|@0Ptt@ P T0gaDp@ 0 0$010d |Sp@-hPMP@T Ѝp@ `0 @ s 0 @spjdj0ƒ S'* 0@- P@ R P@ 0\ R^H00"@ 800 0^$00"@0/t p@-`0M TAT!@ `` @!  4!0  (! 0 e QpP 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp| l| h\ `p L08 @-M @A. ЍPh  0S/ -PM00 0 p 0 S 0 0 Ѝ$S<R oq] /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/:*/)7*/=4*/1*/.*/"+*/(*/%*/"*/*/////^*/*/*/< */ */*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/D */*/ */*/*/*/W}*/Kz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/4T*/ */6 */*///*/@-@Ay@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress6-6`Nt"<'4\36\66<6?6pkp;tNC6 J6D I6D  WM6S6.$Y6%%_6+b@Ae6LGbPI3wNp6R[y6_)Ke6= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory @A?hwT @@ AlA@@A`A@| "A(A$@@ 7t$@@.A`unblock and -DNO_CONV?/T/0/@545$/l.p.oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-pv] directory ... D Pblxi1xi1ezÉEԉZ-#7 7_I^IFI<I>^?qPATH= sjatF~Pf%acdjcs~Pcwcmpcl~r ȝ p+ncv _b    EOF reading here (<<) documenthu}ØȘИؘޘZ_dioqTKfPõ<}-+?=jW@WКٚߚ@DΚ͚͚abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.''0/'17'1=P'8G'0Ux'0d'0<'0$'0Ɲ#% QUU bNAZ:$ owA`z   cYY;y';ɵ !NΚD                  X]6<%Okלh/`*t3L0DnC65,I.8д>B<H3K$3a4]\]SaJ(Upk0[;@rbLjD^qvw\8VyКy&B / , 1Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20251006162410Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedЦئ ަU?, a dN` ٦ sjΨHNʦ:\-ħ.˧0-0-Ч,4,ק,-p--X.`/t,n`/./qa/$/P-,?L..hy`/RVZ^c#b3k#j3r2q3x3w# @I@ƩϩשCBEM\dU  @!(d.K5< C$C C$C$#)˨@1@¨ 9 ֨ި@ lsz @option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.CKS@)@Y@a@h@p@y@~@@@ @@@@@5; @ @%*4:ELR"X^fkry7in˽۽ 1ATvо۾vD~-9Ma1`OD(9-15`?CKOU`o{!)n/4;BIPY`inszǿпٿ "'/5;D~-9Ma1`OD(9-15`?CKOU`o{D~-9Ma1`OD(9-15`?CKOU`o{changing %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] 8uUsage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'Y4Gn   9 U w4DXm !a#a$&a1a23a4a56a899:8;R<p=@ABCD:EPFeGeHeJ{LMNOPQRSTU"V:WT\^aycdefghipqasatau$vaw*x>Zk8Tt ">Vs 5-Pcraaaa&@Pk.Fd $?uaa,zaIaj/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]Xbj6]WbOD(9-15`?CKOU`o{returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-2IQ!Q(Q;QFQtQ}QQQXQOU4UBUUUjU|UUUM%O%N%N%0N%HN%`N%|N%N%N%N%N%O%N%O%0O%PO%pO%>OD(9-15`?CKOU`o{Y4Gn   9 U w4DXm !a#a$&a1a23a4a56a899:8;R<p=@ABCD:EPFeGeHeJ{LMNOPQRSTU"V:WT\^aycdefghipqasatau$vaw*x>Zk8Tt ">Vs 5-Pcraaaa&@Pk.Fd $?uaa,zaIajSFH0eC&`SFU0eC,`5Hah!IdontNeedEFI6`;`(s*K>;LfE`|nQn- q+P`\`|nQn- q+k`u`|nQn- q+``|nQn- q+``|nQn- q+`=rGy=iG}``;Mt?``mWC 3KOO``yD<#*=(`a3Dh&aa\ M}-*a;a-чH-La-чHaaZIчHb{aIчH]aIчH`a2IчHaS'@ )Ѹaa*1@ )Ѹao1x )Ѹaabackupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapszz{setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusDprintallmaindo_setifpreferencedo_setifcapśzixQ%cJyiyyy(Q%ydT%;yy(Q%m@U%U%yT%sT%U{T%Ѓ$(Q%CS%ك8(Q%HT%HT%D(Q%D(Q%*6 BNZ@fr~ 0@+' ń ˄@init_current_mediasetmediamodesetmediaoptsetmediasetmediainstGcD `@cmedia_statusmedia_constructor}U%U%U%}U%zU% V%paddr_matchT4t@dsettunnel(Q%ƇhV%print_link_addressessetvlansetvlanifW%V%D[setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsW%(Q%ÎpX%ŽÎ (Q%nX%mnt,* (Q%$9X%ȎW%ΎW%͎d(Q%4@X%^4,* (Q%W%W%,*AA*33%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s2h]gXJOXr̖ ט Ė@usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o ˶ Xʷ#:PǸ۸1Deٹ+`̺%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @NB_CnFzILNOXSabcef(hoi{kmnorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u: @@@h pp pp e` @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()[[[[[[[[[usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYH`;g 3aUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print$&$2$<$H$N$]c$H$p$~$$$$`$p$l$$$% %l%9%XG%W%_%W%s%W%%W%%%%%%%%%%&%&)&E&P&c&j&&&&&&&&'&'1'6'\'n's'''p'  ''''bitmask_scan$H####%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlKKKsendrequestrecvrequest[R R$R(R,R0R***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gz4%H%%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data[jDLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-iJIrSkpT,II;,J[M, J[DD,J!JG,K2JH,CJKJI,mJxJ$=,JJ<,JDJ,J[J,J[K,J[JN,JJ9,JvG,JJXG,K[G, Kb,N,KJ:,K/K8,;KN,HK=,YK#J$?,bK4J#@,pKxK"A,KK#>,KD!B,K[?B,K[>C,K#JLO,K4JKP,K[JQ,KLLE,LDIR,L[gR,+L[fS,collect%NU)NUDDUOD(9-15`?CKOU`o{NAME=W]j6&Xmount_disks>      !"      !"#$%&'() str_arg_substget_available_cdsOD(9-15`?CKOU`o{ edit_fs_type_ext   (  1L@ _ o edit_and_check_label OD(9-15`?CKOU`o{disklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdtH2 8? ? B @= B 9 6 A 7 9 5 5 P l= $L ; 8 81 7 C F I 01 (1 0K 6 6 86 : 6 disklabel_change_geomChouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_defaultl,k,Dl,$l,pm_from_pepm_whole_diskgpt_freegpt_create_new$"!40/ 1..*X#($`*`)7,(!$P :$9@=`<2x=4  4baaLfLf6`] `&`-`aaa `!wO7]gwlwqwbj6]twzw6wW!-wS'`&rX*.wgaw`gpt_get_part_devicegpt_get_part_alignment2I!QtQ;QQX Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC&`SFU0eC,`5Hah!IdontNeedEFI6`;`(s*K>;LfE`|nQn- q+P`\`|nQn- q+k`u`|nQn- q+``|nQn- q+``|nQn- q+`=rGy=iG}``;Mt?``mWC 3KOO``yD<#*=(`a3Dh&aa\ M}-*a;a-чH-La-чHaaZIчHb{aIчH]aIчH`a2IчHaS'@ )Ѹaa*1@ )Ѹao1x )Ѹaa yyy`y(Ay<yyz z)zmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newx[f8`Za gpVXM@bMM\U|VU VLVhRSP s\yeO<HnpeORcX: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.1_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************[R R$R(R,R0Rusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump277dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_option1b_dc'dקeCfۧghi2jJklmmn'opDq>Brs dtu'vwxzy)A/B<CDCEMFRG\H=IyJfKmLMvN|OPQ S&BTUVWX¨Z1Ѩ4ڨ6yPЧ|hJ~}(64=;BJOU[aJXpyɥ©ȩթ}۩ݧdefault_configread_configrt_compare_proto%%""rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt##rt_buildrt_delete""sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initZaktyscript_buftoenvot©Rmake_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osCz~if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CD@DCget_leaseread_leasedhcp_openbpflog_dhcp I$dhcp_bind09AKڷI Qdhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASfwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\BD-)d---0--.Y$.D.`d...BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%HPHX)0Y `@ H)0XY$h`4/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist