08PZi'&<  'ZiM P''`'#. #.Zi'&P@@<@T 08PZi'&<  'ZiM P''`'#. #.Zi'&P@@<@TU Zi`'#.yAZiZiZiQ$f ZiZiZiRAZiZiZimAZiZiZinAZiZiZioAZiZiZiAZiZiZiAZiZiZiAZiZiZiAZiZiZimKpc%ZiZiZiX`hpx$ZiZiZi (08@HPX`hS$=ZiZiZipxP${ZiZiZikQ$ZiZiZi (08@HPlIAZiZiZiCZiZiZiAZiZiZiAZiZiZim<ZiZiZiX`hpx\$ZiZiZi$ZiZiZi$>ZiZiZi$ZiZiZi$sZiZiZi$ZiZiZiAZiZiZim ZiZiZi$ZiZiZi $ZiZiZiAZiZiZiAZiZiZiAZiZiZiAZiZiZi$`aZiZiZi (08@HPX$ZiZiZi$ZiZiZi$ZiZiZi$ZiZiZi$ZiZiZi$ZiZiZi$ZiZiZiAZiZiZiAZiZiZiAZiZiZiAZiZiZiAZiZiZiAZiZiZiMRe4-p- (\&7L3F8&CZ&jxr8wc:l-}Z )l>4qDx3U.G/C AU30P "m};8P^i]CG#. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4P`%4 (""ЁЁ$22x TTT,,$22Ptd)QtdNetBSDKwGPaXU SR ffffUSWVP[_.t$$ujPjjj̕j'0F $ux& Q/tuITuk;(s(9rD$t PI=P:=;s9rHP =$06v@ P+8USWV [È^.A A  1f rw  :tbZfPfGȉD$1 ;L$sσtu+AۅO111$$Q$w,1ƃ)݋9ǃt$4$9svl$9s`79sƃ)l$9sӋt̹sDtʋt܋T$4$9sJ*tu  ^_[]"USWV[û\.; s' ~*u.UE9r^_[]"SWV[l\.;s9r^_[f$SW&\.5u1ƃ5$tЃ t$k_[SW[.4uYƃ4$t|$<$kt(?t<$ktЃ_[WVD$0tP>tKj/Vt@Ƹ!"&PVt&uVh"hȀ"h3 @^_`SWVh"h"h3? 1۸!"&PCPrFh3j fJwh%h3? uh3j 7Jj 4D$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5t3 u$1^_[Vh"Vh"F 5p3h܃"j\wVh"jUSWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%S<&tutD$D$$D$% D$t$@N D$l$hx3h$4D$ @l$0tD$PhӤ$4j 3D$  |$\$4t$,s$L$)L >QPh"C4 D$  L$s()@L$L bQPhۅ"4L$ D$  s D t 4|&h"3L$ D dtPh "3D$(@9XU:\$D$T$T$9tt$N9BD$4|&5p3h*"t3 1h^_[]t$|h">%WS$h>"h["jeU5p3hy"jzt$|h"5p3hn"3$h"jhc 5t3p u15p3h-"j$SWVPD$Hw#t$>\&W t ub`&$h""W t N1AQhc5t3 u 1^_[5p3hB"j菲USWVP|$t$7Oh>"WV, fu t=p3u ԏ3)u p3uhA"I"t p3hjQO t3u 5p3hR"Ih{-u3$(&SU t uUh{"j聱h["j襱$NPVS& P\(V3PhV"V3 Vjjh"&&h"h33 uj(5t3FWVοV& tuVh"jİ&^_VPΉj PQ̭ x $9u^Vh"j苰WVοV<&f tuVh"j]t@&^_USWV\$$103 ,33 3sVj=Pmx<$hjjhd&U' L3H F H L3VP3uL3t;#=t%{ L3##=uthR"9L3tttjut!tcuL3H ܟ3^_[] L3jVhȆ"W Wh"4$h"4$h""jծhl"h"D$L$011PjPjt$h$蜙03,3331PjPjt$h"l33h"jQ1hjPPt$h"8331PjPPt$h",2tVj$L3u$1PjPjt$h)"ܘ33ËD$ȟ3h:"j跭1hjPPt$hP"螘ԟ3П3h\"j胭L3u$1PjPjt$hs"d03,3ËD$83h"j?1hjPPt$h"&D3@31hjPPt$h"33fSWV3t/ 33 t53)փ>8F u롨333 3 33;,3 03r*jU333 3 33^_[á3 3 t 3 3hv&h$j'hv&h$jht&h$jht&h$jUSWVt$|$6qI#SjSVW足 u=ԏ3P]ȟ3u,ȟ3$̟3؟3&Ah"ju؟3&1QQPy ̟3y 5ȟ33 3 =,2rğ3uhN"롡83u#<383"H3&1L3HH3& hQP3y <3yJ1L3H H3 hP583Q <3 43y 58333L3utS1V 33393rZ 3t= 3 ,3@ 3t# 3) 3I ,3 3ujg3 33П3 ԟ3t @3 D3t L3h`u;5@3 ,3=H3 D3503VP5<3W L31Vh3fhjg hjX 53535 33hԲ$-,2`L3t%`3X3 d3 \3;3 3ss$3 3tQj QjP  ؟353535̟3P$ xd53-31‰1 3 3=3 3X3\3=3 3L3 ȟ3xPh$ ,ğ3u6؟3j53535̟3P  t5ȟ3h$ܣL3 33 33=3 3X3=3 3\3CL3s 33=3 3`3=3 3d3u@s)t33H 3PQQJ 33ܟ3=3 3j133133hz"jsPh$j薦WVܟ3=t=H=ju <N3 3 3t;,39щ503s))Rj53V  03 ,3 3 3 u\5T3=P3 tJ5,3j53  03 ,3 3 33ʉ3)Ɖ=P35T3 t jY=<3uH3jPu m 8u*H35<3Pt^_h#jch"USWV,3|$,t33(p‰D$l$|$,u N3 xT$ T3P3 t!H3jQP5<3R !ƒ~t$VSh3 $~ D$ ` 18D$ Z T3P3 ʋ-33t>5035,3QPe33h3l31T3P3T$<$t$ 3-3l$13L$ p3t3D$11 43t,3u#3583h "$.T$43L$ AD$)ʋ$tЃ|1@|p9@|5P3T3*,31 03T$1 uKh3l3I$T$ 33)ѣ3 3503-,39p3t3$ t 3)PQ53趬 3133 33 t(p3h35t35l3QPVRy tjhG%j3o$^_[]583h/"583hՈ"583h"j583h$j-USWVt$(|$,\$$Uh3j+o C4WVs(P( 8jUjo 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[h"j蕡V΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$h$jVP^9v V肬VPQ褱 t1$^fSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV3 3t/jhB#jrl 3 3tjhB#jTl 1t$PV脱FȺMb׋ 3-։+3D$H 3iى tL$ 1FD$|$ 5t35p35l35h35d35`35\35X3h"jdW,WPWjkk 33 t?ƒ ʺǻ%t#RQPhԉ"jd|$4WWgPWjk |3x3 t?ƒ ʺǻ%t#RQPh"jd|$4W`WPWjj t$ 33 t?ƒ ʺǻ%t#RQPh"jd|$4W WPWjwj 3D$=3jPt$ t$VgÉiL$it$V)QPcRPVSt$Wh"jdt$@V$V=PVji e^_[]EVt$;V!ajfUSWVğ35П3=311C؟3W535̟3P$ MtgM3u5ȟ3h$詘؟3W535̟3P$ ݅~ğ3t )u=3N{T,2rOH,2d5П3 3=؟3 ԟ353jVP5̟3W !ƒt^_[]hQ"j辛5ȟ3h$jܛWV43uD5@3 ,3=H3 D3503jVP5<3W !ƒuuJ@3 D3ti11H35,3535<3P$ ~J;5@3D3r,f @3H H3Phm5<3Q xw^_xof@ H3Phm5<3Q tD;5@3D3s5,353h3 3,33 03 t583h$j臚fUSWVX $p $l 77h#j6jlAhk"WS H-$&333@33333333u3i33S 3G(3; 333$333,3=03-t=E=3u =M= 3ui $X0:Ph$h3_  h"'0Ph$h36  hݎ"N^_[0ܽPh$h3  h|X&hN 3uá3u tjwGjFUSWVj!Ƌ|$11K< @u=l3t?jj5x3 5x3:p3t3l35x3UjW= A)߉np3 t3N F5H3q0\3H3-p3F t3j0苼Ph$h3 h|X&Mrh "]1Ht3p3(0IPh$h3n h"'0 Ph$h3E hݎ"LV1^_[]Vt$5H3q0F\3H3^WVL$ 35|39})=\379}>\3829~vRO9G9~-82X3~ZX3΋Nu#82)Ou9~82RN982 |3u 3uu82^_É1jDjDVT$X3t=X31X36X3t@9uхtX3uhq%hK1^SWV1ȡ3t3j?Жh #a."tWmt|8/uWh4"Wh@"h32 3tLPU%t$hg"P`x31ۅu@W,S53h$ j"jM"PJV ^_[Vx3tAPcxGx33t!P$53覟31l3t3p3;53:0[PVh&h3h"I^Vt$x3t3P3t!P$533Vjh 3hЕ3 "x X3X3\313@=ujuSVL$D$ T$t$33533~A23BI^[fV13333Pw~P>qq3Fu^SWV53953t$3Vjjh3ut=333jjPP`thۏ"h$[H303@u3=3V>tVPO G~*h "53r0h"h$G1N1Nyh/"h$G53~3H 331H^_[Ë 3u!T$73313xD$Q331HSVփuU303@u񸠡3jjPPi_thۏ"h$G3 3 33aˍ3)Qh3Pm 3303@u񸠡3jjPP^thۏ"h$FVjjh3^[Vt$ 3u3313x 1H^USWVh"aƊtx<0uFD uh"h$$EGuȿ|w WjPl 1T L ш @u3hjV: PK1FthЏ"h$De^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$x& 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVPX3 t uh@"XC^_[]eC$tX38u@X35T3Nj-T31;-P3M1WtÃ=t3tj jwSVVVSt$1Ʌ;L$uWwZ?E;-P3|1MV31535ġ3535353ޗ53 3u 3uu ^j:jq;V53953}3I3P53tC533 3u 3urufL$3r53 1^0Ph$h37 h|X&A 3u‹ 3u tj:j9USWV l$ D$fD$p 1P 3ġ3193@u 9uġ3SkH3 t$$PPh,  $ @3| t %ܕ3ڃuhB#QUuhq"QjD$P 4Ë $39}=3]39|A‰T$R53NjD$3=3 3u32$@PSWx =X3?5ƅtH3VPP,+ X38uK=3뜣ġ3GhB#5X3zt:jPDžZ"x Q:? ^_[]Í|$G0hPh$h3 h|X&> 3u3utj8t"j&7WV 35ġ319}'3FىDuw9@u1=ġ3^_USWVD$L$9tV3r=3~=39 t9|1C3Mu9|1C3=3 9u^_[]fUSWVl$}!uEh3B#Pl"UT1h3B#PÅt*t$Sǀ}!u?SU'=0PUh&h3#h"=eSvx(=3uWh("h3 5H3+t$0r0蓬PUh&h3h"=^_[]USWV |$$Wơȡ3$t3D$\31-ȡ3-t39-ܡ3t\$=H3t$ gDž~w1135̡3Y6tsH3PPjJ Å 3u3t$ Dž|$$\$9t$utt "<$u=ȡ3t!ɐ"9u t3 uh3Pd9¡t3Ƌ ȡ3Ӏu1A9|$t $ ȡ3 t3ܡ3t )) 3u 3ut j4 ^_[]j3USWV1|$=ܡ3t WrGHOHt uG `-С39}̡3V39rFU5̡3裊-С3̡3 3u 30u t3F8W<1ۍF-С39~N3 ̡39wUQt7-С3̡3 3u3uhtk̡30 F(0IPh$h3n h|X&9 33j2G @utL̡30 Fȡ380ͨPh$h3 hې"Y9-1̡30=t3=ȡ3  )Ɖ^_[]js1USWV|$?!uGhQ$Pet$WI,VPÅt2l$t$ US NjD$8!u?SF"=0PWh&h3h"{8mSgx-=3uWh("h3 t D$ )@ʼn3^0Pt$h&h3h "8^_[]USWVPl$Uƃ=ܡ3t1ۅtf;l$ `1V$th~;-\3u=t3t =ȡ3u8 GWPt$ F x4EEs @6;l$ |=ܡ3tt$$$^_[]USWV|$\$l$19t[=ܡ33t UPrUPOFy20SPh$h3x h#"61^_[]USWVP\$5X3FEx @u}|~PVq6tjء39~l3ԡ39SP9gƉء3ԡ3 3u.3_tO5X3;^_[]Ë5ԡ3W5X3V蔩 . ,1xщǃ|$uE@3| /5ء39$~Z39V5ԡ3vcÉ5ء3ԡ3 3u3t ԡ3W5@3U ,$+HPS5ԡ3D( |$tM1BDžhZ"409Ph$h3^ h|X&41 335ء39} ԡ3|$N3ԡ39͋|$|MVP?t05ء3ԡ3 3u 3umua(/ Y0zPh$h3 h|X&4 3t13uj-j/,SWV11ԕ3H ԕ37hЕ3u8ܕ3@%fܕ39uЕ3H Е3ÍF=39~Y39wW5@3=3@3 3u 3t @30u t3F <3C0%Ph5"h3J h@"2%ܕ31t @30@3X3^_[0ɡPh$h3 h|X&U2 3u3u tj_+j*USWV\$ D$1tt$hR"D$ l$1uHD503J 03;@3у  (3Q(3;=D2|h(3h%7Z1GD5 | <\t<03H 03;@3h(3j\(3H (3\\5tjj ShW" tVGW")Ȋ`"03J 03;@3Vу J (3Q(3\$ !003H 03;@3h(3P.(3H (3D50 03Q03ɋ\$ ; @3h(3P (3Q(3D50 03Q03; @3h(3P (3Q(3Dh(3Qt4 03Q03; @3~;ȃ t3 (3Q(3D$F9h(3Q!h(3P똡03H 03~(3H (3 h(3j 1^_[]fWVD$L$L$$$0f| $ |r13hi"t$t$ o ot9EtzS3ǃxtostypft=3먡ԏ3  $)D$|$ta$8-uW3D$|<ԏ3b3S ܡ3D35$L$jjQthj^1Fh6VMVjBhWj3h3ƅux'3|$t$8t$0|$t[h3hq""V$8u h~"_-j葩u$h3hp"Uht"--y =3th3h$h3 3tPh$h(3ў xt` @3| D3x51gH3QPP M=83=3h3hq"Th":,jl%ܕ383hZ",%ܕ3΃t0h3hq"sTj51583h3hq"MTh"+VǧQ=3th35<3h"h3jrjkPh(&h3 jD=3jPunh35<3h"h3f$j0yjt$8!$h0h3q uh3h$h3 jL$ ɸ!3Phht@jج x#$r@2D$ rD2ËL$=3t1@ 3Ql"L$=3t1@ 3Q#WV1F=3t9|$ ?!t!hR#Wֻtj/WGth")1^_L3H3P3T3x>L3 P3 T3P3 X3;t,uQX39;uH3빋 L3| L3P3t9tT31Ƀ USWVP3X3DJ@t t@X3@DJ@t uHH X3~Ã=w$T&=D3!h;"  !=L3" X3A1Qptntl  Ӊ X3A˃=L3FP”^ U X3@߈\$ ̀1ۈL$QuH X3H1KDB@,Aǡ\3 L3  Pj  5\3j$1  ˣX3@̃=83t=3y=L36DB@jLǡX3@1Hptntl   ˣX3@̃=L3DB@8!h'"=L31Hptntl  ˣX3@̋ P31PptntlN  ӣX3@̡H3HQPN"X3@1Hptntl%  ˣX3@̍H X3 P3 p1Pptntl   ӣX3@̡H3PPv X3A1Qptntl  Љ X3AˡH3PPH-T3P3=L3=P3 9=\3 -T3P39 9w hl" H3PP X3A1Qptntl  Љ X3AˡH3PPl@ X3A1Qptntl  Љ X3ADB@;h" 1ЍrЃ sOj hX35X3W l3ww8"%h3 X3:o t!gc ptrP  A X3< b=d3Ho1H3PP9 T3-P3 =L3=P3 9=\3T3-P3X3@1Hptntl  ˣX3@̃=L3F1Hptntl  ˣX3@̃=L3h" 1@T3 H3AQP2 X3<j hX35X3U @2荿8"h"N@2 X3x w =L3\3tP30h0D& X3x A =D3u;.5P3O1@T3 H3AQP@ P3jPP>X3x  1q1ۃ=3Ƀ=83 ˃hq% X3x  =D3u-5P35T3 5H3g X3x ? =D3uL-5P35T3: H3@;\3?7H3-X3x =D3u , P3IQ TX3x =D3u,T3 P39QPnX3x QVP X3y F( X3y 1 X3y P5P35T3g X3A1Qptnt lu  Љ X3Aω X3y  P3\3=@29|PRQ 1=L3u \3P3 ǡX3@1Hptntl  ˣX3@̉X3z !D3SPhAX3x  1@+33uF%X3x t=u<2=3t13X3x =3h3h$h3 X3x }*x1Hptntlu  ˣX3@УX3x 'ܡ3G1P3T3X3@Hptnt lu  ˣX3УX3x =33u%|$WtQ$5P35T3QP';\383X3x ==D3uJ)=33u5P3Q5;\3)83hW"h"h"l3hq%l31< *5 X3y qtp3@Pp3@P2=3h &+X3x )5\3j 6'(Y$i*tEEp $A8GMi T391P3)@أH3=D3t W6U831 3u 3u u^_[]jjSWV=3uj貽L$ɸ!3\3PjhQ$h"Hy|h[#wXtkP舗=Yà PLtGWP|3/tf/VMed.hDhup5\3jhQ$Vj=3ujL$ɸ!3jh3USWVPl$5T3'Ƌ=P3T3-H39ʼn) u)E1u1$3E@3V}tzP蘹t_H3PPj DžtO833H3u 3u[uE6MH3@Pi1,$l& 3u 3ut j1^_[]jUSWV$3 3th"ckjP~X3L$F$ 39} 3V339|BVPT533 3u 3! X3 u1C1E҃!%=3h3P轔Ɖ$ 39V39V53 T533 3" 37 09L$]939|WPS=33 3]9~[39V53KS/533 3u 3yt v3 X3 (E X3QX39\u=QX3I ( 3G (E,$s X3L$A X3 p3y 3)9~_39VPeRI533 3u 3 33| p3A(EAp339r X3L$A X37 33/ X3QX3 ( X3݀ (539}p3R3p39|KVPuQt]53p3 3u 3S53Pt p33D$1!Pb0pPh$h3証 h|X& 3 3u!u#^_[]h"qht"gj'jVjEtL$Qq p PIH10oPh$h3 h|X&n1^V3t.L$19 3u3H3t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h3?XWV X3 td< uh@"1 QX3I t;8t7P1ǡ<3t?=`3u6P|<395<3h"R5<3j'D<3tV`353WP+q <3t.h'h3QPO5<3[T<33/0#nPh$h3H h|X&^_USWV=X3 tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-D39}=@3M3@39|KUPMtYlj-D3@3 3u3uyS5X3Wkq 5X3=t3tsj jSWme0mPh$h3& h|X&1 3u*3u(tjh$h"[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17uX3 uH3E#tX3 uE1^_[]8uPX3HЉʀπwR胜j hX35X3{2 1wU8"uh"1gu@X3ErUSWVX3H X3H%u,8Xu'X3L3h"t18u=P39 L3L1}5P39~[39V5L3.K#5P3L3 3u 3\t YL3 X3QX3 u (\t u^X38uTX3H X3 L31< u0=D3u't @3| t %ܕ3ىX383L39|NWP?Jt8=P3L3 3u 3uuuw5H30L3M1IQ0riPh$h3藵 h|X&1 3u 3uu^_[]HX3,j'jUSWVPL$H3T319P3}%H3ȃ Eh"Kl$ H3PUVPt$$KǸ1$H3PPT331S̪áH3tP芬EPPjM Ņtl9u 3l$ u3ue$H3P3+T39}yFH3@H3P%Ut$ Pt$$hDž+9 3u13uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=t3tj jvS肮vލD$jPjSumt1t$ED$$D$1E $A9T$ 4X39Ɖ $T$~c3t$ 9V5T3 G\5X3T3 3t$ T$u3=t3tjj RS藭T$=T3RSW_j 4$D$D$ X3 $9~bt$ 3$9V5T3ZF5X3T3 3t$ u3=t3tjj t$(S=T3t$SWi Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVuv&D$)D$X39~V3 T39SQOEX3T3 3u3|$~#D$$ D$ ud$th"$=t3\$tjj SV賫T3SVP~h T3f |$%C<0dPh$h3= h|X& 3t e^_[]Ë 3u tjjUSWVPt$ =H3T$-L3E<\<&I,$D$h)X39~Y39W5T3C=X3T3 3T$u3%$9C T31F9uEEπ;D$$,$L$l)X39~Y39W5T3C>=X3T3 3T$u3ml9}C T31F9u,$y^=X39}T3_39|W5T3B=X3T3 3tT$ 3T$M 0E+L3;H35X39}T3J3T39|KVPAt)5X3T3 3u 3u^u`I0@aPh$h3e h|X& 3u 3uu؃^_[]jjfWVd3 `39|ld `3j Qh\3) tJP`Ph$h3٬ h|X&@5\3F1\3`3kd3L$t$T$ =\3@Q葤 \3d3RDVu\35d3@LF5d3\3^_SWVd3d3r9 \3@<u|L19tWWE9ud3H3H2\3L2^_[USWV=H2=L2=d3t 83H3$\3D$j荣3d3 \3ÍS4R4nr@44v\1L1 [ \3\1l1sRt6,lmL)1 \3t)|?wt)LI1 \3t~l)}L1 \3,u44vL1Y \3l1}w4R4Ӆ HA9~R\34@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=D3t׫H2H3$H2L2\3D$L21 3u) 3u&tj\h0"$^_[]jlUSWVL\$d3h@"?E"tNjt$`hP"SV. fttu=t=߃u ԏ3r|$L$ D$1d&ړ"D$P}ƋO9rPSt$ ~ tu;_Յuͅu t$hy"-|$dD$ Du$$1Fl$?uSt$ hU"j&L$j QP,# $;Fl$|1ƋD$8u&1zPUy!Uh$j%D$ th"j%NjC=m@!sHQPW xs{QPW x4$Uh"- =muqB dut\$fCShmWZ HefD$t$Shmh=m8@u֍D$Phm8@W y?60Ph"ӍL$fqQhmW 3Uh:G#D$ukD$Ph"hm"S T$"h"T$"h"03H 03~(3H (3 PhP"kh(3j 虩t$8t$8t$8t$8t$4h"ȣt$Ht$Ht$Ht$Ht$8h"解t$h˔"薣t$ h"腣j諚FPh*"h3 j茚SWV֋|$t "?t$"VQP8 JB803H 03;@3h(3j<襨(3H (3詧(3H (3>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hQ"9thc"Pzuh3hg"9thc"Pfzu hq"jhc"hg"\ 93P+u h"j.!0+D$ u h"j@!t$,)݉\$D$$D$11D$$h"SU( c7~+Hr߃8tlH w&$&t=$뼃4t6맃dtket/1@D$S2=t=umWt$3yXh"5t=KD$71@D$$+L$ ԏ3 ԏ3T$uAԏ3$T$uȋ$D$,jj@RRl$L$ $tL$ $L$,1ۋD$PvCEu S+)St$PʼnD$$Q- UXvl$$T$DtIL$ىL$$U$E L$)QPR, 4$vEuED$ush"h30%ru]hޕ"bh"XL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$Vhl3t$ t$,QPRmZt$ `:yj=l3y h"|$$tQt$(jVjhSby h"jVjh5l3zby h""h"qǽt$(1CUVSwD$P9bUVSw5l3%bt$,01L$XAAA @D$HPQSu =h3u'l$hD$h8jU(&  ul$uDžy hSB#1O~fVS5l3 f VSt$Vf |$h5l3l$0fE<u1范u@hWj uh8Z18tƉjjUx tD$68Zt8tEVSt$ x )b8#Thإ%|$l$8fE=h3ul$0fE9EjD$LPj |$@f9fGfGl3G$jVU tQf|$<tٺtf|$4t?l3L$0u+fD$<=h3ufD$4 8t$>Nf|$Dt1BuNfD$Dh|$u%j t$kh4"jt$j蚑hy$y+hx"Ph9"h3jlPD$L$jQ5l3C XUSWVA1K8uSt<։<hU7G ~WUV ~)u11ۃ8#ۉ؁^_[]ÐSWVP|$\$WSmƅu]jj>/tqƉx jPS ǀ;t$8u<蓀8"u(G=w(rfljF^_[ÍG=rhh"j;h"j_fD$0豶jfP=p3tD$L$ $QPjO XWVt$|$ t8Ph"j5O 45 t3A9tL t3^_SWV\t$lt8|$jYPWR GY&Ӄ(Ӄ,P6B60l44^48P4WVd^_[USWV $8 $4 5x3VnPV!0W5t&1WWPփ (JWWSփ _ƍ Wh P|& WjjW& TV&h "<Ƹ jPPV(& hVU\Q V43E=a==hD$\jPSx& 1Nxr$ SmǃWI"0t^SWP&0 tg0$8 h"jL0h"jL 1N ^_[]þh"j|L۾Sh"jcL ¾h/"V#2=bt =buk $}u+Zt$WSVL$ uH FYD$t8Sh]"#ShQ"WVP;H 1QQt[0( Lt5|3tQP!0,tt|@P Ɖ4Pi 8tg04@tt| r>1A8Љ4DAtt;L5rSh"jJ 10hu"WV|$x$t,WDWHDWDW4Dx uWWjtw\wXi=29}5PBt852WVh"#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,0* t$$jPb8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W $>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,S( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,q' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d::3t$3|$ uK$@k,PUD$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph",h"5|$PQt$t$RhB"j.9C$t&8$\T$XT$H|$RQt$t$Vh"j8$L$l$8h "h"hh"bUSWV u|$W|1+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu h"j8NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWPVl1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hRj,PScD$HPh|& |$0hRj,6S%tND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWh"j 6^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh/" 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ 3333353D$D$TH Qq T$T$ t$t$QShR"jt/ 11KL$0t.^SPhޙ"jM/V53[S343t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1hljP88H H;1D$8<9إ38D$D$ tD$tD$|3ڋL$4Iʉ9w9vˋt$ 1t$t$81QSP "PD$tD$t$t$8WSP "PjI,tD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPhI"D$8Ph3Vt$,V'~GD$D$8D$HD$L$PD$LPh3VD$HD$8L$ $\$(\$(u@,(L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L 33tt94 S.8|3T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Phw""¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh"D$8Ph3St$,V~D$@s,D$¹tt;<FG;D$ L$?-Vh" Qh"jp( $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QPp;D$DT$@D$(4t$8t$t$t$0|$(WVh" HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhg"je1gD$4$DŽ$߬$D$D$D$@$߬$ &a111CƋD$|$8D$|$H|$LjD$LPh3VL$HL$8t/3ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPh̞"b11ҋt$  t<=33$T$p$1߬$$$߬$3333DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QPj31A1ҍt$dV$Vt$4t$4VWPjD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4o*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=3$t1J8D$<D$ۋL$؋3k,L$1T$9|L$$)щL$ Ɖ$D$HPWh"W $PhD$(|& yNHSL$ L$tL$L$8]:u*t$ tD$PhU"j ,uh"jx uh6"jd M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$P"D$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPGD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@h4t 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RW2NJ1 t1t$|$ 9|1t$$]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVP ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$VhH"jST$$BRt RPRPVWjt$$Vh"t$$k,PQD$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph"j$ D$,|$D$T|$XD$TPh|& t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$t$t$D$, =p3yh"ji e11t$ t$$k,t$D(D$L(L$(}tTt  t1L$(VWt$Q](&[$t$ D$L$9Éʋ|$S=p3tQPjWhF"j ]K |$t$tuL$HtL$D L$PtL$L 1D$ L$$uD$ D$$D$,9T$t$$Q1QtQQy $H 9h PWwjh |& 렋4$t$T|$ k,ƋL$k,T$4$9rT$ PRt$$QtXD$XD$TPh]|& |$t$t$kL$,9 $ ?t$:0 PVh#"j D$,]|$t$t$t$L$$QtXt$|9|$11k,D(t P;|$}L$֋L$]t$Qet$D$,TD$, m4$yD$,`14tPP2ha&j8 ,u׋$e^_[]USWV3tWjjPO 39u 34t0jQx!=p3h"jt$3xi8tLPWhС"QmV`tPSh"WIjHt8Vh"j 1^_[]ÐWVD$L$tT$ 1<219u^_WVL$tT$ 11<219u1^_V1T$ 1u^fD$t1B9| 2I 213Iu顀2P,3 2~ t1@,3@9uUSWVD$921A9|G2SCƉ<$~ SjV3 2D$~Q1ɡ,3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5,3C5,3$2^_[]V$3 3D$D$ &T$ t$ 253t$T$L$D$\$ $_"UO$^Vt$FtN H N tNHNfr v V 3^VD$`sH) 3 3 3HtP4BPQ@@1ҋ3v9t3,3rh"jtp4F@3^USWVD$T$#25,3tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hh".USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv /F V>3 3 29|[5$3tFNu (353t5FNHNFy F4VPV3@31@j@PJU1@P;F ~4D$F(^$F0^,n#2^8,3 ,3t q4,3^G FtH 7~ F^_[]É 3=h "h"hh#"h"hh"-Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H 3N^,H 3 33H@3P 3 (3H(3H4I,3H89t;tprp,340,3t4F ,3H^hD"h="h4h"+USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv - fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ jN8p 03HtƒQ 03@ 03^_WVt$ 43F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv+ v^_USWVPT$|$:%483\$ 83$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4831ہ=43| t Pt<3031t 98t@^_[]Ã^_[]`V15435@3hVh83* 503^ft$ t$ sjY>SWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[hr"x1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS#$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h"#USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FFqF ݈F F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$hݨ"&j$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthUW1$2L$1 QWPUSVh4jÍD$(Pu S/ \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4jËl$hu PF $\ E1PU\$tE|$8t h"g,$StU ^_[]Éu C4CHKL1},$Bt؉Ń|$8ths"\gt$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh"l8B$  $ V)19tQRh"(8 1@^USWV |$,\$$t$ tCPPt Ttt4RQhY"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthj" 7h(3D$(u KHKpStURQPt$DljT$t h")eu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh"k D3VRhХ"T T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh\"D$L$9tQP$$ht"t$Ht$wL$tI9ȋt$ tPQ$$h"讋1t$\^_[]h"h"h)h'"h"h"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|ttr|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$ "pu0|$ r]@hD$D$D$,$D$ ,[D$ p D$D$D$,$D$ ,LD4@hD$D$D$,$D$ r,@o M|$@ t"D$D$D$$D$$:"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$DD3uG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW臗ƋD$0T$UWkƋD$0 u$$$UW0ljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPÖERP賖$GW #RP螖ERP莖$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPzt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP<|$FV D$t RP|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP觏 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP |$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP聍$ D$TBL$?ttXLT$BtJ J T$$T$ QPL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP|ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVdD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hf"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hU"h h"h"h h"hd"h"h"[USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p nA L$H SjQD ^_[]fUSWVL$T$ BH3ulF1G &UhЪ#m ,$03H 03~(3H (3 h(3j u q1^_[]V3PPh"VVjjhԮ""@&PhR#h3\&ujUSWV׉΋*h"UD&tCt[PUjhhL3s 5H3L3t2H3L3WVS5L3[^_[]Uh{"jG5H3h$jeUSWV$:$D$VuP# 9$j uP 1ɉ\$QSus Ƌ88"u11F9Ή$<$|1ɉQSu >q ËD$8ՉS8"u !t$$Vhyd5L3a tbVh" ^_[]jhȩ"7jh".uh""$h:"hT"$p hn"h"j藊$05H3h:G#j謊USWV}E phZ%VBFh"V,h%VSD$(P5L3{Z#D$0= M$L$A1yyy D$Phwd5L3 D$tG\$ D$ L$|$j XljL$ NjL$IuɉNjD$ D$|$uhjОD$v1111O w+Ow?u$L$A1AAA D$Phwd5L3-  \$tmt$ NL$,D$(H3D$FD$FD$ FD$$~D$(PJPWt$,t$t$t$hΪ"+ KuD$1D$|$Ynhxd 5L3R5H31111VQRP5H3h@"hxd 5L3> H3LQhq"ww ww5H3h"hw_G|$9w  jPQ5L3!¡H3tNSVPh"Wt$ 5L3]U `%9t\"QV5h(3ٿSVPh"7كT$;r ZƉ[|$?e^_[]jj5H3h"lhI"h*"h"h3 jQh"WV$u>$jvWr s'Wh{dЀ5L3 t^_jh˫"j65H3h:G#j1VPPhtd@5L3L $t%t5H3h"$2"u"5H3QsH3$$w"w"s#QPhP"I H3$$ w"s#QPh|"$ H3$$w"s#QPh" H3$$w"s#QPhȬ" H3$$s#VPh"^5H3h"jWV$u^Vhzd@5L3 tH$D$PWVh6"^$PwwwwVhD"<^_%5H3h%"j|USWV}D$Phd@5L3 tzD$Phd@5L3^ u5H3hx"&H3$|$\$ t$jVSWVRPSWt$h"e^_[]f5H3hg"j轃SWVP|$uX|$_h#S`ƅth"SLu+1Qhwd5L3 t ^_[75H3h:G#jAUSWV|$0t$,1@l=ԏ3$1ۉ؉D$h"WVʊ qt\$te+$95ԏ31|$7wWh|d5L3 D$ ;D$t-i9l$sUt$ƉD$l$묅hhPV[H3L$ #t.#RQPh"|$ t\ư1P`VvvvvQPh'" G;|$ ru5H3h"v$t1^_[]W5H3h"j讁5H3hǭ"jljeP|$u1Phd@5L3 H3tQhN"XD$ 0Qh:G#jDSWVP|$t$^h(#StDh3B#St@hQ$SttT$da3 D$dD$ tTj/S+tF1;tٍT$d#3D$dD$,t>\$:t$1\$(Xh&d&h(" u1\^_[]h"hY"zԏ3=\3uj=d3l3`3X3T3 T3Yh1"5t=h "Ph"jyX3=h3u th"0"`3 T3t uh"t=2uh")ǃ|u D2j=x3|$\G1PPL$lQPjW蔬t2t$d轄t"1PPD$lPVjWht52=x3u4$P52Zu#$=ux3h3 d3 l3 `3=3 ɡ2=x3t&jQPF 2u[52h #jhh3QP艏2y"8h3h"23=x3u'L$dQP=52hE"h3hrdAP 52h"sh3hedA52 52h"h3h2"s$$t(hQP52hO"$$ƒ 3>s1@![Vs ) ȣ3333? 3 3333335352=3=3?wd3h3=l3L[Vl3?h3) d3>r$r$d3 333u 22]u1hQP D 2u253h$q52D2jq52|V+3u Vh+"8 11h3t1A1A1ۉL$@1h33 3h3=P3u#3d33h33l3 t$\F|$LSSWSjV9t$L_3n 1QQWPjVy53貐352j/VQt@UUUU)ʹ3333!!сis31f3t!ttb33cԋj3 t3x31n3‰ |3331 31AhQhp3'^ i-p3=3 / t3ًx3P+==w !r%1H$D$ ʀŸw1D$ $}ȹj3yt\3t  u31I $L$9 p311O|$ytyt F9u1H$L$$L$ 1ۋD$(1uh"$D$Nj 31҉19ʃ$t$ىD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Cu9$r$$d3-h3=l3x3D$t3t T$$T$`3=t3uu 2; 37=X3lP3_hW""E381uh"%3L8L$(L8L$$L8L$ L8L$48\$81=2Ɖڋ\$4PVQRoPSt$@t$,t$4t$<31K1Kޅ`1PPPPPP =28h;"1b38LFu=X3uRh"%tajh"&1 "WjWWWP+h"t҉3u b3=h3u`3u l31g=h33D$tD$|D$h"631N=t 蹵@ 1u"WhVVWP+9tigfff։f5633L$ȃjP}D$ u h"j7hh"=1HL$ Ajh"1۾83D$3tB?t=kWUh"~ 3L$ DD 3$ D$tD$D$ u53 31p3|(.tq<(tk{PWh" x3t3p3t (BD$,T(2D$ TL 3$3L$ щtT$ 3T$D$,F9u߃|$~O1l$GVWh"v T$ L D3$3L$ tT$FЉT$9uT$1۹"VWSSSP)T$ ‰ $DD$R肂`3=ue53$@D$ $#D$u D$ d&1$L$19;ta $Ȣ43=`3ud3ul3u h3=X3t83~ h"3~lhװ"]h"=`3u1I3 3t h "]h"t3o3e$jt1 43j3t \3t3$ D$ 43 u=35p3x3t31|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 43|$E9u KD d3Dh3Dl3DL /3 3WQD$lP> D D$EFI 3EPART3M u#E1M1 uu WjJ ;Et 11=p3t } tu$u SVRt$hR")Uh0"[ ^_[]USWV|պ$u $D$$$L$ T$,D$t[9-3~x p3 D$ D$x35t3D$8$t}t ։t$(tb3D$D$(#D$ 31ۉl$8QD$ 1MD$(D$8D$D$P$uat$(T$,$L$P=X3t-t(WPh" L$ T$8St$,T$4$tD$XRQPk XL$ tC=u=D$8L$XRPQk l$0$$L$ *D$ D$Xl$0|$$L$ tW$=T3tduD$P $OD$hl$( >-31ۉl$(-D$D$DT3$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$x3 t3533D$t$u~t:t  Iuh3 щ $ l3t&=u53օ4$u 53GX3ti3ȨuhF"h%/3tjT3=u)3Ѕ$tN3=X3u"Ph{"0hF"Ph"t 3 =3uQJ$$t%t҉%13ti)3х $t4$P53h"!=X3u53hX"1t"1`3=u )353^_[]VPD$ L$ $QP@Xh"ԕ3H ԕ3~Е3H Е30hЕ3!Ɖ t9tDԕ3H ԕ3~Е3H Е3hЕ3ƒ1Y^h;"jIUSWV1=|3˃y CS t 35311 uY1ɉNVt11@5C C"t&"Ph")E h"j1He^_[]SWVP$2;2u+x3u"QhmdP y h#D11h3<=3u;53|- 31Puh"V=3~e1p3111 t3x3Pt,p38C;3|h|"DSh"D$2;2u+x3u"QhmdP y h#C^_[USWVP։y1ɉQPU{D 1O}t#Ë$8uP8"u r1^_[]USWVP։ϋl$=\3T+p3 3tú#t$76PSRh"T$7St$h"xD$7UPS\$ Sh"S7PUSh";77PUSh"7PUSh"7?PUSh'"77PUSh8"7PUShI"7?PUSh["'1PPPUt$(SRh"`^_[]USWVˉ1u=p3h"T$$8$43|$͉)uh#Wh4"Y |$Z)uh#WhW"? D$|$USWV1Hf3t$u9e3d3  c3l$M?>j3:i3h3 g3l$M?>j3n3KL$ u}tGE)9H9^_[]USWV,։L$D$DD$d"tD$"l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h"証 l3h3D$HL$LVSQP譒D$T$D$PVSUP葒D$|$ D$@VSPWuljӸ1=2ƉT$ L$@PVt$QR9PSW|$LWVUl$lt$,t$,t$(t$@h"ֻ,hЕ3jdh<3" |h#h<3h<3\$ $t < uC{ - 3DAu<-j D$$Ph<3: D$$\$ hY&SQHK|$(@D$Ph?"SK $ϋT$ t։t=t$hQ&SK t't$hB"SK ct$ |$@D$1=2ы53jVWR蹐D$ՋD$D$D$D$D$$t$t$D$$  T$3u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$Th#S< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRhl"衹<3Vƀ;3t$VhF"q 53D$,$t$P։ω,^_[]h;"j_9USWV΃ twttu"^T$(|$$+3уD$ ;t3"L$ x3|.|$,T$0 3|$9=|3|=X3u|$4u 1^_[]Ë-3~} ʉ$9twp3|(tk t3t( T( (t1+39\$ \$$}2;T$}#=X3u6|$4ttD(OG1nF"t(n9Չػ}n9l$\$QAuƉf3tt  $tt ^j3 t311 x3t$ -3t$|$$|$}p3] ʀ|(tP t3t( ;L$T$|L( (9Ή} =X3{|$(t ;p3KC x3t3:"1$t=t t3 x3S"=X3|$(535p3R13333|3x3t3Ɔf3t$ |$(Pf393u85p3"R13333|3x3t3p31Ƀ|$(T$3\$1 53n p3|+D$Nu p3[\$j53t3)؋ p3P|$(t$ hhj{Jp3VfǀU3L$ x3D$t3ƋD$$ȉ5|333113up3=X3h""u"}"=X31|$(9 3u85p3aP13333|3x3t3p3Ju UPQ= 31|$(tD$t3D$x35|3=3^_[]h"j3WVp3t^ tڋt֋|҉tΡp34 3 QPV0= 3ƀ^_USWV T$L$3@hPhp3   3p3~Cx3t3$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR{< p3;UjP覕 fDŽ;UtZF , M ;M;MU;; t3 3T$)ʉUL$  31 EE=l3 h3ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! M3 ^_[]h:"j41WV1=p3Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ53<tD~t@ uB 1u€πr<r1@^_USWV 2D$Ӌ52݉t$މ$!!jVWt$ly!1Kl$ 22uhUPzQ53P ;2u[jVW52 y!1Kt?D$H53#$SUPi 52V52; ;2tÉ؃ ^_[]h"j(/USWV$0$,1@D$l$D$D$ $1h"WV6 suMj U5t= át=8=L$90誕8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-ԏ3)1<$L$jhQP4uEh3hedAPHw =>3K9l$| K@f>3UjDž\$ t|03H 03~(3H (3 h(3j jh3h(3 03H 03~(3H (3 h(3j 諲<$ D$tt#t]"Ph="ĬD$f<33Waf<3gdWPVv xnu)D$PhwdVu h"h"V1^_[]Ph"25t=h"jP,4 h"h"_j0ˑPhj"h3苮 jUSWV\T$3< $S7D$9d$ՉjRPt$ VDu11 Sl$UV 9 1U\$tL$j@PQe 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4l&h"ԪT$l$ >31ɺT31MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$H3t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf >3ŅtMaQ4l&h"轩T$ t tuf f111H3|$ L3P3T$T3U3fV3l$E<$g\$ttXaQ4l&h7"/ ;B Q4l&he" <$\$t4l&h"<$l$!F1D4 "V诩 w,hP"V螩 w0hc"V荩 w8hx"V| w4h"Vk w"@D$Rt$UWQP $71w8$Ћo,1lj1l$DRWt$>"P@PUaUD$PShG"$S袧$#a0QShU"$Sv<.Ǡ!w4&hc"Phk"SH  w$&5h"_<t$uM55h#RPQhr""555WRPQh"SѦ7h#h"S輦 "55RPQh"S蘦M8tDƔF1Ph"Ss F;E=L3L$y"$0EUPWt$h"jL3{<|$\$W4$;Wh"h"S4$u h"jF j/PQt|4$4$:jmUSWV\$ l$|$t$1EH3&L3P3h"WV& h~n3itVnL3Ѓa~.btCdT3봃otBs\3띃NuSt=H3X31=P3P3mjSh &5t=tHPdEuAԏ3)ރu4t$$V41ut$(t^_[]hn"jf̂Ph"h3茟 j$"=P3uD$ D$@"H3t -$P=\3u %=T3u "=X3u $$@P0h"h9&jWVPh3B#QKt1ƉPjPW臧 Wnt jPVsP^_ÐWVt$|$ VWKxt$?/tWhc"蔦Vh|"膦^_WhN"jfWVt$ |$7_WVUSWV $$l$WVSU$ $ hU3WhX"/uWVh4"jGD$@tF$j$h&hV}2V$$$h="jUSWV$$$$D$1 h)"SU" $D$D$1G$D$ȃ 1$`&N|w5t=Ft|$`N|Z5t=Fx|$Cj$h&5t=HP5t=UFp<$h)"SU! Vԏ3H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hn"jpWhT$jGc~Pha"h3莛 j@WVPt$jWV" 9u9t x^_Vt$h"jVt$VWt@^h%#V^Vt$VS"t@^h8%V|^WVPt$jWV 9t9u x^_Vh"jTWVt$|$ VWstt$?/tWhc"輢Vh|"订^_WhN"j;fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds h",1VWt$ t$MPX:1@PPVVu4u0uNË\h4h&PKQ }D@u hh& hh&S&Q }D@\E,CEh%Vro\$th%Vh", u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$x~D$x|$D$xt5Ph"X+%t9\$t h."?+\$xD$x\$D$D$ 9\$~\$~tSha"+\$9|1} t h"*hW53h"誟}4xME0;E4ru0h"*},u,D$D E4t h "\D$T 1u D$D5 t$ D$$$$L$$$E@$D$,D$(A$AD$|AD$0A $CD$4D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$">(D$ D$L$41۾ËT$||$|tL3L$4 3tD D$ W'\$tt$1F9tWh^"'D$ 1tt$ tЉ|$TB7D7R0'tt htD$pt\$1t$T$2:|$D$xtIt$)Wh"3Pr |$)Wh"3PS D$ $L$t$}D@tCWH&1@9tWh}"E&L$G$D$$|$tD$|D$P$\$hT$,T$ T$$$D$tD$|0Wh]" $tt$SWh"h3讌uDt$ vh" ~$r-D$ t$$$0h"轉j ӈ}D@uh"h"D$ttt$$DŽ$߬$$ڌ$ &|$D$ \$$:"*F T$tT$ uD$,D$tD$(D$LD$tD$Ht$t$t t$p$1‹6t$ uЋL$+D$ut$FF$T$lt$FVF8VPh%`t$$t },u$t$ t$tL$ltt$pL$`&T$$wD$$ 1H1 u#D$T#T$D t h\"D$TL$D 1Ҿ?9|-T$D T$Tt# tj jt$\t$Ph"D$ (t$duD$ },u+=D$ },u8GD$lT$DD$T uЉ\WD$ )4D$`D$DT$T t1҉WD$ )wT$4WD$ )D$Dt$TGD$\$$T$D$<tD$0|$uD$,tD$(D$LtD$H1 u\$u1\$|$vkD$\D$ 6l$L$|$r:D$D$ l$9t$dt$T|$D|11D$l$D$t$ltt$`} t1|$9spt$ uT$D$DLL$T$ ׉D\$.uD$4+D$ D$4GW+T$ D$dGT$4WT$B\$$&nt$ uuh" GD$.D$<tD$0|$uD$,tD$(D$LtD$Ht$ttt$p1 uЋ6Vu\GWFD$(+D$L$,L$ ʃ{1QPWVgth:"jP1F\$D1VPSh@"_D$XWVPS5%|$$u1Ʌ|$t1ɉAw1@|$Phn"}_D$tt$535x35t3t$\t$dt$<535|3Q5l35p352PWt$L@ƃ|$4tVAVUSWVӉ $@F|$j W\$ Se Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ cE8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h!" t$t$h"jUSWV31F/WVUhm"WVjh"WVj!h"WVjh" WVSh"WVj+h"WVj;h)"WVj$he"WVUh"WVjh"xWVjh"gh"WY_WVj h"HWVSh'"8VSfD$t1B9| 2I 213Iu顴2PE3 2~ t1@3@9uUSWVD$921A9|G2SƉ<$~ SjV>? 2D$~Q1ɡ3t<2*tBEB(B$B4!؉B8<:tWBuA;L$u5353$2^_[]V$3 3D$D$ &T$ t$ 253t$T$L$D$\$ $_"Z$^Vt$FtN H N tNHNfr v *V! 3^VD$`sH) 33 3HtP4BPQ@@1ҋ3v9t33rh"j[tp4F@3^USWVD$T$#253tC=311-39| n-39t%9P4uH$3L$X(3\$ t Fu1^_[]h"h"hh"O:USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv F V>3 3 29|[53tFNu 353t5FNHNFy F4VPV3@31@j@PU1@PF ~4D$F(^$F0^,n#2^83 3t q43^G FtH 7~ F^_[]É 3=h "h"hh#"h"hh"8Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP 3H3N^,H 333H@3P 3 3H3H4I3H89t;tprp3403t4F 3H^hD"h="h4h"7USWV}]uuu W@t 31@31HCSuu WW KN0F,xNF4VPe^_[]vjv L9 fUSWVP|$g&s&G4$O,52w0VPww D$0^_[]USWVPt$ff&s&F4$N,=2~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j8p 3HtƒQ 3@ 3^_WVt$ 3F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpdFhjv|7 vr^_hUSWVPT$|$:%43\$ 3$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^431ہ=3| t Pt331t 98t@^_[]Ã^_[]`V15353hVh3]6 53^ft$ t$ jISWVt$frLN4F,=2~0WPvv 1&t\fv4V1AN4F,=2~0WPvv 1&1;NuN^_[hr"1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h"h"h h"y/USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$F|F|F M}F F$9D$4toh4jlj\L$0D$,$Lt/\Xt/uB\Il$(\$$ |$8$hݨ"u$1۽Pt/`t\//tt ʊt uG4:u/G4+GHOL#$ 1=2É>GHOLQP6jjWpthŐW1$2L$1 QWPUSVh4jyÍD$(Pu S \ EWU=a=t ==bt =b¹tTt 2݀<$u1 \$t1 L$QUSRPVh4jËl$hu P $\ E1PU\$tE|$8t h"fs,$SktUW ^_[]Éu C4CHKL1},$Bt؉Ń|$8ths"rt$8VUS9p݉eV΋=a=tK=u W=bt@=bu @hhhbhbPh"CB$  $ V19tQRh"C 1@^USWV |$,\$$t$ tCPPt Ttt4RQhY"N1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$Åthj"Bh(3D$(u KHKpStURQPt$DljT$t h"pu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh" 3VRhХ" T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPh\"D$L$9tQP$$ht"t$Ht$L$tI9ȋt$ tPQ$$h"^1t$\^_[]h"h"h)h'"h"h"h"PD$L$ $QPj2 XUSWV,t$@~HILT$T$1҉T$L$ T$T$$tD$$"D$H uIN QIN,V($D$u N D$ N(F,D$D$(@H1ҸhtT$ T$T$L$$ $D$|tt|$@7/1Lt$ t$l$L$ T$D$D$($ l$$tD$l$$ "pu0|$ r]@hD$D$D$,$D$ _,[D$ p D$D$D$,$D$ 1,LD4@hD$D$D$,$D$ ,@o M|$@ t"D$D$D$$D$$:"uEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$".D$H uUQ UuqQu}uAU Uu1҉Q$Q ` rFH4$QD$ $D$.uO 1O(W, u<$ST$HL$D3uG(G0W4\1t$t$D$ T$L$<$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UWƋD$0T$UWƋD$0 u$$$UWljՋT$ÍL$QL$4tUWR D$uGW uE-GWu-E?RPSERPC$GW #RP.ERP$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$ 1RStSSPtPh"'D$ H uIM QIM,U($jPluE D$D$u E(D$E,D$u(},}HIT$ 1RStSSPtPh"vD$ H uqqy uu A1҉Q$Q ` rFH4PQhtLt$1L$͈T$ҋTË $D$0 1 uЀ|$uEL$0)A$yD$r~H |$t!Aq9|ߋD$A|L$0)A8Y<D$H |$t$1AAljqy 9|ދD$AD$/H |$t!Aq 9|ߋD$A|$0HIT$ 1RVtVVPMtPh"D$ H T$0uii Y$ ݋t$0uu A1҉QQ` rFH4PQD$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ |$L$# L$ET$t 4$񋿌T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW芝Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP̛|$FV D$t RP诛|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP7 t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$WƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP蚙|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QP袘L$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$Wu|D$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQ.ƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVD$Ӎ|$h $twwuƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv m t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\ut4Lp0hf"$ D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃h"hU"h h"h"h h"hd"h"h"USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0coL$(|$u)n$ )n8F<4$NdiA N1t-t$p A L$H SjQ ^_[]fD$@(Vt$ V(1y<1I+F$ыT$ptj42QP1 ^Vt$ V(1y?1I+F$ыT$ptj42QPQ1 ^Vt$ V(1y?1I+F$ыT$ptj42QP1 ^SWV|$D$PWjSWK jSW? C fdFFpx$t PSW $u O4OHWLٹ}VSW3 SW FʃuW1^_[USWV\$|$ t@ f X8ZLJ jLCƉ t,UFtf^81FFH1|$<΋t$  3uN $3NVfF fFLtt\$XtD$ 7Dt1oL$DpTt΋D$HT$LуL$ L$u\|$h|$l){uD$tt$ L$4D$tL$@ 1 uWVRPzƸ L$9|$0rD$ @dT$D$T$R1RtRPt$諒tPQVhz"}L$ultDH!!lt1t=RA X jQ/t9Ftt1t ;T$h"h"jh@U tDutLtT$T$ T$ 1 ulju \E@E`Ud^_[]USWV|$ $3 3uPt7 \$t$`tL//W }1}ott\  t1h SVP臍ƻSWp 袡 ^ hjSo V^_[]h"h"hh4"USWV l$4E}0I\$8u tȉFSt T$$]F V$Ku tɉH tɉHDu JD$@HE(M,1ۺht\$ L$$T$|tt1i/ڋLt$t$\$L$ T$D$D$$@L$4tI(D$L$$ "袵\$8u;l$L$4A(I,WhT$L$$D$ 臩 l$u L$4A(I,T$L$$D$ P \$8[\ \$8TUEuE0D0EE_A(I,WhT$L$$D$  @M A CtE4,$PFl$4E 3 tr\$<u tȉFSt T$$[F(V,Ku tɉH tɉH@E@UDE tg\$@u tȉF St T$$[F0V4Ku tɉH$ tɉHHEt!uE0D0EE suE0D0E%E ^_[]USWV$8tWcƅuWhu"jc$$<$4D$Phd@U} tj1OLVhedAU) F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(hLL%t$1 Sh"U- CPh8"U˃ C Ph"U蹃 CPh"U觃 CPh"U蕃 CK,C,Qh/"U} C0PhD"Uk $@D$t P1-Uhzd@$<W t1 VhedAW hjU D$ P$4{CD$, 9L$L$9u0$S11:8tx$0h"0]b$11҉ $ƅ*ŰPhjj PUn ^_[]$0h"j`USWV81ۍD$4ShPSuw1NtAljSPSWuWn/uMU D$t$$$Q1e^_[]fUSWV $( $$ hojS h3B#Ut.P:|$"V(t!Uhm"JUhS" 1OUh"l$D$QUPh3%W赞tPUh6%W螞iD$$Ca2=ouV\$u&V{Vh$( ]hh0"Wl ƃaT$,"V1u\$ىjW$( h5" VT$"V$$ h"V 4 ^_[]1ىj=ߊ< t< uGjh#W k2$( aj2WPk EKu$( 8~y$( 1\$ىj(Sh$P-] u$PUh" "j2PWRk E2$( ;(|V\$8"V$( @VwT$"Vg$$ hc"h"?uD$ $PUhw"SuU豳<Shh" $( aPWh"Uh>"$( x?$( Z1ىjPySh$P[ uSUh"q j2PWi E2$( ;h||$jt\h"@PUW $( ƁaD$ a9QPUh"$( ƀa$( ]UD$PD$ PD$Ph"W葚L$\\L$\\ $\]u^E &Yt8u1҄tʋ$( t?r QVR V腱q8uUh"Ih"Ph"4USWVՉt$hR 1I t uFjh#V[ u<^Ft t u^F t tW*PWV tt$hU  u1I1ɉ^_[]WV׉RhQ t6< ~< t<#t< t >t< u6AWhV űD$ 1GtPh$^_V1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh/"+C< t< t< uh3B#SƍD$$VhP L$T$\$PQRSD$0PD$Ph"D$@Pٗ t$$$ىh"rC< t< t< uS?=$<rLjShD"Sh`"&TSh"ch"Qt$<L$D$D$L$ oP\ctXljo 1tX L@uH~vCtTjhhn" V"$^_[]V  )UjS] D$ D$ CD$CD$C D$C$Cl$Uh #Vj u D$CV薭)1$<;obD$D$PSh" =USWV$0xjWkƅ~F$0h$1jUk~4$hPa C9uЋ$4h3B#SǍ$ىhR"$0St| uƄ$ $0ph"QUD$$0qh"QPىD$PUyPUSn u׋$0EED$1ɍ$D$ $PhS/ D$PD$PD$PD$Ph/%SCD$L$ T$ ыD$E L$ T$ D $A9L$D$uPhh"h"P}Sh"h" Sh"h2"P $02t$t$h"$@t$Ph" |$W}~14RpG;}|VCp1^_[]USWVD$(}~;$ ~VE pSa $PjVWjSkD$11D$D$D$D$$D$ D$h<"u Vu+[ H5$&D$>j 5t=P3a Cr,3밋t=$PCrj h#V(] ىVvSB1PuE$ ~S4V\ $Ph jSPt$VguVht" ,Wh)"jNÍD$LPSu $PP@ D$T%=`ދ\$l % rr<r<Nr<orrV1$PT$ QAA AAAAA h"Qhr$PPrr @r ,r .%r0B$PPh%r0BV躖 Y8YSh"A*r'r)rzD$(h"Ph)r])r9r rBD$>PF,r<r<|$$$PWS?$XAQj2$TPQk $Phn"Phr<rr h"jhr +rryt$$$PVWU>ލ$P|$xh4"PhrS!*r{ r 1B$T$$PىPVFލ$Xj2WPX~ $Ph"Phr"tM"PSh" .1$P;$h"Shrt$VW"9;$PVh"L|$$Vh"3h"jhr t$j! =,3:$h"Whrt$ "?c.\$jh"WhrS$d|1$XAA$Pj2PQ{ $PhV"Phr"1~~;$1Fȋn&w &QPhX" G`;$X|΋$\>9rh"$`>ߋN8n&w&PVhX"* `Ouet$$P\$ ZSh"h"$P\$;$PPhU" VhE"Sh*rt$  09rh"h"$\>$Th{%\ Vsh "$X~:$\1j hV$V胞 "tQC`;$X|j ~-h2"W$`>VG`Ouj $X1~$1:t @`9u9u$\Phs"1@\D$,\$H|$PS$hjVɨ L$,9F Vh"VhrW h"F0Ph"F0Pv,v(v$h"j h&"C$Th"Ph"h"Fh6%VxD$0L$4$PND$8FhQ"Vh(r WO  FtsShp"Q$PtPh2%8h"+$Tt*Mbi)QRh" j $XqPSh" ]hJ"*$X~n$1Wȃw,\"$&L$7"!""n& 8""PRhb"O F`;$X|ۋt$~G$`>G8tu #Pn&w 4&QWhb" `Kut$h"VhrP>U"tj"P1t$1 E$`$d $jj hq$QPjVmyjh4r$VP V$`t$Vh"O$XMbi)QR$\VhD"$|$|$|$|$|$|Vh" $\uM.#1wh"-L$!r "$PPVt$h"!11҉4hӀB9u#t.#QPt$h"@=,3~S$h1h )#!1PQh" C uߍ_ j  rt$h"Vh&r@t$SN#;$PtF""tM"RPt$h"t$ USWV`p׉͋$tph"S腙,$tSÃr t1C1|L$PVQz Ou vu hu Z$1hoVW] owt1$0 j2t W N F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0Ghh0"W@M Ƈ$L$h1"Qh+rU9uh"jhr U`p^_[]WV1VFF FFFFF h"VhrQFĘ^SWV։ϋ\$1D$$jh%SO tVjh"SN tBjhNb#SN t.jh"SN jh#SN u$D$D$h"PhrWh"PhrW=,3t?|$"t"PVh)"q |$u$4 &VhD"R ^_[$oWVƿ3Ph"W¿ Vh"W賿 VhW"W褿 Vhx"W蕿 Vh"W膿 Vh"Ww Vh"Wh Vh"WY Vh"WJ Vh."W; VhO"W, Vht"W Vh"W Vh"W Vh"W Vh"W Vh"WҾ Vh "Wþ VhA"W贾 VhX"W襾 Vho"W薾 Vh"W臾 Vh"Wx jVRhQ; t^Vh$j;WVPΉ1WPhPPj PQ~$ u^_Vh"Qjq;USWV։ωl$PU\$hjSž E9C Sh"ShrW VhH"ssss ha"ss3h"{""t"t$(Ph"轺 t$4t$4t$4h"褺$t$Ht$Ht$Hh"脺D$8PhN"q$t"Vha"T$4 &ht"6$h""Ę^_[]t$ t$ t$ 薃 tt$h"jM:USWVӉύD$(jP.L1t$`FFF FFD$h#V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP<D$HD$PD$P &5&|$D$ fD$ l$ \$Tl$+D$Ty1&Ph$j($PrT$D$ +T$(+D$0хyL$XD$\D$\5&D$XuT$hL$l+D$$D$ $߬$&ݜ$ܼ$D$pt$t$$߬$&ݜ$݄$T$xL$|l$x&ݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh"j$P DŽ$ <\$D9r<"ShrQ3h["ֵh"UhrVuh}"貵t5|$d} r"<$c!r"P^_[]USWV$`T$$<`$8`t$D$0hE"Ph*rQ 0͉L$9r\$~HT$ |$ $1hWt$ H u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$  u$8`D$1@$C`Mu΃<$t $`^_[]t$h"j4USWV$,h@"kLE"tŋ$0h #LL."t \3~?-|$h"VS; M~%Hwv$L& L3L3ǃDt*Mh%5t=衶X3u5t=M+4D3nNRt 03j W5t={0 `3L$9&-t=2<343832j W5t=/ 2L$9]`d3@3}H3nPG>tW蚉P,>ujj~2QPh7"j@2D$كL$l$ umt$jNl$ 1  ut$)KL3h"5t=h`"p5t=h"` $L$L$GȍQw[sV?P貈PD=-G A6PGu$t L$-AGL$AL$$j=H3u#hh#h#h#h#h#h#h#h3JP$W}Ph&W~ bU*yŃ=83u#3MIрK=<3u }8$V+ƹV])uV+W1$VVY+DžD$u h%#Xul$VhЪ#h3> Vh͌%h$ P#W(yl$`t$Xt$T1ҋ\$މT$̓=83u3MIрs6=<3uA}t']hG%S,~thR#S~uWH(Ņu{D$TƄ ML$XE|&hP$ Ph>#h3CD$+hP$ S3 ىV1 D$@W'$W{Ph$W| $'h3jjh#W$WT{Ph#WE| j)$W{Ph#W| =<3tVh3jjh#(W<3$WzPh#W{ 6WKTh3jjh#V<33h3jjh$#V83ꍬ$U$PBzGV6z)1;$v7$5<P{3$Py$$1Ehh3jjh# Vl$WK(_D$h 9jUPLL$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=<3 ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$hG%Sut jhb#St t ;/u f. Gf./WsSs9SWt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PSptH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 52 3H $s-t$$tHfHxt P2)1^USWV=<3th(3jjh#Jjj9#tvƃ=<3th(3jjh#dJ31GNIIˋ^s 3 tVfV(3ޅu3=31WS"ơ3Krk=83tV$Ph#h(3螘 ~uV7dV'%V`v v"@4F$5@4vu;33K^_[]USWVPl$3M1t$"Džt.w w!ƅu h#d9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=83tW"Ph#h(3[ W_1l$$ttF9u t G9t$H&Qt$hE4h#h3<$WbWE&F~X|$<th#V_VCbV&vfFt$ t$ t$ h#h3dEuFufFFV!|$WP`WV&N=831ۈH4D4|NILD4hD4jL4ǀD4|NAMǀH4EFNDt$hE4h#h(3谕1N1@=831ۈH4D4|NILD4D4W-jǀH4FNDǀD4|INOWjL4ǀD4|NAMǀH4EFNDVdPt$hE4h"#h(3C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=83#~VPt$h/#h3~1t$hE4h#]a >W\Ut$$t$$|$$WX ƃ*Vhg#V%]1@KGufGfG1@=83$ WbPt$hE4h"#h(3躓Ut$$t$$|$$WƀH1@=83ىV_bPWhE4hU# |$u V[v vY@4F$5@4Ut$$t$$WDUt$$t$$W.PZN1@=83t-ى,VaPWhE4h"#h(3ɒ؃^_[]S1H4D4|NILD4t!hD4TgǀH4APEǀD4|ONTt!hD4.gǀH4FNDǀD4|INOt(hD4gǀD4|NAMǀH4EFNDƀL4t(hD4fǀD4|MODǀH4ECHGƀL4[SWV=<3th(3jjh#B3=31VWftmxtg 3W sJX tCf{u7=83tSPh5#h(3\ S\S [빃;=33k5@4tc~ tWuLfthS#W Z=83tWRPh5#h(3ڐ Wy\W9 륋v$^_[SWV=<3th(3jj hk#A@4tS@41{ t$C$Su[SFuՅu5@4th#VKYv$^_[USWV=L3R<3utDh(3jj"h# A,th(3jjh#@5P3t$G!jj#^ơ3;333,׋-P3WV]Ɖ׋ 339sAWV2ÅuWVh#p\ SPh#h3Q c렉1‰1 u`WVÅu h%#%\Cuh;#SXCt SZcSSPCcQPWVh#h3Ɏ:KP39tPt$ ZU-P33;333^_[]USWV=<3th(3jjhS#\?fx3jY9T jj\ʼnT$3 3PQ\D$5353J\Ɖt$U9\ʼn$St$p\Él$9$\$3 39ˉs6fx3j8DTk D$;33rM\$ -P39sI3953s9-P3tS P3E9u3 39\$ 3 39ΉsZWVÅu h#YSCPh#h3ˌ cWV[Ɖס3 3911 uU9t$D$ rIWV<Åu h#|YSPKAc9-P3u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5353fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=<3th(3jjhl#<FtVPXfvu݃=<3th(3jj h{#m<3=31ҹ$RL$QtMƋhtDEt9VP|$ Wf1ۀ~UiCSPW+W em븋L$$; 33r^_[]SWV=<3th(3jjh#;3=3rc11CWS5t:FfN~u %fFfth#VYSvuȃ;33r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWh#V ~u,|$ t%h#VRWh#h3謉 1^_[]fUSWV`=<3th(3jjh #q:53535\3h. #hh2HL3 t=+4uFFF%)Fu9rV9=<3tJh(3jjh #5F <3t(t$h(3jjh #4F <31V9vtRPh #h(3跃 <3th(3j N$ 9̓>t9߁^_[]áh4tPjt$t$T4uù2WVIAfF=t4|Cx4)f45d4jQh|43u5t4F1|4PVQh  =x4Ft4^_ù2Qh/ #l4g8u"h #hr #5\3hS #h3pjvWVjh2X1t)h  t 8@ W^_V3 3t7#|3=@u%o>3 3t|3!=@t^USWV$$$ $jhWVXC,| 4tE1M1 tmjWVS$8jWVS$8t$Sh͌%hVH}VU$ p4U Rh5p4DžtGhG%PWtSh #h3 5p4DžtGhR#PGWtSh) #h3谀 5p4[Nj5p41jPP6G+^^$DOGrhPD$PhR #h3B:hPt$V  $(j7V@ p4u D5p4Nj5p4j1PP6F+^^X^_[]SWV׉1jPP1F+FF9tX\$)yWh #h3 %؉jQP6}F~tF hP6 F^_[USWV|$_ OtGhS7 GO9}vDty)9|n4 ȉG.uFhC%PYU;-33rv=83tUh #h3~ \GP1=83t:Ph #h3o~ %1=83th3jjho #L/1^_[]USWVD$$PsD$x/@thC%QD1ƀ81Mbi)| 4H1ًP1 t p4P RVVR5p4At\G9uGSVP*S t5p4Džu*hC%D$P|~tƀ8MbE^_[]USWVt$!M1 tFjhRW>,| 4t(E1M1 tm`ƋU R^_[]ËD$0}USWVX=<3th(3jj&h #t-L3 ߉^_[]USWV|$u h#>WmF(4u`Ɖˋ-h3UDžuh#z>-h3)ً(49w؉9vlj<(4|$(4WSzy^_[]USWV։ϋ\$ t;=33rVWh#= -4 4QPVW2{s LK$\=83t%[$tC1K 1 uh#S9^_[]SWVt$f~thy#V9~u(~th#Vg9~ th#VS9FN tkQPDžuh#V)99tt79uNH4~^ SW FtPh#V8.>WD(4(4$4F$5$4^_[ËAP 9ttЋR9uIHËIH h#Qt8Vt$VD(4(4^SWV|$t$Åuh#V,8;^ty^C Fs j/W1GSC(4 (4W WCFV86P4E1ɅF fN^_[USWVd=<3th(3jjh#s=H3td|$xhQ$Wnƅu0R0"Ph5 #h3(n Wh6#;t$ f 331؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6vuݡ3$3؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(W[u3$53L$T$9΋$D 1$T$| 4~L1\$4 tAD$t$ jjSeG 49|͋ 3 $53T$|L$<q$Q Aip3t3QA 33QA`3A$t$ Vjj(QF @t3P0Phc#h3k t$xho#8V%@h^_[]USWV$=<3th(3jjh#e1PPUk Džy0O0Ph6 #h3Ck Uh#88D$,PW',y0O0Ph#h3k Uh#7$jSƅu h #7SVW耶 xD$j(PWl y0@O0aPh #h3j UhH#{7WOL3RrD$l$t3=p3,$1Չ1 9$h3jjhj#jj5353 4jP4u h#6PjPhG%HĨ^_[]fx3D$L$ t3p3D$L$ 33=03u t$(6t$pPh#S6D$ L$$ 33L$T$  4<)4؅~ڋuch3B#h%#9h3uBXL0yPh%#h.#h3gh3B#h_v%g3t04Wh44o^_K0 Ph_v%h.#h3@gj[Vt$5`3952}/4#4t P Pd4#4t52^1Fh3Vj&hB#Vd[V|=<3th(3jj hi#=,4tF1PPh44z; 2yC)K0JPh44h&h3jf=04n2P3 `3A(404 034#4~P1F `39|(4=,4t QPx; QP52膱 *H `3+4=<3tPh\#h(3e 3u@ (4 8#4 <#4433h3jj&h#<=04tD=43TtkX#4@#4@'4uI) \#4=<3u =L3tuB T3 X3 t3p3L3 P3 33PhG%LD$hs22H=33u.=83t58#4h#h(3/d h3#%19 =3un3i 3_ =@'4u3|^1PPh44ٯ:oH0Ph#APh#91Fh3Vj!h#j1Fh3VjhQ#X,H0MPh#h3rc jWhh7#Ph#h3Nc1Fh3Vjh#4VWV2to=P3uf=04ubf$HD$=,4t PjE:?Phm52) y"kG0Ph#h3b ^1Fh3Vj)h#VWUSWV(΃=43|$()1\$@kD$(D$$D$,D$ D$0D$D$4D$D$8D$D$ D$$L$ L$D$F L$D$FD$FD$fF D$$F,^(D$ FHF\nXFd~`D$$hQPH FTHw)$&F F(F,11kPh#*xu @'4FFT @'4tF$F&1G=83 ub%tē%Ph#h3\  tQPh#h3a\h3j g12 2ˁ +,4$&RQh=#~lF|FNF0FXF\F8F`Fd1FTFPFLF Ph#VS U=83t58#4h#h(3S h3jjh!#8#4D$QPh8#h3xSP3=043$L3 1A $t=<3tPWh=#h(3K =+4 4#4(4hQV8 8#4<#4^_[]t`3 PUh=#k s-4#4hh@#4U /0Ph#h3&K j?USWVE3fx33 3D$Qte^_[]áH'4fD$ +4L$ +4}Ph'4讘QPh'453h#h3>j3SWV|$t$+48;+4vhK#b +48+4WVP +4^_[53h#h3$> j2USWV$$=<3t$h#h(3= Z$ $(މ4$9{CKQPh"hl$U9=<3t CU342h#h(3h=tUCKQB+{))σ#WRL$ QP$(CKQB3{))σ4$#WRL$ QP$,kBCKQB;k))΃#Vt$RL$ QP$,t%=83$(tqUh!#h(3_< \{$(u0jh1#D$ P輜 tFjhl#D$ P褜 tk=<3th(3jjh#9(jtzwC@D#P$Z6C@D#P$C@_#Pj$$!C@O#Pj$$M u_{C@_#Pj$$!C@O#Pj$$ =83J=83t&#;$ t#Ph#h(3: =<3th(3j E^_[]SWV|$t$=D3t+4WVh+4P =H3uWV5+4蠄 t^_[Ë53=330PSWVhe#h39jf.SWVt$=D3t+4Vt$h+4P =H3ujjV5+4!ƒt^_[Ë53=3304PSWVh#h3V9j-V3tufx3VVVC ^PD$L$ $QPh3= XS8T+9,2:3.V=+4t114Bu11Bu=Iu1@'535353Ph#h3w81^SWV\$j/SatMƊ?SDžu#Sjj0SDPO/F^_[WV|$ th#WWNƃ=H3uhVx=<3t.u Ft# 8 44jhh(44jP|(84u 5 44 44(44h,84hQ@P: <&$xl&&x##5$44 PVt(E u!#<$x"VPh!#j{ SWUjfPh$j艤V 3Ph(#V& Vjj(h4(#`&\&hR#h3}& uh3jj'h](#bd&`&hR#h3?& u1Fh3Vj0h(#"V|$ujhU 5(84 u*h!#j解SWV |$t$ >h#WEt9hq%W3t'\$j SWO $ 9uy6h!#U$~h#Wt@hq%Wt.\$j SW D$ 9uyvh"#j蹢D$PhU5(84 u ^_[2h""#j询SWV |$t$ >h#WMt9hq%W;t'\$j SWW $ 9uy6h!#U$~h#Wt@hq%Wt.\$j SW D$ 9uyvh"#jD$PhU5(84 u ^_[:h."#j跡USWVhA$(1hWD$ P |$ |$ D$~P1ۈD$$,,jUh"L tjUh7##8 tG99ufD$u\$ tR$,4jVhǻ% EjVh=## 4jVhB## 5\$ D$7f@jh0uht$Vj P5(84D$^ރ9tD$j@hK##P ߉tD$P=DaryDpriml$t?tD$PD andfD D$PDgrowfDnt$VD defDectsDuVjh##P V5884548450845 44h##Et2tR}jh##V IH}j1h3$#V[ #}jIh##V6 `t6Wh"Sh$qUփOut$׺ h(#L^_[]1h##jLUSWV}\$j S5(84O D$t"NuD$Hj@PjSPhy$#j$j$Vjj5(84rF=tPh$#D$D$ D$$fD$t$j VE 0! 9 1L$81qAQQ a A j QV5(84-D$t$ *jh$#E p>  D$ @L$jhtjPjQ5(84h$#h(3D$t$H1D$`D$L'Ƅ$0VhQ`5(84 $j D$tPS |$'y9D$(ȋL$;h&|"@D$Ph=%#h(3j [D$$<JD$ D$ L$jhtjPjQ5(84~e^_[]ÄtH<t<u'5 44h$# 5 44h %#h3  P5 44h%#h3hE%#Eh$#j菛E 0h$#`USWV $ ~($ 1j4hT%#S ?C9u1CCJt$LUPVG CJjh'UVjS5(84~D$TL$jPj!QDD$\$jPjAV+D$ll$;jPjUUVD$"P5884548450845 44hX%#5 vL$D$$jh'hVjS5(84Ffȁw$VhU VhU ƅtL$D$jh'h$PjS5(84]$f1Ɂw$PUhWh(#GWh$5vL$D$jh'h$PjS5(84$f1Ɂwh(#CGt$ t$ 1؃;D$ D$4ƜF>|$Ń &hXl&h%k ~y)L$h'#D$Phd$#VD$P H PpRQhj$# tVhs$#^h(#=^VD$P H PpRQhj$#k tVhs$#X^h(#<^USWV$Gh4 &Vh Vh(#  r[h)# O yj h)# O,@tPh')# O, tPh7)# GȅtPhY)# GȅtPPhl)#p  O W hVbVh)#L GtPh)#6 $hVjWƅtVh)# j t)$1@9}$݀M jhH%V.M m84W`PWVM VlO^_SWV։ϡ<4H <4uhh<4=4hB#hB#hS7hQ$S +tZÉ B#t#h<45<4PhB#SY|@h<4? PhC#S yhB#PhB#j蹵<|.i< #t.#QPhC#Ss t Sjj!hAC# SjjhcC#Rp<4tSPjhm848h=4{u;hdVjS/1WWV^_[WVPC#=`84u%T84<uC#P84uC#u"hm845<4WhC#j藴j=hD#H,=X84uhD#2,=L84u6hhhC#=L xjhC#PJ VL=4WhD#jQV>4hD#+jJV]jG=h E#+ `84uT84ujjKC#uC#C#uC#$=d84u D$@C#D$=h84u C#=l84u C#=D84u "=\84u -$=P84u g-$o$ @84uH18hlB#WPVK w8VhC#jв `8VhC#xj=X84u hlB#Vjjh=4h=D#fUSWV4>4jUIƁ l$]1EE EfE 52UUUjV xqjhyt V/ y 8uh52hCt V  xBt1PP虉u51F FFVG)Uh$hD&h4уAtVMu\P>4D>4@>4p2[l#X>4T>4듡t=H>4L>4`>4v<>4k}ԏ3=`>4t =\>4a-@>4<>4 t =X>4C)׋ P>4 5H>4 D>4tuu @>41Et$T$t h2(31d>4h>4h襄ƅt 1GL$ 11PVWWj!D$tvh3B#Ps1-l>4UUhl>4UPP?t6À;tىPMS螔UUhl>4UW?ÅuW &t7~ D$G UO=p>4Ã<^_[]hE# 5H>4h$jwjhS#PhR#PhR#PhR#PhR#PhR#PhtR#h38jUSWVpT$ L$$$t>4ƍt>4D$\D$`$A4~A4L$XL$H)L$L)L$dtMuI|$ tB1\$L|$H#tG%L$$ L$D$ \$<$D$%D!F9t$ uȋu] }trOl2|$ w#L$L$dL$L$` $D$ D$%G%w# GD$t$ D$LD$D$H$D$% ދ] =P>4 2=T>4tD$A4$#!2nD$A4D$t>4$E#KwDŨ%$D&D$%$$F#GG0O4D$L$$F#4r$F#F# F#F#D$$F#LD$,G@D$$-F#1%B4#D$0pu?t$B4<$D$#t$<$D$F#J%ىШpu:|$t$B44$较|$4$D$F#誃كှJ%] yBD$t$B44$}D$4$D$F#dJ%sBD$t$B44$5D$4$D$F#J% sBD$t$B44$D$4$D$F#ԂJ% sBD$t$B44$襂D$4$D$F#茂J% sBD$t$B44$]D$4$D$G#DJ% sBD$t$B44$D$4$D$ G#J% sBD$t$B44$́D$4$D$#贁J%sBD$t$B44$腁D$4$D$G#lJ%fyBD$t$B44$>D$4$D$G#%J%sBD$t$B44$D$4$D$(%݀J%}tQL$ D$h$D$+#D$ 9|$t$B44$菀|$D$hD$}4$xD$0D$D$B4$8F#LGHtD$$IF#5G(D$$SF#"$ 6|$,u=D>42t|<>4uteXu<$L$$T$ <>4u t GX@r9=T>4uD$t>4$#GXHw $S#$.Gt u UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$A4$t>4ƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$舣D$(u;<>4 d>4Y=P>4LD$t>4$sF#3D$(M I"$\&|$D$ D$D$$$ z_8D>4ZG4D$hL$$T$ JL$0$ {LưD$81D$D$D$hD$ t$D$0D$D$$$薢"4$BD$88 D$h$z1uG0D$$F#|D$,-1D$D$D$(D$ t$ht$D$ D$D$$$14$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$財D$(D$4$D$t>4D$(1ɉL$L$D$ t$ht$D$ D$D$$$Q{4$D$D$$by`1D$D$D$(D$ t$D$ D$D$$$D$($D$t>4S1D$D$D$(D$ t$ht$D$ D$D$$$蝠4$D$D$t>4c[iF D$|$D$ D$D$$D$ D$D$D$A4$t>4V8 D$($>xt31D$D$\$ t$D$ D$D$$$؟&A1Ah2$D$t>4D$F#D$ @D$0t$h1AtD$h9k4$-^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$ wT$<1Ht |$t$ $若T$44t_1CL$$T$ fy=<>4u =d>4t-ML$ML$ D$$D$L$$T$0F`;w4r1L$XL$\e^_[]á<>4 d>4t݃=P>4uD$t>4$F#$-eD$D$t>4$\F#2$ USWV׉d>4j=QTt&9vx?u @L$D$F 1D$hb#S҂t.l2m288CtF=sjhbc$V uC<=:l2jhTY&Ve uC <=M:l2AjhMN#V: uC <=%:l2ShVN#$t$މ|$=h>4t2=/h>4D$(2L$, T$l$hPRht>4QWVEuMD$(t$=H>4|$t'3@DJ@ut1ɊTAu=L>4umT$,$uWjSt$8^|$=X>4p>4`΀<$|$tZT$,$VWjSPiUtgHp St$0t$8$PVhA4ht>4у *D>4T$,$VW1VSP5D>4t>4C$t&D$,$D$(D$=H>4t +1ۉ\$0\$&\$'D$4SPVI ljӉT$tD$p!Ѓ8"0МPVh&1<==L>41$1Ct$|$81 t$4t$0D$(t$tt$pj,T$R葘[A1OD$D$1D$ D$j=QUD$ tOAL$ \$ h%#V豾t=j,SAL$D$"h%#Vp21۰D$t$h%VNhN#V8Nhkl&V"gh?$V h^&V.h^$Vc |$$i \$ Ct$ɍQw1$&>a΀-% plj\$ Cut$BT$ҋ $)|$4C1ɉQD$PSs D$ D$ 938*8\$ L$ D$D$W|$h#S蚼Dh<&S脼;h|u&Sn7hA#SX3h#O#SB'h(O#S,D$t$ |$@ 1ɉQD$PSP D$D$ 9؋t$88|$1ɉQD$PS] L$ 99։D$L$8{jb$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sht>44t2h&R#v 1<==L>4 ڍt$81 D$ \$phjSht>4PVT$ROn$1BD$L4JD4`L$p$QRSRPVX>4 T>4u1$P4r$w &Qht>4hQ# h>41<=4 j=V.9=L>4 j=VT$81 D$ t$ hjVht>4PRW,m\CD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LP蔓$ht>4h R#D$49t 8VhMR#S1JD$ $$QhP#,=X>4D$t$=D>4$D$D$,D$\$(V耶GC@D$p9Vh_R#30TPt$hQ#|$oQhQ#=X>4D$WSt$hO#VD$ 81ҸD$ |$\$ Cj"$PGjÍD$pWVPSt$ $P\$ E $t>4jt$tS7 $t>4jWV# -0?Pht>4hQ# BX>4 T>4$Pht>4h&D$ $u1@t$2|$ QhO#(11G|$1\$ tpupthb#QvD$ t$D$t1@L$ ɉ%tN#PQ^Q|$t 8t1j t$ .y4$`St$hMO#FQt$hO#7.l2m2L$ L$ ف$K{8P|$W膡D$ t@j QS}j D$ ;$|$8tQtUL$4 T$hjRht>4QWt$h l2T$ gL$4D$ t>41ɍAD$4tT8`T$ Q$QRQPWLcX>4 T>4T$J4r$w&Pt$heQ#t$L$ $d$ r $3 $tu¸A#t(O#PQhP#|$D$u |$u |$TF1@]%tN#Pt$hN#$ ߍD$'D$0L$&L$ 1BD$8D$ D$pD$0Qh/Q#T0uPt$hJQ#|$L$lj% L$St$hkO#{D$$&1ɉQD$PSw L$ 9t 9St$hO#,D$ D$ D$D$0L$0RPQt$,t$$PtBD$tUtsD$ |$t>4jVPM D$h|$t)811FD$&|$t>4VVP  D$'$D$8|$t>4jVP D$pt>4jVP UD$1=X>4D$44$Vt$hO# PhN#=H>4he^_[]4$hP#ًt$D$t$$t$SI@9s Vt$h6P# S!@D$t$|1ɉQD$PS: T$tD$pD$ 9t8u跾8 St$hxP#QhP#菾1ɉQD$PS ƋD$ 9t8t}St$hP#St$h/O#D$t$։D$0L$8`OGL$0d$ rxL$D$nT$L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hlN# jj-Pht>4hN# hN#hxQ#hQ#ht>4hF#SWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVS萈1Ht$L$ltT$d;WuT$h;W(u Q` ŃtD$ppPU! D$DGXHr PpoXd^_[]USWV$l2@48t>4t @4/@4Sht>4迆tWt>4މ)ˉESQ|$ W螎 DW@4V0V?fǀ@4/SUlut>4Uh@4Q0,^_[]USWVhT$D$AG#&1Ch@4ݪD$ CL$;rjt$V脌 ufD$jD$Pjh@4Vt%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVPjWt$h!G#|$$j@WVPjWt$h1G#jRWVPt$=h2qPh#W5 H>4t5l>4PhM#5h2D$$PV5h2 p>4^_V΅tO耹Hw;s1<>4 d>4teZ0{Pht>4hM#M Atʡ<>4 d>4t"$0EPht>4h& u =H>4t^jUSWV=X>4ˋ}T>4 \>4 t u tth(3jVu}ti=`>4|}t j YMO؃thD$VuP蛋 t$UtuRh#{5p2Rh% bD$VuPE tMD$PVhM# D$VuP t+t$ t$ VhM#V]D$ s*P? D$L$ r!QPhS$ rD$rIPh #QPh/$xt$h]$}u hM#j e^_[]Ph [&USWVP=X>4u(ˋl$ D$$|$5T>4 \>4 t u^_[]Åtth(3jt$W܅`>4| t j m$^_[]uCuWt$h"  K4$~DN1ۅtPh*#t#=`>4uPhN#9t`>4C뿃u,hM#'t+ORh#4t^_[]É֡\>4`>4 t5\$|$T>4 tt΅t9t4h(3jWV뵡<>4 d>4tht>4hN#L 딅t~=`>4|t j ^_[]1ɉr $~1Ph*#C9ur4$h9N#j tuQh#`b5p2Qh%G IWVD$0L$41|$VVRWQP݀t)L$$<$ug`>4 \>4tT$jjvB1A8=T>4uQh#t$t$t$ t$t$h!K#^_QhK#jLUSWV<>4 d>4=P>4|$(|$4`>4 \>4t{\$,1PPQPSWt`,$tYU(XtLƍD$(1QQPVSWt&$;D$ut>4jPwVfhaV[hD$8tPht>4h]K# ;w1D$$&PhK#PhK#PhK#PhL#^_[]UWV EMT$ 1|$VVRWQPt@u|$ D$L$ L$D$`>4 \>4tT$jj Z1APT>4t!u.=p2D$PڂPWVh?&QPh$ t$QPh&L#e^_]VhK#jJUWVEMT$ 1VVRWQP/~t+M|$ `>4 \>4tjjj1A`T>4u5p2Qh% T>4$h t$t$ t PXt$t$h3L# e^_]QhK#jIUSWVD|$huI=<>4t@D$$1ɍT$QQPRh;L#c*qD$pt$D$(1N\$$SEUŋD$d\$ 1ҹt(t$ RRVQWP|D$ \$1Ƀt,$t$XL$$9 1 $\$(K1ՃH11D$1D$D$1D$D$ \$|$,Euϋ $q|$,\$]\$\$ ]\$ \$]\$\$]UT$T$UT$}T$UT$T$(Iu$L$HL$ H L$HXPL$Hx L$H$t$X\$(t1E<$tEPhl2VhCL#j\$DSC`>4 \>4tىjj(A=T>4uSh#mw$w wwwww ww7hJL#C,D$tM(9ʼnd4$1A1AUcD^_[]VhK#j"GUSWV$$|$$u1D$1ɉQQPRh;L#'4$$t$V}Rtfŋ$L$ 11RRQUSP ztO$D$ ;D$*#L$$l$u1L$$jjUi 1A1AU=<>4tM<$1\$t$Whl2RhCL#jSdL$$jjV G;<$|u `>4 \>4tщjPV=T>4uRh#n<$~/1t h#UttVhL#?F;4$|j Ot$aĄ^_[]RhK#j8EUSWV$=H>4t  $D$\$1ɉD$QQSP$Vgxj0WWUUWt3j Wt$S$UV艫8W$hL#{ =H>4vjG11ۍL$l$ PSQU$Vwtct =X>49$$D$\>4 `>4tT1΋$PjU$hL#1Ʌ7_l$ 11΍L$AAQU D$L$PUhL#jdQ$WPUV to\>4 `>4t$jjPDH1L$AAQ\$SZ D$|$PShL#jdW`$jPW Ā^_[]USWVP\$(|$$1PPUPSWEv$PbN1PPUVSWvtu=T>4u5p2t$h%% $ $ r/1۸#WwwPhL#C #;$rj 1A1AyV@^^_[]PhL#jBUWV0EMT$1|$ VVRWQP?ut0M|$`>4 \>4tT$ jj1Ay=T>4uQh#%1D$ L$ T$$L$l$L$, $$D$T$l$L$(D$L$l$\$\$ \$$L#e^_]QhK#j@USWV@$ @=H>4t Z$ VqKƍ$ h jUУ hJ%V t}1ۍ|$1EfSWV L$99=z  hJ%j$ƅu$ 11L$RUPQ$8@$8@`stIt =X>4$,@$@\>4 `>4t.1T$Ph X1Ʌ1ۅÍL$MP~$@SPUB U$@w[tW\>4 `>4t$ jh V0$ PjPS S[@^_[]ȥ8"tD$9t 8uVh&M#VhM#j>hM#h$j>USWV \$0|$,1PPUPSWq)4$J1PPUVSWq=T>4ut$ h#>rt51t ttt ttth[M#製 9uЋkT ;$tl  1L$D$Sjh"Y {t+1:LtPhM#3 G,;{r܃TD$@TL$9uj +VY1A ^_[]ht>4hqM#+USWV }=H>4t D$ tohM#W辕tcң1ɉt$QVW T$$9t8u訣8,WuhM# =H>4jj11CL$ t$PSQVuuotWt =X>41=\>4u?=`>4u6L$1J1ыT$1 u#MUPj hM#1ɅRaMUPjV tK=\>4u-=`>4u$1H3$3|$ uMUjj hM#MUjjP e^_[]ÉSWVt3q~FDx@uAFX@ut9v30Dr@tH^_[USWVPω11s6tUVhXT#t (P4iT#!sT#t ,P4=}4t8=C4u/湄T#0P4b&4P4=0P4u 4P410P4#u 4P4#$8P4t8u`C48P4#⹣a&qxP4# tÉ|P4s##tƹ"=O4u#t‰h#Ɖ5P4>u H[4^_[É$pP4z8{lV t<0 1=O4u Vm^USWV׋t$$\$l$;Et*+u(^%#t D$ L$M^_[]USWVր9tMτtC1P4 2U5C4W谍 P41P4U5C4V蓍 ;P4|ut$`C4^_[]Ë (P4C4USWVL $։ύl$ D$?hT#WT)?SWU4c D hr VU $؃$j L$QP] D$ $9*u)jjt$VQPD$P7tD$t$xj>t$Zxt$4hr VW^ L^_[]Ë ,P4C4V=}4t =LC4=}4uF 0P4C40P48t!4P48t=O4u xP41BhC4=}4u P4C4b=(~4t (P4C4HP4=}4t!=C4|1Fj 2F;5C4|^Ë |P41B^ xP41B |P41B=P4ug=}4t =LC4uN=(~4t ,P4C4=}4u $P4C4=}4u 4P4C4P4Ã=0C4"P4Ë tP41BY P4C4Ht$j5DP4葏 1B)=}4tË lP49tC4 =}4jË @P4C4 8P41BV=~4|P4txP41B5P4t-F=O48P4tP4t hP41B'P4t `P41BP4t XP41BP4WVD$ #=$2 lj Ƌ TP4j" \P4j dP4j=@~4ttV$ LP4j5P4^_WV|$ 1Ʌ<+u OL$ GWf{-rO|$et t1AAL$ ƸtL$ QT$ 9.u L$  ɋT$t7t^_ÃX~q/Q wL1$L&1@ÃQ*A wO$& ÃytdwteruVÃRt[WuFÃYu;øøøÃ-uø ø øø 1Høøø WV΋9?-u G>j VW x9>u1H^_ËL$#$2 ȉ WVD$ t1Pt%Ɗ<+tu1Bi>+uF^_^_1B^_NV΅th.%VD{trL$PQV t4uRL$xT# $x2P T#T$x T#$x T#w^1JT#^aD$# $2  P49uVD$ T$5$2! щ щ! ‰ 19^Ã=2thT#Ë pP41BSWV@΃=2ttP4tVsytx1Cj S*VGVxSP_GVh%P" P4=P4!VhT#j@WWZ@^_[ËD$P4WV92t#֍|$RQjW輞1B$52^_Ãw|&ÉfUSWVPt$ P!уtRPtt jhT#jhT#l$$\$|$Q t^tY9uE} 4u ;Ճt(ˉ $19u tC ;$u~2KՃujh%U#t jhT#jh U#D ^_[]1ۅs IQRP踒fVt$t=2tjh9U#52^á2xy=P4uE P40@#4@u.P4jhNU#?t P4t2P25$C4:$C4V1N=P4t9t/ P4,@wB$@(@1҉,@Ɖ^USWV=2P4@@ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh`U#1@$qQ52u 9D$}P4럃^_[]USWV-P41|$(1Axt$$!уt9} 1@^Z $@u@@L$1T$1 u/$@$(@),@1^_[]Ɂ *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$I9}5P4(P4@9@S P41JЅt8=P4u/@u1u0@4@ '[WVP41t[@t @4v P44@0@{!уt RPF1G)t P4t^_USWVP4t>@u59t811ۋQq Q9׉|މ ׉9u ^_[]?11VR^_[]WV1VVtHP49t:ʋz;yzy|ϋ9uOW(@$@ǀ,@1F^_Ë P4t$@(@ ,@1HUSWV5P41H(@$@9t#H1ًP1 u,@;Hs D~4%D$z9tG1؋O1 D$ ~9 $tG#G=}4t @t2x9 @}lh jB/tH @1HGG7FGF8~FNOG Fx ~,@;GsN+}4~ڋGO H O A$@(@o_G $GW x 9G Ã!уt 9ÉX@1؋@1 t<@jUS@Fb!ƒ5P4@@2tOD2Q@u;G  )RQ@w u&P40@4@(&OD1@l$1tʼn$yjhU#1=,C4u 2x~OUQP 5P4@@o<$t0@D$4@=P4tU=~4u#L$ Qh$ ~4j2=P4t=~4u q=P45P49>tOOHOP45P4wx>GO H O AD$DHOG Hy x,@G9r$@(@D*?#jhU# `[41H^_[]USWVP4ti,@tI,@^_[]$@(@փ|9@u2΁ƃ~9t_1ˋo1 t 1H^_[]É$@(@뇋L$xu1@1H2áP4@u1I4@0@Ë9t1JQQ 9u@o P44@0@1@@(@$@,@PPP@^!ƒtjhU#81PPjt$^!1WVP40@4@!΃t@@9} 0@4@^_SV\$t$ 5C4({P4h8@jP4@1ɉ @@@@$@(@,@1I@0@4@II Jut)1PPjV]!ƒtP4 P4@P5C4vzP4@u@^[SV5P4@  ˀuH9tPQP P0dž @vv Hu5P4@uE u@5P4dž@tV/1P4P5C4y^[áP4t@1fWV|$t$ t=P4ttIN<^w@Aut5t/|$t,*u~t~tFjnPjnV1EtD$*uFVt>L$rdtku$stuu1B 1҉0^_SWV h#j`EhZ#lLh R4hR4h$R4h0R4\$ -uF :tjhZ#]jNbt'.t5R4bt0:wtptcu+$R4F&jSh R4 0R4jSQ ,uF R4R4R4R4R4Q4R4R4$R4Q4(R4Q40R4Q44R4Q4hiZ#J1tPh9Z#J1F$2VhDZ#WhP4P(hMZ#dJVh[Z#WhP4P ^_[huZ#>JPJj3(C1B thZ#Jƅu&hZ#IƅuhZ#Iƅt]hR$Vu6hU#Vu$hX#VuhX#Vمt1BU#w1 3TA ruƀP4ƀP4ƀP4@=u=P4D$P4SVt$ Q4M1ۅuDQ4;1Cu13(u!=}4u 3 1ۅÉ^[D$P4ËL$=r!=P4tP5P4j hQ4蹌'P4u Q4Q4uQ4ESCQ4Ãw@P4uQheZ#VPt$ u Q4ESCuw P4u;Vt V5P4B$Q4xPV@,@P4uPheZ#V5P4j hQ4Q4^WVD$L$ =P4=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_ËL$x1@ÉʁtTʁt?ʁt*ʁt1@USWV|$1tbl$Sk9Qt u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[]SWVt$|$B9sńuBx^_[SVt$ P$&F? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[USWVl$D$|$=P4t'~3P19wKS>~-19s2C,9r9v)CK$SU[uF8AUVo ɋl$u9tSv R[t1|$jjSOF ~.EFE0uE^_[]VTZ4t";T 3t1FVh.uD$ L$PjQ课 $T$e^_]Ë dZ41; LZ4|$( 3D$ $X 3D$D$ $Uj $Pt$Wփ ShU蜂 S;N1PPWփ Č^_[]ËD$ L$t jPQ^ Åt PEUSWV=,C4o=8 3u=h 3u =x4P1TAPM@PjVPwWM|8QZtQL8hQ$WqyÉ4$pu1ND$PV9x#D$ =uhVuh.[#a0tPKƅdո( 3Ex uָX 3Fx uh;[#h$S[x T$Zi]VUhO[#S:SL4$VW[WVĀ^_[]SWVhr[#/P/tt;^_[&h #VAN1ۅt+h_v%V-NtV<1AÅt^_[SWV|$\$t$t.9tFtVaF( 3tX 3u%k[#+c[#Qh$P+w tWh[#vw Y=8 3t"hc[#h$vv V( 3=h 3t%hk[#h$vv VX 3^_[^_[USWVPӋl$D$ $uSPLKSS1tD$ t}t8^_[]StV믉hrjjx Z4Z4$t,tV#hj:} =P4TeuYÃ=P4e4΃eZ4~o6/=Z4u #=Z4 t t =^=Z4;Z4Ct}.CЃ jS&ed~hZ4 Z4Z4=Z4t Z45=Z4u!\$D$D$>7 i$S3 D$L$QP$Ƌl$tEtEPEEuiuM=Z4iZ4ih%jjS\Fc`$l&=,C4 &t#-l 35Z4=ES[jUY  xSZ4H݃t =<~4-Z4>!(Ƌ 3ķ>tjVUP t j=2u J[\ 3jry C$ & 5Z4 h\#9C49pC49C4=Z4SZ4C1Ƀ Z4Z4ῃ5Z45Z4Z4/U]VsWWr!2@*=C4%Z4Z47`~4Z4h$jjZ4Z4n=,C4 5T 3Z4 }h[#Z4 _gh) &y1PPv`~41; Z4Z4 Z4HZ4Z4/=,C4 Z4%h\#1PP9C49pC49C4؉ك u. u.S莍iZ45l 3Z4%aih &{jVyZ4Z4 PZw Z4 *Z4уBЃ@*? !1҃ ƒ!D$Z=Z4,9C4t 9pC4h 9C4W jh]#j#t$(VcOVrlp1BsRtM&=C4=Z473Z4ЩuZ4Mj5< 3ùe=P4Iv_*-t%+q1҃¹) Z4Z4S\B D$t1< Z4D$ D$ PD$PD$ P萪 Z4tjD$D$-<{|Q<`ʃ=Z4tR D$HL$@븃@Z4|$ ^s 8eBZ4emh\#1PPL!ùe9C4e9pC4e9C4e e 1?PS1FP@/Z4Ph#5Z45Z4虤 1;5Z4Z4|Z4Z4n蔰VVA 1;Z4Z4  Z4Z4|\C4'M1PP5\C4 =}4 Z4 t|7ػT 1;Z4Z4|Z4Z4蛻=}4Z4u' Z4|5Z45Z4PZ41QQm1;Z4Z4 Z4Z4|\C4|C=}4u5Z45Z4P1PP5\C4A Z4Z41҉3P5}41;Z4 Z4|Z4Z4}4聺觮5Z45Z4DT5}4JZ4NVh\#h1PP5 ùe9C4e9pC4e9C4e e /йSE*re|褹ʭ^4Z41^4 }4 Z4}4 p~4 Z4p~4h^S#Cjjh%\#Z4݋5Z41ɸd9 jhI\#=C4t>t5Z4^4Z4}4Z4p~4j)eD$t Pj{@eJr蘬 L$Qh$1;Z4Z4|Z4Z4)O=}4Z4u' Z4|5Z45Z4zMZ4jjP1;Z4Z4|Z4Z4跷ݫjj蟷ūD$< 3D$Ph[#=,C4jh[#VR Z4Z4}4 Z4Z4}4Z41ɉ Z4|Z4Z41@Pe(ejh\#e1;Z4Z4|YZ4Z4 諶Ѫ=}4u5Z45Z4Ljj- Z4Z4ʃEݣ~4c Z4Z4~4Z4  Z41; Z4Z4 Z4|Z4Z4q j5< 3?Z415Z4"5Z41;Z4 Z4Z4|Z4Z4 j5< 3RCiZ41D5Z4=}4t5Z45Z4J1=W Z4iZ4me5C4V?P/V$Z41ɉ Z4|Z4Z41@PuGjhm\#Z41ɉ Z4|Z4Z41@Pk 2V_e!ֹe5}4RPyJ1A诳է Z4Z41҉AQPcM^4Nn^4Z4>X`h\#r1PP?ùe9C4e9pC4e9C4e e S賁+̲1PP5,~4n豲צ1PP5,~4jP#'Z4Z4ؽy蟦=}4t5Z45Z4Gjj5Z4d:0ؔZ4Z4艽*Pjj5Z49; eS贔D$D$Ph]#{豱ӡZ41ɉ Z4|Z4Z41@P"etbt3tFu j11A; Z4Z42\#|#L$Qh:\#11%Z41ɉ Z4|Z4Z41@P'"e11A; Z4Z42\#|#L$QhZ\#je5C4<h #P/5C41=tjh[#o5l 3Z4nvh &1SVUh蠻Ag58C4rSPx]~4 C4݉Z4 Z4^49‰}Z45Z4)‰^4`[4e~4 C4Z4 Z4^4`[4i1Z4Z415}4QPHFjhy\#H3D$Ph\#d ։u=Z4tZ4 Z4Z4e,5Z45Z4tI~V8Jjh[#bUSWVP趮ܢGVD$1Ƀɉlj щ ^4^4P4=P4uH9ljD$u21xUUjn6 9-P4u;=^4^4D$tP4 P42t8teue^_[]USWVPӉơZ4uZ41 r4$0utV4$#Z4Z41ESWPO áZ4 Z4 Z4tu1Fx` sKu j]j%u0SW5Z4 áZ4 Z4 Z4ujh]#t 4$4$^_[]WV=2u=}4t =LC4u袬׮t DC4@C4!ʃt]5HC4QY`[4u =2uP5}4=P4}4P4u _BLE5}4=P41jPPB ^_SWVZ4߾h%t #Z4/ V+=Z4u V@t h]#t u &) &P1\[4PP^_[V蛫ơZ4"~S.#V$^%=,C4Z4VPujh9]#  tY>!t Z4t P4 V!Z4=,C4MZ4.h-]#qF<+t< t C4t Q V菛C4/7E=,C4V蜭h3]#Pt% =,C4V^XZ4^(N5Z4jF5Z4jQP軯^5Z4V5Z45Z4Z473Z4Z4PVC4h-]#h#r^SV Z4t s7Z4ZbZ4sh?]#iZ4 shJ]#QZ4 shV]#9Z4thb]##Z4 shl]# Z4fyhw]#Z41Ct$‰sSh}]#jVLVZ4CuϹ"tC% s]#Q\[4^[fD$=P4t@WV|$ Wjeƅ~WhV\1 ^_USWVt$0l$(|$$t U%,$|$MD$T$ PjD$PA NjD$4tSuND$;D$$vD P4H|$$D$9Hu׃tD$4tFWRt9Ët$94$sWSQu$H $89rS|R|$$FD$4tWd t W WD$Pu|$,|$$t +l$()D$,,t$D$ 9w,$ʋD$9D$4t9t$0v y uIt$0t)^_[]f Z4 Z4 Z4 Z4USWVi $AD$)< u?FP貛^tP(#9~k^#ފtGEEGu뻄uEE9w EFEE롍F~x h8u;l$r $ W^_[]Vhhp 3hhh3h]#htjPV jh]#h]#h%tjh]#h]#hjh]#h]#h%tjh^#h^#h^Vt$ t:j jJ tL$HΉp Z4Z4jh^#荞^Vt$ t:j j tL$HΉp Z4Z4jh.^#H^USWV\$ D$tPZtP l$t1U%ƅtD$SVЃVN 1H^_[]hS^# t8tMjQP[ ƅuh[#t98t4jhc^#P/ ǍEjPW W iUUUSWVP1F=,C4jt$辗P#19jV n1PPPS!ƒJVWS <$S/11 ?$:81xM'x+xG1O|E(|n|dȃ|$Z4tZ4Pu;ctreJB,9PR_vJB,9PtJBxj,9s`PRTW S1N^_[]4$ |t|uVP11xtɉSWVhZ4t$b<ƅui\$hZ4e5Z4PSh[4I5[4P|Z4tZ4h[45[4p^_[ËT$ Z4t$USWV։ύjOGT$9sP:8uuP~3w޻dr͉tGD< POމ^_[]SWVet^_[Ã#t,`tau1ۃ=(~4ÃB1ۃ=(~4ÃCɍH9 C4~Pj#|k`[4SWVPύL$ex|$;uxƍL$v~i|$;ubL$b~UuQ@tAu"1ۃ=(~4ÃB61ۃ=(~4ÃC%|$mu9C4~HPj#j`[4؃^_[USWV$Ё vt w<$}|$1jjPj PPU1Ou\$jjjVQPUu8#Ё w*$jjjj QPU1O^_[]Ë|$]fUSWVt$ \$zD$PV0ʼnPD$X9vpG$11Ʌu2~>9sWt$V t't1:% 31F9r':$ 3u 1A4$1@1< uD$XЃ^_[]WV|$t$ tWDV19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@WV|$ W#'t`ujW&^_VQpt1=l~4ƃtEuG%t|Qh_#hh?&AVh$6] Eu ?=u Qh`#$ u 覣!ƒtVHQh_#^Ã=l~4t$C4tPP&t5C4ËD$t5C4PF$1PUSWVu195C4OC4t_jP%=C4tJtWg%W"=C4u"MjW0%=13V$PЉV8%D$\$D$VC%D$t\$\$D$ =}4uID$xAPt4D$8\$Ph^#FًT$WVt$j 1@t=C4jWd$5C4t$V$t$5C4g$5C4$h@C45C4#XC4t$ t$ ۨ~4=h~4111P4D$4PD$,$jUuWP 5W U~ڃ,$C^_[]SVt$ h #V 1Ct'h^S#Vth^#V1ۅÉ^[WV$ VtVWVtWt^_USWV 1=~4]=,C4Pj\h\#1Ƌ|$ 11@L|uM@-u)Fh #W')1%tuQ%t s@AAۃ\$WVW؃D$jPtWVt$P'W "S 1tXt^~u1O\$$D$jPWv uQD$P4D$(0 #^jh`#4|1 ^_[]ÉOVX;t;VX1|$rɅuŋD$(^#1O;PrS" USWV=,C4t^_[]j荈h`#t݉ƋD$ l$1ɉ%tuZ%tsu ABB߃|jh`#U{PljD$UVdWYS\$J,8jUHrS\$SVUPd%4$: S1 \W V=W V|V$ˆ#N@ |^WV|$=}4taPW聈1=}4#D$=W]*jP`qWP0hP3LPW x#D$=@{WjPqWP0h@3V' WoƉ|^_V|$PVx D$XT$\1jPPV|^UWV蒊lj5C4# QPXt1GL$ T$34[43 0[41@ u,L$3 <[4$38[4 u!tL$\9|$X}e^_]ø!a#Vt$V9vHx/uAΉ^fVn T[41ы5P[41 u^ãP[4T[4=}4t^6~^P~SWV1ۃ=P4t^_[!ƒtj}!Ѓt111 1Ctj}1Ã=X[4tX[4USWV-L~4~ON}=L~4~Q111SWuljӉ:}qF;5L~4|؃=P~4' =P~41=P~4|=C4111;5L~4| V|ljՉ!<$=P~4FD$1;L~4áC4D$ O4D$^4D$$C41O4^4PPSUt$ ljՋD$ C4D$O4D$^49pt$j pF1MC4H91Z{1@^_[]Vh 2F;5L~4uj{ t j2^USWV\$,=X[4tX[4&|$$t$ l$C4t  $9~ }4$x 9} H9$!tT=|~4t ~4tC[41҃=P4TRQPWV脘WV Ɖ1ND$(D$<$=}4t7C4H9-11 t {WV{,{z1@D$jz11 u C}tZf{WVz=}4tzmz1@D$/1@D$=|3uu=2t hNa#\o\$01~1tΉcWVC RP!ЃtB|$ujy!ƒ1PP|u1@PP|th1OWVzE<$uF|3 C4t)!u =}4u=0}4uX[4=4}4t Xm\[49l$"C4HPj-|1Ot1E1=L~4~1VV|{~ VVVD5 -P4t <$tw y|3j@ ^_[]USWV=X[4tX[441=H[4u!}4y=}4t C4'|$t$;D$||$$t D$9C4~ =L~4É!tF=|~4t ~4t0[4,@1)͹|ЉjWVQPs|$~]1WV6RPX Ɖ!Ѓu|$ t&WVjxEuwwk9l$ut t*i ,vjI?^_[]1=H[4tá}4y=}4t C4ø'USWVPt$ |$\$ct0>t'sujjh(4$jw!уtjt$WRPS#^_[]ÅtC4HPjytm=P4tPay1u11FUvUVRPVjv!уu P4tw^_[],u1HYUSWVP\$ l$D$$jGvƉ!ЃtSUWVt$N^_[]Åtjv uك^_[]V C4~&111RP!уtF C49| 1 C419^fVt$tsVGF95C4u#1=3tu1Ɂ3tщ C4AF=3tH d[4v  v ^ ^ËD$3tQ13tЅtË 13tËD$3t 13tËD$3tI13tád[4USWV\$S@Nj533tv W6WG |$j4j'fSeFSF 1HF$F F1FFF0F,3tFq0@@F=3t@d[4VEESËnU9Ë\$sU虶 SKeFW脶 5^_[]ËD$t@1ËD$t@ 1ËD$@ËD$L$QP(IH$P ËD$L$Q(PQ I$HËD$@ËD$@ËD$L$AËD$@ËD$@ËD$L$AËD$L$A,ËD$@,WVt$|$ G0t 9t P诵 w0^_ËD$@0ÐUSWV$|$ <ʼn؄uu ݈u*jjWRt$t$~}tPQ%^_[]WVt$ |$P=^4jjPWV^_USWV,T$Dl$@ظBӃ=|~4t  ~4t0[4 @1)ʉ|ЉjSUQP虊كQP4v=}4tK uu|| t u+| t uP4ttP4}|t uVxƉ׃ ExƉWVuBl$ \$$WV4$D$QW`uD$ |$(t$1HD$D$+tP4ǃ݃ tkwRPW v=}4t( t u 1|$ tt$\$ȉD$ 1El$ ;\$ D$$p1Ʌ |N ^4 CfN =^4=}4ti t uf|$$\$ :s t u us1Ƀ ̓1Ƀ ̓9݉4߉&|$L$!ȃn)݃`1\$t$1ɋ<$jQP t$Wxxl$(T$Xl$t$1@Él$t$1@<$1}4l$t$1E1!1M,^_[]Ã=~4t׋T$VSt$ t$WPWT$,SWV|$t$!tXWVru[qt t uy52=2H~y@wr 1N52=2^_[ÐSWVstjh^a#c^_[uƉסC4HPLi11 u^_[8iWV!Ӌ C4It*QRP4 C4HPh11 t^_[]1QPP tUSWV\$(|$$t$,kSWkx#)~?jh1QQjRPUASWqtOjh b#bKy1V[hVjRPUo=}4jusj'hD$ jhD$T$l$ !Ѓtd9}\C4H94$SW!уRPvlj9Љ $AC4H $9|14$~;1l$#l$t 9|$D$}$SW!ЃtIF94$uԋ4$A1?$C41VVjt$t$PY95}4^_[]1K16-X[4-`[4C4H $)QUjSWP(1K[6=}4tf"g15`[4SW=gC4HVjSWP$뀋4$FjjRUV}=tŰ+u}=tEE< t< tj D$PUdY |$9t>˃;@!$4,$+-9t[4Ke#>$4,$tt=t|<9t[4|wC^w \$D$She#jWn$4,$$e#f9t[4u+9t[4}9t[4t9t[4hu_G t t1"~#ut|\tt t tL@?3~|$j=W费9|$v"ŀx+uVEl$t$ 1ŊtE PQEEul$E< t< u<=t< ujP谔Et$ E< t< uEl$<= hP~EE< t< tl$}1IŊtE PQ>EEuD$8up|$t$ |$1BŊtE PQEEul$Et< t< ujP̓] t uEue##6$4t$ t t_G칌e##$40tUPStue#dF,$t$ t u_G|$tq $4 PQ?|$t51ŊtE PQɒEEuD$8uˋjP訒,$i$4 PQVrl[4^_[]SWV׉Ή5p[45h[4hwe#hS=w )WVRQl[4S^_[USWVՉ΋9ȃ^tr\uxGOуaЃ11ɍуЊH@̀0u {r܉t ʸl3 t^x[4x[4y[4JtGtO GO x[4y[4l3 tx[4ux[4^_[]ÍZ w6$'tEGЃTZ$'btPeu>fx[4랄tGOm>B#놃>D#w>Xl&h>.A&YC~Dt*Lt)Ru, `1tBuRUtKXu D@ <8J^w]x[4y[4d   >x[4 x[4 y[4z[4~[4Rhe#jhx[4`e#x[4_t>#vVhe#]4P+t ]4Ƣ"hf#蹻]4Pt ]4f#jVL]4jVL]45[4h ^4h^41$^4PҎ $uH^4^1|$áP^4T^4S]41^4]4 ]4]4 ]4]4@]4;]4|1ۉX^4\^4`^4d^4h^4l^4p^4t^4x^4|^4^4^4^41HT^4P^4h ^4#h^4$^4P $uH^4[USWV\$0l$,1=}4uSUƉס~4 H~4SU\*@u6 22!ʃt'9݋T$0|2@9-2T$0| ^4=~4tU t^4^4Z^4]4]48~4 ^49}Q^4Ɓ]4 ]4ك=}4WV^! tt$j VRP)NV1 4~4)~$^4r5^4Ƃ]4 ]4Iu܅~+1ɊT 5^4~=^4]4]4A9uס^4H ^4ƀ]4 ]4^4X^4^_[]Ë ~4t 8~4=}4t14~4@V5]4]49}9 ]4<u"]40Ph ^4 ]4]4F9|Ӌ5]45]4^4X^4^SWVt$\$u$D$0j?oP/=P4t&v!Ss1҅ SVqt1҃Pn1҅t$St]4~- ]4Vt[u]4 ]4LV3Zt ]4t> ]4VtV[t'i=P4tVs1҅ƒK1JFVY# P4#P4#5P4#O4‰^_[QY# P4#P4ʉ# P4#P4á]4^4X^4^4á^4]4^4X^4ËL$1wQ5]4X1SVt$ 1ۃw)V5]42uV5]41ۅÉ^[SWVt$|$\$VjWq 97sPS t^_[Vt$ L$yttsyt21\`xJ+f#9u!B1@uDA;1A+u%uVt1@^ÃwV5]4?u߸ع#L$1uj jE1ɉHHߖ SWV=x^4 u|$t$\$t-1 |15^45^4tm1@Z ugx~4t }4uU=p^4~+^4 ^4\@^4p^4x^45^4=^41x^4=P4 p^4%=ua^4P^4^419Rh^4bmh^4m^45^45^4^4 ^4H ^4p^4u"^4^4x,1WV=P4t ^41At^_[ÉШu-%=tS0lp^4=^45^4뢋^4 ^4^4p^4USWVӋl$,|$(h^4=}4^4uBu>%j jzC1҉PP^4^4h^4h^4twQPl'UWS ^4xt^4Ph^4蔅1^4h^4u+p~4t}4A\$l$͉=P41؋5]4]4h^4Rk5]4UWS% 65^4; ^4^4PV軄H^4@$^4VP诅V荄 H^4AVUUUЍ@@H^4d^4 ^49}oh ^4藅ơd^4 ^4Y$gQVlu&]4]4PjVPml^4$#5]4^49|]4l$ EVjUek L$ )v %uh^4蚃5^4 ^4 ]4; ]4 5]4|tq=]40jf j]49u"_l$\$u4Шx$_l$\$u$5]4 _ ‰$ u*t~4t =}4uKuG ڃ^_[]P4m_uiud1UWjX^4+^4 t3[491J$;[4} qɉы4[4)t _]4\$ PjSi 1EL$]4) ]4PjS`i ǡ]4 ]4tW4V)X^4~Zl^4t\ [5x3)Й)֋$F UWh% N1h^4E1-h^4$_PdtUW ]P4t6=}4t-QdtQd UWl $UWS t1@1^_[]SWV=^4~4։1^4Pd VW u C;^4|1^4)^_[Ã=p^4~^4 ^4p^41WV=p^4~^4 ^4mp^4|$t$ =x^4uu 15^45^4itb=~4tYd^4C49X^4|`^4X^4\^4]4AC4 d^4H9X^4} ~4 j ~4 ~4jf=H~4X^4tL^4tBx d^4 C49}; j,X^4P d^4 C49}^4ы d^4 C49|L=O4tCO4„u0=}4t't4|$t- 1j1j 1j5]495[4 u]40]4^_V=}4uajm5]4¢tMȺj9T#Fu=^4u"Ⱥj8f#Fu^SWV։ˋ=]4G]49=[4 u]48]44D$ X^4; `^4~~ `^4]4\^4 X^4^_[SWV]4 ]49}1T$5]4ׁtu Ӊ ]4@9|^_[ËD$L$ ]4]4VD$ L$=t^4u=}4ttNI1҉ tK1G^49~]4]4+5]4)΋ ]4 ]40 ~^t^4d^4USWVL$D$!ʃtcQP,Q1H…uS PtDËt$ l$1t= t8P4u/[4H9| Qu@]48GO1H^_[]cS ]49t ]4Mtۉ>?SUSWV-[4\-jSm jS` DžtVtRU5]4V+ ]4UPW U 5]4 5]4=]4[41t W轉 1Gt V證 ^_[]USWVL$D$ʃQPO1H…t$=[4]4D8OlV tnP4uc~]4>-[4u@]4 (I=[49rHŠIJ]49s=[4)\8OVà uQL$ t ]4t=[491H^_[]11USWVT$$t$ l$lj$ ω1ۉ|$WjRa %u4j j971ۉXXWD$PV= V% 1PSPV)$ɉ|$~9rt$ >T$$ )) ^_[]USWV|$15^41K^4|EtESSP t衴^4@ԋ=]49=[4 uS1Hte1ɺ|3:tWAuN1|31I:t?@u21|31I:t%@u1|31I:t @u^ËL$H1Ʌx 3USWV։Q@1At2t%l$\$GȉUSjQ u Gu11A^_[]V=}4u1@$5X^4+5d^4~1; C4^USWV։L$|$0\$,Ѓtl^4!t6tC؃T$RjQPWSQ=H~4=^41ۀ=|^4tw4$|^4 H^4ىȺVUUUЍ@)I(^4~4,I(^41E 8Vt$0j* G;}|Cu4$SG ^4tf ^4^4!Ƴttt$,9} 5^4=^4|^41ۃtQ]4 ]4T$ 1ۅ~&L$ PjQ\ ]4~]4\1SPVt$lÉى#t$\$(tPZ1Gr\$ D$1Ed^4;^4uXP^4#T^4uD$,P^4=T^4=^4~01 ^4 8jG;=^4|h ^4tX^4;`^4~<$~`^4 ]4 \^4$X^4~1 ;j_G9ud^41;^4uD$Ph ^4t]4 ]49~~51ɋ]44*1 ]4444A; ]4|١]4) $ d^4]4 d^4; ^4~( ~4 jd^4Hd^4;^4؉^_[]WV|$t$ =}4u1WVP PV WVt1@1^_Ð^4H ȁw4r1w4w4^4w4w4w4 w4 w4w4w4w4w4w4w4USWVL$0D$,l$$w4$w4w4t-9Br }$r1z3|$( Hw4u$$rw4t :=w4w4w4<$:rBJ jl$(jWw4tC:w4t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?w4t_ )ϋ,$]}w4tw4tV+BJ NF=w4uW-w4MEu$9ˉ|-w4],$ϋ=w4t sKӋ$JHJ^_[]USWV1=}4tD|$(T$$!t3|0w4w4=w4t'9PH }=w4u11CŋE1ЋM 1 u ]u,w4w4x4EP$H u,\$$)ӉT$ ʋuE t$+t$$D$9‹T$ }yQRD1۾$pXPh ;T$$1PPUR}P4!у4$։4$t$t$ D1۾u]Um 9T$$}b$1PPUR[P4u`Չ!уtZڋ$뽉4$URVS9l$$4$)à URVStx4 11؉^_[]Ã=x4xÃ=}4u `[41}4Ph8f#4Vx4xNH x4d|@x4* w45w49|jhPf#z5x4^USWV|$ l$1Ƀw4w4tKC9w4w41 w41 5w4v vB1IʅI~nVv 4$9ʼn1I1PPt$R9P4 ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sA1Iʅut{kSs 4$9}F11IVVt$RP4uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$WF8ÉdBƉ$!u1x-9=C4~%GW8É!Ѓu O;=C4|܄u<$<$US111 )ȃ^_[]USWV1PP@uejha#2^41111ۉu WVSU1PPWV+P4u Ɖ!Ѓu^4^_[]WVT$D$ =T~4t 5L~41)|щƉ^_fUSWV t$ >-uF(s7h &+V+hB#+艣D$1S6]+S)S\^Sw/SL,jy WZ/hx#À8t>tkV聪tmSʼnD$ݳ$Uѳ $ȃ$jP'袷t$PSh%t$Ut$x  Sa'Ņu>tVh"F'U<Uwx jl+W.WZ+1FVJ]V'D$$t*P*hif#y*/j ))3`[4t$赥j\^_[]USWVt$!Ѓt61U 5!ѻtՉj4|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WU=tjhzf#.1N\$hQ$S4h &Q)SH)hB#;)3(1S|&S[jj 课1KD$$#D$($<$t9l$$T$(ʼn|V;tIËFHN~ ;F~à tQuVS|jhf#1KtL tGf;t=ËFHN~ ;F~à tQu VSV 1Vj Ľ1GWZWg%e1=`[4VZ^_[]fSWV1x41K4t 5u'#ar'G__ _Gt PNu GF6u^_[ËL$ 1ɅV-$t:}4'W.t7^uMC4}41(}4$}4,}4C4 }4}41}4 }4 }4}4t P`r }4Fu,~1S薺PW豺Fv)r ^F~ ^v;C4t PNu VSWh ^_[ËL$t@;C4tjhf#x)1HËA QUSWVD$T$1ɾx4=C49~u 1Ӌn1 t A5u1wa #3w'^_[]øL$1J9}4u (}4$}4uUSWV\$SκƋ }4t@PPV语u}4 }4p Dž }4Wp u^_[]USWV=0~4|$,t$0h$W l$(}4$}4!ʃtWj UQP" }4u}4 h #Vt}4VU,}4Phf#W[u^_[]USWVP|$?mG< uGGo,$?ƀ} u<$? tOj SUJ$ u1@=C49Nj$8 u @$8 @tHj SP3# xK $9 u A $9 ItIFF V~Ft P^o  $FQF^_[]V=,C4tjhf#&dt$D$tt/uKV$C4;m?u7=2xCjh-g#뵃=2x%$C4QhTg#l&^jhg#jhHg#{Vơ$C4t Pn VޣP$C4Vhn 5$C4蛙 ^3 C4VD$$L$ t tC8.@L$$Vhu&Q 3>jhbg#3xxPhg#j VV覨||P|0tB D$0Phg#;D$$Vhu&P >t.jhxg#1}4L$Qhg#$^ã}43V3x$ C41Vh@BVPRQ_}4^VD$$L$ t tC8.@L$$Vh#Q 3>jhg#3xxPhg#j VVm||P|0tB D$0Ph%h#;D$$Vh#P >t.jhg#1~4L$Qh h##^ã~43V3x$ C41Vh@BVPRQ&~4^V|$u%t$jVt0PhIh#N#^V|$u%t$jV؇t0Phfh##^SWVD$L$tP0}4p=,C4tjhh#"VP>PR Zt V踘)X!ЃtV谕5}4SW? ^_[VD$L$tt\uoPe0 3_Pơ0 3t=( 3t Pj VӟP0 3V]j 0 3Qhh#!^V|$uJt$ =}4tVC4-4}4hC%_V_h@^^WVD$t t0t$4l7=tDMtGhuXF 3P}44Qh$5!Emtwt su!FF 3F4F4F$ 37Ni V^_D$u5}46Ã|$"7VD$Hs^\jhh#7< 3V)h$&Phh#hh#Vy; 3xu'hh#h7i#h[i#hi#hi#hj#h6j#j^^WVD$t$ʃc"y$t'm~nt^st]uuf1@dtRkuTVO HA:3, %1E>7<wVȃ=@~4utjhj#$FVPMy0Phj#^_ÉPhej#USWV l$ T$$1AT$$9s} u E9u9s}L$1E< wf$1BRӺRjj QPD$PY $UЉSSVRQPD$PXT$$ E9uՅL$u$;[4~[4A9s } uE9u9t},u E&| t3[4+|[4x3 ^_[]WVD$Pt t*$TV虠PVLD$ps D$ stopD$Tab =t3|i1Gt$rVQfD,VA4[4h #PJ G;=t3|VD andD theDen t$V5x3hj#PwJ 0Ph$D^_à D$t t+uyL$tJQtQytWjhj#Mà$ 3L$% 3AAD$Ph k#!%1% 3$ 3$ 3% 3 $ 3% 3 V D$t t]D$t$jhp$QVP46h #V螠t5>t ~4 $ ~48~4tP9~4 #L$Qhk#O ^ËD$Hsjh/k#/Åu tejhk#Ot$5P~45L~4h$jV0Phk##t$D$,Vh$P >tjhk#9 ^ãP~4L~4D$,8,cSVD$$tkD$(M@1ڃQ~#s wX$'d~&s wR$ 's wU$'gRtFWt4^tXBNIAt-u#13rtwu!uրπي@G`~41 s$E1B sFBtKBsNB sRBfyWB41AsBˀ0A4uu-FL$Qh l#1QZS`~4^[ÍD$Phl#҃=}4=P~4=L~4Ë }41 C4+L~4t$4Phwm#h8}4D 8}4USWVl$,H \}4t&AUjQD$}ol$,7F]$H'|$,z|$D$ t_<ÍD$ P1VD$ P ŋD$D$,t$tb t]=tMt @D$,5V3Phwm#h8}4C 8}4FVEŅ8D$EH$'E l1Ʌ^E R|$1Ƀ1҃.ɉ'D$,8jWD$4P0 L$,< t2u< n=}4nAL$,9 ItIT$uWoD$,74}4j+o2Phwm#8}4VB T$jV%D$,|$?+C4t P\ GP C4CE<-ul|$,|$D$ ‰Њ|$ME|$tWjЃt W\ |$,?eeWQh@BQЉ<+u ol$,O<+DŽ,.rD$,jh`}4P \}4I\}4^_[]É|$|$ u D$Ph]l# D$Phl#͉-\}4ōD$8Ph3l#uA0hvm#j*h`}4ŽËI1Ph{m#j*h`}4誽USWVl$u 1Ҁ-tH|$$t$ < ru7tQ0Phm#=j UQ xt-u)%tt0Phm#1H^_[]SWV9toӉQ賕@jP ljtG\$=~4t <\u ~t F <$t)\tPSpt GFFuD$Qhm#1^_[USWVt$(t2\$4L$0݃㿃u4F@tb[D$`}4Phl#|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]h #3rtP~ 31@USWV\$(|$$1E=~4uh~47?~4`49<$l$D$l$ =~4t=^4t=~4u 3=~4ubPjD$P D$tD 39PaHD$=P4t=d~4tft$,SW! ~4=P4u"t1~4@~4| j=y!辝8谝8#1Hpt9=`4t~4[1~4D$ D$D$$PD$Pj 9=`4t P4t, P4~4^_[]øjh~4UVVe2Ve^]USWV\$0 l SV,jUVSh:G#UP ^_[]Vt$Vk uVh#h~4=7 ~4^USWV D$0щL$l$ |$$t$4PWUl8ƉӋL$0L$4ʉL$0)ωL$($t$,ӉƉD$D$,׋D$4PD$4PWV 8Ջ4$d$0$D$4ʋL$0Ջ $)L$T$0T$!T$9΃ڃ ^_[]USWVPD$ Ջ\$t$$Pt$$S7׉d$ L$$|$ )ËL$d$kdkdL$$Qt$$WP97Ét$$d$ t$ ы$)ϋL$$!݃Ճ9؃^_[]USWV|$$<$it$,@BT$(T$t$01PQRW6i)$l$D$ ׋ $D$ՋD$1PPU\$SY6ыt$ ׺i)͉غչ9ȉ׉^_[]UVMMb‰iPi@BHjP$e^]fSWVPP4t `[4Z1~4WP(t>1C4$$~4u V WSCu ^_[S=4t4 \$ 3=ۂ4r  3H  3܂4[V5 3~4t(~4 3VP5 3 9t `[4^Vt$5 3^Ã=4t4r Vt$tFP;Fu^USWV\$8T$0t$,11|$GUSRVي&#O u݃|$0xG-Wt$8薻 ^_[]USWV\$8T$0t$,11|$GUSRV蠆ي&#O u݃|$0xG-Wt$8' ^_[]SWV|$(L$$\$ 1Ѝt$F&#NuxF-VQں^_[USWVM1p0D$ U< w<wé<r1KɅxc9}_1@PPt$Qt$t$D$PT$,"? 1@PPjSt$t$D$P=T$,M BlE t1ЋT$ $e^_[]USWV l$(L$ 1D$< w<wé<r1KɅxd9}`$L$1GWWt$ UQPD$PG> $1BRRjSQPD$P =L$$ AkD$$t1 $ ^_[]USWV L$(T$ D$11< w<wé<r1KɅxW9}SUPt$ QUt$D$PT$$x= UPUSUt$D$PE<T$$L$D BxD$$t1 $ ^_[]USWV\$0l$,1E%tEPbFEm%tKctUduNj nttxsu;tGP FGuj%wPǃ\GPFGuBj D$Ps3D$t|$PGuD$P轃 ƃ^_[]WV t$RVQ t|$P3GuVa^_9Hw @sÃtP=USWVPt$|$4V<$=~4uԇTh=O4 jf#Vt$ P]Eu P448JMp;5C4| `[4^_[]VWj .^_[]ËL$T$#PPh7# USWV։ϋ\$l$hVWPEtEPEEut$tCPCutFPFu4^_[]WVt$|$ zt!3PhV#PhP##PPh7# ^_WV|$t$ t%WVra7ft=C4 `[4 j Qu jF^_fUSWV\$l$=}4u<؉%t1U1GWP?[PW1WPPUVd[1 jj1=C41Ƀ=H4HPVWb Åt!WjE |$t8jhn#'D$ tP.mD$ 01E D$ 89t VE ^_[]Vt$tPl6D ^1|$USWV]}e( M1}$1ҍt$V^^ PVujWQՅ ]kU |$pكr x9|Jщ];D$|$11ۃxwEƋE47uE Eu4E4C9uȋ])ӋE)Љ‹D$u ~D$E ʀ[} }4@ʃtʈT$M T$щL$ T$ L$M :uR19t$t;9t7M L1̀[} @̓t͍~:l2t̋M ׉ M ֊T$;L$ tGK;|$r1ɋ] E1EP8EX01ɉ }( 4 1AsU41ҋ];4t‰Au܍e^_[]øo&fL$tt"u$ C4C4HI C4I4ʋTUSWVD$T$ C454|1Gll\G9uTD^_[]SWVD$L$5C44|F|\\|N B^_[áC4~Ph54و USWV C4; 44th!t 1G31K;)1G1I4:tl!GtˉPkA  C4jQJƣ4C44~PhV2 !t\l^_[]USWVPL$\$As C411H$(uC41@$14<#|tZ44ȋl!t!4$9t,$ȋ4ˋl!t@\$C3k^_[]1M\$1NUSWVL$41H; t$z|#=C4|O1;Ll |C9u^_[]USWV C4~.411F1l9޻r G9u1@^_[]USWVL$T$9~1@+54A1G1֋l9߻rB9u^_[]ËT$C4!х1A9Hh'*4=}4 't'P 4hY'4h' 3h<' 3h'$ 3USWV \$444|$ ȃ9~!:?t6\uCC%tw.D$ D$ qsC$ى&ÃO $F$'=}4EQ-s4C$ىË $Fw$,'#Fw}$'X!уj WRPBBtDt L=}4!15C4h #P z1sTu~-n$PuYQA tLу|=RP螽1 $1=447f1=^4u ÊCCs|,v, l,uȡXC4!ƒtظ:,u5C4资j W5^4QTу C45L~4n9|$ V5C45C4蛅PtmƉV; +1+5Q ic+Ɖ!уRPUV4=4H8 4H=4wA5C4kP豄 !уRPaٹ L~4 C4VQRPvtg 4C45C4,Pkyփr9RPٺٹ}"RPOj WRP$"QD$ tOՉr6UPlٹ}RPVt$!j WP( "/15C4Mj WP j W1P9;"@|4#9 4t 4# ^_[]WV։ Qw DrPuNxP1Ƀi~jt tt2mu/&Btbu1I5}4Q^_V1BȍHp>:uȃu0\tȃ?utȃ.u͉JuxtB^5 3~V5}41=}4tȉt 340AXC4^5$ 3'SWVQrNj4ع49r Ѝ4WVSN ;4;^_[VQ!уu$x C4H9}FV!уtt^^Ð14444WV|$ =X[4t54tZ=HP4ta=C4|<1W!уtRP虆Ws@GC4H9|vu4覍54^_USWV 22D$L$!ȃ2D$2D$ 1H2222=HP4=X[4t4$=C4|y$1U!Ѝ]tOS9t$ L$|8!уt 9D$D$}#WV脅U^+1@$C4H9|u $u^_[]Ã^_[]鍌^_[]T4K|$th4m=4t1=44j jh~#"V΋At Pc5 FVC^h4SWVt$>t_w (5 W5 ߅u1F FF1H,4(44404^_[h84SWVQ1u(\$|$84St ;xX^_[USWVt$ $A t]T$h X$9}q L$;N N$|yt_֋T$r9ɋD $A 묋$X1t*;SK|;W O$|_u_u…u1 Džu1׋ $y ^_[]WVt$|$ >u-84Vt;xH|p$x Hȅu^_SWV|$t$u;84Wt'HP9Ή| t@ Ή11^_[USWV\$(t|$l$T$=~4uH 252!ȃt3292|$|$ !@tp\$9ϋ\$(|$}^4U1tHt$ !t Q9y}1I(t(t$=|~4tT$$1=4uȅt^_[]h44=|~4tUWVjW7!t"j]jRPWV je^_]Ã= 4u }4H44d 4Vj5< 3t24jVx 1F=|~4u=4u@11N^USWV(U ]1Nt$ t$tr:tm14PSi( |~41 ~4t)1V54h4 |~4~4ttxq @34 |~4t =~4tj)|~4u=4t494J\$tP1ػ&!Ѓ1ojh#D$Pj@t$>SD$$PL$Qt$Tt$V>L4$u:44 04!ƒt&9L$L$|D$;(4D$,4t$ sjjD$xP$PVt$s3$u [uUD$D$XD$D$\t$t$`D$D$d84T$X/ t$e( t$ Y( \$(T$_CtN4$jjD$xP$Pt$4t$54542$\$(t$t$ uO=\$(t$ 3T$8L$ыT$D$lP$PVt$,t$Ot$' V' T$1H#E t0E t L$PL$THD$$e^_[]Ã=|~4u?h4L$8L$T$D$lP$Pt$t$,t$K$iL$lL$Y+D$ ^4L$^4L$ D$ $T$֋\$D+\$@|$Lj1QQRPq9$}L$+L$D$ D$ $T$։t$t$D+t$@j1QQRPp9$L$};\$;t$D$^4}$D$lt+D$T$LT$<9|aL$ D$ $T$։t$1K։RP6uC9$L$};\$<}1OE$p8^4`[4t$% t$ % }tEL$L$H1USWV8=44045,4(4D$$8u=L4u\$|$t$ E1ɃU QQRPT}D$$x#t$1}D$$VVSPҙOu1HÉD$}44 04ȉT$!Ѓtsu!9t$ƄuY,45(4;t$T$$|@Ut$ 9D$ЉʋD$4$[4@Eh4h84}![4 @M׃tʉL$L$ $L$!D$!ރ 9ЉuЉ!ك4$|$t9D$ | L$t$D$># 4L$U|$|$t$|$L$$L$L$ $|$ L$L$ 1ۋD$D$ЋT$ S|$,WSPSt$(Vt$$< o=,4(4!D$D$ D$(L$,9É T$ ʉu$t$T$ 9„T$u[9T$ |QQPt=1SSt$V蛗։!1BT$|$T$ $T$,t$$44 04!ƒt(|$\$ڃ9ω| |$\$؃SW&VVSWOlj!ЉL$1B|$ t$c|$$L$ 04D$44D$$(4D$ ,4e^_[]1JЋ4$|$9ωL$}@D$ [4 I)|Ɖt$L$ L$4$|$gNjD$D$D$$Qd=L4 USWVt$h84tH>tC\$1EjU1GGGUSxLL4G=L4-5L4t~'V uL4`[4^_[]Wl USWVT$ $\$8D$(L$,L$ƋD$4;t$ @ L$4<1ti 3tb9vM $\$ډD$D$0Ph@ Wt$|$8W $ڋ\$8t$0U43D$@40W3@u $T$t$0h@ 3Pt$83D$ 9w ;D$t6@ƋD$)54jjSt$DPV5454s$^_[]USWV։L$ :JR F$9ljȉT$\$ kCD$UE9׉|7C S$9lj} n;k(uV;$L$lj=ku0;$l$}n;k(u VF $D$kukl$ CD$SC9׉ŋnl$k(}?9l$3$3D$ uTD$8HxCC 9l$C 1S$1 uY$C D$C$|C t3x 3H$ u $H L$H$YL$ iCXK t H K AC ECt,$3hT$3P u xHL$ "CX Kt HKA C@x1҃{ q9uyt't!SWAȅuA;Cu 9uPAXSҋ|$t;Cu;YtqË|$B@;ZtpVt!9AtypVt9Atyy7FP y7FP0t^_[]ËPAXSdSWV΋yt G9|@1Cjj5j,S(G 1GGNtʉ:~HOk,G ^_[USWV0T$ω $] E)ËM)E|$t$T$UT$(U4$t$|$ L$9}ou uCt$x9t t tG1҃Єtt>D><>u^_[]'#1@4Ph̋4zUSWV T$(\$$t$ 1` 3PURS;)ˉ<à uVh$3et$|$u u)u%u!1ɃtsQl 3Ph#dt Dh #I^_[]SWV \$ hSh:## uPth# ^_[xEhSh#o# 4$ٳt t$ɳj Vh#뙿 hl WH5"3t$S jWtH|$Wy[9uR1Vt$74$LjSh#VZWV|$ 5#3j/V(t@jWh!a#QV$b^_1@4PjGÊD$03J 03;@3~{у ts (3Q(3jPh4h#" th4h3B#Pet:j5"3P? f=$3u54Ah(3Qbhh4hJ#bUSWVt$81GWh~"5 4蛯 1-4hn SFD$hܑ4SD$U Wh454葰 tLtFPFuf=$34tjQPV Pkjt$4l$0joD$T$1D$EHM~EHMU9ڃÃ=4uf=|$3u0Iڃ% tM 1f=|$3@ ЈD$P D$ƒ t|f=|$3Qq f=|$3uf=#3tT$j \$Ct,j Cu\$T$f=|$3x댉\$ 넻 $f=#3tD$ @D$ Ph#s`ڃf=$345l$3jW54蘮 4 4 u61=d4#$ |#39uj5$t hʃ#Rjڀ tf=|$3u j ttFPFuj5ÉU6t$jCf=#3t'+\$|$f=|$3##t\#WSP jh454T h4jjc(^_[]USWVP\$D$jP54 f=$31=45l$3jD$P54% Wl9=4ttػ1FU Ph#^KtMVh454- =45l$3VD$P54豬 W9=4u^_[]WVjPhT4hs#% t ^_h4hT4Hrhރ#Xы 4u 4Q[h3B#P`tAf=$34#tz#PQhW(\Wh#V \WhJ#f]Lht jA4USWV$03J 03;@3у  (3Q(3t$hVh:# 1GWh~"5 4ީ WSAWjAhܑ4Sj Wh454 x>jƉ׉Ur~*9u$h(3QaEh#蜊11f=#3tj)RPhʂ# jh454  1h4VW WV<@Wj1@^_[]j54WX1Sj?SW?VVh#j[SRUSWV$03J 03;@3у  (3Q(3t$hVh:# 1GWh~"5 4 WS??Wj4?hܑ4Sj Wh454 x>j%Ɖ׉U&p~*9u$h(3Q`Eh#輈11f=#3tj)RPhʂ# jh454, 1h4VW6 WV\>WjQ>^_[]1W54%j54SgWj >WS>VVh#{YWPUSWVPh#Ӈ1GWj=Wj=9MtDƅtZWn9uh #脇1Vjw=Vjl= ^_[]h3Wjh$ h#Z1Sj>=SV/=-#3j/Ut@SQUJW h3WVh$& hԂ#WWVPjh\$5 4胥 f=#3t%5#3>t=4V/PVWT 1FVhB#54= |$VW54i ?nu5#3h#W ^_VPjPVh# t=(4u.5 $3V7yVh#Wh #P^Vt$j5 4^VtVh#cWh#ƅEjwNWV5,$3t)>t$=4V.PVW? j%j{VhVh%# V"3t$"3jhq$5 4ܣ #3u#3$#3%#3t$#3t$#3f=#3t5$3t$$5$3f=<$3Lf#tڎ"Pn$3t$$3$34$3t$$3j$3t$$$3f=$3Lf#tڎ"P^WV,|$8V54hڎ"W.t! $#4 $ 441GVW54  h4Wj 8^_WV,t$8W54 hڎ"V[.1Ʌ#G OWj54S 8^_V1Vh{t 54 jVhzt 54k ^S\$1u0jP蘣[ESWV|$\$1FtCWPt1^_[fUSWVl$$144l4%PhP!3hg#t$4U1I~1L$$D$=48O>HЃ sX 4HЉ5l4jhP!3hg#t$4UC߃ufH1K$<'t=4뷃EFt=jh"S+ jh"S+ h(#So,D$QPuVt=hv%S?,hc#S),zh(#S,$_=4t=p41@D$<$XD$4=4t=j/S 4k<$$YxD$ P1PhPjPP5t=0 l4L$ !P5t=h#Qzgx4ؔ4|4=t=W&)*ShƗ%h4 1@1H1HD$1@$D$~1HD$$ԏ3)t5|$L$(4hi%VO*t5p4x4ؔ4|4 Vjh5Vj]5VjR5VjG545l4hc#j V\OV4$jh(3N(#w'P_ D$tu1=4 1A111ɣ<$3 $3#3#3=4t $3=x4t5l4 uW6uB=x4u5l4 u3^_[]xVh#Hhw#Ahh#:h#j5l4h#!h΅#h#h># h#h#jh3jj@h#jFh3jhh#jbFfUSWV,|$@h j3W^1ۅ4=x4h4cu.j 1=|4ȍPUT4jU4x3=4u?jP 4teQ4Uh$4WŅ?1GVj2=4t1O,^_[]ÉVQ=|4uL$ @Vj54. 1Vh t 54h Vj=21@4jh4bfWVP=P4t 5L4t$uhh#ƅh#t8/u"3"3# P] Vh"3P [%1'9uQPt$ 'uڃ=l4u%hl4hJ$t$s u l4%hԔ4hV.%t$N u Ԕ4=ؔ4j:h#t$ 1Ʌuǡ4u'>/54jV445Д4x4ؔ4=l4u l4%Ԕ4Y1ɉ ؔ44t=4u4t =p4lj:hn$t$ 1Ʌ 4=x4u64t=ؔ4tP54$1x45Д4j:ha&t$T t #3j:hk&t$3 t $3j:hSN#t$ t "3j:h\#t$ t "3j:h%t$п t #3j:h#t$诿 t #3j:hy#t$莿 t #3j:he#t$m t #3j:h%t$L t <$3j:hv%t$+ t <$3j:hh"t$ t |$3j:hn$t$ t $3j:h۵#t$Ⱦ t|4j:h#t$誾 t $3=4u 4"3=4u 4"3ܔ4tPh",4tPh2"4tPhK&4tPh>%h4h(#t$ u 4h4h݂#t$~ u 4h4ha@#t$Y u 4 545L4P4t%j,V>tA1ɉ54 L4^_Vh# Vh#hm#jttu$Vh#ShÉ#h#RjS?fSWV t$ |$6e3T4yX4\4=`4-h.#P d4VW8=|41h4SW  44%4%4%4fБ4 ܑ44fΑ4ȑ4h4jSn h4h4h4ht jh+ي#9d4t͊#Ph$F 4 x |AEjj54輕 xPj54褕 h#j u h4#j1hH#VWg vtHЃ rt+vhT#Ph4ō HЉl4봡ԏ3)ǃG<13DHu0W5=r$hhg#`h#jSGhWhp4 ?t GG?up4p45l4h#j VD Wj)Wj)Wj)Wj)Vtuhh#hw#jh(3Mh#0"3t t4 h(#=x4t5"3u,u5=x45"3{5"3h#jPh# WV/*ƿ3Ph4#WF VhY#WF jc;=$4th$4htj  j)SWV5$3t>u+t$4t Pk Vƣ4$3h(#Vtsd4hc#Vtah<#VtShX%Vtehv%Vt13Vh#WE WRd4$11ɺ"30 ߈4Bu^_[ñ1WV,|$8V54WVWVX#NF=|4t L$f=$3t D$#$d$d$ wfD$ f=<$3t $Vj548^_h4jj SVPf=#3tjTt$R #30utztD$=d4„u#30u1f=#3#3몈D$< t< u>jV54z f=$3t|$ D#t#Pp`u 2 <#3tu #3tt A8u1f=#3t 3DAt 3DAD$jV54 f=$3D$P;@/h4jj; USWVt$D$ $1=(4h jA%D$1CSj/%h4SW Vh$@h,4UtWD$ h4jj t$j$Uj$=(4uD$ 1;$ȃ^_[]Ët$$4$ԕ3H ԕ3~Е3H Е3hЕ3_eȋL$ < U;t$ KD$ V1FVj5$5(4hD#"nVh,4TSWVP#3\$ x 3t%\4 39u Gt+t' u9tpD$jP54 Yـƀ_r`4^?t@آa4b4 `4a4h`4h$>PW1^_[Pԕ3H ԕ3~Е3H Е3$Е3 t1Ƀ=d4!YXD$_r`4^?<t@ a4b4 `4a4`4SWVT$L$D$=d4ut1<1h41F9uRQP1 yE%8thإ%f^_[h #USL$ \$1B1t 9tA8u[VL$`4tSA #8t6u(^@\VPt`4)ƃuf^?݈@`4^VD$Ph#F==x 3x 3\4Ft#3_r`4^?<t@ a4b4 `4a4h`4h#<_r`4^?<t@ a4b4 `4a4F t*vPh`4h#x<\4~ v 7^ÐWV1F4VW54i VW54虊 ^_USWVt$jV54w  uD$41؍oD<jV54N D$< t r֍,f=#3t4t P u#3D$y1D$h%P>4tD$y#3D$nD$jP54{^_[]1f="3"3USWV1GWjWjB VW~Vjs4fC4CfC 1l$jjSS ~}D$tvjh454 ~]4Bt8StGWuG1GW4U54衇 WUl$54͈ 1f="3"3D$hU54蓈 jO=Ɖ,<=d4  A9rWD$Pj  f=#34tyf="3~g|$_r5,#3Pt. 4YSQ;Y~ڃ tZG9r QR?l$!y- 8u!PWjl$UV <Eh@H<jf=#3t4t Pj0fSWV"3t3"3^tPtF tFFu҉5 $3h#hW+7h3B#W;tRVhWC t4=h4tWh#M8j WtWV7%%#3^_[USWV|$hq%W j Wj=Wt@C@uShX%Wu S6ÉXj?W1t0tO@t8JS~?!tOYt@t QtWh#"7~5="3t,"3Ft = @t t~vuك=4~hD#:e4^_[]SWV΋4C!w\C4؋ 03Q03; @3h(3j %<4 (3Q(3 X4#|>W أ4NI$'Wh#64@4N Q1f~ @403H 03t;@3lh(3j!i;l4v Wh#5 `Wh#54@4N tEPP 4V(3H (3!6h$<54#|4hD#c^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!n#L$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhX%S> uW 1@WT{ljR1^_[SWV"31t8ϻ"3WP t!CtWP t Cuމ^_[USWV׉A tS^؃H$<'n tWU tjPu U WQF tQfB t Xth#a*N 1?!9~ t~ N 9tF N^_[]hɋ#fSWV,1f=#3t hʌ#2|$Wh#3+t%th4#3|$ D4$ $ 4hWͨ uW$ 4h:G#9ō$UhP tʼn-t4=h44hPU w x4uإ%t#P5t4hj#h|4Pu5t4h#p4uG=4typ4Ė4=Ė4tVĖ4hh4Qp4u7J$ p4z$u+hh4Pu,p405t4h#Z:u5t4hɏ#E=l4hj$$ tv 4u$ thI#h4Pu$ thh##4=$ D4h45t4hА#&p4tpp 0h#& h4uG4I#tt9##4P#@t#QPh#e& 4tPh]#N&h4uu+ l40Au*h# l4 v# l4{#U)#hh4u Vh##4=u#5x4tu5t4hɑ#5r5x4uu5t4h# 4tPtu54h#j l4Au$ th#=@u54t4$ th#h1#hq"h00USWVt[ׅtf΋'t#'tVPt%]uWVh#_/ jl4^_[]hГ#hœ#hhݓ#hœ#hh#& PPPh~#h3&l4t@t hh4ЃjFD$t@0h:#.1h+#h #hh#D$t@0hs#.1h+#hf#hh#jD$t@0h#S.1h+#h#hh#4USWVh#&.1Xl&,'Qh%h3%'t*tu6h3jjh#h3jjh#h3jjh##t#FKrh3j 0^_[]USWV39u1Ht$Vhht@P V$PPftхu! $h #-'tc D$Xl&'0tBVؽ ;$ݸ#D$VPh%h3$D$#uh3hB#蛑^_[]fL$t11f3QBuhƕ#h#jTh~#`WVD$ tRt$tX|$t3fPhޕ#k!fPh#T!f1@^_h+#hӕ#j` hƕ#hӕ#jah~#USWV @$ @F~  ߃| RQhӖ#%19ս|*Ձ tRQh#J+ 1 @^_[]û l$ WWSUPt9tmv h<#踜$ =Ut%tv h}#" hjU 1$ PPQsÉ11 Զx$" 9/$ $ =JA|$ hD$ Z|$O< G|$$u)D$L$T$$RQPPT$ L$D$19عPhy#)ch Pv tOPSQhI#)6$!u$!$!j?PQ輁 t$h#K)Q+PQh#$ "u!$ "$ "hPQm t|hߗ#$ QRPh.#]h+#hn#h8Bh{#hn#h91h#hn#h: h#hn#h;h#hn#h<h/#$$j@P$!PI Pt$$"P/$$ Ѷxl$$ $8v+)t)+8uHJRQPl t h٘#Í$  tL$(SUP l$ 1rh$ US{ |4ōPUSJ < ߁WjP N1\$ PPh; tB=NýjPU  9g8t ]8uxS8u2N1 T$ PPS 9ǃu8!8u<\$ShmdvT t*h###Wv h3#v h&#FN1 T$ UUPB ljl$Shmdv 91EUSWV$F~ 1jUWSPn9u!D$=жxt9wwF̓uv h<#A v he#%ST$1uD1Gu<jUPSvm9tu&v h&#h~#-%1^_[]hPv h#%h+#hW#h h{#hW#hh#hW#hh/#USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ PF D$VUPW s DD$st$s 8D$ s <D$tf4$l$4U0'pt_uh ##h%h$h3 0'h#h3 uh3j B&4'D$l$4$sf@8tD4$t$xV+6@S PSV6 \$$Vt$S??K1D$0D$,D$(D$$d$sD$4j@HP襦 st$st$h#'t$h#t$h#t$ h#t$th#L$94't uQhř# 0'hљ#|$4tD$4Phݙ#|$ gvVD$PU# 16D$8uT$Bg)QPR}z th4# "1@^_[]USWVӉ͋t$V' 1Htkt$t$VSU}jtGUet$t$VWUj9uVSWy t'WO  W9 1H^_[]W( USWV$$$|G8-t ԏ3$D$ 1FD$hך#WSj it 1`'%39t9At&9IuJuiu3$tHPh~$ AtPqh#  늡t=A뀃Dtou&t$ mt$dt=$W$uQ 1t$hWV  jSV $FWPP uhw8&VhiP u h#j薕WdT$`'%3l$D$G_HrY7S_hjD$*PA ft$fD$CL$fA37S[hjD$&P ft$fD$f\$ $T$0 T$T7hjR SZft$fD$fD$PSU $T$l$GD$x|$ hhjD$$PN \$ $ shǟ#sh#s h #sh(#zshI#jshl#Zs h#Js$h#:s(hΠ#*sHh#s,h# s0h,#s4hL#s8hf#sXf|$rL$Iw#fw x'L$T$ t$"VRQPh#h#h#jD$f='31'3hjD$$P fD$|$<'3fD$ $T$'3h$]H$L'L$f|$o#th#P!D$=ufD$L$IL$}1|$D$L$ t314/Drt#E9uT$ЃDPha#~|$ujMjPP菚 jt$t$ V! VhiWr u hE#D$(|$ u,$PD$D$,$|$ 1hSW  GG?t$>hSD$$P G$0hSW jl$UWb whȢ#"h(3Wh:it$V uO j. h(3jMWh:iVM u Cw8)|$}#k#P;$rkLPD$$PQ $<1|$Vhբ#? t$kL4t4h'h# h1# 48~1D=P G9uh#O;4 D$4!4"4#4$4%PSWRQt$hG# 4(hu# 444,40k<SWPRQPh#O 4`h#; h#. 4\t h # t h%# h#f:4d6|$1A t$t&u/7t$t nu Qh*# FL9Mt$ $t$qVZP$t$RVZh!#Ph#h3  jaUSWV։1hUS jWS7 sUPPt t'Sh9iPn tVPZĔ^_[]hw8&h#jUSWV׉1hVU jSU踽 }VPP tAUh:iP uGPhI#踆1FSYĐ^_[]hw8&j耊VA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Pha# ^WVhD# f>r1D~Phk& GH9|j]^_WVhD#f f>r91D>Ph*#K  9} j:TG9|h# ^_WV$fGjRW# WhiVt t Đ^_hR#j'fUSWVu }6h&h#jٻ h#VW訐 Hw$'44ԃBu|1PP5t=褅 4불444444너44sjh(3K_4S3=ԏ3=4u.1L$A AAAQj jV =444444ޕ31O=t4$3tch #V@t^=4ukjjVU ƅD$ PVD$(!=<\$yB  ޕ3u1PPV;U Ɖx\$463=t454PL$QT ƅ~E14VPSNS i)u5454t$hT ƿy54h$V 4ޕ31O=\$t$9ȉQ0UL$54u ύD$ PS-54r*Vh 4Vh# 44444VT3h$x 43VdT3hդ#ˋ$B6549vPh#h36 1@4$;Е3t=h #Wt1#=4u3B#PWZ;? \$Е3\$=4 1$ӋFHN~ HVRƒ =4u u u1G1=4up=4u< u7 =4>h#hФ#h(3 43@t>$@$Phˤ#h(3ڃ 43@ t_  =403H 03;@3h(3j$  =4x03H 03;@3h(3j^K:=4,03H 03;@3h(3jMڃ(3H (3$(3H (3^03H 03!;@3h(3jI (3H (3I (3H (3M03H 03%;@3h(3j-0ڃu!(3H (3-3DPuW03H 03;@3~ƒ t(3H (3h(3Rڃ03H 03";@3h(3j^ڃuv(3H (3^?tЃ@Ӌ 03Q03; @3~ ȃ t (3Q(3Vh(3P=F @t54h$| 4f 43@uiЕ3\$t V!(Е3%ܕ3Wh$c| 41;`h(3u 4e^_[]h"jh$fUSWV$$0Eh#j趲 11E1D$D$D$D$$׉jh (3h#$V{Q~Hw@$'ىl$ƒKtNHtLtIP11듃Ru>ىl$넉ىl$wىl$jt=$ىY1ɉPXuG ԏ3$T:-u"j9uzuI ԏ3 u ԏ3)t u <$u|$uM1ۋD$Ã<$D$ P%tD$ #$4u9>WuTWhK#D$u5t뢍D$PW`u!Whe#Mh#j}$1 |$ $jSVI? u hS&PH1u8V1CHHf wy$8'|$uhUnHÅu뼋ss 耳 PVh:G# |$u.jSUT ss I PVh:G# 1F $tCPpQ7|$t KP;AmPsT$Z|$Osh$x1F7h3S&j|*PPhv#h3jofUSWV$$61h#UM -4- 4-$4-(41Ch#VW e'H wu$l'(4- 4-$4Ńo'fil<4뙃prvD4oa 4044%$4- 4-(47 4-$4-(4,4 44484048444@4u ԏ3)ǃ=@44u-tX1Ƀ=(4=$4tL$H=(4=$4= 4= 4tʉT$4H4j菌L4P职t$lVUhH(3 9rUhj#\hH(3 H(3 @(3QT$/u>t$|9A@(3A @(3I(3vy/th#h&#jyt$ D(3Dhu j= 4u$PhH(3g[$PhH(3[u@68uT\=@4u=4t@$4 (4t3D$ P6 [1#$=@txUhH(3D$ P6Z[u6h$jx#D$=@u4 @41ۉ  t1ۀ|$/uhH(3h|#.t9Ur|/u (IHr IH9/touɉt$P P4USWVT$juQt9 PBD$1t$CHfw?$'ss ͭ PVt$ h:G# Psh#>|$(5D(3C,H(3)=|5TShH(3h# t$V7B1Ga{DuO|$u C(D$?Cj/D$ Pt L$)@L$D$hR#QT$CS(L$)ʀ</t ~/t/FD$щT$H(3)rPhH(3hѦ#t$PV(s L$@(3@(3=I(3vx/u H@(3= 4tD$PhH(3XD$PhH(3/XT$KP3Qt$31 u@T$(3Qt$$3q u.shH(3h#[ CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shH(3h# 1Gt$#KPqt$1BD$ $'=4L$ QP T$ 4 @4sHtbffM T4QT4T$ T4t$/D$ !=@8fushL#jSt$ VK 1G)=4tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=04t$tjQ\T4H T4Åc1G18uFV<e^_[]hʧ#h§#h6h#hݧ#h?h#Y7h$h3S&jrhH(3fWVt$$D$(H0JH(x,z H4x8J z@wUSWV\$|$OǴ OOtQPS= uG1CQPhH(3< t9|18thH(3hj#g1F#GGtPSj=G1PhH(3<thH(3ht#Rg1Ft\=,4uSolt US2= UhH(3=u%8-ulthH(3h~#f1FuWhH(3t1F^_[]WV$ hWvy8 t,$t'hH(3x thH(3h>#"vh1#hH(3WP:tWhI#Nf1@^_Ã=04tjvP(1V|$ thH(3 t hH(3h>#"t$vhH(3:thH(3hU#e1@^Ã=04t jV1V|$ thH(3 t hH(3h>#(t$v$v vhH(3}thH(3h`#ce1@^Ã=04t jVF1PPh#h3[jUSWV|$j/Sحt@Ë$hg&SuGh#WVp Xԏ3)ƃHt49j1h7#WV@p e~!r8$'l5˃K~3LtgP\5믃st\vtcwh5듃FuXX5`5d5h5md5`5Z\5Np5Bt56uXԏ3)ފ p54 -u5X5u=X5ud5u`5h5,ttu'MUj MG%jPt=l5u4PVIu$#D$=uYjPVHuB#D$=@tM19t<1jA ŋ9uU{Vh$jf PPh#h3jNUSWV׉΀=p5tj}$hVS5t =w6Sst)$ PQh%WSR9?A 5!=\5u4!L$QVЃu#D$=@`Vh$a1C؍e^_[]Í\$SWHu#D$=@=l5u"SWVGu#D$=@=p5h5>/uD$PVGB#X$hSWr W7pt?$ VPh%hWD$PWF[#t VQ`D$PWGÅp5WVE/PVNt@\$L$/PW.t@L$ Q\$Su)D$ )=|\$=`5u=d5h(3{Wh#h3 ԕ3H ԕ3~Е3H Е3hЕ3薻É؃t9 t4ԕ3H ԕ3~Е3H Е3hЕ3Vƒ߃Y=X5u#D$=@uWwWu8=p5u WV3\5 PWQVQ3tW#1ۀ=t5$u5VPWh#Vh3jj h#ە9D$t$QVP躜 Ƅ fDŽ$.$$PQ>D\$4$9|$ t#t$WPg$ D$Ƅ fDŽ$.$PQC$3$$3$ $3$$3$  WVhg# fD$L$TTPQ7ËD$L$TTPQUSWVD$L$pPF4yP_49ËN8o8}1@61J9})G<9F<|D$TL$TQP輹^_[]USWVD$L$pPF4yP_49ËN8o8}1H61B9})G<9F<|D$TL$TQPV^_[]USWVD$L$pPF(yP_(9ËN,o,}1@61J9})G09F0|D$TL$TQP^_[]USWVD$L$pPF(yP_(9ËN,o,}1H61B9})G09F0|D$TL$TQP芸^_[]USWVD$L$pPF@yP_@9ËNDoD}1@61J9})GH9FH|D$TL$TQP$^_[]USWVD$L$pPF@yP_@9ËNDoD}1H61B9})GH9FH|D$TL$TQP辷^_[]USWVL$D$QPrXR\xP_X\9}1@9}1HTTQPs^_[]USWVD$L$PPrXR\yP_X\9}1H9}1@TTQP(^_[]USWV |$87h#j j%t7D$Phht@jM uD$tL,3555ou 5t$41۽hn#WVe HσG$'51515555155555낃wȫ5̫5^ԫ5Oܫ5@51x5"55@155555555 5=5t 55ȫ5̫51V5Gī5ȫ51C+515555551551@Ы5515555ث5551M55rx5c55J15554515555ԏ3D$=5u=5u =5thT#rtP!L,3=5u 55 5L$$ ȉD$5 55 x5L$D$ ы5 T$ L$u1 T$ =5t ŋ$u|$u|$ t+uhī5j@@ī5 ī5=5x5tL$t*t,uw kL$t;t=u^ R= K =5u==5 t/T ($ !" =5u=5V t 5)θ0 =5u/] =5u! =5u=5A t 5t1AT,3U4|5 ^_[]7Ph#h3 j}USWV΋\$=5 t1PSR ~jPS01ɉ=5tW! L݉t$=5D$W#ÉL$ CHHf$('ks PUh:G#E |5{Dt{T.u =5tw=ԫ5uL=5u%shϪ#?1TSh#L|$|shЪ#5VWB/ʼnى=5ut jSW. W"Å0W 08u ^_[]jh3S&jVWVD$ qH1ftYT$zHftIf t$f tf9t=5uyDt,RQ51f Duf u RQ^_fu1@fu1HUSWVL$d5D$ 5u =5D$D$TT$PD$@1D$<D$ D$D$D$8D$4D$`D$XD$D$,D$D$ 111FHf tfuPl$ߍ^Tv t$P薋 PSl$$h:G#t$X 1@F F|5Z|$dt~T.u-=5t"fu=5uFF  F,9w|$t$L\$D$\^PKdՋS`9׉ȉL$(L$T$$T$0|l$|$0C {D$HT$ 9‹L$ȉ|$DrL$DT$H{D$|$9wD${\KXl$89͋T$4|׉L$8C@ %=`|$4u~C T$9ыl$щL$  ȋL$,9ȋ|$ȉD$,1@D$XL$(T$$CT$L$ L$H\$Dl$L$L$T$L$D$D$L$(T$$l$|$=5t-T$$L$(=Ы5t-sh [&j $W$D$\l$t$0Kjs薦Džt=Ы5tsh [&j $UjsΧŅtщ|$W+‹L$@D$9ʉT$@l$ U ʼnD$<9L$<=ث5t/h #sl D$TPҩT$ 9щL$ 1|$PH^  à t$P Ct$ P=ث5t +Cl$TUPUpn ^D$\L$(T$$t$0l$D$`t$|$H|$ |$Dl$l$l$߉T$L$ŋt$Lv;D$`L$PDL$hD$tl$x|$D$D$lD$D$p=ȫ5tD$|t$ |$ nī5ʃQPRW[$RPh"jVVaD$|=̫5t$ |$ tHVUUUȉD$|$D$<$$SWhS$VUFU$t$h [&VU#Uڧ$=ȫ5tDŽ$Mt$4t$ 03J 03;@3~у t (3Q(3Guh(3Q=5tXD>03J 03;@3~!у t (3Q(3Gu7h(3QxL$D$ ρÃ5T$95}`;L$}XD>03J 03;@3~!у t (3Q(3Guh(3Q03H 03;@3h(3j (3H (3 1D>03J 03;@3~!у t (3Q(3Guh(3QQ03H 03;@3h(3j &(3H (3 e^_[]SWV΃=ܫ5t vrhC%c1TVO^_[SWV΃=ܫ5t vhC%1TV^_[Ã=ܫ5tATPqh% ÃTQh$Í` f w5$D'03H 03;@3h(3j@I/03H 03;@3h(3j*03H 03;@3h(3j=k03H 03;@3h(3j%D03H 03w;@3oh(3j|!03H 03g;@3_h(3j/;1@á(3H (3@(3H (3=֡(3H (3%á(3H (3|밡(3H (3/1á(3H (3*USWVl$(}=5tE G=5t=ȫ5t(DG51 5Í4^69L,3} ^_[]{E ;\,3~*P55kZ tM \,3554FMt%$Q  Qt $ B$Iu$ L,3șƉșD$$t$D$ D$|$1ۋt$=ȫ5t( 5 U tt$ ;4$}Z;D$}El$)š03H 03;@3h(3j '(3H (3 MuC;\$r03H 03~(3H (3 h(3j D$@D$;D$ ^_[]jk>LUSWVt$~=5tF G=5t=ȫ5t(G51 5Í,C L,3-9} ^_[][Gșljș|$$.1E  E;|$|603H 03~(3H (3 h(3j 1V =ȫ5t(41;$}D$)á03H 03;@3h(3j k(3H (3 KuGm=03H 03~(3H (3 h(3j ^_[]USWV|$=5t_ C1ۃ=5t=ȫ5t(C=571F  F03H 03;@3h(3j,|(3H (3, +N,03P03; L,3} 0;@3(h(3j ,;~&(3H (3 "(3H (3 h(3j 1W =ȫ5t(4_ŋv03H 03~(3H (3 h(3j ^_[]fSWV|$5Wt pSPJ t81PWVo Vh$oVZ ^_[h[#Whj#jy>USWV$U蒕4(F$$1 |$1 9$)덄$PSUD$Pl tXǃt-tat$"o ?tL$T$d$.?T$O$E1 $ ;<3r9vL$?T$$$^_[]SWV ΉRQSwl 1t4u t|uHth(3PjSpt Veo lj ^_[fUSWV$$31h#Wo WTO%$ D$D$ hi%SVD mu05t=ItChP$WX 뼃pu D$ 뭃u ԏ3,uk5t=hK#j}<#D$=@u.$VtPG 9r*th#j9|WP蚰 ty/t AƄ/@L$M$D$S蕐|/uH9tx/@tj/SN~ޅt@V\L$rSh#1A $'@PVt$ C ٍ$Ct1@$Mg4$̯gPPh#h3&j謯 5USWV։π=5ujVNt~VW# t9w8uR\$@SVt{SW9Wh$1ۀ=5VWh" VWh#D4 w=5u=jW[NuWh#H#D$H=@VK=5/jVND$@PVjWMuD$1Pt$LD$2x #t%D$1Pt$\茊1Pt$`VPSt$D$BPh#h3}#D$H=u}1PPW[ t$HhV? \$D$$5(5VCVhݫ#21C؍e^_[]ÉVh#h3˸ ԕ3H ԕ3~Е3H Е3hЕ3YÃtH tC ԕ3I ԕ3~Е3PЕ3hЕ3 ԕ3 tuÃ߉1ۃYM@Vh$1'$$5SjA (5t$|$SPt$  Å11S5(5t$H 9x߉= 5t{\$(t$,l$( &$$L$$D$ l$ |$T$ fT$l$\$l$T$ 5RQPVSt$(t$(h#h35$5$55(5t$  Å6|$W\$S1t$uVh #0SD$hL$l$JD$pBD$tB D$xBD$|BRWtVh#[0t$\t$\W  8tVh#*0#D$HD$Ht$\$ \$D$t$Ph$/VtVh#/t$S1V/5$5t$t$ЋD$HPW|tVh#z/$Wzt.8-t$Vh'#G/ WNtV|$Wt Wh#H1ۀ=5DVt$SWVP׉IjWP\ t$t-hB#ha# hB#hU#.1@^_[%tPhB#h#Լ IjWP t$th#h#%tPh#1돸J#=5uP#B#jWVh&Ph"SGSh$-jo#jVh&h#h"WWUSWV8`,3t P`,31054585<5@5503it$L$p'hjV `,3Vh#0jG`,3hhVA `,3<5hjV `,3蛗Vh1#0jͳD5u,31`,3D5d,31t~H5ttja`,3D5l,31@5`,3D5l,31@DVh#0jE`,3tH5tj`,3 X6tQ`,3hL5PsxCT5%= ts=`=@5D5hc#j許 Y5D5hQ#0j膲5`,3w`,3<51HPhm8@5`,3Xx 1ɅA @5-555<5ˋ 03uW6W6,3v$'=W6=W6>1jSS5`,3w!ƒuh8f@5-555 a1H 0303=5Gt =}r t~=W6W6q˃u#=W6tPWUV ~jWUV tw߿(=W6u W6~~=,3|,318^_[]111RSWV։ωSC.,3D$t,t\$W3C4$t$ ctjt$B!a#1@jt$Bڵ#1PWB4$t$jSVV*x^_[h# h˵#h޵#j`,VP=`,3x=X6 Y6t}=@5ut= Y6tDX6HQP~'Q &514585$Pj E5@Y6h#5X6 5X6nd=<5uKhL55`,3nu4#T5=u"5 5u5D5<5=03w=X6t,3~ jP5`,3f,3~jQP X6 Y6t4=@5u+5X6hM%#f Y65X6c`,3=45u 85tP14585X6t,3 X6 Y6t'= Y6tGX6HQP~Q 5Pj 踯 Y6X6tZ5@Y6hĭ#uC5X6 W6W6 u W6W6jhQPRPhɭ#V;1V5X6b55^USWV=03(3t3D$W%O+ج5 ܬ5 u1@1ɉ$L$=X603\$5W65W6h#hS腧<$t$W5W65W6$h#RPWh#hVG$VShz#hW+}WPW}tf=5t]t$5`55\5h#hVߦ$Vh5h#hW迦WvPWj* 03u_55<$t$WjV~$h$RPWh#hSe$S]Vh#hPFX6D$=,3O5D$ #D$5W65W6VSP$5W65W6VSPW6 W6 W6W64$t$VPQR}$h#RPVh#hS蘥$S]$QL$Qt$Wt$$hô#hPd$t$V~PVj "$PW5@Y6h:G#t$ e^_[]V~=@5u(=|,3~h~V5`,3 |,3~^VȬ51=@5uE1jVV5`,3oxRP5`,3z y1h֭#0jd 1N^Ã=@5uh#jI&1=05u5@Y65W6h(#j!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSUg ~)t^_[]WV5|,3=@5t$t$5`,3d ƃu*~345;5W6tc5W6tU05L~ 45?5|,3x5,3h#j, 1ۋ5,3hf#0j^_USWVP5|,3|$l$1ۡ`,3$WUt$o ƅ~)tދD$9uȬ545!|,3@5Hs-58 uc1h#Vh5|,3:~\%tS1jPP5`,3_mx})RP5`,3x yPbȊ8tD辊8t:贊8t0Ty:褊8t 蚊8u |,31脊8Eu |,3xt Ȭ5145=Ȭ5uhҮ#j腥`tx>X6Ht)t h`#5,3h#jL 1%h*#j5,3h#0j^_[]USWV1N=̬5=|,3 03uh#j٤45<u85-@5sg4551jWW5`,3kxXͽuWURP荦)jWU5`,3kyQu t#45@45=|,3:h#Ff@Phm5`,3k x|,3h#j1^_[]USWV \$$|$ l$(1uu5|,3@51jVV5`,3jx\D$ljT$Ӄ=@5D$559L$ujRP5`,3]jx+D$T$EU,=@5u#ȇh%#0j |,31N ^_[]USWV~=|,3$(~$$~@5t)hU#j蔢I1u)1ɍ|$h~W5`,3G 0|$fGWhm5`,3Fi fD$D$Whm5`,3i \$h~S5`,3 $h~S5`,3 GfD$D$Whm5`,3h |,3t1<$uzfD$D$Whm5`,3ph f $ W611F$$~jQUR"ы$ʉD$ ʋ$$~) h#b1F|?1jPP5`,3 hxg)y11=,3|!h#11Fs1och#RjRP5`,3g1yK?hְ#.3h#"'h#h<# hf#0jB 1N5|,3~^_[]fD$D$ D$Shm5`,3g y躄t$h'#誄t$h#0j٠SWV VhDY6j yohL#0j袠 jVj yChf#0jv 1N=̬5Ȭ5=Ԭ5=Y6u5@Y6h#趟=D5hl,3Wuhd,3Wuo @5aX#t# ,3ڱ#t #QWPA S8 03J#tB#P5@Y6ho#h#h#h#ݞ|$h Wf|$.D$tL|$uErYtSu6yu#5D55D5h5#sWh#T5@Y6ho#Ah#4h#'h#<=Y6thu#j{5,3h#5@Y6h#ҝhٳ#ŝ|$h Wf|$.|$t+D$5..L$f tWq= r@h&# h#h#Y5@Y6h#Fhٳ#9sWy\Wh_#̬5|,35@Y6h# Y6 ^_[hS#МЬ5t P36 W$Ь5t D51̬5|,3hE#j|503mtt$11Hfhh5Uxth5p51Th#0j臜 1Ht$f%h,#0jX 1HVt$VE/uVh@#0j*^\SWV|$$Wƃu[1~tHNtt 9 tu/PWt#D$=@t f1N|^_[USWV1FX6PH{X6P kjuƉ+㡔5Hw> X6SPh5Q@ 5$ 5L$QPh5\h5Cjuh5[jh5^uH=5/u+-Bu"5P]nPh55P)! h(3WVh5M<43@ub55 5 5QP.t X6P(jhDY6j xsZ1e^_[]}hU#0jՙ USWV (-3x&,-3kL,39|׋yM1II151PQÅy19}WDu=03h#j.hh5OÅy1ۉ9|(-3x(,-3kLSh5,3y݅u=03teh#j迗51E$sVh55PH )؍51Ehܸ#ji1IkFL,3X6Sh5#1ɉ^_[]USWV D$X6xGD$5$1F15SQ291CX6h5h5P$ X6Qu*D$PUh5Q8 5tu=03h#j耖t$h5h5% $W1CttUtB:x9u=03tFh=#j,Wh5Q19uh#j1H ^_[]h#th5Q<t 51hc#USWV1CX6PHX6P yjƉ׃=$X6t/503tzhf#0j4 e=X6t Rrx7t$t4X6P(jhDY6j lzbV1ۉ؍e^_[]Ít$\$D$5Hw5 X6VPh5Q@ 5D$ 5L$ h5kWeh5duy=X6tSh5t^X6 Y6tSh5uh5Ujh5Xt@h5Em55 5 5QP=5/u+?<u"5PohPh55P; Y6 Y6tSh5 X6tpX6|NPWt$h5)6Q=X6Y6D$L;85D$P<5Ph58 Y65t@t=4Y6u Pl=03t15Hr@tZ tUh5l'9D$X;D5D$\H5?uD$Ph5$Ã|$=4Y6ut$h5ÅX6VSh5P@ =4Y6uSh5/!؃=X6\$C= Y66D$X6HQPQ Y6=Y6D$L;85D$P<555 5 5QPDy h5j=X6\$^= Y6QX6HQPQ D$L;85D$P<5D$X;D5D$\H5OPj ̓ Y6D$u5D$ 5L$ QPp5x5035X6F55 5 5QPh5ji\$=D$L;85D$P<5Pj  Y6USWVj/h5jR1Uh5kit>55h5USe /tOGh5WUh5h#jjO1N,K|/t1Nuh5h{#jj^_[]SWV=X601F X6t9t71hi#jێmQHbX6P R=X6t i<X6x t `m#X6 Y6t#5@Y6h#5X6聎  Y6ujh5^t(55 5 5QPu1=X6th5hxuth5lyX6P(ljgSW, xaX6 Y6t&= Y6t5X6hM%#2 Y61G*ƃuejhDY6jk ^_[USWV $X6xu d?*1FX6P,X6@0D$ jD$T$=X6jSh59]jh5Q$=X6th5~gh5+th52d5 w's1PP55F $jh5Pƀ=5/u+4u"5P`Ph55P =0Y6t4$h5Z' X6t:X6|Pt$t$h5s.Ph50 Y65h5T$t8=X6= Y6X6HQP~dQ cX6L$Qt$5SPD ƉPS?&=X6tc= Y6tZX6HQP~3Q 2Pj ڍ Y6Ph5%dPj 賍 Y6D$L$ʃ|QP  55ʃ|QPxnh5*1C@TPh5Z%n55hL#0jh58ch5)t X6P4 jhDY6j =X6tn)11Fe^_[]þ5PV$Vb뙉Ph5$뇃=X6t cxIxX6PHx11@USWV $$h 58Y6S = u$ /,4ŏ4/t EƄ4/FED$P58Y6h#D$=@`1Gxv%xmlxd=X6t exRh5!(ttjhDY6j% Gm'158Y6hĶ#j 1GĐ ^_[]l58Y6h#0j҈58Y6h #뻸 )D$ )D$$h5 XX6 Y6tV1=5/5t$PU3 ;D$vh5h+#jN _D$PSE5WT&W^jh5Kt'h5K`h5&'VSh5NR xơY6 Y6tD$Ph5I=X6t5X6h5+ Y65=X6tEh5C=X6Y6D$D;85D$H<5h5{5Ht 1PP55 $jh5#Pt$h5 Wh5D$P;D5D$TH57wD$ Ph5;Y6tk=Y6tbD$D;85D$H<5Nh5h5^^D$D;85D$H<5D$P;D5D$TH5hi55hL#0j蕅P5WWWh5!Ph5=X6e= Y6XX6HQP~ Q Pj G Y6 D$D;85D$H<5UfW65W6u X6@W6=~| h~Ph#thPh8#j蜃1HãW6,35D5y x1W6W6 W6W6ʉW6 W6W65=03u=W6t4=~| h~Phi#thPh#j1H5D5 y xᡠW6W6W6W61W6W6W65~,3W6USWV=X6thŹ#j艂1I^_[]Ã=W6W6,3uW61IxՋ=W6+=W6|$\$5,3UVSWJ)9|11UV$)݃W6|JW6 ,3W6~H5W6PW6W6;W6r֋ W6 ,3W6W61)ȉQPx[W6Ɖ5W6 ,3ȣW6)=W6W6 W61W6W6031h#jWV1N=,3=03uh(#jy1W6W65,35W6Z1,3~9} G{u'Ph]#j~ xI1=W6=W65,35W6~ W6 W6W6W6 W61^_ËD$L$W6)ʉW6QPR!8 USWVu ]1D$ D$ D$W6 W6)ȉ9؉| W6)։ W6QPVS謁)ЍT$RPQ 1ID$L$ )W6 W6|~ W6W6)ЅqxUtX W6W6D$9ؿ|‰W6)ظ|D$L$ 1H1@D$D$e^_[]V1=W65,35W6~# W6 W6W6 W6W6V1xC=X6t/x&5W65W65,35W6~W61 X61H^VW6;W6v*5W6)QjP^ 5W65,3^USWVt$W6 W6ƒ|]; W6W6}O1h#W}=W6=W6$-W6,3 ( W69)1 -W61ۡ,31PUK;,3tS1W6W6SW6 ,3W69)QP륉W6 W6Nj-W6S5W6U4 +W6,3)USW6W6W6 )VQS4 W6X6HttX61O1^_[]É-W6USWVP\$1~cl$W6$5W6<$)"5,33x3ǡW6$5W69|WUV4 5W6)11H^_[]USWVPD$~Z\$ W6 $5W6ŋ<$)Dž~9W6$5W69|WVS3 5W6)D$^_[]ËD$)USWV\$ l$؃|~W6D$=W6t$)#5,34x\ơW6D$=W619|VQWD$ [ =W6)Éظ|$1H$$^_[]USWV$  $x$|$D$|= Y6t7P$t;y#_$ hQ#0j.{$|r W61NW6)ȅ5,3  W69غ|PQ$ ~|)à W6 W6ظ| uXP$:$3D$8$3L$4 $ h#jUy hx$ h#j5y L]$ h#0j z']$ hQ#0jy111o^_[]USWV$$x$|$$D$x-D$PQ9t">]4$h#0jny L$|L$1$p0L$1W6 W6)ȅ\$^ W69|4$ST$ RT$RPQ$P~R|$ =0Y6 W6tP;CJ W6)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=0Y6t% u!$9$t4$h #jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$= Y6$4t1PW7y#$[hQ#0jQw1HD$sD$$P$<R74$tZVh#0jw $l$ l$\$ 5,35W6W lj\$11ËD$ 9D$D$D$W6}$4$t$ L$ QL$,QWP$PWP$@ ى9u15,35W6$<2 ljޅz11 ͉$03x$3|$ uRD$$P$8%6$3D$\$3L$X $0<$\$t*Wh#<$WhX#jt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]Y$0h#0j8u1K<$X<$W$4h3#0j uUSWV|$7t6|>/u/1N=W6MWh#js W6.|$tjh Wƿ V $=W6W6_ShW#VPo$TƅE<$8$S x<ShW#P$5o$ywW0=$Y6t5X6e)$ha#Vjs15W6$ $iWQh@#0js1N^_[ÉSUSWV|$?/tGj/P~"ƳUWu/Fj/VP"ƅuhW=,Y6t$$W jWy3UW%u%D$ PW)jUPWV/Fj/V!1ۅA4t*PWIt1K#D$1=@ۉ؃|^_[]/WVD$t$ $P+yu~UWhr#0j r$tDP֏yU$h#0jq$ 1$W6^_USWVD$Et$$^߅tP芽y>UWhr#0jpq=,Y6t<$8$W 1 (Y6tt)$($u7=W6uj0W6P"W6W6!UW03 03t%1PPL$H$X$T$W$tJSWy!WTSWh#0jpW^$q 1$W6^_[]WVb1uA|$ t$t$W< t(5X6%SWh#0jp1N^_Vt$#D$ PVt%5X6a%SVh4#0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=03t =03D$PVtSVhϽ#0jKo_=03u&D$DL$HL$$Mbl$L‰T$=03u'D$PL$TL$D$ Mbl$X‰T$WVt6R8Nu} u&WVurRVh#0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVt%#D$=@uVh#jm 1HjW |^_[USWV׉L$]D$PSt6St$蚻thnQ0wwS tՃ} tL1@_1=X6uTG3D$ 3L$ uKG3D$O 3L$ u9t$h#jUl 1St$h#Vj6m1He^_[]ø#D$=@u%hG%SBtS0S̊} DPSh #0jl댋D$$u1@Ë $jPUWV}wPV1@xN=X6t1A$$3L$ $3$ u*0$3L$,$3T$ uVh#j%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $'5@Y6h#2Auu=Y6tlD$PUuZD$ !=uHhWU ƄD$PWuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PUUt$覷 4$U[iNL$ t uu$UFD$y)Q8=$Y6us<$8$U xZL$ A$Nt$Uh#0j3j1H=,Y6t2<$8$U Uha#Wji1ɡ(Y6tt1Ƀ$ !($t($t$$5@Y6hĭ#/?jUxN1=(Y6=03=03Uhv#UhD#j7h 1OD$PUlx=1$ ?#D$ PU1@=(Y6u;L$ ($/Lt$h#0jh$ PU1@Pt$6UK031 03t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PW1x1K=X6t މ|^_[]ø#D$=@u5hG%W=1EtXWyĉ#$t W觅y5X65#hKWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5Y6Y6 Y6Y6L$T$tI AQPF DUVP 9t_L$ xZjPUQ,ҋT$0y@oEP Džt<$\$MQVPG D$8+$T$0)+|$$>ha#jJe*It$8ho#It$8hQ#0jf1O ^_[]SWV1|$tQ\$1OjWWS,xjhW6Sx y%o##\$|ISV0je^_[Vt$ xFP蕱=X6t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$( ~H111Ã1T |A9uV$P$(软 ǀ$1111틴$(3x$3|$ uUP$($xLX$3D$8T$3L$4 uF1VVV$(*xE$($\h#GhQ#.h#j%c #G$(hԾ#0jc1N|(^_[]V=Y6tW6=Y6tW6=Y6t@W6=W6uh  W6t01x&=X6tDyh7#jhb1N^WV X6tPȩ1 X6X61NW6t X6tqAX6uj1ԕ3H ԕ3~Е3H Е3hЕ37tN;4-3u1tB W69G= |+X6xxW6 PW1t-W68j5W6hW6謠 X6&1^_SWV|$tR?tMj tSƋ\$W 6H~ </u>ۉ^F=W6t%W6p!hf#j`1Hh#5W65W61^_[áX6t@=X6tX6= Y6u0=X6t'D$$uX6tjP5 X6襵 WV=X6tB5W6t;11G~u)uh#jA`6h$h3H` vu^_USWV =X6u%X61N X6u X6}$ $ $L$PpX6t#HHf w=$'ph+##"phտ#je_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p赪 C X6qh?#0 ph#p j_e=X6t\@PL$QL$ Qpp p09Bx8X6jjt$t$t$t$ph#p j[_ X61N1 $'LJ$Ƅ  LJ$LJ$=X6twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G X6 VqP2  X6VqP 5@Y6hĭ#31uX6@e^_[]fUSWVT\$tl$h=X6P($޷T$L$X$1V8$-V<$/##t4$tVjQjRD$PhY#S\ $u2@$%  RPhk#Uh$^|$x$hv#S4\EPD$Ph%S\$Hs Uh}#u# Uh"S[ S>X^_[]Sj ~fUSWV@L$E\$CD$PS{3j9#|#L$QPj@t$V6ue^_[]SWVT|$dT$t$X$hS($WVSh#t[d^_[SWVt$F=u1H|$Pt6t)G\$QjPSVSGu܃^_[Ã^_[USWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]VX6~1F1uX6h#j9W^ÐSWVL$D$t$|$t=X6tX6tt\^_[}\1KZX6teSPti:tdx:ԏ39}j t=@ԏ3sPVW3 hVX6:-u/X6ÈX6nX6X6`S6h#ԏ3=S6h#h3PV?^_[f1Ã=X6u1áX60h#jV X6t"H X6p0h#h3U5@Y6h#`,u_sUSWVd|$|j/7[@Y6t@l$x@Y6h#PI@Y6#1CX6Y6D$ D$1D$$jh-3h#WUHЃJw$d ';t$$@$ 't=H5묡03t 03X603r03t c03P=03#\$X6! t=kW6 W6H5C#H5E%,3Y65t=R03t 0303\$Y6tD503eX6X6LD503=Y6.X6 Pt$ * NL$ t= X6$LFD503D503D503D503X6t= X6H5ܥ$Y6q5t=[Z 03@K 038t=8-u xD5D$ =X6u ,Y6(Y60303H5`#X603$X65t=WO X6Y6sTY6d03U,Y6X6?D51@D$ )03 L$ ƒ ʺ3t(3 ԏ3X6ƒu 9u , l$D$kL,3X6 X6 @Y6"1$jh8-3h#WU/~HЃJS$!'4-3ƍHw$!'TY6뫅!t=H503Y6|H5ܥ$mX6@XX6ˀCX61H5`#"X6 t=@Ƀl~mtKotRpd(Y6SatDeJ1A ,Y6 (Y6 03 03 03"03,Y6 03@{pet=D5SHX63 t= W6W61ɉ5t="]X6Y6t=L$hْ jLjh,3Q DX6bl 5t=Vh(#$Vڒ,34Y6 Y6@5t= i@Y6Ԭ5X6H5E%Y65t=9i t=E W6NY64Y6 $! t= }X6Y65t= =X6@X6 ,3%=03X6(3 0akG1A11|$<$t4Y6D$tGNutNj]]h-#SG"1t[hR#S3"uE X6X6j5 X6S^ 1AL$y#$]1 X6<$D$h #S!l$\$th3B#SKDžu Е31 ðt5hR#Si!u3X6S I 1urL$tP؅uAJjhU#Sb  uPX6D$t t Pd CPىQK ؉D$1ES#jt$ S 1AL$"1ED$\$t t P h #S t Wd=X6<$l$S|$; X6,031ɺ G1Fmفt#u41A 003<1A 003!5031ɺ.1!# $ 4u X6,3=rnFr0s9-ԏ3D8Y6PMԏ39}j4NxPԏ3@ԏ3,3ԏ39 1VV4b xԏ3@ԏ39| Qh#j?H 1FPh#V(H V<5t=h#h"#jHj<5t=hd#hh{#5t=h3#jG 3VhI#%5,3WVG 5,3WVG VhH%ô5t=h#0h#jjG!j<mh#jCGt$h#jjP$t,(XN8@tUjP$yFD$8Uh-#We1D$h.D$1$h #U2th3B#UGDžu JЕ3tkðtAhR#StjhU#S tj1ujSðuh #Ut Wo=X6UhY#l$}$l$hR#WI]tjWB\$rt D$W,3|$ td^_[]áD5t8uh@" D5t8uD5E"Uh0#j E USWV|$C%UW?mUVNJ00ht$跩tAtZ/UVlUWA488ht$vuI)t$h~#0jxE1H1^_[]áX6t H X6h3h#膱j8WV31FWVhhp#AWVhh#-WVhh#WVhh#V8USWVPˉjPQ*  փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9QA$1>tj,VÅtj=Vtmj tdAE0H@X6=X6t X6sX6uh#j6B1O^_[]h"#hK#h"#j B4$ ɋD$L$01WV5@Y6hb#h3A t(ο#Ph)$h3A !uء3H 3~3H 3 h3j D^_SWVPωPQ`t4Ƌ$| tC$S t'ǍCPVWC DG X6 X61^_[USWV$t%t_݊M\tS8uEEh<#j@Ej UEƃjSV% t3l$hUVPWUh#j\@SO $EE<\t:uCCU $AStRC1fGt,PtStgtstp1B ы$J@u $A=X6tZX6HVVo4$u WhU#ji? 1H^_[]V;VC hs# X6 X61V4$ Wh#USWV\$tK;tFjk tLNjl$1pSG woD$G95X6t%X6x!h#j>1Nh#=X6=X6^_[]WV5X6t;11GFu)uh4#j^>6h$h3e> vu^_USWVX61 l$$=X6Kt(=X6t!9t)@tB9uKKt8?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=X6tGtlD$@1G8D$@1D$\1GEt$ h#j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh#j59tNjE|$tDD$@t:$t$PVhV#h34Vh@#h34 $t+Et$h PVe 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh#j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7NX63WVVj螺uD$L$ L$$VjVjuuD$L$ L$$VjVjLuD$L$ L$$VjVj#uD$L$ L$$Vjh# y|$ujWj& WVj y|$ujWj WVj y|$ujWj WVj y|$ujWj TWVj y|$ujWjv (D$,WVj Z  WVjF 0=03th#0jq1 X6e^_[]h#jY0 he#覕-=H5u4!=03u03ҦtX6h#jӭVt$1@ Y6X6#t#QP/W6t PN1=X6tVq j>$fUSWVt$=XY6t38$/>3i=)‹1@?9 tR=\Y6t3<$/>3i=)‹1@9 tR `Y61QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=XY6ujh= XY6#t\u#uGW tjxGj jW/ 蝵 />3i=)Ë XY6,t 98t#@u $jն t!8h $1(Whn#j9- h#h;#j!-^_[]USWVP|$1N=\Y6ujh= \Y6#t\u#uGW tjxGj jW. ' />3i=)Ë \Y6,t 98t#@u $jص t!8h $1(Wh#j<, h #h#j$,^_[]USWVt$totij/V1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉh0#j+1H^_[]1j ÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCj#S CS>tKt^?tYڃCKt6C;C C})VWh#j*S hl#C=`Y6t$dY6X VhH#jW* 4Vh#`Y6dY61Wh#j** S h#}VQh#j*USWVPϊۉ$ts311JDhu.e[YAuۉ4$Åt>V,FN4A1RQ113W>1J 4$$"'G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSV!1҃ډЃ^_[]fV1=hY6u*jh  hY6uhH#j1(1N^USWV hY61Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉Åuj Ël$EPޯ $$$KCs{ D$C $C1^_[]Ët$ h 3Pղ  1$$CHC1FwCE3 S S hs#j&1NwUSWVhY6t"t$4$r$ ws^_[]Ë,$qvщ i )‹#V0j$ W軽 "ph# dh#0j$ 1H ^_[]Ë$ T$X$V9F} FN11@USWVPT$D$@~T@Ɖ1r2w1F11ۉ1/,Eu$C/9u͋t$ t$1:CK 3i=)ƋDt1ًP1 tD@|$t6j tx@ LHDhu#jY 1^_[]USWVtY6CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXj J1ɉHT$, $$$P HN HF F t$1 H;@u tY6-|Y6xY6xY6-|Y6Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@xY6=|Y6l$T$s}ډD$0! umщjt[|Y6=xY6 tIj٧ t; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,PhR#j  h#j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=Y6u*jh= Y6uh#j1N^WVY6t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(T t^t$DtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<Wu h#jj ^_[]USWV Y61Kt$/>3i=)‹/uPV_Džj$ tWWܣtN$$QVQ4y8~V Q(y,~VIlNF Y6F5Y63WhD#!WhD#j V Vh-#j ^_WV5Y6t~1FY6=(Y6u~ t v6蚫03 03tWWvvvv 6踫=03t v6ά6^ VU 5Y6u^_jhÀ=Y6u1WVL$T$t$ Y611H<>u5Guu%P=Y6tY611@^_V|$ |et$>t\jh#P t 13=13t#h#j|j 131H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPha#j^_[]SWVh1Njh#SWu3h#WBu!03u9Y6Džu91FWSh#Voh#h#h#V WSh1#jL1N^_[USWV\$hSb1N|$1h$UW O$LJ4$<rD ShY6hY6   PhY6hY6  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ觡 7̯ 1D$ereRPQx ^_[USWV $ $Hw.$#' e| Rh#{=Y6x1ۃd|Rh#Q1l$ hVU% $ jdPU$,ؠ $$$Hrjtr$@ L$ D /f@ 0 whW#h#h#h#$F1 $F2 jdPV* fF0 $j j0P@ 4X6 8X6t\X6T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0UM $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0U $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R t$ h#$%$ $LJ$m9rD$ )yQj0U 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0U $ t%h:#j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh#W9 t1H^_jh_#W u(=Y6uY6uY6hg#jjUSWVl$hUh1N\$1h$WS K$ǃ4$Yt"Yh PQb Ǎ A/G<rH )UhY6hY6o   PhY6hY6G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VPdyEtQQP  ƅ(8$VP>yElQQP˳ 1D$@$$$$$ȃJ-σwY$4#'<2ǃ$)$Qgtxu;&-u~t6h3B#VDžu'0 PVh-#jHЕ31FUWt5Ë$rt$Vh@#j$_Ft1N1Е3t W ^_[]fVjh%#LxKhQ$PY6t)h3B#VhY61u;5Y6V$M=X6th%#h#j 1H1^WVPD$$|$t X6t$Y6 X6t"= Y6th3j  Y635@Y6h#W 4$VW Wj O  ^_PY6t$L$T$ $RQP| 5Y6εXSWV|$1N|5Y6t,\$OPWS t;j S11t^_[SWVPD$ $|$t X6|$t$Y6 X6t"= Y6th(3j  Y635@Y6h#S 4$WS ~Vd PhӤ$h3 h3j *  ^_[fUSWV} u7th#j \$1h$WV讃 LtPt߃95ԏ3D$h#藓ƀ8/h#Vush`#Vua$PV_]tKD$PhG%H]t4$3D$ $3L$ u$3D$$3L$ t1PPƅu j02V )h(3莳43@ujh"jz:Ph#h3 jUSWV$$6h#jb 11Ch-#VU, e~%q~3كrtރvt_xY6ŃV.PtrكRtwftAiY6Y6뒃Wt6duqY6zY6lY6Y6WY6IY6;uԏ39|=Y6u 1Ĉ^_[] D$hL j$D$,$SX I9v9/u؃@]9v8/@tj/St@À;.uCt<.u{t0\$u h#QC\$Y6EHu]j$8u Y6Pj蜻Y6a$8tӋD$t$ VWZ Y6tRtD$W>H=Y6u%8ts8?ti8t_Wh$1tHtj PWh:G#d +D$@uDY6u;Wh#7Y6;;=Y6uW%ڀ=Y6utV/tD$%=@t/==Y6u uWKW  Y6 Y6х ˉ4=Y6u Ő=Y6t@jPt$N8 u h7#7PAu8VZ@NjGHHf wO$#'=Y6WOwP"{jWVM GG \=Y6uWOwP:GHftIfgft9G =Y6u P PW}G  Gw踉Y68=Y6uG ?tow  PUh:G# c=Y6uO1zuSwDt)Y6t 8t18?t'8ut/wh$qY6V?Dž6=Y6u =Y6tY6w"wDh3S&jtww 蜪 PVh:G#jStPh#h3 j4Y6USWV΀=Y6uLVhG#h3{ h3άԕ3H ԕ3Е3H Е301C=Y6l$$#E=jR8D$PuP=Y6uvVhU#1ZhЕ3Ɖt9 t4ԕ3H ԕ3~Е3H Е3hЕ3Bƒ1ۃYÉ؃^_[]ÍD$x #t%1Pu)1PuVPWSD$Ph#h3USWVAӉ΅:#K1jhV@ $ǍD$PW迵.D$3CL$3 D$(3CL$$3K #D$ =`D$W@1PPPW` D$$h PQ  KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PWb> D$L$D$)T$T$ 9D$t;$SVSY6Vh$fm),Y6Vh$DmWK@1@e^_[]=W?u1PPPWP uh h$P KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PW[= D$L$D$)T$T$ 9D$t1<W ?1PPPW覹 h j$PW KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PW< D$L$D$)T$ T$9D$tA<W[>j1PPPW Th j$P CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW'= ;D$t$$P$!PQ L$)L$L$L$ |$D$ hS;Wm=|1PPPW fCXK\D$L$ȃ|or \$9ËD$| S$PW; 9D$)؋L$D$ظL$|:W:=1USWV\$l$UEtMƊAuA)k')Z6j赸UGG SѸGY6tVG t|$u G?Z6wx wm Wd  Z6u=Z6t^_WVt$ Z61G~3'uGPVZ6WVP  Z68^|~u$PPh#P~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5Z6^_ÊVF|uܹո ѹ Ǹ É)B$:@B~3'uVPQhJ# fUSWV|$,t$(S脲=Z6jLVLt:xIuxNt@jLPj V+1tE@j P)=Z65Z65Z6"1,=Z6uƉS;^_[]ù#V=Z6)u ^5Z6Qhr#*WV#|$ |$wL13 P13 b6>t'F b6Qb6RN@>vuڋ7 b6Qb6t& @뭅+L13@P15Xg6VrƉRPh$# 1 ^_USWV8׉ˋ Z6Z6D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh"jV jVt$ % USWV Ջ\$$St$$tƉ׃=Z6%up1҉  ډD$$=Z6&uU1ۉ D$Z6 Z6ME \$$L$SPy t D$$ ^_[]ù#SWV֍Qȋ\$L$|$$4$'  u !ڃ SQWV99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVƉ׉^_[߹0#A#$#wSWVP=Xg6Z6Xg6Q5)Ɖ=Xg6=13ttxt>u&y1ۉSPV  Ɖ_9u$8t*N8u+$t@~3' t$@u^_[ùN#c &USWVPՋ\$St$gƉ׃=Z6uKh$Z6 Z6MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljաZ6HwSjP ljաZ6uND$Z6 Z6N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!THZ6 Z6N"ىWP1Eكra$"ى=Z6#ÉZ6݅~hZ6 Z62É׃'1HZ6 Z6NLىWP1 1Z6 Z6NىWPÉZ6LZ6 Z6NىWPe$É׍EكwZ6|$4t;~l-Z6b1A1Ǎt$WSh"jVWjV5Z60't1I1@1l$QPh"jU!jU6  ؉^_[]ù#T#J#@USWV֋] $t$ơZ6 Z6L$ D$T$uPV֋=Z6Ww,7'87'}uPW ֋=Z6ȃ}tً$VPt$ ֍Gw7';E Qȉe^_[]fUSWVb13$D$ h#t=etuD$ jb60hZ6GVS?SMUB@P谧áZ6)QPS` Z6)١b6pQVPS/8$jh[##ƅ<.u 1~.D0t/ua$PhG%7tGPV7t6$3D$$3 $ u$$3L$3D$ 1e^]Sh$5t/h$"ub68Ltjb68j*5Z6uj=Z6523[23f`5Z6323HQPP23Q 523 23@u1[h#[b0胊 PhS#Ah2#7SWVWϟWP u2\$Vm8"u6W蝟WPײtVLZ6V1^_[Åu̺0 Ph#jZ6tjPh# h^#ÐUSWVD$ 23fa1Ƀ|$‰tpыLh-$S%$thdG#Su 1t$.4NJ]taM\uNEU\rw$t$'\0u!11ЃwxAunjt$>23HQPPe 23Q t$.PN    ȉš23HQPP 23Q<$t*23HQPP 23Q 523W 23Hu 1^_[]ÁfHh#jfZ6uL$ Z6jPV=Z6t Z6K15Z60ppp VPj 95`6t =13ujVTV{^jpPT$=[6u [6D$ $1APVZ6Z6t1It$aVPL$T$ D$$PD$[6jWVP|$t$D$$u4$ WWV׉ΡX23t L239ty u hL23 =Z6Z6u詵Ph#h`23 =Z6t5Z6h#h`23 t*t$ Wh`23 x4h\%h`23xVՅ Ph$h`23] 23HQPPj 23Q h`23 ^_SWV|$t$\$ISWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$õWY^_PT$D$ $1IP>XËT$1It$)Vf$'T$ L$9upu'0fuQhV&j hZ6 Z6@^1Z6Z6Z6Z6WV|$ |t|$wL13 P13 b6>t'F b6Qb6FN@>vuڋ7 b6Qb6t  @Z615+L13@PơZ6PV Z6^_USWV\$0t$,|$W̙5Xg6jVi j=823thƉ؃$1t7=13u.D$0t Nf $uQVi=Z6u"W这j螵=823u11EPiWcu Z6D$0u^_[]jUSWVL$,|$(1306̓VԘ$%'Uw1ۀ=13_=Z6Mjw1ۀ=131=Z6$=Z6jwH1ۀ=13=Z6=Z6uQ=`d6tTjw1ۀ=13=Z6=Z6t  u8V31tu Z61l=`d6tUW_j\$0SWh a=`d6tWD$,E=`d6tt$,WK_=`d6tst$,WE\$,SW=`d6t@UW=`d6t)UWyPh #e hL23k=`d6twww. Z6@jw1=Z6Z6 jwa=Z6t Z61V谖VuL$,=e6t l=r13t Z6tu u^_[]PNjUSWV@|$T5Z6D$$w=*23tttnTf65Xg6P$Ph#Gtj P523[ KȅuhT#523Rl$jU{th5Z65Z6jm<$t&4$hh[#[523|$Z6\$XZ6-Z6j wD$ Z6u=Z6tSwZ65Z6j Z6u=Z6t]<$t&4$he#5238@^_[]j5Z6USWV\$;s3=*23{Tf65Xg6PP'h#stj V523 vh0#u h?#23HQPP23Q 523Vl$Z6ttQu {tF1ۃjU_|Sl$SP~ tuQV{Z6Ju Z6u=Z6tjsUsV言Z6 Z6u=Z6ttJ=*23tA{t;Tf65Xg6PHPhC#5239^_[]SWV|$Z6jw1=13t Z65Z6^_[Ë\$1Z6u/? Z6ut΅tSw5Z6Z6t"u8Z6H Z6KZ6jw=13tru+Z6H Z6Z61 1@65Z6+USWV1=13t5Z6|$0D$Pm[thUS- =Z6tiD$Z6,$\$4>GXg6=*23 Tf6PQPh2 #w 23HQPP23Q=u23HQPP23Q 523juw  Sw5Z6=13uZZ6t"u*Z6H Z69Z6m"uZ6H Z6 Z6 Z65Z6D$P襏 ^_[]USWV|$0t$VR@O Xg6jPw+ _1=Z61{t'GXg6$pW WuuޡZ6[tZtT1=Z6uI=13u@l$41; u{CXg6Us t=Z6u =13tʋ-Z6-Z6V譎 ^_[]USWV\$K1t@ Z6PSwƋk1OuD$}t 1{PuVy uR Z6u=Z6t~ jW|$x4$yjt$jux WQ<$t$BmE{t V[v1 Vh{Z6 Z6u=Z6tA^_[]Åx W裧0v Phm#USWV$$D$1t$ ,f6D$$e6D$De6D$Ht$05Z6$P辌5Z6EXg6L$XIEtH1F\$XljtwuGXg6hSW ) 1ɉȋOυuNjL$\u o L$4IEt6t$4NjGXg6w誸tjVW( GDžuԋL$81D$ D$Xt D$ ȅuD$ P$D$XtH$r4$ ȅu$1ɉL$@=13t=Z6u|$ ~ $@D$@D$ )$=*23Tf65Xg6PDPl$41dz=u)23HQPP23Q9}j=WpƉt>u#23HQPP023QFPU 1Ո`1t$XtOË$t)23HQPP23Qv É΅u$u t(PV523 مt ȋN΅uء23HQPPS23Q 523|$ +t$4~jhP&'WA u|$$ƅuf|$# L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t T D$$|$ u$|$<‹$t$t$$t$4V0fPD$7 fD$D$# f=`d6t*fsD$= t=o u ft$}u$D$@f%Lu D$Z6jU[qD$,ED$D$tD$L$` =z13u f|$t$Ut$4r t@Z6|$D$D$`t$dA D$,F L$Z6=Z6tYD$t;=Z6uZ6=Z6t.t$` jt$hL$D$Hs*|$ # toD$ t$,tZ6.u D$ 1@t$,oZ6=Z6  $At:ʉ9-RЊQ-t u?y,8‰uD$#}t } ]@g6D$(@g6Z6BP<NjD$ Z6? D$(@g6=Z6Z6Y1PPW 1ɅȉD$PPVb6\$pfb6D$ Hb6$b61b6Z6 @g6L$( Z6L$L@g6D$D$hP Z6u=Z6t$jVB0Z6D$ 5Z6|$t&D$1f|$tH e6e6$Z6h t$8Z6H Z6=t$L$QPy Z6Z6t$D$(@g6D$De6D$He6D$LZ6hb6b6t$pD$ Z6|$Pt jK Z6u=Z6t=Z6u 1Z6Z6D$@z$jWZ6D$ =Z6h!t$85Z6t$Ut$8nWt$Ut$8VpD$ffD$0fD$8D$L$D$u#x2323t23|23@L$D$Z6D$pySD$lZ6D$ 1D$T$PWt+Z6D$|$D$[6=Z6D$$ ,f69t;D$=H* t=7 u)@g6D$(1@g6D$TL$$PQt$u |$ uD$0ufD$D$4Z61f|$ˆQP$Z6$b6b61@l=ԏ3D$Z623f`4$t$T$$L$tZ6D$ Z623L2323`23T|$TtD$(@g6Z6D$tD$pZ6D$D$tFD$t D$f|$t$lQZ6=Z6t|$ # t jD$u23F t23)N23|$@tht$Dhh%m $P薀^_[]h#5Z6t$1=Z6ȍPu =Z6u"D$4thB pȅu5Z6t$ t$,Pt$=Z6uS葕'h#hb6xb6t$p|$Pt jt$h)D$(@g6D$De6D$He6D$LZ6D$ Z6jP谙0 Z6u=Z6tVh Ph#xZ6uZ6jZ6t[61WVt$tr|$w$,&'j Wv M $@Fvu;Ftj WP( $jpVg ыF @v 빃^_V t$t8>u3Ft,ptF ,f6QjRp ^SWVQHt1OS jjP= t6>F1"jjP tva^^_[USWV|$41GGG =13l$0\$S]}Z6AjUfjUPCh uAZ6=Z6t 4$1CSt$SU\$t$$w Z6u=Z6tS|^_[]h#VPZ6u1PPVPjh13c tF$P{Z6t.1QQVPjh13Kc tZ6@=PATH5Z6K Z6 13 13^áZ6SVh#Zb68uj21^[1ۈ13135Z6thB v|65b6 ,f6SSQPVZ6áZ6ËD$ Z6Z6PËD$@Z6 Z61Z6Z6Vt$ |$|vXPh#1@ Z69~1Ҁ8cBZ6 Z61^WV15Z6VDb690t\Wzb60PjPfH5Z65Z6Z6@Z6jw5Z6JWzZ6^_USWV$,f6$j/W-`t@D$PWD$ %=`t|=@t}Ā^_[]ÉjWS2 tFƍl$UVwuD$ %=`uVyjWS ƅuWh%Wh# Wh#L$Z6x Z6V|$|D$ p膇Z6Z65Z6uu~9} ~ Z6Z6^11@1USWV4h#c|$$WT$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$h#523(14^_[]UWV׉΋ [6uj')#k< [611D$ T$l$ &D$ $,$<$\$ D$ #D$?6u0uFjḥ$W9 %W菂|80uHx.t x0@te^_]fUSWV|$7j/V]u#$jVP uaK$$WV4 Pu  1@Ɖ$m=[6ud$$UVuGn8t8_8t.U8 uPVW t .V{vju$P OfSƒrtt~ [67PSCPVh:G#jSWVt$|$t$VW 虐t 荐^_[Ã|$u0jWC6tb6Z6V蝈jUSWVPD$tnt$ t%1;t <:t9tGt$/,89-P13}@v,; L13t,WSQL$ >cL$ |9/u 1xAA/D$PL$Q_[6E9u,;E-[6L$Et <:tEL$<:t1ED$(Q $+ L13AQs^_[]USWV$1C1D$ 1D$D$D$\$h#Hw5$X&'\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ b69Ab693t$$1CjWtV@wM$&'|$t&|$ t4t=013x'@ |$ub6H b68u,f6PVD$ PW9D$ft $|$t $|$tftjWt jP:뇉4|$ÿ [6/tPEȃw?$&'|$u/|$ u&u |$tf<u t$Um묃[6r52323$@th#1@$$$$^_[]SWVt$Z6 [6t5Hftfu95013| PA 9p}Ëu̓[6r Z6t^_[Ã=Z6t^_[USWV$G$$&'o,f6EjWS PqqM䃼$$twhD#Vhn#FGPh$Z6w>PQ^ Z6u=Z6t hx#D$Ph~#/th\#he#GPh$Q t*23HQPP23Q*23HQPP23Q ^_[]ÃPWh#SWV|$tWȊ Bu%iC)ʾ!)! [63tFWP7|tc6|$tTZ6WWzPSnƉf@@ WP躭 Z6u=Z6t u1[6^_[Z6[6Q ?  Z6u =Z66USWV$$$j/$TturfEE^,f69tth#V觘t $j$q1Ʌt@@t`tm$umtisD$ P$xfE$Kو8ˈ8轈$ u=013x $u  \u =013y& u $MƋ$1Mtfyu013YL$$j$P 1OD$V`mG[6tAPh#m{t$t-'5[6h#>{t>/u19}-9j$$PM ƅvvD$ PVx3D$(!D$ =u8=[6$Nu$=8t38t )D$}o$E$\$|$$t$t'523jS\P$h&VfEo$T$pƋ$$Z6|$ÍD$ uj$HfxT$ ufBuω7 Z6u=Z6t ׅt"G GfEG EG fEGE fEEĜ^_[]Z6T$ Éuj$fxE$ufBj Z6tbiVuC+L13P%jV$ij$t3fxu*SVm$=Z6V$h#SWVP4'1t8|$4'L$8u%tWPvL$ t us^_[SWVP5'1t3|$5'L$8uWPvL$ t us^_[V5't%5'jPf@NHu^V [6 013trft fuxB =[6r^USWVP\$=,f61N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh#3wt1<:CG럡013y x50131Ʌx $y $Q5013^_[]SWVZ6 [6>t+fuwWt8 ߉?u׃[6r Z6t^_[Ã=Z6t^_[WV|$D$ Z6jP+@ft*fu vfFGF GF GF Z6t^_Ã=Z6t^_WV t$D$L$ Z6fO 13fOPtGWVU Z6t ^_Ã=Z6t ^_jt$itfxupE%1USWV t$811G$1D$h#ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШPb6:KBb6*#$1\$ D$4$߅u U= +'t,]+' +'8uUPsujUNƃ<$t0vh$4$b6H b6(t|h4#-j vLtuhB#vh$b684$t23HQPPJ23Q l4$t%Uh$SPhR#+h#,|$t'4$PjD$PU51T$(jU4$PfT$HL$ʃwW$&'D$j/UJjU.~e0N PhN#:uhh#Yuht#Bu h#7t.Uh$3+,f6 t$|$tJHh#_t$b6H b6(ouh$돡,f6D$ FjUD$PK PcN<$u#|$t_#PhX#~Sh$pt$ct$1 ^_[]h##ct#RVh#Vh#1PPt$  5L13@PubUSWV|$D$\$=13t[6H [6 L13 [6 P13 b61ɉ [6 [6H Xg6Spb6tH b6~[6[6dH [6[6+L13Pa[6[6u%Vjap [6[6s[6UVW[6-[65[6x=tE[60va5[6΅u!c[6b62V'[6[6t O[6G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ te6t D$23 e6D$[6+L13D$?~uЃtRWT$4$ D$1@D$ wy< b6H b6f[6e$!PVVST$0/>u!y@u=D$ D$[6$b6H b6R[6Q=[6un[6+ L13;L$~[xuUH[6Qb6H b6[6b6H b6[6$ |$D$5ЉD$$ b6H b6[6`T$,H [6>~=u|$ D$ RV"T$4| uXg6b6H b6~#[6%J`T$,H [6 X.`T$,H [6$9Ut$ CT$4[6+L13jPHPuT$8 _T$,H [6>b6H b6~[6 _T$,H [68 Xg6w_T$,H [6Xg6V_T$,H [6$^4_T$,H [6D$$ 4|$tu^_[]USWVt$,\$(=[6te6t$D$ 23&j[XNFe6D$ [61oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=[6Z6[6u(QFe9P7Y[6NQP5[60* [6 Z6u=Z6tP[69t31Ʌt AuQP!u=[67vA [66^_Vt$t"[60v5[6΅u^V5[6t1Z66Pj) 5[6 Z6uۃ=Z6t莻1[6[6^USWVt$(PnY[6+L13PmXL13Gtr}t  KvC#:t /tQ t7=13tAL$,u8 b6Qb6ZO@랃tPY^_[]Ã=b6u Zb6L138t!P tx PXu$h[#ljPXGËD$,tÊz1'$< t< s4< w*b6H b6~[6ZH [6b6H b6~[6YH [6Gw/u}/uEP USWV,D$DD$L$@9A|$$D$t1~3'‰T$D$D%D$ j=L$Q;=D$pD$$L$(<$ L$ u:|$L$D$ PQ 1ڋ\$L$ xf6T$)11G[6+L13D$D$<$u \$H l%t$l$UPRTT$LQT$L$ t,1t}y;@ڋL$ u[6[6+L13=13\$t%1<*t<@t1$ ws1D$1ŁL$u\$@  $$:@ $u =b6t1C L$@11ۃ9|$t$ |$Wt$T$RV WUL$(/<$ }D$1|@uD$b6H b6~ [6ՍQ[6V[6MP[6EK1ۋl$$]|$ D$EÊz1'$< u.b6H b6~[6 tVT$H [6b6H b6~[6 FVT$H [6]EuKl$ u% [6L13)[6 b6\$\$L$ D$E< w.b6H b6~[6 UT$H [6b6H b6~[6 UT$H [6]Eu1L$ }D$n $Ip$''|$tb6H b6~T[6R1G>L$u0L$ QV1>t5[6U[6ۋ\$uhT\$H [6=[6+=L13t$ t$(St$ WV-u[6=L13[6)=b6Sg1G[6+L13t$PS <$t[1@Ftuրut܋ [6 [6̀tuŠQ1ۀ؉Hu,^_[]ÉRPh#dh)Ѓ5Xg6h#F׊t!#u(HL$IQWP5Xg6h#D$ƃHQWP5Xg6hB#USWV5[6+L13D$Z6[6D$ [6D$$[6D$([6D$,=[6[6l$0U+Q+L13P-PD$ P$jU3QD$,[6D$([6D$ L$$ [6[6=[6[6D$ h$$ L$1ɍ|$DL$YD$HL$[|$ 1 Z6u=Z6tfhWt$ yj8tZ6HD$EEt< uD$C낉$L$}1A9b6} RL$ƅ~N$ b6 FK1:b6H b6Q FK1Ƀ=b6 Q1ɉƋ$|$tz1'$< t$< s< w b6F$ b6FZ6D$ x P D$t P D$tP5=Z6$u+L13jPt$$ 5[6 Z6u=Z6t^_[]USWV D$4L$@-[65L13l$)hP?D$b6H b6~[6qPH [6=L13UEWD$ P[N[6+L13PZM5Xg6W蝛ljӍD$ P]NL13 [6[6) b6 b6 P[6SWh"jP[6xt$GF9Iu|$"tjVU0 [6A [6b6)b6D$ ^_[]SWVt$|$\$[6t#9Xu 9p ux2jK [6[6[6[6Xxp ^_[WV=[6t$ 95[6~?=[6Z6?P =[6 Z6u׃=Z6tѮ[6[6t?9p|Z68Pg [68 Z6u=Z6t芮 [6u9q~)q$95[6~ [6[6[65[6^_USWVP|$ r Gu;|$vO11FF€xr< 2tc*<) t`b6H b6~[6TBH [6e623Z65[61[6^_[ÃЃ wZj PV vZ8ű$<=tuw~;5b6b6be6D$5b6ØD$D$‰؃AD$$Z|$ T$L$T$|$,z1'$< u*b6H b6~[6AH [6b6H b6~$H $ [6Q[6 @[6 $Q$ P[6$eØt2[6 $Q$ P[6$eØt2H [6b6H b6~$H $ [6Q[6 .>[6 $Q$ P[6$lUSWV L$8T$41D$@l$։кgfff)À0] }r D$9ʼnwƃ|$4xG-Gb6Pb6~=GA?uىȃ ^_[]USWV$$1҉ljŊM)̀xuHME'*t?t[u<$M^t!u,}*1B/}1u}̀xri[t ]tzuQGL:uF:O.~ :u ]u*Bu_t,/u%/t ]utY뼊t#/tG눀:u yt/t1B<$E!9v @HʀxruH@F9rࡴ[69tH9u C%8/t FG%QuD$;5[6tF/}tEEGXـxs@<$uokt$tdǀx .u.uN jWt$G t8tG@u@/UPWVw5[6=Z6tt$tWE/Q [6߀xruX@8tB@9tD$P5[6x5[6,Ą^_[]ËD$1Ʌt AuQPFWV|$ W?C@P7WPvj7p [6[6^_USWV\$D$|nOʼnmIWP)|$SUÉpsqDx 7u߅u҉3D$^_[]SWVt$(\$$W7C [6L13[6P13b6[6js2b6H b6~[6h9H [6[6+L13Px6jVP W7^_[USWVt$FPh #ĩ23HQPPu23|$Q1ۃ|11E4AE9uSh$j23HQPP23Q|=1C4膤23HQPPޤ23QC9u1^_[]Ðhg#辘hg#贘[6H [6~[6H [6#=~u[6H [6USWVP813H [6t+u y[6H [6~xhL23蛤h`23莤 [61813~PX[6hSp {eO8t_813xLO8#>WjWt !PjjS  h#6813p[6813@1ҋ[6  [6@@P t 1+[6[6813{tXAˋ-[6M [6~ @لt[6أ[6=23t$5[6D$p523D$[6H [60~^_[]ø[6[61[6[6h#,USWV=813w Z6^t)kU5>~D(< t< u 823Hc F[6F[6F [6G $9t V   Z6t^_[]Ã=Z6t^_[]-V [61~^Ë813r t ~6u1@1z[6 [6SWV\$t$|$Z6 813y tja1 813I  813A$A [6H [6H [6H XtK =[65[6 Z6t^_[Ã=Z6t^_[RWV$Z6jWƍD$PV(uT#D$ =uD1PPPV. u2jPV腳 u <$ELF1PPPV. uZV9t:$Ph Z6u=Z6t菓Ā^_Wh#V1h#ؓVWh#ēV Wh#谓Vt$Z6hnn VjjVy |$ t813H~Q813pxuh/ 813A1[6[6413 Z6t^Ã=Z6t^馒813tL$T$9PuHuá[6 813A [6A[6A413Aj8. 813@1ɉH H$H813WVt$|$ Z6|$t=[6W:[6[65413 Z6t^_Ã=Z6t^_V5813Z6Fx PϊFtPs ~ u813VV 813H [6H [6H [6@413 Z6t^Ã=Z6t^U813Vt$ 8139t[6tPu^h#莑=813[6t-Ã|$t=813[6u[6~P813@fWV|$ 9=`6=`6@13t P袉jh%#f@13MPȈ@13hr P=5@13`6BW9t jjJ1Vj莕Vj胕Vjx `69tQj1`6P5@13 ?H0` hƲ `69tQjT`6P5@13ǹ5@13m@131Vj躔Vj诔Vj褔=`6@1V#tV@13Fuh9#J13^_`G0 hPh#:AG0b h+G0L hPhg#@13;D$u D$@13h#Db6SWV= `6jQEƋPh$Ǟ|-1GPh\$蠞G;|ۡ23HQPPB23Q O5@13tJZ6V[V Z6u=Z6t{^_[h#ۍh#эE0 hPh#貍Vt$ h#C^USWVh#vC= `6b61FjPlj+`6i5rO@QPh#Q |,Ph\$+E;|ۡ23HQPP͘23Q ڛWb68tH b6@(1^_[]h#臌h#}USWV\$n;%u(sVd8V7H#KS?8#dS7 `6M5`6At#~i9:0#I {`6#4$D$D$=`6C1tQ~H$8?uEt$PRuUt$6t #tl#K\$ueZ*t%tS-tU+E#D13x+;`6}#5`6it #\$1|$ t5^_[]áD13t `6i#뚽#SU~USWV`6)i5rO=D139u=D13)`6~9ut Ku ]t]tu`ǁTtCiu3itit0 5D13^_[]SWVt$Z6~X1tttG9uމjQuHA19}q~5@tu ƆH Z6t^_[Ã=Z6t^_[^+5`6i5rO@Ph#賈+5`6i5rO@Ph-#蘈P Ph#脈WV11FhO#_>kt!Zu忀ރlt puԉпɁub6tg8tbPh$vm=13u =13u@b6tA523jPvW:b6H b6@ujavW523 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh0D&Wߖ\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th )#jD$P ] `6)i5rOC-D13+9tti-;)t RPh#jl$ Ue\$D$P7.$t+,D$0h#jS0S\$.ŋCt:tBuM ,%Ph#jQD,ingD,Runn}=tQ l$ ,j SP0 D$xxl$ ?Si-l$ ō,@)QPh#w0 h%jQR ݍ,P$-WD$P}݃FD$ ݋\$GHO W謐H EuݍCWP2$u/1M|t؁Ph\$W@ N1MM|FGHO WBH GHOl$  WH|1GHO WH ~T$KWiD$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =13$tCt>5@13螭9t%5@13PV$=`6~y\$t$1=`6tEt*t t.<$u u/S0= `6u WE;-`6| $^_[]:0 hjPh#膂USWVD$4\$,tl$0|$WUS ƃuW:8=e6tZ6`6`6D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1o`6D$ `6$iD$ 9T$tcu tQ=`6t 1=13uL$,uP9tPtu 23P Z6u=Z6t^_[]Vt$Z69tPh džƆ1z Z6t^Ã=Z6t^oWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV01۰D$hS#5t$ntpub6D$D$D$t b68D$t(1PPSȑ EjS== `6u|$1`6-b6~6@ `6D$u}t!AH Et{1jPƅt9u ED$u :u G Eub6t Dt111D$uD$`6L$L$t$D$\$l$|$ `6@1퀹ttt[uL$́Hͅ=u;1D$L$QPj ul$t3u 'L$͊u/ <u UD$`6C$jU9 L$tc|$tNuJD$1rȋi4h #jD$(PKl$D$D$L$D$u U D$\$l$t0~Ot)D$`6y\$l$D$tUD$tMjPSD ?jVDžtjuS# =13u V 4Ń퀉0^_[]hW#{Sht#{Sh#{{USWVP1$1C11h#J1it"gu$ڃjt puЉ̉( b6t yjPƅt,1t`6)i5rO@Ph#H$t#tH~1i0 tPh0D&轊11G^_[]Ã~1i4h#腊23HQP~G ;| Z %PG ;| 23Z;|lh#yh#yV1= `6ujt$ St1+^V1= `6t. `6~$A`61F:uI}^V=13tO=`6tFD$t+ `6i5rOA1ɋ23u0VQh##R^USWV= `6u65`6~%=`6Ft WN `6l$`6~"5`6HI}Z6tfiPƋ-`6=`6iPUV ~ ;uKuU l$hnƋ=`65`6i 1҉AJw)׉=`6 Z6u=Z6tmwZ6fdž=131`61B|iP Z6u=Z6tv^_[]SWV\$|$%ƅtt.VSt$W\$<$D$ #^_[/08 Ph-#vUSWV|$ `6tWdW~*15`6Z6`6V>V}5`6l$t$t%t =13ttttk0hWj~Wj~t uu`mul1V脖Vh_v%薕tOh_v%h#vKVjQuV5@13ΟtTWjzWjzt*=13t!WjzWjzWjzu `6^_[]-0 hPh#wuUSWVt$ l$|$1ۃ=`6t/t*=13t!ttSV|u5<13tEL$ji4DDt QP ^_[]WVD$t$ N `6=13u=132t= `6jP= `6~`6>f@..@.^_WVt$ Z6NJujVj 瀾tW5@13<u%+`6i5rO9D13t mjVt=tu  ρπtt=ttu j)u VK Z6u=Z6tr^_j+0 hPh#DsSVD$L$ =13t1ۅ SPjp ^[Ët$1҅tހu1=`6u2 `6u) `6~`6:tzt Iuh>#~`61@SWVt$$1@= `6|$(1@$r#$''Wh#bjvu h.f#h%tjjvjv 1~ h@#21@^tjs%;thc#h$jvhd%1WvhV#1Wvh[#Wvhg#jvu h.f#xhj#kjvm~ t+u h.f#Ghk#:jv <u h.f#hr#v#Rjvu h.f#h~#7h2 #v h5#jvh}#jvu h.f#hkx%;h#kFp]h5#P~tF1SwJh_#.Sw 1> #t#P uh#h4r$vh#v#'1T#1###1#N9tQh #jWWSxuF x%Ph #jVRVjv S h #51^_[h`#h`#jvUSWV fD$ `6 `6l$ 1D$U$u1!" $'']1x&~'t!=\t_"t $Q\$ \|$ B]ڃ # t#,$$׃߻&!$}D$##} u#$d%)4$<$zT$tvӃux<%('t ur>u<&('_pE~FЃ r# ,$t#\$҉Ӄ9uG8,$"2D$1&<$(':$('$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I `6`6 ^_[]WVt$ tG|$t jV~t'h%h%jVvu^_USWV$t (`6 =(`6D$P f6t e6f6 $=(`6z1jh)'St `P>;Hx@u8/UD$PV苞x D$pL$t 1D$tD$p1ɋ4`690`6[6tH1 8t:tGt89=P13Z 9=P13~[65L13WPVX >?#<=b6l V: fiDle cDhangD ged߉V~v23HQPPvv23Q D$pL$t 4`60`6E;-(`61-(`6D$PĔ^_[]fUSWV<1UjKD$hhh UPj< 09u 9È`6j U訉 `6j`6h#U h&#13,$Uh`62Nt$T|$PZ6`6`6`6@fD$PVWVW~=`6 Àu {=13n$h6#Z6ttQu [6 Z6<$B=135=`6(ȃu6`6`6b6$Z6u7=Z6u723HQPPt23Q h`23tD$PZ6=Z6tcg$$=`6u>h[#J)'t1PhC#QPP[V$=13u13 `6t N=`6uEt$(VhM#t8t$PTPV$Xg6=23t =b6tjx('kuD$Pb6u/jM=13tFhB#|rh`23s*1ɀ=23ˆQPj=23u=b6t413Xg65Z6+p$$#uSWVD$8t^Z6jP|ƅx jVO Z6u=Z6tvex"1=13t=*23t*231G ^_[11=23t 231j蜉V3V芉=13tt*23u23^_[USWV|$(V11C=e6tn1=13u4t0j523ujh`23q13P=823t.te=13u\1Ƀ=`6 `6jPPi1;tW1R=13uIu=13t7=13t.hQ#hpEVuu$u蔆V#^_[]Vt$Z6jV諃x1jP Z6u=Z6tcj^Vh#ct1Ã|$|D$pPmmft$ thn#ct$t$Z thn#cWV|$ W @PF tWP(?^_hn#ZcSWV|$P139~b9Z6؃P tr H13 L13P13H13 Z6u=Z6t wbP13Z65L13>L13)P13 Z6u=Z6t?b^_[hn#bD$t L13) P13L13j h{#ja D$ H13 L13H P13H b6H b6Hb6ËD$Z6H b6P Z6u =Z6aVt$Z6H13;t H13P0 FL13FP13F b6 Z6t^Ã=Z6t^=aUSWVP13<kZ6-L135H13`6t|F9uuH13PV  H13H13+ P13 b6L13=P13b6tG90uC H13 L13H+HH x@WSUP] 5L13=P13 Z6t^_[]Ã=Z6t^_[]S`hn#`D$Z6L13)P13 Z6u =Z6`V5P13P13b65L13^V5P13+5b6P13)b65L13^ËD$ L13) P13 P13L13+D$ȣb6USWV(L$@D$D$@t-΍i11PwDGÉ,$Eu1ۋD$b USWV1\$@<uPƋtPEu1ۉ]hb6b6=b65b6b6^_[]SWVP\$t$t2uhu%V1C$"h~#^Z\%(,23u*223\#023RQPh#^#uȡ23HQPPtZ23Q (,23t"223Lf#tڎ"QPh#h^ u.$(,23tPVtu\#VPh#M<$u#123t(8123uƁ223u숟223h#1 [13t$Y13t(8123uƆ223u Z13@uă^_[V(D$ T$0239tu\#RPh#Lt#123t(8123uƆ223u숁223^WVt$ ~t)~tPʹ uv趹 ^_USWV jA b6t_y 8-uUD$$b61b6P  b6y8-@P1F Pơb6)Z6b6=b6~-b6Ft7 b61Nb61ɋub6 Z6=Z6J1F5b6P)ƅb699SZ6 b6b6lj4$މt$\$)1*C/5b69rL$ 9v!\$ۋ4$ P; b6w4$ 9vQ9wb6 Z6u=Z6tIW1 ^_[]h#2Jh#(Jh#Jh#JSWVT$ b6tstm8u'1z:trrD8uAÀ~:u"9u b6Qb6 tf b61ɉ b6D5b6>1t6?-u1t+O^b6-uta5b61^_[Phc#:IPhv#/I|$u1PjPPgeZ6jwb68t PI Z6u=Z6tjH1ËD$Ѓ w#j jPږ ub6b6ËL$~ND$tH  b6=b6u b6b6b6hb6hb6Qpph#CHUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh#h*#Y J|$:uUD$8@?jPh*#Y ^jUh*#Y 1|$D$0)@<Ph1#h`23V jh*#f1?\$D$01@11T$4*l$Ph #j UVhUh\#Y D$EEjUt$0X u0^_[]À|$:uD$8@:PhE#K1L$0L$4@UjEfVD$ 8231qqA1Ʌ `60PQ823p ]t u 1%823823@j* 823 u^qqhR#EPD$`6/$aQXUSWV'ơ823@tu'tƃ 823 x,$@D$t.$x٬$18uWPtG+'uD$tKjD$p4*t6NjpVWPVl E$ht823@^_[]USWV823@|$u 823A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uq823@@|$Fu6|$uD823@ 823Ap8 u|$u823@^_[]jjX 823ASWVƻt u j pxʡ823@^_[USWV823kE1͋ 823x t*`6,PqN823@ C1Ƀ8Qs s j@823HOH O oKy K9t?U1CSpt ^Shx0'P= 823HO@ G 蝯823!^_[]WV@t$P 823A uyW wWhT#4*'h#j"Q Whl#j"PQWuL$Lx4*'h#Vh#jPQWUSWV823@1u 1=13tMtݡ823@xuUj @jtÉGpj`aC+t823@tj,(pƉ^_[]h#823t$p0h#O@USWV823@$ u823@$EŃCߡ823@$4)'$ 823APUj já8231Ƀx )ȉjCjCUjjj 1VCs9jjN$:jj{Cj`Ce߃uKjvljF j0G5jGt823xJjG B u0823x,u%@~3't@/@~3'uh#jÀ=13tjjj 823H0+H8O U 823p0j^@ 823QPI H pGu5823~ h%vNm|$F823xujD$ 823Hu 823H L$ qx0j@823HKH K {@;u.823x }823x|$ T@0GjG 823@t(HS u 823@823x\$\$j 823HK @0Cku823x ux,uh%pjP@<231ɉH H 823Q0PCAHrAAtejC9t jW\G @:823@ u823@$EŃ!ߡ823@E<$t!t;tj pXÉ{؃^_[]/ uS\$|$823X0j2x@ 823QPI H X t\$|$D$C 823APsVL 823jj 5jj,jj#jj jjh%jjjjWV823x$G Hs823jpW$ uq823p(x,u~ 823At8 u @A8 @tHA~րxru\tuՀh#823p0+p8j@ 823QPI H pG .Pt823@F 823t1^_jjVt$&9u^jVVL$1~3'tA1B1t A~3'u^uVt$j@ 823QPI H p^USWV |$$tD$ D$$D$l$E1$823xc 823x0$t $j\ƃF 823QVI N ~ut. 823I~3'tAt=t A~3'u1c823H u' $uH0 $p$D$0FD$N/unL$yT$$9uguc413 823A4FA~րxruwtuՀh#BL$T$$@ 1}D$8j(823 $+H8N~L$NL$$N @0FEPrj/v詹uG413 823+A8FF823@4 ^_[]jjjjh#L$1~3'tAt=t A~3'u1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSct#SF ;`6}X;`6~P`6I;-u{tBuG823x0+x8j@ 823QPI H xF^_[F h#lUSWV|$413D$=u ?vl$$5L13P13b6G$|$ t u Ǜ t19uD訛 $ tC9u?,$ u413823HH }yMt9t u>u:<$ t=u葞$)jWP萞 |$l$$uS\uNb6H b63\F u%b6H b6  F413#áb6H b6ƈF t詚=v413菚=t hL+' u413823HH b6H b6r=L13)FV,823x413+D$^_[]USWV$$1҉T$ T$$D$(5413823r0=x0't1$|$ fw|$1/fFn D$j8fNL13 P13 b6=|2'u ƒ=b6‹nD>  $)'=v/'u f|>z b6413Bס823=v/'Xf|>LCD>fT$ T!uhЃoĘ0N,諘05,/L>=z1'fu b6Bn׍MN|$=@01fD T.fTT.fTT.fTDz1'fD1AL$!(ljƒ(M b6FD b6BvNO|$s@81ɃfD T7fTD|2'DfDfD> 0 = b6\G_T$ t$>Hff b6T$ Bf|>D>u6t$補 nMn b6}f|>  b6BFfL D$$D$f|>tD>t b6Bf|>u D>v b6BW b6B*Ã{t ~3' b6}E+=L13 b6E{|$}ðD$ # g#}cD$ 1@ ftf|>u f|>Iu6y $R nMnD.=v/'u b6 ft$D>JD$]^|#$@0L>T$1fD t>ftfLfTDx0'fD b6T$ B1AL$ I) NjFfL b6B) 413823@8xt `6 `6$8W Nf|F\=`4" $"}f|  b6T$ BFu6$蘙 Ft$HFuЖD$$D$ Poſ1۹$)'D$ 1E9t$D>D$MN1һ|'>$@0L$1fD t>ftf\fTDx0'fDu6t $腘 FHF b6B赕= t]H\t 'u 4 t =u 4138231Ƀxɉ `6$6 b6T$ 'uF|v/' b6F$ z1'$< u b6T$ BT$ b6 cʔ,t$@  413823xD`6?~3'L$ 3DAD$D$E|$}~z1'f|t b6 b6B\z1' u b6BNf|t b6B1@D$ b6 b6B݉ý {"XŃ', D$0$* nt$T$ Mn b6B1@D$t$C`6$4#U ̏` Ń< ?\u袏\ 0 \$1CHЃ w&Hw ÃHÃéOu M b6vNO|$@81BfD T7fTT7fTT7fTDz1'fDőL$ uk%=I =b6 D$ wF b6P?ˀ b6@ww b6 x?ɀtw b6@ b6W?ˀul b6GXT$ W b6x ?ʀtw b6E b6O?ʀ b6Gw7 b6x?ʀtw b6E b6O ?ʀtw b6G b6A?ʀtw b6A b6H?ˀa*8c69c6D$D$$8c6B1z~3't.b6H b6LjGq ~3'u\KЃ w4b6H b6LjG; ÃЃ D$ u t b6׃Z b6H b6]=Gt/ up}tkb6J b6/#@ǽh#tE%t@Ń:bD$D$$k+'#¸U1#,W9uڍ1|$Nf|uf|t Ms@ L139T$ vNK؃|$ @11fT T3fTT3|3|t3ft1BfTft|v/'fq fq ƋT$ [6H [6~[6H [6 ډËFD\$D$$k+'ƭQ1k+')G b6x?ʀtw b6E b6O?ʀtw b6G b6A ?ʀtw b6A b6H?ʀtw b6@ b6A?ˀa2 b6AD$ ??b6H b6~2G:b6H b6~$_1c:B ˆB1=v/'nD=|2'G=v/'tf|cf|.3b6H b6莿5L13Gf|uNT$ ؃t 4$t$nŀ>ts4$flPT$ )B823L$H,L$H $վ823pM tΉ$蹌 Nu823xĨ^_[]1HE;`6} ;`6~`6>uxkjy1$&tu>tyu6EBE9E0E"EEEA }823h$ Ή$肋 Nu=tuS$ #$ #413 823A0$H#u$-#b$v#V$[#J$,#>$C#2V 823xt@@ ^Ãx t#`6$@)823@ @8 413H0[6H [6~[6H [60諄ƃ~0:=F $P*'> t=u럃F~t\u^ 413@413 823A0yt`6 K`6$S(*;|u0d|823@=t*ʆ4$D$D$v/'Kuۡ823@1v u413823HH @1@Q&823@-823@823@&tQ;ub823@ 823@؅823@823@ 觅823@u:\u?0 u6413823@81Ƀxɉ `6P&Bjjh^"A ځVȋ 823y8~0 b6Qb6@ 823Q8rq8^USWV\ӉΡ823@D$ 1,$Z6D$^+L13D$$UPZ6$~S"ʼn$S5L13PE l$|$tD$$Z6 Z6u=Z6t?w413D$-L13P13b6823x t*`6PL%823@ 蠀ǃ[~!\u9菀ǃ[C tJ$Q u"413823HH s`un=ub\tX`tS413 823QQ NDt""u$b6H b6~E\E \@ŋ b6Ab6@b6H b6ٷEL13@|$t~Pt$jP荅 D$pŋȅut$ j轴E823xtH@1D$413D$jNǡ413D$Kt5 823At$ D$AExK823@t$ Ex P139ًl$踵 P139~=L13b6t1SUW订 )b6Z6Ux $ Z6t\$=Z6\$t 823T$ QZ6Nf|u%Du b6Qb66@Vt$+t$ b6Qb6@~.Fb6Bb6ȅAJ։ȃՃ\^_[]á823L$H0h#W~<$t 4$y /823@D$Z6jP!jj#jjVtQ1 N^V 823#ytA5`6t7t u(@f6f65413P5`6#^USWVt$,|$0l$U5P131BW;L13u(VeG@c69w&Hc6 jjV' ;D23~=D239t V'^_Vj 迣tL$ T$5Pc60Pc6PH^áPc6tT$Pc69Pt u'Pt }'USWV$|$<\$81D$ $D$1F5l=5ԏ3h#WS_ !1tbho$Wfh #WPuo1<`c6tEZ64`c6l `c6t jV Z6u=Z6tF@u`d6>hg-$WȨthv"W趨t D$1p@|MD$K}h&W~t8D$D$h# j5231CKD$D$u}h # v11 t=t8<`c6u.u h#v VaPh%  GF@uhB#A F@uu=`d6tk1uu莩ND$E11P@É|$t<`c6tW4`c6h$Ah#<`c6t4`c6 h #{SfPh# Eluh#523 Cu|$tE1F-Z6D$t P1<`c6D$t4`c6i D$`c6t jS< Z6u=Z6tEt hB#11<`c6t:`c68u.u h #aVLPh%   GF@uhB#/F@ut hB#1<`c6t?`c68t3h#4`c6VPh#m F@u1^_[]ËE8-uxu1D$1FSWVD$,\$(=`d6t61B=`6tbu^1Ƀ~7t@tuH1=134 `c6t1Ҁ9ƒ (u1=13B1ɉσu1Bdd61t)9t`tbփub1^։PjS9 $u=13d1@ָb PSt^udd6u jS1D$ D$D$$K?r 蟱 1@ jPj ^_[À=13u=b6u =23=131@VZ6`c6>t8t6Yf `d6r`d6 Z6t^Ã=Z6t^eSWVt$u `d61ۃÿ`c6t6`c68t+Z6SP Z6u=Z6tdc6=`d6ru^_[,^_[V1=`d6u#`c61A:t2>u `d6r^WV|$ #0`d6u"t$=Z6tg=d6u^Z6WuS =hc6tӃ<`c6t>`c68t2t-d6e6=13tu=Z6u"虯0^_WV|$t$ dd6uWVjdd6<rjV蒬uƆdd6^_ác6=`d6t1Åt8uUSWVd61Ge6Qu9523u V^_523t$WVt$ Nfue6FNtF t0fu^~Z6 ?NQPF N)NZ6vՏF FF Z6u=Z6t V N^_Vt$F t-)t'VfxQPR yNFN F^523t$USWVP|$t$j'Vuvt~th#VP<k>t!hL,'V`1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=23uUWMGHO W]H"WVGHO W3H"^_[]WVhL,'Qj'Vwtt)19<>^_hL23oh`23bUSWVD$~@|$l$1SWU t 訨8tF r)~1H^_[]ËD$)D$Z6X23tP] 1X23P23 Z6u =Z6PD$L$ T$$RQP XVPt$t$V tt$ P4$1] ^h#PD$L$ $QP523 XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+Xg6+e6Pqq hJ#jhDg6荾Dg6SWVPe6,'C PVw u,$$wJCGσCGCuhf6Vhk#8 u*$ f6f6f6f6^_[USWV1ۋD$t$l$1Tt =t JCttHA)k')7t9^ uSUv! t61^_[]ËD$t8SV 躴Ƌf6`uf6$[ f6v#to#$#t&hIf6㟉f6t$D$$D# ^[WV<5Z61$|$PW!t $D$PL$LT$H=Z6PQR 5Z6$<^_USWVL$T$tHtA|$9t91~3'Írjt/9t+1~3'tnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t U蟔V藈Ƌ $A$~ C@ $Q$f=t @UPWVp ^_[]SVh}#WV<5Z6Z6$|$jWu"D$LL$H=Z6Z6PQ5Z6$Z6<^_USWVD$ èu|$=Z13uÍD$PQW Ƌ@Z6Nt$݁ uF @SPуF`u viX F~tuF1Ɏ! s%t É^~e6te6uf6t j~ Z6uk=Z6tb[r2j賆XxL$H @ $  $#`uWW `u WW fy^_[]vv h# D$@!|$$~L$( t 9-uD$@-=b6u0@=b6tc@=Z6tf@=13ti@=13tl@=`6tp@=23ts@jPh#,WVt$|$ Z6twхVP? Z6t^_Ã=Z6t^_WVt$ t|$Wv 6u^_USWVP\$Z6j2ƀ;-u {l$jPSd tjNj@F GFGFG0 t uuO tGT$< =uFRSP}j=SkS迄UPu< ؉G@5423S5423hT13Pus ~ F1gjt$tf6uQG L$<=u5e6He62UjS $81F FFe6tf6~@g65@g6 Z6u=Z6t^_[]WV1VVt$ t/NjHu%Gtt WЃu GO 4F^_SWVD$ Z6t8Q12<08uF=u =ut j=RHjF^_[1VVPO tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWVf61tr:1҃Љu8g6r׍P辂ƻf6Nj+t7Mȃu%EttUЃuEmŃ8g6r^_[]SWVf6>tLGu% uwR Gu#WR @tw݁Gg;u8g6r^_[2SWV|$tfh#WCWS9uWh$V't*tUj'Wsht8)WPh# h# Gh#Whې%^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhj$tUhj$>=uD23HQP~ j( P 23j)n~=uGuth[l#EU23HQPP23Q ^_[]USWVP8g6u)uF Gt/1Ix t#t0u51>j1ɀ>g1AbP1pI1>?f u%PV1u%#L$1PV1t1Ʌȃ|^_1@Ow$L-'1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$裡 t$b19{USWVӉϋu`g6fx@$-'$PWs 1ۅD$PV[ r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PW 1ۅD$PV $L$$t$<|$@11$;D$D9t$ aZ$PW- 1ۅBD$PV ,$3D$ $3L$ $$3L$3D$1 dVW虂1ۅTVW艂1ۅfVWyVWe1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]JQ9-u1tQyt8ytBÄth#Qm.'t1hM* jjh.'QhM* jjh-'h`* jj h.'RGËD$L$  )VL$D$ 2)u AJ)^USWVPj PV蒮 lj8t"܎ځ8"u 11E9s:$9t( 3@DQ@uuN9t ڃ^_[]Vh#yVh#nUSWV׉=t 9Fup  ^^]9uM1PP]~ōP@rPU|]~ LH;NuS3C #~^_[]ÐUSWVt$(h#jY D$,^H $x?-Ok-u)sstdluu~xwGWKÅu"3DHt'1Ʌ Szكh#Eh3DH\ƃ~ƀtVtVOVh#jQރ $h&SH~1Ʌt:SIu+$891V523V|-$K$8ʉT$h&W}1Ʌ9ufمu$1D$\$ $,}%urUYDžl$UWHu.'&|" $4Ph% 1@D$l$t jWOj D$PUm ljӋD$9t-ف8ur1u 8tQ%#x#UPhU#3 1@D$\$ $4h0#1@D$F \$ t$Ph$jZ6PPPPh#5232jWVPΉj WQl 9u=у|=}^_Vh?#jQhl#dj523j`WV@h\6[6[65h`>>t)j=W'UthW>uTPh #j@VjVhd# Vh23h~" C$VWh\# #t&VQhD# j,hi#hq#q VWh#bL^_=Z6t 1[6[6T?823b61c6c6b69Lc6tj=Lc6u23L2323`2323tP= 23Vjz15Z6 ><135`695T13t\13@8@u jRZ6jDd6uƀd6@u Z6u=Z6tx^+fSWV|$ tK\$CSW>CPkAQW1^_[SWV|$t$p6'$5'Vw vVw d_ t"Vst Vw?w0wN@F1Vw q#w wN@FVwL?O^_[ËtVw#?tރUSWV|$t6l$up6'E$6'Uw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$t9 Ã|$9 USWVPu }dg6hg623f`|j%vOm O1@ 0lg6D$,pg6|$@t$(q%v>%L$ h#V<*u C h}#Sp1N .u{*u{ 1HD$Ch}#S<1HD$  t$CD$'C`L$&~QF0 $6'. D$׋L$ jj D$tfL$tjWt$QPhg6TFu$6'lg6l$@؉L$ <'t<"u31B T$4D$0l$0]D$Wt$Phg6̂lg6L$ Q0|$lg6H lg6T$ l$=hg6uM|$L$ jL D$tbL$l$tf|$ L$D$$g6bd\$8D$8L$D$ tMT$tQ\$ T$L$$#D$l$|$D$$g6L$\$L$$X8Glg60lg6E ƋL$ cjl |$D$VPt$wlg6lg6lg6lg61  lg6 lg6Wt$*|$$g6 \$$g6g6t P5 VpPX% g6҉D$xF\$wZ$$7'a=&t1"u@"*\\t#'u0'btnv fre\qFuZ3AD{u#\ҋ\$y AMȀuf^?\$뷀^@-PD$~Vg6tg6T$t P4 T$tg6xg6t P4 T$15xg65|g6Љ\$H\tF5|g6X])P0tXM\$u/^t-u#F5|g6벸^tic\$>T$ j5|g6F5|g6{ 31:DYt 7GuF5|g6\$DF5|g6ȋ\$+1L$ jlD$t1L$t5WQgg6L$ T$t$ttpPVRQAD$WPRPVNsL$D$ T$tt5t$RQPt$RVt$ hg6 PRQt$QP  eg6FPN" xg6 VjxPy 7sxg6T$t t$L$ t PVRQhtg62MT$L$ t1PRQhtg6.VWhg61PQ*t$P PQhtg6 ttg6g6T$z \trB<]*<0tu$l7' ?$@7'."'#Eu uSh'#dg6 4$3D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu h#dg6\),ҋ4$u|$ uWh#dg6 ^_[]WVPlg60tplg6=x1ɉQPVo Nj 3#DQt$c#r& lg6+ pg6VQP4 dg61^_SVˡg6H g6 u:23Prp~r0 P{23Q 밅ug6)23HQPPD23Q^[SWVPlg60t"lg6<'t<"u1B^_[11f w1ɉQPVY lj+t:<-t6 3DAu)lg6+pg6VPhT# dg6 $ڃ^_[SWVӉQfǃArVhE#dg6GPVhg6W D$g6g6Ƈg6^_[USWVP׉1PPP膶 ,>U:f@PUQj x$tG9tClg6+pg6VPhh#.lg6+pg6VPh]#п dg6$^_[]WV9t"΀:t9lg6+pg69t\VPhh#Zlg6+pg6Ph#賿D\u8"uD=lg6+=pg6j"iD PVWhE#~RPh"#m dg6^_USWV\$$8l$}hE j jh7'Uƅu!hE j jh8'UɅƅH h]@L$h8'D$P賏ƀ8j=VU>GPh#W6K k^cih‡"Vd+h?)&VydPh#WJ $L$A$ltkou|hՇ"V9dh(&V#duTPh#WJ $L$A(h#Vcu"$L$Axh#Vc7'7':uPVct E ujEuPh#WI E $T$L}t8|$Y#$L$$L$A܋$L$A Ѓ^_[]É1u h#j Qh#j fSWV t$ \$81?-uGF(8hI j jh8'Pt0Hu~(u+t QIN4tVP1@1 ^_[Wh#Wh#4D$L$01\bVD$H8PdpjVp$RQ^ËD$x(t2#H@KH@@8+$@#HDHD@<H8"H<#HDɀHD@,ËD$#H@KH@@8+$@#HDHD@<@,Vt$v4fFfF0^ËD$@K@M@PHDᜃCHD`9@,VD$H8PdpjVp$RQ^Vt$~(t D$Ph`t6xQ F,^SWV\$1PPhW$d x ƍC8j,PV V$yTj6PMC8C<C@CDD3\FuC\C`C,^_[WVt$ ~8v4}PWF,^_ËD$x(H8tH8H< H8`<@,WVt$ ~8v4$PWF,^_Vt$~(t0#F@ KF@F8+$@#FD FDF<F8P9#F@ F@F,^Vt$v4fFdF0^ËD$Hd@fPQh{%( ËD$8P7Ph# P1QhtPO xXh#j=hnt jaOxh #jhot jAOxh#jWV|$D$ 0G@9'PhP:'luTG8:'Phl;'Pu8GD;'Ph@<'4uG<<'Ph<'t G,1@^_1USWVP։ϋl$\$t PW ^t9 u-uG1ۅtJL$PW]tu*C#EE CF|$-u#E EE1C؃^_[]USWV$$UUo9uVh#=PVh#, ƃrk$$$@PQh# tUh#Džۋ$tSh#Ƀ$t j ̂] =g6tj 趂g6g6#w %u"#Ywx*#=w %u 0#w؃u8#D$w؃t>#D$uE#؃L$u L#D$uT#@D$u\#a D$ue#B D$u n#"D$uy#D$u#D$u#D$u#D$u# D$u #i]=g6tj {g6g6# D$u# w %u#@D$u#D$u#w %u # D$u #w %u #`w % u #?؃L$u #&w؃u#D$u#D$u#D$u#]=g6tj ~g6؃g6#wu #jw؃u$#LD$u+#-w؃u2#D$u:#A#u=g6tj }g6g6I#w %u P# =' W#u D$u _#Uw %@ug#4fD$un# D$u v#D$u~#D$u#D$u#g6tj |g6g6#7'tX7'|$FTPSh#jdW{,^ u΃=g6tj 7|g6g6tj |g6g67'17' tN$L :Ntl P#PSQ4{g6t49t0##9tSN#9tSN#QPh#s 5g6č6ȍ6^_SWVx$MD' D'VSh$h3jK#uj)_VPjj"P th#r1Q1>'$ =uhp} jj"t$ 1$4F"u4$ 1@^WVκV u1H3 r1P^_V΀=h6u6=g6t t41t)Ph(l60h(l6hedAV xk^Ã=g6u Jt=h6t7h6t.h(l6hedAVp th(l6hrdAVY t=m6uj]h$jh%$jUSWVPύAPjh$h(3hGw4lC'h$Ph $h(3h (3w(h$Vh w,h $Vh w0h'$Vh w8h.$Vsh w4h5$Vbh W4O<W8$9tQh$h<$h(37h#OHtQPhE$h(3h#OJtQPhO$h(3g#OLtQPhY$h(3g#ONtQPhc$h(3g#OPtQPhm$h(3g#OTtQPhv$h(3ng<$f$1۽a(3Pjjh$,wVh$(3PgwVh$(3PfGtm'Vh%PVh$h(3fGw=BBs3gRPVh$(3PfwVh%(3PfC$9(3Vj qV^_[]USWVL$(y(y,y01y4ujh#*nL$01FfyHujh(# nL$0A8u A0A,A8y<uA4A<tK1q(tVh[#mL$,C# ##jPm1@$$^_[]jhH#mL$0Ft1q(t'h#bmL$,jh#MmL$0Fg69‰4$sRPh# m V`>ÈJ9|6{u;[tVPWh#lD$(ffL$(D$ 1ۉa)D$u!)tPt$hG#qlL$4 <)ǘ΋I<9vt$ht#Hl$N<.”T$9vt$h#l$D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h#k D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( l6l6t$(L$QhVk  D$ 1h$VtG<$h#V4(1>tYj:WD$AL$\$h#SΊ,1tD$hkl&W9tkh^$W8h4$W8\D$PhV$WK D$q;g6efl6ujh]&l$!U l$lC'1tUP QFC'r܉1hD$ Pj <$Wh$iD$ D$t$ <$}trÉD$h&"U: t:h1"U( t/h6"U t$UWh$Oi F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWh>$hD$ D$l6FʼnD$uf5,l6l$u D$l$l$h%W6h%W6h$W6h$W6h$W6 h$Wv6h"W`6Th$WJ6h$W46h$W6UhT"W6kh$W5h$W5h$W5h$W5<w ~W|$Wh'$ g T1<$l6jD$<$rt$Wh$f D$f,l6@<$Whe$fg6fl6jUh0l6jUh@l6 <$t$ht$0V/g J21jD$ Pj< D$Pl6뜉1jD$ Pj D$Tl6q1jD$ Pj uuD$`l6J1jD$ Pj uND$Xl6#1jD$ Pj u'D$dl61jD$ Pj^ tt$W|$Wh$teD$\l61hD$ Pj uD$fpl61hD$ Pj uD$frl6a1hD$ Pj ^D$ftl611hD$ Pj .D$fvl61jD$ Pjc D$xl61jD$ Pj8 D$|l6; g6sr"jW|$Whb$W|$WhB$΍L$$ t$l6|$Ѝ6L$$ L$l6t$Ѝ6rh#Văl$}}>'1ۋ>t.W40Lt t uPUW׻ Á?'r D$3MDHu D$"91hD$ Pj t4$h$cD$ \$"r)Ut$h$b h$bD$1ۋD$l6ND$l6W\/4(t$|t%h#V蠂 L$1Ҁ<tʉT$D$< w'<$$d>'L$ L$l6<$tL$$L$ L$l6|$Ѝ6cL$$t D$|$Ѝ6L$l616FL$<$C fF|$Ѝ6L$! L$l6|$Ѝ6t8L$$ D$|$Ѝ6tL$l611A<$D$ h(l61D$ ȁ(^_[]4$h$aD$ WVPθWEV(l6l6fl6h(l6 fl6=h6u=h6u#$}h(l6hgdV 1h(l6hfdV y=8t =8uv$=h6u(PhmdVn xX523h} Q1=h6u$h(l6hgdV2 y #1G^_ù#h#5 뙃=23tt$ t$ t$  U<1HVD$ t$=(l6thPh(l6 ^D$L$01-V<t,uVh#-t"uVhR#Vh$Vh #Vh#8_^h̍6hmd523& USWV8 $RPh hm6Qӧ6 h6v|Pt$hj$^ lj D$T$1D$ XƉ 11 ‹l$To6 6m69m6hWD$P $;D$#=m6t =}t=}uЉD$$$=$h6tȋ $h6=WEVuT$tf9g6rD$Pftt= h6%4$t$Uh$] D$t=VEW=$h6$t=VEW4$t$UVh$J]= h6|4$t$UVh$&]=m6$D$PSt$Ut$Vh/$-R=h6u $h(h6S(3V 5h6SVI SGSt$VhVWq  m6D$ L$D$11t4$hC$8^_[]USWV T$ $11F1Ń= h6|Uh$\ QPWD$Pt$Ӥ9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99= h6tUPh$P[ Ɖ ^_[]Ã= h6tUh$= h6tUh$[ċL$T$tPh(l611@PhO$\t"j QPT u=78"t1Hg61Yh_$j>Ph~$t"j QPAT u68"t1Hg61Yh$jSWV։ϋ\$+ h6tItEu h61tGtBm6To669w1m6 1tth(l6QA1@^_[Vh'$j*L$1=g6T$ PG1ɅɉWV6~( WRPhm6Q 69u ^_hX$uQVh~$jPQVh$jUSWVPӉ΋l$|$uj WVR Eu5"9"t:M";L$ w,O>t" t9t3DJ@t1^_[]WV1t>΀9t7h#V<t#ƍFh#P{x1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)Wh$Wh$ X1۹Ѝ6؃^_[]ËL$9/up`l6D$\$A/jPU u$D$ Tl6D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh$MWЍ6!Wh$7WЍ61 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh$XzD$$Th$Sut]"D'W #PWS# '> uۀ$U-$T14dE'D$XP' tpC"uD$TPh $J$T$끹 $dE'j" $eFMu SQЃ {Sh$DJh$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$h $/$PQh) $R~$ "Ph $Q? ~5$w$D'66 hq$nVh $P~I$ $u ~ˍ|$@WVS9t"b&J~PH k$$D'1OJH w@$LD' &B(D$ D$$l$ CtGtngtbcB8D$D$l$c&ɋB(D$(D$,l$(B&ɋB(D$8D$<l$8&ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=6uHr8jVSWD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Ph $ <h $;~USWV|$t$t$h"Vy> Gw4F'hD"Ph"VS> GPSh "V;>GPSh"V(>Vjjha&GXtVjj h%"GXtVjjh0"GXtVjjh5"Vj pHw(h>"V= w,hP"V= w0hc"V= w8hx"V|= w4h"Vk= w"@D$Rt$UWQP 8$71w8$Ћo,1lj1l$DRWt$>"P@PU7aUD$PShG"$S;$#a0QShU"$Sv;<.Ǡ!w4|F'hc"Phk"SH;  w$E'5h"_<t$uM55h#RPQhr""555WRPQh"S:7h#h"S: "55RPQh"S:M8tDƔF1Ph"Ss: F;Eu 1<1A71Au01<  $jj@PD$PkD$ Ph$2C9u<$u403H 03~(3H (3 h(3j c81^_[]h$jfUSWV $ $ D$-@1666666$666t$ h$USO c~!P$G' 6˃PtdT]=t=?1AJ5t='y6뒹 .t=6h#n 6b 6D$6T$:@=6lt=D$ Tnt uBxou D$ 1Ɉ 6hJ%V 5t6h#`ءt=$j:WC-6tWu tm6S c$ \W6t6t 6ԏ39$ 1ɉL$tVh$PC tj/Upu Uh#"h%h$ U.VÞDžuVDž7h$Pӯ Ƌoh>#Wt(hh"Wth$WpV 1QQ$ 4PU7L$9C9$ $ 9tU%lj?,$u1QhD$PQV h6hzd@P} tq$ PhedAWc WA~|$ WD8$9",H'uW}6,$h ho 56P Ġ ^_[]hm$jZ$Ph$jvVh$j9h"h"ʍD$ Ph$ D$ Ph$j>D$ Ph$롍D$ Ph$땍L$ Q4tG'h$USWV։ϋl$j蠴 V U CCCOK G^_[]5hH'Ph1$h3/jv$USWVP׉΋tASW4$4(VS裴 Wh_}$Vt$ P+ Wp É^_[]USWV|$1_h>#St$hh"Sth$Su\6toU3t[u= 6t .= 6t%6toU3ht [u^_[]USWV$D$|$6#tW3 t CÅushzU$t$ uD$q%D$ 6t L$ mt L$ ^$D$ D$h苲 $$ t$h~%hV *$0|$D$4$L$hJ%Q/1G@΍K9|,SP袲 Ŋt><-u(GD$tj=Vt>FD$ GDj$thJ%D$P.u|$1F1B,$֋$$$,$D6tP#t"P$h $L* xF1Ë$4h%0*C9uj ?)t2ƅ|$t t$y 4$n tA710h$F|$t t$D 4$9 ^_[]ÍD$jPVV x!L$ȃtuuhY#֥묁tlP PUh:G#3 끉 6utD$P$-uW$P$uB#t#Pv vvh$h36Č$SWV։ϋY Wss ss҃ 6t~j ]Wss ssԅuA 6^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉ術聓 PQ40M40<8-<8D@ D@LHLHTP͒TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40340<8<8D@D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7yVw wfV FwwRVFww>VF^_USWV\$l$EffEffCEffCEffCu uS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uu!SCuu SCu$u S$C EDȉCDu,u(ݏS,C(E@ȉC@u4u0S4C0EHȉCHudh$VŋFNД6tbSQP Д6x 6~,=X6tffOfGG@ Չn,~$N()ǃ~$N(=69<$D$hP-6>N,ș)N,)n$F(teh$V$FNД6tbSQP Д6HT$<L=X6tAf=X6t4f.<$ ^_[]66F,)F$N($fOt@ 6븋D$L$t$ QPQPUSWV$$$ $$$(hj$SV\1j _ D$SVWUhPD؃r_|695x6rPSV Pt7=X6tf% #=@t.~#WQhO%d WhS$T^_[]USWVP|$\$s s@=X6tf9uRP6t=6t=06tj:D$1PPPs sQs s6O63C 63K u 23&=X6tf% #=@t.~#Qhb$胣s s/)SUhp$  6u =06t:yj h$6th$8=6uh$u=46X6t7t;f56D$P6jh\$S-^_[]Åtff^^_[]USWVP$h$d|$1SV(=X6tf=X6tGf #@t.~#Ph$/SVz.=6t)1=46L L h$7h$$p$l tRQf@ 66 1VW 23L$@D$DD$1 t$|$ 46pt95X6tʋ 465X6T$Htt tɉL$LL$QPh$=6uh$51523PPPj66  523RPjjt:6=6h$:6D$L$ 6656=6 tYjj=46HX6tt,fI=X6tftfI=X6tfIfHVW516696t-j : 66 djjQP 66 AQP=X6tf%=@56568,$t$R=|6x6 t# Fjj WSΉ9ݹÉrFND$P9|$P$d닔$hjj RS茉 )ˀ0^N9wh$訞h!$Ntf5661523WWWj66 CRP523jj_h$h,$161P^_[]Ë$d#6 6$tҍt$PtV$lSUQP4$SUfH1G@u5656hR#SUu.$l#$pthR#5656SUq5656H=46X6fA=X6fh$6hM$hB#2jj5656D$DD$L t$\$ VS@@PD$PQVSf@5656tfA=X6tfA$l$p!fHG5656qf@5656SU5SUhu$ t$p$ph$; =6j DUSWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡؔ6@4 1WjPQWWRS 9=X6f23 6ff23=X6twf23 6ff33=X6tjf2323f33=,6t23ȃ=X6t]D$ Yf23 6f23f23 6f33f2323f33=,6t237D$ G UV=46l$$tApQt=X6tRP yA(=X6t1ҋ ؔ6I4-Д6teQRP Д6xtt$V/11jWpv =6=X6tf=6f23ؔ6;x4})}jh23W4 =6E ؔ6A49rE =X6t<$fGj \$l$u6_=X6tf1UVyfXUVW! t$$\$$ST8tt$$SB8UVW! UVo#L$$HXH XQS ߊUVUV8u8|$$$X=X6tfUVfXW|$$Wf@t$$W=46HX6tt,fA=X6tftfA=X6tfAfH ^_[]UUSWV$$1Q |6x69;$$߃9։$PU$T$L1 B(BE $BjZr1B$J$=46pt$ =X6t ɋ=46X6L$xtt tɋ=465X61L$|1ɅDT t$t RPu56UVRPU tE{[|$t}SWVuljUVSW)SW.ulj_{[ |$t]SWuljUVSW)SWtlj?UVSW)Ӌ$xX#UVSW)Ӌ$xX D$4PS $$W$VWVhPWV 461ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =X6t SWt ؔ6L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p83  D$HL$D$ =46<$\$T$|$(t$,DpLtL|Dx=X6RSsTtDpؔ6D$0X0vvrRPrVFvvr RSrVFt|tx|$8rD$T$Rl$$D(D,=X6tFB\pTtؔ6B0FN FNDxD$L|׉L$L$؉D(MU =X6t]RQ"r ؔ6I0VPrU EMhɡؔ6@0 ȃ=X6t3ȃ=X6EhD,t($ؔ6@0MU EhEhD,=46L$ tL$D$D$=ؔ6,$\$ 1QOP\$  t19}#8@#pLp0l$$ Д6ɋD$taVt$P= Д6x4ƍ$56pS% ؔ6@0fPt$t$ Д6x56Sp 6=X6tf؋6f23ؔ6B09}+^jh23S@ 6ؔ6B0N9rF =46tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL Д6taPt$t$$ Д6x=46t$,|$(DxL|DpLt1҉TxT|FN=ؔ6<$09X6QPo)RProVF^vv[o )RPJoL$(D,D(D,EM =X6\$QPo ؔ6I0)RPnU EEhhȋ5ؔ6N0 )ȃ=X6t^ȋ5ؔ6T)FN^FV )S\$L$4$*5ؔ6V0)EM Ehh )ЋL$Ev8QS 61Ą^_[]Éjh23p $Ph$k=6th)$%h$߻F & ؔ6@0 1RRPQ$$t$Xt$XI D$4Pt$ IUSWVLl$`\$dSU& t$1 F(F ^nFD$hF$D$pFD$lF46pt =X6tɡ46=X6L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=X6tf)9F=X6\$tAf)=X6t4f=X6t'fL$=X6fVT$Rt)f~T$JR>>fD>=,6tq1@1$CD$ƈCCEUL$ q/G9<$u1A=6=H6\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=6t Vt$t$Ut$h$1Ƀȃ^_[]1A=6t1=H6<$\$ HfUSWV $8$4}tE1ɉM4M019 46‹DT 9 X6tRPhM$U(E$f M$E$U( u ^_[]%=uLIؔ6(9‰|ǃ=6t<|u=46tFNFh1 t46tD$hVP. |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =X6t RPg ؔ6I0VQRPzs։D$D$ ЉT$t ؔ6=46Q8k=46L$$tL$D$ =X6t QP5g ؔ6#8t@DQL!!IT u‹$8U t#DT tE=X6t!RPfD t(=X6t1҉EU}@U=}@|$6EM QPQPh$3WWh5$聇hY$'uQ{u u ؔ6y0ƃ=46X6t:tMPWe?UUlCD$T$NQt PWe~V ~V h-$L6Ԕ6@ 뛋5ؔ6F8E -46T$$tT$D$ =X6t RPMev0 I)؉$ʉT$t*DT tZ=X6t RPe$8D t6=X6tȋ$81҉AQSt$t$tv<$8}@ud<$D$|W6E$8I QPQPh$3UUh5$薅hY$<$<t7ؔ6Ht)$|$-46Cq qƃ=46t0FV=X6|$$tJRPc)RPc4FV =X6|$$t&RPc)RPc)FV )FV h-$vL6Ԕ6@ USWV|$ \$t|69x6a6 6 ‹-ؔ6t9ˉrux9ˉ\$؉jL$QWPnց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$סԔ6t`v0WUL Ԕ6ؔ6pxjV|$(WS)Љ 66=46jVPSĮ Ԕ6A^_[]WSh$Ԕ6@ USWV$׉ν_ y@tnVՃ2v vv $<D$$8D$ؔ6p0vv_ $G ؔ6y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQPl19rÃ=\6$t$ \$ti=46t,ۉ~A1_t4`T\$F9uۉ~1O ɋW @9uG W5H6萲t$ D$x, ؔ6;Xt|$#=46t JًL B tmt$v vh $hW WVt=46t$$B1ɉL 6t$ $$Bt$ B Cؔ6;Xt`R5H6踱T$\$1ۃ=46t%JًT tN=X6t#RP/_Bt/=X6t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb6L$AI QPQPh$7W]Wh5$hY$|T$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=46t+FV=X6tGRP^+D$RP^1FV =X6t*RP]+D$RP]+D$ډFV +D$ډFV h-$L6Ԕ6@ 1@$5USWV\$41F~3|$0l$,|!l6 h69|)S9у} ȃ^_[]Éދؔ6K89}=6tOI.A!1‰9)=6l$,|$0t!t$4PWUhg$rؔ6PVWU荻Nj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=6!$l$|$ T|$0tN# $ND$T$RPWUh$V ؔ6<$\Ttq!qIVPt$ Sh$$@l$19=6tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUh$ؔ6t$Sh$x1Al$,|$0USWVD$,\$( 66փσ56=611 J 6966 66696@D$ 6=ؔ6\$jD$ PL$QT$Rfց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =ē6ȓ6tГ68̓6T$tԓ6‹D$ȉ66ؓ6WUS5ؓ65D6贬=T6l$$-6+l$(=46|$`5ؓ61VV=X6tf%=tjvdv`XVdF`vlvhXVlFht4XTCut4mXTCuG9a=6t< ؔ6(1ؓ6SS=X6tf%=u1=(6u(x$CS =X6t RPW9Ƹs& ɉ @u ɉ @uG9wt$t$t$5ؓ65H6襬ؓ61Ƀ=46 6^_[]PSh%$awUSWVl$|$ؔ6jVUW 1ƒ 6666=6-6=6-669ؓ68#{H1ۃ=46(=Г6-ԓ61ē6̓6ډȓ6t@ē6 -̓6=ȓ6Wh] ؓ6t^_[]UWhH$Tvhm$Jvؓ6t P({ ؓ6USWV l$ =461ɅDT =X6t RPU ؔ6Y0މD$ʃQSRVw wÉD$4t,Pj 1ơ6$6QPt$0t$04$ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ 6; 6u3P56s =6t-66d 66Q64 ^_[]h$\tSWV|$t$66QPWVtH 1P1 t^_[WVh$ tV6tR 6~%646x ;56s6Px 56x 166^SWV\$t$s sǃuG=X6tfL$% #=@t.~#RQh%t s s=6tfhL$ 66{@t1H1PPQQsHsDs su SW=46t6hh 6W -h$葠u7=6{놹 6s sԔ6H 6^_[WV|$t$ WVh$ C|695x60WVh$=6t7=46pt=X6tPe t 0hj$'=46pt=X6tPh\l&.=X6tfPh$ =6tqPh#1Ƀ=46DT =X6t RP:QRPh$ =46tF(F=X6tjP|tPh$^_SWVD$H8=X6t3P PP0p4u'11C9}QBRQp<ޓ P0p4^_[USWV|$_8+t]Cw=46RMT$=X6HRP@9L$0ơؔ6@0 T$D$=46D$0T$T$4=X6t$$t RPQ@Mt$t$$=X6tȋMD(ؔ6@0T$,‹t$(΃=46X6t+tMVR?uVFt$t$ ?7KVR?MQ AD$:MQqD$T$AQ!EL$DT=X6t1ҋ ؔ6q0RP耐 ƋL$ jWSQӃ=46D$ t7~SPt$t$$NjT=X6t RP?|$)~SPt$t$$輝=X6tȋ|$1҉\$$ t/f ؔ6q0RPݏ xËD$L$ L$0|áؔ6@0 T$ʋL$ȃ=46L$0T$D$t!D$4=X6t)PQJ>D$ T$8=X6t@ɉL$ D$ =6t h$X=06t h$Xh$X/=6u h:$WX=6u hX$W3=6u hy$W6=6u h$W<= 6t=6u h$WT ؔ6|$Y8֋T$  SP56565656h$Wd,$kdыؔ6@DWSQP`D$T$iщډWSUR%jj RPRPt$t$t$t$t$VD$Ph$趽$=6 ؔ6+x6 |66 66 6 tQPh0$Y =6-ؔ6KC)s, 6-6Ջs4HS8\$ ډD$$+h6$T$l6 $ $ډ Љ 66tRQhD$衼 =6t8hY$苼56tvvh$n 6j 耻=6t8h$J56tvvh$- 6j ?156565695@6tmj8 ؔ6405\6h QV F 56Vʍ=X6t\6PPҞ5\6z`6=L6t 6j ؔ6y,t+61TtRW 6 ؔ6F;q,r6PW 6=P6t =L6th$SЛ61=@6=6u h$S=L6t h$SGRtgD$PhC%Fu1D$t)L$ jQPhC%hq%Nt-=6u h2$S3 ^_[]1USWV6D$45ؔ6~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B p6l$9؉|5ؔ6|$0G;~,$LHN4H~KT$މ)1@ p69׋T$9|5ؔ61҉t$L1F, 66669S,SދD$4HxL$HD$81ۋjV ؔ6ׁ\Tډ\$tQ!QЃQ SPh6Eؔ656|$D$Xt1NPSWUʼnFظ|߃\$ <$w4F46<$t LX FuWFsT$ 66$@=X6tfL$fAf|$l$$j : hX 66T$ =6t| $=X6t RP %RPh$l=6gq$ʋT=X6t RP$WURPVhn$]($DX=X6tPh$86h$Eh$frT$ '|$@@u' T$t$SUt$A 6t$D$, F=46=(6$@=X6tffu$@=X6tfft}SU{$@=X6t?f=X6t/ȃ=X6 $ApfAAt$f=X6t $ApfAA $AtfA1ɉ 46 06 ,6 (6l$T\$X46pt4$9 X6t ʡ46 X6$tt4$tʡ46 X61ɉ$dtX$t $D$LPt$衹=46=86t=6u,$$@\=X6tȅSUh$C h$,p~SUؾ19 X6t1ɉH\H`HdHhHl$f!B=86,$(E\=X6tȅƄ$E\=X6tȋ ؔ6I0H111҉,$L$ D$t ߋ ؔ6Y8Om\=X6t͋ ؔ6#8߉@DYL!!ÊIT u,$\$lD`Td t<=X6t RP!D$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9ؔ6H4 D$|$׉D$|$=46t݋AQ=X6t-RPs !Eh=X6tȋt$|$1҉11 ˉl$$WVRPSUh'$uA=6th$h$$m|$t;SU蕼ƃ=46D$|t1$=X6t RPFV6=X6tȉFhܽ$|$jj$$$$SU z $A`Id=X6tEQP@ $plph'1$D=X6tWUPVhH$  $AhQl D\$C5ؔ6;^,T$$L$ $6 6׃ƃ= 65$6 ؔ69˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-6t$| ؋T$(tu3D$1 Kl$@؃,Ut$H{= ƋD$9\$(s+l$ Uh$>j#SWUt$@h8$h $m=j[sUSWV |$ ow@u Xw VUp D$t|VUh$$w w,6 (6ʃǃ(6=,6|$ |:w whe$= =6h$qjG $D$|$tjVU¾ p6<)1CVUh"$D$,p p*46 06ʃǃ06=46 j O0 hp 6tH6 69tDy1Y1 t 9u,66$|$ ,66Q1I1 ы|$ t6$G0W4L$Aڃ]D$ p ph$J< =6t)hs$1C+6h$;h$h1Ct ؃ ^_[]6jpjNfUSWVP$T$1B@B0 686ؔ6x,11=6t>Q:ؔ6x,$kd1PWSQh$h3B6ؔ61ۃVU聶tzljl$ t$46pt=X6tʡ46 X61ɉT$HtttȉD$LVUz8tD$PWbu(Cؔ6;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$86ŅtTM1ًU1 u3VSh"$w w86HPUMpX86 69tmu1 6ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $xI'h$F9h!$eh$ejj聴=46X6f@=X6fh$8h#$eeU1hPVPVҜ1Bh$8h!$'et21VWhVWVW莜1 tah$+76h$du<tf@=X6tf @f=,6tjjxfh: j5656nIT$1B@B: -66  $6$Wt>E6+56=6kdPWVQh3$h316uF$hV$vv 躑 6A1ڍF$h$cvv 6ǃ=46F$ X6&jPf1 6I F NQPQPhSt=06F$ 6t%QjPSh3$hj$>6#6QjPSh3$hj$36=6th$=61F$6 I1)щN$uh$b-vv *ǃ=46F$ X6$Wt jPW1҉GW1҉GW }hjD$\P: =46X6D$tt7fD$T@jv$-fD$T@jv$fD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=46$tD$\=X6tL$Lu$D$PD$PD$XPy6;,$/6$W=`6v`656;4$]|$T{$AhjW~ -46=X6tt0fD$T@js$&tPfD$T@js$FfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=46$|$TtD$\=X6tD$L$|$TtD$\D$PD$PW٧;4$=6;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h$ss QPTh$(^t~s sqf@fNCKK CQPhR#ss oOCK =6th$ss QPCKhR#QPss fN 6;<$=664~^1ۋ/uu q]]8u9rۋ=6/CK tS  StQP HKX9rjj轄`^_[]6j&ejÎPh$/L$D$@, +A,USWV $0 n8$=46ui=(6t`E=X6tȅtNE=X6t$;x6|6s&E=X6tjPo@E$F0N4 utEhG%Po)$0 F=X6tȍL$A=,6AAhhG%Q$ ,6 X6tD$D$L$L$D$h$v v薉 E=X6tfM9v%}EPh $.5 $h $4[4/E=X6f)=X6f=X6fEtf=X6t΋$0 AI 1 h$QP辈 h$Z$0 F=X6tȉE$ $PpZEL$fAWQU: $)fEPUV =X6tfD$fXWPU $0 G0W4w wmfH$X6$0 =,6t>}t8h$v v贇 h$Yu EB6F0N411G9 v vGD$@=X6tȍL$A=,6AAhhR#Q" X6 ,6 tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=X6t2f)=X6t%ffD$=X6ffX6 )fD$1fM$0 A0Q4MT$ tjQkfHD$=X6tfPjUJv D$fEutEhR#Pkl$L$Aq $0 JR ωtljh^ $RQUW݅l$EMك9v%}EPhz $* $hk $qWD$$0 T$ 3F0V4=6h!$BڃD$=X6t΋D$p@ =,6X}$0 ~hF $v vڄ Eh$VJ6Bk $$0 1GPVtXD$T$ F0V4=6h!$tڃD$1HL$A A$0 1HL$A A11L$AA }t4*E)fEPUV D$fXSPU E$t'$0 G0W4jPEifH1G9$0 .1L$AA EL$fARQUY $EtMw\}.uVV4~0|Juh $ } .u8h $v v% Eh$ U4$F0V4=X6tȋ |69x6s5h $juv v݂h $T4$=,6E=X6tȃu}uE=X6tȃtb}u\FN U=X6tʋ4$h $jRQPX=X6t}Eh$T1 X6EtjPgC$0 A4y0 $$0 t=6!$=06JR u=X6tPjVRQ菁h $cSƋE=X6tjP1Ƀ=X6t fX61ہ@€@t f X6fG64$Crv $0 A4y0AI U=X6tʋ4$h$jRQP褀h $xR6zE=X6tjP)Ë@ C$0 A4y0AI $QPQPhRcE=X6l$\$tȋM=X6t1퍜$UQUPhScSh%!$$"Ph!$ %9-6thx!$誺l$\$ h $zQƃl$\$$0 A4y0| AI KC=,6taEO9tU$0 AI U=X6thM!$jRQP%GEh$Pu $ 6fO4$E  ^_[]ËM PSh\!$"ȃ=X6tUSWVT 66,=6t>)"=6kdPWVQh!$h36}ww cO W $T$ WGO ƀÄ:1=6t4=P6t+=06t"uGO 1F9ƺw1 tbQPc8uS=6xJ1v6KNj@ $GD$wOG tQPb8u E;-6|E;-6=4$h!$b"h$ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$D46pt =X6t ɡ46-X6L$Ltt tȉ݉D$PD$PRmu h!$!D$TPv6t$t$~tyD$ v6ΜL$QPt4t$t$af@jw wt$t$~t 661JQPFafp69)T^_[]fUSWVT1ۍT$1BL ؔ6x,@=6t;ؔ6p,kd1PVSQh"$h3t6ؔ6 6<\$11ۃVU衛VUm`$t$l$ 46pt<=X6tϋ 46X61҉|$Ltt<8tϋ 46X61҉|$PdtX 8Džtɋ$L$HQ$I'xtCVU誓tV=6VUh+"$^1=46L L tOjh"$s6tuQ1y1 t6 u_VUYdtl=6tHVUhU"$@7jh}"$$PxyQ 6P" jh\$D$P C6L$;JWD$ P`646tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$5\6`6ؔ6h($h($ udؔ6ǀh P5\6G 565\6,=X6t\6PP>5\6`6ؔ6@ ؔ6HHщ8<=6th/$=6uh$u_h 5ؔ65\6] 565\6&=X6t\6PP75\6'`66ؔ6D@RL҉111C QPh"*$[ ؔ6HLщ@D=6th/$ށ=6uh$h 5ؔ65\6v 565\6.%=X6t\6PP665\6@`66*HHPLщ8<҉@D1ۉ,6 466ؔ61Ƀ,=6hG*$1L$ ؔ6L9| 9PhB)$ؔ6=6th/$x=6uh($Ih 5ؔ65\6 565\6#=X6t\6PP45\6`66@hg*$L$>(6ؔ6ǀ,04ǀ(<HHPLщ8<҉@Dh P5\6E 565\6"=X6t\6PP45\6`66 466G?ؔ6L-=6th*$:h*$7$6ؔ6ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5\6 565\6!=X6t\6PP25\6`66=6t}=6uth 5ؔ65\6z 565\62!=X6t\6PP:2ؔ6ph5\6562 hd65H6=ؔ6VhE LVjP+2 G011D$)9|ËLG8 $HLOd t1SRPV5D66t0|$u)h*$h$s1AL$=T6tLSVV36 ؔ6A8$HLId t1SRPV5H6U=X6t SVV5 =ؔ6G0ŋ $A9l6 h6ʃƃVh p6VjP0 jw,6y9 |6x669؃s6É66C 6UPlƣ6US[6 Vh 6Fؔ6 $06=6 61Ƹ1ҽhWV5Ȕ65D6|56=665Ȕ6=LBALtl=6Hh',$Xh$11IPPQQPV7Ȕ6f@5Ȕ6+6 Ȕ6fA̔6FȃtvFjPhF,$ =6th$y=6uh$$nt1FȔ6f@5Ȕ65 Ȕ6fA̔6Ff=rmh{,$=6th/$y=6uh,$t0fFȔ6f@5Ȕ6,5 Ȕ6fA̔6Fffuzh,$=6th/$x=6uh$tt=11IPPQQPV6Ȕ6f@5Ȕ64 Ȕ6fA̔61Ff9D> <:PVQƱ D>/|)Ot$L$6ܝ62ܝ6$!D$h8Jܝ6$ D$tB?JL$h)PRQXSWVD$t$ |695x6r==6 ؔ6jSPV<)޹3394v t^_[PVh1$CWV|$ wu$ J'1XD$@uPw w Ph$*=6th2$Th1$t ^_Ph1$趽6USWV$\TM@$ 5uh`ȱh`VP =6t h2$ T=T61ۃL뀃=X6t\,L$UPQ DPPz$\, X6L$L$UPQ |$u $PP@1LDffLD@9u=X6t8PP\X6L$UQPn t"PP\L$UQPH  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h1$(USWV\$t$=6!ߋ,t9Xt6@u|$t&jZt1ɉH HHXh1^_[]h#2$VD$ L$56#p9tыR9u @^USWVt$|$VW/ؔ6!t7^Fu+11 33 1u{ 6tqt$0|$,\$(l$$T$6t9PtjRQ 6(Xxp L$ 6t9HtjQ56 6(Xxp ^_[]WV ؔ61!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$L'$1Aȋ$sY9UJ'ؔ61ɉSh4$=6th$>h$lt$" ؔ6QP#T$1RQQD$P1Aáؔ6;X0t$~~1Ƀ=46T$DT =X6|$t RPL$ pL$QSRP躒ǍPF6$|$1D$D$t1)ÉعF@jP贤D`r9w<$r$l$T1C @<$9uG<$;|$}ؔ6X0l$ot$|$oh\$ىh` PU -l$($|$ t$ t31T$ph` WP $@$9|$|$|$(1L$t1ɡؔ6@0)ȃ`T$1ۡ6ـ#h4$b=6th/$;h$ ع`֋,$L$t1ɉȉD$ օt$ tH ؔ6i0T$,RQUt$> ؔ6;A0l$,} $L$l$l$,ؔ6@0D$Mt$ |1TT1PD$T$ ʃ=X6t RP!L$(ωQM D$H 9tet$C9\$t$$h4$ 64$F4$;t$SD$`160^_[]ËL$ ʋ ؔ6f9u Shj4$褤D$`,t$$h4$lj ؔ6Ph4$CUSWVT$L$D$0(D$ X=X6tSUނʼnӉ OD$$ؔ6@09ʼn} t$t$5D$PSUt$< ؔ6;A0 t$~QPSU~t$4SUWt$T$LtL$A L$ Q5X6t9RPt$ƉT$ t$1ӋT$1 t<$G RQD11 u5\$$9t ;D$t`GPD$ GPWTt RP躁$<$G L$;L$t9ta щʼn$;D$t`1hn5$辢^_[]USWV 6$ؔ6x0UWt$0t$0Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PRɌ 6T$4$1B srl$,$ ȈU1wX=X6t 6!9GX=X6tȋL$,1Ph5$蚡 6L$ $  h5$y=6th/$7h$t$D$OPWTP1GTGP^_[]61USWV|$,[%$t`%$61@$ؔ6sll$ 6t6 L$  ƍD$1PQQVK9 ؔ6;A0-T$zu D$`1]l$z$Ń1EGpD$h D$ Pt$ u&xMt(T$h D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWh4$џ=6th5$m5h!5$Et3s ss3st$Vn[E;,$u68%t%#Ph4$0jUSWV0\$T|$HOX=X6t1D$,D$(D$$D$ D$D$PL$Qs tPst$OGX6҉L$D$td$PQp}É׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQ:C;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u3D$<3L$8 O>;h|8$('h7$h8$h h6$Ph7$O4$V0Vh}7$hj7$h h`7$hO7$hWVt$ F,t@6th8$(F,P1~,>d9~8uv0^_h7$h7$h h6$D$x,u@Pt P迕鷕h6$h6$h h6$WV΋I01t*N8~2IN8tPQP PlN0G;~4vɃ~8u^_h7$h7$h, h6${h7$h7$h2 USWVEH1Bx,T$1hwM1A04$4tOF~|$ D$ڍD$P|$Weu$v vu WS|u 6Mu1NjM4$F;q4vS腔e^_[]h6$h6$hF h6$USWVP΋I1HЅD$$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]h+8$hl8$hK h6$USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]h6$h7$h` h'7$h7$ha h6$USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]h6$h=7$hq h'7$h=7$hs h6$USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]h+8$h8$h~ h6$rfUSWV\$$|$ l$t$6t5H6SWUh8$USWV5H6 1^_[]USWV\$$|$ l$t$6t5D6SWUh8$4USWV5D61^_[]V= 6th9$Œ2j56HtahK9$腌h$+tS6xL~61 6 s"@Pt4hk9$ 66F;pL|^56vj6t'x,tP6P6á6t x,tt$t$t$t$P1WVt$|$ VW=46dtX=X6ts,ؔ6`uau33 u1@1^_WV 6t1 6 ؔ61!`u/aʀs2hlpx1Ph9$ԊPh9$h$gJh9$蹊ؔ6 ǀdƀah P5\6| 565\6=X6t\6PP5\6Ѱ`6ؔ6!1111QWRPjh6hh9$h$艶lh9$ۉؔ6 ǀdh P5\60{ 565\6=X6t\6PP5\6`6 ؔ6dPs+aʀu Ph9$Ph$:$h$蟵h :$ؔ6ǀdƀah P5\6Iz 565\6=X6t\6PP 5\6`6^_jUSWV1L$ AL$HAL$@AL$<L$ 0]'L$A ,]'A(]'A$]']u }h:$SVdw ka~(bt@it YltAsttuJD$PWS/5uVPD$DPD$DPD$,PW*D$HPW$ D$ PWy&uhL'jBƉe^_[]Ãu95ԏ3ujh$]'D$PQ u1PPD$Pj$u95ԏ3t$Dt$Djt$0t$0Sw*!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQJpRPt$8t$@t$8t$@WT4u2h:$R1PPt$8t$@t$8t$@}W&4%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQs ]Skt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ Syt$\D$Ph #hVnD$@w ww7VPh_;$S  1h:$+h:;$W fUSWV1L$(AL$$t$@L$ D$ }] h;$WS6s aLuKVbtit'cD$ Pu"D$(Pu D$$Pu!udt AuZD$ 9ԏ3u~]#D1غ$Phzd@ tN|$$tOhM'jt$ Æt$@跆1Oe^_[]hM'j11J$THPT$,L$(HL$x1VVVVV]PT$4 @T$ƋD$(D$8D$,D$4D$$D$$P 1^_[]PL$T$ D$$jP XUSWV$$$jUWSt"ƸEFI 3PART3N t+Vtz1h!>$S51K؁Đ^_[]ËV FFt5$1I1,13 DM'C9uы$$$19FًnTnP1$1ۃFHVLWT$RD$PQ)|$ t)t$1K1 713DM'F9uӋt$$;^X |6$$ ȸ>$t>$Q$Ph>$UF1C$11ɋ$ )SVPjSRU$ 1K1 $)jWQjt$vLvH$~ 1Ʌ\ S $FVP1$^Tjh$]'S? l$k,S(C K$)̓$$|BSh$hD$P^Ut$s$s D$ Ph>$$C K$jSjUt$QP$ l$EhVPE$9.1C]2UWh->$S$$1Kt$t$hQ>$Pftt$t$hu>$UGP5wSWVPt$|$\$$0PS  ^_[PD$tu-Ph#[D$ L$ $QPh j \XUSWV\$,|$(hjokƋl$8L$4D$0D$$V<QPڜ($D%== t =`Di Qhd@X nk x16Wh>$U#h3?$D$4 蠿8hWVf hh W& $D$u i =D$l$1WSUR݉ 9|%RPh?$V],h??$VJ|$$T$tRPUWSh@$VT$ D$RPV$ t D$11WWPW1@PjPVq$L$jEWhd@d ttۉhq?$ $jSUWA tRSUWh?$V-*hWVd h'?$hZ?$h?$$8hBh?$u\D$ D$8,(VG) ,(h{@$V8'jV#"tH h1@$1ɅtVA I$ tJ;$T$s?jQPV\u-h@$Vt P$ Vq1^_[]hV@$USWV Ӊ΋l$ jURQtn=Uuq1tu@ yyu݅tj ud1PPhUE$VPh!>$V tUSh.E$V"Wq\tUShhE$V|UShE$V1@PWPjPUSV D$@\$4$1= uD$ Pt$hE$t$  $|(1RVRUPQhE$t$D ^_[]Vt$jV%tOjV tAjVjVtt@ hA$ h/A$hTA$V 1^USWVPD$H qTqPl$ 1Ҹt, $] 1H1,;13DM'G9uЋl$ $|$AXAA t#1J1113DM'F9uҋ|$Q1u:t$WtUWuA$nA$PW1N^_[]ËD$uP hA$P1ËD$ P SWV|$ËL$T$D$@f@@f@փ|fp fx^_[ËL$D$@ @TD$ A ËD$@ @TD$A ËD$ @ @TD$A USWVD$ t$hx t11t0Vh#h3D$4C9uP荦hCY$S=A$D$ t# A$#$L$Ru0QShA$h3~D$<r31F4$t0t$h#ShA$h3KD$@ F9u1H^_[]ËD$j$,(诤USWV|$(jWujWthA$W1Nڃ^_[]1VVVjW tSӉ$Ճ$ՋD$49L$0t$,s,11Ʌ,Eȉ h!B$s,$ʃЃ,$9Չ|ˉ$|$(Wxt h$\$SbjPjt$ t$jjW# X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PW\Sl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQPRE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W t $p q  H @AQ@A$Q @QHALhtB$SghB$hB$USWVP\$|$tus$" $&"$jd`tQ1@PVSjPt$8t$8W E1u>4$hE$W VfShD$W4$hD$W 1H^_[]UWV} uOʃt=|RQPhB$VUJPRVx& $T$W1ٹ|$5t=hB$ 5t=h"V 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjh$]'Vw, 1OujV5t=yMuW?,VQ>~IhC$Qp1$VQ7 t1PhC$Q= 1O^_SWVP|$1N?u\j S5t=+ 8u1u/|$ί8u į5t=h"W ^_[WV|$1N?t5t=DS1t^_hD$t$zUSWV 1N1;B} e^_[]É׉ $D$ j P5t= у|҉Ӊ‹D$ R~st btSuxtZbt tOBuxt]D$P5t=ATxL$T$$$jST$ RL$Q  tXS?$$ىډWT$$jD$ PST$Ru t)t$hE$t$ D$D$G D$_1USWVt$1191A;BB|z$u z,1O9$SSljF$eoZC$t9KCKʃ| 33O .CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$PD$Ps,jh$]'t$($ tjVt$($ jQV$Ѓ $V I iTh j$U$  V tZs0wh2C$V1t^_[]1;BB ,Fjh$]'P' 1Ʌ 1OUSWV|$W1Ntal$ \$jUPӃ W tB jUp Ӄ  W tD$p0hBC$W 1^_[]ËD$L$stitau1t$QT$ t$ Q/1PhLC$Q= 1HUSWVt$|$ t)l$\$$jWUS_ tWUShC$1huC$VD*l$(\$$jWUS, tWUShC$V1H^_[]Ã|jWUSF11USWV\$1s3hJ%5t=x t^1WQ',tuWhC$t$ 1NQ'Q' ChJ%j Džu^_[]WV|$ Q'Q'WhD$u^_USWV t$@\$46X'PWhpL$UPWUT$@ toN8jHQt$VP-$H(K$t$11+D$t$9L$w‹t$V n$SV(n,l$ $G9%4$_C^_[]V1ND$~t!t#u%0t,u PhL$t$& ^WVL$ vAw$R'11H$R'tuh|$t$ #r?Qh,L$j@h46轤46*81 *#X'PWhL$V^_ÐUSWVP|$u*t$V&ljjVthL$hTY'j jVjV jVjVt;ƅ tDE h$1݋@ 1 t:ފPheM$V G t0ƅ uh3M$t,uLjj2hM$V^1M^_[]Ät +Ai UPtσ tu'SWtjjtjV1u1UjUUV t|jUUVtu1hUPD$ 胇 $fǀUUSWP1@Pt$jUPUUV PVt'hM$V:h?=$hT=$hf=$VUSWV΃tuw&"""&"jp Rp pt$,t$,Vh Et1PV2t*SWhN$V1(RhM$VGWhM$WhM$V 1H^_[]USWV Ӊt$$t$$RQ1Ot, D$&"$"! D$"$&"8$s p ՉT$\ Eh @EMKM$E OEHMLEu UED$0Vt+t$t$hRN$V[1%ShM$V 4$h5N$VR 1O ^_[]ÐUSWV4\$Pl$LT$H1 F0#hN$SU) tPVW u9-ԏ3ujh51VWNhhY'j4^_[]ËD$ 0]'H ,]'H (]'H $]'fUSWVX1L$ AL$A\$HCL$ u} D$hN$VW( bt(t?qt0PSD$PD$,PuFulD$Pu7D$9=ԏ3uHD$|$|YutJL$T$xupt 81ϋX1 t$@uh|Y'j}Ɖe^_[]Ét$ t$Lt$Lt$t$0t$0}W!1NtƉT$4D$\$ D$ D$D$$$WtCD$@PWjh$]'D$LP tXj$t$t$ uD$0T$,WL$T$4t9_t0uhN$uShUD$W \$8ЃG_ D$|X\$<É1؋\$<1 L$u>D$ $t|$$L$|$t$,t$4RQNL$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh/O$P%1D$Bh/O$ D$_$ӃD$DL$H(X,EPt$@E X,L$H(u}4$t$w7t$HhPO$u-1fUSWVPM(,|$8O] D$1h{O$uS{% sujsWVVu utqD$9ԏ31t$r> E+u(ljށD$D$Mj@$PVw tPFdL$9wȉD$WMj@$PVw tPdL$9wȉD$u|$D$ ?L$>G CVhvS$\E$S$PSw71P E$G$PSw w1P \$|$tD> 1@D$,$t$|$@u  jhWVƉE ك@T$dt$`wQj h#|$Wt$PVE x'D$`D$t$ \$\,$]S$t$ tnf"tRS$Vt$ P|$pWl$pUl$9~?r1D$Q$tQ$Vt$ L$( PĀD$D$D^_[]WVtfy8tH8|$jmWj$Q軞hR$j3ƉjWP t Vj3$1t^_USWVLՉ΋|$hT$dD$l u&L$pj@\$SPt$t|$xÅuE4$\$ЉL$`щjj h#UPjSŲ yD$4$T$dWRVhS$;tShӤ$j ~P^_[]fUSWVDt$`l$\\$XT$1 0]'A ,]'A(]'A$]'B0OT$` h\T$VUQ k)Hw]r$uStJPSLu7HsutPD$PS@ uh\Z'jPD^_[]1Hu߅tjh$]'D$P t9-ԏ3uPhSD$PS蟷벃luhXl&1뜋D$L$Q P QPIHfUSWV(]1L$L$AL$A} uhT$SW1 a~bt)iuRt7D$PV"uUt$D$PV薺tD$PV藳uhpZ'j4e^_[]ÃluhXl&1u΋D$ |$|HVt;L$L$ L$ L$xuXt3L$ P3T$ t @u\$p9=ԏ3d1t$t$PPt$ViUfUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AL$ At$H 6H 6@6 6h616F6F6F6F^Vt$|$uD$ h606FD6F@6F<6F8^fUSWV$$$ #h1"WV ou-t=95ԏ3&m 1O$QhlX$D$P $vƋFHt$ $H]'l ^ hSh&PD$ xþ1${sl Wh{T$P] Ph=#V CPhX$V CPhX$V uCPhX$V ZCPhkl&V ?CPhX$V| $CPhX$Va  CPhX$VF CPhX$V+ C PhX$V C PhY$V CPhY$V <$u贖 $lVt$O! WGU $ɿt$ D$tQhxX$P D$Ph;=$t$ rp~ j wh/Y$P1 fG8Ph #h\$SfSh8Y$V 4GPZPh:$V] VhX$貕 $i D$$$Fo~ 1Ci OƉSh{T$V )Wh #hD$PD$Phkl&V< Wh #hD$PaD$Ph8Y$V wwhs%V: wwh\%V w$w h@#V l(jm$Pj$W$t$Ph$Vr ,Vt$蝛 C$$L$ AA H94$hxY$t$ } t$hX$t$` t$ v8t$Xv t$r h #U$IhQ$UrPV(3tkSF`hh]'j4V hY$$81ORt$ 1O4$Ԧ 6h(3V'V 1*Uh<$$虔 V t$萦 ^_[]ÅtVv hVX$hY$h hX$hnY$hhGY$h=Y$hh&X$OfUSWV]} #D$D$ hY$SW iu5t=tFumD$ D$9=ԏ3uUj]$,(DǃD$T$ЃD$,jS}t%D$t6hY$h|]'j艞jSI D$ tjS1tD$t hL$w@h #VFY$tQv "hlX$P/j )j$PN hX$Vj h/Y$D$ Pi jhP^N D$0Ph:$t$ D$0$L$ 11t$ L$ D$Ph8Y$t$( bD$\Pt$ tpt$hZ$S> 1O1P V 0hY$hY$S V輣 hY$St$蝣 ֋D$+D$ L$,D$D$@L$$L$u$L$4fL$fB$PhY$S $PhY$S t$(p Åt$(蚢 $fǀU1PPPEh0!ƒ[u$t$貳 ;$4t$8 D$t$ fËt$01 |$lD$Phkl&S D$lPt$SD$Ph8Y$S` D$|Pt$$Phs%S `$Ph\%S B$Ph@#S} $D$Ph$S tj$$Pt$ 臄 D$DPh{T$S D$D9M$ $ȃhL$pQP t$~ Åt$訠 U$61QQPy.!ƒ~t$ M$$VP轱 9U]$|$$D$jRP.!ƒ=M$$VPd 9E$1SP|$WG GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$ljhR\$^T$0L$4 tH)Љ|M1KE8/$;E81$;tyh=\$jh[\$*^PhC%^ha\$ ^L$(D$, t )|1h[\$]WhC%]$;|$tv vSj \6D$1P賚@ ^_[]h[$h[$ h;n$hw8&j USWV $Sh^'U Ǿ_'󥍌$)QAQ tqq‰QqT$,Q q$Q(q,T$HQ0q4A8A<i@YDAHT43qL1ATAPAXkiA\j\$A`i Adz\$Ah!i Al\$ApuQ$0$0 ^_[]ËL$L$ USWVuE X8D$Ph%#V |$V V t(C 1Љًx(L$I$1 sD$PD$D$ t2t$ ^ {uWv4u{u C $\$uoh^$D$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$  E0t!t+M4S9rQSP  0t,h^$ MHtU4uL9rRQPw  t$|$t%u@uhVM tI881tSul|$tDEM9rQWP&  u@u`V u@yu@u`V teEptUt$8ЃtEu8uXV t, ^_[]hr^$hN]$Ahr^$h[$5hr^$h^$)u\u\h^$udSh^$j wlh$j3 fUSWVt$J 1tvt$K t[S tCP!V Vt$2N tPUWSO uWƇ S 1S WGJ ^_[]USWVu]Ph^$S t$f1j?1Nt}ǍD$ Ph٬$SA td\$ t\hjD$PA3 jS\$S ShiW2 t$E L$Uf jQh^$P~ je^_[]PPh٬$t$ u1$YVPt$ t$t$V tPh٬$V u1$^USWVt$t$K t Nj\$ Pf 9v6? 61N*Ƌl$Wf VPUN  )SjU2 ^_[]USWVt$t$#K t?Nj\$ Pf 9s9Ƌl$W-f VPU )SjU1 x5 k5?1N^_[]UPh7&u t$151H]USWV@uPh^$V ] hX_$VNJ tPqe |$ P\$$ShiV\@ |$ jSc PhX_$u 4L V詄 ۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jP^c t!PhX_$SK VN 1He^_[]h>%hU_$hh^$-WV|$$hX_$WNI t;P?d u1Vad jPV# VhiWQ? t^_hb_$hR_$jVh^$-h_$j V6h43V V Ȟ6hGV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPh_$hV>tVh_$KV"FߋD$t$j7QPh_$hV>tVh_$MKV"F߁^UVuPhg$V& t3$L$ AQhiV= u h g$W1e^]h>%hg$hha$+UVuPhCg$V t3$L$ AQhiVe= u hGg$1e^]h>%h>g$hha$+UWV}W#ƉPh5$W; tZt4$P<tW@PVH` tGPhf$u H t>VW1e^_]h>%hRg$hha$q*hf$hRg$hag$ hRg$h{g$j hf$t$F tPhf$t$IH HhS&hf$hha$*WVPt$|$D$PVW tKD$tUh^$WE tPh^$VG H^_hS&hf$hha$)hf$h^$j- h^$j SWV$hb$SFE t]P9` GAsdWt^WPhb$StNpxPhiS3; u?V1}/1HĐ^_[hg$hg$hg$j@ h,c$jd USWV 1CCj7Shxi Pi uhIf$?,$Puhbf$#Ɖl$D$Shxi W( u hf$j $L$9~D$~*1t j FSh$RGG;|$|j ^FVj[>USWVHj'D$@j'D$%hf$hfha$i"USWVuPh`$V tg|$ WhiVO4 t$L$x f D$1H01҉ʉ$T$Hf!D$WhiV4 1؍e^_[]h>%hf$h0ha$!UVuPh`$V t,jt$V 4 1u"hf$h$) '1He^]WVPt$V't&ǍD$Pt$V> u Wh9c$j P7D$L$AËD$L$AËD$L$AËD$L$AËD$ 93931ËD$ 93931ËD$ 93931ËD$ 93931ËD$H@93 931SV\$ Sh931uCЃ r"CrCr &01H^[h93H?r & ؈931ыL$t 61ÍAЃ r)Aw AwÉ+&1HUSWV1t$ D$hVPA" 93x6t8u^6ǁ666 6$6(6,6064686<6@6D6@wh93R&uhe$0h939&uhe$ht93 &u he$j@ $593tvh43%61N6O6P683tt93$h93$U ƃV B~>CNP6F v/FwD$Wu4D$P1VhVVj V5t= \69t$:*ƀ6l `C Lvms9383u$63S6T6rR6W6D$P1VhVVj V5t= X69t$taYN6>O6OV6CatTl5$63+wtz839t93 63$ÿ53؉$83ԏ3 T6$u =W6uB=&6=O6=N6u|t =W6u =6uftu^W6uS$ttH)ŋ$L$ T$ RQL$QWPU%u2 u&hq"h,a$,5t=hn&j躺 t$PD$P & u hGa$D$t,DtVPyDžuhq"hTa$JW WtS)uhq"hN]$Wuhq"h[$93t H9t@hq"hpa$$@ t%VWЃ$Wj0ha$hq"h*ha$0USWV7@1 uhh$h,a$j諹 Ƹ93jmP##th$jL93Pth$USWh h$h3;93t VSm#h$u#WWWWWQWhh$h3U;$V p j/V 931tT$q9t Iu^WVΉhjW D$Ph#g$V tZhP%V4 tQPP L$PyRPQ WhiV* u h.g$bĔ^_hS&hg$hha$WV h8d$Q[4 t;PLO  u1WnO j PW0 Whui V^* t ^_hf$hf$hiha$h>f$j讷 hb$e1ÃD$ 1ɉJJJ JJ BRhiP) t1hc$jU $1ɉJJRhiP) u 1Đh,c$j Qh93KUSWV΅t RL0 b. [. 0($D$Pm!\$D$1t$$tsVLsD$tVP/Vh٬$W trC=Q6D$uCt\=R6uCuM=V6uCt>=U6uLhj$V  VhiWn( t!$uۋt$$4u=T6t ~ j q4h(3sWt& 93ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhc$h$V VUhd$4 jl$U$VS Vhit$ t$,$t!Phd$@4Vh d$蠰,$jt$V Vh~it$ t$tPh)d$3j 3ꍄ$P$$ j:QPh?d$h$P$t'$Uhd$r3U E}uj:$$h?d$h$Pf$t'$Uhd$3Un E}u-934$tVWUmuj|$W$V谸 $$ DŽ$@Vhit$V4 u$ hd$21@Pl$U%jWl$0UK 1@D$81D$ USWV Ӊ΋|$4h8d$Qd* tPE 1EUhvi Vv j UC Ph8d$ST, Vd H ^_[]VD$tL#t$jj QPRjV&` V .#uz#PVhe$--у #t.#Qh=##PRh#he$, ^WVΉhjW: WhiV tD$Ĕ^_ÐSWV$h?.%V ) u6h+k$V( u$hdj$V( uhl$V( tDd6 `6=h6!lj=d6hjS {Sh7iV t Đ^_[hoj$j2 Vt$V'Ph$+tV蘤tPh|j$+t$V٤t%L$ PQh%r+ V蹤J%uߋD$=rPhj$D+^USWV$WW1ɃtQÉ1 jVU述 Uh8i(S` D$ sjPkQƉD$$Uh8i(S# :t$~Phj$p*h%t$D$;D$t(h$H*h%t$ ej)M)j C)\$#|$h%l$*1AHl'9xu H uh]&)t$(hjV:  Vhi$ St$<\$8h%l$)8j$j'Qt8u 9A uVh/l$G) Vhj$31#X4h#h%) j .(jmtz D$ ~[11ۋ!9uIuUԠPhj$(hj$(hj$4j 'D$ 1AC9|M rVļ^_[]PVh[$$hj$hN]$h"hj$ hj$hj$j蕨 Vjmul6hTVV2^hk$j\ h3jjHhGl$UVuU OPhk$V t!#d6 $ d61e^]h>%hk$hh4k$?USWV(ӉQtohk$U# td6H1 Rh8i(U u f8uIjhk$S t)D$d6t(^_[]h[$Vhk$j hk$hk$hj$j, SWVt$T$;h?.%VO# t\Ƌd6Pj> V/> PWt+Ɖ߁PWt2 Éd611H^_[h%hk$hh4k$hk$WV֋|$ QVWPhk$j5 WVPt$T$th+k$V" tkP= Vn= PW4t>ƉPV5d6̠ ǣ`6V1u d6$h#Z1H^_h%h l$hh4k$WVPt$T$hdj$V! tbP= V< PW茯tIƉPV5d6$ ǣh6Vu1u! d6$h# 1H^_USWVt$T$1hl$VE! thƋ-d6P`< V%< PWt6ƉPW裞t>V ݉-d611H^_[]h%hl$h2h4k$h"?$fSWV|$ t= 1H>t$|$\$jD PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$V9 tE$$PwCt/$F ~G F1g  Z  1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QP Ɖ׃с11E9r 8"t$8t 1H^_[];sC| C 9s} "WV^ t/t$ L$Ps(,tD$$F ^C F1S  USWVuD$ tV} ]CtP7x tEC tP7b u/D$ Ph7&7 u$D$1$1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V0t|$,$hJ%W$D$&tD$1{tj/t$(tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$HD$4D$4D$ PD$8Pt$ t$ ÅuD$ xK1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxr1X \$TfD$t7|$0j WP苜 t9t1ۉD$=r["11HD$$P肻|$1OL$L$D$L$T$PQRhl$Vf 1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$PNjD$fVSP sD$ t P4$W.4 WT<4$uM S]s {te|$t^t$Vt$t_@PW3 WtNVsE0. ߉VuT ۉt3EF ^C F1Vt$hl$hl$hl$hag$ hl$h{g$jQ WVt$tVAr1H^_V t3t$L$|$ Pwt΋D$F ~G F1 USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'<$t@1@>}.1-t PR 1GG GGM1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7 t+{0t>-uUsft>VsVt)ud W1H^_[]Ís s(CtP7 uCtP7y t1@뿋C$1$l'4v6 !6 Po:  v6@ tMtk $t$ 4$UQ%hs$hNhHr$khs$j VPt$ D$Ph%V9 t!D$ Pt 1^h>%hFs$h4hHr$hOs$j蜆 VPt$ D$Pht$V֥ t!D$IPxt 1^h>%hjs$hAhHr$hts$j9 WV$t$0j!jWD D$j Ph%V袶t$WhiV t1$^_hr$hr$j觅 hs$j˅ UWV uPht$V_ t<|$WhiV t=$D$WhiV t)1e^_]h>%hs$hhHr$hr$hr$j@ USWVx$t$xhVhbo$W&^1@D$D$1L$8DL@uVhs$jVhs$5 u$D$ 3DAt\~:uVЍ\$C1|$8+jPWhJ%Vƃ uր>$t^hs$D$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh8r$jɃ 1Hx^_[]hs$hs$jo WV0t$<|$jWhPo$V萴t8W t7HfJBRhiV t!10^_h's$hs$Wh2s$j hho$j SWV6h;3VS6h;3W@VgW^6h$V36hzWȤ6h{SVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UW& Whi$ U $!h9t$i$HQPۍ\$4|$fGWhiU t$@t$f|$*uJt$=O6t PfD$(WhiU t$St$f|$*u]t$=O6t P|$fG WhiU t2D$*=) Phht$=O6t hpt$wfD$(IWhiU> t2D$*=) Phvt$B=O6t ht$*1Shi8U |$Dht$1tPDL@uShi8U t$HuM1|TuD@uD$L|C3L$P9Dzty:t|$jQhs$> uVht$\11t j,jDLxPtT hs$&v<u h2$j $PhiU tDht$$t$ht$ hLf#j PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJR5 Pht$7$=tPht$j 0$=tPht$^_[]Pht$j~ h3jhht$_ÃD$1ɉJJ JJ fBRhiPm t1hho$j} 8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h8r$j} USWV,$@$PhiV tr$A jjj"^ xgljj2 xi$-hSW K xB$/uE$0uf$Ciu.ho$x1H ho$xho$xWK 1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'hGp$hŨ%hCp$h>p$hq$hro$hxp$QL$4Qhp$(D$f($-D$](E!L$:!PS E P0 $EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q Ф6t Ф6EѤ6tIAtcAtCAtPA tSA@tBAyAAT$hФ6UWt$PVt$D$VPRRhLp$,l$ }"E!Ê<)\<$0n'=O6`Cs|$[VPWl$Phwp$hp$#<*<0<2=O6<$}p$<tp$sQh$ST#1L;#yq$QRPhCL#GJ%9u<]K%C=Php$h$=O6S<$CPhp$KPhp$K s k t?L$D$Fp$PWh%f N) &܋L$D$(Mu} L$D$D$Fp$PtPtPu4q$q$ 'q$"QPh% N) &D$ŋL$D$(ȉ</=O6%<C<$dn'q$=O6CPhp$=O6CKSRQPhp$hp$-C~@sFNuQPhp$ IRQPhp$Muj>l$ L=O6?CPhp$(shp$h$=O6<$CPhp$hKPhp$RCk tAt$D$xp$\PVh% O) &܋D$t$)E}twt$D$pp$ttu4q$q$ 'q$"QPh% N) &D$<t$)ƃl$ rPhp$dj>z<$€q$$Pn'q$rQ=PuJC<u;hp$h$=O6yCKQPh>q$ ]=O6Pȹp$6<"<-r$q$ q$q$q$q$q$q$r$r$r$r$r$hp$h$=O6<$CPhcq$1D3 #tq$T3 ׃l3 URWPQr'hqq$uj>l$ <3r$(r$CPCHÃ)gj zEŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]ho$ho$jr WVD$(1www ww7fWfGfGwWhiQ6 uho$n1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQB ;l$D$tD...P7^_[]Wh$Q 1<$tɍGrD$X1.Ph*#Ss E;,$sGwUSWV։ϋ\$Qh$eW)Ǎ 9~)j<]t+~'K1.Ph*#9t OE܄u j-j>^_[]ø wr'ø"øSwr'ø"VPt$ D$Phr$V tD$P^h>%hr$hhHr$$VPt$ D$PhTt$V讍 tD$P^h>%hr$hhHr$WVt$(|$WhiV tgD$Phr$VF t7D$D$WhiV 1uhr$$l1H^_h>%hr$hhHr$Ohr$jo fUSWV8蔂 y hzu$kh%T y hu$kjhu$م t\=qL$jQP D$tPhw$`kjhu$聅  D=31 VPh  VPUSWQRPh`$1EVRQUhBVWh. 1H\$(C CCVWPPUPP P P PPPPS8VSj`; |$www wwVWj VWj V*= S!= W= D$ @ )T$VVQRWP41I9u 8tމ56 D=3tщ1@8^_[]hw$ij jj| hw$菃 u8w$jV蛃 tw$jh*$hw$Vh"h,% j j USWV`~ZD$=6tIt@ƍD$H@ L$1jQRRjP6ut$Vhw$< 1t$HFFF FF1G>\$SVjq l$ UVWb *nƅZD=31OjUj t:9uB$=hv$jV:  8uh D=39tttn1VSj VD$$Pj D=3vhKv$@jjjA 1VSj VU6hzv$1=D=3u$=|$ u'1VSjG VWj; `^_[]Ét҃t̓ u1Ht$8F FFV"8 Phv$u1u$WV? tu$D$8x xx8WPV7 "{jhu$h# ,%SWh Wh'v$j:*VSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[á6H 6t$Vt$VPhu$ij)VeD=3VPD$$Ht5t$ I?r$ !P$Ѕuσ^PD$L$ $QPjҟ 裟XWV1N=6tED$@ L$1҉RRQWjP舜t4$ hv$^_VQY9 jhs'J7 jV7 tP`t^VhOw$>jBVhaw$)j-PD$L$ $QPj XPD$L$ $QPjў 袞j (XÐUSWV$$D$D$D$,D1H$11D$hw$WSo f~/P w`1A$s'5t=M D$u[FtR=5t=D$,D$낃gt=8#u(@j L$ QPad $D$8Lt=Pk@$)t=8#u)@j L$ QPd D$D$8t=L$QP j D$ P5t=c D$D$8c1Fj D$ P5t=c $D$85t=hw$8ԏ3<=6u-6~q561ۋtVPuJVh$FtPhy$FtPhy$j -6C 9|?,u)É\$(k <D$jw D$Pw Gx$Cpt$$tctUb)`D$ H|$l$D$|$D$1D$ E L$ D$ D$(1l$01ɉQD$ P4 D4D$8u 8tz`Xt$76u 6-6CPV6t Mu|$ uD$4$l$0t$F9LD$ D$D$(t u t$4,1(|$@D$4WPUT$8 ƉT$ D$|$l$L$ Ձ ͅt UP ju |$tt$ VUWw  UWV4 f8C|$$8D$@PWEtD$H\$|$tD$`1L$d3L$  u1ۋD$H1tWt!t$ VUWHw #|$$tS9u$UW3 RW5 $D$utSPW?5 uWhx$^1ļ^_[]Ë 3DQu#UUt$hh"UCth$U1u#4$suK {%LtD Åu+h|z$Ut$uKD$Ph$P[ kK1PPWs Vt$st1EC Å $$ 4hV0[ Ã<$L$hz$$ 4at$\jS) ƃut8$hSVi j/Vt@V@9vHH9wr$jP) ƃh 6hzd@V iD$PhedAVΣ V) 1tS胱DaFk<$$P$ 4H D$tVH u=VG u0$ 4kH u$ 4G Hŋxh>#W蚲t(hh"W舲th$Wv!mh|z$U[u8t(ʼnD$u$ ʼnD$G$w utƉD$u$ ƉD$z$PgG tNjh|z$S豱tG Ƥ1$UhSfX  1ۉSSSWt$t$t$D$jP}; Dž~11D$4$P u L$ Ou1wVa' 1=6t36,$9ȉ}!w 4tu'1v't1PPPPt$t$$ tʼnĨ ^_[]hWz$jW VSh$jW $ 4hz$hN$ዄ$ 4hz$뻍$PSh$shz$SWVP΋9tRWh]}$SR_WZs RL]^_[苼PPPh}$h3IjUSWV11C:nu~ou 1@$1$Q\hJ%D$P3 t<18nuxot,$VP詉thJ%jp3 ut$r^_[]USWVPωjP@9 1~:Ë,$WPtWPt Ku^_[]USWVӉ͋$|$(WV t2\$$$ $t([u%D$ =Vhz$Qd)h"S1ɅL$ $|$ uf|$(/u $u&K$D$$jP8 Él$|$$jhz$V ōjZD$ PD$0Pج u-t L$PVQ诬  Ku|$(l$$t Nb#t ># t h"%v'$, PWj tq$ mhN$D$ h"1ۀ=6u =6h{$Pj t$Wh{$a%v'jj@ZD$|$ tjhz$U舫 t?$ٺ"st$(Uh5{$ $(Uh $hP$DŽ$0ffsDŽ$,t_puDŽ$(moun$D$$(D$D$$(hJ%Pm1G@F9NjD$|,6VPY ɉD$t3o-uj=Sބt6CD$j$hJ%$,PÅu 1G 1GD$D$D$L$ D$L$(LD$D=6$u 6tQh={$|&1G1D$4h%xF9uj 1ۀ=6$tD$P#h u hf#M9S|$(t_ƅ$t Pmt$~m$u |$ $H$tt4$2hSB#'M$t P(mt$m$(t$ jj WSt$ ~)D$ u|$ jWt$ 탼$u$(h(3P?|$($(jPV t"$(؃tTu*tGhY#FL1C؁^_[]ÁttP5PWh:G#b 1ۃ$u1ۃ=6u 6t$, Pt$,V t$, Vhv{$=6uj*$t7t$ 1FV Vt$ne u hC{$lK[%s'$($(SPh%hWot$W2M 8tD$(PWh[$K uԵ8u$(QD$,PQhc{$Jj]USWV ˁD$Pj VL$ Qh{$8#+t$1s'Gt6t =6t#$t#FwPh% G!Ņt G tu'rt4$t#U#t.#FUQPh{$1tK$t#FPh{$tXt 0h$ h #F=6$t#FstspPh{$=6$t#Ph$sds`sTsPh{$slshs\sXh{$=6|Ut$ 1|$$hVPPh"Pt$u(|$ t!j VtVWh|$] hd%B#t$Ph$/^_[]WVt$t-t|$ PW&tuܥ64 1ܥ6^_WVD$ 18nuxou ܥ6PVt_1,tu@APWtCƉ8j,W~1Gt@Gj,P}'h}&Gh"GWg1^_fWVt$ |$7 WVUSWV$$l$WVSU$$hhU3Wh"6_ uWVh4"jK D$@t.D$t$QPhw'hVaVjUSWV$$$1hWS跭 8D$$81G=l==ԏ3D$ C|D$D$1D$h}$UVR T~H wV$v' $׃Gt!M5t=L$ 뱀L$5t=-$Ax|$뎃UL$5t=($At|$_ $V $M5t=L$|$0P$hWz@$N|dže^_[]hn"jA t$hT$Ph~$h3 j-WVPt$jWV:> 9u9t x^_Vt$h"j@ Vt$VoEt@^h%#V^Vt$VkJt@^h8%V|^WVPt$jWV= 9t9u x^_Vh"jl@ WVt$|$ VW苜 t$?/tWhc"Vh|"^_WhN"jS@ fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh$T uI躦8KD$  =l6%D$ Vt$S jHSt$D$@D$ $p QPhd'hVyVD$tS\$O$oj j ShWt$ P螅tP葕Ph!$t$ SWh1$设t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@hP$p81p^_[]WVh4"j> j{SWV\$D$@u+t$4It;SP t7VZ1 6C6C^_[h}&jF> jUSWVPL$$T$ l$\$1$1=3֍zh>$USE @~7M${'OӃ23=h6l6먀'룋 t=DF@N@늋 t=IF(NnOe t=R>3KF ? >30O' t=aF8N d6O t=g\PnD$ p4t$ N @OPt$(h|'5t=:Ƌ$t d6t'tOt@tO t=h6l6 s=l6h6g@tOy  >3sg st1A T$ J sh%#VR8p6$fyhZ%V78L$ A$I$shf$V8L$ A I$shl$V7L$ A$I$shu$V7L$ A3WP t=1$PPhPj\6t=1$PPhPho6rt=06a1@D$(St=1LA%PPhPj%6(t=1Ȍ$PPjcPPh?3=t=h8%Wvh%#Wv <6P6=@6@6=D6=t=yW!@t=1$PPhPj?`6Bt=1$PPhPjp?31Gh3Wj>h9$]P=L6<$=t=hA%WuuT6G=t=1 $PPjPPd?31@D$$t=1#PPjPPj@6mt=1 $PPhPh<X6P9t=1$PPhPjd6 =t==46j:WPNAj/W=N.?y86t=빴$l$0UU݋\$UW|$Pv l6h6s3DH,WeD$hM%Wthh&Wt$6W <6N1/$PPhPj l?3,H6 3DHWD$<$$6h)$ԏ3=d?3_=<6tVh$z5t=h$j5t=hx$ZhY$Phn"jZ Wh$9Wh$.D$ =@6u1=D6@@6$1󫍄$B,6Al$$+D$ -D6t1$ 1D$$$MljL$$ PWZ?t$h$X6l$Ul$RQPl $׉ȉ h6=l61| h$$t/$$T$9‰sQt$t$WPhŇ$tFtA X6WPUk u5l65h6t$h$|$(F=$PU谚 uRt$h#$: A#$=`hp6h$1=P6 $VhMu Vh7$al$VjD$Px h6-X6-l6݃=@6~VUWt$hQ$|>9|Pt$t$  )̓ }4$=1\$l$ 66ɋ|$  6=86 l65h6σ|,@σ|1ҿ9  X69|щ 6|$ D=P6Ejjhp6 .hp6h7$6=86t686t&hQh$I 866t=|hPh$  =(6u1=61@(6=`6u 6`6=h?3,=$6t#jh`$h8$h-$轝$6=\6u=d?36\6t$t$ t$4Ut$$Vt$t 9t V! t U =D69$PtEztƃh$IEj wPh}$jd$ P͐E% j j j hC%}( t6$X6h6ApQt,6@jxQP$Ph$=& gx0ՈVh}$jd$ P0$\ $|$8jDU$P $PSjju/jZ$P$dPi u$<mfsjWV 9uD$8%PCGP$Ph$h$|$D$D$4jP $u/hp6hJ$$Phv{$jX hY#j  /dev3p6 t6/ D$ u6tD$ p6<$~~l$4 $jWh#"h u ƃrl$Wl$$UiMGWU i:l$ ʼn\$4Ë$H$|$06\$L$ u D06$dT$dž,<tx(=86dž dž,dž(Ɔ l?3p?3u(jhz$=L6-5|6u"jh$ĉ=L6,5|6 6N06F4Qt$QhԎ$苉=L6w,5|6F4Ht$Ph$`=L6S,5|6F4 X69}"QPh)$1 =L6+,5|6F0=)hPhW$ =L6+5|6F0=|)hPh$ш =L6+5|6F0N49}QPh$襈 =L6+ 6|6;6|QUUUU)ʹ3333!!сis{09\~\{0\\5(6sXș9}%CX=@6~Qh$|6sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$h$=L6**|6{4$=X611F9tA uPhT$j $Kd=l65h6 u։<8=d?3[ WVhA$\ =L6)|6<$C4$8=X6`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQPJ[Njs8ƒPVRW薉)lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVhu$=L6'd6tm |6yxH1҉$q1ҋ8$$)$<$$1C$I8$ `6=|6_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W%Y1C1 t׉Ë$$QPV$$V9s($$$VXÉ׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRPƒ$$$$$$׋$$$RPVQ$9wȃr$9‹$֋$r‰$$$$$B1WRQPUË$Ë$ʃQPRS9)ÍC4$$W$$P$Q@$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQTj$P$$@$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQh$r} =L6 |6B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=d?3$_|HL!ʉG41SSjhjPSU6N |6I4QSP^ |6H 6 6 6P44Q56щ 6`@#HL 9| Hh h?3H< (6HX \6H\ $6PTXH fǀ$%=|6O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=d?35O _(HLJ$<6$$$t!LJ^F=@6$$߬$$ڌ$&ݔ$ɊOd t1G0 T$D$\$t$ED$\$$$x |6$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$$w=|6O0 9| IУ66=D6u\Tu))У61VVjhjPV6u696656jPZ =P6Gl6 h61ظ|(RQh3$v =L6l6 h6565X6~ ș)dہ|48'GuȹC=86tL1$PP$$546V1=X6VhZN X61u;1$VhjVu  =65|6h`VWF0 =H6tWV5|6x\6hhPX 1@$=@6h$貣=@6|o5|6N,I\Tt~!NȃN׊Nd1 t1WPhS$RRqs$639u1H$Whht@P1> PPftu!ѡ@6t $ Q$=P6u$|&|6H,$$DŽ$%$ |6I,$1$ DŽ$1h(3,|6$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hג$=L6Y |6j56V 56FU $F +$^|6$~J`^p=d?3uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=86uFh$ NlK`ڍOȃ$ډFd;v&h$[=L6|656F $11ہ~U uv`щSA|6$~!ـ1@ 6Il |656F=d?3Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\56N uҋ|6B8H!tk)D4|6B8)Nj56$9sE)ȉـ1B~U uv`56F$CHu͋|6B8$؋N9ȉ$J`~U uv`щS|6$~!ـ1@ 6Il |656F=d?3Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD456;Vs2р1@~U uv`56F$Bɋ|6$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$6H 6V$P V PV~x; 6up=H6t6s4PP |66@6Kd156s466 |6q4jPN |656{0 9 6PVQ% =H6t65|6P56g |6y06$ryxtG$\%TuCl$AP$ |6Ou$ց\TtQ!QЃyId t156563 5|6\TG~8^xN`1?9'6+$~0lj$Ɖ$)ى$=6$%Gl669wߋ$9w$|6$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=@6} $H$$$~A=P62$=|j.Yg扄$#t% |6ׁ\TtQ!QЃYId t1RP$VhK$g$$;$$|W=@69|6H,t =P6 $$ DŽ$j [fDŽ$C|6;X,/$~ j -f=P6 $hjPiJ d?3 D6+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A\$h$ld?3fDŽ$A3tt?3$_ lj$DŽ$|6H4$ $ H5|6D@VL!! $`Nd8[GfAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$t?3@ lj$DŽ$ |6H4$ $l$h  5|6D@~L!! $߉$Nd t1$Sv4$j2|6@0p9w Au1H$$DŽ$1$$tZǡ<6|6@05H6V$SQP$h$l H6ɉ$$$t RP $CPKT$l$hߍ$󥃼$$tA$ȃ=H6CX$tFDŽ$PQ18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$$pthj$PE |6\T$$i$$ $$$$DŽ$H0$$_$ |6@$D$@L!! $`W$h$l$  |6Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h |6@$D$ @L!! $${V$$$h$l|6Hd t1$S6j$$V |6$ȔȐG$11F$t =D6$$=|640=d?30w4w+_16$`SWP $PjSB =H6t$W\=T6t6ǀ\8 |6=6x\hhP.B X6QP4WV=H6t6 |6q4PP׸ 5|6HLNd t156v4t56956vG=H6t|6p4VVx 566@6=|6Od1Vw456562|6@4P56e^_[]ÿWjVA 1=X6VW\hR#h]Bhr$Ƌj&|Tj%uTj(nTt6j ]TjVTj'OTjHThT$Lhl$Bj-Tj&TjTjTjTj TjTjSjSjSj SUSWV=P6ua΋\$=D6tX6t6St$P 4׋ X6UPSt$$56 9u^_[]C0PWVh-$(\j$NSUSWV"=P6΅ 6u|6H4H 6 6 =X6;h6l6|6;}FWh H'1I!;HtG#P;Pt;H uV9R_1ڍ_56P=X6Wh De^_[]USWV΋L$l$=D6t=P6teUjQG>p׋ X6SPUt$$568 9t?A0PWVh$uZj"QX6t6UPQ ^_[]SI`wD$$'1C:Qh$h3\ .  [SWV1ۃ=86։ SjQ@= =d?3@fF F)f ^_[USWV Ӊϋ5|6F Nd t156G=H6t65|6PP跳 6yU +y/\$|$y1U =|61=U L$D$uq`|$ G`Ӊ $u щw*l$$'р4l$skPh$h3Z =|66D$$F  l$uX<tR$|$ G8ʋL$;iЃ}Ahv$ h&$hP$011҉ ^_[]ÉՁ|$U u L$I` L$w$$'ʉـ1@BPh$h3Y 8ʍ 6ʍ   1$5|6$~3%)1@ 6Il 5|66K=6Od$sC=d?3CNdЋT$ t1҉t$VQPR,{U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPRxZL$|$ щT$ՉD$ȋL$D$VW|$RP.Zыt$ʋL$Vt$QRP+$L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45|6;F8|$}X1Bσ) 6yU uI`1@5|6;F8|$|=H6t6VPP 5|6F Nd t156USWV$΋=|6G Od t156=H6t65|6PP胮 6xU t)hv$6=L6(6xU ‹l$(H $t@\$=H6t65|6PP =|6G Od t156w|66HC, $9r%UQhݑ$R =L6V|6 $\D$jT$RPQ D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$56W|6\Tud6jpxt$0t$ $<=H6WV1L(ɉL(@ u1LXɉLX@ul$6jpxt$0t$ $,;=H6trUV胪1tttpTtDpC u1vCu) qv% $D l$hVUg  Ov% $D9Pl$|6T$56p0^_[]jGj GWV։σ=d?3ȃ@PQR  =H6t'ȉGffF=d?3u GffF^_fUSWV$8tW ƅuWhu"j $$<$4D$Phd@U tj1OLVhedAU5 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(hLL%t$K 1 Sh"U9 CPh8"U C Ph"U CPh"U CPh"U CK,C,Qh/"U C0PhD"Uw $@D$t P 1-Uhzd@$<W t1 VhedAW hjU1 D$ P$4臰D$, 9L$L$9u0$S11:"58tx$0h"<b$11҉ $ƅ*ŰPtj PU ^_[]$0h"j USWV81ۍD$4ShPSu1NtAljSPSWuWz uMU D$t$$$Q1e^_[]fWVt$|$ VW) t$?/tWhc"`WVh|"RW^_WhN"j fUSWV|$$\$(SWt$(t$()jj`SW~XNjL$t$AhQl11 mTTDPD$T$ |$,t RPsE`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jVB/ 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$Vj2$u Vh7$ ī6ԫ6%Ы6ʼn߃=6~VWUt$hQ$+B|>9|Pt$t$ )σ}4$Y 6-6uU-6uY5ԫ6=Ы6ī6@19lj| 19ǃ| 6u 6͋5ԫ6=Ы6ī6ˉjURPs=̫6l$ ȫ6uA@19lj$ $t$u hث6h$jPVW v|$wext23$2fs3$ WhG"hث6h'Vhث6hY$} 19ǃ} h$ ̫6t$VUt$  U趏 t 9t V褏 jJ7USWVӉ $I'|$j W\$ SF Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph"1L$8ɉ׉u L$8t 1@׉׉|$l$ l&8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h"3QPWUt$t$h" QPWUt$t$h!" t$t$h"j˾ WVd$3Ph$V#A 1GVWjh"Vh('!W5USWVu} D$8jP=د65ܯ656%UUUU)3333!!щ%i6Bī699C3C3T$u tv|$΍Q6656 6VT$ 66ډ6P…Ƅ!) 61f1ҁ‰t$$r=ԫ6Ы6\$9D$ 6T$61t$$ËT$ u׍؉)9H1D$ 1̫6 w D$L$|$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$ t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ̫6566C3t$ƺQ=6D$6D$ 66D$661 65 6D$8666S6 6$6N5(6,6<6@6[D60f06 f2646 C3f86\$H$SW 93rWhH6> 56|$t"VYjVhX6n 1h6666,6D$<6 6+ 6 1҃r1I156~σRVPW 56H19w+56|$OL$)9r΅u <6f565656VG6YVjP GD$AD$ 11L$\$66tnD6tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& 6@<6t 6 6@ 61H6L2 6D1\$;|$t6)á6f\0 6D1 6u\$fT1 6T1fD1L$ G;|$tD$ ,6|$11t$66=6~i 6 i{56Q5ԫ65Ы6PRuh$7 6 656PQWh+$[76@661QQjhjPQ6I 56jP =6ukԫ6 Ы61! V5ī6 1N1Ƀ *&Fu  1@D$$=6|>hr$d=6|(L$ 6 61PQhS$PP4D$$639u1H|$LWhht@P PPftu!ыt$6tL$QT$=6uL$L$D$ 1D$L$ 11T$h(3=,6t$tXD6tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5:6616 56D$ hh6P 566P56Vt$ =6=6 615ī6ǡ6)؉1t$ P =6Wjh6 6H9|$u_656 6)ʍZ9s1Gр6B9r)6VhP t$ 1Ƀr!11ƃ6Cω 9rωp 9ǿs"ˀ6CI 9rޡ6L$  61Ҹ6Pt$ 56Vj6P 6 6L$)QhP u16@ u6L$ D 61Ҿ6Vt$# 56jVw =6tb1=6t 1C3_X6F;56r6L$ D 61h656 G;=6r=6t$|\tX=,6teD6t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=6|$T$T$|ʉj.0t$몸#|$|$t% 6 6jQt$,PhK$1T$;D$_=6* 6t=6u&D$ D$D$j ]01hR#'1~ j 70=6d=,61<6$hjVY fF쀁&fFD$8FFF5 fF56 ׉؉t$ ֍$fBt D6$,F܉VDF81 L$ F4D$4z 61CL$ =6W D$(\WD$S56tPjt$0L 6 9`L$97|$0N6L$,ʋL$(T$61GL$ T$D$ D6D$6D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$D$G;|$ u\$1;L$t$0sD$)RjP& L$ D$1t$V 61CL$ \$6 6=6t$,9sD$()QjP t$L$ D$41ҋt$(VW'V$Yj=,6t@6t F3G3F3@1=6à r t$hhjV fFA#fF6ÉFD$8FFF 6fFfFV 6AFmlj\$r*D$p1ۋ 61zC9uߊ 61h65656f5H3|$D$1ۉt$ H3x1ɉt$)r6RQP  WhH36V H36D$ f 6 61Vt$ \9\$t56H3D$ CiL$T 1VhVD$pP} 95,6t@6tC3D3E3fD$TA!fD$VC3ƉD$XD$8D$\D$`D$d fD$lfD$n 61@D$pAD$| 61h656iL$Tj f:61ۃ=6 56<hh6W 566P56V 56 615ī6ơ6)؉1WP5656e^_[]hw$hO$ ͖$hƖ$P|*hT$Phw$h$Vh#$RhK$PRhv$hVh$hVh͔$RVh$Wh2$VPhl$hQ$vjVWt$hp$gh$`h̕$Yhr$Rh$KRQhb$B$1$'hw$h$"hw$h$hw$hۗ$ hw$h$j詩 USWV6=,6trD6tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(6Ѓ<6t 6 6Ѓ^_[]SWV=6u0׉΋ ī6\$QPSt$ 5ܯ6 | 9u^_[WVhL$h,$j USWV=6΁ 7u=61 6 7ī611;Ы6-ԫ6ǡ669v@1Sh'8!;HtH#P;Pt P uhϙ$‹} ]7< 1HD$D$ 1D$؉h֙$WS H41B$'؍|$W5t=Q878&} r؍|$W5t=h7} 8!M ؍|$jW5t=b 9D$=} ؍|$jW5t=M" D$} 8e؉|$L؀ (7 t=1$PPhX7؀ (7؍|$jW5t=詚 9 ,77؀ 07k؍|$jW5t=g 9=D$؀ )7؀ (7؀ )7ء(7@ (7؀ )7؀ )7؀ )7t=1-#PPhH74 ء(7@(7t=D7|؀ )7@q؍|$jW5t=m 9@7} ؀ (7-؀ (7"ءԏ3HD$ ؀ 07 ؀ (7hq$ 87(7uz&t87t胭 T87v g =@7~ Q 87|$D$ fD$"l$"|$0l$L$0T$48 8T$,L$(l$( &|$D$ fD$ l$ \$$l$D$$8 hr$ 5t=h$t\$D$6$$藚 5t=h$Lh$C5t=hĚ$45t=h$'5t=h֚$5t=hS$ 5t=h$j7 h $(7Щu h$$,7t@7 ,7D$ Ku9ԏ3t-h'$hV$9}#hh7hp7P t7%(7=u (7L$ u(|7d7x7`7t7\7p7X7f778tω=7u ~ 1ۃ| ‰T$ (7T$ 757V賤7u Vh$WD$ @ux=9}b7C9uUD7zh(3h5D7hI$G9}%8i-@=B'7C9u8=807t.D$jPjh5 7 u hٛ$[07t.D$jPjh5 7 u h$$07t.D$jPjh5$7 u hٛ$07t.D$jPjh5$7X u h$趓 (7 t+f88t78̷88̷8t'ƀ8'(8ƀ8̷8((ȷ7) з8ܷ7)Ph8Q\ D$jPjj5 7 y h$Kз8 ̷8@L$H (7@fP\$1ҀڈP@ L7P \7P ; jhL7j j5 7 h$31Drp\Au_!V\$h|$lt$pT$tL$xQRVWSL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQh$P Hơ7 79}1Ҋ\<7B9|1@9u(7h$*~"177Ph*# G9uj s*D$<jPj j5 7 y h!${t'D$jPj j5 7 y hB$P)7t'jhL7j j5 7x y hc$ 5t7< 57Ph7h$CjhI3hh5 7$ y"I3 I3=hȜ$jhI3hh5 7 hj@15Է85ط85ܷ8585858588(D$<8@ppp pVPj Wj<95@7~h8j CF;5@7|/USWV։ϋ\$l$1EE EEfEUR5;t tM)7u6jjUD u##VDt)xu:H Mt0t$VS ^_[]5x=] PVh$Wh٤$j贒 OPh$h3 j =$8u-=<8t$ht$89,7~,7j1jh8j_ th/$j^ USWVXݷ78ff7 838 83 8 ܷ78f7f޷717Ѓuȉf ޷71t$<jVjP5$7V 4jh7jjhܷ75$7^ y(7t h$膍D$<jVjj5$7 h8jr ܷ78f7(7 r&sK878787+ 8ɸMb-8ʉ 77 7yf޷7|$qD11ܷ7C9ut 7‰f޷7з8T$1A xVWh7h$| h$h381B 8$8@88088488888 8 uCء8888 8 88 8 8 ؉+88D$HT$Ll$H 8+8D$8D$85&v?|$ D$ fD$l$\$4l$ D$4Ӊ 88 &wh87 88 888 8ʚ; 886eĉ 811ۋ88D$T$ ؋88D$8D$8D$5 8L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05& &t$v 885 8=8|$(t$(|$D$ fD$ l$ \$,l$|$,= 8ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă58 8= 8(7t 1A(7y77 79}(8i-@=B'7@9u8e^_[]hУ$h$jd USWVh8jy h7&\$Du{'-88D$hD$h5&\$Dݜ$݄$h8j u{(-88D$dD$d5&݄$\$D8;,7D$D8 8 t]+ 88$$߬$ 8+8D$\D$\5&&s=$8uZ(7tQ8 8 t5+ 88L$xD$|l$x 8+8D$XD$X5&wD$DD$D(887 &w١8 8 t>+ 0848$$߬$8+88D$`D$`5&D$Dw\$8 7$fDŽ$jhԷ8jV D$8 &|$&D$& fD$Bl$B\$Tl$&t$Tj$PW SD$lD$lPD$,Pj57575 7W <h8jf 7D$8<BC97)؉D$D$8 T$Ĉ'\$A98I؉L$A 8Iff9u$88888888 8u888888<8(7 1D$18 8l1A h$h3A(7<1A t$,5 PVh$F ΍T$(jt$>Ph$D$ (7t$؉T$΍T$(jt$F$ 'h$΍T$(jt$Jh=$j΍T$(jt$bF$'hK$΍T$(jt$$Fft$NfQPhݡ$ ΍T$(jt$؉t$h$΍T$(jt$^؉t$h$v΍T$(jt$z0FT_h)$G΍T$(jt$9FPhy$΍T$(jt$ ؉t$h$΍T$(jt$؉t$h$΍T$(jt$d؉t$h$΍T$(jt$9؉t$h%T΍T$(jt$X؉t$hˢ$)΍T$(jt$-؉t$h$h?$Ph]$L$lL$AQ D$iPh$h\$ hj$h$Nh8hȡ$it$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ0$L$dT$C;\8u#Ph`8QD$XeL$$ D$L\8PQh`85 T$Ҹ0$u1G1$T$PjL$r |$ rI03H 03~(3H (3 h(3j (  }T$A{^N2D$ˀ) h6$uPt$,| L$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh;$Eh$/9 |$ sS03H 03~(3H (3 h(3j   }KF߉Ήs(T$h"$L$T$؅t%03H 03~(3H (3 1I h(3j h(31ء<8;,7*؅tء(7!^L$AQ T$Q=8 8 t+)|$L$p|$tl$p8)ЉD$PD$P5&8888I3vI3(8v(8\$CfK%8f!t8 <8T$ .KfKf8D$ з8@1ۺ9T$t$, L$IfɋT$8RD$4\$T$T$$T$ $L$Jз8@)t2(uK 8(7t1 8h4$ 8 (7 PVh$  Ph$h$hß$h$AfPh$h&$h:$hR$hk$h$h$h$h $hӠ$wh$mh$c 8h_$B1BD$D$pfI3@)f~\(7tSωL$!ȹT$V!RPt$ h$T$ D$,(7t1RT$D$fxf5I3(7ruTt$,i L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B7C9D$=(7 ؉T$57|$77)RQP_ GD$9L$~D$8:7uG9u߅uQt$, L$IfɋT$8RD$4\$T$T$$T$ $L$E57)7t$>RQPh$O7;7}0u hb$/PhV%$Cы\$1B\$D$\$D$T$jh$j8{ 1Ah4"WV8@8~bD8H8 03Q03; @3h(3j./@8 (3Q(3.H @8by`)D8H8 03Q03; @3h(3j@8 (3Q(3H @8|tN=D8t403H 03~(3H (3 h(3j aD8H8h(3蓲h3膲8P88T88X88^_jj1A1=<8PcUSWV׉E\$1AM(7]E uWVhP$t hn$Sht$(7t5@D$ &\$D$$|$(7fyuh3je^_[]UVh1AtD$7$$A8D$$$,<8D$$$8tD$$֞$8t9+ <8} $$!L$LD$L &D$Ht$H\$$ $$  <8(7 8L$DD$D=8@|-8& I3 (8\$,D$(\$ D$\$D$\$D$$$(78 8 t5+ 88L$XD$\l$X8+8D$@D$@5&48 08 t7+ 88L$PD$Tl$P88+8D$L> QPh$l(7tkD>L> QPh9$F|>uGD>(7ufPho$"L> ffPQhZ$ ^_[WV)7u8jjV6% t'866 PWh$hh8"6 Ph$hh8^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ h$"!$t$t$ t$SPh$ UPh$w t$t$t$ h$^t$2 Ph$Dt$  Phj$*r0G9s'GPh*#| KG9r߃$^_[]fUSWVƀ8-uFhC#Vu 8hC#V1u 8T$,11CD$D$h֥$Rt$0y Hw؉$`'\$̃duE뻁뱀=8t\랉\$떁댁낃u1 ԏ31;L$(uj|1L$ 1ɉT$Љ $PL$Au $AP|D$t2ڋL$ PWM Wf uމ$DDuY|$ujlT Džu1 Pz4r$t8=8uIj VhC#肦 Whߥ$T1FV6Ph$Vo SU@ hC#=8Mj VhC#, Wh$V% \$#" $VWS˧ jjVWS轧\$u < 1GWWWjWjWjWVvWj kVW= u h"$j=o jj= u/$8j. u; j. j js= t)qtOQ. j jL= uE$8t1Aj jhC# ukWh$jh[$t$U? $QzjB0WW< $t#VIPSh%Wn SWh$jkAV&=8u#rVPh$h31jfD$tPhc$19h'Phw$h3jzUSWVPu } h'WVCu cR~5StET $8͍Hw4$'8벃L88둃ftTdL 8t8e(8V 8G,88 8) ԏ3w08=(8tjjh_v%: 48ND$ jjj"w 48jL$$Qh@hP u h %Hh48i )ލ<S H $'= 8t1Aj D$<1CPS)D$D$ PSD$D$$PSD$D$(PSD$ D$,PS̀D$D$0PS趀D$D$4PS蟀D$8|$ |$z |$o |$ d |$Y |$N F D8D$8gtj548: rD$ D$#D$D$#_;-88Sh1t.H$1ۃ=8uWh$hܬ$h% >h&Sg =8uhǬ$h$h%k 1CH8FLCSS H3 VT$W$' \$@1ɍP$'`81A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12h8#H8L$L$# 1AD$ PD$@PD$ D$<+<8R D$ Pj$D8K3D8K3D8K3 P8T8׋t$#D$ Pj@8d$zT$ ED$ L$TL$@JL$CD8"K3-L$#d$d$d$L$׋t$p8:8@.8"x88 8\$ 8P8T8 t X8t P81SSP L$Y\= 8j$)/jD$D$ D$#D$#88L$9a|$u q<8 @8ta|$  ‰4 D$=H8T$tD$1@D$ 1ۉD$0hxSh8 atgcuL$8 88X8@X888888X8 8 8tJt$(~A|t188t|$ ObT88(8tPt$ tH@WVh(8n (8=,8t= 8u$88tMD$tH@Vt$ W,n =,8t= 8uL$$88tDD$(tIAVPWm =,8t= 8uL$(${88tDD$,tIAVPWm =,8t= 8uL$, $.88tDD$4tIAVPWCm =,8t= 8uL$4$88 tDD$0tIAVPWl =,8t= 8uL$0*$8)f=8=,8tP= 8uG=88t403H 03~(3H (3 h(3j 81=8IWh8548(/ u+;87t1t)7|$t+u-$/9|$Ph$!~$|$$ PPh$[83u=D8t"1ۃ8=D81ۀ?D$PSVhb${h(3n^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV+D$  PZ1PPWSjV貁|$dt$ \$hk$9 D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9K3tEK3P{y$L$t hϮ$h$QQh%PPh$ C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP #PPhZ$X 03H 03~(3H (3 h(3j T$h9t$h hk$k L^_[]hA$ jh$j9L D$t'T$tt hϮ$h$QQh%PPh$ ËD$t%u$%tuޮ$Ph$ծ$$PhϪ#>USWV|$<\$8D$4t$0~u/jUf u.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWhR"Ph$PWhe#{ ^_[]USWV|$4t$0=`8uM`8hha8rVt a8'j.ha8|t@hPha8^X t"^tCt0Wv`rhhu%hh8X ^_[]1w)ȉPjQ SVU0 fEu jUe WUu&Vhh8Sh$hhh8h8^_[]ST$D$ L$YttuRPQ9RPQM ,[TQhh8Sh?$hhh8xh8[SWV$L$4D$1G\'t$"tZ@:t9rD$Ph$,^_[SWV|$t^D$uFD$jjP4 t1Nj0j.Vzt@ha8P\u7ut$ u%hVhh8WV h8^_[VD$L$ 1Ҁ0QRRhhh8VP茎 thh%hh8z h8^Au yuyt$Qtu ȃPk Qc APhc$hhh8h8SWVD$h8Q4I$Rc84I$Rd8ƄRe8.r|I Vh$j> =|81t t8` d81QRRP5`85t8n A ;3D$jPjP u/hŰ$?:>1AFL$ tWWVWh' u;D$ D$ PFWWVD$Ph' tt$yVĨ ^_[]h%t$ , tԉ1|$l$Vh$PVSTQHt$t$Wh|dD$P  \$tN1D$;D$ 2i9t$sVt$HPt!ʼnD$t$Wh|dt$΂ ul$$WhedAP賂 f$a$>ukSt$h#"h &h$WwƄ$tt85$ 2$to$QPW萸 $Kà9Éu|$$P 1h%j Å~A1ۉh"PEujVh#"h%h$W衶Ƅ$|$tt8\$ 2$t薝$QPW跷 C;\$ mUT|$l$|$$PUSWV  uj蓮D$$D$<$shR$VYth{%VG3hU7 Ƅ$h{%sut s h{%Vjtt s hU$VJt P:A t8D$ h_$V!tHáx8th$P脏(j,ShtZ SD$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$h$h$S֧\$ =8uD$$$D$ P$P茧 D8\$t$Ph)$Y%8PU uUh$2%1@$~#Qh$]1@$\$$$Ĕ ^_[]$Ph$j( +Ph4$h3 jqUSWV L$8$T$t-8*jh8b 8š8$T$1i E$48t!u6$t$PҀT$ uF$t$P趀T$ tEM<ǃ hN$#1 ^_[]ËD$ t 08$4$݋D$ t 08$$ؾ8Phh8' uh8h$jb' fVD$t.})zhʁ9hU$58x y9T%%%'PQh%58Cc#u58h]$By9^ËD$ H^WVθ%'PVtt)uVh$58Ө y9SGt8tPwh$j wh$Xuj whʁ914 G99^_WVD$ t;59D$=`8 8u `8';pt8@uVhw$j% @u=`9th`9Ph$赀 Ph$襀u59=`8^_Ã|$t $yy9Ã|$t %Xy9Ã|$t $r7y9Ã|$uh<9h$58O y9Ã|$uh9hԵ$58 ձy9Ã|$uh9h$58 褱y9SWV$$DŽ$HH$pyƋ$ ƒtS!=y9>$t9$4$atσ=y9 =y9 PSj $;rtr1Auu($$h$PQ te$P$$h($PQm t8$(1;BQPVW7Vq?>y9^_[USWVx֋$$t{tp11@=3D_t1z\t r9΅t<΄t453AҀ|Vy53TVP53@u΋$ $t`1Hhy9trʄt<$1ۊy9t8tCu 9sy9B+$=FFu4$D$|$ 1 y9$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ }9<$؉D$}9$to\[$uvz$\$-3BDEJ<0HB,t ]tVрy$t[3BDC$G)=~"B $tG)=BJB5A3<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$58h$*<$?uhVW, x^_[]USWV0$Du%$H$DhC$PQT y1E-9hE8j(Uh8ر t$H4$=8I1VV$P Í|$0;=<8=9$H5y95y95y9s =y9>$t9$9ƒ=L8RPSQGy=9uE=8t<L8L8$Hct9L8 9VV$P Å 4$j9y90^_[]Ã$D|Ã=<8t=H8;1 T$󫋄$HRjh4 |$D$=<8ʉǃ=9$H[L$05y95y9j =y9>$t9$9Ã=L8VPRQw=9u9=8t05L8L8$H1t95L8G=<8-=9$H$HL$05y95y9j ƃ=y9>$t9$$H9=L8PVRQv=9u_=8tV=L8L8$H1t9=L8$$H4hO$D$P1 E;$Dnj=8t#8@=u1HjhB#P jh8 WV=9t@=8t75L8=P99L8P9915L8=P99u 9^_USWV1@=L8S=P99Fϻ-$ͅtUSh;$58Ǜ58Rt$PhVhЕ3xd3L$DH?uy9t$j9Ą^_[]58jj/hn$:FUSWV $ u{$$h3B#w}trƉj h%S xy9 |y9Q$tk$l$ jhUVx!|$ toSjWj@b!V i whܶ$58联 y9 ^_[]Ã|$Lf#tڎ"Ã|$t!h$h$h$58611Hy9WVt$D$ tu51>I#t5D8RPh5$Qwh8#58jj6h$YAh81y9^_hX$hH8t$t$ y9ha$h\8t$t$y9WVD$ tZ}UuZt$~hڎ"W@tOhLf#W@tBWy7vh}$58裏 Z1H_1=81@18 81ҾLf#tڎ" щ 8PVh$58D1=8y9^_ËD$uD$L$h$PQ tvD$ph$gu<=y9u0=`8t58h¸$ D$ph$fgu+999>y9VD$ L$y9t u]H 8HQ"tsP" t8[=98t5h9h$P y9(^鳘Vh$Pjj$h$>V'^ËD$tIDuD$L$h($PQK t$D$phC$Gfu90y9SWVD$-uD$L$h$PQ  1G=9hE8j輴Wh8l t D$1VVt$@ ǀ?tx=9tyD$thWhC$teu 9=9uB=8t9=L8L8D$bt9=L8 9VVt$ DžaSj׳9y9^_[ËD$uD$L$hK$PQ tmD$_D$L$hU$PQx tI|$BD$ph]$mdu8D$phe$Tdu9Ãt8y9USWVt$ |$.E1ۈ$58jj,hm$;% u v1.贔y9^_[]y9USWV D$ #D$$L$ h$PQS L$ ȃ#D$$L$ h$PQ) D$ L$$|<$Dh #t$_t3$8|t+4$$H$$ 3D$$hƹ$0_D$1E-9hE8j臰Uh87 t D$$\t$=91D$ H9=<8Q$t%$9t$t4$T$$VVP4t$Q܀9u?=8t6L8L8D$$" 9tA 9L8E_t$j覯9$9t4$!衒y9 ^_[]SWV$tKjjQtK~S觚 9uWj(1uhݹ$D+1Hy9^_[þV- Fujjۮhx# ,%tj/VI t@hQW =8t858V 8HQP~ Q Pj ͉|j5dy9h!a#WV豂  jWV裂 Vhʹ$Uy9j{SWVPD$D$t&D$t$h$PV ry9^_[ËD$ph $^u|$h$( tD$x|$Wh $^WZPjWf uP|$h($ t D$x |$Wh2$;^W0ZPjWDf 1ۃuM|$ Àu*D$p Vh2$]VYPjVf <858h:$ D$y9=9t =9u&=9t#h9ho$58詄 y958jj%hI$5ËD$y9-=9u=9t#h9h$58@ y958jj$h$5ËD$uD$L$h$PQ蘺 teD$phԺ$\u<=y9u0=`8t58h$ D$phӺ$S\u9<y9ËD$uD$L$h$PQ teD$ph$[u<=y9u0=`8t58hۺ$ D$ph$[u9蒍y9ËD$t8uD$L$h $PQQ tD$L$QPh# By9USWVh$V $|F$$h1Gh4V 9}hh%V G9$uVh$Zu jLT9^_[]ËD$t8uD$L$h"$PQ\ tD$L$QPh<$ My9ËD$thuD$L$h"?$PQ tHD$:D$L$h($PQ t$|$D$pphB$Y Ãt͋y9VD$t$5`8`8u hS$Y%萋y9D$ ph^$rY5`8^VD$HrVy9>5`8`8uhl$*YD$ phv$Y5`8^VD$t$5`8`8u h$X%؊y9D$ ph$X5`8^Ã|$u|$t蝊y9Ã=<8t 1PP)jg=<8t 1PP j&t|$u|$tDy9Ã=<8th$%X釽V1VVcVsVPD$ D$t}uD$p*y9 ^V|$t%5`8`8h$N5`8言y9^WVD$ =@8u58h$D$L$ h$PQC tq|$ j=L8t58h$ @89L$j qP @8t.9FȊ99u#tȊ9999ԕ3H ԕ3~Е3H Е3hЕ3J< u# @8;4Ȋ9~F9u ԕ3I ԕ3~Е3PЕ3hЕ3(J ԕ3 tu:Qԕ3~Е3H Е3hЕ3Iԕ3у u58hX$) 1Hy9^_NA @84̊9158h6$WVD$ tkfuD$L$ h($PQ_ tFD$jplj!ЃtD$VWph$58ws1"~1Hy9^_USWVE{uE Mh($PQϩ t]E jp蠸T$$!ЃtI58E xS)P虺PWh$Vr1;C {}1H1y9e^_[]ËD$tuU}y9h$?KËD$ph$*KVt$ hQ$jVt$tvvh$583r^USWVD$uD$L$h$PQ訨 D$pƵh$軐tǀ8u"WuFVjF,U谲UWP> Uh%S UVS Sk y9S9 V0 |y9^_[]USWVPD$uD$L$h($PQ诧 h$ۏtǀ8u"WEÃPܱ|@CSWPe =y9xy9$-|y9`81`8y9xy9|y9L$Pjhk$qVh$h=y9-|y9$xy9`8V& zy9^_[]SWV|$ust$>hѾ$W t+h@%W t hؾ$W u7 1Cvݻtt8u8hz1H!8P58h$58o1y9^_[VD$ L$y9ʃuCuDt}|tUp8<$~D$@$D$<$d-SWV։jh$Q jh$W tlh$W[tjh$W uYt F t8t4h<$Mt8tjh$Ww t ^_[(11VPP ^_[)WSh$j USWV$\$@t$<|$j h$W |$D$ 1D$D$SƉ$P;D0h$P(t$Dh$$t$訯 $t|$@t$t$@ЃD$;p8t|$tt$iD$L$dC.$`7.$s.$tg.|$Htt$H!D$H|$Ptt$PD$P$t$DŽ$$t$DŽ$D$Te^_[]ËD$lt8uu L$DUuD=p8t;P襡D$HL$H+p8tD$Ej/t$L$ t@Pt$Dh$t$HYD$t$Ip8L$D|$D$81|y9xy9ty9py9$$9t8t1$Pt$u$\$` |y9xy9|$pyy9m$h3B#t$L蒸D$|$t$A$QPj!u5$8$<$$$\$` ty9py9xy9 |y9t+t$޷j5|y95xy9P'Y=`8tPt$Hh$58_ |y9xy9 tQPh$58_58hB# 1O$=8Y81O$8|$pu5 D$TQh.$]gD8ht$hW =9|$Lu:|$LD$puuhF$t$Hh<$[uh<$}D$Ly9$|$LD$L8|$dD$t$h]$}8P莞$$W(3$<hI%V_1A$<$ǀ?tvj:W t=@j $QP_ ~޻t?$9u3;$u*W29$<r$)PWR t/hI%V^Džm1Ft$Hht$1$t PY$$u |$p$$xy9 |y9t$Lt Vh$t$dKt|$dj%W t Wh$1$GGG fG$P$xPW# $u2$t'8t"$tJ?t1hC%W 3tVh'$d$7(2W>DŽ$t$DS$F|$d'1D$$L$d$,|$h$$$|$pt$\$BBB BBBB 8JBB D$$PRW$8f0 t ]1@0RRtD$$Z$$Pf-j j WhSvv` t%h"PS j "PW =`8t+D$$xt!~Y$tm$WSP58Zv jv Åx`=`8u~PvvS-x)$P$P$Ph# ykSR 1KW$Ph$' Nȉޅɍ$PS. PW$4h@$=bh1N=P8tJ$t$uP$$t$uPљ$@8~R9Wh*$0tNu1h@h$hL8, t805L99ދ$tP-DŽ$$t4W-PjW: $tPDŽ$$t4W-PjW9 $tPDŽ$D$$t P- |$D$$hj($8<tQhk$$芰D$$\t$ Bj8tV=`8tWh$58X t$$tI=`8 D$tPt$hh$h$58W1@t$ht$hh$t |$dwh$Vĭ #h$V譭h$V蟭8xt'1ɉϋ4h#V} G8Љ;zrۡxy9 |y958h$9 5|y95xy9h#$V/5|y95xy9h8$58V1F&1t$lh$V $`#=8t"D$$r$t_$QP躬|$h$ tPh$W薬 h$h$h$W|D$$0$|$Pt1$t$t#tD=`8$tPh$58U FWh$$8W $$0t-=`8tPh$58U FSh$Wʫ t=`8t58h$ h$t$ 虫t$21V|\$D$Lt$P5R3DƉ$$ىD$ډ׋$$|$8‹$4$8$ 8ˉƉ$D$@1S$P$+$$$$+$ى|g@By)Qj$PF$+$$$$+$ΉЃ||$`t$@$Dt$$|$`tCt$5858" h$58PM|$`=$@$Dt$h&#]Kh #t$D$8|jjj m$D$@hQ$Po D$@|$@DŽ$%|y9 xy9 m!ڃt9}M#$H5ty9py9$$!;$$=`8t58jj h$D$TLD$@(3x=y9=d8|8 x8ƒ89}%8HQP ;HQ#8HQP<Q 8tB$ڋ$!t py95ty91ϋ$H1 D$h%P hQ$t$DD$@|$@tDŽ$` t$oD$@Phʹ$hO$Vhq$O("8)PSh$h$%Pt$Hh&$jykh$h$Lbh+$LL$D$ D$8t$4D$ D$0D$D$,T$1@މPj Ft$nth$`Wjbt$@$=` $#$1V$W$$$$$$t$@Ѓt$@Wt$ u.58$PP艊Ph $VB |8=x8| jjty9x& xy9 x8|y9|8; py9D1|8x81\$  xy9 |y9PL$T$ T$8t$4\$0r\$ `81tt$hv$58A L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$(|$(Wh$ID$L$ L$8t$4\$0ËD$D$,T$1@t$[Pj#VD7tt$h$58&A T$d|$?D$TD$L$ L$8t$4\$0ËD$D$,T$1@h$HD$L$ L$8t$4\$0h$HD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h'$$H$D$8$D$4$D$0t$,$$1@މt$$h$GD$L$ L$8\$4q$$ًT$ t$\$|$|ljL$xL$D$($$ω$$$L USWVD1D$ D$D$D$fD$D$0D$8D$4jh$Q t}D$V~ƉD$j@Pt%L$L$48@P~ƉD$j:V@Px~D$ t$D$0|$#$jPW4 D$4t 8D$t{8tvD$ t8tj;P th$Ph$Wh$WVWhL$E Vh$E1C)1C>l$,|$ $tc?tTj/W L$9uut$@jhC%V @L$ǃuC=H8taD$t$uI$t>thl$Vq1Ʌ $t}thl$UO1ɉL$<=8=<8t 1PPѼ=8|$DhPW |$L$D$L$D$ tD$ D$$=P8P8L$QPp=P8<8t=ut$8t$8t$ D$Pj3D$T$"tQPhs$C "D$Pj觓<$l$,|$u'j/VHtG1|$t>tFhha&l$LU l$t$1l$ -9D$Pj9-9*x1l$,1Kd}Z<$t3$DSVWO ShC%W SUW <$hh%t$LV t$l$D$ D$<4uT5L8L8=t8$t$hP|$LW |$D$Pj5L8p8uj/U t@ʼnD$ D$$=t8tAD$Pj?>uP=y9uDh3jhh$)1D$PjT8y91ۃcÍL$%L$0d؁D^_[]1Eh$DAPh$h$j蚶 USWV օ\$ |$$jh$Q l$t=jh$U t;jh$U t9T$(.C fCPC fC C 1}Gt$j/U<$t9lj)CS:yS\$$UP { uG<$WxC Uxj@V|$$tZ{ u 8w@PwƋ_j:St@PwG_Ot[uUnj]Uo$tYÊ@t<:uL)SUV Vf,$}:1j:VtEt$t$Vh$1ۋ\$ t3tHj PU8 }t $9ut=s fCt$t$Uh$>CC tWt_uk<8KUVhu$> t$t$Vh$>\$ n1HJ3@8(u#U8vC{u{ D%tC%PvC1 ^_[]hN$j} WV։2uvuGvuGF G FfG^_USWVȀ%t u7Qt*53|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj_\=8t< Ph$jdV0~ 8Iu1IPVQ) jh 8JF Vd88j[=8t<Ph$jdVd0~ 8Iu1IPVQ~ jh 8E V΋tPFtPFFtPF^WV΋AtPF~t,WPjW FtPF^_SWV׉΋j:StDSsP蔄tj%S`tShT$Vz S"ShK$V` G tu)GfPu G=tPh$V+ h$V^_[USWVP։ϋ\$l$ 8<tP/ZPUVWjZ x.1tETw4s,I  $8 u@$Ph$v:1@^_[]USWVPӉRlj4$6Mw sEWSU: 1uCL=ʀw һru$wsME$(^_[]USWVL$d$`1@D$1ɉ D8 H8 L8 P8 T8 X8 \8 `8 d8 h8 l8 p8 t8 x8T$(JJJJ58rBJ PRSW t u 0$@t0hP.P PSWh$8y9hWhD8Z 9D8<$l$\$HWj j UhSww t h"VS j VU =`8t*$xt!Y$tm$USP580w jw x6ư=`8uPwwV^yWV| USh$苩 #$d$dh$7 y94$ xwwhD8k GD84$ $D8D$HSh`8V7W D$H`8=E8uD$jUjjVd h3B#V9hQ$V9=9=`8t59h'$58. j}^\$WSjUV WShUV 9c$d$dh$ 1h$Z69t P9t Py9Vz 1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV81ۍ|$4|88hjUD$(D$ hNjTD$,D$D$8D$D$$$y911L$8L$\$0D$t$$ 8<tPjTW59v=W59\r&wW598tPhW59tPhhhp$59i,59Cà u $E`8uw|$5uprk=8ub=y9t&t uu59h$58+ 8HQP;H\˃ PQ $w3DXty9CУy9y9uss)5 $ ȸdtȃru3DXu 1@OuJ t$ tB$T$у)l$t=8s=J\$\$$\$l$"$T$ыl$ދ$L$t$ dڃ( ʹtu-u|$t y9D$ $؅t荌$79L$`L$AL$PPSs-=`8\$0l$uE5u@=8u78HQP~ Q Pj $-58fD$x u@uhD$$Wth4$WQ$u39H D$fxL$$D$@щ˅tVWh% Wh$@9SvD$|$ 88t9tP 8tQ蘻89|ʉ׺9օt 8Qb8j@D$ujj HD$=y9tD8=d8t ty9!ȉ'D$$jSPt$_19HsoL$1HfytL$IT$fztD$PW585858E:u h<#a%\$(St$tƃ t0ti|8 x8;L$D$|T8HQP;H~0Q#58u8L$D$L$Pj##͍D$ Pt$ j t D$@ @x8|8D$ Pt$ Vt ttD$@ @ujx8|81HjSQPЅx,5|y95xy9h$ k$u ht$n} tc|8 x8;L$D$}%8HQP ;HQ#8HQP~ Q Pj !D$@ @tt$(M0Wh<#pD$@ @t/t$ *0#8 t h$D1H|8x8j=|$ tD$ t$ЃD$t$1t$V|8=x8NPj#!SWV |$$D$h$WVt D$$=y9>$t9$D$9ƅu=9=9 4F959t jVuh$)j$=<8959t jVth8h$t$ jh8h. jh8Q. hjzD8h$WB 8|t1@v58h$豉 M58h$虉 j!#y9!hBjC$ |y9xy9 tQPh$ \$$SWh% joY j"D$ |y9xy9 tQPh$ Vt$h%v 81WWE"W4$jCj%"=8SVh$58X4$jBj! ^_[Åu1t P!=8t jI  |$1=8P!=8t j  |$1=8Pi!=8tV 91j J$,y h$W=48t y9j`YVV=8t j j =48t y94$jAVt$h% t)Vt$h% u=8 j =8{jlWVd881V A595|8y9rt suY,$#$dWPV WhT$V迥 8Iu1IPVQc jh8* Ph2$j裖 USWVD$=T8p8`8 8jjP財 l88tL$jQjhP  8<<=8w=8j=`8=8u `8h$Ɖ=`8~&t =<8u!h9h$58 =<8tCy9=$ 58h$ h{$袑1A =8=8=`8=8u `8h$JƉ=`8~&t =<8u%h9h$58X =<8yy9=tT$ wJ58h$B ?$tg8h$=<8 $3$t28h$=<8$PASV3Q LPSV3Q QEPSV3I1  $y9=t$$ <$$T$$$VRQPWh$h8 %$$:$:$:$8D8D$ff 8k=X85l8{b l8T8=818`8u f 8l8t P(b  8jjP l8=8u(QT$ RQhPd l8 8Qh8P 8tjD$ Pjh5l8 D$18 88888 8D$Ph85l8n< OD$8j5l8hy h$ =8" 8$t#/=8=8=8=81)L$ ׾8󥀼$u DŽ$$j j $Qh$QPR =`8=8u `8$P$Pt$h$Ɖ=`8~&t =<8u.h9h$58  =<8+8 8tPV 8 8858= 8 8SWVRQPh$T8$8$8D$|8D$x8D$t8D$p8D$l8D$h8D$d8D$`8D$\-88=8588 8 8PQjRVWSUt$|$$$$$$$$$$jjh$;X=<8[=8N81ۉh{$1A#h]$h|$u 81ɀ= 8D$jD$ Pjj5l8- 1Ƀ58h$} 1E= 8y9=$ w58h$h3$:5l8<] l81AJ8;y9=t+$ w!58h$W58Q#} 뗠 8<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph$h8 , |$ |$|$1-8- 8-8-8-8-8- 8f8D$L$  ȋL$$ D$( ȣ 8D$ $ fD$ L$$T$(t$\$VWRQPSh$h8 1-8- 8-8-8-8-8- 8f8D$L$  ȋL$$ D$( ȣ 8D$ $ f 8f 8;H88jPh85l8_1ɀ= 8uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Ph$h8w \|$ |$|$18 88888 8f8L8@uD$ $ ff 8jhL8h8cm 58hz$58h$58hD$58h$58hz$=X8USWVX=T8l8tuPSjjPX ƃPj5l8X t$l8D$fD$D$jP趛8<D$T$ |$ Mbt$1PW膛T$L$+T$ +L$(x@Biy1PjV_ u8t 8#th5$uhV$m`8t$4\$8VS5l8*X ǃu+8t 8#uoVS5l8W t׉5l8W =l8t$jWUW ut:|$9uD$0jPjjW V5l8Ehy$c5l8eW l81e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$58hH8T K=L8thL8hj$58 58ԝjh@hL8hЕ3'tEt W=L99k80t&ƅu'$$58PT /$~ t߻$=<8tP99j 6Wvr 88805L99V =T99t'~t!8HQP;H~Q~  Pjphj hj ^_Ã=8t8HQP~Q fPj fV5D8u<FA\t"uAt""tFAQt FAAtF5\y9 X99;$\y9 X991tu `y9`y9dy9^_[]WVt$ t8xr r11ݜ$D$8dt$4) 4<'RSt$Dh$QP7 ty9py9ȃ|8x8D$u݄$|9s0;T$ D$r$|$\$|?؍<)h$؍<)h$QP N+xy9 |y9T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh8? VD$ B J1rrJVRVi $^Ã0D$4L$8T$ 1ɉJJJ JJQRPԻ x$1H0V軼0j誼0^USWVh=`8u=d8u }t$XjVg+9~=9N+ 9y@BD$HT$Ll$HL$$D$$5&|8 x8Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и#t.#|$d5y9PRQh7$hW|$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ#r.#+|$QRhJ$Pt$a$ų i)s<$*<$Hrr޸t1@D$))kd΍ ,9HQP~ Q P¢ʍHr̃t"1,9HQP~ Q Py\t"u5,9HQP~ QP:09Gdu091G ,9HQP~ Q P[~#\uE,9HQP~%Q'H wr? t:,u3P袡t%09Gdzh$ 1N09=09iu%p'h09P tu :v2USWVՉh09Q)|tDj.VF{1ۅt6UP|u&)Wh09VOY u1ۀ091C^_[]SWVD$=<8t59h$58 nD$t$h$PV` uA h8<8tD8t$~Vt. 89PQ y9^_[Pv蔘t=h8t"=`8t58h/$58 1G=<8 Sh%hʁ9U =9=9ShV$h9U =89Sh8&h<9pU =\9Sh;"h9WU =9Sh'K&h`9>U 9=P81PPv h$jF WVPhL8ơ8?snt$hO$P& ƆL8 M8?)PRQhЕ35 x?t$|$ L991; 8 ^_Ph3$5 ^hU$t$h$58 =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=8tDt WbhD$.$t Vah3$PD$D$ L$PQRSm:4$uu|$l$ 88tQSh$PSh $P D$WjPUhЕ3tU58sƉ$t=h8t`V S<WFWt$PR Whz$VS WSVwS $t P`4$Vh $覟uD$uqh$& t66hsB#t$h$58y9kt$VD$V6PjVJ D$Ph $Ƌ|$W PjW u{D$ u?h($S& tt$VD$ VPjVզ D$ 8Ph2$蚞Ƌ|$ W苚PjW蟦 1ۃD$  ˀuPh2$Vu_4$91F=8uR<8,=@89Sh*$śOuh&$E 1$tP^$|$t.W軙PjWϥ D$tP^D$|$ t&W腙PjW虥 D$ t P^d^_[]h@h$hL87P 805L99Whh9۠ u999V5`8=8u `8h$Ӝt>h`$h9dN r1ɀ9.)h9Phe$58jh$h9Q tfjhy$h9Q tN=89t9j h$h9# uh58h$l0 S=89t99j h$hʁ9N thʁ9hU$58 1H9999998sh$1Ƀu 1A9u ǀ9u 985`8^Vt$t3DH@tNFuh9$V$stQjh$VlP tDh>$Vrt9h &Vrt.hJ$Vru'999 99^á9t P719<899=8u 8l8889t PY[9=8t@888j=8t#8@=u1HjhB#P jh8 WV裥0jk=<8tp9t1@=u1HjP 5919l8x#jP 5l8u l8<8|$ j%=<8tD9t1@=u1HjP( 59誔9<81y9P8u 襤0^_Wh$j= D$tPEHt h$ja= h$j= USWVt$ \$l$|$WSUi tU\| u;HDO 1 t$ t$fO gK9uX ԕ3I ԕ3~Е3PЕ3hЕ3 ԕ3 tuÅt$g t^_[]Vt$V>Ht^Vhx$j< hh9; t9USWV=9H8t`=<8tW$tw9Phh9" j h9Kn9tJ91P芒99tNjwt99t$h58VqI |0/thhC%VJ hh_$VJ Vk5$$PS  `8L$`8y9$-d81y9d8$ t1=8PGt*Q$1SSQPVh$y%u8y9d$$r t9$ t1=8PfD$`8$y9-d8h3B#V9VA9t2$759ʐ9Vhm$6 h$Q 1^_[]USWV,=H8t8l$@11 SjhU tUhO$ ",^_[]<$tދD$0S ,^_[]WVP5`8=8u `8|$=9tft$h$+uqj h9Wk@j WP耿  =3LO@1 58jj(h$kru=y9u=9u 91HtJ=8uA58h9' 8HQP~ Q Pj 蓽1H‰5`8^_USWV45`8=8u `8\$L=y9=9!t$Hh $+j h9jt|$j.h9ith9褎94$uY9519 91f u>h9h$58褹 f920h9hT$58胹 9t$1 U&Vhg$U>O D$(Vy!у $ `858jj(h$iu=y9u=9u 9tj=8ua58h9% 8HQP~ Q 0Pj 虻# 8tUht$58k 4$|$5`8=y91Hƒ4^_[]t$h$j2h9`t9h$j5 USWV\$l$jWhhS#WhUh$SM Džu&Uh$SM DžuUh$SM VjKh^_[]SWV95`8=8u `8=y9h#+9u_j h9RgtL8tGx"uAHt.1Ҁ"ux"u"@9ZHt@r1Ӎ95`8=y9^_[SWV$h$VzB V? hG%P11Fta\$SW\ t?|$/uH$VAPVS4 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh&P[ ƅu 4$ڂ 1$^USWVHu\$ $Cj j ShWuu `r t "hVW9 j VS9 8]t/M I9Nt vuvvSf jjST ƃPjS: \$fD$=8~%|$@jWN=8O$Cuu S) VjP 1D$ PWhp" D$ PWhr$h$&賑81\$@jPPhSvvq thh"S8 w8Sh$&-D$ PWh$M8$\$=8~N1PD$PE<T$@L$H+T$+L$x@BѺMbiy1fD$ PjS u,ǐ8t轐8#tj}ud觐8AuZku<FD$ t:D$L$ PQhhuLn t\$ ۋEu Y JD$ PWh$h% 1He^_[]e t$d_ SWV|$GHO~H0^_[Ë\$1NWu4G `f@uɏ8t 迏8#ug GHO~막뭅t蚏USWV|$\$GHO~H^_[]1M;G~ uWSĭu4G `f@u<:8t 08#ug GHO~렉륋t$t WV|$hC$W΀t.h&W輀t!t$?tt$ hT$#1F1^_ th$j' Vt$ Vt$ X t^Vh$j' USWVHE ML$8t$QPV DUt$F|$* WEs|<ǍWhJ$ttI=Ԥ9uCؤ9u:Vh\$$WhM$-hЕ3rjD$P|$W t $Vhz$1PPPWd=Ԥ9$uL=ؤ9uLhh W ƒu 1@P D$ 1@P^ T$1=ؤ9uW4$T$WjVh$$P t$t S7N| $T$ V1PPPD$T$4$ t h$D$ tP t h$L$#L$Ԥ9tKfjjW tT$PQL$r]tDWh$b4$u W Vh$Wh`"KWh$*$l$pT$ 3T$ϋD$1 u V迺4$ $Qt$Pt$h$s4$ $Wv|h"$1B1PW 5ܤ9h'h$h3s jV3h'h$VS {~Phi$V? jŏUSWV΍D$PQ\x#L$D$xt$hI"1L$h $tS&$ǀ=ؤ9u$h$jى\$9r<$SWV: t*t)u1ۋD$)؃tǃwh$ h$@<$D$1Bh$PW|$ WW3e^_[]h"+PD$L$ $QP[=ܤ9u ܤ9XPD$L$ $QP0jFUSWV׉ˀ=9u h$h t$9jjjS`!ƒt7jPS) tuh$Tl$h$11PUVWh$艖؃)ˉ u1VxMƒ|" Ɖ9r |$ ti1 |$ Ph$jV蔔L0L0D0.Vh$h(3t Wh#ƕ^_[]PD$L$ $QP蛢 =ܤ9u ܤ9XUSWVpT$hL$lhx!}ha!D$b$l$(T$411 j$BBt$rZZZ D$D$D$ 1D$D$D$ 1D$$$T$ȋ|$0ʼnʼnƅuFuBtWt$0RT$ T$,:)QPt$t t1Ƀu 3$1A|$0lj|$0ʉD$(L$$1T$d$'1@ɽ9jD$0P~Ń|$<T$1D$ D$,8@D$,O|$01PPD$(PT$ D$1CL$dD$,t  @D$,O|$0L$dqD$,8@D$,O|$0PD$,L$@D$,O|$0D$ %|$ D$,L$ O|$0D$D$,L$ @D$,O|$0D$, L$ @D$,|$ D$,L$ O|$0 D${D$,1ۀ8à D$ZD$,8 @D$,O|$0 |$_ $$'Cىt KDP@uD$ 3|$1 ,,C t ^DH@ujGt-Ê 3DA@CCu 1OD$" 83L$C CDP@uʃ;K}/ K>C<\W O Cj$jGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E@9ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$D$9$$ D$ PhWZ  h)G1$C<\  Cٍ$ j  H$$ j  Êt3DH@tKCu$ D$VVD$PV5z Ǎ$$ D$ VVD$PV5T 94$ =<31@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$9L$ QhP 911 |$ 1 $Rg4t1BuڋD$8L$ Qj P94 Ǎ$Pj t$4 ^ŃuuD$ L$ }D$HPQ4xWt$ P> $(4$hUt$P> L$l$ ȉD$<9 ɽ|$X3CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't 3DQ@tVFu$$  Qσ s[9jj $( PSc j8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A 3CDP@t Cu;|kw3Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ V E =9 hh V EKCDH@uٺH$yG=9 GKoCDH@uٺR$KfCDH@uٺ_$ GQC t _DH@u%ƋD$pWW@1҉ϊ@usFCDH@u\.tDH@*Bhjh$(P 1 $ 11E\tuQtA u>AGۅ)=wSVSƍ$ jhU0 uG1,9t!9}uEpVpX*mj 9xt$p@ 9>GWVt$F1Ejhh9f Å1|$څ,5D95@9h$|$t5D95@9h$9 911<9t6 uGp5D95@9h}$݈ W߅uFu9t@Py99P`9(^_[]R5D95@9h$j 5D95@9h$5D95@9h-$VQR5D95@9h?$$P5D95@9h$$P5D95@9h$jjUj1 5D95@9hl$lV5D95@9h$UP5D95@9hI$>5D95@9h$(5D95@9h$Q5D95@9hZ$5D95@9h$5D95@9h$jj 5D95@9h{$5D95@9h$5D95@9h$5D95@9h,$n5D95@9h$X5D95@9hf$B5D95@9hz$,$P5D95@9h$Sh$95D95@9h>$$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u9_NSFJ1<9tJ9ouwvSTt?G $pSH|$698^_[]Ë$@S5D95@9h_$j SWV׉HЃ s%j SV~ G3^_[Ã.$tJ+unFɃ/t\u[Fjt5Ɗs9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ S0 uC99s9؃^_[]Ë5@9=D9SP PWVh3$j USWVP׉΋$1m~ w]$T' 1at*dt+fuC j   j j t C$1E^_[]USWVӉϋl$$1N1҃1t*j @x R3R3>u)jH1҉P5R3 R35ojnH@R38 R3>u j59h(3Iu  9Pih"j HXPPhp$h3ujiUSWV\$|$t$ 91EtB59WV} <9<959I1<9@9Ht8h3B#pt9 <9I D9Kphe#jh93prf89"49 ...D99<9@9 9 =@9u98#uxnu 9  9W1 t,E-9@J}9<9R)ʉ1ɉ<99‹\$k@91m1 @9Q@9u>#u~nu 9t91B C1ɾ8f @9@91ɋ\$u@9\$t1A ^_[]ÉSQh$jY USWV|T9uN X919u:=9uT9Е3Е3D9$\9(3`9"P91NHQPPGT9=Е3PWF=d9tCd9S萐S5D9 thd95D9 od9=d9tM\9t=(3tPEV\95D9hd9蔿 d9`9=P9tP9X9 X9@X9D9=9QPrf|$98t0W5D9d9Vj W59V =<W5D9$V8 W5D9$U! Vh .U PWVhd$Whd9;l9hd9\9޻t=(3t PvDhQ$hd9dp\9rH9tt$t$Pj \9H9tȋL$!QPd `9d9=9u@9D9\9(3`9"h3B#PoT95D9h$  9T9$@1Q5T9P蚋 5T9hL9hH9R ƅttbH9|0 uNt$@ $@ $QV5H9P@91@|^_[]5D9h$j 5D9hj#hL$h6$5D9h,$j h$h$ =d9uh#$ hd9jbh$벡T9@ u:HQP~ QPCt5T9PR 1=9t 9t SWVX9X1t^h3B#3mt&Nj@HOWCuWA[뾋HWPɉ WA1F^_[Vt$Vgt^Vh$j Vt$ D$tVP)uVh$j V^WV|$t$ WVt^_WVh$jW SWVP\$|$d9t P]D$jPSW PLd9VPSW d9^_[USWV@9jhh991FD$p999JBtOz T$R uW|$+;A h9l99ыR L$y th|$ @9)щ;HT$7D$t{T$A h9l9+9. @9;H@ h9l9|$to9u1ۉ@91;A@91;AT$t1~T$ 9=91ۉ__ WjWSQPZE|$t4JT$B8 @9;H`9T$9591~>~ VjVWQPD1FT$19=91ۉ__ WjWSQPDT$t tCsBtt$u @9;Hr9xt$t@91BtȉÅQJA7$ '=p95l9$=h9FPj W  @) l9QPW% 9Ҿ5=9 9R҉Y = 5@9h("5\9 h u 1PjhB#h9S1P5959)1PjhB#9S1P5l95h9S%1PjhB#h9S1PS =p9 T$h9=l9GPj S ƅ t9D$4)أl9t9 5999a9j5959hh9j5l95h9h9 4 5\9r  T$h9l9D$<=\9(3=R311 |$@L$ɿ1D$@PL$ QSD$,PtǃrT$ 1 |$@1GT$ uGF;5R3r5\9jjh%5\9j$p 5\9j p 1-RL$ tKQD$ ;R3r5\9jjh%15\9WjSt$ tsQ5tejPh' tQF;R3r5\9jjh%81')e$Pha$5\9e Z;R3r5\9jjh%1t$ D$13Phm$5\9d F9ut$ t$L$)4R3F9r5\9jjh%~5\9j$o 5\9j o \9@ @9  ֡9 p9u55\95l9j5h9=t9t5\9j n n jhh9Y p95 =p9( 5\95l9j5h9=t9t5\9j En 볋59999+h9T$JQ9T$ut Q;P l9T$I9D=p9yBu%hh r F 5l95h9PY ;l9 jhB#r9  _ T$=9ujjh#h9 p9D$0l9D$,h9D$(t9x9|9h99t9L$(t$, 959L$0 9999=p9_ l9QZ=<39h9 @ h9 l99r 9֍9@PQ959 $r q Bp h$j 5`9=8t=Q PVh:G#GSWV\$t$|$G 0A;OvGPwGD$u G1OVPQC ww0^_[USWV =911E9 tui5\9tjtI Oh3B#tXt:Ph jSUt5\9PUS Vh UVh,G;=9v\9@ @u199 ^_[]Ë5`9[<8tL<Ql PVh:G#j# 9txt@ x{t1ɋjjh#h9^WV|$t$ 9tfF{t.wt8suOFHtQ u>F@+6vFt Pң uF6^_ËFp vh$j USWV ՉL$99щT$Љ$ 39E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B ̿99r7 ̿9P5ȿ9ȿ999$90D$SPt$V it}ŋ4$L$]\4$L$t&uE\̿99r+̿9P5ȿ9ƣȿ9959F1C4$99\$D$ ̿99ȋ$r+ ̿9Q5ȿ9;ȿ999 ^_[]USWV`}$111D$hs$u Wb uu5t=>ut0Gtgt=;ut=$8u ԏ3ȉL$91t*Vt@T$?D$D$t Vlj|$\$ |$t?1hJ%S]U t+8ttDGhz$j 1E L$3 thG% u3h$jr tD$PW uh$ۃ|$ tt$脡 uh$뼅tt$ uhϙ$렋Cu/hx# ,%tjh$VV, VeSPN QVh$ 16Ph$h3R jwGUVQt@t $e^]Vh$j5 WVP։971ɉQPW V?t$8t71H^_68"u #Ft1fUSWV\$t:{u4P3ƋD$pVtD$0pVo Cf{~a11C403t?L$qPt+{|7u!473L$1qP D7EC9|^_[]Vt$FtKPF tvPv sF vvVF^USWVP1k<j`3~4j`3$h޹ 1BD tf| t@BuG.uf9}[t t t t t | | t B$9}0$p| |||<\\|B9|K$f^_[]ù USWVPk<j`3j`3$Xݹ 1F9T t.@Fu^9$}ST T T T T | | T F89}+P| | | | < \ \ | F8Of8^_[]ùnGn8o)op ph3jjCh!$XjCV1=9SGZt*yjjj> V`V觅5<i95<v9j5<@9jP9t#1ɺX`3A<.u91 1@^USWV D$0f 99Z 9,I fEE!f ufE(Mt!U1f~ t @9ufE,$]tE,t}u t$4UЃE0t t$4UЃ}F1ɨt1Ѩt  D$ $AuQ T$qIL$tPP/tCÀ8ttHD$߉)9L$L$EGj Wu%$D$D$&$-D$W!9D$D$\$$Xfy<9Ӄ$x fu$xffx ϡ9t$ )9}2f| 4$FDu)y1҉T$ *)ʋ4$fV ʉ4$V494$F@ut$ 3ft$ )9$fH |$D$Ef|$u]f~P1ۿD$D$ $I9ut9-tPu 9D$D$C $A9|D$D$D$L$<9)T$ft 9 )t 4$F  94$F )ST$RWP-FRjPG t&Pt$vyPv4$~y3F St$WUʻF F tP5<T$47}W8uDW81vum=~7=S=Ru@w1$'= ? 3DAh3jT W@$4'MуEu<1nP9t9($@[uMуUu1H9u} )y19|fu9f}=tUу$D'E&HuRufEU9fEEUM )ʅ1fU)ȅ1fEuLW=m$ 5<ף5<1QQPSI7t$V5<G5<f1U)19}1ۋ$p$)ŊEt9}1< ˊEE5<:h$1VV5<蓇UVj5<聇Vj5< 5<b5<t5= 3DA=p,tNdtIM=Q%r(=t.2w utqu#[=Rt=Sut(=u}u&h3jQ bxu+=9 9σqt$VdV(Vx5<Ih3j Q ,$,$fUuE 9|)BfUh3jP ,$T$4xut EfEuGza|1x(| E9}ED ufMh3jeP !}Eu)uE t uP踼u f;}]D; jtTD; tt$4UЃF4; ~ttt$4WZu~E tuPu vE u^uvE9,Et)uE t uP軻uEtPQEEf~3M1tR'MEGЃ9|׋E4t t$4UЃu!vEE tP vE ^_[]cSt$59t$t$h$h3CZ8S$@ t$St$t$ t$UPh3$'S $A It$U59t$SQPh$h3fC$j7USWVT$qЉD$ qGud$ T$T$ $P$ǽ)j P)1Ƀ QWl$ U|$ WD$pDtS;tNt$Cj S)؃ QSVWD$pt G}uo $ $l$Atl$|$qƝKL$L$ S )D$ su|$f{f9 )Ffs+D$D$ D$ 1ۈÉ99|9~4$f~\$ )f9} $)y1f9|fy $|$9f;t$}V9}R\$ _Q*uD*Pt$W L$ FyD$ 9‰|$9} 9|AuD$u#tЋ<$w(t$SCW G΋<$9Ƌt$ufthu$VSw΀|$Gu1PPw|$ GL$G)VQw w艺 ^_[]D$L$9 fAËL$1x9 9~9USWVl$0.99}=9DP59wǍ PjQ  =9ۉ9t @tFj-9E3\Jك@to@uwt uDZ@t< ty< =9u =9tI59wtj 59$=9uj 59 9 999?=9u"59 wtj 59j 591999 99 9f) 91ۈD$u9C59vt$L$4 59w9Ƌt$|259vVUUU9}j 59|$uCj 59KVW59] E߃ @ Ȣ9 9=9uW59ut7j 59r%5959,Y999 959O ^_[]t$Ph$VPt$D$ L$ $PVP1A4$^h#t$t$t$t$USWVP|$ \$$l$(t$59H9 9D$,$VpUPp1B4$SWt$(^_[]USWV,T$ˋD$@D$|$HD$DD$ʋt$LuD$1GW蚢j59j1ɉV,$E|$@t[D$@8tRD$u:hni%59Wt$@59zWh#59gWWt$Dt$d h\%59AW4$V59sD$ 59s59t‰T$|$GD$$11҉߉؉L$ D$D$T$()}w\$ 9tl$l$)91y1OD$9Ή)9L$)֋L$)9ȋ $PQl$(US59.W59sth) &US59wW/)PS59 59T59fÃ~0L$ZD$  &1 L$X1)<(x1 3~$\JDY@uBЉŅx1~$THDQ@t@ŋ $)\$)SQP  QtRD$(υ~] $9I\$)RPQ趝 KOuLuH|$@tAt$t$D|$W藡 Wh3jv D$z19Dzf tN;L$$} 3DXuh3j/  $9A)RPQ $8GED$t+)j Pt$59L$9 9D$t8ʋL$ u|$@t$;D$@u  $L$t$t$P蒠 4$踮0^_[]h#t$$t$$t$$t$$t$$t$$t$$t$$$USWV\$<|$4l$(59#p59o$tKۋ|$,;S|$0L$Dȃ19AD$LD$Ut$HP1t$PQQŹt3;|$,t.D$DE9}SŃ1A |$,,|$,D$D(9~l$(tȉl$(L$\$8u )։GT$t$0y.U j POtC@j P9uL$$)݃} 9WUQS59览ƅ|$ V ƅtV5<4$593PW759MPWI1PPWB WiD$E|$ GWUPS59Pŋ=9VPW=9V$MPWJI599 9#WUt$ Sh?i%59®1$|$<\$HD$LD$t$(SPT$t$t$Ht$HWtIV 4$tWV計VCWUPdCW[C^_[]h#t$t$t$t$USWVPt$|$ \$$l$(D$L$, $PUP1B4$SWV]^_[]h#t$t$t$t$USWVP|$ \$$l$(t$599 9D$,$VAUPA14$SWt$(^_[]h#t$VPt$D$ L$ $PVP1ɉ4$ ^V59k591k^fUSWV $$$ :15!:58#::y%5":W0:WVPm H'Ft(=h:tvvP vhh:&B>vuɸx):P:!:": ":hը%輤 D$|$ hi%SUy e~o~1pKrtCGDT:붃fg5t=h3B#VPhWH \$h#W6 D jPh$ t \$Sh|$W u4 j%H'WPWVn t }u몋}tE$th#S5 <=u͍4@h#P5 Fhm%V! 04$VWP H:h ":h":hi%5t=o bS$$$ Fmt=D$/J1Whm%lu#D$=uD$h|$d}:hm%k t61W& t@ < uFrWc 1Wc jhC$h$i AR5<gǃ5< h1FVVPWg}\:$t5":5 ":W5\:hZVjVjhj5<)蚅hh :kD$D$@VljD$ VD$1Åj2PÓL$t|$ o u*t$ G%n ut$ l%n j|rjUtc1L$ <:B @9u1PPPPPjPPj jUVPb4t(jt$W-WA11Vl|$ t$~14S4HC9uW:V1j tPjպjVhZ# ![:j":j"X:$u誸t`=:t jǡ jjGȜ/ 91 ^_[]Ét$ hT1GQWP Ph$h3i  VAW =h3jj,hqi%?j Źh3Vjhi%V V1Fh3VhEh4l%V UWVV h[#s P誜 6|[3= :t>V萙Phzm%W 5 :5 : :=`:t>VHPhm%WL 5`:螾5`:`:= 9uh3jjhm%e^_]Ã=d:tá!:tt$P je j^ h[#d tP藛 t hC%膛 Zjh.w hjUSWVB L$Qe  P聏 Ń j h'l%Ug ~ uF t$|$ W> WfD/UW` Wjŋ>7P*tn,$n ;nu:FUWњt^FPv蹚tFljFn ~D$P豎4$裎UV S ŅS ] ^_[]ËD$L$I41@fUSWV1t$:j%Vt$t$ t$t$4$jjVP;=:P~t$Vj >hj]jYj߄{jVf4ʁVIVjj^4?15:0~|):VPX~Bjhy|):jPWyjhx=T:V/Vbu%|):ǀ$jhxup胲~|):Ph$jX jtO|):)tTPCu2PKu#PuajhxP辚^_[]Ë$l$ D$jP輖tщƅt*1L$1ۋtt 19t G9uC@9u1ۃ|$t01L$klT4tt 19t G9uC@;D$ut914UZG9u1PG9uUgU$tG10L$9 t.T94t&zt T98t4t9t9b`$El9rۉt14U7tG9uVYfVKfSWV1t$t$t$ t$t$4$5:jV#jr4PVf8 |):$*tKuKt!Pуt|):$P|):L$$Q3 tXD$t$VSVx)VOum%um%t*VB^_[À)ujhbsu Vt5<z1WW5<' 5<i5<zSj X9;xhj_jZjC]jVkJm%m%!}E'USWVο$WQS Whm%S賌 WSU WhÓ%U藌 S1tGUt0VVVVVVVVVVVh#h41PP/t US^_[]SWV$SQVT Shm%V SVW8 ShÓ%W Wit VW^_[WV1t$t$t$ t$t$4$5:jxVtkjo4PV[5xG|):*tD$$tL$PQ^t$VfLtV誕^_ÉWj $?t1hj`PP~u{?fUSWV$$$$1EQt < tEBT$BL$ QD$l$1@$4V9D$pPt$V Z$DaD$|$ $%t um3DJ@tiOGPXhg%dj D$(PW# L$$9T$D(D,BT$ 8GÊSC؉τaitqs}l$1ҋ53t$l$Du@u:Ht\u|tBLBu׋D$D(|,@D$ AAl$끀%G4@< tt88t%OGt8u3DH@uOGu:D$$$tȃctaFt,<$t( $ Pt$D$0PT  $uN $ȃ $1j D$$PV \$ 9tOL(tu(D, $ $ rt04@ Ct<$utCGދ$;xr$$E9`$l$L$AE91^_[]ÐUWVWu 5 :t@WPhzm%V 5 :M5 :O :sh%h$n%1  :t*W蚋Ph5n%V 5 :.5\: 0AtPhKg#h%j[1e^_]PhIn%h3D j UWVV't =`:t>V1Phm%V݄ 5`:V5`:X5`:whQ$hn%> `:t81hn%W莄V虊Phn%Wv 5`:$%0FPhn%h%j[1e^_]V1hhPhPjjPj jjhu3hи4xjP訪V輹^h3jjhn% :tPjjhn%jh SWVD$x1|$ :t`:Ps1; P]PVh:G#Wg^_[USWV$$$L$$QPhV $h3B#V ! $D$Wj1K4$r 1G9r6|$  WUŋ$(\5F4$ ÃugD$ PV1WuH|$dh3B#V $t:|$G= :tVhn%hnn%P5 1KS1D5$$t 4$% 4$ju :tVhn%hn%P 1ۉ؁Ĉ^_[]U袐$$$1KT USWVu ED$l|$(PVW!  ED$8D$1ۉΊ<'t  j Fj'V7u Vljt$ t$PSW D$ t$ )VPh"L$Qp! ho%V t+9s'T%u@u @Qj*P ;'uC|${*1\$$|$D$8j/W tWT É@/ WS É|$PD$Sy} ND$+D$D$ .t Vt$W tS>} Džu]D$T$L$;ȉD$Pt$ SD$L$Wt$t$ ho%P 뒋D$L$T$;t RPSVK |$\$$h%Sp G|$\$1\$L$< t$0Vhht@W  fu fD$0ff|$2ufD$2PMufD$0D$ ru=L$(T$0 d=<jP|$ W 5<m:5<j5<_5<v.m<D$D$(D$$1WS]D$ L$VWSPQh61N|$p$ d:hd:hptt$$ڹ =u3\$hu3hbtt$(賹 us=u3ujjh-A&j%= hu3hf@t$$ =u3t0u3hu3hbtt$(V Go%\$u3 :t P蚨`:t P胨q£!:1t$@t$Dt$Ht$Lt$Pt$Tt$Xt$\L$1@ D@5d:L$@EL$D$D$9}@D$hP+)AtIg|$u9Mx{;5<tVHjP)|$ۋ|$t hB#^+hPH+gԕ3H ԕ3~Е3#hЕ39Nj|$tfjv* .;5<t V|$ t E%u15<Q5< j5<SX{ft$(胆twPquW_D$td$8u-e^_[]D$t$ hn%jj Vhn%P 1S9 1FV9 Sjh_v%8 VS t$8 $ D$pL$|PSt$(p t$ ` :t*t$hfo%P 5 :  :`:t*t$h$Pv 5`:ؿ`:ha&D$ 0u.huo%D$ put$vm t$e s h:REtt8tjP; u%t$V6 6ho%d j 3L$1Phxo%td USWV։5< 1@P5<V5<|4dh 1PSUx) =hP-(=hPS1CS=) <Wh$b=hH%'FPU蚇c5<D@)VUPRQ5<[_tcjPjbt05<PV 5<k$PV 1PPV脹 V;c^_[]h3Sj+ho%/S fUSWV-1@=$9$ht%Pjq h:rD$1D$ $ $?$Vn95L%VWs PWt$ נ VWr G|$Uu%'3D$WPWt$  uD$L$DAu >uD$ |$O 4$ ))ht$Ps FD$ |$$ ))Ƅt$茁$}8 }? jSz ƃ $NfFIJu1ҹhuRRRRQRRQjSD$DPjuǦ4D$D$D$ D$ jtSD$ Pt$yD$ p $9 )) hPh(9_r 14'jVh(9T t1GuD$(Vh.v%j@$S^ 1PPD$0PD$XPSD t|$Lub4Ě'h(9h%h-jSj"D$L1QD$PPQQS0D Sh@v%s1=(9su=)9lu3 *9DH$D$$PhC% u5$nfsu( $D$1@D$ |$$tD$$D$$i jvjh1Wt$TV j!W|$0W iW&]hhv%QCh9PPji=9 h9PPhh%hw% Phv%j+o h&w%Wohv%Woh'w%Woh*w%Wnh9h5w%Wn =9t!h9hAw%Wn $9hLw%Wnh\w%Wnhjw%WnWhr%jtnh(9hmw%h DŽ$h9VVj~j hq%VC 9defa1ȋ 9ult1 j hw%h9C 9manu1ȋ 9ual1 91 9none1 9 tlf=9 tb=9t`h9h(9hw%jtCh(9hx%Sj~$$'|9(9hhw%HOh"Ifh(9hw%hw%hL [ 8 (9ho%D$ Pj3 ~ht$ h,9Im t$n{j h,9~th?p%D$ Pj ~ht$ h):l t${j h):.t=):t (9hp%D$ Pj ~ht$ h+9l t$z=+9u:hIq%D$ Pj@ ~ht$ h+9Vl t${zj h+9苐t=+9t (9hh*9iu=*9t (9D$1@$" h9S$Wk V*9PPjxV+9PPjw SWht%(9|$$|$ t |$uj)9PPjye|$t jG9PPjz^h)94$ =e9u=q%=r!ƒq%tq%=ujQhe9j je9PPj{h,9PPj}(9u4D$D$Pj|$uh):PPj|=):o$o$t):=9q%t9=)9t)9|$ti=G9o$o$tG9=e9o$te9=,9t,9SVWQRh(9Ph*9h+9h#h,$L=e9o$o$te9=,9t,9WVQRh(9Ph*9h+9h#h(jjjf xP* 9q%Ph$hb ha}<h(9hw%hSr S"jrjQ$H1WWV$Phtu%d; t( ;$P$Tshu%jPbt^DŽ$ 1WWV$Phu%; ? ;$0$4&hu%jPh`uq5": 1H t$t$6v1t$t$vhr%j<$t$jw$91@$F=):hQ$h#r%N h4r%jft$(VU VlPhnr%hQr%Wtf=+9th+9hr%WXf =):th):hr%WNƸJ%uցļ^_[]VPh(9hEv%PjB#Vt$1 Vj1 tfjhiv%V u;hqv%V u&h{v%V ujhv%V詬 u"hB#j1 ƅu4$p^Ét t t@hVh9Hb SWVt$hV `uT|$tMƄ$j.V]t#GSVh*9a SWh+9 hVh*9a ^_[SWV*9SȪh+9蹪hSh9a =+9tO)~!)9.u*9Ph+9茆t(9VhG%W b Vh+9Wa ^_[ËD$wК'ø#USWV$Vhf%̫u $1퍌$Uhs%W :HUUW f@$|$$jhs%P 9tx/uG/$N~/vt$jhs%Pa #wК'1҅‰)ˍL$$QSRPhs%hUK ^_[]Ƅ$8USWV΋l$M9vb׋D$tU|$t /u"t)|t<#:1ɀ=:/:QPh%hh`:b 1^ËL$1Bh\$:WVt$=$9u jG7Wj 螄u1@l#:\5!:o1ɀ=:/:%QPVWh": =1ɀ=:/:QPVWhT: 1^_Vt$V dЉh:$^WV D$Ph4:[ u:$nfsu-Vh4:h":] Vh:hT:] tWj 蔃1F?t[h:hZ#:hs%jPu>8#:s%h4:VWh": h:VWhT: 1 ^_SWV=$9hU(9u(h#%Q\u9h9hs%U=):t h#r%˵=9t hw%赵|$h(9hs%hW hQ$WƅVWPht%j[h+$V[=9th9h t%Vy[ hr%jj[(9uGWPht%jK[=9tDh9he9h)9ht%V%[=(9tCh~t%Th(9ht%he9h)9h*t%VZhr%jZh%h9t%XPhDt%jZ 'w%SWZhv%WZSWZ=+9th+9hv%WcZ h)9hv%WPZ =+9tPh9hj$W/Z h*9h$WZ W誣hr%jZh^t%Zuh,9hkt%nS=9tht%XSh(9ht%FSt VCj)^_[USWV։ϸjPPW tCËl$hjWk ojh(9W(Z WVS] SB 1H^_[]USWV$΋$Phf%謤u tW#V ^l$PSU :<$u#:PVUWhv%hC1Ʌȁ^_[]ÿv%fT$L$t$"u/Átu$Ãt6u8h6h/u uh%!w 'hhV D$L$FFhV~ ȃ ^SWVP1ۉSSWSjhț' ~t{4$6V1ۅtjSSWPjhț'}tEh%VZ' t&|$\$PS׃th%j4' uVXf VKf1ۉ؃^_[USWVrx%'\$|$jSP]9 ƅt Eu$wS7W wh%7{X G^_[]WV'|$u't%|$ jWQ8 t u1^_ËL$u34USWV1td։σSJPSW= t u6P1PhPPj D$PU1 D$t΀8uɃ<$uð1^_[]ËL$u3w4USWVl$\$1}$hmW6StOD$SWPHDWWRt.ljFt(V$'E~x%EE@W1^_[]USWVpT$1ۃy ύt$1$VSWPL tD$uwu=L$V7T$DRQtXL$jT$@RQ u89t*jt$t$WуtT$V $u $C;_ `1e^_[]USWV$1D$L$xVPQ\ $V1VPH 95:D$40$X@h33P@tt$45<:BhЕ3Z 5<$9r :ɉt$ =1MD$Ni8D$$11t=i8,4":tǍXUSN݉|$|$l$$0:|):ƀyH1ۉLPTXVUQS |):" .hQPS VUh:S ,|):L$,  $0$4ꋭ(80T$4 t <$l$t$HDRVSQP|):$()1HD,048Ƃ(1 :<50:6W":|$c[ 0:P$$,D$, 0$4(8苭04 ؉|$u 1ۉ͋$HDaxH O9ً :ɋD$L$ӾV W#QSPSl$GUE |):$H@ VW#RPQSD$BP  :t% |):QUHDRhx%P =|):$0@ơ|):$p&L$*QUPVWjj:WD$ D$D$ PjvD$ t.-:L$QP5|): u<5|):h_R$Pdž$l$|):()8 0: ":VM0:VjP> L$ D$@D$9 :yuƇy$u4P4 44S*$똋D$|):$H@HD48D$L$$<uujj7jf$t+D$xfDŽ$DŽ$ID$41B$D$D$1ҍ{t9l$4fDŽ4DŽ4IEl$L$),$|4xfDŽ4DŽ4IT4E,$DB8t$ 9zt$D$tj$DxZfDŽDŽID4B=ND$?P1D$ +D$D$$|$y+DxXfDŽDŽID4B1hPPPPjPPjjR$Pjz4$1K|$$8h$jW D$Wt$%sD$tvl4u^u3h1PPPPQPPQjt$,$Pj4ÃtCD$WSrD$lxSŁ1H$^_[]1M4$见$<t4u/h誢hPh2v3L |):v31@멃=:yu::s19dL$w BsÁt1USWVD$$|):*t1G.$ )$Phy%hV q%jt(hfMVhy%h% j$ iC%W踢|):$PhƗ%hV| WVhQy%蜥 ]hC%Vjj\Q1PP3Ahjl1qf$ 9`$D$1Y|3$D3 D3|31QQQL$QhR\$$t3WPx tt$S6t$ }1AQQjL$QQS\$$t3WPx 1AQQjL$QQ$ Qt3WPx D$0L311҃9.$ܚ'hy%D$P y%D$y%X3|$0tPh6y%hWŹ Wh1۾PxD7 D7D7܃t u<7uD7u D7q\$D71S1BRRD$(Sh$St7PQx لu1ɀ|7z#t#$ {%\$t7ȉL$7 T$wXy%D$ q%D$$'#$uht$$PA {%Pt$h{%t=uD7L7qQPhW{%u4r$$z#d%Dz#t $D$ % $T$hC%RT$ D$L$ 1@D$h|{%RT$y%D$L$ hC%R薋uD7z#t$$D7#@t{%#y{%#t{%T$(#t{%T$ |$$#t{%L$,#t{%#t{% #t{%t$t$PQWRt$8t$@t$Ht$Pt$4t$0t$Ht$4h{%t$D?@غRPh.{%t$>ClE;F{Pp\$CPWL SMt$0|$4hh褕L$0QjP7. P8WMtVhz%t$y> SvM=h:u#D$@h:@@hPih{%\$ S0>h|%S">h|%S>=h:thh:h7|%S= $ 1|$@VVPWht~%; ;w#r#t#QhY|%S= h|%ٕh|%̕h|%迕=h:t h|%評h|%蜕1hr%WL=SچWhe^_[]USWV $ 1ۀxt ؁ ^_[]1Fl$ 'h|%Uq1 Ueuhy%h|%UJ1 U>FjVD1Ktljt$#"h|% :GR$Gq%G 'w#"Gh|%9G R${$q%C(s4C8'h|%9C<{@q%CDsP$sT'Sh|%U0 UstlSh|%Uc0 #"UT9FR$F^ 'FSh}%U/0 F'U9F R$F$^('F48ihy%h|%U/ Utly%Wh|%U/ #"U8FR$F~ '^Wh}%U/ F'U8F R$F$~(^48+4$iƷm۶|$9U :1Kh8z%賙tzh6$臙tiD$h6$Pj記 XWl$UVt$t$]I6NIOu4$=I|):Ph$h 1PP}#|):)t5PhƗ%hU 鋔$ 1$ 91APuDFl9Ɖr:|):Ph$h6 1PP"969ƻsRAklT421GWWjjhUt8RVx L$ $ g|$3jhbhk}%h_}%hh}% L$T$jt$oËL$T$jt$XWV׉κq%jujWZh#Vh2B#蘔 ^_V91ɾ 9r^^VD$9tU@8xtlIuAH1FVVjjhh90QRx tjh9j*= t9^À=9tjh9j= 9USWV 1WWj< &iP 6SPj < t$ Aá3D$1/dev4$D$iƋ1N/ u1FSt$$P /dev uDL$DAt|tER|$$t.jVj < t 3L$Nj4$D$/devG4$D$M[1O4$1O1VyE ^_[]USWVPD$tPpP11OFtFhC%P݁t.El9u݋L$tAP1xtEl9u1D>L$yҋ81u/Akl|T}%w}%Ph\"h%Vy ^_[]Vt$D$QPbLt(D$t%t!hj*hPQ[RD$1H1^WVD$L$ 9։9|1H^_USWVl$$1EEED$D$ D$,$D$5":.@ujP =D$1҅D$t 9tL$BuT$ЋT$P]1hPPh1h[1jjAPjQQhu3w i4WPZw 8CM} D$1T$t(]9t7D$1G9t}9u9͉ŋD$rz(uRD$F9/M1ɍD$l$$h@h33PuG1G1Ҁ} D$1L$ y(uQD$F9r1t$6jPk;D$1҅ӅtwU~t\P,40U5t5L${|$P=$tL$ST$Dځ8Nut/$E t$AЁl^_[]1$D$Pp1ËD$p1ËD$@1@USWV`T$D$D$ |$tL$D$ 1ɋD$L$,} tp$Ft2ڳ1F9lu <$9|t9Í<2GFut$u$EL$0Qt$UPL t D$@$<T$ $@$;E rL$A;L$tpj|$W9ŅjW9{l$D$|$t1ɋD$D$D$D$D$L$ ,} $Ft2ڳ1F9lu <$9|t9Í<2GFut$uCEL$0Qt$UPL t,D$@u%D$( $HD$D$@ 2?D$$@$;E tL$ A;L$tI1۸hSShS?ShjU>~`^_[]USWVϋ@PD$ P-hFPt$V¬ x1|$T$RtPQL =:1PWt$$t$$wD$T$1PWt$,t$,w t$t$RPqh~%|$dWI# D$,tjPpWC0 t$ Wt$ 20 |$F;pRw =D$G e^_[]WV|$ tt$F fG ^_Q^_SWV|$D$XhƋ1ɀxQPVh:G#S@^_[USWVt$~ tVFtE1 y(tG9r*9 t1C9t]9 u9rQF6<^_[]USWV0D$Dxt=111 StQRL u11L$D$ ED$D;hr110^_[]ËD$L$IH01@SWV$1G$WWjjhV$4PQx tD$WWjjhS$,PQx tSVh}%h:1^_[USWVu rx%'jVP uh8j}wP jVw- u3Ou3Ot 5D$PQ0CG1*QP菂D$,W D$($D$$(D$ ,D$L$40$VRB$$(QVPh}%hSf Z8^8PG@$QP"B'$HffsWBD$Bjh}%1ۃt$D$ h}%h}%WG Vh~%SG Sh~%W՛ SL$Ph}Dt$VW9W}#V:ۻ$Ph!~%$< 1ۄ$h.~%$hA~%PL$LQhkl&PE t$,04t$jj h#RPjV |$LWHs3r \DZ@uWQVt$hK~%ht$ R 1C}$.1ۿ9PSW~ t$L^^^F~ FFVhQt$ ? t |$dJSjV~ $1BfBBfJB rZB'BBL0$VhQ`t$ > t$pT$,ȉ04jj h#RPjVr VSh$ht$ }G8@É؍e^_[]9=}t'fy"9 9NuEt FuXt1€1ɾ9( Ӏu A'w'9 ' Àu A&r  uȃsƄ\$,04t$jj h#RPjVT $PVShY~%ht$yD$T$i!jPD$\$AjP{D$l$jP`t$,04ڍ\$jj h#RPjS W$mPSVhe~%ht$ < -USWVPt$tI $l$߉r u@Gu# .Io11ǀr u^9u $^_[])1 $8 rx\uCtf\\:t\80Y80Y80YJtAG9uUSWVX1ۃ}͋$l~ h{%q= Y|$hC%u pDžtoh'6ptkDŽ$v/rDŽ$/dev,$$VuP>& D$/devf@/VuP!& Q踃낋E\tu xt@@AED$5":$ttt$PуuN|):덬$WPU{% t$/devfF/|):WPVX% [Sm\asDa9aO$CQPU% {PWV|):$t(tt$Pуt Nj5|):,$1D$0$h@h33P5tt$G|):PUntTP,40Ut-t!t$PуS8NuNj$,$1F1ۺ͍L$VVjSRQWUPx E$VVjSRQWUPx $pt$t$jTÅT$-t WVS# $WD$pV" l$ UhJ%VZ ǰD$hh"WEmh$W/mtyh>#WmtghR$W mtUh{%WltCh"Wlt1J%D$t~%tD$VPS" VWS" UhJ%jRY DžED$4$v PS} t"vh$jx j#t1ۉ؁X^_[]ÉNj,$1VD$L$ @4‰qDA1@^USWVE M 4|L$QWVPL Ht1۸tWVуD$=:SWt$t$h$1PWt$t$h|$u1@G#:Ds:%VPWSh": wsVPWShT: 1^_[USWV |$ faa@D$$1C#=8#:th%j8#:VrPWh%h:vD$PUAD$h:5:hl%j訙x8#:rW!:u#:QWh:Vt$D$PWh%SR$'D$D$ =mdt2Vh4:h":5 Vh:hT:" 1$hVS5o t$t$t$D$ 9jVV蕏 ~;Ƹ PV;!D$i jQPj e9]D$|$hlWw'o ~#u4h9hh: 21jioh:ލ$9Hf@ItJu1SSSSSjSSjjUVjlL4jmoPV>VMkt9Phh:c u`~*=8#:t!h%jU18#:Pjn)D$WjS>\$tt21ۅ1C؁ļ^_[]hDŽ%h%h'h%jUSWV|1ۀ=h:t}hh:h%jŕ ue8#:%%":h4:VWSU+ h:VWShT: VU#N@1 É؃|^_[]ËD$L$I1@Ã=8#:th%j(8#:Vt$ D$t PmVj=m5\:r^USWVPWj<1F?tih:h<#:h%j讔uL8#::%%h4:VWSUh": h:VWSUhT: 1^_[]SWVPVj`<>u1@;:%h4:VWSh":訆 h:VWShT:蓆 1^_[ù1@t 9It1ùtA9t 1ùD$9Au9ËD$9SWVhflhy1$hWVj 㹔w3WSChWWhKWj659WjWPVWXI4SP5;VIJİ^_[USWV|$1i/t\1tW9tI1r rr2o0u&1q1ur1ۃ0݃or @뜃|$tB pBBp^_[]USWV|$D$L$BJ 0uQ=91۾]&-9B0t#1urF9tu99u'Cϸ99t099t90 59|$Q-jVPhX%W7%^_[]WV|$t$ Nt tuh%Ck%%2tC%jjPWV^_USWV|$=#:t h:j;WWG:u#:l$}QWVhv%hU蝃 1PPd ơ#:t3Ѓ<PUuu#D$=ueߋ$$$t*:P{jۉt{uh%jz$t]PUh%h[Z$t*:hhSjP2 jP W V jUh@%h Vm Ve tP$t*:Uh$hi jj7ah5\:.1@|^_[]Ã=#:t=!:tUhd%ju C91$t*:Vt$h:%V]\tV":t T:`:^t$-:u#:USWVt$,VFZD$j$t$Vs5to1\$l$t$GSVhVVj UP L$Vtu(;D$0s"L$44YL$|$)L$OGj$W5DžuD$@PPDžj$t$04|$1<$t$]D$PVhVVj D$PS NjD$VtuK;|$0sED$ )UPt$Vy< 1D$44U赌 D$44Y$D$D$ j$S>4Ņm<$t$ >tV\$Sh VX$|$);\$u ^_[]hA%h3%h h%aSV5w31/t.T$ w39u9t 9t q/u^[V1ɍt$QQPVhj% y1t1^USWV|$(1$PPWVhj%p $D$(1PPWVhj%7 Z$LF1d$Pj%J4$>$'h}dH%Ueh~.hh%ehhUdW95\:KD$hjU5\:^R R'PPqhVjU5\:)VVt PVW  WD$ P=St$5\:Q 5\: .5\:Sjh)% j D$ PU U[hG%c D$(SSWVhj% $j蕾 hG%fMuQ1AtCjV u4VhF%"1ɉtjV uVh%j) D$(SSWVhj% u$~h~%jTȁĐ^_[]1USWVhh%B`:tPjjh%711*:*:*:*:*:*:w3/u D$8w3ڃ9t9u@*:Q/uD$/u.*:*:19haj w31@|$>Z9M *:L$ *:L$j5<5<P5<"=8#:th%j聈8#:*:*:6P5*:h%jaa#:Wj b0D$ttRN1ҋ0t1t /u oBrg9uƃ9*:19uAuVD$u,D$ *:D$*:1@9*:^/ *:F*:*:QR5*:5*:5*:Ph%h` jj\/_5\:]19tvh%hu>h,_t$FVj.~th%j軆h1%j謆h]%j蝆1G99thy%jfhC%_L$QPu{h%_$QPruYD$3$L$3$ t?h%h%Mft!h%jޅh%h%a迪1=8#:th%j訅8#:]$1L$VVPQhj%P }t|$ th~%jTGjS"e^_[]1F]VD$FVj/-F^SWVPD$$h%hN%{at@Ƌ|$]1Ph%S9 4$WV VOhr%S^_[USWV-y3ta1Fy3t&U7Jd1tUh$h] 111Fo u1tjh1@1^_[]Vh%]t$hPVH hh9V% x(9ƀ9h%Qgn j/P\*@%*:^SWVh%&]9hPV VN9K5*:\9 9PVh%hWu jWh%D#2 h\V[j< 1hh‚%WWh\jHj j j jVWW$94ƣlz3WP*lz3V9W^ jj[t$59h%WV$u h% \$WPS S輗SVj jjZ1@^_[UWVj WWh/ W |$ hPW: j W(tZ*: 9tV("RWQPh"%hhe^_]1PPj<7 USWV=,9uj53 ǣ,9509u3P>ƣ09^V=(9~GtO(99W4 WIL;9t109h-Y ,9A u(9$9$V} y))L$H 9Jx .@ SPt$ D$Ph9=(9-39|uP5,9 ,9QjPmW P509 09 QjP4W -3D$%=@t=ut-,9D t1,9D8 ut$hC%t$g =(9-,999P6  09D G=(9V V $$,9B (9fJhvjQP3Ą^_[]VPt$D$ L$ $tt$VPEy `:t 4$VP/y ^PD$L$ T$$RQP XUSWV$01D$$hN%WL$Ph$Qc h%WL$Ph$Q; h4%WPh$Q 4$RPAhk$t$ t D$ t$hQ$P ED$\$t$ hS| tt1h#S 4$0PHP$4V|I u <.=tSh$t$t t$ hSG| ut$ Gt$G4$t$ t3h0Ut$FVj$~t$t$Kt$t$.1Ʌ2jQ#D$t P D$t P Wh$h3CU jj$T5\:m1N^_[]t$ Ft$ FV-11N4$t$t$ t$ 4$ VD$FVjw#F^SWVPD$$h%hL%Wt@Ƌ|$4T1Ph]%S 4$WV6 VFhr%S]^_[h}%hN%S%)1ۅtH"t]" 1ۅÉ[USWVh# Pl D$1Ʌ$l$h$U)r ti\$WPS 9s?hhC%S* =w%hVS =wjS t@h$Uq u4$R 1jVb 1Ʌȁ^_[]4$$ 1AVt$VD1|TsrLc1f ^Vt$h:%VwFtV4:t :\:^WVt$ D$wǃr9t\u/tSPQj4 V5<4V5\:3V5<萦V5\:聦5<S5\:E5<5\: ^_WVt$ Vg$ u.>vS0"PVWh%h3n ԃ%^_WVt$ 0PprPGt$>FFVj F^_SWV=w3/t/t$w3GtPVDt /u?É^_[USWVj$t$ )1ۅtKƉ|$\$FUShSSj WVQ $Vtu;D$ rj$Vƅu1؃^_[]VPT$ D$t$4$CVP ^USWVӉϋl$jUtMƅtPt$Vv% S3OVUP tP׃S.V%^_[]VPT$ D$t$4$VPv ^À= 9ua 9g"*:X%.:b%*:U$.:CY$*:&".:SWV\$T$r1 щS8^_[SWV\$T$r1 щS^_[USWVHT$ $Ex t#11ۋuL$QSVPL C;^ r1ujlW$L$D$8~ D$1FVL$QT$RSPL L$T$$k\$lT L$(t"9t؃jQP& $LL $UT4L$ L8L$T$T@Lƽ$$hVWU= uD5<w |5L Ku1PPD$P菳 )ƍD$Phd@V[. |$D$|PhedAV3. Vf$1 GaD$P$,h؄%t$V, 1PPV迲 $C]su PUhh(9t$臷t.)9CD001 -91 u=(9tZF9|4$)ja$,hy%$0uz EPPZn jOhP9D$4P D${O1ɳ$$uƒrL+1Ht$,D04$葲t$$,hy%u EVPh$P EtE @E w-G$9@  V0؁^_[]1D$L$I@P9wʀu9Au9 91USWV$$1$hWVE E jShWWhKWh59Wj jPVW$$4SPV%1Ĭ^_[]ËD$1ɋ0t1ur9A1ËD$1ɋ0t1ur9A1USWV ։D$ $E1$  D$$ ,$D$S% $Em%u%D$$b%|%u%F\$$*:k \$\$$&HD$\$$)|$=:=<#:=*:$ <$D$D$Յ%<$q|$4$D$ *:D$% |$D$ :D$<#:D$%=$9u$ByD$1Ƀ 3\$pz3C|$D$$$H%D\$$({|$!<$D$*:D$pz3{=3#|$l$ D$D$%$kljl$4$i K=$9u $fxD$|$D$$.$H%C\$$'|$u1=Z#:=:=*:$ <$D$D$Յ%<$t|$4$D$ *:D$%2 |$D$ :D$Z#:D$%$juLl$ t$<$D$y%i$ \$<$D$%i$ l$4$h > ^_[]Á=m}3ftp]v%=}3PFSWV|$ty9GO4VS}6tRVP t{S59 9Vh959ho%hS[ jSh%D#w fGlz3~"PptV}Va1^_[ËD$ 9Ɓ9 49fH 89fH1SWVt$99V~)S4:Q F49F89F1^_[ËD$L$01^5fSWV1ۉShPS$ tD$$P% t VkC8VWC81ۉ؁^_[WVt$|$ 1F FFVh|dWd t F;F t'iFP6fu61^_ðt$hzd@t$  SWV$1ۉShPSWt/S$SPW3V腪y 7B81ۉ؁^_[t$hedAt$ ÐUSWVuF 1ɋT$(RL$QVPL D$0L$4D$ L$ D$8D$(L$,D$D$ L$L$D$X;^ D$DD$$D$HD$ L$(QSVPL tWL$0t$4 tID$8uBT$(D$,;T$D$D$|;T$ D$D$|=9T$D$D$| 9L$D$|#C;_ rL$AF H91e^_[]Ë=:1SWt$ t$L$ T$/D$T$SWt$ t$/D$ ׋X:t$ t$(2%L$\PSWt$t$,t$RPPQW $:1WSt$t$D/D$T$WSVt$-/É֋=X:t$Ht$H迍$PWVSt$t$%PPPQQW $VD$`Pjhq1@USWV u C(D$|$8hjW; wEHOvklG@1{ 9\$DP1ɩ I|$ \$9߉T$ uI D$H$jL$0QJ<$L$ PP@Ǿh'|$D$u$'B 'B'B'QP׾'B@ tu Ǿ'pЋ$+L$L$8L$9Ǿ('HQQQQRPRPjD$1jPPPh2hPPjjj VjM14%SPWVKUSWVt$vv0P! ~ N$ t ~N)É9|11ۉn$^ FV1^_[]USWV8] RsPQL u s s$s sst$t$0)x" 1Nv9} +KsȉC S$1e^_[]ËD$p( 1ËD$@HpL1ËD$@HpL1USWVl$0EH|$SPW 1SWWVVjjj `> tj31҉tDH@tӉOGڄu܅tEۋl$0t/t)h #SD$ V)L$ tEH/uj#EH@EH`L1^_[]/EHjSPB EHHLSWV t$ vDh [&WSfN 1WSSPPjjh= SEFDNHA`1 ^_[ËL$Ahh1USWVL$Ayt&~܋\$;;tlHuL$ A$0;N Z\$ klT$<ư\8͋4$vD$F@ F5":me^_[]USWVPyt?׉΋PQ\4$Vi 1D t 1Ɂ|94$ukGllPwYGX FPv3t~C $i)ىQRP[ 1D7D77qfD7 D7 4$~Efn'  V)RQP  fNfF V^_[]USWVt$ PQ\>1ۃt 1D$G jPL$ A$W t׉\$ A yOu\$ @9fA |$tAqfAA 1AA tAfAAÒ A %AufAA) 91jEVVhuhhrjJVjVQPh94C(OL$<@C,SPm{,BD$$4D$+{tR[L11HD$Cu5{t/t*ChC%PuF|$y C tCD$lOu 11HD$ D$<\$ urF|$y:E0%ƋEp%PVjWOUBƃu4UtU%ƃuEtDjUуƃu:C(C,SPJ{,1s$C$10s$mC$s(!C(1ۅÉ؃^_[]h%h|%hlh5%f!USWVt$ kFllPvuNj\$FFi )tkllklPRQ ,$kl11CPsNj$ /L$s)RQt$ 3 1/D/D/D/ y{l$ }$Ffs$fCEfC SUSى1M1^_[]WV$|$hWP t,1HhWWPjjPh- WP1^_USWV|):t$ 1$V[/} Vٞ$T$GD$ pjVD$D$ 1ɺ<t$2t5;L$ s:w|X|$|\+\$t} w^D$D$D$}D$D$4D$ D$0|$$PD$1ۋD$ 4؋$RtVQL } $R6T$@RPD$ $T$@t$D|$)D$ 1IQQt$t$$PWVRj$Pt$L$wA;L$D$4|$HD$0GX:GjRWjPy D$1Ex tjSWjPO Ã|$tjTWjP0 jUWjP ۉt$t2t.$L$ PRVSƋ|$Wh%Q[ t$$|t%L$ PSƋ|$ Wh%QZ t$St-$L$ PRVƋ|$Wh%QZ t$ "L$ PƋ|$Wh%QZ t$PSVW:D$D$] ٹ}$L$ |D$ L$L$<1jPWSRPhS$j$Pm* t">tt$ Vh%D$DPY D$8D$ D$8t$XjVt$(1IQjFj QPS D$89D$ t PV$P~ |$YtZVr MqQ1QQPQVD$$PD$pPÉ׋t$D$D$L$Xa|n:L$hU $VPRQL VO$$$$ND$D$D$1F\$$|$(D:D$,"9D$<+D$,L$|D$D$D$1FMQ‰L$ ȉt$t;؉T$|$ߋL$ǃPQWV. )׉T$$)ًt$(9ӉT$};L$|$T$ًt$$)T$(9};L$D$}\$$|$(T$DЋt$@ t/89ډ}"Q ơ:}] aVt$ t$؉e^_[]USWV D$ 8t$8L$j QP $T$t\$,l$(t$$|$1ɊbL)CtAGt|l$ct0guquZ1ɸ@8Mt'St WmtsuM11@D$0T$4t%u 1ɸSUQPVGz1J;1H4t1H+u‹L$8tGL$$|$1? Љʃ ^_[]USWVMAQQT$4AD$T}] uVSQP| )u֋:1щT$1)΋EM M1WRQPljT$1Pt$uu)T$U 1Љ3M |$|$|$|$ \$,t$(t$jt$VSxD$T$ t$(\$,M9ˉ|։ˉ\$Ht$LL$t$9T$ T$`L$\]||$`t$\$t$ t$hS$jVq% C `L$rL$DPhن%uL$DPhކ%jQ4% D$D---D$D$sX:CjO SjPe ƋEx tjP SjPD 1jQ SjP( ÍD$ tSWVh%P4T SVh%P"T VjWaSX:D$D$8D$<D$H D$LD$Xt $D$XMЉD$hE҉T$dT$,ʉT$PL$(L$l1HD$01D$D$]t$`t$`hS$j$P# t"?tt$ Wh%D$LPTS D$@D$ D$@|$tjWt$`1IQjFj QP D$@;D$ t Pg$PW{{ t|$uuxD$t HL>@D> >jhEV> wE%rhD $uR1jPPPhmhPj jjj%VjMF4x!t$PW0Va1@^_[]h'%h%hh5%|WVt$L$ F,tI V4)ω~8 WRPQ8&ɍQwJ 'N41҉V8>??RQPW8 F,ujP4F,NHA,F4APF8AT1@^_SWVT$D$J4uz81҃1t ھ)fp; 'tBufP^_[SWVt$L$AwF4)f$udF41AN8V,t>??QPRW8 F,ujP4F,NHA,F4APF8AT1@^_[Ifrп1tt9t_u 9t߃ w@9r빉F4 F41SSWV|$D$W4pt"u-w81҃1Ƀtڹ) f$8ufH3fr-1tt9tu AtA wG9r^_[USWV,T$$D$@t*1‰sr  1H*s@sH $A |$ 1 9wI؍l$1$t$Vh$jSK t$]EfEG9v1PPPPPjPPjj(WD$8Pt$44x4$PW11@,^_[]VT$ D$J Hr1@tuB%ZhJ%jLD$ 1ɉQQPRjh3t $5 D$th%j]1@1@USWV}1::tL$ T$QRWЃ uGOL$ D$GOL$$D$ :@D$ L$|):;\`}3GQqO9‰ω|ω t؉ ::+1}hj蠛u} D$D$D$ D$1D$,1ɉ$u/\$,3\$1 \$ D$ Ë$>t#t$3D$ D$u,5t4$3D$1 D$$T$uD$$ @V07 D$1ۉӁ  s  |$sÅ ځ ȋu u> t61}-hjtu t1@t=:t@u.1}hGju tEx %rtډ%tȉ%M u@=Uu,>t'D$ L$|):;\M`|ˀuK(Ѓt tu tPjbjW WƍD$(PV$1 $$QPVV $VW9$ul$`=u]tP$PSj $5fǃU'VWWh$h% uQe^_[]SWV0\$@1҉1 F FFF =:tjP4D$VjRRS0<^_[USWV|):(t1V1Ҁ)uFl$1N1ۊt uBCu1uu Ƅ5^_[]1UV8E t6uRPVQL tvt$t$h %jkt1e^]USWV8=:EM 0~klP1 ËE E8؃lklQSP; ߾4'|):$F(tƃ~ tS1QWVPL t D$;C,tG;~ r-C0 C0D$L$ K$L$K@C$USWV D$ =:u RD$ 1t=11ɀ|( u<(t;T$$t'B;P w;T$$wG9D$ u1ɉȃ ^_[]ËL( $L$D$T$(L$ D)D$ t(ux(uD$ (1+BJ T$ B D$ H$ƋD$(@.D$(HD. D$(@(D.t$(N(t F$11L$ D) F,PFt9t jPS~ F uL$3 $1H L$tNT$ Ft L$ L) 9uF T$ h%hɎ%heh~%rUSWV@U M:rB D$ B$BD$$BD$8BD$B D$ 1H1CT$(PPt$ V|$W1P1SPSS*$t3T$(}G_D$كT$9Ћt$,}.$T$ 1O]hb\$|$ $T$ tuR|$Nj\$QPSWT L$)ӋT$ D$)މ|$(\$,D$0t$4|$ދL$0|$49ÉЉ<$L$ |ЉىL$\$ىD$T$Ћ|$9|Ӌ|$\$\$\$ 4$ډ|$)$|$9Ƌu| |$D$$0:u s0:D$|$҉t$D$$D$D$ 11ɉT$>1҅|$t |$trEw$̞'d$ u10u(.|$u&}(CT$9u19T$vQB]fωT$D$\$D3$3L$$D3 U B(D3J(t$B$1uth{A1Ot1L$D1 L$8ɋT$]t"9tjQP{ T$ ƄD$ C K 1+ $S$T$|ЉΉs C$e^_[]1ω1B USWVt$(0:u 6q0:D$D$,\$ @D$D$D$11;1Ʌƒ|$t |$tr9w$ܞ't$u%uu|$ue|$((t[E9u19|$vG\$(fl$,M=|$01Nh{11G l$,L$E|$\$ D;E; D; E(D;M(t E$11L$ D9 E\$(t#8t|$ jPQy |$ƄE C ^_[]WVt$ hjP ~(t ƆFN1@ƆdžF fdž^_USWVT$,|$(L$$t$0t$t$4։4$D$  d$ 1퀼)t0)D$)D$0)1ۋD$Ãy(t( u#1 uL$1׋$1 ʋL$$|$(ty9|9t$ $L$$}9ыL$$|R9D$$|G3 u1HA rHA D$A Q$Ƅ)DŽ)9l$ ^_[]USWVt$D$t&\$11y u9t9tEG9ut-%1^_[]Ãt ux(tth~ԋ3Q u1JP P$1҉QA H USWV($<TlXs\z`d_GDt$jPV w >uD$ D$iousD$fictO4uQG4 t51ҋ53D~$<uL4Lt rrӊu1ɉH HHSCSIS1 :tʈTL5PtuDs l$(Ph+%U j hQ$U [Ɖ$Uh=%jYu D$PhL%VFu wXw\w`hp%V/uPwdh%VuwTh%Vu f1ۍ{aE4'WuWuWh%Vt E< t<uEMPWQWh%Vt$<I%9|B#PVwtC9z1hr%WTtV D$PD$Pt$\$4Sh%hʐ%WS1(^_[]h%h%hBh%h%h1hՏ%h%h h%h%hh%h%hh~%USWVhj{{1O1ۍD$ShPS$4}9+ōF,PhedAUU l$$4$0$($<$8у|1҉$$hp F$,F$(F~$n ~n^T^Vd f1D t6F <tA<y0Ddž1@<F PD$ PD$Pjtt$謱t98t4 .jPL$Qr D 9D$ u D$4$8,$F n$9Љ} 1F$F )ЃF n$,$G9t$3$$h%jP r=t31>t9>u 9>t0uk9uV.V&OVU31@19$,|;ЃVt$2؁^_[]USWVHD$1PuهRhjx;ƋU}1HL$L$ ˉT$ډڋD$\$҉$~1HD$1Nj$|$ } Ӆ~ 1H1$D$$F`D$ F\\$^XL$NT؉^d'ucm FEF~D$F$|$ ~ F~D$FM N(1FLFPFDfictFHioustƆE F @F Ɔdž $@F fdže^_[]ËD$@dSWVt$~TtY~Xta~\ti~`tq~dty|$\$|$FVс@8|RjQP^_[h%h%jg6h%h%jh(hՏ%h%jih%h%jj h%h%jkh~%D$T$ L$DrRQP1o ËD$Djt$ P USWVl$j/U 1NtbNj\$)CDWPU uHD/t(t+t!u GF "u^_[USWVPӉ΃=:ui"sv<: 0:0:tx(9w4Ju1AQPuã0:0:H 0:k4+$1 4+Vh [&jRk 1D+ <+ hsVPh]%jW> 1D+'<+(D+($D+,t+0^_[]V΃=:un:) 1t(@"u0:t 0:9t 4Hu1^USWV|$4L$0Rt$`VQW ك)ыT$`9|ы\$\ߋt$\$<$9߉D$}D$P9D$띋D$<^_[]SWV΃=0:u ^0:~V19|(1@@89|~@w1A^_[USWVP=0:|$(L$111='"\$uӀt0t u@tӋ;'tPt$(t$(t$(UUt$0҃|$(u8څu1u&1h't$(t$(t$(PPt$0' 1^_[]USWVl$ T$D$ ׉Nj;D$tc}t@8Jt 1Kr rQЉ Fu/M1P4FuPDFu jP4F^_[]SWVDnhh'h\ :J \ :k :@11KjdƃwDȠ'DtGCuޅtH=0:PGd0:t)1ɀ<t Ġ'AuVt^_[1V 0:t(0:1t ҡ0: 0:F9r0:PPt^fUSWVPt$ 1h4$111 tu9Gt FB11Ҋ tu9t G1BC9|1Pt$h%jQQWRjjh5%(,1^_[]USWVhu}WWPHD$T$|):L1ɉT$ڋPD$| 1HD$D$]  |$0t$ Nj1IQQt$ t$t$ t$(t$Tt$TjL$vjhv|):@u ǀ@>1t$(F F>D$,Vt$<|$,x1;t։ÅD$0L$41҉|t:T$1|t D t44W4D$0F;trԋL$4T$B9rwP2|$4r!1FD$0P2F;t$4rD$0=0訷D$p藷D$6艷D$vzD$  #1ۺL$#PWVSh0RQ t$kPW#PShPV |):VL$'Qt$t$t$ t$PPh`g$hH%Ǻ|):$0Ͷ$|):$p謶Ft$uD$D$\$(1t1D$pT$xPRVу t\$8CfCCtffC C CfCC=0:rC fC*C,G1ۍD$(huSSSSSSSjjWPh貓48P胓@,t$VWrW膔FuQ1K5@ :mt Pmt$A5@ :mm1ۃ|$,} tl11ۋT$(RWQPL t(D$4 D$0tD$8uD$^_[]h.%h%hyh<%6USWV$(E]0輬ƋEp謬ljl$E@ t P蓬#PWVSjh\1U5:|$ ww0G%t$R5X:RPSQVw U5:w$w l$45X:RPSPUF G\$skhSjPD P迹Vc :j!hb%V V謞h裫|%L$5X:PRUQ hv$5X:P|%PUS hKPSD$Ph%hhD :g 1҃9Q :A \߉$4PWhQ$j$W" hWhD :U Nw@EƆ : Ft3N$t.1@Ƅ :-H9s Nr, :$EBL$ ;QUD :Vh%WU Vh :WT hH%&İ^_[]USWVX] E81h#PPPPh%PPA 9_ vSL$QSWPL t@D$ tWD$8uN T :uhƩ T :D$9H*h#VhQ$Epd+D$8u RPt QPVW҃:1VSt$t$&D$$VSt$t$ L$8QRPt$ t$h%Ep3dD$V9p1h$YQVu WPTtY$UtOwGD$VPƛ)vVQj Pϧ W@ )Q$YQP|R H LCF;puD$VPh$Ep~c e^_[]USWVLt$`T$d\$1*kvs0C41GPjht3  9u vEL$QVUPL 1hPPh!hhj6Pjjt$(SP衅4ōt$ VPqwU腆S_~<u4D$ L$@;H s't$Vt$VQPu t$3|$ItWt$ 5@ :c_|$.@ :L$`ʉAfAD$ 1Ƀx fJ1O S _1L^_[]USWVpU t$01^F4jjX1AǾ'D$ǃ@<'SPHD$ $|):L1OًP|T$|$`1 |$0jP4D$DD$ :|$ 9ϋ$|$1HPPVt$t$WRQjD$L$4t&t u$Ut$ t$ h%jt$_LWf $ ^_[]USWVՉfD$/D$jhG%BD$5謔t&裔8t虔SPh%hU VSU= 991j/Ut t5ÍD$9tK9vH8/t@PE CߍD$ PWD$%= h$PW FƄ$/u&踓$QPh%hU! /h$PU< hhG%U< e=@uWD x*|$VW$Pj< 9r>N?C0|$Wg Wn&01Ĉ^_[]hU t}/u }$$tcD$UWƁ`|$tVhC%Uk< 9=VWUS< 9%|$W x(W7T>1F1S:0jh*#j SWVύD$ PQ1xVD$)tOjWOx@ljj PW W u $=rɁ uƉĜ^_[USWV h讐ljPhW@ju \$hjS藏 jh%D$ƍD$ PhW@Vwu t$1hUSJ ,$d'tWPЄu-X :D$C 6'E,$ !u1L$PPPPhp'jPPjjj!Qhm4t$t%j=t$VWf_Wzn6V ^_[]VD$@t(L$ 4@\'VhW1t F\ :1@^ËD$ X :fH \ :tPPQQQh"%j跶USWV} E_@klD$؉D$G GuL$ AuD$D0D$|8\$ t$TVj f^>D$48T$y:D$ػ˺ӌ$L$~D$<P t3#D$D$tAbL$ D1L1 T$NL$ T$DL T$u0D$#t$DRQPh%jV D$ T$Bj5:QPz~#t) &t$DQRPh%jV輦 D$ 1ҋD$ L$40t$$ȃD$1HD$(T$|$ o5X:t$h%jt$hVD$XP1WWjjj0賕,:|$4D$0|):L$QW<W,D$DPV[~ljӍD$DPV菀|$߉څu D$$H؋Pٸ"D$<h%t$N|$,] {t+[1hC%S"t Fl9ut$(] CL$(9sJkl|8u@t| 1\1 |$(u%\$${؋[)މqM y|$(M YklD0tD$|$,T$j#ΊPt$h%jt$hVD$XP1PPjjj0?,j D$DPV@  D$׋D$@t3@Dr@t @u11҅%ud;D$ljÉT$E PQHÉT$L$0ȃt$4 T$ ‰\$u@ȉ|$ދL$NjD$PQSW )lj|$׋L$D$$t|$D$ |DtY t L$q99}RM qtQ0"lNuL$$L$$T$ T$ ދL$tىT$T$T$ T$ T$ ًT$ 9׉DŽuȉ1D$ M u$L$I)L$M QM T$QM |$tT$B1e^_[]ÉD$D$wSWV$A6I11j5:PQi'|$ RPhS$jW蓢 ;X:CVDSjP jPPh_ :2 V8@(^_[WVt$ 5<T5<! ~$uFjP59F$1O~(1h_ :QQh1h0hRjFj WjPv$h` :{e4F(x;F,VPOWv(afv$?F(F$~,v$n?F$1^_USWV4ˋA@Pjq$A C{$t%K0 u G 'fG lJu'fG G5Gh=G G,?G01G8 Q +Si$k y t;$1T$RVQPL tD$u$D$ $l$F ;q rЋC$tKA0u+ilHu@SkC(x+K$QPc+{$4^_[]V$j)藆Nv811Fu >tlIut5t.j+ȅj,輅L$PVh%jPQ 'u tEj,j+荅L$jPPQg/ hB#7j*fL$QjPT6 hH%j-?t$R5X:Ph$jFV^ j.h'PVh%hh` :6 İ^USWVdL$|$9OD$GklD(0tBOWփ|2 (T(j5:RQkvL$RPh$$jQ轞 G<(\(|(Pu#]j#]L$>PSWhG%j&Q%j5:SW vL$t$>QRPh%j&VY $F|(,u)|$hgPh%j(W& <$1e<(Ou*?D(Ltۍt$h趃PWh%t$t(Tt(PPWh$j(V 4$1ۉt$x$PD*0+u@u|*8 t=D$>WQPh%vN>t 4$@;|$|$upd^_[]1؍L$>PWh%j&Q(  $L(4RttD(8tPQ҃lj$uFt(Tt(Plj$FD(Lt&h脂t$PWh%j(V訜 4$h^VjP lj|$D(dph-PVh%j(WU *USWV|):$1G)ttntjPLVуtƃ~ 1\$0$SWVPL tD$@uD$Dt 1Ƀ8 $G;~ rj1ɀ(1WQWPvá|):H1WjHDWWQZơ|):$1$ |):@u <@TX uDHXT=:tLLPL$T$|$ D$F(T$|$RWPу 1ۃ<$Ë,L$W W#WRPPQ1ҍD$*W Q#QRhQPD$$W Q#Q1Qh0QPe&)ߋ|):0D$pL$$QL$.QL$QPt$SPW/ |):0uNjpfL$$QL$.QL$QPWSSj'B0 hH%0+|$pG$DŽ$$T$0<$tT$@BfBBQAffJ B _ABfJBmAB fJ*B,{A=0:r~(uB0fB:B|$\$ k71H11D$D$D$ D$4T$T4D8|,tyL$ qx(tDPtuL0 D,u!8 L$1TT$D,t`|$L$$D$;L$wL$DP{ tTPjQ8T$ `L$ D,OhC%D$ Pgt5h%t$ ~gu$1;D||$4D$D$|$ T$DPt uDPDTGD$$l911HD$D$D$4D$ T$L$B(]tbx t\1t$@VWPQL tD$T8tD$\ttGT$B(;x r!\$K(jt$ t$Vڋ]z tm1t$@VWRPL tND$PuGD$T8t%L$@D$D9ىU |-L$HD$L9L$,L$|L$jt$ t$V%GT$;z rRPHD$,T$8D$$8L$ 9\$srkl|8ufT$Zrt$rމt$(RT$T$0:)ދ:\$\$\$D$ڋT$T$|\$0t$(t\\$1ɉȃtHwPww}L$9s'kl|8uiTDT N9|$ sHkL$ l|8u:TT$T4\\$ \$\$t 9t$T$|T4kD$ lTD$LȃD$4Dt$9Ɖ}xt$(D$9|$sc։T$0T$)t$(ΉD$(D$,‰L$T$tD$P(SQRPL D$HD$ D0u؋\$+Xp Nы\$|6\$<t$8t$(t$$VSL$ L$\$$t$)։\$$t$\$t$ GD$@0l9T$9D$L$$H\${ t$p [$)Hkl؃1L$L1|w|$<\$8t$(t$$SWD$t$(v L$)։t$ t$A5": 1FhW%hF%h]hЖ%|$ttSt :tN|$(tNF^_[]fSWVt$$tZ|$H 9vOtujQ tt0\$4S$ tt<1^_[USWVGD$5":l|$D$$6x ,1ۉt$WSPQL tD$(tC$;X rE ttdu݃|$4uaD$D$D$D$ 10:9ru 3L$r3t$ ΋t$tO ρuͨ|$t |$4sjSVo _|$k<4dD$F^D$$Fj1RjRjVSPQx tLt$1҉TP|$DTDXIAL$D$~@ 1ø11OT$LhuQQQQjj PWWSRh649tBƍ|$WPZ(Vn7x#9} :k<4LE1UЍe^_[]USWV10:T$t$9quY3Z)3* t_ ߁u$^_[]USWV8\$L$D$P9A @$=*:t*=x=:11M<t9\@u 9DDMHEr=*:tOT=:D$PP1ipt$1t9 :ut$P9t:,@uލEpr=.:<:J<1iǐ1t9)ut$P9t)$87uލG$rW1H$Oy tB1|$$WUQPL tD$ut$TUS $E$;i r$$8^_[]1@$|$Tt:1@$|$Tt)1@$|$TtD@x=:D WVu)y8u.q$t"y8uqxu Hu^h#h%hm h<%4KD$x8u@h#h%hm h<% KV 0:; |):tD":t99t‹9u€":2t ":^WV΋$tRtt tdjhX"W> tvjhU$W> jh&W> Wh%h"r WhΗ%hr tsH@#Whޗ%hq u`tQ0|@yu)":9tЋ9u":0u1H|$5":,1C1҉T TTCD wk<\$t  ED )tT 8G\$u$1BtۋT$D 81$;X L$xQSPD$PL $uy$_GD$@1҉T 1҉TT1҉D$@D w$ktiD$Pt>Sh<%hfT$\$ =:$DL$4L$0=:0|]t$VPhۓ%WS =:( ( PQVh؛%WSt$\$ CCa5=:.> >,>(>$> D$)Pt>Sh%hTS$$(t$,t$(r  :t P :1` :tWWhe%CYWhə%h3uI :t8Whə%P]I :1Ntjh{%PAI ^_[]1N =.:tt$h(%jPuR SWV|$tu$ul1SSSWwtZƍGSSHDSSPt.$ |):V;DvH} DH1ۉ^_[USWV0l$D}8]1 SE$y$ytPmptYWtDžtFE tWPV" u WVkjVS E t VPV1HPPS| ƃx :0^_[]h#h%hm h<%%USWVEx8X$1 1OS6n$Wy\$t.1jPPWtƋWt $VPHD$|$1 M ׋j4'jP8 D$$tI6 5 :h:zt)u D$(h #jP6 5 :h;<t)u D$,h #jP5 5 :h<pL$QPVhd%Wu ^_[]USWV$@1K $ $8'_ 1hSSVVjjh=p$  /t$l$ WSU Uhs%WS5 S |/D1l1_|):, 1>WV<VH /11 11$? t1$@$J1$A( 1tiu`$B,\$ D$4h #US3 1USSVVjjt$" S7| xL$1^_[]WV|$ 1uOG P t/1; }OX"h<:x 71^_WVt$ F1hWP dž dž dž$dž(dž,P40^_USWV$h^2t$hPV $$$`'D$@{tUh%V USVy 8Ouڋ$xhLuhMSPh՘%V}C(~Ph #hV1 }hNHC,~Ph #hV1 }hO#C0~Phߘ%hVm1 }hP#VPh՘%W-^_[]USWV$3u*11IhuPPPPjj PQQjh3P43Nw'$R($t'WP\1N1jWWVVjjhQ lS, T0D$4h #QPv0 1PD$PPVVjjU D$Px x 1^_[]USWV0t$D1ۉ^8^4`D>܅t'$U4>PQL tD$L$ F4N88(8uu 10^_[]WVt$ ~1 F(F,F0F4h\jPd Qkd)Qh%V赲 ^_USWV$h^|$hPWѾ $$$'{hV VPh՘%{hWvvPh%W[hXp1~,t[hYS1~0W[hZ6ǃ4V"uh^V0FT~Phn#hW.. sh[[h^1~`{h\vXPh%WF\~Phߘ%hW- sh]mFd~Ph #hW- sh_HFh~Ph #hW- sh`#Fl~Phn#hW[- shaWPh՘%V/[hb1~pPPWh՘%S^_[]USWV$@1N R$fT$' 1jWWVVjjhc|Gl=Ol|):,1۹dWS<S1,G,10G041jWWVVjjhe] 1`G`gX"h\id jhD$4h #QP+ 1PD$PPVVjjU D$PSt x1pGp1^_[]1wwVt$F~|F Pt1@1FF^SWVT$1ۉZBr 1Bl@Zp谛Qkd)Qh%VL ^_[Vu L$^WVD$ P@1ɉ޾}1@89־ƾ@|9|1^_hϜ%h%hh\%pSWVD$L$Y,1Ʌtt1At9r9u|t$1 C,K0NC4K8N F\'tNFFF F$F(F,tF ^_[WVL$D$ p,1҅tt1Bt9r19u@t<|$ :uh :s1L$F<tA^_USWVt$$F ;F4s7VU1;F N$}$1MUUSSWPWPj$1ۉ؃^_[]VL$D$9J$v]R(4IP sD@,t T$ tJŅttut t 8u1^ðSWV$A,t#$tNƅttuc$ 9Q$vU$I(RthPW 6Pw$$$('@21^_[Ã!t*Wp1@<QKWPV* rSWVL$t$V,Ét tyЋDžttu|$69~$vv(<<t1^_[ËX<t X<t1ۃËr<[ ZE4tL$Ph%Qr D$D$uPh%j[t1ۉ؁^_[]E@USWVt$ $=*:$Wh%jP 1t t^_[]Ë :! ÍD$XWh%Pj1~jDjjtD$$B#Vt$\nVjnD$(KD$T\$`C D$\D$D|$(D$ D$HD$4D$ D$0D$D$D$PD$LD$,D$8D$@D$<D$uD$1$D$D$1h#W ƀ8tt1tCuVL$ D$ j jVs É$qj jVs t#D$Zj jVs D$T$C\$ \$D$|$u\$uthh%S. hVS \$E61ۉSt$,j SVs É$ tbD$ ʉ $tQD$ D$tGjhR$t$}Vr tOjhS$Vr tdjhR$Vr te|$ushB#jlD$(kzT$Ӌ $L$BD$@T$<\$8\$PL$L+\$P$D$L\$D$\$$D$\$4D$0j h'l$}Ur hj蠤$tJ@j`PQT$ T$ $B0Z,D$B8D$B4D$Du0|$`t)Ѓt$\P T$uD$DЋL$Ht D$ D$,D$ T$HD$TD$ D$,D$8D$@D$<D$D$D$4D$0|$$\$ _,D$,G D$8G8D$@GtPv<fWW߅uvF^_[;h۟%hҟ%hh\%a D$ph%j iSWV= :5 :t^s3ߥt #$t$j(PVw 4$蝣_u9hsj|$0VPh$jxW WVV &t Ĩ^_h@&h%hh\%s USWVσ= :u h 1t0?t+ :t!- :E WP tt/|$thhJ%S= !hvS( u4$$$$$St$h%j ^_[]SWVD$Qt$Rh%Pj hB#t$]$jh'P uWhB#j]$tAt$h#W; 8tjt$2hB#j]$ut$補1ۉ؃^_[USWVӉ΋|$|$tBh8%S h?%S hE%S hK%S hS%S hY%S h`%S \$h#S6 ǀ?t(;$p'WPS uE F@j`WV -j(W\ tj)PK t G^_[]fUSWV D$@(,$Xf\$HL$fL$HL$L$H L$L$ HfL$L$<@ D$ AVUK |U,$9¹9փ?9|uٺ?ut$D$ D$D$t ^_[]1H^_[]USWV\D$p=\$|hPl$ 3h #WU WUUjU@ H>wѻPD$x0h #SU SUUjiUP@ H=wˉ|):DD$H1Ƀ|1M1҉$PVRU 1Q\$ SRP 13 $1 ø9|ËL$1҉`\@L$pV|$ WSQD$tD$x8D$|0\^_[]á :tq. :Vt$ :u W. :19vFt=N=:wu1w=:pj:^ËD$Hs-s D'.h#h%hh%9 Vt$ = :u-(t;u2L$ rȃsd'$tuX`:1 pj:}:^WVP|$t$= :uI-j PVo =v1t-h;t =:t4ƌ=:^_Ë $9u։^_-=V:tV:ù^-D$1ËL$T$t$ h 5.WV D$$s1!t$ T$L$7GWhT . ^_SWV L$T$ D$$t$,|$(;sCSh -^_[ËL$T$jhP -WVL$q$19Q |1NVVPPPRPRjWQ,^_VT$L$D$ N1FF Vh @-^USWVT$,D$4L$(t$0|$<\$8]}uM EUh -^_[]VT$L$D$ NFA0F Vh,^WVT$ D$(L$t$$7OGA0G Wh,^_USWVP} uD$Ph f,D$PhxH,1\$}UM;t;Gs} ShƗ%q} ~Sh;%yF,tTx tN1\$HSWPQL t,D$L3D$L$H3L$ uD$T3D$$L$P3L$ 9GF,;x r\$FD$D$D$t$D$ D$D$$D$ 1|$|hPW L$D$ T$VQPRt$Vh%h$P $L1QhPjV貊x`WhydP荼 D$VpB|$t;jWS- \$;MU}h%h%h h%k 1e^_[]RSQ Shy%RQ' ׋F,U$u RVuuuuWPQx USWVL$D$ $D$01>t%ut#tt>,9t@uȋ01ۅuT$rt$vt tt1T$WPVPS /x$1҃^_[]USWV$D$TL$DT$H1t$4$L$ ٹT$|1AL$ D$L$\L$L$89T$X|ȋL$\ٹL$`|1IL$L$LL$L$PL$L$80L$ T$8z9J;t$@L$ T$jt$WPD$P.|$LD$P|$,$t$|N\$t$D$PPD$PPVSִ )9\$LD$P|\$L)\$1ɉ)r $t$9L$ D$}%T$<1l1l t$LF/@1$^_[]USWVPUE|$ ֋H=:)^01H@=w Qɉu=r1H$t=t 1ɺ1 tt tuʉ;} tGAu̓w9tu<hAEpD$1t$\$WPSV )ƋD$9|1ۉƉt$\$$11ɉtX;M At tu?0t51ۊtt D$Gw1ɉL$01҉t$¾)֍$4QhRVPhu1I΍L$0Qhd@D$P4 0=l$\$t U1ɁUƇfu fdž L$ fD$ j(QP趗 1ꀼt,;duà $u֋0t 렋D$ j(WPa l$\$h|$;l$ L$ D$HL$ ؉D$$1HD$|$,1󫋾,hVD$

SU^ @$\Cǃ1:k0hWVm D$4WhPW$XrpD$ED$,؉D$01H$D$1D$D$ t$l$(|$t$u" QPhVt$(+tÉ|$UFd#D$0jPUQt$(+1 Ⱦu#\$,hPt$ 蛒 Wnt|$\$ 6|$=U|$twt$ȋL$PVRjt$t$,P` P轢D$4(t$?1Rttwt sSD$L$<t)l$ s",ʋL$ 1HD$  D$DCL$uL$ ,T$ 1AD$D$tgt$;,\$ l$$vnhjjtFt|$D$D$ȋl$(D$$,$(,$|$\$ l$$1D$?,$\$ t&14pFuUpt$D$l$x P#tn{ C K$;}sL$4QjSPL t_D$HtW=:)1ɉAw Puu2S"j@jP4 fdžUS#p1ۉ؁4^_[]h%h`%hh%7 USWV4D$L D$PhjiƋl$X\$T|$H,'W1^ F|11Kn^؃N$F Fdž?džjh>US @džPWtwt%D$ D$D$D$F114^_[]h%h%hh%$ USWVhED$$11@D$|$ t&1ɀ8>@,19QYvPW6R D$vP6R 1^_[VL$ D$@(R1t=u[1|$tRT$I 19t!@u$T$t$I R,9dtЉd^SWVT$(L$D$|$r?([tЉ^_[h%hs%hxh% USWV|9t@t$\$u8l9D9ƒT9?HT$L971HXT9D9ŃT9?HT$T9L9 IT$ B)u)9^_[]ÐUSWV0$H$D7%15:5:5:D$D$ D$1D$h%WU@B pu t=:e~ft$lt*zD$ƒbtCeubD$벡t=D$ ChjVV5t=hʣ%$::zVhVV5t=hߜ$$D$Vu=ԏ39}4D$$D$l$ t%1PPU D$yUh$IL$ tHt$(Uhգ%V9 h3B#6zuRh%fD$0Pt${| #D$8=$$ ::jÍt$0ShV u UPVY UjD$0H ::Sy h%t$(T1|$PNy h#%: y h-%vuWjt$JN1St$;N4$Pt$DE%Shڵ#PPO6t1h;%t$t$M4$t$5:5::(3|$t3:63t3=l$u1HL$(Qhht@P讀 PtL$* :t$BuhJ%lʼnPMyh%T8 D$ yh`%@$uBL$$4jPM4$$t$V6 6hu%j6Phj ך j|$WUt$ x>tq1.SPt$ P yd 19u2::)uA 8t1FVh%1FVSh%V16t$HD$D$L$D$ L$ D$|$tvD$ PAƋT$ уƉǃtωÁtt؉D$ u 藜 8t;t$ t;t$u!1ɋD$ D$D$ D$ D$pjjj 肙 UQL$ɋD$tP" V輚 PD h#PVh%h3k j V jV# jR@ VPz^Ð= 3u f 3:@=u1HP 1; 3USWV}uCjhȁ:F ȁ:؁:́:܁:Ё::: : ā::|$(jWSF 5:5:::?X+=؁:܁:@1;:)ω|$$\$ ā:95:T$s;D$0:D$(L$, ܁:؁::D$ā:D$$D$ =:EtQ1$w ww7wwVWVF 7www ww$PWj6 M$m%1~~~ ~~$PVj 1@F ~~~~WVWgF =:B5fDŽ$ :t$Ph$hQ 1F: :ƒ\$\$xT$T$|l$x&ݜ$݄$ &L$pD$tl$p|$D$ fD$l$\$Dl$|$Dy1d|d4)Wh$QPM :9|ӡ:tPL$ވ L$)΅~DQ4))h#Sh'Rh$QPЯ Ƌ\$1ҁL$ȃr61҉؋L$ωÉ zrr޺t<4Ǵ)4'QPh$SWW L$(+ ȁ:T$,́:NjD$0+Ё:x@B‰L$hT$ll$h\$@: :1F؃D$@5&|$vqL$`\$dl$`&ݜ$ܼ$&1۞s|$ L$ fL$l$|$Xl$ 3\$\L$X؃r+1@ډΉ >pr r11ݜ$D$8d|$<) 4'RSt$Dh$QP٭  ::ȃ||=::݄$|=s4;T$D$r(|$$\$ ؍4)h$؍4)h$QPE ƃ}u 4)hB#QP ơ:@=u1H$VQPx e^_[]+: :T$PL$Tl$P\$H|$Ll$H|$ D$ fD$l$\$umFOKu$t$1VQ$Ppr"u%h$%TZ 8tP 8#u$SjVb tGtV $1E48FB$)Ex t$7@[h$%hG%,֎ h$%h%迎 7h$%h5%eS^_[]$Vj$A3t@L$T$ t$pP HH1҉PHPH H1^SWV\$|$t$hSVh-jPEuh%hS%{RÉhPKt4Vh8-jPMEuh%hS%-R1H^_[USWVp $$$!19L$PVW1Hl$UO} ƃUA VD$PWa tb$UtM$dt贛 $dPUt t$jW\ tu)$-j4'WU 1Hp^_[]Ë$j-UP3 D$L$PjD$L$PjSVt$ t P닆t>PD=džW1ۃ1ۋt9PlDdž- t^[V膋 V 1ui 19^SWVlT$|$$VPC1Nt/ǍD$P?{ PSW1 t W?l^_[USWVӉjh0jQ ǃt{jjjV L$ FUY#t#6Y#tŃ%##t %؉#tG%|$u#SQRPh%jhV軡 ^_[]USWV$=~4 71Ha~B11ۋ$4V1z <(Gs@ ,PVQV] C$9u1$WQ ^_[]SWV\$t,|$Gt11t H 9N r H 9v/u)聉 jj7ƅuƋNtHNO N uFF9sSP8tVF^ St$Ps\ ^GNON1wOWh0Pw {@v>V=1H^_[SWV$uSh%hg%EM $%~GuG$O1@G$GD$GD$ JPRv  tOt;HO6 8  89hޥ%hԥ%LNF G8~ ~u3FVh0jv S?uhޥ%hS%3Lt6hWv  t%uh%LPWVu  s V^_[WVp׉$ftPh%hg%K jL$PQW\ jjP PjW tnjjW t\PjW tHD$|PWV t2Ph0jp >u6h%hS%J"h%JW h%Jp^_fUSWV\$%{ ` r^5 tS1r 5 u$Sbڃs tAt1t% t&%S@ su^_[]USWVt$48`ځ% t0ty@ !ȉف tV @t !ف tVat ع!ȉ`! tvu1%r u s^_[]WVt$ I%PI1jW3jW|35^_WVPt$4%@5@u^t8tW%Vr$%8Vh6j?#45@u`V,2<jP,M u h8%G,dž,sh!%|Gj?3 t1t3u5r$0$ $1Ph%F $ $1PWh %F^_WVt$ h$#pG8r4@84^_8t8t uh*%W譬jJ>^_USWVD\$\t$XFtt+NQT$PQhj@RuhI%FD$n D$SPU69Vt)ǍFxۉ,$t1j@SP( SUhp%F SUh^%E 1KNދl$Xue^1Ct'D@Wt$ P` ؃D^_[]USWVP΋QtF$tQ1Ify1J!!ꉓ uՋC tFH~ uC t<6@u,uVr'FD ȉC ,t7(1Ҿ<1uCD1(1,B9r ~ j$(ǃ,f@K(1ɉHHH HrF>rD&>C5F $Po w_ǍCWt$PR ;)QjP{ h2%Cu^_[]ËFUSWV |$8t$4l$Ĉ^WVtt0t$ 9t!x t u fu;>t @u^_à PQh%d> SWVt$~ t^_[ËD$|$F @PWDr( ~ t͉^_[gV6uYhۭ%Q肣~PtVAt(t NLt#t%PV9^WVt$ >~Lxw16tЄuOF$uItV@u h%4=jjAV? u h%=^_vF$ljjVz? ZUSWV|$$\$|$|$ D$PjUSBWPAǍh UtAÃx tC Ph%;G$C$G>C>>-ك**PWQJ WtHAt[ƃx t PhH%p;_%KFNtTHNUhh%;(w 1Ow 1OOWt#QWtJV<1V\$ GtIO9tA t1Uh%:@1ۉSSD% 1G|$ ~UVt$$H? { t S^\$ HPtQPV P-<uV[+US?^_[]USWV׉΋A Ph%6:11BU*%tPVVUU1n 6ujn1^_[]USWV $ D$PQhhS t$h%h%9$1Pḩ%91F\$ MbihS$( EuVh%?9ut 87t t 8 uF띃tVh%9D$$ \XPW>&Ƌt8t* SV>uSj$( ҋ>$ 1GOtHONG Pt=mFuFGGtIO9tA t3@UUD" FWQjj.>jV(t0<t$VtSB< t<=VS= h%7 ^_[]Vt$N Qt<tv$vLP ^8L$USWVHL$dt$\tV\$hWQ<D$t9<$ڀr/r 7 Vh#%h:G#!7T$1|$`F(f9t(~ tωӍV QPRh7%6ڋL$tf~(^>8u(F*4$QPω ~ tcF D$F*|$ <UWSPωT$ P\$Shg%6 <PUt$WPSh%5T$ V>t*4$QVD H^_[]WVt$4rDD$ tN8tCt;D$ jP,( u!h%hԥ%5 j-^_Ã~+ajjj襶 ̓kh%hڨ%h%5 1m9h %h%h%4 <6Rh%5@hɨ%hҨ%h%4 111dh%h%h%w4 @+X1BWDPU hɨ%h¨%h%14 11G1=::6u P9W+:zh%h%h%3 t0S vPh"%44WVP1PPPVCD@PjVlN48@t @ sfyt ‰48WV{K^_USWVP$t8D$ \$9}$w ŋD$4VU` tE9u݋D$ 9t9 u~<$h%Wm1PPt$$ sUVW s W@W;9t>G 1PPt$$ UWD$$ W42D$ ^_[]USWV9ttb@@8tVֽ t8 L$ t!! 鉐1G@8u^_[]USWV \$@l$8;hW%W^ .hh%W^ !hx%W^ D$$D$h%Wh^ |$t$<t$\ ǃt1Fl$<4h\ GF9uW$t$<l$U3\ WUD$P E t=1FߋD$@D$P[ Wt$U EE F9t$@Gu݋$;D$ut$St$@ t[uD$471D$D$D$471O ^_[]{h |$ A$9YD$4t01tvD$4tt1IL$D$ x  $L$΋D$<9}/D$ x 4$tWY tFt$9t$V_Ѓ с u VXV{^USWV$1t$t$($|/xh%WW hW%WW \$,hVSa j ǃ0%$31O$$0@4jV9u11@PP$u1Ajj uD$l$(D$ D$D$$dЩ%tϩ%Uhp'P$V?u$duiM)4tQ6uD$ 럍Hv H w?$İ't=$\w$'D$%D$[D$ PxGD$ը%D$2 $d 1@D$D$D$$h5t=B $hD$ݨ%D$D$%1@D$x ˀD$D$FD$9ԏ3t$bS{($h($$p$lԏ3)$艄$\$,Su1VVVS6$U$PjSA\$hG%蚩 D$9ԏ3$4$|$0W ?ԏ31VV4Wo6&$$Pjl$|$t\UHrBPt$hj%# t$\$ SgV_ 8$U` $`$d$`$dԏ3T$ QR$4 $$`hq"hE%l$,<$茄D$ t<t,<ulhx%̥ D@Ug uDhZ%覥 LHUL hg%脥 TPUCs D$1D&^ Vh#"4$hq"hT%"D$1Cl$,$bu Uuhq"h%d"D$PU'$tCt)QqtrqpQ#$PDŽ$WU':$t PM $ }$nUqq$VU# U+A$;$3t P%$dP@1uh% !$dt3$Xt'L$jQP{ uhq"hԥ%#!$j"$hh(3. $$d ؁^_[]Ë$r,u'ԏ3Qj$4 $u*$`1PQQw $$c@u h%$VUI hĪ%$`5 $d$`$dUhxkjj$=t'Uhkj$($}hq"hݪ%hq"h̪%D$L$Ph%U$"h#(Z 8thq"h%3$`Z L$a[Z 8 S$`$d$dl$,hh%m u!Z 8th%hq"h'% hh5%5 u!Y 8th5%hq"h'%^ UVtUhq"hE%Uh%1k$`r;$d@ щ$`$dUtePhq"hϫ%KD$ Pjh0j, hSB#yUPhZ% U$`$d҃ ց uK$`$dr>1rԏ3$L$ QPUM W$`$d%r ԏ3$##t% t%VQRh?&跎U{\$,1D$WhPiu h %Sh"hj$$nuhq"hS%N$u($`r$d$d$`L$$PQS!$"$1l$,~O$4P t x uT%<%$4PF$$9|t$t׃z Ru$dh%P_S[$bh%Jhi9&yD$ L$$$XP裾Uh0gj$d$ uhq"hS% $dh%而$dD$ L$$$XQ Uh0gj$d$W uhq"hS%7S$D$xhq"hݬ%`_h%hq"h %9hq"h%*hq"h,%hq"h% $O/ Ph%$`m$8l$,t01 t$VV$ uً$t$VPS VSmD$$b@t S$$1t*1G{ tS!u΋[uً$`<$$r>$1Ʌt z uRl$,<$$l$,<$$u@u0$d@h%PJD$,PB't#%@tD$,Ph6Qj$dWD$0P"0$01~ tVh@jj$$vSQ WVjh_v%jt*VPuVh.%MWh_v%h#0^_Vt$Vt$pApdr$Ph6%NjjtVhfjdj ^WVPt$D$uPh%hg% jP,M tuIh%h8uM, ,*dž,>wt=D$|$ffN(ffOfuj8 ȉG_1_F*N>QPS F>)^_[USWV$lt pvhu%PWj t=wM$lDKJ 8thu%h$h$u)h%hu%hh% $$l~>1ɀhL QSP ƍl$hUPt$ ͵U9 =wfD @PUhhu%W=udh%h"%htI{>tA,$fEC(ffEEK*S>RQP C>4() PR1pČ^_[]ÍF Ph%n tt {>u[[ht h%? ~>t$fF(ffCCN*V>RQP F>4)mC Phϳ% $D$@USWVt$L$ \$$l$t<T$%ft+>t 9htouF t!Pt(QP#G 1HXju V >8t~L$ T$pFhf@H X@fPFM1^_[]h{%hW%hGh%hW%hHh8%@ D$tFL$tt 9Jt /G  "G 1HBH@M1@h{%h%hh8%m@ USWVt$T$B*V1҉9ʼn\$[s׉Ƌ|$ʋD$+Xy tʚ;111ۅt^_[]ËD$ xx xʚ;vVF 1HËT$L$t$t$PPUSWVP\$ |$ʚ;΋D$$y $t9_u9Gt0?u~(tOu#N,$jDžu1HrOtqHOl$&oL$O _D$$G$GF t9hwu9H wF$G8~$HOH9x1^_[]ÉN$h{%h%h h%h%hh %h%hh8%> L$T$t$t$jt$WVL$ t$|$Mbi)i@Bt$t$WP{^_USWVD$ttP tfL$ |$\$1Ջt9]uE9Mu@t9}u7}t z}t$t$~$E~,}/n,@ϋL$ u1^_[]h{%h%h|h8%= D$t L$HH@Lh{%hд%hh8%^= D$t@Lh{%h۴%hh8%8= 11WVD$ t!L$T$t$|$x0p4P8H<1^_h{%h%hh8%< USWV(l$<\$߾@'1|$ |$|$<$E4t.1FM0 I?rC E4  G9rՉt$@Pj5 1Nt91D$ D$D$D$9E4t$1E0jS4A t G;}4r1(^_[]h{%hX%hYh8%< :tD$ :Q::WVjPj1tMƃPj0 t/1vN F NN F N$(F(N,FH VL^_SWVt$D$D$>t_?D$$$Ht;KuC9uuϋ StQSV t PթNSv@1F@FDFMF t@PtQPV P؋PtQPV$ PjF uPtQPV, PBF(uFN^_[jt$USWVu-~L =:t':H ::N8tv 1+h{%h%hh8%7 USWV ύ\$Sj, CƋG|$1ɉىT$ 9ڍT$RT$sӉىD$ T$t$+rt$y" tD$ʚ; 11D$T$z T$tUʚ;+T$T$ _)ús1҉W_w +T$stK_t$ w W ?u G D$T$BD$L$Je^_[]fPL$T$ D$$PXUSWV ։ϋ$ =,3t:l$ }? ESVhU/T tp L$PQ5,3âW(3s>|x| @t,'\$$3SVU \ Uj b (3 s SVW  ^_[]PL$T$ D$$PXUSWV։N< $VhUgS SV PUh:G#W< ^_[]PT$D$ $PXPT$D$ $PXPT$D$ $PYXPT$D$ $PeXPT$D$ $P!XPT$D$ $P-XPT$D$ $PXPT$D$ $PXá,3ËD$,3r SWVhS$  1OtFƃ ||t : +D$HP03Ph$Q] 03^_[á(3ËD$(3@P )3 SVt$  hjh(3h3(3 s1fà 8 jSP  t: V1H1@^[_ fVt$tNVV{VcV.jVPVO6v^^SVt$ V1Kt=jhj t!jhj 1ۃۉ^[ Vt$t'P[džtP=dž^靄D$t$t$t$ SWV$hjW4 C jPW Whi 1NtF$$T$ !fD$f9t hWhi t1Đ^_[ËL$A$u1ðyLutUSWVTt$h^>tv 7 7 7 V1H11Ʌtv $BD<IG9uލ|$$ ^ F>L$jPWVt uF>*PWV 1T^_[]VD$0tVUjV v^USWVPD$ 8t$ 1w o _E<t2<GOtjSQPUwVjt$8`VGw}uM ufE O $PJt $jSVPUQt$4Vjt$8]$?=^_[]ËL$1t$VËD$t 0 VD$0tVBVv^USWVL$tPl$]€ư8t:1G9tT5t1ۀt1~u91^_[]USWVtt$\hjV1 Fjŋ$@VH $1WT$ȍD$l$C txuD$ Psot uAutF L$0QP& tًv\$~;1$D$0Ptp& tF9u19D$$"$8ЃD$P1~11TjT$4R4袼 t GP9|PX~11\jT$4R4g t FX9|XD$ 9D$H$~11LjT$4R4 t FH9|H\$ "\$9|T$ۋl$$\$u9t $t$0u $V$WuVh_%t$ 0|$w$H;D$t$\hjSKlj$w jD$4PV CG$C D$ jt$ VU C yQPD$|P D$lD$ @D$pUhi$ l$D$m@t$ FGF<<y<$l$D$0P$0# R`~/1djT$4R4 F;`|ӰD$|$0WQe~t$\yWh%e$_w ɺ@r <t5<(<$L$ 1@ut$h%$1@fG(FG>O*VTPRQ2 $t$6@u<$tW{tmWqG@WfGDGȉGHW~t GPGH$G sW}GLGMO9EVh%W%$7t)|$ jVWb w_ jVSN r1/ 1N^_[]j:Sv t/@1UQhQQj QP G8mt. (G8GjSP O t 3DPu:pKCu1l$PVhVVj UST G0Et=it.u1@1QVhVVj VP! <$ O4G4SWV$WjSK* F jPS  WSh~i5 tD$Đ^_[USWVPʒ!D  : : : :h%F : : $<  O+VQP% 9v1 LJ\$ I;<j,jU@t ǃD h%Vj,j&Ht ǃL h%'j,jPt ǃT h%t$$Wh'VQ D$9rh%h%[H$|$ 7D$PWD$t$h#D$PE ŋ\$tt< t< uFCCD$1$81ҍ\$SVPU\$SD$PW螖D$u?\$S J9t& t uJ؀\tJ\$9u돉닋@$8D1@DHLPT $A AAXh\lX\$<t$$hV0WAqD$t|#t3=w&AL$0h%h:G# HD$1D$S0Wq 1ɍD$D$$D$ 01D$ύD$PD$$PD$h#D$P|C ŋt$1ۅt t< t< FFD$<$u;|$t4L$ !!ЃD$1@D$h~$UA h%U+ hE#U $D1)h%U 1Ʌ<$t$V H9t- t u!H\Ht$9u1@$D$$<jPS 1Ʌ $1@D$S$@tXtT$@S# $1B*$Dt,t($DS $1BщT$1@$D$<$$$8$<D$PD$ PSUt$$$8`@jPdg t6ʼndt$/ `Dd<t A`Nh%<$Dt&u"t$ $<$ 1D\$ |$u!Ѻ!к1N!!щb؁$^_[]USWV։ϻ0l$U@'z tu;uHUh͸%D'D$uuUh#t$$t$$PL't$$^_[]USWVt$ t-tQN  8uP5|$t-tQ uPtt*t$1PPUF t xTuXTj卆jPW5 $@DtW,Du싾@WXHLtW,Lu싾HW&PTtW,Tu싾PWX\tWg,\u싾XW(V^_[]SWV t.Ɓu$È Ƅ1  ǁt!t !ց u %t utxx^_[USWV |$,t6D$(ԏ3|$$t)`#L$# $ 1CƋl$ \$18Щ%sϩ%Shp'Pt$ujt$\L$,1VSWPUAjt$\t$ VSWUkU#jt$\t$$VSWUMUjt$\t$(VSWU|$Xj=|$\WU Ê@tC< t< u CCu1j h%W j h%W jh%W jh%W jh%W jh%Wi jh%WQ jh%W9 jh%W! Pjh%W 8j h%W ?L$P1T$XPfL$T$t$XVY(1Kj/V uD$|$PjP9 L$r L$rL$T$t$XV'1Kj/VR uD$|$P jP XL$ r  L$ r  |$XDD$Pi4$PTt$X'TCD$P@3|$X D$P$;$3t PB11j|$\W6!ƉD$V茼yjW t>th_v%Vs V$ǀl@F |$X L$P T$Xj #' D$X |$PjP^ <7h%h%OD$Xt$P jP h%|$Xx D$P$<t$X@  $<PU D$PX|$X h#|$\W t$1VWjWWWWPΗ L$P9>t$XhI% |$X t$1VWhWWWWt$t L$PA 9>t$Xhh% |$Xt $;l$D$4|$t$ $T$X\$ S\$ S\$,SUt$`Pō\$ SWV"$6?mjt$\D$ 0USWVcO jt$\t$$USWVEOjt$\t$(D$Pt$P1t$X#džD$X= 84 j/P 1|$Pt@j/P tƍt$X.#t/PF1V #6 |$X t$1VWjWWWWt$t˕ L$P9>t$Xh% L$P ЉT$jt$\# h%%~|$Xq j,|$\W * ƀx 9l$Ps%ƅ |$1WShSjSSt$t ,9h޹%T$P |$X|$X4t4u t$Pt$P6tW6u @WF t u VFuu냃|$X0t$1VWjWWWWt$t L$P9>:t$Xh% |$XD$P4$HLt$X!L|$X1K|$XGl$PGt< t< tGG1L$1Vl @jP l  L$j ZP< t< lGG|$Xt$P$ft$Xٴ $h%|$X$;D$ t$\$4|$ $T$XPVD$,PD$$Pt$`VSl$ UWD$$P&$Ɛjt$\V3u7D$0J|x 8Ut$XhK%011IT$P  =D$P-D$Pt$P# Ɔ 1HFPFTFXF\F`FdFhFlh hP fFPfFSfFVfF^fdžƆ D$P f$6l$Ptu|$Xt h%@D$X  y@Uh%D$P |$X D$P D$P D$P |$Xn$6t$Pvih%fl$P@Dil$PPTT*BE$ E|$X.E$$(i1|$Xl$PX$\@D$P` D$P D$P D$P" D$P  D$P D$P u |$X4t$XVڪ@@ $dD |$X|$XG\$PH  @D$P D$P D$P@ D$P |$X$; l$ D$4\$|$t$ $T$XUl$ Ul$,Ul$$Ut$`PSWV$6?mjt$\D$(0USWV|Fu8jt$\t$ USWVbFujt$\t$,USWVHF t$Xh͸%l$PHL$1D$Xu31L$,|$X_D$0K  CD$XxG< t< tGl$Gl$1USjSSSSt$tV 9]Vh4%'D$PG D$P7 D$P ' D$P D$Pƀ D$P@|$Xt$1VWjWWWWt$t膌 L$P9>t$Xhӽ%|$Xtut$1VWjWWWWt$tE L$P9>t$Xh%D|$Xt7t$1VWjWWWWt$t L$P9>At$Xh%Qh% %P C t$Xh!%W à \$S螮ƅ|$PPh.%SV !  jvVj/t$\ AL$1|$P# KD$ɋl$t t OGuhE% N|$XoE1j:WN l$t2At$1VUhUUUUQv 9.MhT% j=W  ED$(@1 t H@WhĹ%+D$Pƀ 1K1t$P # $D$P1t$P D$X.U$ D$L$t$X3d$D$ $D$ D$0D$ D$,,tV(͉֊E|$Xt.t2f9}u,8eu'$8EuD$08EuD$,8Eu `XNul$P(BjRQ Ƌ,HR‰(,f||$XD$D$ DD$ DD$ DDl$$j/U SGJVhͻ%>nT$P   xUh%=D$(h%J h4%Ɔ <hd% D$Pǀh% 1K$dVhr%D1DDD DD.u h,% 1D$(1h$Wjh)%W1xh%Wh{T$Wphh"WZPh%WDJh%W.hA#Wzh%Wh=##Wh%W h%W> t$ h%W h%V h%Vs h%V] h%VGY h=#V1Z h%VT h%VE h%V6 h%V' h %V h%V h%V h%V h %Vk h#VU VhӼ%  t KC  t KCWht%Ɔ  xt$P1$ƀhuh޻%XttC< t< Cuh%0ǃh%D$,Kǃ%1CƆ 1CL$PTGt$P jW l 륉h%Wy t-h%Wg thk%WU t hý%W3 t@ChZ&V thɽ%V D$P@ tsFH t t@@1 t H@ttC< t< Cuh%Ƈhh%wsF< < F1$SUjnN tUh6%1C CC"$f8l$1USjxSjSSW謁 $D9]$ƃWh%ttC< t< Cuh%Ɔ L$P1S=flF D$PVI@ ? 7Ƈh'D$Pǀ 1'S #؄  H@เsƇhD$PǀFt< t< u GGu1L$l$S$ L$1W F 4$VÍD$PSN#CUPA#؃8L$QP.#D$PVSP SL$PT$Xj 6t$PjPja 1Ӄ  (jVtZl$P  hK# 1F؄t  H@hm%1K؃<^_[]ù@D$PǀǍ0PVjJ wh%F -{]< < ChǺ%G11|Kh@ ыD$* * h% C{K< t< tC C{< < Cht$1VWjWjDWWS9} L$P9>sSh%8l$1S 1K;4$(ƍ|$WPQ FWPD 8UP5 D$P4$VP L$PT$XjCut$PjPFCt+j/S tIGC1L$P4 1D$PVSj6H u7tb\$1SVhVVVVW{ L$P93tQUh%tGSh6%1F FF@dD$PƀMG=6 @/@(!  t$ %|$(t u$Wh%t$蜽t$1D$( s$t %@uh%j?suh%ItF1tC< t< Cuh5W$Wt)WG Åu"=1rWh7%31ۀ|$,L$ t<$L$ D$<$L$ t*1ҋt$090D$,u e{j< t?< t;C1Q\$8ǃ,1ۋD$0t&ST$L$ 9s~,C9uCԉڋ<$\$89ʋD$,uQAj,QP t(t$Qk,1҉T(T$T T!h%S螬IVD$0D$ FD$(F^ t8UN ljD$FWUPz >)QjPA 1FFL$TT$`r|$\s72USWV׉ˋt$$V >"u y"uIFA $Vj"ct*Ń!9 VSb ڋ $1|$(u>t1@tB1D$ 9 $h9v\u=T$^Nуm~4sjnrAT$B 7t3 B00b T$ 1ҋ $Ftx|$ D$ 1=3DWtCT41Fu|$ D$ |$jjD$P, T$ BT$tu mFyD$ 1Ɋ ր0u T Auˀ|$ tPjjD$P֊ T$t+=| $B7T$t T$t B1ŋ|$ ŋT$1ҋ|$ $9JŃ|$(uEt9vN 71M^_[]USWVՉϋR j=Pn ,$|$D$ V 1ۉ\$t?t9D$ 1j=S, )9uWVS D$\EuVި4$R t5ƍEjPt$ Z 4DL$h=%Uh=%hI% |$$t#4$ tzSRD$h% D$tHTMPRh%hB%hh%a Vt$t#1PPV~ t@Tt$ V0 ^Vt$t$Ƙ^h`%h%hdh% SWV1SSQ t&WV,W蔠SSV Džu^_[WV|$ t^ǘ1PPWѪ tPWhƅthjV, ^_h %y1h`%h %huh%: D$t L$tHTh%h%hhͿ%h%hh% Vt$t61tpT^hͿ%h%hh% WVt$D$ L$zVP-9tV 1^_ËD$HTt1Pt$ h/%h"%hh%G USWV\$tF+1PPUZ t.jVUH 9^TuVUWV_u^_[]SWV D$4toHTty9|$0uPLjPWt<Ƌ\$8PWShl%j Wv VNV ^_[h%hJ%h h/%hJ%hhT%hJ%hh%8 USWVa$c$L$<D$ VPU }W D$]8D$HVPS SVËET%t Etuu' 8Vt h%跨ňjjU赣 jWU蟣 Gt ;D$TG9t ;D$TWU菠WVeurGTL$tIѺ!! tD%WWj03u!X 8tN 8t h %ާW߅11SSVϢ tLWVߟWU9t! h%舧WSSV腢 Džu1VD$PVD$ PD^_[]t$ t$ hËT$11;T$ tэ HUSWVӉ΋BTx tt /4u$SGtCP7t1Wl$SV̚DžGT;CTuQGt ;CtuFSWnu8GttCtuGKQPNuG8K8QP:ژ&t%SGtr7tCtt-SjJ1l 8t h%Wj1u2E 8t(h%եژ&t%ScSj0u 8th%菥1ɅtWV讝W^_[]ËCT@$u Cx;Gx%Wh%h%h;h% D$t%@<t <u ø` /1ha%hS%j;h% D$t%@<t <u ø /1ha%hl%jQh%~ D$tBHttu#xðÃxux uxux /1ha%hw%j}h% D$t>Ht4t uxjh'PO[ a /1ha%h%hh% D$tEHt;tu&xÃxu x uxux /1ha%h%hh%Y USWV|$0G<tL<ukGȻ!t Ȼ )˃wq1N9t^~ Wo1=u!GB9r1ɍ|$0+K /1NjB1ɉÀthAu_1ۀ=:uD1FFFF FFGF:SVrVW_uP:މ^_[]Åt 1u19[:Rt1ha%h%hh% h%h%h'USWVP|$G<t<$ $ l$W)Ã|WhVX ۋ|$t(ٸF\$$)؃|PjV# 1=:u+:W9u!: /1N^_[]h%h%hnh% SWVL$thT$tqAZ8u+:8r<t1<u*r)!rVRQW ^_[h %h%hh%h%hh%j USWV|$t$)Ã|UhV t(ٸFx)PjV ^_[]SWVt$t~|$\$C<t u#17Ct3KكWVPQaGSKWVPQ. ^_[CPhc$WVg 1t߉h+&h%h{h%h%h|h%M D$tL$tf Hha%h$%hh7&h$%hh% VD$t&L$ t/fqPp QPI H^ha%h/%hh7&h/%hh% fV~$'Ph;% u^USWVD$t$V`1Ij0Vy1|$/ooo WV5't-1C 'I?r   DE9u֋-'t/11C 'I?r c   DF9uWt$V 8 1ɉt$\T$\RVQ2PVt  81I $ȃD^_[]WVP|$D$L$ $QPW: tWj t1H^_USWVl$|$~s/W9w1ۉ:ur9s >CB9uyuH1L$9sCCjP) tbL$1tHh%h%hM8| /IG?uWG9rD$^_[]h%h%hhC%@ USWVl$t$|$t1ۅu>t7NL%tn&#tÉS1ۃ1Ct:tV>tXtSh%t؉8txt@HtPt؉CjV.t.Vt!th%`t؉Ct:8t1Vt$t8uC^_[]CWV΋:t$ StPV|L 1H^_SWVD$1t^|${t 1NA~0jh%W uW W G9rh(3膧 ^_[USWV |$ 7u ;l$$Ujh%U \$C UPWh%NS$t^DžtnjSW  8th]%hU#荙9h%~1HzSlt$h]%h:G#R tG11CGt0WJ ؃uh%h% ?Ņu1 ^_[]Ë$t|$u%tPWh%hh% =mQ[PWh%h%辘KUSWVӊB D$ L$$t WT *QPwNjD$$7@uMh#萄C%tQh;%W w Pha%We |$ t$hh%W@ {D$ D$hr%$U t$h%U U |(6h%U 1>hۭ%Q~ h#$Ua 5h%UK hb%U5  hn&U h_%U h*%U 1ED$D$D$HtM~DtGD$D$D$$D$D$D$$~jSȉD$ 4D$, ED$D$$SD$D$D$$D$ )D$D$D$$1D$ |$ t9C Phw%W I4к'h%W +7$@D$o|$L$ uMD$@tBL$qPSh%W"A%D$ E|$tSh%W <$tBt88t/SQt"D$pHpDSh%WAM|$ tSW3D$ t7t1Ph$W D$ 0uWU W輫ǀ|$ WD$(P D$ #tA%Ph%W; vKL֦%t$]&tRh%W AsHh%W 'CPPh%W  s$h%W SmPh%W {Pt;CQt$(stPhhV tVh%WT {xtCxPh%W3 tr7@OǀD$(h`'P臆t0ts~ t!V^t&PD$,P9uvhF%OhF%B1OĨ^_[]D$D$D$h%W t1PPt$0V tc1PPV 9th%h$W oET Ph$Wj QjUt$0V行 Ņu1UVWU h*%$V藾 hr%V聾 hۭ%Vk h#VU hn&V? h%$# tzhb%$ A%tn|$"D$<u D$xuT|$t Su@|$"$<u D$xDu'|$ tjSuA%#(##D$ ##tA%Uh%W Vh %Wv S,E%tPh%WP 3E%t= t1tVD%u vuPh&%W ?Q@th4%W|$"D$<uMD$@tBL$q PShē%W0;ē%D$ S|$"$<D$@LL$qPPShē%Wtl{USWVl$t2E1Ft/׉˃PWhW%S tEu11N^_[]USWV\$l$|$ttUPWp 1tk<.tghI#W{ tUh$Wi tCj h%W蕺 t/tj.W轔 tUW8n 1t^_[]D=|Vt$ 'Bء03H 03;@3h(3j k (3H (3 Fut$03H 03;@3h(3j ( (3H (3 Fsh%O Fsh%9 FshzT$# F sh" F%%%%% %@uwxn%rh<#r]%rR% rG%r<%r1%r&f@#r%r%Q@ F sh%* F sh% Fth$ Fs h(% 03H 03~(3H (3 h(3j f h(3詘 ^ù %TVT$ L$\tX9t(,Nu2l1th9t,Ju^USWV$$Vmtg$$QPVha%h %h9%US 1N@t+9w');@MQP'At9w :)߉ha%h %h3%USH ^_[]USWVD$<Pi t$ $h#VM ]NjD$@HD$?1jhc%W衶 ujh_%W芶 u|$D$4Njt$0tNF tA.t;\$SP D$P1U1HPUUUUSF 9l$u9t[,OuD$,Njt$(\$Sv t-D$P1U1HPUUUUStF 9l$u9t ,Ouwuo|$@u~x |$wȀ1BL$81BҋL$8 t$ h#V Dž4$~y14$oy& 1H^_[]4$Ny USWVPL$1t{tu|$tw1@$.t t7t%F <t($tt/nމ@$t t ^_[]USWVD$8t$,]|$4,1҉D$0D$ l$9D$1$\$G͉ـ@rJl$9 |$? ؋\$u|$89D$D$4j<|$;|$@<$G<$t5t$ 9SPQɕ t$8 +AA.߉|$ 1ɋl$|$\$91$Nj\$<$t9tA t$91҉t09t"I$ V "1H|$0t1rЃ^_[]  7 USWVT$$D$ |$\$,ۉ$l$(1\$]fsuy3DHes3DH@O\tx3DH \\$ $2f\\ $$I$T$$I$O$sZ/t uPH tT$\0O0O0_$t$tpGH$1 1T$$11@\$E9p1T$$1趿 T$$t4<$t s%|$$u1F} 71N^_[]USWV Ί 3D$۰$D$1+.uME@1.u,6t uC9t~Ѕtx$tD$t $1 $D$7-t_u $uEuL$DAt1>G$t$GMEl蒾 1 ^_[]ÿx 8D$t)ݿ"USWV$$${ t;$tu:{PtDD$@-KQstQhhP~%W3Ve 18 1H(D$ H%tb%L$QSPWV Ą^_[]USWVt$HD$DD$L$UjS C@G jPSZ fC $4CCD V$4P؆ UShip讕 C O*W>RQP衆 UShipw  1N^_[]WVPRQ ~u~uF $`19؁Ĭ^_[]h%{oUSWV(ˋl$uG*SVP; tuH 1^_[]fD$fx(t1ËL$ D$fx(uD$ V1ËL$ D$fx(u D$˛ V1ËD$fx(uL$ȃt 1I1HIf1ft19HUSWV1<$\$(hWS螗 |$jjI`Ƌ$(@h@h]%ljFuJ1ۍl$Shf%j Ua h@USFuC 8tǍ\$($PhqB@W } f<$f|$ jUSA ShlBW| txD$PhpBW| tZ$$VЃuBD$PhfB@v| t(D$FP>F u+ hq%^Ft P1V)O1ĸ^_[]USWVt$fFtV)vv v AFF1ҋN t\,<*9v 1Ot$LыD$9wًt$fx(uQ tCFFWQt$ l FVՉn9r 1FFN? F뻉lj^_[]VD$L$T$NVhgBP { ^USWV L$@T$*@h t$ Vh%U $ETu*D$T$Pj!t$  t L$EPD$T$Pjt$  $L$1D$ D$~wΉt$@莦ËD$D$ PSCL$QP ؃8L$QPSt$@车9r$؃(^_[]Å,$D$ CD$VŋL$D$ 9tT$;Jt T$;J usD$D$EtD$ PUNEL$QP=8L$QP*Ut$@$l$9Jfȹy,tt1ɉuʉT$TH1KUSWV$4$0D$|$Wj4$@ t |$u1ҋ$,$(Eu E dT$ $P蓈PVh%S1I/ދ$0$4Wj$@U t|$r $,84$GP$P$0Vh%WwSYGPVh%WR$0$4|$WjU $,t|$w1Ћ $ Q虇PVh%$4$4#]SgPVh%$4轴T$ }ltE$u?ClhPhhWWVh%$4i{,t=u8C,j@Ph@hWWVh %$4$$0t1WPC,;r鋆Dt%@1W"C,;Drlth1WC,;lrF $'1|$TPÀsE,$0;rT$Dt|$@9tʃ,Ju$4|$WP$@Z tt$PhJ1Vt$$@$@$L0 >}k|$`$0PDL$L$QWhJ1Pt$$@$@$L0 1I1AT$D@1|$$8L P€rM$0 $4WPVU t.t$PhJ1St$$@$@$L0 E,T$;Dr1Aȁ^_[]USWV(l$<׀cScL$L$$OlL$,1D$D$1D$щމʍX9m@KCt9.CD$D$94u|$u|$uT$ ʀT$T$ ;L$@uD$D$؅L$tT$ D$L$;vJD$t$D$$P9|$tL$ )L$L$T$D$|$uD$D$\$D$ D$ PVt$ VY\ t$ t$D$L$l$$D$D$uT$l$t3\$ ˉ\$覈  虈 V1(^_[]ËL$DtD$L$tPVQ[ D$ƅuN SWVD$ L$tT$$w) .11t$|$X+9s "11T$(|$t 9t,Nu:^_[WVt$ t?GL^_VF\t% p @v\F\^VF`t# P?v`uF`^SWVjh0jM 1NǍ\$PSPhWdtrjSjjWdt]jSh@hWwdtBD$$1ɉ $L$ L$L$D$fD$DtD$jPWyZ t W^_[USWVt$+VjUAChu,$t#tVh~4Pj@^  r%sc%PShI%^PSh%I 1Bh4 ^_[]WV΋tF>rD& GTt tB9tt9BTtI䋆tÀ~>r QVh%I ^_ËD$$POL$1Bh4` SWVt$tgw]Vh4j @^ w$?~PSh%H GLha ^_[USWVhuD$D$G$D$GH t-wa9GGGG G _G_1ɉO OG_T$SPwD$@tGH%_0wF SPh%H _0G89+\$8D$<l$8 ĩ&|$ D$ fD$l$|$Xl$ D$XG8N PQh%G w$|w(<PSVhi%KGG0GH% w$|PVh%G G0GH%c1HG8G4 w$F|PVh%F 8\$0D$4l$0 ĩ&|$D$ fD$l$|$Pl$D$PG8G4t\;G8G0D$(D$,l$( &|$D$ fD$l$|$Hl$D$HG4N PQh5%xF ?G0D$ D$$l$ &|$ D$ fD$l$|$@l$ D$@G4?u5Odt.D$;Au#Ghu P+{w0PVhv%E w$ {w0PVhv%Et$6u$HujGtGht:?%tP%Ir%GHPuXj<c@O;Au<t %?u%GH0ts]Sh4w4Q;Sh;w8P;Sh\<w0Py;C w8w4Ph%yD 1HG8G4]@uPD$u>C wiVPh%8D wwhV3uVh%DOhD$L$u2wHS3jt$Sn9 t"GdGh SIDtT$e^_[]Ët$;th!%CjaUSWV ֋T$ F BuB |$$t(tCNVًT$ PjW[ t%<$r%jVQ8 tJH N@P6*8FD$ًT$ PjU t |$rF 67F Fn ىj3Wt$(& tEnىj:Wt$(& tEnىj;Wt$(& tED$ًT$ Pj6Wd t|$rFF ^_[]h%%h%hh`%?w SWVt$^ Sh3%'BG0+G8PShW%A Vhaj81G?6u0%EHPV Vh9%|? ^_[]WV։h,j")t/L$ PǀcSc tfǀ 1 ,^_ËL$h5?VD$tF9tAtIdtI;u D$ th'%P^USWVPt$t1t+l$$# uVjj4^_[] GiP6mVKAtAt;<t5^ w$rPSh%= j1VUjt4/w L.o ow;.GOGO oo_H,$uGdGhSV VU=w-1GG G$^_[]USWVxT$΋}D$t$(HL @r@t‹D$PLih D$ɀT$wȈBBV*QRPFI T$(  D$tz tA<t]<tYD$PPjdD$ 1SPD$XP. 9s1H<t<tfB fT$fB\$ً\$ CTȉB D$ǂcScK$tA{DcScu8|$|$u&T$ Rd\$ Ch;J1ɋT$)ƒsDF Ph%9t$*]tVSt$Dj/e^_[]f5PT$T$P\$ {$tz{DcScugʋL$ti\$ {<tcʋL$+L$kf@6\$ KD$t1@^u+D$T$)ЃftBT$\$T$wi sWD$ tHL$|$)9\$ G AQSP? ǃL$D$؋L$؋T$B)Á+),PjRh ,L$1OAhT|$ 1|$CD$PjsǃSt$ PN? G D$G D$ GGDCff_f_1ۉT$SfGEh衱 fGG@D$ffGSf f_ t$WhD$ p\W F Phd%/+k ΃]w'6uhg&V VjjA&1gydA$jD$PVo$ D$D$uD$HwK*PQt$ u)C Pt$h_%* ىt$ t$ [u^_[]WVt$ Vt>wwvw k ]WT6ttt9uq@苆t'P{džtPdž1^_UWV}tuPG><r 'u#r G(ftf u  s% u`h蕪 ƍG 4$D$,$5&D$\$$K%u(WhYUVjde^_]Íe^_]USWV($uZD$>48Ѓ% u 8u)u jh0jw* u&h4j@`GHۭ%GP_iVjhStSE0, pLJ  twAQ \ BjWhqjP[h%hS%7'sY EX>@P, UB( A J*R>RQP5  ]rts4 t*Mq @T$hRQPPV]h%2C>t2Mq M*T$hRPQPV]h%% PjO1wLw w wL$u]rruG XixiF SPh%F% D$h$PS6ΪNRh%%@u3EpCP t: @ NH M plYh%(%u Vh%%h%v$ޕ3=u1HL$h$QP_ t=w:F h(%Ph%$ w` 1Ƀ8tmF SPh:G#$1Ƀ W7@uÍT$D$ Pj5S@؃ PG tL$SQP3 h(%C$1ɉOG @L$jQV*T$ _ cuuSu ct Ut @Gcu(uSucu W$T$wSG@4G cL$Scu%0tGiL$QP6hL$ <G cSc{ ni;`CLsu%1C &cMScq s$WPVhO%! M1C1G G\$"O0)G4)G8uL$YME Ph% A}w s$HUPVh3% WuWVt$ VhYUjtht j66t^_USWVt$ ~3E(L$tW9ud G N Qt$(Pho%>W0Edh'%WWNttxV1ɄutZE tS@;FuK_ P!TPSh% uWt W+8#4 uE$;FuUhudEh>t ^_[]Ër^tuMEEVF $PE}t\$G$u=EH%j7~ruHWЃ댋Et {WZtstـT$sO$tPЃ8u)ʃAr Y N@H@USWV׉΋D$$E t @9u ;M$^ P@RPSh%L EiP6r$u!}@uHhjjWV Džt jWVjj|$$tD'%EHPVK#8#4 u2j1Vh53jj؃^_[]ËL$haWVP֋T$D$WPt$ 1Ht<$u 1t ɉ^_ËL$h7bSWV1{\t^_[Éjh^!Q蟻 C\t4Whcjpuh%hS%V 8u"543h% Wh%h:G#> 1NcD$T$ PUSWV$$($$$$_\ftPh%hg% ch$USY t'sPUV`t3_\t,Ct$?tF Ph%h:G# V%$^_[]USWV`(Ӊ΍D$`l$EE(T$41 D$$$D$l$D$ T$$t(D$,D$ftPh%hg%  t `jW0 tD$ WV h%`(^_[]WVD$ t01r9wu f΅t0^_USWV׉΋$$L$D$?D$CTO9u=F>wGOՍV*PRQ# t.Љt$P*ĨQĠ^_[] ~ D$*$\$ t21ۋl!9,tG9r PbMPVh6%$ t1ۋl!9,9rD$ Pj5t$ t>|$ u7T$l$ uL u)\$@s%n1ɋl$ T$Et*u4%& Vh%"%L$ E$D$EL1CDpـsjSt$T$ Cu|$  B6@t*D$ Pj6t$ |$ %t$\$SWVStǍF WPh% WQ} /6uh%VEiP6ΛVh53uPj EP'uD$߀ Vj4Wֿ t|$u$$}, uZtV,j@Uh@h\$ S蜈 t$C4$teSPh[#Vt$Wh%t$( [#ۋD$t$0G/% PcC4$L$ t/PUVt$Wh%QSPh[#t$Wh%t$$7 $PUt$ Wh%Q  h%V^_[]USWVPPj8t$ 覾 1t1,$t*ǀ8t#EPtUWPm +މ^_[]SWV(΋6ulVjj3K AuA jQV_ t=Ht*ub 4$/BPVhE% OVD|$ss D$L$ q qQPWV8  >(^_[VD$ Ph%% v B1F FFL^L$hqWËL$D$1PSWV΋1u1PPVF t7O t P SGt-^_[cF Ph% 0%GHPVq^_[WVt$ F Phi%g OhGL^_D$ȅtȰ (1SWV\$C rF 1H4t${GPhVB ۀ1HD>1^_[ËL$t4ɸxÉʁtt1WVD$ 1t. t(T$t$ty;>u ty ;:t u^_ËD$1t tQʁuSWVD$t1t6T$t6tt_;t?uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[SWVD$t1t1T$t6t:^1^ t6uIu^_[ËD$1tyhu 1ydSWVD$L$1Ht1Au t wSt u u1Gh[hu t tcuQuHSu-cu$cuUuLSuCcu:Su ct&cuuSu ct1^_[USWV`D$ttX{ Fo}e}h[}d0h`'D$(P Edx t]SXƀH|EdH #HL$|$WVrhEd@ D$WPYhF9VD$(PY1VVP VVP ƍF8Pbuz3WMhVP SWWG| WD$(PXjVP ƅuSD$(P臮C$t{tlSWD$|$WP@gFWP3gF8MdQP gXMdQP gVD$(PWS蔭1PPD$,P^ toVD$(Pg~xF| uF|FXMdQPfVt$|w9tV;UVqT1PPD$,P ƅuC$t$xh`'D$P1PPV ƍC D$~dV`Sn8U`?1PP$k 9tC9t?UWd T2T@HT$tjW룄$F<$Ghu5 j<$Ghu5 j 81t7= 8t-= 8t#= 8tG h%Ph:G#h GtO9KuS ;W t u^_[ËK StQSP St9_duGhGdh7&h%hh%6 Vt$u.jt @h9%1^USWVP|$WËl$t"t0H;Mt P}u䋇t8ttTH;MtJuj4Gt"lj$D$GEGGGhG%1lj$gL$$\$ G Gw u5 Ʌt ѹ )QPh%jVbS D$h @$^$tt"D$$0}5PSVUhT%WjLtGt $AG8y-; 8thG%hs%!1Gt W^_[]USWVP|$1!{t3s$Cd$9Htju  rj7S{htCdt Pj7SsHWdH ;K(uH;K,uO PQh% 2C(K,QPVWutAhAd _: 8u0t0t 9Ft!6u Wh%^_[]Ë $t9At QsdChj7R;usHW*d7莵묋D$t tHUSWV D$ t](tWD$ $]Et>D$ 0tD$ED$}  PjUWt$t$t$ jV$݅u ^_[]USWVD$uD$ttft$ PPt2Njl$$L$1tFt@t0Q;Ut, u&8 G8 7΋L$T$0D$(t!tJ;F uwt ;F ЉʉFNHNj4ƉXEFD$(F 1ɉNON1wL$ˉF ~ u1L$( Ʌt ѹ )QPh%jW/O ًT$0D$,t1FVfOыE@rt$4VQD ƃu V^_[]h% VD$t:t0t!PtQPV PuVj^WV|$ 1u7jt @1H1N^_USWV $ yr6 t$ $ q>YtiDD$ \$fl$Ӌl$ h%WU_ M6 8th%h%t$@s"j@{Dž@7Kt D>1ɨ1QSV? PQFRC F CFKN\$l$ o ! Fo ! F D$(t8tjVW uʋu1QRPSVmǃt<$^_[]ÃAjjR; t$K N KN SVHHN@LF 0 oUSWVD$1tW8tQ\$l$G@tjUP荬 u8u@$Vu4jjt @H h%1^USWV0hjdƅT$PL$LD$H|$D~Ӄ^dNdžu`P VLPVH@FDV@PQ5n@F M H MHMUP1  L @uu- rs@tn H NHN@FN P VPVx~V WPU n@t7HLM HHMH@@DEM|$D8H NHN@FN LF SWP|$PWUtNj.PUj w t:NhVRPh%j.Q: @jPW t&@`F`Nd#hz%Vy1F`F`uNd 0^_[]WVt$ 1WWV# t1@WWVL9 1^_USWVD$$t8tb\$(勇tK0tEFPU#t.3F@$u$C3FDD$uC3FHD$u C 3FLD$ t 6뷋u1^_[]USWVD$t81t7\$t(tEPjSP tmu^_[]SWV|$\$L$Ƌ@t9Xu9x t)jtXx N HF 1h`%K1H^_[ËD$xuH u L$ffH @ËL$1yuQ u A fËD$ jQP_ t&hPt$ h%t$-H1Ƀ H1ËD$1t' t!1Qd(u Q` uSWV|$uuu jPW t$H:u @`PUjPVWTtaQPAHd1IH H$ǀjPj781Fuh%W0J1N^_[11SVt$ ^d؃ FdF`u uhF Ph% F NhQPh% u2 tQd s((th%PI^[USWV |$41G$ujjWT t ^_[]ËsWt׋trNf(@_>t .o*Sh'U蚚 Sh'U胚 TD$ 1L$A AAPj@QWj1HE$E D$,$E MMDE@f(u:G><t;<upO*EHMHW+UIW,UJfEKW-UMW.UNW/UOEHMHEHO*W.ULMHuD$dU U V1N\E@M U\$SWRQPD$D$]@D$ (tE@jPS t=m<$hj.PSjp 1T$ JO9zPWE`t.tRD$@D$,$KU5E hUPh%3 4$ f4$ 1SWVt$\$Gt!PtQPW Pt1jPWtt2jP4%W51VPj4^_[Vt$^USWVPD$D$8D$ h@$1F?C@jPUJ tKd(1tD$ @`C`|$u%CdtC KhQt$(Ph%C` tt#Cd ut SуCd$ Cd|$u2CdKdy#KtHKT$JSN0t4$ 1H1^_[]SWV\${C KhQPWkƋD$dž؟uC4PN4V8@Ft^_USWVt$Ft-9t'\$l$9GuGxSVPUy?tF^_[]USWV8U1D$ D$D$0B D$(\$D$,D$D$ 69WGd<$t$tJOTSQPt t u"GPt$,hH% GdD$ D$1xG O4SQPt t $tsOdtYG %tP%OhQRPh_%hWj[u! 81t 8t hq%Sw$w gdװD$ T$9rхtȱL$D$?9$t`7G$SPwYs t $t8$C O0QPh% OtHO\$u4$FTjPS NPD$0VLz)T$$R@Às\$T$wr<t<u\$T$rrtۋ$tD$ ǃt*+t$0vD$9rÅtްD$t$\$똰D$) D$u% $ƁD$,@D$,r 1BjgUt$&$T$9rхtȱL$D$<$zL$tRh|Qj螽D$ t;t$(h% j6Qh%V,e^_[]SWVt$Vjj艽tj11G9quƁjmمuިt?5j6  sh%V+^_[USWV] D$@Cxt$rj.VL$0QjT |$,wVh%wD$@PSu tUx u\‹ tIT$D$K9Ou:u5D$t |$,w:D$rPh_%h%e^_[]T$rRQPh%ߋL$@T$ru_L$(9ujIu_yjjPL$ tjt$,VQ t8D$ L$rQPh%h RQh% \Rh%<$EL$t^9HtutL$HEۋL$t$(t&9KuC jVP{ L$  uhj/ËD$CNC KFCF CCj.L$vQP艦 Cx1ɉKxC|ƃ9KPƊðD$$D$(D$ OL$4QD$ Ph%T$$RGTD$0Pj= $AG`GdD$TAfGdA@t|$Ot$@t+1=6wD$Hh h%D$$ D$@h0u$@ t|$Gl1fLJƇGpht$GxtHdGxD$` >@t $L$(yD$<<t:<ut$h%<<tj<uŃt$hs%|$$HL$Xpx jP$PP D$<t$h%|$rst$h%$p΁Vt$ h.%t$$C$x|$D$ƀt$h%B1|$t +D$(t$( 4XPjQt Vt$D$`P \$Zt$h%t$ 訾 $A D$PAD$LIL$HD$DD$xdt4D$t!t$ut$h9%赺|$$t$L$U@AH|$u D$&D$6D$t0t$ t$<t$0V)j6t$ \$1ɿSQWҰV1QW轰hr%t$D$u%D$6j D$@`L@O|$ut$hs%몋sLߋD$,9CPut$,t$Vp VGPD$$t$,XGLtbt$,Vt$P wPD$(À|$$.&D$$h%ø|$$3WQ%t$4q t$h%Etk,΋D$9t ,JutVt$4q t$h[%U|$u/j |$u$jt$ut$hc%$t$et$4t$t$h}%|$$tL$11BL$jSD$(D$$UWV}u WYh8 ƍG 4$D$,$5&D$\$$G%ԶWhEVjíe^_]WVt$ VhjWۭVhEWĭVhW譭^_SWV|$G Ph%聶ujj蛠Ɖ6GF_>tC FPjTt.t+@JAH *RWP tF F^_[h% ^_[USWVd|$xD$H1ۉX@X @Xf@@wpMT$@ ,$MJL$ YYYYY YYD$D$T$ D$L$D$ \$/jSW D$HD$$)D$(.D$ \$,\$0\$4\$8t$<_ Sh%袴L$jQV u h%$BHJAWhjj*G Ph%+WhW iSh%|Yjt7UhjPs@h%hS%O)h%=d^_[]USWV׉΋A1PUSͪFVUS跪t!NtHNVJFxUUt$Pt$PtQP P9vL,V#^_[]USWV8|$L_Odȃ GdG`tTk Gh$PUh%! t#@uUh%' S0AC $1E9^t 6u(Fxt1ɋPd8t9tʋхut4$h%j봋4$VUh8%. WjDu! 81t 8t h%QL$o@G WQSRPU踶tDD$GdՃGdD$ j.PUj@ t'OQPh%j.V h%ر)h'3  WhPj)8^_[]USWVB(1t]׉˃ 9tE;Cu t mu2uxtF jPWh uFdt|$tF$61^_[]USWV΋yx1t>1COdШu* uG@jPw{ Odt Od tY?uŋFuh%Pch%PMt-u~`?w#F0gF Ph%^_[]jt$趾USWVp$$D$pl$EET$@1 D$$$D$l$D$ T$D$0D$ftPh.%hg% jSWQ tD$ SVk h.%詯p^_[]USWVt$D$t_L$1۹tU1ɋ|$9t A,9u9u'u uh@%f PUn!D$C,9r|$t"w 7h@%0 PW8!,Nu^_[]WVt$ tqwgVh:j胥1GGG G XGft+^_# Vh%h:G#w ^_ËD$@|tHd(tuðUSWVD$1t(x|t!\$l$SUWh u?u^_[]USWVD$t81t9\$l$tp|tSUV u6u1^_[]1USWV$.FX|$ j.WUja< \$wWhH%腭$$tXjVWr ÅFD$Pjt$ L$QƋ ulp|$NjSW: tL$9uPWVd t0 D$ PShv%+ ^_[]hh%蟬jjt$ t$Vnt+> |$ u2}E$<ދl$ D$ PSh%늋l$ t"UH4:QuU:QuU:Qu$t1t.tI4tU:QuU:QuU:Qtdv΅ ML$Uu@4xh@L$ QPUWVRt$Sh%$ WSh%藫 F PSh%ت t){4t#D$} t*tu Vh % Vh%蔪jjt$ U\$D$D$D$1 $‰1Cl$s5jPt$ l$UB$1Cl$ L$tjPt$ U<G $,D$;]E%f'9t Qf9Au<< <\$H $'|$|$WU(jD$$PW& !ȃ!D$>2|$l$ T$R WV PWVh%oD D$ PD$p Vh9%% D$ PD$p Vhb% D$8|$Wjt$ U$t f|$u$D$@@t0L$I<9u$WjPQtf|$u $8ml$ |$W'jD$$PW% u4F L$ QWPh%wD$`$T$B"pF L$ QPh%P 1Br&$F  $QL$$QPhC%<$tD$x%$l$ |$$ PD$$PVh%蓥D$wm 1L$ T$t$QPR SWVPjh0j 1NtKljjSj hP˾t $jSjj)W课t WI^_[WV jh0jt ƋD$01ɉL$L$L$L$L$ L$D$"t)L$,P |$WPW@G WQW达D$jPVP t?jWj$j)Vt"$jWh@hVѽu%h@%螤V6H h@%艤1N ^_SWV\$|$1tD$'1ۃ ʾrft1ۋhDj͍H(H,| t1ۉfǀ<fǀ?WjhP jjW t W G PhN%ߢWhW購 1^_[Ët#uujWuW 1NUSWVPt$$1ۀ?؍~ Whm%P E]1@EEE,E ]$z t(Vhj jWh%h:G#t^_[]USWV(u48Ѓ% u 8uu/1ɀusA u$L'D7sl7PuJȀ1C u u$u t8u VY61OxhD$ /,\$t(1$f:t$˃Hu[1PPShjPh%hS%Ġ$1ۋ6<$tD$D$$t;F SPh%Ο D$$hPS6V%Ch%6Jh%蘟ޕ3=u1HL$$hQPB Ã37@$:VL$QRP% \$\$TSjUj[p D$ T$!Ѓ$D$L$+D$ L$KT$$Sjt$T$ T$ L$D$@h\$t,+T$L$19и}F Ph%~T$E|$wD藏S GDtL$$SQP藭 _Hbh%Ğߋ$t|1QhQP芰T$R6#\$sD$1CDCH%-ۅt}u2 8tn 8tdD$ Ph%h:G#6 FD$ u9H|t;A`t"ftftAdu y  Љe^_[]1ɉH1BPP@ H~ Wh,%\ot/Vhj jۓ1WhN%h:G#b vF Ph%h*YD$twËL$1Bt$USWV $΋|$ 1Ct 4T$@D$tVjjPwcE <$L$ V諟txEtptk8] 1ɉHH@H HH$7"E%$P67!11Ӌ$PR*uLjEDMHELMP1ɉMDMHu5t1T$!ʋ\$!11 t%tPV"ELPu4 u<Udž6ttFtu7@t'P>dž ^_[]à Vh%h:G#ٚL$1jSWV|$WhjdtxWhS>WhS'WhSWhSws^_[SWVt${Du ?~ Wh%P 1@1ɉKCCS(C|S KtHd sHdit x0t^_[Wh%h:G#k ^_[ønL$x0tBL$4SWV|$t$_u~G`ux{ ur 6ugtXuG@Psmt3O WhjP迋uhq%hS%蟘t|t$WPV6^_[D$T$J P&)USWV$1@|$D{l$Hw C\$@ D$ $t&1VG,$;r苃Tt#P1VG,;Trt$<$lt h1WoC,$;lrD$Vh%P D$@L$D D$jAfЉT$ 9PL$ L$fډt$ـ1GL$PTD$tk,t$19tF,9u|$19u/fu)fr#D$t$@P. D$D$T9΋t$u'$1Ʌt9t A,9u09t,t(t$ t$ hcWt$$t$$t$PD$\0 t0L$ D$ PQhcVt$$t$$t$PD$\0 D$ L$)1HJ t$|1@$^_[]USWVD$$L$tKT$(|$r\$ 0hf++"9s 1>f։T$,|$t 9t,Nu:t^_[]USWV͋G4tP贅G4 w$('N   ȅu0  1uD$ 1۱L$(D$$(D$ $VhP  D$$D$(\$41ۃ t$|$l$ D$ E $D$PD$TD$1t ދ|$;tS,NuBrD 1GuD$0rD$0u D$D$E,;,$u\$t't$|$l$ $1D$MD$ t$|$l$ 11|$(ujt$( Ãu t˃ D$0uEpD$D$WjUPP D$Ãx3 t 11A9r1Ë71$1 $`'D$HDH0D$PjVQb$D$Ãu D$hDpHT$B|tIHdu= r x t1:t,@`tftft x t: u ft볉׉D$,t(1f:ÃIuD$01ɉu(D$ 6uD$@t @u$$u D$PDhH1 L$wZ sPD$uCD$.Pj UR9t.L$ 6Njl$uD$ Ph%虐1l$S3qƋD$p4t.X8L$ lt&f|$.uO H OHWP)1N x(H t(H p(H l(|$ t*G>r!D& D$H<D$@ VfFt tY;L$ t t4t8Wu 8gu8GtIы|$ t>rG QPh% D$P4 uOt$ pffBfBpɋ<$tXQlRh ڃ p7t$ffBfB<$tD$WVPR& ڃ L$t3D$fffBt$tVWRω ډ ,r1ɋ(ɍ4@L$D51fÍ<L5L$H1ɉL$LL$PffffJB|$WL$LQPn |$ ߃L$I|.,$Yd ry t$>A`tftfty t \$; ugf;2ub,$;]uTftNqLt$DqHt$@q@YD\$%L$$%ftx'tk~f9Fu`1ɋD$ D$##|$u%ZrRu$WPRVSQt$D$ǃL$tJHP dtKWUP蚒 D=l$_D$ fǀ< 1fw ,')h%葃R|$Qh%j W8 D$l$ f9<t1}~ QWh%PEt$sf<~ fu.Wh%zx(Ext(Etp(Epl(El6tj!zD$0^_[]USWV΃|$$w VhX%躂1H׋ 1ۉt$$S1ItU½ $]h]d]`\$,Džu\$Sjƅ>S|$,Wt$, t^_[]Ã}u,<$u&UDtEHtƅ>SWP uƃ Vhs%&WV΋rjV蔲tVrjVwtVi^_1USWVP׉΋\$D$PjRSR:tLf|$uD(͉čF DQwUjs(Ph%蒀k(UPh%& ݋\$D$PjSSWtCf|$u;8ωă =DQwWju,Vh*%4},WVhD%Ȁ ^_[]V΋QhjFw1ɉHH@@ @ @$j t ^D Vh^%h:G#* ^WV΋Ƈ?tr1BhwLpGDOHGLOP1ɉODOHth%VtP6jVjj`v-wx9Dth%Vu Vh%<^_É1jVUSWVX։ϋtu'C|t@du1ɀ@ƃ@L$tG uVPh"%Q|1%8WjjVuD$$Pj;<$w$'8uJ:%=ǃ8%8u+%8u%8u A%8{`G D${|t`t$ްGdu3N`W u u1!1t9wGhPt$ hI%} ؋?ut$u {`<$uhs`t$ hk%{} 1CdC`<$t1@D$ $ʃD$$ȉD$$D$(ȋL$$D$(t9vj D$\PjD$`Pt$|t$,t$,Pt$h%u:fD$D$D$PjUVD$0T$4)̓w! t$h-%ufjPD$DP D$LȉD$LD$PȋL$LD$P9v)虰 t$Pt$Pt$hM%ul$4D$h|tjD$@PUF upmjhD$DPt$<ǀ fD$ $BE0JM,E(EL$E(EduEd$%EdBE<JM8E4L$LM$E T$P9t MdU ЅtT$;s T$l$4tL$;AhvL$AhD$0D$PjUVK|$0tXfT$ $tBD$$tL$ I`I9 $r L$ A` $D$(tL$ IdI9 $r L$ Ad $D$,Gt$|t$ h%]sЮ t$h%ws|$ɋD$,u ȃd^_[]USWV|$_d؃ GdG`tG OhQPh%r wE tu{E|1ۅt5Hd(tgG`t ftftGdu tǍF Phr%rt}u^_[]8V6)^_[]SWV΋y Wh%q 1CCCC CC$; t\ ^_[Wh%h:G#q ^_[Vt$F Ph%q1B^L$\ Vt$?N Qhq%Po 1B^jL$ WVt'׉΃|jt$RPKt j6^_USWVP,΋ $1۽(D/fu /u'|/u|/u|/u|/tbfu //hQPV1t:ǀ L/艈L/f$HC;,T^_[]SWVt$Vh+jg1CC C XCC~ ;u Wh%p Wh%ot[^_[Wh%h:G#o ^_[ËL$[Vt$Vh[jifF Ph%o1B^hVt$?N Qh%Prm 1B^2L$D$1PUSWV`׉$tL$`T$ B1ɍ\$@KKKKK KK l$$,$D$T$D$ \$D$ L$ftPh%hg%n tjS0 tD$ WSV h%vn`^_[]ËL$aVt$?N Qha%P?l Vhjd1^L$"L$@ <3 t=B99T$:,=Z(D$j P5t=> 83 t=9T$:@=cRED$j P5t== t=D$0؀:؋L$9n 18D$8j P5t= D$J 98} Tءt=8B؋D$8Z,#@< @<t=X*|$W5t=Jp<} 8yet=D$#@< 7 A<#@< D$#@< @<D$j P5t=L< t=K9BT$:5H<I1L$xA AAL$hAAA :hL<QP5t==L<wwhP<y Gl<W} D A<@`PT @<1Wh(3tM=T3=P3} <t=D$ A< Ck B<_ @<t=t 3xDQGu\$$$$R$R$R$R$R$R$R$R$R$R$R$R$R$R$RQh$P|HH=w$)11ҊP:B9u9~@<u7h$޼ ~1P:Ph*#ü C9uj Ի \$$} # B<  B< @<@ @<%B<D$P5t= t=8L$9v\$$IND$$&9|$D$ fD$ l$ |$Pl$D$PL$T T3P3L$LD$Hl$H &|$ T$ fT$l$\$4l$ T$4< uh%0< @<@Ƀ`F~2GtZLtOStf~(gtAlt6sf7At.Ctfatcxff f f@f D<@xEh%j:QhP%Rh%h%Qh%QhY%P ԏ3)΃\$$@<j.Sl u S衑 )1?$QSPLm Ƅ<t- 3CҀ|Qy 3LQH 3@u܍$1R2D$#jPW VSW D$8WPE|$XWh%j D$8D$dh$VWjVBD u 1Ah%TQhm%Z5t=h%H5t=h$6P貏Ph5%" 1Ah9%Q85t=h%5t=h%hhl%1FVnPh%V81uS á@<t=<3 h%1t$hFFFFFFF :hL<VPS|u&=L<GtÉ<Guh%-P詎Ph$wPh<mr w wwIPK0IP J@<Шh%)$PVjQ8ud$xtA<th%q$ppj0j)5<{uc$oh%P'PVh% u2=<3<r-0*hW%}h>%s<<30 WBD$u h%Bu rH:@9u^ <1<<E <; <DŽ$@<@t$jPjh5<vzD$8@=<u2D$8jPj j)5<Lzuh%ht%|$u.D$8jPj+j)5< zu>h%P1|$L$8jQj*j)5<yu h%@<rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:5< yy h%QA<t+DŽ$j$Pj&j)5<xuK1ۃ|$$83D$,tD$t3S?<uhL%h1%ƣ(:,:|$$tF1FFFFF  F)F.N,(:,:9rF t$ƃ|$t.t$L$Aut$hi%+83D$,|$,tF)F/83F A<@;DŽ$jjj> y h%Q<<X<<\<<`<<d<fR<'u<h<|$tjt$ j.j)V2w=83ujhP<Vq yPh%UPh83Pj)VvuY=83tjh83j j)Vvth%$PhP<VG yh%h%h%VD$ <3 | h %$jPhh5<-vt$8jVj$j)5<vy ha%m- jVj%j)5<uy h~%G- @<H H r8r <30 s~|9~ h %,t$jVhh5<Muy h5%jVhh5<$uhK%d8<3PQh% @<Ѓ1۹<PSSQVRhP<v<t"Qh%襯 @<ЃPSSPVPh<;vt"Vt$0tWNuN'Vj蹓 Vj讓 1<<L$?V1Fh3Vhh%%b V2 USWVX H<Ԃ<t91ɉ D: @:1GH Ԃ< <<f @< r+rm ]1sqA:D:YA:D:<P:<T:<X:<\: A:D: t1@: <<H: L:fH:<3Uf@: <ff D:fF:=<u"t$@jV? ȣH:FȣL:<3:<:1L$@A A@:Y :$:Ph:5< ƅx9t&y hO%) VS5<h% @<uWhI3W Ђ<<̂<<Ȃ<<܂<؂< u2ءЂ<<̂<܂<Ȃ<؂< P؉+Ȃ<5̂<D$8t$ A<tFu%sa%P K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( 3D$0LA m$s%PQr F9uEPhl%Z h% h2%hG%= |$ FPhz%& 6Ph% |$ "hK%h&% h$h$^L$$ 'j.$Pt$ j}F$Q4'hr%Th%t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"Po $@D$@|$ Ph#h% t$ 9|$oh%h%З D$$$T$ $@WjWhԤ$&P臗 Ft hh%t 03H 03~(3H (3 h(3j )L$|$$t1 q΃j.PL$Qjuj.h"$P% $Ph%跖 |$u"tVh%蝖  h%莖 03H 03~(3H (3 h(3j t$GNjL$+{h%ih4r$# A<t$Nh$ Ntu%&P 1L$1΄u j, D$H %x%%sVQ蓕 D$9D$t$uKj,蛔 h%n D$4L$:D$tHj,r D$4WPh0%< $D$4D$ uj,C h(% 03H 03;@3h(3j)蝚 n(3H (3)h%h4r$Ĕ @<؋ 03Q03~ (3Q(3 h(3j - @<z|$h ot$dc~)/F1#ty1h%n2td3h% ^ F N t$~WRQPh_% \$S 6ƅx*Vh%ɓ 'h%躓 N h%蠓 D$@Ph%芓 ~`1St$6t:j.$WPjuj.h"W! WSh%; Sh%+ C9u\$,t$ |$d|$h19wƉ΅h(3K (M<T$p1Ʌu9Q V&jVw  VPpj趉 5<h%s 5Ԃ<h%` 5<h%M <tPh-%6 Ԃ<tI <9~h$ 0D$D$L$d$ & \$$ $ 03H 03~(3H (3 h(3j ` <<tz<$$<|-<@3<$\$\$\$ \$$?%- $h(3 J h(3J USWV $$919gՉ $t$ $;8t$hhG%$, =&GШu+$ ؃?9?)9K9si 3LA m$s%PQhV =hV$,< =GC~ 9r9$$ul&hhG%$,V =wDG$8:$ t-؍L$VSthV$, 1 ^_[]USWVP։1|$4$u9|.HPh%P %wS$'W )1@1sC9uÅu.Ph[& t$߉E1 `^_[]USWV4)ȃ'h%觎 :։ϋ ˉ h%ˉ $Wf_oUSRQt$Phs%? Gl$j.UPjuj.h"Uf Uh% Gj.UPjuj.h"U3 _UG()|c؉<+<'ueh%0<9#<,uth%蜍 '<+ugh% <9D$t'8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5 <t$PV;hD$$HL$L$ 1x1PPPWS jh@Pf 1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$ ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qpt+<$D$ lj$T$4D$L$L$tt$_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$t$1H|$$<D$PVP謒L$@D$D$ 1 G|$<$D$=X3$TD$j=ha&|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=ha&S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$PMz$))Չ|$)L$ É$T$(*)QSPe SVUZ |$|$t$ "+Hj=ha&P Ņt$,]m 04$Q"m 0D$$@'߈FHGNm&Þw$T':܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4f "FPWRtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PUt2߃dރdDd)t8ePUu$U%1H e dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=8<u t11jNt<<1P<8<t P]1@h3B#h%藀 8<1USWV1=P<MT$ l$(L$DžD$58<hhQ<菈  |$t$)#j hQ</ D$Q<h)#Vˀ<<tUPU uTWV誀@<WV蛀t7j L$QP' x#L$9uD<;D$ D$uL$us 8<8 8<APQ~ PQT  8< tuQhhQ<荇  |$uP<1^_[]H<T<T<1Ҋ+~,u"1t$L$t' t" t΅tAL$=p<up< t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=L<u#P<8<tPR 8<t <<1^P<8<tPQ 8<VtJT$1Aj<ƃ=L<u#P<8<tPQ 8<t <<1^t L<t D$L<1@1USWV D$,L$(l$$~ )$1H$`t L<1A\$9|ωL$ tgp9tX tt$ PR t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$P<8<tP|P 8<D$,L$$ ^_[]f11f11Ã=t<u /t(x<11hh<PjNtx<1<t<t P襆1@h3B#h%{ t<1USWVT$1=<+\$0L$ D$D$|$(D$5t<t$8SՃ l$,D$ D$D$t$j S* \$1 h)#V |E|$tt$(P2Q u~)#WV{EWV{t^j L$QP^| xJL$9uAE;D$ D$<u/h)#V{tj L$QP| x L$9t[ t<8 t<APQ~ PQO  t< tuQt$8S袂 E h$V{Eth$Vzwh$Vzah)#VzEHh)#VzE /h)#VzE$j:t$ 8) 1@|$ u<1^_[]WV=t<u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh<hx<t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=<u+<t<tPL$L L$t<D$$tˉ01C؃^_[<t<tPnL t<PPhh<hx<t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=<u+<t<tPL$K L$t<D$$tˉ01C؃^_[t <t D$<1@1fUSWV\$l$t$VK PVWj UK PUWV SK PSWB t$ VuK PVW* ^_[]WV t$uRt>DžtA=<t ^_Épxj Ph" ؀=<u1F1=<tZ 1맋5\3KY #QQh%Pփ4W USWV1ۀ=<t ؁^_[]}Z D$ |$GSSPh<jW&u < IJ< Ȳ<r1H̲<#1ۃt2u3hWh% D5<~ȍQ2w$h'Ѳ<PAu в<?$D$-\3 X hO#L$Qh%PՃҲ<`3@Ӳ<d3 ̲<I9@h3 ̲<I9@<<<Բ<в<yѲ<pҲ<g`3 ̲<A9~WH`3OӲ<Fd3|t%ƍC!t2)É$)t*<<L$ <<$)PD$p xPh<O =Ҳ<=Բ<WjD$hpj Ph"轺 5\3zP #QQh%5\3aP #QQh.%PփJN 111{PZDWhVM ESWV 1L$ |$ ru\95 <s(>tGǀ=Ҳ<u.;= <rN;=(<rD< DžtVjW2M =<t^P 1ހ=<t& ^_[À=<u1Ffu]pxj Ph"I 뺋5\3 O #QQhc%PփL NUSWV|$4t$0Ë <9s&<9 8Ս1ʅ/<99;G  ȉ  ȉ B1rAS Չ  Չ  Br@9t$0Չхu95 <95(<H_ŋ <!9r؅ ز<9s9s_Ȳ< 8!9t.M9wI9rE<8! d3!9u!=Ҳ<=Բ<<Rf ʼn9rPVU!  8!!ōD$p <PVL$D$PVt$8 <Pt$jUV螶thŋ$L$Ai Qh< =Ҳ<=Բ<u=<M 1=<tM^_[]t$h<O=<1GDu3t몍D$0xhj Ph" 5\3K #QQh%PփI 9U7)SjZP)MPjS7I :9/ $)QjZP)PjSI tƉ111USWVˡ<!9ta)‹ ̲<h t u9=,$)<l u=Ҳ<OE$)ÍFu\wl'xD$X <PWPW=Ҳ<N V<<5<<w(X' w'1É;GsG1B TGHO;Mu9}tAtDEWP75u%E9tt9sMxt MPQO}-E $ut=Ҳ<tGV^_[]ÃWU VjZS*G vjZv G VjZSG V t$=<tt ^É01ɉHHj Ph"E ҋL$SWVȋ<!9t+)֋ ̲<| u 9t%)D @A Qh<@D^_[USWV=Ӳ<t^_[]þ#VVVh%\3VhB#h"h5%\3%=в<u%P &=Ҳ<uu&H#=Ѳ<u&RQPhA%\3G&=<uZ%"=<uC#n%=<u]$]%=Բ<u$VRQP\3\3$ <|$gfff̉ҍ4މ劄1}#GO wһ#B#SUWh`%T$t$|$f4SUWhg%\3\3$ <Ggfff̉ҍ<߉劄9}#FN wh#hB#Vhv%T$\3$ ز<|$gfff̉ҍ4މ劄1}#GO wh#hB#Wh%T$\3$ <|$gfff̉ҍ4މ劄1}#GO wҸ#PPWh%T$\3$ `3|$gfff̉ҍ4މ劄1}#GO wҾ#Vh$Wh%T$VVVh%\3USWV΃=$<tPt <3!1Pcǡ< <!)ȉ9r1Uc$<9tEuótP-Ȳ<!1PPjhjUP t(@<tD<=@<=D<-H<1ۉ^_[]V΃?D< ; H<v$1uD<Ɖ D<^USWVP<<< 0trƃhD'PdF,=IJ<=<4$t|n011FEEhT'P+ـEEC<(9r:5\3C #QQh%Pփ=в<<11<9s[ $,0EEhT'Ps+<C<]ǡ<<(9r<9$sj,Ѓ0EEhT'P4ز< <s <)ÉE;ǡ<<<(9r$^_[]@ L$ D$@ +A USWV ׍B $Y1EMˉ)΍ 9wۡIJ<D$ <D$iD$t$T$l$ D$ljL$ȃ1EMÉ)ƍ9wہw;|$w|$r k=9w$D$BL$ JL$J L$J$ ^_[]ËL$ T$B+Au)ʉËD$+D$ USWV9ܲ<s$5Ȳ<!։Ņ9<v6J Љ  ȉ  F1r{@p9ز<sBJ Љ  ȉ  F<< h3u%1I#5<!֡< d3HH,D0l$tmxtgXHT҉|$|$  l$ |$$T$lDT$|$TTT$|$ $$$TL$0$,41PPUj tPUz$Cl$l$THLË$C |P P1D@;rt4$|PA9sWT t|$ |$t$lD|$t$|T|$|$ THL$$14$1TLуt1J LTCS$1Lt0щ$|$ ՋT$lD|T$щLCTP@9s3L tщ$ ՋT$lD|T$щLC1 t=Ҳ<t=Բ<uVj1^_[]VhU?< USWV5<1!-<<t E<<1-D<E@;H<v@uW-D<E@D<tE3t,ÉE uUh<=Ҳ<t"=Բ<t!<<E-<<^_[]VhVjS; USWVΊ ̲<T$ T$FD$t$V$D$9Btr$u$…<ыR$T$9s@1ۉ‹l$t| t!;t$s^9w9s;l$sil$9rȉQ\$SB~VSuSD$x,t @,KZ <tjNjD$G G< <)ʉWOT1Nt TtWt$-<T$ ̲<^_[]1USWVȋ5<!) ̲<L)ׅtƃ 1T,E9ut|1Ml |lV^_[]USWVDΡ<94$1PPh,< Åk jS,<W SW<<<<;- <r ;-(<1WWjhj\$SUf t\tV9tRSP uE< j@\$S0t -\3&; hB#Sh%PՃ=в<1lj1<4$9v(< 1QQjPjVQ @wg1=$<jYŋ5<!Ɖ)tPX$<9tut݉<$/(<u1]4$D$x Ph,<tA<$,<C 9r09$v+jSV; SVO<<<<uɉD^_[]7 V< <r!1F<u. <<F9r^USWVP $1N=<1!׉) ̲<D$)ot +t=Ѳ<;<v|u+HL)͉ll+;<s| ullD +lD;G,$vuWVNDGWV};_s_u.G WP=Ѳ<u.M,t <-},^_[]jPR} 5<^_[]USWV@׉9 <95(<jV;(<u >9uPV;(<FjWV *1ۡ<<t  <<8D<H@; H<v@jD<H@ D< 3H <HPh,<D<9rWVK u=9 j@S0 -\37 hB#Sh%PՃ=в<9=<u]<<t  <<6D<H@; H<v@u,D<H@ D<t=<p xPh,<@^_[]9$<u)$<(<4 fl3øl3ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á<3D$t$P\WVL$T$ ‹q~y ;q~ t 1~9 QPT ^_D$ 3DAD$ 3DAD$ 3DA%D$ 3DAD$ 3DAD$ 3DAD$ 3DAD$ 3DA%D$ 3DA D$ 3DA@D$ 3DA%D$ 3DA%D$ 3DA@WV1F|$ 4X'W.' tF u1^_ËD$t w$\'1ËL$1t9t1ҍB|uËL$1t# t|$t3LH1H rËD$t 3DA$H1ËL$tT$At9ut1VD$t$tPt$V ^D$ 3DAD$ 3DAWVD$ ##tƀ>t\%#4 0DPWVh&h3gO ^_Ð1|$w L$t9tø3f|$3X#t#fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fUSWV$9u$$t^_[]A 1۾$$T$$IwL$I`q|$ \$߉t`rL'j`PS  `Ǡ1ۃ`u։,$|$ \$,$|$tL$9`\$|$ 1 $t$hjD$ Pw. t F;P'tmP'D$t'D$'1FthPt$$V V " Ft$N tVD$PS( |$ut$`e|$ \$|$u,1F|$uu1;p't$`=u-`1 01H^_[]Ël' r ,$'t u‰,$''<$t9rPQt$_ 1t/<$t9v0 |fL$q%9 (v3fL$%9 X(vx3føÃD$L$L$ L$D$Vt$ t$Vh3O hŢ"V?t"J0 0kPhӤ$h3K 3Vj 0VV ^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t. 0 {. 1$^ÐWV|$ W4x'0 tFu1 ^_D$ftL$Q'1USWV$п$$ u V  X)jL ŁTUUrP$@@D$0jP D$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#sB4$Y(111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n1$$|$a$B8 A<A0?t$T$1|$tVT$D$$1۹uSrD$ 1Ҹ1ɋ>!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$L<L$L$ tU#|$$1Ĥ^_[]USWVt$~X>3܃ V$' j F H @(N]_?[\;^r~uFFL<L<C><% ^q{t|~F~F ;^r~uFL<FF h@]X@ w|(hS;Fs8)t)h~ wFDPpS|;Ns A9)t~uFL<F^9րրw t$rI{i9s <$=3]D_\,<$t~uF FL<L<Au~uF L<F>:* +F)@HWP^F)P)?#{Ë;NsD9,u=A3IDJt"m9~~uF L<NPSN9/8}@F @y(e pjF H @$1P1C)F؉HWPYF)PPp^XWS0F)`P}F)@xWP F)P!~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF L<F"{u@9s 3DAu~t}1^_[]ËnD$D$F@^ ]nj(Fxup 3DAu f'tf`uW~F=@9t8}@u~uF ~uF L<FЉL<$USWV t$ ^h.\u/;nr~uFFL<L<EMŁ'$~]$'|tfύ]Љ8S dBt@SB*@.[Oω\σ~uFL<FF @D{ σ~F ϋF H@ih@ w\(L$hUBV9s"H9s 8\u9)t\j)T w FL$DPpUV9sH9s8\u9)u σ~uFL<FωωD$$xt~uF L<.n~EFx 3DQuf't f`FdϋF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS| F)`P9\9{ ËV9sE9,u>A9s23 DJt"r 9~~uF L<N$PS FJ9s&9s":\u9}u$t1 ^_[]9s9sy\u9}tHA~uJF A ^D$D$ F@^ ]$.^t~uF L<FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAIItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFL<F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj3TXL$21@u"3TXL$1t$1ɅtT$T$1=<3E9Efl$0|$L$=щE pX D$ t8(|$w7~1T$39u!E HD$8uL<F4^_[]ËD$ |8,uD$xuD$xu~tE t$+p 0V8뷋D$ D8(D$SWV$΋A @u1 3LAtx 3u3f9DAuP^(^_[Ë>^D$f@]D$F>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ蹳 F^_[USWV1y19sC11-3D]t#=k)CB9u1Bt=|yuA L<Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$L')@xWPF)P~uFN)! ʉjl~uFNT!ڃTj=GEUQ1CU=Kl$E1=‰$|у $~)ExWUWt$jpF)P~uFN)# ʉj~uFN#TTj)~ )EHWUF)PP' FL<FUSWV\$1=<39v1@(ϋF,@jPv( t|F(N,QV,fH~<t}3Dh <31҃9v1B <33Dh1҃9v)1BuG L<G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFL<L<M<^_Ã~uFL<NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFL<F1^_[]É؉D$%'t$t$U( u U t/uՃt~uFG롋$USWV 1=<39v413A8 $A,tI 3L$ 3L$ $y(i<1 Wtt$f9\Ntht$f9\Nu[f9tVB9u֋4$F4tN01f9f9\}@B9uF$t$1N  ytS'uF$G9rދF81 $y81~8 ^_[]USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRqH tF^~uF L<F1^_[USWVP1N׉$1+t{`tswsK$'@LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l=<3|$ r3GtD$WT$ou]t$S |$Qo ]GtD$wt$wt$wS |$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ s ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$'$M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4袦 L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ N ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf 3>|$u l$`\$\z 3D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" 3T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA 3D$¿!DQf_֋D$ !DAf|$$_8tV|$u3L$ DHuf|$$_u3|$u3T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t VŰ @wj/V 1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPh1%jPhX<XX<ø%Vt$1Ʌ1t э^fffffVYT$ws^ÐUSWV[l$,D$(u1T$|$;D$ T$$750PW讦 Ea PW薦 0PW~ i PWf tq PWR |$D$ tH0PW | PW 0PW i PWѥ t PW轥 |$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,19r 胼$ t+$ $$ FhPW9X D$D$D$j1҉$ xfD$4D$d۰ /$$ AfAfIHQPRhW,t$VPj $D$$P1D$$ D$$ FVu 1Ҁ~ $Fȃ w D$$ V訛hPWV j:W>{ D$tǃD$11ɉt$D$d$|$ |$l9tD$ T$hD$pD$4$ xfD$dD$4$j jjhQVPÎt Ĥ ^_[]ÉL$$D$lljD$D$pD$ D$1D$D$h$ L$|AD$x|$$T$l9L$B$$ ,$Ɗ%t"F9sᐐ1҉OiۃKl,,$L$ ɍ$ d1,$L$ Lz9s L$4.,qPh$P)$$,$9s|$$$,$9s|$$ y L$ɍ$ P1,$ L$LZ9s T$hBJ R RQPUh$P$$,$ 9sL$4,qPh$P$j$,$o9sD$l6$,$/9s狄$ @,PQh$P$$,$9s狄$ @<h,$9suF9snF9siF9x|$B$ y ,$9s%NM9D?<$ @<\L$|I t$xjhQPRt$Ph$P$$,$9sL$tW,QPh$PT$t3$,$/9st ,$,$9sNF9s/F9AΊF9|$pk,$D$ ,$$ |$jj Rjjt$,$ 聈$,$$$49s獃 ,$$ g ,$QPh$P$$9s獃 ,$QPh$Pz$$ _9s,$9siF9snF9seF9t,$9saF9spF9spF9slF9seF9stF9saF9slF9sk ,$9slF9siF9snF9sk,$9siF9snF9seF9stF9s6ZD$dL$HP pRQt$Uh$PD$hL$HL$0HL$,HL$$HL$ PH @ l$(PQRt$,t$4t$@t$Ht$,t$Hh$P蟽,D$L$HL$0HL$,HL$(HL$$HL$ HL$`HL$XH L$TH L$PH L$LH L$HH L$DHL$@HL$<HL$8PH@ l$\PQRt$Dt$Lt$Tt$\t$dt$lt$tt$|$$t$Tt$\t$dt$lt$tt$X$h$P蜼XD$4L$HL$0HL$,HL$(H L$$H L$ H L$\H L$XH L$THL$PHL$LHL$HHL$DHL$@HL$<HL$8HL$tPH l$`pQR$t$Ht$Pt$Xt$`t$ht$pt$x$$$t$Xt$`t$hpt$tt$|t$`$h$P膻`$,$$_9sjjjhRt$,$ K$,$ty$$t%9sT$,$tJD$T$ 9sND$ $D$$D$ 9sND$~$F PQhW_1ɃD$D$ D$1 f fffUSWV`[(t$tD$ D$$D$(D$,D$0D$4D$D$D$D$$D$D$D$ N?r=  l$8D$UPjO tCL$HD$ QPV t2VI t+jPj 1ɃىK'謡 (jD$LPV蝠 蕡 (l$8芡 0jUj v 0`^_[]fffffUSWV< [õD$yXXD$/Xty$/devA jPt=ƍD$4PhFtHV[ V@ t|$4l$8$<D$ oD$ $<T$$6!PhQRV=D$ t@D$D$D$KD$J p[ L$T$ t$FY 9t$D$0l$WzE?tD$pD$ jjRs tkD$tJt$PD$P  ut$D$P uPL ujjD$P k6蛟 8[ 耟 iŋ$\ $X $T $P :)tt$ P$` tVjQ$p 1tWhgtQ] < ^_[]ÐSV[JL$t$ t$ t$ PQft+9 ƃt;u"t$4$.1D$L$4$^[fffffffSWV[üt> mB 9u8jjՋ t P1 1 4 0ǃ 'ǃƃ tʝ 01^_[ÐUSWV[$01 uut!j/Vh uS tƅu ƍ|$ VPQhW蚴=r) ?h@VsǍD$ jPW D$$WtLD, L$Pjhjjj QD$(P~y Ƌ<$t'Vu D$8 t菜 8 聜 L$^_[]ÐSWV[ö u.P6ƃ $tj/Vpg uA蒚 Ɖ獃 VPQhWD=rӛ ?t" VP蒍 tEFu7hh%@V  hVPyB ? jj t=jjj} !ƒt" PqJ 1u 0 0^_[ޚ 8#uVt׉迚 ƐS[>[ÐS[t$[ÐUSWV[u }J D$<$< t$u$$D$Pz/ut=k<T$JL$|D$x$L$x$PQm$$$Pt$llH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$X1DPu@4 $9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$託 D$@j PW- 苗 8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $蓏 \$ 8u$$>$0։] D$|D$$D$$D$$$D$ t$t$|$|$$L$PQLb|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6W8G4jjdv6=m jjdRP蛛WPGLjh'v6m W`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$, L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$t9u1^_[ÐUSWV[KL$tEׁu$C t+t9u11ՉL$!։1^_[]ÐUSWV[ˣ|$GtB#l$%t$Pj9t!G t7t9uӾ^_[]ÐUSWV[[tC#l$ t$P8t!G t7t9uӾ^_[]ÐUSWV[tC#l$ t$P8t!G t7t9uӾ^_[]ÐUSWV[xt$0t$, ǍV VP‰t$D$(%D$1퍃D$ <$l$tg|$ !RP7tG t@/t;L$uЃt'D$ t$jb…<$uNt$0t><$9tRM[ PUW >&t1<$W1 ^_[]fUSWV[;t$D$hEt'1PV6t%D=u1 u@VPjmD$@ 8^_[]ÐUSWV[ø|$ D$hEt$1PW]6t%D5u ^_[]ËD$@ 40tMi D$jPt$V ŋD$18txi r"u## uRB"tt$ af4$WPjуH@WPj.SV[Ít$ vWv LVC^[ÐUSWV[HD$,8tD$,1퐐8@ujl HƋ|$(WW F$"jUF D$ D$,F>V D$Pt$_1}nu1ɀ}ouL$D$j=Ut3 tǃ|$D$,t1PU4tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$jŅ8 t 4$V1^_[]Í@UPj0USWV[Õ$4$,g 0jPU uj:UW2 jPUm tKt$}/3t$UhVh jVPUV P4 t$UD$P/$0VPW-  FD$ GL$ djjQPjR|1tqVUW  Rd 0$0Xd 0kd 8uj/UBŃt$ $0UW  zd 0QPWx  111Ud 0$0P$4I  11,$j$4V$4WjUpP>UPWNst$t8HPQ膇&c 0$0P$4  1,$D$PUc 0^_[]Í,$UPVWz1[c (1WP$8$8zVsfffffffS[{D$D$ $L$T$jjPQjRe/yD$[fffffS[D$D$ >$L$T$jjPQjR/yD$[ÐS[ûD$D$ ?$L$T$jjPQjR.yD$[ÐS[[$L$jjPQRqyD$[fffffYT$uhÐS[ޗt$ZqSWV[ü|$Wt$t$O 9r1a ?WVPj^_[ÐSWV[l|$Wt$t$ 9r` ? WVPj^_[ÐSV[t$ i ƅuWPj^[ÐSV[ݖt$t$ ƅuWPj^[ÐSWV[Ü|$WƅtujWPj ^_[ÐUSWV[[l$|$UW\ƅttuUWPj^_[]ÐSWV[ |$Wt$=ƅtuWPj ^_[ÐUSWV[ûl$|$UWt$ t/_ 0UWPj^_[]ÐSWV[l|$t$WzƅuWPj ^_[ÐSVP[,D$L$T$$RQP* ƃuPj^[ÐSV[ݔt$t$t$ ƃuPj^[USWVP[ÚPt$0t$0t$0t$0t$0jt$4: Ɖ׋,$t1] (t$,t$,t$,t$,t$,t$,Pj ^_[]ÐUSWVP[Pt$0t$0t$0t$0t$0jt$4= Ɖ׋,$t1z] (at$,t$,t$,t$,t$,t$,Pj ^_[]fXL$"wÍ*ffffffUSWVDXhD$4t$dT$\l$lL$`1ۈ$<tyD$XD$T$D$hD$t$l$D$D$ D$$D$(D$,D$0|$  tt Z %ju %#jo%#jx|$L$t\$4t$hVWRt$h\$4t$hVWjjs~D$$<$|$ D$<D$81$ |$ <,L$4lGD$ =u <$f :<$F<$f ՉʀЀ r ʀ¿d ʀŸV _@F O?1 G<@& fu  $t$T$։t$<1 tl$<1 u<@TP* <$  |$ |$8\$6O? v 1ҸGD$ $ t1#T$#t$ |$0D$$D$,;D$s L$,D$$D$$ O3L$< =u!L$$;L$sD$=D$ L$$L$$HL$ D$$ D$$y|$ t^;D$sL$L$ D$$ӉډGD$ |$0L$$L$,;L$s D$,L$$L$$L$D$8CD$,7|$$T$()9%D$$;D$sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$D$$D$(D$,D$0T$|$)D$݋\$4WRT$$RQP;L$s D$L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$t$)oD$\$4VRT$$RQPh;D$s L$T$L$$t$(L$$)9v# 2L$$;L$s D$#L$$L$$D$9sD$D$L$$݃L$$L$(D$,D$0T$t$)eL$\$4VRT$$RPQ^\$@L$$D$,T$()9D$$;D$8sL$>L$D$$T$(D$$)9v#D$$;D$s L$#D$$D$$L$9sL$L$D$$݃D$$D$(D$,D$0T$|$)D$\$4WRT$$RQP\$4VRD$$PjjfkD$8 $~D$$|$ $݋\$4WRD$$Pjj,kD$8 $Ƌ\$4VRD$$Pjjk1Ʌ륋\$4WRD$$Pjjj~D$$$D$8D$ x@uNt$  t$  ~!‹L$s0|$0D$$tUD$,;D$s L$,D$$D$$Wt$  wy;D$s L$l$L$$\$(L$$)9v# +L$$;L$s D$#L$$L$$D$9sD$D$L$$L$$L$(D$,D$0T$|$)vUL$\$4WRT$$RPQQD$$y|$ Q  ;D$s݋L$L$ D$$̋\$4WRD$$PjjhD$$u|$0L$$tB;L$s5T$ >#\$4 Q L$$;L$sD$#1L$$1L$$T$t$()9v# 2L$$;L$s T$ #L$$L$$T$9sT$ T$L$$L$$L$(D$,D$09sT$ T$L$$L$$9vdr L$D #T$r@L$D 1T$9sT$ T$L$$L$$9vr L$D #T$t L$D uD$$D^_[]ÐS[.jt$t$t$t$t$[fS[L$T$ Pt$t$t$[ÐUSWV[ø|$$t$|$0t$(aD$ j/Uj ,$t|UPt$ WVt$8IuUN 8uFt$ t$Pt$t$@t$tD$~ L$ u [PQt$ [ÐS[sjt$ 0 [ÐS[sjt$t$t [ÐSV[Ýs0t$t$V( tD$~ L$u  PQV ^[ÐSV[=st$ t$t$VP( tD$~ L$u  PQV ^[ÐSV[r0t$t$V' tjt$Vh ^[ÐSV[Írt$ t$t$V' tjt$V ^[ÐUSWV [8rt$4@|$lD$ L$jjjjQQPPt$(v$[ÐS[lD$ L$jjjjQQPPt$($[ÐS[kt$$t$$t$$t$$t$$t$$t$$t$$0$[ÐUSWV@[Õk$\$Xt$QP%$ % $$`t$PRӁ&$  $t$PR蔁&$  $$dt$PRP&$  $$l$htD$xPR |$x  T$xtD$PPRҀ |$P  T$P$t$ptD$(PR萀 |$(  T$(tPR\  $L$(T$Pt$x$$PQRVWU$P$4P$t d^_[]ÐUSWV[5i$U$tvu $ 󥋬$$tvu $X tugt$ $ 󥋬$$tvu $0 tut$ $ 󥋴$tvu $ 󥋬$$tvtu $ tuHt |$h |$h 󥋔$$E@mHt ։t |$$$$Xt t |$0$X$t t |$P$$0t t |$d$0$t t |$`$$t t |$\$$t t $t$ht t ʼnl$Tl$h$HPЉT$ rȉL$t$|$XgD$D$L$$$\$`l$(D$@D$ D$ D$HT$8B$L$D$4Qx$h,1T$L$,؋ $LIfDL$9$D@4dL$$LD t;hPu$h,$D@D T$v$D@L$fH|$p1j $LII HLIA 9t$ u‹T$$D@ʍ f|$yS4OD0 0L0Rw|9 G, $@fD0f|0$vxt$(_x‹O,$L$@t$)֍ L~;|$ _L$ǃx <ǃ| ^ǃ vǃ #ǃL :ǃ` 'ǃd #ǃh #ǃl #ǃ -ǃ -ǃ _ǃ |ǃ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ f2Ot^t8tjtfx ؋tvQjPW+ 1 QTpQTtQTxT|=u^_[]ÐVYI1 T$tpqttqtxqt|1=u^ÐUSWVP[ÊI l$j+1GG(ujj_QP u*Pjj3bQPej> j< j^ jv j#|P j:l j'\ j#L j#< j#,8 j-x j- ( j_ j| jo jpP jr jy jz j{ j||0 j}lX ǃ !ǃt +ǃ !ǃx ,ǃ !ǃ| -ǃ !ǃ .ǃP %ǃ 0ǃ %ǃH `ǃ %ǃL aǃ ǃ` fǃ ǃd gǃ %ǃh hǃ8 &ǃl iǃ` %ǃp jǃ %ǃt kǃ %ǃx lǃ %ǃ| mǃ <%ǃ nǃx %ǃ qǃ( #ǃ oǃ #ǃ sǃ %ǃ tǃ $%ǃ uǃ@ 4%ǃ vǃh ,%ǃ wǃ %ǃ xǃ ǃ ~ǃP #ǃ pǃ #ǃ rǃ d"ǃ yǃ e"ǃ zǃ ǃ {ǃ0 `"ǃ |ǃX ǃ }2NthtBt'zx ϋtuQjPVp 꽀$ ׉K4$ z(p( 4$LPPuȃ^_[]USWVX;D l$+4+ع x( PPu^_[]fffffffXCL$fǀ ǁ4ǁ4ǁ4ǁ4ǁ 4ÐS[ÎCt$0[ÐUSWV@[XC|$TED$G8$u!O9OuO9Ou 9u_uWEt Wա|$XE3t:\10KEǀ3A@^_[]Ë3tUQ33DL$X9tÉD$ D$D$ l$jjv@PUWUV'뒋D$89L$u+0O8G<ut7u!/#tG1҃uV‰jSP0|$W$|$T3D/1j ‰PD$<x-.D$8|$AG $tJt PwW' W~"G @t;{ 8u1E3t%\10EEǀ3g -D$X$D$ D$D$ t$jjw@PVUVW%|$u_*E2$t L$Xu$ L$Xt$AsiSV[?0t$t$V tt$Vj^[ÐSV[í?t$ t$t$V tt$V^[ÐUSWVL$[d?|$0D$(T$ 2D$ED$4D$D$ f tW-t$= t)Q4ֈ4 44PƒЃ44]|$ y444Hȃ4f9ufǃ ff:f)|$ t)Q)R,Vt$VF 3@f%|$t(D$@ u}4ֈ444Hȃ4 ftdL$LqfxRɋT$ f9yt20%L$fA 4;4fǃ D$4Pjjj 4449)4L$ 4QWPt$4;4}2Dž4t(D$4PVt$ t$h 1|$0f 4)Ɖ4fǃ ff9t |$ u |$ t)Q)RK* t$VUF @f|$tG&D$@ 4444H44L$ 4QjPt$e4Hȃ4`%L$fA 4;4AL.tt#4ȃ)4 4> 44L$ 4H 441;4f f1jD$` `4rփփ19‰4 4f fAL$A %L$fA Ѓ^_[]Ãtwu4)ȉ4 44L$ 4H1;4 44 44L$ 4Hȃ 441;4f f1Pjj!QI jS[.8t$j[ffS[80t$ [ÐUSWV$[7|$u'2t PjP2GHtȍL$ QPVU|$<2ȉL$uCT$ GHtȍzRPQU|$<2uHQ(W$IO 3@@D2@ǀ2@@l2@@h2@ǀ2@ǀ2@ǀ<2@HHpG$2@@( PtjjP ,GTPְtjjPՕ GX!2@@xGX GXO <W$\ OT `2pt13~0t*~pt$u Htu$Luu tt12LJp2TL$L$D$l$ tL$qcLJp2|$L4t$V PD$$<$$u$Ps HuǐuU P襢D$$鐐<$$u$}P Huǐul$Ut$V V谲U觲$|$0D$H$\ H HT HX` Hl` 2t p2 t2 x2 |2 2oG[ÐX/ tT$QX`1øSWV[l/1t$t&D~fx닎f8upσ>~"14;>|έVŭ^_[ÐUSWV[.fǃ hu$ DHDHDHDH uǀ2ǃ ǃ ǃ 1IT<,$8j T<TV$2@44tV} =wlj<$hVt$ VM VT 1rNj2Z1퐐T,jj L,LNp9u^_[]ÍPsjS[-0[ÐUSWV [,|$ EG8$u%O9OuO9Ou9$uxWO/t Wb`8tUEHAIL$WW9uOO 9L$u-O OQRt$ P8GGMIAG GAE3t4\10|xEǀ3 ^_[]Ë3t*Q33t8tVWn‹D$89L$uG8W<ut#u%'t^1Ƀuk1g R G4$薣=u8 $A @11 $<xD$8 $tQWdL$|$u $E t΃2t2u΅rhƋ $a qU 8uE3 $tԋ\10vL$Eǀ3뤐SV[)0t$t$V t V^[ÐSV[Í)t$ t$t$V t Vr^[ÐSWVP[K)$t&T$t$2PWj $^_[ÐUSWVP[(1$D$ trDofx닏ft9fuӋHD$t$4$t$ Pt$ 묐9Pu|$wL$Hj^_[]ÐUSWV[+(T$9D$P 1rƋ2~F1퐐D$(jj]L$ )LOx9ul$T5t$jT5TW 21^_[]ÐUSWVP$[E'1tSDofx닏4ft)fuӋN$F8uPz뵐$9FuF뢃^_[]ÐUSWV[ø&D$0>ƈ2L$ȉT$ D$D$ D$t$%fG 9  f$t|$u!|$t'QL$ )RW|ŃuRG @tG 8u=D$3t.\10IrD$ǀ3G @|$tmG  f Hȃ  fftVWq=Vt Hȃ 9 Hȃ f9ufǃ f АT$ftiLjfx_ɋ4f>t%fG t~t- 19 f D$DhhA Qʃʃ19 f ^_[]ýG @tB 8u8t$3t)\10oǀ3g 룸Pjj Q jSWV["|$WgƃuOG @tDm 8u:3t)\102oǀ3^_[ÐUSWV[{"tt$339}3AP3ut' 333343;33PQRP聎 33t331^_[]ÐUSWV[ë!tt$339}3AP3襚t' 333343;33PQRP豍 33t331^_[]ÐSP[ $tT$ 2Pjj $[ÐX  tT$QT1øUSWV[V TAx43fTFT$PHj B+f@H $f@@ Hf@@Ńf@@T$$DLl fTFD$4ftXuhh谍to DHDHDHDH uǀD$ FF^_[]øBPjj,"PjjQ踴 j>`Pj(ffffS[Î0[ÐUSWV[h|$$KG,OWhG 4l$ lx,$ l,$4,N ɉT$t,l$iQȜuF GT$l$L$ ,<$ :9}P)9s7 TVT V TV|~9r9|$$w6GDFfFGHFVw|诱t1fF9vʋGPt$wW"W1^_[]ÐSV[0t$t$V t VN^[ÐSV[ít$ t$t$V t V^[ffSWV([i0Wt$<2WV0^_[ÐSWV([)t$8Wt$@2WVd0^_[ÐSWV([0t$ 01[ÐS[ 13t)PtЁ3QP [ÐS[þ 13t+PtЁ3QjP [ÐXo 3u1Ês3ÐX? 3u1Êu3ÐX 3tD$s31ÐX 3t L$u31ÐX L$31fffffffSWV [i D$ D$D$$ t$VWj9 XD$D$D$ $jWj8 jj3:jVj8,^_[ÐUSWV[13PtЁ3QP蜮 , u0 j3 ƃ, L ~:Pjj $;4 u4 jPj 1L }t&jSEHjjQppG@|t0QjP Et"@:t@0Qj8g @0UjK @UjX5 p踢 jjjp赩ǀ3Qt43PjQ賡 ^_[]ÐUSWV[3, uPj 0 ƃ, L uRlD$D$D$ D$D$D$4 L$PQj ǃL @HtȍL$Qhht@P tBL$t9D$t0\9 t ǁ39tǀ3\(8$9hu9xt WUPgK 9hu9xt WUPJK Qt43PQ It3PjWܟ t6@$0d^_[]ÐS[, uPj 0 ƃ, [ÐS[þ, u0 jm ƃ, [ÐSV[Ê@HtȉQhht@PC t!$tL$t\4 Hwtǀ3^[t$ЃS[L uOl$D$D$D$ D$D$4 PQj5 ǃL [ÐS[{L ~:Pjj $;4 u4 jPj 1L [ÐS[3t[ËPtЁ3QP [S[Qt3PjQ8 [ÐS[~Qt43PQj [ÐS[>^[ffffffSV[|$ ta@|$t|u7x1t-0QjP 3p 1^[þfffffffUSWV[ËT$2tt6usRRt1u8]RuARt'20PjR pM ^_[]ÐSV[2tt6uq IIt1҅u8[ Iu? It%20PjQ% p訛 ^[fUSWVP[:t$tF8 t V_F8@u^_[]ÐvtF$~N,19$t؋~^(,ME9~߃E 98}։8ҐUSWVPD$@tGH $~P,194$t؋xX(,MM9~߃M 99}։9҃^_[]ÐD$tL$9H}1Ë@,$ðÐUSWV|$tfT$x[L$q)~P|$xH9|~<֋D$@,9}*L$yY(,MM9~߃M 99}Ӊ91^_[]ÐUSWVPL$T$q)|$ 9|։4$ ';$}o|$$u.yY(A,,ME9~u 9}ˉǐY(A,t3tt$ t$ P? [ø[ÐS[t3tt$Pc[ø[ÐS[þt3tt$ t$ P [ø[ÐS[~t3tt$P[ø[ÐS[>t&3tL$ t$Qt$P&[ø[ÐSV[0t\Ɔ43t)2Fpt9PVlPV(3tP3oV^[ÐS[nt3tL$jQP [ø[ÐX/1t T$~93|4 RDÐS[t3t PWV[ø[ÐS[îD$t3t PV[ø[ÐS[nt3tPUtJ^[ø[ÐUSWV[+0Ɔ43t)2FttrPVPV,a3tR3~>11;3}:tt3PpT^_[]ÐS[nT$t$t$ [ÐUSWV[893|$0t$,T$ $u*XMDH@utl$4D$ Ug 鐐t$ D$PL$ QD$ Px)t$4tL$9D$)<9u AT$)RUat( $4T$4R7D$0D71^_[]ÐS[t3t P[ø[ÐUSWV[ø8D$ $4VjPjtSʼnt$UaƅtMD$ $t$UD$PVƅtT$t$$V Vq^_[]ÐUSWV[|$3t P 3~/11퐐440q0;3|4wq3ǃwwLJ3j0jrj4tW2Ht<@xX3~3P<72@HX3@$4Ƈ31^_[]ÐUSWV[t$3t P3~/11퐐448sp0;3|4Wp^_[]ÐUSWVXXt$01ۀ3 3D$l$4 434|$ud@,QP\ ω։I)1Lʃ||$t$0~P1\$W39|~{11 ;3}\$Ãt߉ۻ؃^_[]Å~t$)Ճl$Wt$ t$1|$s 1~1뱍^|$11 $9l$tOx,L$9t<$p\U9t4$U9t<$U9ڋ $tΉ룋t$1ۃ|$ ,109T$ 8t$9tωސUSWV([4D$L$ 4T$ RD$L$<1҅?D$ 4D$D$Wa 1Ґ$t$V|$(WD$0Pt$$,ŋD$;l$w$)D$ <8<8l$u 1ŋ$t$L$$Dtt|$΃R|$)L$)/9L$΃t'Wj V讳 $4D$)Džu |$ $tR1VT$ 蚊 4$)tWj Ve T$L$ (^_[]ÐUSWV`[X14t `΋43t42NzRЃPWVPVHhk3s39u)E8 u# RL$4 $L$L, $;M}, Rt,<WY PWVjU t^_[]Ã<$7L$ȃ,D$11$D(PD$DPy;4$|D$ <$D/܉D$D$3jjp@D$PD$(PRD$D/D$P誀D$T$3;4}D$PRjQD$PRjQhNj$D(P^D$$L$ ;47&ffffUSWV[[|$$D$hjjU t)ƃ|$t:L$tVD$ tNt*T$@19tL$  11fVUl$ U D^_[]USWV[ë|$$2t$Ƌl$r:D$0.D$4 uX9uE$E EEEEE EEEuDE$E EEEEE EED$%E@9tL$ ft M}Wt$Uc 1^_[]ÐWVYMD$T$ t$w4  p@^_fffSWV[t$VO~~tyы9uv0gv,g9p9p 9pt Pݡ@gV7g1^_[v4&g9t8P89uNX2X90tKǐG?90u.@9p U@ 9pN@B1ҋxt29PfffffVXt-L$ D$t #r@01tR@f^ø^ÐVT$t-L$D$ t #r@01tR@f^ø^ÐS[|$ uT${[ø[ÐS[|$uT$ L$O[ø[ÐS[Þ|$ uT$[ø[ÐS[n|$uT$ L$[ø[ÐSWV[<|$u<t$D$9% ƉM1^_[øSWV[|$u8t$D$|$% Ɖ81^_[øVX~|$ u@1t0QX2#Q@Q@v~8tt$ Q@^ø^ÐV|$ujt$ [ÐUSWV[|$tyG8 tsl$ 1tiWD$W$jwPW{ UW4$t$W{ 98uj y48uG^_[]ÐS[nt$02[ÐVX>tT$xt$ 9q~ 9~QPqT1^ÐVL$tT$ xt$9q~ 9~QPqT1^ÐVXtL$ T$pP2@T1^ø^ÐVD$tL$T$ pP2@T1^ø^ÐX_Ht t1ÐX/Ht t1ÐS[t$0[ÐUSWVZ|$(QL$,C@D$8t98t #GHD$ɉT$}_;_P| wT9w)9|ʃ$)9݉t$ }h$؉щT$9\$t$ 9GPjVWF;wxًo;oP| GT9#G9G\$Prq` _9ZG,T" !uW,LЋO\$t$ l$U9ʼnT$5~11$G,ODT$x7 7L$L7L7fL7\$Pu|qWHfD7$M9ȉ|G\$t$ l)ڃ9unD$)9|ȋL$‰D$ )ȉ $9}WD$ 4\$!WRqpk_ ;,$}%W, 2 !uȉ O,Ӄ|$ G\$$щ$;T$}i~11G,OD$@( (L$L(L(fL(fD(Rw|4VtG9|델Kwl$9\$}!GPjVWp9uGt PW 1^_[]fUSWVL$09AD$)‰T$ 9S~CD$A,$K(\${,1T$t_D$D$ȋL$ $4L$,1\ [ˋZTJTJ9t$uΉD$L$0\$YD$+D$$PP/^_[]fffL$t QtA+BÐL$t QtA +B ÐD$t@øÐD$t@øÐD$t@øÐD$t@ øÐD$t@øÐD$t@øfffffffS[>0[ÐUSWV[|$$98t#GHD$D$GDD$ oW,4u,$W/19E|$$GGt1҉$G9}^N4T$9tߐOn9~ OFŋw 11Ҹ9)͉…ҋ\$G sK 9~ ȃG s o$($9)\$U?t$9%FLVZ®L$1~t$ ~9J$u9r ^ÐUSWV[kD$ǁ31~Kl$~C9A$u9i t9UP;Ƌj0uU77N1^_[]ÐUSWVP[t$1҅L$$9p$u 9H uQ i*9|1ҋA u)i$4(|$9|1u)ŋt$Ux dQ i*9|1ҋA u)i$4(|$9|1u)ŋt$U!jD$0H)ŋQ q9|1ҋA u)i$4(|$9|1|$u)Utg$x$p \912u-t@:uP $PT1҃ډЃ^_[]ffffffUSWVL$tkytdT$q;wVt$Y,3;oGI:Qxqt~7W w,1;A}"<_9~ Y9}ډ1^_[]ÐUSWV [Èt$ L$$V~X, ;o$l$(N;o yL$L$$+n|$(+~ |$~<$t_<$9OOՋ$;jET$(<$9W 9l$l$<$;o)NV VL Vt$ jV41 ^_[]ÉND$(F V D$>9tΐoG W t$$?9uffffffD$tH8T$ ʉP81øffffffSV[-T$L$ Aq D$t$jVPt$ ^[ÐUSWVX$1tXՉ΋L$ +T$ VVυ +|$$~~ ^;\$ %N ;L$$D$ ^9 D$$N9~ 1^_[]Ë$t$(jt$,t$,WÅtˋFDCDFHCHk D$C$sCk0xƒrVǃ߉鐐AA8ATApǁǁǁut<ҍ<1Ґ9uK +N K(~k1t$C,,C+FV, HMPUE ދ$vQCE;~} K(t$몉SV[ T$L$ Aq D$t$jVPt$ ^[ÐUSWV[ˬl$1t>19)Rju uuu0tPU^_[]ÐUSWV$[ht$D1Sl$HGL$M8T$ rU(l$m9.l$t$ v 9}M8T$Hl$Lt$x4$t$pt$t$)L$pىL$L$x $ $L$@L$N )t$D$9֋$~L$ I )L$+i(T$)ϋ@9~ $)ȉŋt$ʼnD$T9ЋL$nD$0$8t$nD$D$0L$L$9T$T`}(49} 9$9Ӌt$|E($9}9&L$,1ۉȉL$,9L$P~)D$8T$(D$4@҉щT$(9P1ۉ؃\^_[]ËM l$9xA:uA$~A,D$1fŃ9$~ŋT$t|$_,q+w4tƋ|$w,A+G"뮐USWV Yؘ|$4t}\$\$0$Pjt$,IT\$ D$L$ H HD$4;Hϋ@,L$4p F| fFV }![|  fN 49D$4;H|%T$t$ t$ǃD$4;h}pD$(p|$OoL$AD$$jG, 9;t$u 9l$ ut'9L$D $jUt$t$V$T$BL$( ABAcOPL$Nfɺf|#udt$T$ ։D$8)jVD$ PRPfL$8#|$T$t$ WyL$΋D$ )jPWVW#t$D$@f|$$ut$It$t$8Qp0QjP-ɋ$Kd0PjQQ f~$~gD$@u]D$(t$Fh2u&@9u%$PD$80%;\$6>v t6>vuD$@tt$ t$tNF$jv=D$@$ $0jP Ktdt0$PjQP D$@|D$<@1fl$<΃9T$$u뎐|$ ;l$,0L$|$$t$HT$0;l$ G;|$8NjL$DT$0D$D$,|$@|$L$D$D$,@l$99l$ l$T$ЋL$D9щȉD$ D$AD9 t$$ $Pq|V\$U BfBD$ALfBt@zAD$Rq|\$|$$uD$D$ KD$D$,T$D$,p; u D$Pz1r)1 $Ph WA\$ ƀw $PQR\$ D$@ L$P D$T$D$$)ЉD$L|$T$ )։t$,)3|$L D$P@D$t$+t$$D$@H0t$ T$pxpu@t*t!|$ ׋T$t$6;VaHTl$Ut$$Q}f 0UjPG jjjt$V(|$@UjppG jjt$jj@t$ Q fUjPAG |$D$,T$Lt$ )T$T$Ll$T$TI,T$DD$Dt$8t$0l$D|$,D$ ,D$H4;l$$;l$ ;l$D$@, D$L~9|;l$Tl$@D$P9AuqwD$ht2$VP\$t6uw $PV\$D$px1ŋG  $h QP \$ ƀ=r{,t$G $h WP F$h Wt$ Py \$ w $PQwE D$PGD$H$Qjl$H&D$@, D$H$QjUP\$L$89͋T$HuD$@,T͋D$0;D$+L$8D$0D$H,t1L$|$ t-L$ :$jjQt$Rl$E@$t$ 4b $0$QjPD\$ D$t$ )jjPjt$0oEHVPbxpuDt.t%|$ ׋T$t$6;Vt$ Lt$l$$UQ b 0VjP7C jjjt$W|$@Vjpp C jjUjj@"D$ PQaVjPB |$EFD$0D$,0jjUt$R1D$@ɉl$8tT$|$9zt4؋$PQa0QjPJB |$jjt$(Vjt$HHL$ QP`ϋl$H $0VjPA |$ |$l$$l$|$$@VjA uL$j|$ |$$L$ T$$F0VjPRA |$0t.L$|$$@Vj$A uL$ $jjt$(t$R$0|$ l$E@$Vj@\$ uUjH@ |$ |$t$$t!t$@UjHz@ u@L$ IQjp0_ UjPJ@ jjjjt$|$$0$UjQ@\$ |$0t$t$$@$Uj?\$ uL$ ɋ|$l$y8VjL? D$ t!l$$@VjL? u@L$ IQjp0 ^ VjPT? jjjjt$0@@p10QjP$? T$$jt$RjQ\$HD$ $jjt$t$R_$0|$ l$E@$VjH>\$ uL$L$ T$9Q|$ 0$UjPQ>\$ |$0t$t$$@$UjL>\$ u PQhrR?: $G= USWV [wD$41\$t$LL$H\$DT$@|$ PQJ t*NjD$9 t#W $~ 1ɋ$0PjW+ ^_[]Ë,D$0L$ \;> MIIlttt$ jQh+ j D$uǃ USWV$T$ [dd D$PBpL$ t$tIT$$` t)ʋL$ ׉)}=)9hgʉt$T$ 9 4t2t$ t$ )t)W D$)1Ѝ /9L$|9l$|Pjt$) ǃ ǃ 11ҋ`D$8 tlj)D$4>$,D$8 $<t$u; } t$Ћl$)$t$@@9 9<$|PjQ0) @x H$L$T$ t$\ՉL$)4/L$T$ 9~L$T$ <$|Pjt$( ǃ D$ ; ;T$ 9<$ to j Pox) @lt|QjP%( F t3 j Piox) j |j m  ǃ 1;  $|l$*ǃ ;  @@ltWjPV' yA t`j t$nx )ȉ }u D$8o@@lU8 LQj `u ;  |"UjP& ; ~U   @@xuă tjWmx) j띍| ; ~- @Uj% yxD$8 )ȃ,$D$ D$4$jP% D$(19 ș)Љփ< 9D$@u t!j t$lx) j t D$@, @D` D$,$.  -; !D$P, t$j<L|$ tv ufL$L!;H@L$uSDuLf~54t t L$ fu-@t!,$UjP#  t0j t$ kx )ȉ j ǃ tD$ D$ $^_[])ȃ|,9t$,$,@tUjP# <,$ t!j t$Sjx) j f ; ~nUjP" ;  @@xu̓ t!jt$ix) j룉PS[~[D$ t# PQix) P1[fffX/[Hy8~DyD~>Hlt htðuu냹tt u1ÐXZ@ xÐUSWV [ØZAP8p|$hD\Alt huu |t$r/ǃ 4$6V\n`fFdҋl$t0PjR MAҾt.0PjRu $p2 !A@MAlthu uW$l2ǀh2IyTt#2IITth2t$!P\~ǀrfǀv|ǀ~fǀ|ǀfǀ|ǀfǀ|ǀfǀ||ǀfǀ|b|ǀfǀ|E|ǀfǀ |(fAA ;|ǀp"ǀt"?~#1ɐDŽp"DŽt";| fp"fr"t"ǃ ǃ 21CdD$L$ /jt$[D$L$ T$R29t9tT$ FHt$ FD$~D$ P@,D$T$1;|$tD$|$~1ɋ@$|$t@$1ɐp!p  p0!0  0(9uD$t4$L!L  Lq1tt  ^_[]ÃttِUSWVP[UL$9 ft$9|$ 9l2uCUw$-4$t$skBw|$ f|$ t"ut"fp"fr"6f;p"u f;r"tЃt"fp"fr"*1^_[]fff놐USWVXT2dT$ D$t$vyt$;\$ tD$9S~ҋ{C,$1St$9}~$t$4n1{9}ËE!9uuF9~F 9}ʉƐ@D$AD$P@,D$Ѓ1$;l$~1ۋt$4vt$u:$tӍ%9uҁ>ȃ^_[]USWVYR|$xv9{`|iT$t$p"fr"f1l2u@>_w-s yBf>2~w-s qBf ^_[]ÐUSWV[ RL$:9O\~~l$t$Ifrftt$ fvR ztC2Rt0D$T$t$ VRPQW 70QjP8 1^_[]ÐSWVZLQL$x?9J\~2D$t$|$ Irftf>vf1^_[S[Pǃǃ9t% DŽp"DŽt" t 1[ÐUSWV[kPT$L$l2uI~w-ssBw!,ff ffffǃ>t* f0p"f0r"DŽ0t" t 1^_[]ÐXOh2ÐUSWVP[ZOt$ t@@1EHd9l2p"fx fr"yVRt6$0PjR{ ( $!A@Ep"f@dfx0ɋ2@Ql30QjP* Er"Zfp"fx fr"yVRt6$0PjR ( $!A@Ep"f@dfx0ɋ2@QC30QjPq Er"]fx*ҋ2@R430QjP2 Efxd#H@ H@^_[]ÐSWV[,Ml2tu6@t!|$0QjP (!G@f@d^_[ÐXLf@dffSWV[ÜLD$ yOQW~ ;O~ t Q WPa4W^_[ÐSWV[,L|$D$OQW~ ;O~ t Q WP3W=^_[ÐSWV[KxWt$W^_[ÐSWV[ÌK|$Wt$TW^_[fffffffUSWVXKKtLT$xDt$xʋL$pyL$lI $T$ L$lt$  u;qTuA8 u t t)$Յ\1[D$$1iT$j xL$`( $ș)l$T$ $L$$$D$wx)ʋ=T$Pxl$tD$  dl$lыUE)Ѓ9~t$^7T$ED$ D$pt$L$T$1Ґ$L$L$t$׋T$$D$1T$$HhD$g1fT$t$j xŋ`0L$ș)L$4$T$ l$lt$mD$$Յ $$vx;l$tl$l)"Px‹FEL$$l$L$ɋl$l T$T$ t$E,L$ Ql$t0t$t$V< tjt$V ^[ÐSV[=t$ t$t$V tjt$V< ^[ÐSV[Í=0t$t$V tt$t$V ^[ÐSV[==t$ t$t$VP tt$t$V ^[ffffffUSWV[<l$t^T$r9n t9tB 1ɀx$u B1Ƀxp|$$t1R(Wt$$t$$UP 1^_[]ÐUSWV L$[d<|$8T$XD$01DFt01ҐЍ GDFu<.u=GLnL$1D$thЃՉ,$D$tGDFu$L$4PL$ +T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ KЙ~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ KЙ~ ƃQWT$H ^_[]ÐSWV[ì9|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(jVjWP1^_[ÐS[.9 " jt$t$t$P1[ÐSV[8 " jVjt$PJ1^[fSWVP[ë8|$t$ t9t QD$PrL$QjPW^L$N|$kK)l$kK) @$;@$i)PUt;y t0q$t~fuUvu1 q ^_[]ÐUSWV[6D$$L$t@1D$D$>D$POL$QjPW\L$kL|$kC)l$kC) $;$i? )PUt7q tAy$t+nuUwiu Ay^_[]USWV[ø5D$(L$1҄t@1D$D$8>D$D$P.L$QjPV[l$-?L|$ ) i)ʼn) i)k${$lj*SiŠ)ǍPD$Pdt1D$H<tzp t:h$D$t}suPu D$uދ} مt3l$,t+Et$WP!uVEЃ^_[]ÐS[.4t$ t$t$ [ÐUSWVH[3t$\lD$P0ND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$UL$QjPUIYL$ȿNt$kK)kK) @$3@$i)PU$D$$ED$j=U(tƉH$$D$<$|$WL$QjPWKXL$Ƚ-?Lt$) i)) i)K$s$Ɖ*SiŠ)ƍPWD$5tcL$f <$|$WL$QjPWWL$ȽkLt$kC)kC) $3$i? )PWBtD$EE!D$DY $$D$WPUPUTPU PUscPU}tIPUitrMPUUteSPUAtX5PU-u^O1<5.' D$UNj$tP 1L$;D$v==wL$L$Qt$7L$uD$ 9D$ tf, UQ,$t'UW|$BUk4+1t$ 1 t]|$uf, FM $QP4$  $LD=uVQ_V $4D$ H^_[]1|$t4$蹬1USWV[-hWT$L$ $L$X1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃGM=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$ 1Pʋ$H $$$H $<<$Rt$Wk /$//$H $>$D$^_[]ÐUSWV]Ř(2~:^^t@\|,$n*^ÍxЃs.ÉD$$XD$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%XTxp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[&1l$E<%uEpuEπ r?Nуstlu~;|$~,|$t#릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[=&L$ T$D$$Pj [ÐUSWVX&$1h ։ͅu4$0 u'$h)0 5 @0t$E4}0u"$hE, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$lσstlu7D$ ~ ~$BDŽ또fЉ9N1ҍ$1$$u>D$$hjP l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,˜E,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $*ȉىӉl$ |$uGD$1l$뀋$XDptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $\,$t"A$|t+H$D+$l1$uՋ$Q1ڃV$-!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,.RE,}0M4T$$V$0PRQ1$E4$/1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V;9r‹E0M4ʃ9‰\$WE,y$H$|T$Xt$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,NrE,u0M4tڍqu4 $p1$P$P$=1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,*tRE,}0M4$V$0Pt$QE4E,M4},$-1^_[]ÐSP[mT$ D$$1Pj= [ÐS[>t$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[T$ D$$1Pj [ffffXL$ÐUSWV[è|$(t$ l$uP!ƅ>l$$uj hj\L$tfjVP NjD$uj(P/D$@ x |$(uVqE\1F49Pk1D$tGuP|$(x |$(tF|$(mV|$(Phht@U t$t$tL$t RB(JtRdPytjjPxw IA(dPPtjjPOw IA1t^_[]Í^Pjz#VSVP[\T$L$D$tRQPVƋ$t P.^[fUSWV[ t$|$t$jt0ʼnVU讕|$T$VŸ9Pt$t~zPt$tk>Pt$t[DPt$tKJPt$t;QPt$uA1 @VK^_[]ÐUSWV T$L$[íǃ4 XP,Ņt'}/u{L$$ t$  bP/P茂PVuU\DžjWWW轓tpL$v u\D$ VP$tIT$ L$$ Pt$ jV`'uW1V='jP$|$ $~:s1퐐Nt:t됐tÍMwUPWٰ D, L$$ t$ [tukP>tGxT$ PQhR~)T$ L$$ t$ $t$ $:uw1퐐Ot:t됐tÍMwUPVٯ D, L$$ t$ [tu$ $ȁ ^_[]Ía4 USWV[xl$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj% \$L$ A ZAthhP+jj!ЉG(hhPw|$ Gt\$h(jPX|$ "\$jhz|$ G9ouG)o\$UD$pv|$ Go\$UVP W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjP ~ gC C$ދ\$PF$ދ\$PЌ~ F$D$\$jWF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|V蝟t.)9uUt$VP t6u0,1(V"9ſuUt$VO ^_[]fffUSWV [( D$48H L$@ 1퐐/t <,tEPDxUWPѦ .,v3l$4uW蛈EED$\$cD$D$|$j|WxtD$4@ T$L$ t*17t<,t\$RT$D$PNwtDl$VWQ֥ Ut$Pĥ K1<$WZNjt$D$Pl$8uŁEW|$WV\ W4D$D$D$ Džt$\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0谀\$<u3D$u'\$Uu\$8C k$K($fC K(K(|$T$ t$4Pe>p1\$91\$-4$蓅K\$PeeD$PdD$4H@hL@D@H@@@Lt$L$ Ȑ8Ht88sL$tnt1fuL$cӃ1$R|$u-;*$\$d ;É$111\$jRQWPVt$(jt$T$t$:\$t$ \$L$ Q> ^_[]USWV[HD$t uy*|$ 1퐐/t <,tQL$赾$PBst2ƃ$UWPϡ 4$t$P軡 Q1^_[]ÐUSWV[Ë|$ t$FN,9vtU6}uCu;Urt.nNT$\$fNNu 1fFF ^_[]ÐUSWVP[|$ l$YPWJuLt}D$x@ȃǃtVot$ U)Lstƃntfuă뿐1ɋT$z HD$8l$|$ u)1|$WuPt$D/W豼prWuPt$D1TL$4xT$$s$tntfuσ1} t WPV进 l$ E|$f>t WPV蝛 }t0EfEfF}WuVq f},t&E(fE,fF}(Wu V/ f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[û|$ t$FN,9vtU6uu]uUUjtHnNT$l$f,Ninf|FFWRP7 ~F 1^_[]ÐSWV[ t$FNy9vtW6.uuCu;W+jt.~NT$|$f<Ny~TF 1^_[ÐUSWV0[Èl$DXEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1bGj|U艢D$tL$j|Ut L$Uh=rvUPt$P 10^_[]ËD$tP2L$ =r"D$t+PL$=r-QUPt$T^jjP;rtt$ $@ 1D5t <,tFPChD$4 VUPȖ D5$(L$tSD$HtJ11t <,tFPg Vt$Pn D5$h|$t+D$Ht"t$f $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p08k$@,t'<$O 1҃ ҃f91wуuP<$O G$1҉L$‹O(Q9T$0RD$p j$D$t$HjjjPjfWjQVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[:|$8 $8 ftGt @1@WG(f< hwUsX =wb,= Ƅ< |)ƋtVPU?X 9vD|ŃƋGtVPUX 9s D|ŃE$^_[]ÐSV[=t$ tavfvevev ev$ev,eVe198 uǃ8 ^[ÐX8 @ÐY8 @u*USWV[u$(E$$4D$$0j:W9{t/jQP t0V$0W  NjE;$^_[]Ã(u 1 tM0ut68ut@x$f$O:t @t@uS4$l$w$D$j@UPU <:t$EF<:uEl$4$D$D$OtuP^(P]Iǃa,RD$O0$$,PQhWJ t" ǃt轭|Oj j,(,q XPX XPuP^tj/Vt|$uF1$jPRQV0'F1T${$jPRWUQVVPjESV[t$ j:Vwt/jQPm tt$V[1^[ÐVYT$փ1u t^1(^USWVH[Ht$dl$`L$\D$Dȃ= u(<$y"L$VPj@QT$tLT 9 $ƅtID$\WU(R ~*)NjD$\u $dVUQ2 ;L$Dt[a1Kt$\(1 "DŽ(DŽ Ī $;D$Du ЃH^_[]LUSWVT[|$pL$ll$hD$P= u( $t$ u(L$WPj@Qt$t$ T$Ijj 'D$Wt$  $t$j 9<$u-;D$PuyL$T^_[]WQU ;L$PtNT( DŽ(DŽ `;D$Pu T^_[] KUSWVD[ØL$`T$dt$X}|$@uM u (t9ƀ.RQt$dPj@W9 tRQt$dV M;L$@uD^_[]iJSWV[|$=uj u (tVw0}tL!(c TDŽ(DŽ W1^_[ÐUSWVP[8D$hT$dML$LL$pL$t$lуuc u (tOz=m8@tW=m 1T$ vPQj@R躾x. VPR脉 bl<$ZD $3F4F0F,F(F$F FFFFF FF,$D$ǐWVD$l(  4()uT$ff׺r$σߺfDfu,$tу$$1ӥE;D$Lu^P^_[]Ët$d(  DŽ(DŽ x,$1,$u!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<:# D$t$DRL$D# A @`? Z19<$# D$D@ @`ƒ?Z91# D$D@ @`Ń?+Z9# D$D@ D$@|$`D$?Z;|$  ՋL$#  <$‹D$Dp# D$L$ D1 <@4$T$<`Ń?|$_u+Z19QL$ T$D $L @`ʃ?|$_uZ19 l$ D$L(D$<_D$$D @`Ń?+Z19 ՋL$ T$D |$_$D @`ƒ?Z9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0t;8;D$(Q,^_[]É<$t$D$# VRPQT$T$L$ t$ ?3Z|$D/? ZD/ ?ZD/D$Z/T$T$L$ t$ ?3ZD/? ZD/ ?ZD/D$ZD/D$L$ < ZL/ ?ZL/ ZD/D/ # <$<$";USWV[Õ$D$$<  ǃ$ ǃ$ ǃ$ ǃ$ ǃ $ ǃ$ ǃ$ ǃ$ ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# @# f3f4t2tkƷ< sԃ1@tt# tlj瀍 ;@ 1ttD~tDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ$ ǃ$ ǃ$ ǃ $ ǃ$ ǃ$ ǃ$ ǃ$ f|$| t!qtAD>1tBD>׹@# fD,|t.tkŷ< s݃1@tt# tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ$ ǃ$ ǃ$ ǃ$ ǃ $ ǃ$ ǃ$ ǃ$ ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# ǃ# f|$| t!qtAD>1tBD>׸@# fD|$t=2t$Fi%I<<fw1@tt# tlj瀍 ; 1ttD~t# eg  fABg w~4ABg w~4ABg w~4ABg w~4ABg w~4Ag wʼn41 @tt# tlj瀍 ; 1ttD~tg$Qg$A# g$B# $u1 @tt# tlj瀍 ; 1ttD~t⍃cg# 0p;QP;QP;Q;u# D$p# D$l# D$h# D$d# D$`# D$\# D$X# D$T# D$P# D$L# D$H# D$D# D$@# D$<# D$8# D$4# D$0# D$,# D$(# D$$# D$ # D$# D$# D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فgр3ʉрUɀʈǃ<$ ǃ8$ ǃ4$ ǃ0$ ǃ,$ ǃ($ ǃ$$ ǃ $ ΀ $ D$ $ D$x $ D$t $ D$p$ D$l$  ʋD$h$ ыD$d$ D$`$ D$\$  D$X$ D$T$ D$P$ D$L$  D$H$ D$D$ D$@$ ʋD$<$ D$8$ D$4$  D$0$ D$,$ D$($ ΋D$$$ D$ $ D$$  ω D$$ ɋD$$ ? ? ։? T$ځ $T$ 1$ u$ E$ Qu$ ƃu %?? lj%?  $T$ @D$Xƃ< $ ΃@ D  J΃ @ D  J΃ @ D  J΃ @ D  J΃ @ D  J΃ @ D  J΃ @ D  J΃ @ D  @ D GO 4$l$T$ L$ Ń4 x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[])USWV(]HD$<X%UUUUʁUUUՍ4P᪪  x @ D x   x @ D x   x @ D x   UUUU @ D $؃  x @ D x   x @ D x   x @ D x   T$H @ l$ D ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y $$@ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x @ D x   $x @ D x   $x @ D x = = $x @ D x   ȃx @ D x   x @! D! x ! ! x @" D" x 5" 5" x @# D# D$@P1(^_[]ÐS[ÛD$1ɐȊt tT Tt t t4 uP1[ÐSV[D$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[MD$$D$DD$@D$9\$6D$L$T$@jjPQjRLqD$HPj "ZT$T$t$D$HL$L9Љ‰ρ |$ulj΋\$jh@BVWD$T$|$1ҿ9ǿϿrs` 9ǿ@\$r_1ҿ +9ǿϿ \$rD~9ǿ\$r01?+5;L$r?x};L$rE 0]$jP6$jP$D$0PjEm\$|$ juh$PhD$lPj$Pj$PjWV)4D$ Pjlt$\$0t$4L$ D$$11 uڋ|$8\$(9~b9ى|dڋ\$(|$8)19)уٹt$|1\$|$ +,\$&t$\$|$ t$|$ \$E 0E8ED$;$u 1e^_[]wUSWVd[$|D$<$`@$ hjD$@P DŽ$@D$V $@8$u H$@D$ $@UV蜙ljD$P mt;uHJWPnRWPnuD$AWP}nD$UV)ljD$A$jPWm D$,u:|$$@PW#x$@L$,UVϘD$l$0V t$\$UV诘D$ D$D$ D$$$@&D$ \$UV`tt=pthmN\$WPA#x$@D$ 벐\$WP#x$@D$$냐\$WP"W$@D$LD$ D$D$ D$$\$t$0$DW肗D$t$$L$(11ɉ֐t$4L$yӽZ)!!덹׻z)Ӎ!!ֻ9)ӍQ!! ΁?փ>́?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$Vq.1$xU6i$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-PQR_h$DUt$@VK j jW= hjU- hj$P D$@hjP D$<;$`u`d^_[]D$RW返D$tT$@PQhR]l$ $fffffSV[-D$ h`rƉP觽)Ɖ^[ÐUSWV[l$0jD$PUh thUh`) $)D$j PUv $l$1}$K1D=t<$t h`tt$, gōT& 4$t$L$QWPjbV$@& L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃t$ Wt$t$Pjbt$(V趍T& @& A&  B& jQPR ;X& C& D&  E& jQP ;\& F& G&  H& jQP ;`& I& J&  K& jQP ;d& L& M&  N& jQP ;h& O& P&  Q& jQPS ;l& R& S&  @& jQP  Ƅ;p& jjt$ ^_[]fffffUSWVD[|$\w t2t$`tD$@jPVđ NjD$@9t8tmtD^_[]Ut8"u tr臲D$yD$ kD$D$[D$<D$8wD$X$2a$WQjP90  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ jjjjt$8t$8t$8t$8t$8t$8t$8t$8t$84[ÐUSWVT[l$hUAƉD$ D$PljD$VD$ thtdD$pL$lL$D$|$ t$tUWK. ƅu>|$tl$ t$D$ tKWV(tD(1t$t$ UT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[(t$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[Njt$t$t$@[ÐS[jt$t$t$[ÐS[jt$t$t$[ÐS[þjt$ [ÐS[Þjt$ h[ÐS[~jt$ H[ÐUSWV[Xt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[xt$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[Øt$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXL$Q##wÍ-$ÐUSWV [È|$(l$$t$ D$4!;D$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[D$ hPt$F [ÐS[þht$t$ [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[-D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[HTD$pML$LjPt$lv D$h|$df$D$V L$)L$D$PVWD$ |$$v=D$Ot$.D$lp8L$ QjjV V1 |$)cƃPD$2PL$QH ? $ $$m=|$D$lp,t$ jjt$>V^ V |$)Ƌ $PD$2PL$Q  $ $,t=D$D$lp(t$ jjt$>V VV |$)Ƌ $PD$2PL$Ql rg $ $,p=D$D$lp0t$ jjt$>V V |$)v#Ƌ $PD$2PL$Q sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7誹L$R)уtuÐWVt$  r!̐cw^_fffffSWV[ìMt$|$G@hjPT zj@PWb g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[ÅK$$N$@r8hUtE\EXETEP$t$tAsE@hjP Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjV' h$$VQhVU< hV1;$u Ą^_[]lUSWV [Il$(16t$ %T$$NP NT  ()`N`L$$WRPc ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP 1 ^_[]ÐUSWV_nH$hRPN RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$0{L$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W hj$P| g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQ $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV D$hWD$$hPD$;$xu D$e^_[]̣ffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[Ø6|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[4D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*|E E(}$uM$뉾1^_[]ÐUSWV[3D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*|E E(}$uM$댾1^_[]ÐWVL$ tgy tay$t[qtT9uPNwCL$t9x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]Ř2$D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$T%4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$/%$FQ? T$‰ً$|$D$G<uD$ ${$ $u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4(L$ |$ )t$)t$$t$,)wD$ L$?? n$ T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E~BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍$FL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00nsL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N p%FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00!q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00"pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q賾 l$El$ $t)G t#ωVt$D$00so|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj $&t$ً$|$tv|$ulT$ (uG(jjj'l |$(fD$hL$hjQP lL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B P$Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?p~ፅ~GPGX GTG\GG?$L$u aD?$FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  %FL$Q? %FL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$%$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't%D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$%~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=%$FL$Q?P$g$$NL$Q?D$T$ ߋ t$%$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPW]RQP d L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $xUSWV[V iE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP )t]D$)WPu8ϩ }43M(U,E4E09w)RVP螩 E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[L t$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[ L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU| F4n0)Pv8Ug 1tN0^_[]ÐUSWV[K t$~ ~$n9uMwr|$} t >?t ^>?u(jjj_ t$WPt_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[( L$(D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8R¢T$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVX5D$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@VD$?? u)D$(%L$(%É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$UX$FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+ȌT$D$tq01t ^_Átփ*tUSWV _(L$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$Vo?L$1)t,)9멁f*] ^_[]ÐUSWV[l$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPH )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[|$$ $w9>~NQǃ8wHtl$([ tWt?t u(t#IO+t*tF(n(~taV;NG9wͅt2Uvw | o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj53 G0FqoU9,$Eo9wŅt0UD$pw I{ o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoU6,$Eo9wŅt0UD$pw ex o $ho)o)hu $AA~+ Nl$("XFx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQw F NFy,t)vNPQw0( G0$F oU5l$Eo9wŅt2UD$pw pw o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQwL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0{' G0oU4,$Eo9wŅt0UD$pw Vv o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0b& G0oUs3,$Eo9wŅt0UD$pw =u o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oU2,$Eo9wŅt0UD$pw dt o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU2,$Eo9wŅt0UD$pw s o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQVe2 $FlF\iU0l$E$ыj9wŅUD$pq Nr $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQVO0 $FlF\iUx.l$E$ыj9wŅ(UD$pq 8p $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD ff F`)FtFl;FlF`l$(sUVuFuaVk-~l$(džCN\^F8VjjjV+u~^_[]ÐUSWV$X$l$8l$8Ex~}tw,$Et=w |$<VrJUHMXElM8u@L1#MTMH}DO]4!f^fOt)ЋM,9E`Ml+Mp~ 2~,2~2$f=r $f u`Et)Et;\$|$FE`EXD$ E4D$ E8D$ETD$EDD$ulU@T$UHL$ ul\$\31#\$]HL$Yl$ !|$fol$8f4YE`ڃrulD$9D$ ululE`E80UHMXD01#ETEH9$E`6E8MlrrrfEtul;ul/M\xE81)΋$jVPUouElE\~WGn9wŅ$Uwv d^ n on)n)oGGElr|$<uU\x"M8U\x}M8x1)Ћ$jPQUuElE\~WGn9wŅt)$Uwv ] n on)n)ouGGD$8xw1)Ћ$jPQUEuElE\~WpGn9wŅt)$Uwv >] n on)n)ouGGD$8xt1$^_[]ÐUSWVX$l$(l$(ElEtEx}tw0$4Et=w |$,3EHMXMlU8}@\1#]T]HEDXt$(n4!fol$(f XM`EpMxEdE`t`;|Ml)ы},9wi$_E`wWu0E`@M`EpMxEdE`s/uMl+MpsMxt9l}dult$EtD$׋D$(UD$(>+D$(D$(Et$(4+l$(Z T$ $f:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQUmAlA\uV7F}9wDžt)$Wvu Y } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uVF}9wDž$Wvu X } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUsmAlA\uVF}9wDžt)$Wvu jW } ~})})~uFFD$(xy1)Ћ$jPQUmAlA\uV$F}9wDžt)$Wvu V } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]XԓÐUSWV^XL$4t;T$8\$0Ӄs3I͉у1&Ӊi913ԓƒT$4zR13ԓƒT$4zR13ԓƒl$4M1ʉ3ԓxT$  1ϋL$ 3ԓÃ1ؐ\=13ԓ\=13ԓ9uЉЉ̉D$ ,׃}l$D$D$D$11|$ $3ԛ3ԗ3.ԟ3ԣ $3Qԛ3ԗ3ԟ3ԣ $3Aԛ3ԗ3ԟ3ԣD$ $3A ԛ3ԗ3ԟ3ԣ|$D$ $3Aԛ3ԗ3ԟЉ3ԣ|$|$ $L$l$11D$D$33ԓ3ԓ3ԓ3ԓ3W13ԓ3ԓ3ԓ3ԓ3G13ԓ3ԓ3ԓȋT$3ԓ3W 1‰3ԓ3ԓ3ԓ\$3ԓ3_1ˋT$ )3ԓ3ԓ3ԓÉ3ԓϐÉ13ԓW13ԓW13ԓW13ԓW13ԓW13ԓW1Љ3ԓO13ԓRЃ^_[]ÐS[t$t$t$ [ÐUSWVXر$D$$tz \$׃vND$t$ԧ1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX$D$$tz \$׃vND$t$ԧ1Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPX$T$tfǃvEt $ԧ1ف 1υt1Mu밸^_[]ÐUSWVPX$T$tfǃvEt $ԧ1ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Nt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXÐUÐXoT$J r ,ù)ы,ÐS[.D$D$ Pr[ÐS[t$ '[ffXߨL$ T $ h, | 0 |8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_KT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P BL$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVX(D$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$ԯTPP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YbL$ 1 fщ;)t)T$l$L$ 1T\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +L)9~P fHpnh1pXkh (f  fыt$r t$t$ T|$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ + )9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVX\$T$L$o>o4>o>t>Tfr T f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[t$xƅt|$7V@G P ^_[ÐSV[͆t$ )tt$Pf@F14P )P^[ÐUSWV[xt$ԯtLƋ|$$l$ $P @D$PWU&2 1uO(Vu O(^_[]ÐUSWV[|$GtE/D(U8]wUt#V譡=yarau D$0VS+O1^_[]ÐUSWV[k|$GtE/D(U\wU t#V-=tcidu D$0VӞN1^_[]ÐUSWV[L$A1t3)D(U6\NjD$pUt D$8BN0^_[]ÐUSWV[Ël$M1tMuD1V[uV't(WJ=yarauD$8M W1^_[]ÐUSWV[l$M1tMuD1Ve[uVt(Wڟ=tciduD$8eM W{1^_[]ÐSWV[éPt$ t$ ~/ t6D$t7<$D8WZt$W1tD$ 01LL^_[SWV[)Pt$ t$ . tFD$tP<$D8W`Zt$Wt,VԞ=yarauD$ 01"[LVqIL^_[ÐSWV[ÉPt$ t$ ^. tFD$tP<$D8WYt$Wt,V4=tciduD$ 01"KVћK^_[ÐS[L$T$ jt$t$ [ÐUSWV[öQƋl$$PK;D$PUWg- tgVJD$tz<$D8WXt$WtH|$$t@V,9t7Vߚ6J 4J8Vu 댅t D$ 01J^_[]ÐS[þL$T$ htcidt$t$ [ffSV[Ít$t$u_Pj=tciduL$1=tcid^[ÐUSWV[;t$t$#_P=loobul$VEloob^_[]ÐSVP[D$Pt&Pt$t$` D$VbD$1^[ÐSVP[Ìt$t$Vt$t$` D$VD$1^[ÐSV[=t$t$t$!^VP8^[ÐSV[ t$t$t$]VP9^[ÐSV[~t$t$t$]VPg9^[ÐSV[í~t$t$t$]VP9^[ÐSV[}~t$t$t$a]VP':^[ÐSV[M~t$t$t$1]VP7:^[ÐSV[~t$t$t$]VP:^[ÐSV[}t$t$t$\VP:^[ÐSV[ý}t$t$t$\VPW;^[ÐSV[Í}t$t$t$q\VP;^[ÐSV[]}t$t$t$A\VP;^[ÐSV[-}t$t$t$\VP<^[ÐSV[|t$t$t$[VPw<^[ÐSV[|t$t$t$[VP<^[ÐSV[Ý|t$t$t$[VP<^[ÐSV[m|t$t$t$Q[VP<^[ÐSV[=|t$t$t$![VP=^[ÐSV[ |t$t$t$ZVPg=^[ÐSV[{t$t$t$ZVP=^[ÐSV[í{t$t$t$ZVP=^[ÐSVP[|{D$QP0t&Pt$t$\ D$VD$1^[ÐSVP[{D$QPp0t&Pt$t$)\ D$V蜔D$1^[ÐSVP[üzD$QP0t&Pt$t$[ D$V=D$1^[ÐSVP[\zD$QP/t&Pt$t$j[ D$VݓD$1^[ÐSVP[yt$t$T/t&Pt$t$ [ D$V耓D$1^[ÐSVP[ÜyD$QP.t&Pt$t$Z D$VD$1^[ÐSVP[^_[]ÐVYnQT$1t 92t^ËBu*^ÐUSWV [(Q|$ 19t$$9Gt{o F D$D$P,t[$W*ȅtЋT$ՋVtэQPRt$t$V1Owo tQT1 ^_[]ÐUSWVP[ZPl$9EuwD$tyEti} P $PltFUu*t$RQt$ P0M}u tQ1^_[]Í8''i&PQh;RS[ÎOD$t9u L$ t9t1[QPjk[ÐS[NOL$t 9t1[ËD$ Iu*PQ [ÐS[NL$t 9t1[ËD$ Iu*PQE [ÐSV[íND$ t9u L$t9tf^[Ëp*ЅtItRP אS[NNL$t 9tf[ËD$ Iu*PQ [ÐUSWV [Ml$(|$$}(tD$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$SVPY|>D$t 9t1^[@HPu/1޻D$9λDžx |$t19λrD$f뢐SVY=D$ t 9t1^[@HPu1޻ÅDžx t҅űD$ĐX=T$t9uBJBuy1ËT$JÐS[N=D$t9u L$ t9t1[QP*Y[ÐVY=D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVY<D$t 9t1^ËL$@Ppt 1xx3T$ 1 ^ÐVYn<D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐVY<D$t 9t1^Ët$HP@u 1xx3L$ 1 ^ÐUSWV [;u t1D$D$ D$~N~(DN+t 0tV-usD$WPv$ T$ D$1ɿ98"yxuD$j\D$WPv$ T$ D$D$9T$rFM8"utjPVl tu L$e^_[]ÐS[:' jPq( PQ1[ÐSWVL$T$BYu'uJrRyI9|69*t#rRyI9r 9^_[ÐSWVL$T$BYu&uHrR9I9|59)t"rR9I9r 9^_[ÐSV[8D$0( VPOV跷1^[ÐUSWV [ø8t$4NswD$8t(@tc@uppQj WgjUVEZ tWVWWt UVI[1 ^_[]Íq(X('PQhR+WVL$t$ 9t5~Q19t(VvxyxA111 ^_ÐS[î7lPQq' Pn[ÐS[n7' Pn[fD$w sÐS[7D$ ;D$uPt$t${| [1[ÐUSWV[6D$ t$tP{D$D$l$$~1̀ws 琐<L$y O!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸd$T$J,z1 7>w􋌋L$qD$ tL$9QWPz 78/u%<$D$@(|7>7L$A(>u-t$F$F FFFL77t$ wɋH vHN1 =tP w싔Nx"u/1Ҁ8t(F Ht"tV$x>X1^_[]Í))(PQhRCUSWV ]4D$ \$$p1}<"$N<\u< $1ۃރST̴$΅$ x$ o$ f$ ]D$1҉D$P% L$ʁtҁuI‰D$P L$ʁ{T$ с$cw $w"$?ɀL$ w)$ʀT$?ɀL$M\$$\$?ˀ\$ʀT$?ɀL$Ƌ\$$t;|$($;Gt;D$(eL$ Gt;D$(CL$ Gt;D$(!L$ @1&t#<H1ۀɋHptlmxpx;&axtuux;uo>Lxtu`x;uZ<7xuuKxouExtu?x;u9"xou/xsu)x;u#'L$$;t$(s11ۉ؃ ^_[]ËD$,t8D$0t0ދL$,t1L$0t̉ȍI).)(PQhRUSWV0[/$Du wj011<o<$ou}u $hD$(PX|$,D$D$@@@@ @@<$GHws 琐HOP} w$B4"u+H$Jx"L$l$(BB(L$+$ -l$(xa$l$(8l xsxeJBB(5xr$l$(8uxeJBB(BL$BXl$(D$RD$ PUу L$T$ l$UD$D$jQRUWXt$t$t$UWT$ L$T$ D$D$뻍l$(}Ѐ oD$jD$PD$PD$PUWt8jt$Wt$VUT$ jD$PD$PVUiWu҉p)D$)D$Ews 搐<<}jt$W9 tfjt$W& tS)jPW E $AEtLt@<-Eu<-u}>u$h\t u94$ª10^_[]Ët$t[$NjH<w sO9t1VLED$"} D$,$t$U6D$m$hō)D$jWPJ tȀ}(u‹Et}uvers3sion3P uD$$HtjPU t$(VeTD$4D$ @D$l$$@T$$H9trueD$9dataD$ 9dictD$W$@arra1Py fals1@e ȍT$(q$@D$stri1D$@5ng XA$@D$$inte1L$D$$@eger1 D$L T$D$4$RVP D$D$jD$PD$PUVSt/t$t$t$UVT$ D$D$뿋,$t$t(jWt$1 t t$,$VB,$fjD$PD$PRVjSt1jt$t$l$UVT$ jD$PD$PUV9Su1{롐S[Î(jt$ [ÐUSWV[e($j,$hjV9Y t5ōD$ PU$t $Q|$d:!9sUY1Ĉ^_[]ÍD$T$tjjUjjPjUYtjVU?^ |$t'jjjhjt$P跓|$t-$U~jWU] WU&lTVUlCS[.'jt$ [ÐUSWV1<\1| u&D Àÿffr ÀßfrÀf D$ D $Àÿr&$Àßfr$Àf fl$ft$D ÀÿffrÀßfrÀf wvD$L ˀÿrˀßfrˀf wGD$ |$$\$ D$  ˋD$$f׉^_[]fSV[ý%j@ ƅtCpPV>jP^F,F0F4F8F<^[ÐUSWV[I%t3PjFtjj@yDžuUOj@^1t=pPW8>GjPj]o,w0G4G8G<1^_[]ÐL$WUSWV[Ø$t$1p9nU(]N4 Džtbl$~4<$tC1퐐F,t1t$$ՓU. ^_[]Í--)PQhRS[îPt$ [ÐS[~jt$t$T; [ÐS[NPt$ [ÐUSWV[t$>W0G49O,tktklD$jjjWP=tqG,O4QW4DPZ-D$(Ct(I*3*)PQhjRQBGPLW-1^_[]É.)3*)PQhhR8P03*)PQhyR*3*)PQhRS[L$A4tPQ4I,Dt*Pa,[Í**)PQhR**)PQhR~USWV,[HD$@xl$DuVJ}4tS|$(jWl$HU3 tjU3tpD$D9(t9$VJ$,V~JPt$D54^_[]jj赉tt$ LAt$DVL$*L$ql$$9.|$FWUP jbuDžt!PW> Gwo 1^_[]ÐUSWV[l$19}EuBM1tDm $t: $Utt^Ut$D$PZ U;1$D$jtt"WPt$ED$E E^_[]ÐZL$1t 9tËA ÐZL$1t 9tËAÐSV[ÝT$ t19 uL$t r ;t$v1^[ËR1ttVRQS ᐐUSWVP[:D$1t 9t ^_[]ËHh t( $tDUXst؉Ut$P ątC.4.-PQhRj.4.-PQhRZL$1t 9tËAÐS[^D$t9u L$ t9t1[QP: [ÐSV[L$ t 9t1^[ËT$19Q ut$tRVq^I ֐USWV [t$(>t~(t  ^_[]ËFOjQvPgt҃~$tD$jPv @ ʼn$u 8"tD$N N$9u8"t=..-PQhR71jPj N,$UNq7ǍFPD$PU tcD$;$uZgjPV tD|$u W~1,$jpƅt-PVF~n WAt W/D$$0USWV[8y1D$4$G=w 4Ս,jAPV( r)L$u'D$1ɉt $;L$K 1뜃t84$un1D$j;t$$L1 $q1D$7;t$$LD1t ;t$2D$D$ L$$t$|9xtpG|$rfuÒws=u6ɺsv<<k1^_[]ÐSV[]D$0FuFt PV1^[ÐUSWV[l$(Ewd|$, .jD$PU! 8Gw t$OL$oD$,Pt$,VD$L$?,PVD$?,PVqp?,PVRQt$G4l$(D$fD$~1҃r41Ґ LLLLLLL9uЅt1 8 :9u|$D$D$D$D$,Pl$,UD$0 ;,PUZtsL$=tD$,PU*tCj=Ut4t$ U PU!D$D$D$D$D$1^_[]Íq(.-PQjtRSV[]L$t$ 9t8V 1;Q u.FtRqPB 1uyu"^[Í..-PQhR/.-PQhRffffSV[ý PQ6|$ u`( T( V^[ÐSV[mt$ 1t9u V^[Y?D$t 9t1ÀxÐYD$t 9t1ÀxÐS[D$t9u L$ t9t1[QP[ÐSWV[Üt$~uo~(timjPvvMtT( !rjPvv*t1`( |$ PQF5V7^_[Í/j/-/PQhRSV[T( VPƃ\( `( VPƃh( 1^[Ð1ÐS[ÎD$L$ yt0@QP`[ÐVZNL$1t91u T$ t92t^19^ffffSWV[ j@XhƅtEPWV4>jPb2F,F0F4F8F<^_[ÐUSWVP[Øt3Pjqtrj@gDžuU}(uL$UxUSWVP[Ú*։ $|$?uwG8]u<GcjjWr tC jPwwt,t1\jjPUt$t1U^_[]Í22/PQhRRS[pPt$ þ[ÐS[Þjt$t$t [ÐS[npPt$ [ÐUSWV[;t$>W0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%0t0/PQjmRϰQlGP]&Wul1^_[]É.0t0/PQjkR胰P0t0/PQj|RgS[>D$H4tH4[Í/11/PQhR!USWV[D$,hUt$0~W%~4tR,$pjUt$4V tjV2tPD$090t9$W@%$W/%pPt$0\ ^_[]jjfdtAD$0t$PL$T$rL$9Al$ F9(u:G@j&VjgW<&umj&Vt{jaVtljmVt]jp+j&Vxt?jlVit0jtVZt!j;t#PVAtB1 ^_[]ðq(43PQhRաSWV[ìt$~ t 1j Vt ;~ r^_[ÐSWV[l|$t$t0t*PVtuj Vm^_[1SWV[ t$F|$uLPVujVm1^_[Íq(43PQh$RSWV[t$F|$uEPVtiu]jV}1^_[Íq(43PQhER#USWV[t$F.|$oEt1PVEuo t9Et2PVEuPVvthu\jV1^_[]Íq(43PQhdR賝USWVP[ÊD$1ɅQh Dt$7jH1Ƀ#hH$GGG wtHt$WՃj W=tjW$$< 5PWtiu千5PQWq tDj Wt5D$h VPW`tj WZ7XWX $ȃ^_[]ÐUSWV [$($$WtEP蘒x=ŋ$$t$t`?t[Wut.H|/t+1]/$,9/;9sfD$ .t$ VH rܡ?fDXDXXXXDistXD /.plVttUt$ VPD$t 9ujt$D tYjLPLUt$u t*l$ WU $t1$t$2$l$ 8t$H t U88V%Vܠ8$ ^_[]É,$9tG9t iy/t)rD$ UWPs D, ,$S[jt$t$ [ÐS[Îjt$ [ÐfffffD$ǀǀÐUSWV[;T$$L$ |$l$t$u2jhDtUhxL$ H L$$H*s3uFˉ,|\T ^_[]1 655PQjAR讘*655PQjBR蒘USWV[kT$t]D$ |$L$tKutUtMtM L$$tEUSL1Ht t L t L |$$t L2 ^_[]Ím6]65PQjZR託ffffUSWV[xD$8t|$4D$0uHL$HL$HL$H L$H L$H $x p PHdl$ QRVWt$t$t$ t$,t$4t$<0t$8t$dVa4>D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffUSWV$[Ht$@|$[fffffS[.t$t$jt$t$t$8>[fS[t$t$jt$t$t$(>[fYXZQ̀QQrS[t[fffffffS[Þt$t$t$t$N[ffffS[nt$t$t$R= [ffffffS[>1;D$[ÐS[1;D$I[S[88t jѐ1[ÐS[þ88t j衐1[ÐS[Î88t jq1[ÐS[^88t jA1[ÐS[.88t j1[ÐS[88t j1[ÐS[88t j豏1[ÐS[Þ88t j聏1[ÐS[n88t jQ1[ÐS[>88t j!1[ÐUSWVX l( ?) R4x( ѐ>t1 @u~1ɍx( >t 9u#;T$t$1 ^_[]ÍWn99PQj>RwffffUSWV[$ÑL$(-qL$,)L$0D$4D$8rD$<D$@D$DD$HD$LD$P|$|t$|$d$$jjdPWU$$|<$u;L$duh^_[]ÍQPjmS[ޱL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV׉[Ôt3T$8tOl$@to&;VPt$DRZ;::PQhRu멍 ;:Ս:PQhRt뉍;::PQhRtT$HkXODH@uMzD$ j PWڙ $T$+z8"u,!z"z07IFWPVQt$HT$ 9L$<lpD$ $ $ 7D$ $ $$D$ $ $ D$ $ $L$; $D$MX $ىL$5$T$ D$@L$$L$ L$9D$L$D$T$ D$$L$L$<xt*upȉUPl$@Ut$@t$@t$@t$@lj$$D$T$1}uET$l$$|$9ljЉZ)C;WVPQt$Hˏ11҃^_[]Ë$T$|$(9ыl$,}[;|$09Njl$4}v;UWRPVQt$Tt$Tt 맋L$8fffY_i̟mNA90̟%ÐX/L$̟ffffUSWV0X$t$DL$H|$PL$%1|$L$WD$ ؉D$ )t$D$HOL$\$T$/,T$D$H9wԉL$Lt$9s0D$$t$TPVT$\ D$x ͉ƋL$L|$$t$TWVT$\ D$H\$lt81ɐ9uD$L)σ|$VD$L|$A1ɐ44TttTTttTTttT9ul$DL$ %D$HD$(‹D$LЃD$T$$4*1(D$,L$ t$;D$(D$,D$$$|$LWPt$H T$҉t$t71L 9u|$L)Ǎ |$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$D$T$LGD$4D$9ƋT$L ߉l$9s>*D$$t$TPUT$\ D$x ŋT$L|$tB1ɋt$D 9u)̓|$^Ѓ|$C1ɐT T TT TT TT TT TT TT T9u|$u_)1\$Dt$ l$  9u)ȉ݃|$k\$T$Lt\$|$$t$TWt$T$\ t/1T$ L9u)|$r |$r1Ґ LLLLLLLLLLLLLLL9u-֋D$ l$D|$k1Ґ  LLLLLLLLLLLLLL9u$t$ &1$q0^_[]Ë$;;;PQhRk$;;;PQhRdkL$XUSWV0Xx$L$Ht$DL$1|$L$WD$؉D$ )t$D$HOL$\$ T$14T$D$H9wԉL$L|$9s,D$$PWT$XD$x ΉNjL$Ll$$UWT$XD$H\$ tt@1ɐD T 9uD$L)̓|$TD$L|$A1ɐT 4t T tt TT tt TT tt T9ul$L$ D$HD$(‹D$LЃD$D$DT$$1#T$,L$ D$;T$(D$T$,D$$t$D$|$LWPU/B T$tD1|$  9u|$L)|$s#zL$L$|$rY101T0T1T0T1T0T1T0T1T0T1T0T1T0T19uD$|$DD$T$LD$,D$9ŋT$Lމ|$9s.D$ $PWT$XD$ x NjT$Lt$tB1ɋl$9u)σ|$oЃ|$S1ɐTTTTTTTTTTTTTT9u|$ \$ T$Ll$\$ |$$WUT$Xt.1T$  9u)|$r |$r1Ґ  LLLLLLLLLLLLLL9u.l$t;1t$L 9u)|$։|$1Ґ  LLLLLLLLLLLLLL9u$Uf 1$k0^_[]Ë$;;;PQhReL$XffUSWV<[(l$X|$Tb D$\}  |$T  D$u D$4tǃԟǃ؟T$PT$$9L$$*T$,2T$0\$|$ <$D$(\$؟ǃԟ|$ l$XL$1L$uПHD$4;L$$D$T4П>-u FD$,Пt$0vE<+<-~؟L$ ԟXT$())D$ $t$љȅuD$+D$(\$؉D$81L$T$/t$T΋T$D$ L$9~D$ ,0D$TuT$΋D$ tNj$9|D$롐T$8t$Tt4$9|t$|$T<$9|ˋ|$Ő؟<*Пԟ؟ȉ $:|$Tk $)t$$)ΉD$t𐐐љȅuD$$)\$؉D$D$ L$T$-T$T , L$T$D$ D$ 9~$L$ D$T,uߋT$L$tĉ;<$|D$렋T$ϋL$T,,t‰;<$|L$|$T,; $|ˋ|$ŋD$D$0'\$؟+ԟ|$ /V؟tԟuԟП<-u ~П4$<:tkE$<4$P1L$ tEH<$W;:&L$A;D$PʋL$TTD$:uD8t}:t@4$PJ $? t/ǃԟǃ؟ȃ<^_[]À:uL$:tVL$D$X:L$u^W*ПD8t}:tUjWP赈Wx:L$T$,ПL$ $_D$p7*П:t%j=R00@)D$Cԟȉ $؟|$T> $))ΉD$t𐐐љȅu)\$؉D$D$ L$T$*T$T  L$T$D$ D$ 9~$L$ ,D$TuT$L$tĉ;<$|D$렋T$!ϋL$Tt;<$|L$|$T; $|ˋ|$D$VSD$\(pD$D$ 1T$ $ $.T$tf\$QURAT uU4S $9D$ t0ˋNT$\;LuN;Lu N;L tD$됉|$ 늃|$ta\$D8D$X8:ȹRQP \$؟+ԟL$ \$D$\T$l$ \$D$\t|D0|$D8|$Xt?:tRQP萅 1L$\|1uD1 <-t<+::BtD8tD$X8:t+RP1?Hl$t(L$)LA;D$PʋL$TTu|L$Al$ ED$TDL$D$\l$XuLD$8uCD8t}:t RP~1L$\|1T$ uD1 aL$\D1L1 t1ɋD$`$8*ПD8t}:tU4$P $E<-t<+u:}:1<: :U==PQhRKSpxA)9}8YTi t?>==PQhRRx3rH HPp 9r@ 1^_[]>Y䐐S[~t$K1[fS[^Xt$ t$ P1^_[]ÍR>>PQj4RzRŐSV[Ýt$ tjjjV0^[Í\>>PQjAR,RfffSWV[L|$t$t1hPWV0^_[Í>g>PQj6RQfffSV[t$ tjjjjV t^[Í>>>PQj0RtQfffffffS[Ît$j t$t$[fffffUSWV[[t$|$tBjWG0~G0t ujW,2^_[]Í%?>PQj/RP띐USWV[یt$|$ttft77t9fh L$f@Hx$p,L$ H(L$$HDL$(H V1^_[]ÐUSWV[Xj1L$,l$(D$$t$ T$wGo Ouu u&t,t+$tt,utڍtuft?$L$Ut: $fH f@xp$L$H,h(@D\uH -UWb 1^_[]ÐS[nL$ D$T$rRQ0P [ÐUSWV[+|$t0l$t$rPU6V t)uދD$1L$)t^_[]S[ΊD$t$t$t$0P [ÐSWV[ÜD$8pPc tWփ1^_[ffffffUSWV[[T$l$t\tE0~-},t xr }$t jr2Uʭ1Ƀ^_[]Íb?֍+?PQj;RMuj?b?֍+?PQj;DHDCPQhR^C~uр~|$^[ÐSV[]t$ t ~t/F;D]DCPQhRB~uN .wu^[ÐSV[~t$ t41~t^[ÊV u.wL$~9|ԍ;DsDCPQhRWB먐SV[}~t$ t~t0^[Í;DDCPQhR B~uЊF u<.wŋL$9뮐|$t1ËD$ÐSWV[}|$t$t@1u6T$L$9w"QjVC FfFF^_[ÍDDCPQh.R6A뜐SWV[\}t$t>~u/L$Fy |y|9IL |F1^_[ÍDDCPQhMR@랐USWV[|t$,|$(O $$PWV  N1<$$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ÍDDCPQhhR?DDCPQhiRW?SV[m{t$ t"~uDNu;V9r1-DDCPQhR>~t^[ÐSV[zt$ t31~u(NuV9rT$x 9v ^[ÍDDCPQhRh>fSV[Ízt$ 9y ^[ÍVEBEEPQjTR>אUSWV[;zt$|$t.l$tGMϸwG)o >1^_[]ÍDjEEPQjbR=뱍}EjEEPQjcR=또USWV Xy$D$$T$ E|$(k#L$,,r 9t Ӊt$)1!)1օ҉ڋD$$t/uE$EFEM$PjQ>D$0 28t p׾$VPU 7+D$p)t5u+VQA$RjPO> 7D$)smH1 ^_[]Ë$;DE֍EPQhR;D$4$EE֍EPQhR;g$E΍EEPQhR;D$a$FL$FՍEPQhR[;L$USWV[hwl$$T$1L$(4z 9u<$)1*!)1ׅҋl$t"uGFNPjQ< D$ }+$x)t6u,WQARjP\< l$}<$)s8O^_[]Í;DE֍EPQhR9E͍EEPQhR9렍FL$FՍEPQhR9L$;SWV[üut$|$)GσwurnG  9rY t9tQ9w<Q  9w!9s9tQ9wQ^_[ú9;DEEPQhR86EEEPQhR8)뒐SWV[Ütt$|$)OσO  9r} 9t9ty9w_y  9wD9s.D$9t7ty9w#y9w9rָ1ɉ^_[1;DFEPQhWRg7EFEPQhXR=7VL$t"T$ tփuQ^ÐUSWVP[s|$$T$(D$,<ȸ9D$ 4t)щʋl$֊D$$L$(xut9wc|$tYl$0|$ tBu5syGRjP98 D$$L$(l$0O}^_[]Í,FF$EPQhR5T$L$8D$4VUQFFՍEPQhR5\SWV[üq|$L$1uLwt?;t$w6)w*t$uQRjQ47 ^_[ÐSWV[L$:$u 1 uL$>͍ >T$1ҍ1 -9si$:GU;L$s>t 9sE.9r9s34$Gh9s맋 $1 9s$1 ^_[]fffffUSWV[KIt$|$lUl8PPWVEUL^_[]fSWV[Ht$ W!PPV W^_[ffffUSWV[èHt$tLD$F$V~nF1 PUWRt$t$QjVV)$^_[]Í(JJPQj3R 듐USWV[H|$,L$T$ |$l$捃KUWRQL$QVPt$H 1uA$L$1 1 1 L$1 L$ 1 L$1 L$1 ^_[]ÍJJPQjBR5 [USWVH[HGl$`D$ D$D|$\SrE$MUu}m:KUWVRQt$PjD$JP'$$avLKPQ6,jjjjPpƍ50+V`jjjjWoƅQUVL$\QL$ QL$ QL$ QL$ QL$ QL$ QPV${D$L$ D$D$D$?D$D$@D$D$AD$(Ÿ4$jjjjUlƍ5D$$1+ V`jjjjUkƅbt$$V$L|$/WL$ QL$ QL$ QL$ QL$ QL$ QPV$rD$$LD$ AD$AD$AD$AD$AW$L?/D$(P JuKL$QL$ Qt$($TPt$hh@Vp 1lj,$t$\hVWo Ņ~UVD$ P? e0WpU0,$xj$uj!ƅth$\L$QPG1\UF ULFuF E;$lu5p^_[]1㍃KKKPQjNRwUSWVl[=$D$h$U=$$U= uj!ƅtXD$XUPF1LXUF ULFuF ;D$hu2l^_[]1ꍃKKKPQjhRJ聨S[<t$ t$ [ÐS[<t$ t$ v[ÐSV[ý<K1 jPVM D$ jVPjY^[fD$ȉty!fUSWV[H<t$0l$,D$tjuj)xƅtRUP1 UF ULFuF(;D$u6^_[]1ꍃKKLLPQjFRourUSWV[u;$ $$P'h@V9l1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ |=P$Pt$?k ƅ~.V$P$P |) u84$l8|$$uj)jƅ~$$QP1UF ULFuF(4$Wk|$;$u^_[]1S[n9jjjjt$t$[ÐUSWVt[89$D$p$U$$U= uj)=ƅtXD$\UPk1L\UF ULFuF(;D$pu5t^_[]1ꍃKTLLPQhR+GΣfffffffUSWV\[88|$tt$p~vt$DJ 1!|$T1ȉωL$PΉt$ L$HZ\$XىÙyZL$D1ȋl$H!1ȋT$tJɉL$yZ1!1Rʉ$l$D͉yZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1ŋT$tRʉT$4ÙyZ1!1͋T$tRʉT$ŁřyZ1!1T$tRʉT$yZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$,͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$8ƉT$L 0yZ1!1ދT$tB8ȉD$<ʉǙyZD$t@<L$L1!1ȉD$0yZD$@D$3$t$ 3t$811!Ɖt$1t$@yZt$3t$ D$$3D$<11֋\$@!1D$řyZ4$3t$D$(3D$011!1$yZD$@Ή1!1ދ\$4D$ 13D$,3D$D$ D$@ǙyZ11ƋD$3D$3D$3D$D$ցơnD$@‰D$@113\$3\$83$É\$4щ án11D$3D$ 3D$<3D$ D$͉n11ڋD$3D$$3D$03D$D$l$@Չ*n11ʋl$ 3l$(3l$3l$4ʼnl$ ׉ׁǡn11‹l$$3l$,3l$3l$ʼnl$$։ցơn11l$(3l$3,$3l$ʼnl$(Ӊ,šn11T$,3T$83T$ 3T$ ‰T$,ىl$@ˁán11l$$l$(L<>4LuŋD$;D$uY^_[]ÍML^LPQhRLL^LPQhR$xffffUSWV[$t$0l$,D$tjuj)ƅtRUP1 UF ULFuF(;D$u6^_[]1ꍃKMMMPQjFRur讏USWV[$$ $$Ph@VT1$|$$ $ u#D$P|$WP|$`l$d$$ʃ|&jQPt$ y|=P$Pt$S ƅ~.V$P$P` |) u84$Tq8|$$uj) ƅ~$$QP1UF ULFuF(4$W T|$;$u^_[]1討蓍S["jjjjt$t$[ÐUSWVt[!$D$p$U$$U uj)ݏƅtXD$\UP1L\UF ULFuF(;D$pu5t^_[]1ꍃKXMMPQhRGnfffffffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[Ú t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUP8 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUPܼ ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [è |$$D$OGD$ $?17l$ )ȃ8PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW ;D$u ^_[]*ufffffL$$Yai qyD$A(tQS[x RjjC9 [1ÐT$D$ Zbj rz $z(t RPS[( jRj8 [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ÓRjj^8 [1ÐT$D$ Zbj rz $RPS[NjRj8 [Xt@ffffffSP[D$ L$T$$RQPo[fffS[jjt$jt7[fffffffS[þjt$t$jb|[ÐS[Îht$t$j/|[fffffUSWV [Xt$ D$D$$|$jjUVjW:1D$D$ $jjUPjWD$D$$jjUPjW̜D$D$$jjUWjP蓜u8 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR 1u ^_[]ÃtOw OsҍHWnMdMPQjw ^ffffSWV[yt$(WjV xqN|$,t?r$d$D?r'- d$!L$jWV ^_[fffffffSWVP[t$tB6 PQhRx>L$ $6 )QVWRC6 PQhRX6 > t@> ^_[fffUSWV[t$D$D$I@t NQw ܻى*+tʃ-!ȃ뻉Ntu/u4u?t#>!tu>uGsPt̉#.!t,#.!u븉#> t<#> !# Ѓ^_[]ÍZNQNNPQjbRUSWVX[D$lD$ 8D$DD$@D$Ǩ,t\ σW?+t%-t =uU- t׉~+t!N'VN=t-t+uV^_[]ÍnNgNNPQhtRHSWV[i|$t$t5$D$ WVjjjPW1Ƀىȃ^_[ÍWnNNPQj:RѷffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[t$(l$$.PT$(18D$8tP)rkt4)PsD$(8rl$ ugPt$艧ŋ$t$b0sD$8tP(W2p4$&#t$#Һ01UPt$"ŋD$G6"oD$ G > > D$8tP(G^_[]ÍONPQhR耴!ONPQhRVT$(#)-qÑ tu!mu?ru<6 FtjPgv +u4jjg&v tjPg6 ^_[]ÐUSWV[èt$0l$$AT$0818D$8tP%gt/D$08rL$ ubPt$#ŋ$t$]谷0D$8tP9%Wl4$t$q01UPt$ŋD$G6oD$ G > > D$8tP$G^_[]ÍONPQhR!ONPQhRt$,|$(T$0VWU jHUSWV[t$8$8tP#> t9ut>mt9uu+$8tP#h1VϥEu> $8tPy#|$jWu u ƃu 趵8tUjtt$^_[]ÍOONPQhR覯fffffffUSWVH[øD$`|$\t$$UVPWStUVt$aǃu.8uj5E~;$} VPaǍD$9tLVjA$jD$P6ct&UPt$hW$S{D$$oH^_[]ÉƍhO\O$OPQj>R葮fffUSWV4[èD$\l$HSt$XoL$`u*tuνut덻tǸtD$T$\cL$00F>L$Tl$LtD$HT$Pɉ|$,xGD$(Gz9иG|{ϹdkdD$T$D$HSQ|\Ϲ+T$PkϜD$(D$T$D$OD$dD$D$0D$ڸD$dD$D$(D$`L$T$ t*L$ V蒢 89v 4^_[]NjT$\0t)1L$ҋL$rT$BD$$jt$ Qt$Ń|$jt$ RUܠ|$tUjt$ RPŠ|$t>jt$ RP讠l$t%jt$ RP蕠tjt$ RP耠T$[ɉ4$|$t"σs1d@D$ 21a1di։Ńut% 44rŃu΃T$\L$ 9|$} 4$10jt$ WQ跟щ9T$ 4$T$\|$/L$D$$D$ u\4$jjd|$ WPaƉр|$ul$эO4$t$0t$(QPR;T$|$l$NjD$(ЋT$19d$0w0L$ȃL$L9ȸX͹gfff4$ֺQ׉Ɖljҍ)|$wL$,T$$ QO4$Qt$(V0WRUt$h$[4$|$2jjdQUыT$,t$$rO4$Rt$(QPVt$dVt$d> 9wijt$ QR贝щ9|$}T$ 4$T$\jt$ QRщ9}T$ 4$T$\jt$ QRNщ9}T$ 4$T$\jt$ QRщ9}T$ 4$T$\ijt$ QRD$ ы4$T$\B;vOPQj8RD$lOvOPQj9RƧmfffffffUSWV[$,$(D$ D$D$$$4$0uBuBρJ BB$D$'́@fH9~f\tu0Nt\t́@fHwf\tuOt\kdD$ftLfHNft:fHNft:fNft+fHH9r $,fx L$Ph L$P<^_[]ÍPύPOPQhR譥>USWV։[$$F t%G HO =r$,Ef{uf}}u f}f{ftftEGf{uLt$)t6pL$PUQ~ D$$$$D$$1ftgfz~#f{tMf}uteߐf[uƉ񐐐Qf]tfuft΃릐뜉T$$$191ɉ$9Efz0f,tJf[u׉ωQf]tfuftȉ븐f{tf}ut랐uL$$9s!$f9r1ɐTffuL$T$$$L$!1W^_[]ÍP&POPQhRܢ[P&POPQhR貢4P/POPQhR苢USWVT׉X$$P"Gl$e1D$f8~|$ G t$$L11ҋ\$DKff/D LDKff/D MDKff/D NDKff/D ODK ff/D PDK ff/D QDKff/D RDKff/D SDž<LY<ML<N?<O2< P%< Q<R <S9tV|$LtaD$$NT$t$L$PhQRVHuD$t @ t$?D$ h |$t$($kPVt$tV1ɉftvfTLLTftZfTLNTftPfTLPTftFfTLRu?$PPL$$Nt$QhRVPH)u$|$tq;$PT^_[]ÍLL)19POPQhRӛ$P>POPQhR詛q$PHPOPQhPRi$CUSWV[Ët$tTFtH>t,N,19tDtP,Vt$FPVF^_[]ÍPPOPQhR՚USWVYT$tht$1BtBظkw+ܽtրztЃːt *u1^_[]ÐUSWV։[d]F,F tvʟFUPWOl$~D$uNtQjPD$ L$$t$ F1퐐fPOPQhR襘PPOPQhR{ZP$ORQhpPQD$SWV[\|$t$tt676^_[Í~OPQhDRuʍP~OPQhER輗릐USWV[D$$ $ $#$;df1fMHftf/t;$sXfyٺҐ$f/u*;$s!fE/Hf/tfu /fE<$91 GtALGt1LGt!LGt=u1B @uD$$PQD$$PQR$1z$B t;$NQV$r袛E/.f}/D$%=@=K1 GtfLGtVLGtFLGt6=u $$$VPV$+yB @uD$$PQD$$PQR($u,#D$=@u;$s#E/$B$PL$ ;$Ĉ^_[]ÍTPNPOPQhlRPdPNPOPQhmR)PNPOPQhnR$PNPOPQhoRѓ$n|PtPOPQhCR裓$PtPOPQhERr$POPQhpRA$|PPOPQhSVPPQhpV$k:USWV׉ $[$;]$$o|$$$D$f1$9 $9=*uG=*uG=*D$GD$ 9$6D$$)9$f:6B1D$D$ D$ $f9u'KD$D$ D$f9)1AtATAt1TAt!TAt=u1{E @uD$$$PQXD$$$PQU$1ɋ $?#T$,@ts)ЋT$$Ut$P$$BT$$UP$ $D$fD$f9ft>$t=tsAuE @u1$P-S$hPQ< E @tύ$PU  $tE @}1ҐQtEDQt5DQt%DQtu$0Q׃1E MD$PL$$уt$$L$F$f8D$ft$T$$$M t$Vjn ux .u$f:.u@tx .uPt.uxt T$;$w'0jf2fu;$';$|$tJ|$L$$t$ E;D$ f/t$$$PF $$$$$l$1$ BtILBt9LBt)LBt=uf $@ @uMD$$P$P Iŋ $fE$$UW$L$$Q$QP$D$,!=YPtPOPQhERM lt$10đD$/ Njt$$E @D$uPPUu w8t E u;$6Ĥ^_[]ÉNjt$몍TPPOPQhRTdPPOPQhR*|PPOPQhR$cPPOPQhRՊOPPOPQhR變7PtPOPQhER臊L$ PPOPQh/R\L$1USWV[fT$(!K9rfu ^_[]1ʉL$|$qt$ߐft*uLG=*tGD$T$;|$(rT$fuyˁ?t%[u=ftxO1ہ!t3w1ft[L$f9u;dwˉٍ^L$ |O$]uk$;D$ u91;T$t&\$9t$(v"L$\$ыt$(9f$'ω4$ލ^ρ]eN-uf9w f;Fw$~Ǿf9t4$뱍Wn΍OPQhRP΍OPQhRՇT$8P΍OPQhR裇T$8ffUSWV[õ$$c$$tu1D$$tŋD$3l$ 1!h@P4D$(D$$D$ iL$L$\QP+itYD$|$D$0t$\ d$<0fD$PPjup] D$ $D$1u1$D$|$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$$tP{PWu uhV0D$[l$D$$D$iD$,D$ 1ҐՅt6D$D$0D$4At$,jD$8P` (jD$PD$0 D$ D$r€r|$9L$x<r9L$y<r9mL$~<r9QL${<r95L$z<r9L$q<r9L$p<r9nL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9$u-$taED$ $KL$m <r9$t L$n <r9$uD$$;l$r4t|ZD$d\|$t$$v|$t$l$`t,t(t$8QjPv? u|$1D$Wt$7Ƌ$6yd$t$XD$|Ay DAD$$uD$*XՋD$DJtDHD$D$ $@uP X DAթD$jPD$p D$ |$t$ztG$`L$tZ8QjPq@ jPD$p /1ҋ$t t-> jhjVPt$$t8 > 0jFc> > tP(> u^_[ffUSWV[K|$> jjj耠 > l$ > tUQ> S > t]1i > 9 > wHt Q8 > W (> t$UWP > u 1T$ Ɖ^_[]ÍQvQ>QPQj u%> jP[0xƃ$> 1%> t %> 1W2^_[ÐUSWV[۸ W$> u%> jP/x5ƃ$> %> UPr";D$wUt$ť1 0W^_[]ÐS[Nt$:.ƃ$> [fffffffUSWV8[u }D$D$L$$XjjPQjRMtYrL$0 $$t;L$$L$D$l$tL$(L$D$l$_u D$,D$D$ l$_e^_[]ÍQQQPQjERz*QQQPQjFRzffffUSWV [QPq1*t\ƀ8tUT$D$j PVW tŋT$t|zt)QVP蕣1ɿ*kP&wA5@`ʹ"&u*@9~ $RjP,$+RVPT$t$$D$ t HR6> RUPjQ葖L$ t>6> ^_[]ffSV[mL> u*ǃl> avB!PV謚L> ttP> VP1^[ÐSV[ǃl> L> tP9avB!PV+L> uVPj1^[ÐUSWV [Å$ǃP> ǃT> ǃX> ǃ\> ǃ`> ǃd> ǃh> p> L> hhUD$ 1Ʌ$t$L$ $t$ `> L$l$<ǃP> L> hhU耠D$ l> t$P@/j\WVO t8t剃P> 8#tj\WVwO t8t뉃T> j\WVWO t8t뉃X> j\WV7O 68t牃\> ǃd> ǃh> j\WVN tD8tPUd> j\WVN t8tP%h> h\> |$$W# |$V j\PD$ P}N ǀ8tWku͍tUWmthUW|mtTJUWhmt@^UWTmt,UW@mt'UW,mQ`> E5xxMf l$<$j\WVM 8t牃P> 8#j\t$VdM t8t艃T> j\t$VDM tOǀ8t扻`> 'PWcl"\> ^PWEltbe`\> D$B!Rl> PQ諝 `> l$tэ'QPkuX> <$j\WVwL t8<$tPd> j\WVGL X8<$tPh> t$t$1ɋ;$u ȁ ^_[]7SWV[ìt$ǃl> L> t P蛟&avB!PWӔL> t*t+VP> ju䍃P> WP 1^_[ÍWnRURPQhRrZSWV[ܮt$ǃl> L> t P˞&avB!PWL> t*t+VT> iu䍃P> WP 1^_[ÍWnRURPQhRqZS[L> tPcgǃL> [ffS[ޭL$T$ j@t$[ÐUSWV8[æt$PT$$t$,ZT$LXD$(D$D$$D$ |$\$ 9AEtL$|AyL$ DAML$Za*?$W[t$ Pž[SWV[||$t$tWhVY ^_[Í>SqSPQj1RQ̐T$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[t[Ḯ̀rS[ċt[ḭ̀rS[ät[̀ffff̀ffff/̀ffff^̀rS[Tt[̀rS[4t[Ḥ̀rS[t[<̀rS[t[̀rS[Ԋt[ḇ̀rS[ôt[̀rS[Ôt[ḓ̀rS[tt[̀rS[Tt[`̀rS[4t[R̀rS[t[2̀rS[t[ḩ̀rS[ԉt[P̀rS[ôt[ḷ̀rS[Ôt[Ḷ̀rS[tt[ḉ̀rS[Tt[̀rS[4t[Ḛ̀rS[t[̀rS[t[Ḩ̀rS[Ԉt[1̀rS[ôt[Ḍ̀rS[Ôt[òrS[tt[ìrS[Tt[l̀rS[4t[t̀rS[t[s̀rS[t[r̀rS[ԇt[p̀rS[ôt[j̀rS[Ôt[m̀rS[tt[̀rS[Tt[Z̀rS[4t[ ̀rS[t[!̀rS[t[S[ކt[ᐐ*̀r׋L$Q1fffffỲrJ!QS[Ît[fffffS[nLSV[ML tF L PjCts L 4+L 4L L R" ^[ËL H L jjjhjPj1tȉL u@j$Pj jMS[ÎD$ L );L t PJ[à QP*[ÐS[NjP%PL uP>k[ffffS[hPt$t$t$ [ÐUSWV8[ЄuD$,$0M D$$D$(D$D$ $]ȍɍ (ʍ)(FD$D$$bD$L$t$yXDP@Ӻ\$%D$ D$$OL$ۀU|$ɋduL$|$1뤐|$|$ODH@uT$EHhL$8D$D$D$ P<Pt$t$= ZD$x$W<Pt$W @D$x$W<Pt$W )D$x $W\<Pt$W D$x$W1<Pt$W uD$x$W<Pt$Wf zD$x$W;Pt$W; `D$x$W;Pt$W <D$x $W;Pt$W D$x$$WZ;Pt$W D$x($W/;Pt$W D$x,$W;Pt$Wd 1D$D$$T$EHL$D$D$D$ P:Pt$t$ D$@D$ Po:Pt$t$  D$@D$ P>:Pt$t$  D$@ D$ P :Pt$t$j  D$@D$ P9Pt$t$9 D$@D$ P9Pt$t$ D$@D$Pz9Pt$t$ 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ :|$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ SD$ S|$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$S|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ V2D$Pt$V ID$ Vc2D$Pt$V 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uPx=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$hQuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$ډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$DA(|$€´|U5UTPQjHR&|$ >NU5UTPQjIR&USWV[ëbl$L$t*t$1Ґtuщ )4@tRjP)( ^_[]fffffffUSWV[(bt$$|$(9jVPƿWLjVt$, t$(|D$l$,L$ t-|$,RUT$bT$t .l$(RRl$(T$tX$|$  tQ`T$ <$*^_[]ffffSV[}`D$L$ t(T$t L$ RPQ肰 Ttƅu D$ #jQ) )01^[ffffUSWV[`$$t|4r)uUUPQjDRv#jjU ;r) $$DŽ$DŽ$$jPJ$8jPDŽ$PDŽ$TDŽ$X$`V$`DŽ$hfDŽ$lf$n$pDŽ$t$|DŽ$$DŽ$DŽ$$$$V芅ƅxU1Ƀ ΋;$u ļ^_[]S[.^ht$t$Pt$[fffSP[]D$ L$T$$RQP+G[ÐSVP[]D$L$T$t$4$VRQP5E^[fffffffUSWV[È]D$,|$$l$0trjjWVWG0tW@9t QG0ǀǀ GGG yw%\1|$,u"fG GGCGGƍD$ L$PQWM T$T$tD$(Չ 1tL;l$t1Ƀ|$, fO Gou GAu0o/$UtB1$ʀ;l$uG݉ojW^_[]þD$9tP#u$$VUPQj?ReD$<,VL$$V$UPQhR3L$T$,V$VUPQhRffffffUSWV[[l$jU}(t4UEE u8jjjuU(!ЃtsE jUW$^uP}Tut5Et.+E EM0)׃9t E<)jUjUt^_[]fffffffUSWV[+Zl$jU$}(t8UUE uEFt PF tT~tE1t(0F t((F t( z;~s F @ƋF P^F,t PNF4tP9F8t P)V ^_[]Í,AyVBVPQjKR?eVyVBVPQjMR?efffffffSWV[Wt$HWdL PVnW؎^_[ÐSV[ÍWHV趎dL P'mV螎^[ÐSWV[LWHWudL lL PQmWT^_[fffffUSWV[Vt$l$VvZVt$z[1u<$Vt$R[DžtpU7t]wtуUPt u막t$~utQ^_[]É1ԍWnVVPQj1(XDHu D$  ^_[]ËD$ D$ ΋D$ 뺋D$ 뱋D$ 먋D$ 럋D$ 떋D$ 덋D$ 넋D$ xs4WrW?WPQhRv0xWrW֍?WPQhRMUSWV [hLL$(l$ D$D$(N|$$L$ߐt$,D$PUD$PlutxD$ѐwz0tM׊D$L$uD$ `l$ s+D$tD$u:t)2+W?WPQhR ^_[]Ël$ u렍΍W?WPQhR΍W?WPQhRS[îJt$t$jt$ [ÐS[~Jjt$jt$[ÐS[NJjt$t$t$[fffffUSWV[JL |$/>3i=)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(ƉDl$Utwn$Nj 0Q 1L utjh=`ʼnL 0ƃL LtMjуL @1t*n$FOUQj P)|$z^_[]ËL )USWV[ëHL |$i)Njtt+~%L$9N$ut1Ƀ|$tΉL uj(荶ƉDl$Utwn$Nj 0Q謸 1L utjhʼnL 0ƃL LtMjуL @1t*n$FOUQj P(|$z^_[]ËL )USWVP[:Gl$UNjL $tOs;1҉vL ljh=L $uƃL D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$t0L tuR:t!jуL tiE$SL uj(ŋ$,tIEj |$WPQ WtE@E$L$1E^_[]t$t@ϐUSWVP[JEl$UNjL $tOs;1҉vL ljhL $uƃL D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$t0L tuR:t!jуL tiE$SL uj(.ŋ$,tIEj |$WPa WtE@E$L$1E^_[]t$t@ϐUSWV[[Ct$|$ tЋL t61=tDtPǃL D$L$ƃL L t?1=tDtPǃL D$L$ƃL ǃL D$ 1^_[]ÐUSWV[KBt$|$ tЋL t61tDtPǃL D$L$ƃL L t?1tDtPxǃL D$L$ƃL ǃL D$ 1^_[]ffffffUSWV[5A$tA$1uhfƅtcD$E/$tt$$9ux/Ĕ^_[]z?$9u/XH>8?USWV[{>t$tD$tdPV$xaa1ɐ΍,?UQ~t&UP$y.w8"tV 1^_[]ffffUSWV[=t$V~L P L ƃL X tj~V:u^tVtDi@u\uRDQ@u말:u~u'L t P׻ǃL ǃL 1v ^_[]ÐUSWV[û<|$t$L$W9tW1tT:u?8utՐ}^8uuuȀ@t:ut:u 1~@t^_[]Í; ]\PQhR])] ]\PQhR6USWVP[ú;|$t$t#l$ t?tajUjW^_[]Í;5]\PQhR1빍>]5]\PQhR uWn5]\PQhRxUSWVP[:$L$d$p$l 2L$|$$h\$T$8u{L tq$l: |$ th8|$ tW:N|E9v t:t|u싌$lhW$p $L$1xjjjU|$ `]PQhl$XUjjjh@Ujh@6lj D$ al$t$,1ɍD$L1Ë$L$AD$(Љ|$L9rB19r0T$ \$hWt$ i ƅ4LT$ < u|$tT$($1t$#tT$ $l$tߍX8؉t":|;$v<t:t|u싌$l땋$$$ߋ\$WnO]\PQhR$|DL$t1<9< t+< t'#<:t <\ut111;T$Rl$$\$(L$T$ $L$)\$QP记T$ )ʼnl$‰$L$\$(l$$|$ t t$ht$,D$l$ tEF4$hD$ \$t$,l$T$L$ |$8$pl$L$ T$D$L$0$t$,D$(֐<:u>tuk{D$q؊6U8u Xuuu@{=uUt @dƀ:t FuFT$L\$t$(Ut$ t$8\$0L$Lt&du%F:D$L$0()D$$tD$)T$$D$t:u)ʀ| :D$@t:\$ L$$ыD$)9L$$|KT$<,$D$)\$D$PUY5))\$ )D$Ɖ$T$<*)׉ڋ\$QVPn Wt$DU` t$$t$ t$0荳/L$0\$|$8T$L$ D$ɋ,$tt$T$LfT$Ћt$ 9v8)PU蔭|$u(U|$ |$L$1|$04$Ҳ0rL P/KL P!L L$ <$14$i$lyD$0P,|$0\$D$4jD$HPWUU t t$t$D<u-t$0D$Hȉ\$PP<D$ \$VD$xWFt_WVPw UUx~1L$ ȉŋD$8L$D$8B\$W脱 |$ t$gdUU |$;$LP^_[]0WH)]L$7]Ս\PQhRL$,8]L$7]Ս\PQhRꋴ$tL$,>]L$|$7]Ս\PQh Ru|$L$,WnL$|$7]Ս\PQh R:$|$L$,Ń|$ \$t t$c4$WnO]\PQhR$|Wn]\PQhR$|Y\$U覯|$ t\$t$b\$t$0X0L$ÐSWV[l0t$|$tatY8t1t0:t+|t&9vt:t |u^_[Í;O]\PQhR}WnO]\PQhR{VSWV[Ü/|$t$tGtiL tPǃL ǃL ƃL ƃL WV^_[Í;Z]\PQhRu>]Z]\PQhRpS[.L tPCǃL ǃL ƃL ƃL 1[ÐUSWV[Õ.$,E$$$(L uL ȋL u!avQ0L L t%1L L PQ1t $D$uz1L VMVǃL L HL @MavQPL u<X1DN@u:t#t L <|\L L L $ƃL l$L$L$ $Dt\uUL P0uًL t:tuT$ T$VtfVǃL ǃL ƃL ƃL l$=ǃL ƃL ƃL D$:l$V}ǃL l$D$<$1Lt:t|t Ƅ$T$ $(jPj$8ǃw5L tPǃL ǃL ƃL ƃL GVǃL ǃL ƃL ƃL ǃL ƃL ƃL 1E;$^_[]À|\u ƃL ƃL De]\PQhR}$<E>]e]\PQhRL$<USWV _X*T$$l$ <$S|$(ZE<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdXƃdD$L$M]g\M:ȉʀ0E€0 ȃE€0 ȃ7^u.M::L|$)FdPWƿdD$$у¾2w/h:륃렃뛱뗱 등 돱 닱 뇉l$)u (FPU^tL$(U$Wڦ ^_[]Í;o]֍\$PQhR|$)]o]֍\$PQhR^|$|$(So]֍\$PQhR&|$&; ]֍\$PQhR$)] ]֍\PQhRUSWVY&T$ l$ $z|$$ 6ZE+<:u׊M8u(t$ؐM8uu҉u@=uE<@D$$jdlt]ƃdNJD$$ƹdEt#<:tu)FdPWu`)nuE N$UWݞt1L$$8$x]]\PQh`R0$W3^_[]Í;]֋$\$PQh"RL$V)]]֋$\$PQh#RL$|$$&]֋$\$PQh$RvL$; ]֋$\$PQhR>$)] ]֍\PQhR USWV[+$l$t$|$@bM:uu8u(t$ː3V8uuu@~#uN@tq0uF 8/>9vuP芽 F(N8D} '~wF^ FPB^ uWv$Q tƒN 4~?:V|@uH)ƒVԋ^ Q K~?:uFV;~t^  ^ 8u^ F,;8u e^_[]Ë^ 謊S[0t$t$ [ffUSWV [} F FEFUVzRu)ʃԉF:FJFx9u0RuO N ;Nue^_[]ÉfUSWV0[3D$(},PQ&XM t$M L$ML$f|$ L$T$|$QRj WP'BuOt$ rF|$j WP(c u0O L$FD$D$ PjL$Qº 79_t$} urQ tgM9uWM % 2^QPR}Wu19r"y";L$(M |jjP@ PVJD$t$L$ W*Jt^fxHuHPQ$3U q 3u uًI3Muˋpjt$V  uEPVu ;EsD$t$W{HL$%D$"T$ ;UwRPu 1ɋt$;D$(u ȍe^_[]VS[^jP;M h P>Q [SV[ÍM hVt$t$t$%t1^[fffSV0[Jt$DD$@t2D$D$ D$HL$ $@D$1L$ ^_[]fSWV[\t$|$jWQj VW) jWH^_[fffffffSWV[ t$|$t P avD_PQE ~^_[ÐSV[ýt$ tPFtPmzFFFtPOzFF^[ÐUSWV[H|$(?u avD_PQt$$oD$t Uyjjjj|$87P$Gʼnt$Pvt< t< tt$WXvt Ń1W/$FL$(A$AFD$1uD$(E< t< tt֋T$(BH9u<BjPD$ P=J D$ L$ 8ukD$ $FD$,t$UumŃzAA jj t$I 28+8tq!0|$(tP߲$tP8xGGGtPxGG01^_[]Ë$fffffUSWVP[l$t$D$ $ t t@u$__S_PQj8Rz@QUVwЃt *0$^_[]ÐUSWVP[jl$t$h$ t t@u$__S_PQj8R@QUVwЃt 0$^_[]ÐUSWVP[t$ l$T$D$$$ t t@$u0__ՍS_PQjpRRt$0@$QVURwЃt 0$^_[]ÐUSWVP[:t$ l$T$h$ t t@$u0__ՍS_PQjpR谺t$0@$QVURwЃt W0$^_[]ÐUSWVP[Út$ l$T$D$$$ t t@(u0;`&`ՍS_PQjyRt$0@(QVURwЃt 蹿0$^_[]ÐUSWVP[t$ l$T$h$ t t@(u0;`&`ՍS_PQjyRpt$0@(QVURwЃt 0$^_[]ÐUSWVP[Zt$ l$T$D$$$ t t@4u3`p`ՍS_PQhRϸt$0@4QVURwЃt v0$^_[]ÐUSWVP[út$ l$T$h$ t t@4u3`p`ՍS_PQhR-t$0@4QVURwЃt Խ0$^_[]ÐUSWV[t$,|$0*T$>t .$ tEt@u%-aaS_PQjJRvE@NT$RQjjjuЃ>T$u-aa`PQj[R/T$,$ t|$ tEtHHu0qaXa׍S_PQhRض|$0EHHPVt$0t$0WRUуt z0$^_[]Í aa`PQj}R聶S[ÞhPt$t$t$t$t$S[ÐUSWVP[Zl$t$D$ $ t t@8u'aaS_PQhR׵@8QUVwЃt 臻0$^_[]ÐUSWVP[l$t$h$ t t@8u'aaS_PQhRE@8QUVwЃt 0$^_[]ffffUSWV[;t$l$SPQW  t"t$ VW hWjjPU裉PQW t$NfffffffS[îjt$t$t$0 [fffffUSWV[xl$,L$(T$ 7t$T$L$D$L$11jUt$,jP2xD$Ƌ;D$u ^_[][USWV8[$L$4L$u$X$PD$u$P| $$Pt$Pr :T$$EjPrgD$tk|$jWSgD$,D$ tND$1ɅujW,gt3L$$\$T@u%t11|$l$o1҉D$L$|$41 t~|$t9sQ r L$4QPVWx9!xt19)u|$T$(l$);$Pw|$$XD$0P辧ƃjP ftQ$1 T$|$$T@uX$L$0PVQWt5WD$$t 8tD$1D$,kD$0$tvVt$ 1Ƀ,$r3T$ 1t 4t tt tt t 9uօt!,$1ɐt 49uD$ l$$Tt*@?@[@ #$T '@`@"@ ;@&@<@>@(@ )@$|@({@,}@0]@4\@8$@9|$uD$ t$ ‹D$$t $uCr.|$謴1|$t$$1|$41 D$D$ 1L$D$(T$$L$t%D$ L$x~14$)΋L$ ;w$D$4PD$L$4V{ DžL$~9t/;$WVQ2L$ 1T$$pM; $L$D$ L$/;$^wD$ 8D$ L$x^ /; $,WL$$1D$ L$x, /; $L$D$ L$=ʃr, /; $L$9D$ L$=ʃr, /; $L$9D$ L$=r! /; $sXL$$9D$ L$ /; $s7L$9T$$;,$|$|$9j |$l$t$D$P2gt$ &gUgVgl$,;$48^_[]ËL$D$(9,$S$T@|$t$\t $\t$ft$ ft$f넍bPbbPQhR豪bPbbPQhR蒪bPbbPQhRs\bPbՍbPQhR`kbPbՍbPQhRתꋌ$hRbPbՍbPQhR襪2bPbbPQhR̩bPbbPQhR譩RUSWV[xD$(|$0L$,T$$.l$T$L$l$L$T$ jWPjU11xL$ȋ;L$u^_[]QUSWV[l$ |$t$t V蚟1L$1jUWPV^_[]ÐUSWV[ël$$|$ t$t VJ1L$T$jUWPVp^_[]ÐS[^L$1jt$t$t$t$6[ÐS[.L$T$ jt$ t$ t$ t$ [ÐS[L$T$ t$ t$ t$ t$ t$ [ÐUSWV[èL$(T$ 7t$T$L$*D$L$11jUt$,jP`xD$Ƌ;D$u ^_[]OUSWV[(D$(L$,T$$>|$T$L$*l$L$T$ jWPjU1xL$ȋ;L$u^_[]9OUSWV[ë|$t$t VN1*L$1jUWPVp^_[]ÐUSWV[[|$ t$t V1*L$T$jUWPV^_[]ÐUSWV[ |$t$t W訜1*1jUt$$PW^_[]ÐS[þ*L$1jPt$t$t$[ÐS[~*L$T$ jPt$ t$ t$ Q[ÐS[>*L$T$ t$Pt$ t$ t$ [ÐSWV[|$t$WuuGكs^_[!t_t$t%<FF ^_[ÐUSWV[{|$ u ^_[]l$ t$W8ut t- t(W!ut`WP u뵃!}/=<FF ^_[]Ã=t̃~~ŐUSWV[|$0t$,Wt$@D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tv<$|$Dփ 6D$4)D$4@u \҉L$x MVrt^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉr$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/XDPg%0W$\P$D$4@uWqu#XDxuGws>4$$^_[]ËD$4  !rfUS [ÅE$D$D$D$PQwD$e[]fffffS[>t$ t$ [ÐUSWV[$$%= uRl$\4$&KƅtUSWV[X|$7mG(_NLfFLftfuwjfFH4NHʃf uojfFHf G(Sjh@P F$NJf~HnHf@u!fu|nH@tN<3OV83W Ok6vjɚF NJGQqRQu𐐐pPO~D'FLfui9t̍Hc>cbPQhR轓FJt v$oGt!,$hPXOuG,$fEfVjfFHf4G(*Sjh@P F$NJpPN~D*GN(~DFFJVVbPj(G(uwgHF,F(nTPUw< j/l$Uwt5;$u~Ut(U D$HQUt$; D$F,GFFF8NcbPQhURpWUSWV[À1A(֋Mȅyh@u Qt}L$QD$P:st?D$3F4L$3N0 u"D$ 3F1~(Pwtq‰4$D$4D$t$@(ugO@4D$ u^D$0D$(D$D$$51fGH茕G D$ D$4L$ $Љj0)t9D$"D$ <u AG OJ3D$$D$0D$ D$(t$D$$D$ D$(t$D$0T$GO(|/l$@u4$1F(t F,/l$,FD$ |$ wDR`8l$ǃt$<)l$ D$8D$D$14$D$Lt$8DžN( u" .uGt<.utʐL$tXw P8ōG UTD$t1 .YMPNQPT$ R5g u,$PUE EJE EED$ 09t$ v4$T$D$<L$H ȉ  ȉ  ΃VT$HRB4$FL$ N9D$DtF(T$L$tȉD$,D$8T$L$)L$ D$؎14dcbPQh1R܈D$u‹.蘎1F)EHftf },$FtpPCu|$t$u N)$xDuW@8/tOF(uISjh@Ph tFFU$U <$u~yljF^_[]FUSWV[ t$tf8}t v$$>V }t!v$v$v$BVBWz^_[]ÍcccPQjBRFvfffffffS [[hPQt$ t$ ,$ [ÐS [t$Pt$ t$ ,$ [ÐS[L$T$ hP[ÐUSWV ׉[ôT$4xtb=t= T$4t=uD T$41L$L$L$L$ D$l$ L$RPQUWV2=u贋"كԹTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[ÞL$T$ t$[ffffff̀rS[dt[̀rS[Dt[ ̀rS[$t[SWV[ |$t$t-9t!t F9u1^_[Í-dcPQj*R|fffSWV[Ü|$t$tt1WV{^_[ÍTld4dPQjBR'uύTld4dPQjCR뮐SWV[|$t$tt1WVz{^_[ÍTld4dPQjBR觃uύTld4dPQjCR脃fffffffS[ÞL$T$ hPt$ [ÐUSWV(T$ [bL$<\$%t$@|$t;D$<|$"v+ƈ1t$ \$VPt\$u<+t<-t D$1 1ҊD$L$1t+ju軅0W諅01^_[ÍWnPdPQjFR뙐SWV[ܻ|$h`W1t-t$)u=8Vu-81^_[ÐUSWV T$[oE$ j()ƅF F8$8t j{)F$jPD$jPW xl$ t3unio3$$n tD$ u Y8a$nfsu F t$WV tK&88$8tv$v$C9v 89V/981E;$ u ^_[]%SWV|[$PW_1t?#D$=@u$jjWZ t1jG [|^_[ffffffUSWV[Øl$,E D$ƩtT$t |$4L$0L$u8uEV'E ?EED$t$1D$ D$1$1ɐw8l$|$Ut$2l$)ʼn$ jjj|$e3edPQj:R]yuōIe3edPQj;R:yffUSWV [Xl$@|$8T$4xth;=t= t=|$8uF1|$8L$L$L$L$ D$t$ D$UPQVWRI%=tot$<ȃwX1fFFu:<>@$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[t[USWVTXD$|$tt$ht&L$ptCwm\$W}\$eTePQjxRWw뵋\$eTePQjyR2w$vl$l1 D$͉L$4A\$P!gD$,T$pЃD$B؉D$0.B$'l$ T$pD$t$hl$ ЉÉD$9D$0wϐD$0ŋt$h9vߍ4\$t$xWV$ ~L$pt:1ҋt$D L9u׍*t$p)փ<$r؉΃<$r1Ґ ,, LllLLllLLllL9u4 |$4l$,/Mh\$ITePQh&R=uV\$eITePQh'VuePQhrVt$xt$ D$l$ .؉D$0BD$(L$$#<$T$pl$<$*ÉD$;D$$D$0wԐD$0;\$$vĉߍ4\$t$xWV$ ~L$pt<1ҋt$D L9u׍*t$p)փ|$(r؉΃|$(r1Ґ ,, LllLLllLLllL9u4D$4l$, (|$ /L$8t$h\$t$xPV$ SL$ډT$Ë|$pT$<,$ϋD$$5)L$,$ $|$\$ D$$9 /9\$ L$ D$<4(ϐT$\$t$xVW$ L$ 83T$D$;|$$r"|$ t$hT$p|$\$ 'l$0t$hT$p;l$ F$ /)L$, $ttC1ҋ|$EL5MD59u.)֋|$|$(r*փ|$(t1ҐL,l LllLLllLLllL9uՊ\$ T$\$ |$9t$hT$pD$0L$ |$tt>D$0؃U0uuD$T$p9r܉;\$$D$0\$t$xUP׋T$| L$8T$pt$h\$;\$D$0aލ<\$t$xVW$L$, 0Ȩu+D$hD$,$T$ptNыt$hU7uu|$T$p9r܉݉$L$ h$Jl$,T$pL$4<)988BD$<T$8D$$T$,!T$,L$4, t$H9.׍P9D$,T$HtӉT$D|$@l$LD$DCD$D؋l$LT$P9t$)L$,<|$9t8|$P+|$@99D$9$9l$\$\$t$xU|$W$ T$T$ l$ l$~T$T$ \$ L$1҈ډT$(|$$T$p\$<*;|$ l$$\$t$xWt$$T$| ;D$(~>|$$\$t$xUt$$ ;D$(~FT$p;l$ \$t$xUt$$ ;D$(~T$p $D$D$T$p\$ $l$$D$0|$ 9v4l$$݋\$t$xWt$$ ;D$(|$ |$$T$p $ݍ\$\$ 9w-؉9L$uprT$p9v<\$ )1\$t$xUt$$ ;D$(~\$ 빉݋\$ $9L$|$tM9r $l$8t[1ɋ|$ 9u)ω|$ ;9r $1l$ L 9u#Ѓ|$<\$s L$ L$  JNJNJNJNJNJNJNуuD$ $\$9L$|$L$ tb9rL$ 1ɋl$8<$9u)ω<$΋\$T$L$ |$<rDq9r1 $   $9u $ƉT$|$9ى9$|$$s|9rЋT$|$<rщ͋$ JNJNJNJNJNJNJNu$ql$d$DtS|$|$@t(E9rE9r|$@t|$$L$t&9rL9r-T$,D$h9u\$QWPc \$R#1T^_[]Ë\$eTePQhsRTh$\$eTePQhsR"h$LUSWVTX8D$ L$pT$htwL\$ m ֋\$ eTePQjxRg$vl$l1 ШD$ʼnD$4֋\$ P:D$,D$ G߃|$0BD$l$t$hT$pD$l$ЉD$9wӐ|$0 $;L$hv΋D$0<\$ QWT$|\$(~L$p<$t51ҐD L9u֍*|$p)׃|$rЉσ|$r1Ґ ,, LllLLllLLllL9u4+ |$4l$,/M\$ eITePQh'VeePQhrVt$xe$nl$.߃JL$(D$Ɖ|$0"\$T$pt$\$ʼnD$;D$w֐|$0,$;l$vD$0<(\$ UWT$|\$(~L$p<$t71ҐL D9uՍ|$p)׃|$(rЉσ|$(r1Ґ l,LLllLLllLLllL9u2D$4l$, (|$/L$8t$h\$ PVT$|,\$p ډT$D$[D$<,$ڋ\$ D$L$$/)L$,$ $L$$t$D$949Ɖt$D$<,T$\$ UVT$|L$8T$L$$;t$rŃ t$l$hT$p\$ "|$0l$hT$p;|$R$4)t$,4$0D$tt-1Ґ 779u7)֋L$$|$(r փ|$(r1Ґ ,, LllLLllLLllL9u׋L$$.L$$T$l$9T$p\$ t$l$D$l$ht9r1 $   $9uNjT$(l$$T$p*9v9\$)1T$$Ջ\$ Ut$T$|;D$~\$뼉݋\$ $9t$!|$ti9r $1ɋl$89u)ϋ\$ $9r1  9uNjT$(Ѓ|$<\$T$(s $ $ MOMOMOMOMOMOMOu\Ѓ|$<T$(rO͐NONONONONONONOuD$$9ى9s9D$ l$(\$d$DtO|$T$4t$E9rE9rT$4|$L$(t)9r9rL$,ڋD$h9u\$ RVP \$ Q1T^_[]fffUSWVP[ |$88tqw$(G$t,GO4$6tV1‹n1 uV ;WujƋGONFGF $wnG$t3GO4$6tV1‹n1 uV ;Wuu$OjUTƅtF PVW. u$*jU!t@ PVW. 1J[8t u<[3[ $tD$ 81^_[]fff̀rS[dt[ḃ̀rS[Dt[SWV [)t$ |$t[D$D$4$Z0L$jjPWjQ'1usZ9 u bZ01 ^_[ÍWn5fePQj񐐐9t uD$))t8t)Pt u+D$ PG^_[]ÍffPQj@RQD$(SffPQjARwQD$(7fffffSV[ÍL$D$T$ y9fRVQP)V6Q4P 1^[ÐS[.D$y%9fQ PQj@RU Q j@4R Q [fUSWV[ˌt$|$tWl$tp1ҐD$DY4tqf9u1tY9ՉuN)JTUggPQj?RP눍TUggPQj@ROq1^_[]fffffffK̀rS[t[USWV [؋t$ РD$P7$|S_ NL$ 9t6ʉi)iAi ˍ $4L$T$ o9s9s}$?9r|t$^uA$t209r9r։t$^_[]É݃t209r9r֋9s9r9r봐USWV](|$0||$4РD$P6t)1ҋP1T$,ރ s;DžDžDžL$0AQ1@t$ sAs(1ہ1)L$$D$0Hމˉ|l$Pt$n1D$0L9t;Ⱥ_ Nʉi)iAi  붋D$, $T$0D9w9l$r؉ыT$ҍ4) tG109r9r؉΋9s9r9r؉봋9r9t$ rʉ؉)D$L$0t$ݾ^_[]ÍggbgPQhYR?K[USWV[Xt$D$.̉)ōР$PSt)1ҋPt14$ͽD$^_[]ÍggbgPQhR,JUSWVP[JРWstI010$9r$9r$i0mNA900W^_[]ÐS[ît$t$t$b [ÐS[~t$[ffSWV[\|$t5jWt ctVW(1^_[ÍWn hgPQjARH몐USWV[l$t{jUt=ǾtUWUt1l$UPt$ L "19s#'NN8^_[]ÍWnhgPQjVRHaffffSWV[,|$1t,g|PWzt |$t=t=tƉ^_[ÐSWV[܃t$t-VW tPW V^_[Í`hShhPQhRMG믐SWV[l|$GPtƉx @VP1^_[ÐSV[t$ t%VPMt L$9H 1^[Í`hohhPQhRF뷐USWV[øD$01t:>t41 |t$t$ t$ W7= uD$ <=u.|$$ PQ 9ttD$0PQ M9u;TQ s|9v9tfPǃPQ ǃTQ $jWP [K0TK8uyPD$0t$ )$jWP K0K8u4)  $PjQ+G $PQ L$TQ ^_[]ÐUSWV[XQ tXQ 1t0DtPVtXQ Hى|$jjD$P tE t5jVt$ F:XQ tVt$V;ŋD$PQ 9tP ǃPQ ǃTQ TQ UjPE ^_[]ÐUSWV[81tR/tL,t4t$t$Ux: uD$|=uօt D$1^_[]ÐUSWVP[z|$1|g|PWtfƀ<=t^tR)tI1 $ $lt+Vt$U9 u|5=uمxD$8.1^_[]ÐSV[~PvƅtHH0^[ÐSV[Í~P6ƅtH0^[ÐSV[M~PƅtG0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffD$L$AAA USWVP[ê}D$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[H}D$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[|D$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[H|L$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[ÈyT$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$^_[]Í+i%jiPQjwR!C<%jiPQjxR!$+iiiPQjWRx!*]iiPQjXRQ!SWV[l]|$t$tOtqWV t(t%uGPVNt WV=1 WV͕^_[Í+i9jiPQhR uMj9jiPQhR hUSWV[ë\|$t$tLtnWV詎t3oUV8t"}uG jQWPV褙1^_[]Í+iXjiPQhRufjXjiPQhRkSWV[[|$t$tqGG>t1^_[WV͍tGPV\tۍGPV諍tʍG PV蚍tWV艍묍+isjiPQhRm;DsjiPQhRFUSWV[ [t$|$Gt/uTot^REwn 1o  u-GFGFFnFn GFG    Ń19t$un 1f$PL$$T)fv fD$ kVQURt$`1L$ ;$T$T$0L$RQPWt(8W $\9vpD$0Pe;fǍk$0PQhW0W $\9v QW$`O %1QW$`5 D$0P8eFl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF O u)L$ QPMtPDž $y+aGkT$ PQhR,= $w89;$(w))΍L$ WQP D5%D$D1D$;$ ^_[]ÍmQkkPQhRRGQkkPQhR($$bFQkkPQhR ;蛵fffffUSWV[J$8$E UP7`E 1Ҩk4$$4$0$,uRUZ]-VU]t9~uۋ$0tPv u*ft#Q$4ƃ1ҁD$D$ƉffD$D$hVQPPt$D$L$ T$PQVRu@m9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVU`24$1E u U[;$uЁ^_[]1ҋ4$E t蟳fffffff̀rS[Ht[USWVP[GPaxT$1tJT$ t4i t}um9ujqt$$V6 1$11Pf8^_[]ffffffSWV[LG|$t.jWAG=tjW4^_[ÍkqkPQj@R fffffXFL$rÐSWV[ìFt$u8mkkPQhrRJ VKtF~tP2^_[ÐUSWV[5F$$$$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ D$4D$0D$,D$(D$$D$ D$D$$$$b$yuyuyu y D$$P-Z$1t1$W+tGotP܋$L$$0$;$wȁĠ^_[]øj$PRѸ?$FD$4FD$0FD$,FD$(n l$$NL$ vt$T$t7t3T$t tu!u u D$D$$P\$1111 Ӊڋ6teN tFtI@s1 tˉ1ʼn\$$Eo:okPQhcR_F HT$뱉\$$$$$D$1$Pal$ D$L$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$ L$PL$T$T$LL$HuD$$L$Pj#:D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ D$HL$LL$D$D$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$ D$PD$L$L$LD$H$4JT$D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$PD$ T$L1T$T$HT$ t1ҋl$ #D$! ɋT$rD$9tB`Xl$ z9\$$R9uL$ȅut|$ utT$$n$L$$$$PjfxL$1/A<tY<uyYQuy uyuyt{wqhQ)t9uGIu *;L$,.D$t$4D$ D$D$D$0D$DD$ 1|$ $!)D$P|$WQt$8RZNjD$$fxxt$ T$@>P]fD$>P]fD$>P] f|$fD$f|$"D$<$$!|$hVWt$8RTYgD$D$$fxxVT$@HV$NjD$91%L$L$PVt$V 1ɉt$4ω|$1ɋ|$ $D$t$;t$,D$ɋL$$%uD$ft?ft9ω|$cD$9f|$tf!fL$t$ V|$8Wb"hj$P3 DŽ$DŽ$DŽ$DŽ$VWP$Pj%֫΍Gfwhj$P DŽ$DŽ$DŽ$DŽ$jaND$$%MD$WMdnPt$t$t$DQ$Pj%%T$t$1ɋ|$ 4D$fuf|$tD$D$1ɉ f$D$L$Mf|$AL$L$1ɉWZfD$FPZfD$FPzZfD$h$!Pt$ Vt$8WSVfNjD$$fx$!xVVAV=*h~L$L$t$L$L$|$hRQD$赀L$ T$ t$@D$D$0t9 ~11ɋ|$ T$0f|$u 9Uu|$@tƃu81ɉD$C T$0T$9+9u|$@ |$t$9~V<0t$4$%JL$hJ$JL$|JL$xJL$tJ L$pJL$lD$df|$tD$htD`L$dt$X‹t$ F1ɅD$ t ЉƋ@ut$ D$ D$D$EyyB|$1ҋt$D$0 $L$0u yn T$ D$$@@DŽ$DŽ$DŽ$DŽ$΍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$(_tXL$ A"OfGt1fϋQt֋L$ tѐ|$ |$ V賋L$tL$8$tYt$`~l$(u2D$4t$%Ut QyFPVt$`)L$8uBff#V01l$(E;$%b%^_[]QUǍGn΍=n׍kPQhRVn΍=n׍kPQhR$%]m΍=n׍kPQhRK.RH΍=n׍kPQhR$% mύmkPQhR$%~ύmkPQhR$%MTDvWVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVP։[6 |$F$ jPŅtg E $M ɉMOMOMWMUOMO M OMOMENMMM!F vt$P蒦 ^_[]ÍmnkPQhR6@nnkPQhR |$GnkPQhRUSWVT[1WD$PD$LD$HD$DD$@D$<D$8D$41ҍl$4D$ D$$L$j L$Q[tL$t$ t$e t tt,…tt$ P踃u$ND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$PD$Pjt$G|$$"RtT$GtItu܍mkPQhRT$u뿐D$L$Eŋ@uaL$$Ut D$PT^_[]1nnύkPUhh RamnύkPUhi R3~USWV T$[BL$8D$ l$4"t$@jV1]F1t 1Ƀt Du`1<$L$D$ Pl$ U,1nPU|F<$T$t ;D$ P ljT$4t$@jtoL$ Qt$ P 1upF<$T$t ;udD$ PtljT$4t$@j*t n)tl$<UrGt!D$881<$;D$ ^_[]ýW;t‹GwtP"܍m͍nkPQhRRH͍nkPQhRm,okPQhRmkPQhRmofffUSWV([u$H$<$$E UPM 1U4$Um$DUtڋ$D0WKt4$DptPW)tu뗐$@tP$Hp j$DWH1$@T$t.$@T$D$1L$D$=wu4$T$$L$%D$&hRWP։L$q 4&t$$DP跞 D$L$T$ t$$QRPVu%t?14$E t 4$1E u U;$$#(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$FT$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$ FT$L$ ut$t$$LUWnooPQhRkfSV[-t$ t,FF#EgFFܺF vT2^[ÍLpoPQhR밐USWV[øt$|$$|$ n? NV@)19vt$ fvt$Ut$$VPL$ A L$T$$19s+D$ (L$@9rt$ 1)ƋD$ȃWVP^_[]ÍL$poPQhR/p$poPQhReUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [|$$l$ D$O $W?17T$)ȃ87PQW jPW EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjW ;D$uY ^_[]ÍM:poPQhR謹L:poPQhR肹%affSP[ÝPt$1Ƀ $ȃ[ÐUSWV$Yht$8D$D$ L$X1DKNl$\$1Ҁ0u.N uuW- ,$u W ,$01E;$u Ĝ^_[]XfffffSV[]t$ F tv0lF0v(lF(F,vkFFN pjP FtF "avpPQ4tF F 1^[øSV[Ýt$ F tvFF F t6ѥF F ^[ÐSV[=t$ N u@v0jF0F t6f jjjj6YF0^[ÐUSWVP[D$@0%t$ $QPZgE< t< t񍃢PU$gǃUfF~ l$EuE jj ;cEF4$Wftx1퐐< t< ttYT$BH9u% JPrdtaL$AFF<4$WYft 1 1F^_[] 0U$010t$SV[=t$ F tvOFF F t6qF F vhFFv0hF0v(hF(F,^[ÐSV[Ýt$V(1|$  F ^[ÐUSWV[h|$ G uWG l$us1w0gG0G t7g jjjj7OG0tdUWuTG 뢨uG$G$G 1T$QRPwI 1uG$4$t$UW1^_[]ÐUSWV[X|$0l$,t$$F u.F(9~,sWPvatVt$$F(~,WUP n(r9t$(EffFtE9rMN M| t&j0t$$W01^_[]ÍQ)tӍ,E9rEUD$$HL$@JF)1"F$J Hƒ)9\$T$$BH9uBJL$ jPD$P17 D$蕰L$芰8$D$ L$FwT$D$$@ @jj t$ 6 $> $48D$T$ 1FfffffffUSWV0[H|$D|$xjjWjjV=|Dt$^TjjWPjV |D$\$l$1D$D$ $19mzuB<tQ<uBt t z D$D$ D$ 4$ƃ4$ftf9zB |$r t>t 1 tmt t.t |$ ި \$t>t l$ l$D$x|$\$l$t t$ |$xD$$D$ $T$ L$ uD$DU4RTRWjP |$t$$|$ 1ɉ4$ 1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$WM Pt$l$ U" t l$ /D$D$<F\$hPW |$ l$(D$D$ l$L$ff9NF L$$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$$PT$t\$|$WUR~T$ \$WjR趧T$ |$L$F t[l$Et Nj,$U \$Wt$T$ R~ E xu $L$ HT$l$L$~ x,$=Et Nj,$U\$WQRT$'~T$ L$E E$\$l$TU_/4$U_$L$$9sD$DQ_1ɉȃ0^_[]D$D捃pppPQj]RaW\$谦SV[}t$ t VE_^[ÍppPQh/RfffffUSWV|[(j$1tGljPWt)l$XD$\|+Wq W1|^_[]jjWjjUjKWxt҃|#D$ l$<$D$ƅuUW/$뚐USWV [H|$$(rl$ NBCD3EB 3M t蹨1 ^_[]Ë|$,jQ 9quJ艞$mD$DqD$4$ɹwt$,D$<$9L$HL$D$ l$YqD$$${$`$ttl$$;%`t %)l$ q$D$D$jt$L D$0Vvt"l$ q$D$D$it$L D$0vt"l$ q$D$D$it$L D$0ut"l$ q$D$D$Pit$L D$0ut"l$ q$D$D$it$L D$0Vut"l$ q$D$D$ht$L D$0ut"l$ q$D$D$ht$L D$0tt"l$ q$D$D$Pht$L D$0t$t"l$ q$D$D$ h`t輆|$4t;{xL$DL$ D$qD$,$t4詶tƁ Ot yI u,D$4$D$5L$@L$ D$ql$$$> Ɓ Ot yI u,D$4$D$U5L$y6L$-uAD$QD$ +tD$ +u AD$QXx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍXщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍXщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$Xщ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVXع1D$X8D_L$u D$(1ˍA^D_uk*҉ ʉ)ʅt 1ɀ|0.ʅx Ѓ^_[]Ë$6z$z֍yPQhRuːUSWV[Ó}PfD$|$D$ D$POlHHPPMz0ppp RQWjV-$r D$ƀe^_[]USWVP[ l$UPUމE2PUƉqPU讉PU薉qPU~qPUfPUNxjPUt# 1uRXMDHt?yj PU y8u$8 L$A.&L$0t9^_[]ÐUSWVP[zl$ PU9txF u6w|jPUW" 1u[XMDHtHxj PUҕ x8u $8 6D$t8^_[]fffffffSWV[Ü|$t$jWQGHO~;G~ t H WRYjW\S^_[ÐSWV[,T$L$Bpr~ ;B~ t 2~: RQ^_[ÐSWV[٭|$(D$$u $PsgD$D$D$D$ jWPG0u ǀD$PW>DjWR^_[ffSWV[LaHt Jt @t A ?t/t5Gt E49s%|||jQjhRE4M01U0)E41u;D$ !u E PzPL$ Qjdj$+WZ9E4B?PWu0'> E49s%|||jQjhRE4M01U0)E41u E P1Pt$ jdj$+WZ9E4>PWu0= E49s%|||jQjhRE4M01U0)E41u E h|PQjdj$+WY9E47>PWu0= E49s)\$|||jQjhRE4M01U0)E41E4u0} MU \$PVu,W >=E L$)T$X\$h*RQP`JD$ /}4\$=E0f (E4w)\$|||jQjhRE4M0QU0E4AD${`/}$D\$u 1M QU Qqu It${\$QRPVjdj$ +PX\$ 9E4<P$ +Pu0; E49s%|||jQjhRE4M01U0)E41E L$)T$Xh*RQPIoD$}44<ƋE0f (E4w-|||\$jQjhR\$E4M0QU0E4A{D$#M }4E0T$WP=;|E }4;E0 E4u)\$|||jQjhRE4M0QU0E4AM }u ;L$0;T$\$WE0P,=+;\$C ?E h|PL$ Qjdj$+W/V9E4:PWu09 E49s%|||jQjhRE4M01U0)E41E HM @Pt$ jdj$+WU9E4f:PWu0K9 E49s%|||jQjhRE4M01U0)E41E E P+E Pt$ jdj$+W+U9E49PWu08 E49s)\$|||jQjhRE4M01U0)E41M AE  L$<%\$L$ L$|L$||L$*M01U0)E41E E |$\$7%Pt$jdj$+WET9E48ƃD$PWu07 E49s\$jt$jht$,D$(E4pE ;D$8}0L$|T$|T$ ||L$ M0QU0E4AE ;D$P8T$\$E4PWJ:I8_E E ;D$sŃ}4a!E0 E4u\$jt$jht$$D$E4r}4u0E WVu,P87}47E0 E4\$u-|||\$jQjhR\$E4M0QU0E4AMU WVu,E P}}$ru cE h|PQjdj$+W`R9E47PWu05 E49s)\$|||jQjhRE4M01U0)E41\$ E HM L$HM pQE T$(|$$f|VPjdj$+WQ9E4H6PWu0-5 E49s)\$|||jQjhRE4M01U0)E41|$\$E L$ L$|L$||L$*M01U0)E41E E D$\$O\$Pt$jdj$+WP\$9E4d5PWu0I4 E49s\$jt$jht$,D$(E4m}$Fu4u0u jM t$)΍VUUUЃ=wE44}$E {PQjdj$+WO9E44PWu03 E49s)\$|||jQjhRE4M01U0)E41E \$]E  8;L$=T$D$dD$`D$\D$X)-PQu0!, E49s)\$|||jQjhRE4M01U0)E41\$$+|$ L$2E 8CD$E ;D$,}4u0E WVu,P,,}4y,E0 E4\$u-|||\$jQjhR\$E4M0QU0E4AMU WVu,E PY,,}4+E0@ f (E4w)\$|||jQjhRE4M0QU0E4AE L$) \$PE M4+U0B  ru0M4B\$OPQjdj$+PF9E4:+Ƌ\$P$ +Pu0* E49s)\$|||jQjhRE4M01U0)E41E4D$E0D$*|$rx)D$L$|L$ ||\$E0 E4ujt$jhVD$$E4M0QU0E4A }4s\$UD$Q|$XWu u$u? E4u0} PVu,WI**E L$))|$1ҋ\$L$L$ |L$||L$$+р਀tsRPt$ jdjVD9E4g)PQu0J( E49s!\$jt$jht$(D$ E4M01U0)E419T$)ыE \$W}$ \$u E E \$PE L${|$X\$PVQj2jWC\$9E4(PWu0|' E49s%|||jQjhRE4M01U0)E41M u4}0T$VW7*6(\$I E }4(E0 E4u)\$|||jQjhRE4M0QU0E4AM T$\$VW)'\$ E }4'E0 E4u)\$|||jQjhRE4M0QU0E4AM T$\$VW=)<'\$O E }4'E0 E4u)\$|||jQjhRE4M0QU0E4AE MU \$VWu,P}$E h|PL$ Qjdj$+WA9E4&PWu0e% E49s%|||jQjhRE4M01U0)E41E HM @Pt$ jdj$+WQA9E4&PWu0$ E49s)\$|||jQjhRE4M01U0)E41E E ;D$%L$T$T$ |T$||L$%M01U0)E41E E ;D$@%\$Pt$ jdj$+Wq@9E4$%PWu0 $ E49s\$jt$jht$(D$ E4vE4u0} PVu,W%$}4$E0 E4\$u-|||\$jQjhR\$E4M0QU0E4Au E PzPL$ Qjdj$+Wz?9E4-$PWu0# E49s%|||jQjhRE4M01U0)E41u E PPt$ jdj$+W>9E4#PWu0" E49s%|||jQjhRE4M01U0)E41u rE E P]E E PHE {PWVQjdj$ +PC>}$u E E PE E PE {T$XPWVQj2jR=9E4"PWu0s! E49s%|||jQjhRE4M01U0)E41E4u0} MU PVu,Wh""""|$XWu W=9E4!PWu0  E49s)\$|||jQjhRE4M01U0)E41!}$E HA x}$1 T$XPRVQ.w}4\$..xL$DY.t܈$\x̋D$DX.t뻋\$-֋\$D$t xL$DA.t.$+)9u4VPu0{ E49d\$|||jQjhRE46DD$E4D$W\$L$D$L$|L$||L$D$ ,M01U0)E41L$0ЉȉL$9L$ n\$t$g4\$9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$AD$XVPu0 E491\$jt$ jht$(D$(E4  L$D$L$|L$||L$D$ 0M01U0)E41L$0ЉȉL$9L$ \$ \$t$.3\$9E4mPt$u0O E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0 E49-\$jt$ jht$(D$(E4\$IB}4E0)E4u)\$|||jQjhRE4M0QU0E4AC}$n }$bh|PL$ Qjdj$+W[19E4PWu0 E49s%|||jQjhRE4M01U0)E41E HM @Pt$ jdj$+W09E4PWu0w E49s%|||jQjhRE4M01U0)E41E HM @Pt$ jdj$+Wc09E4PWu0 E49s)\$|||jQjhRE4M01U0)E41M AE I T$}4\$E0.E4u)\$|||jQjhRE4M0QU0E4A A|g}4+E0-E4u)\$|||jQjhRE4M0QU0E4A}3}4E0 E4u)\$|||jQjhRE4M0QU0E4AE PU $ +ʉU 1ɋ|$wNd2|$7{$+t${$ +f@======2|$7{$+2z4|$7{$ +r|$7{$ +rz t$>{$ +rz4w|$7{$ +r|$7{$ +rz4|$7{$+Rt${$+2|$7{$+2z4|$7{$ +r|$7{$ +Rt${$ +DŽ$ +====2|$7{$+2z4|$7{$ +r|$7{$ +rz t$>{$ +Rt$V{$ +Ƅ$+=fDŽ$ +==2|$7{$+2z4|$7{$ +r|$7{$ +rz t$>{$ +rz4w|$7{$ +r|$7{$ +Rt${$+Ƅ$+=U4u0$+$ +^>~}0U4FU MU FD$L$D$L$|L$||D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$*\$9E4(Pt$u0  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0  E491\$jt$ jht$(D$(E4 |$ |R}4kE0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A\${\$jPjdj$+PF)\$9E4 P$ +P|$ \$ D$D$D$D$L$|L$||D$|$ ,M01U0)E41L$0ЉȉL$9L$ u\$t$ )9E4M Pt$u0/  E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$ D$XVPu0  E495\$jt$ jht$(D$(E4|$ D$f E4w)\$|||jQjhRE4M0QU0E4AE4 9 M0A Arial; seQ U0E4A \$u >E M4 U0B  ru0M4B\$QVP"  ƋM49s)\$|||jQjhRE4M0L$M0)D$E4z|$)D$L$|L$ ||\$E0 E4ujt$jhVD$$E4M0QU0E4AU}4s;T$ BE D$BE JL$d$D$ T$ E D$щT$ ;T$L$ t1਀D$T$Ћ\$P肨PQjdj$+W%9E49 PWu0  E49s)\$|||jQjhRE4M01U0)E41T$+E L$ DD$E ;D$ \$u4u0Pj诈}0WC%ƋE49s,\$|||jQjhRE4}0}0)E4E \$u4u0PjF}0W$ƋE49s,\$|||jQjhRE4}0}0)E4E )E4u0} MU \$PVu,W M ;L$t$)΍VUUUЃ=:T$X\$PRVQ2D$ |$ }4\$IE0f (E4w)\$|||jQjhRE4M0QU0E4AD${w|$ }4\$E0f )E4w!\$jt$ jht$(D$(E4M0QU0E4A|$ wD$D$D$D$L$|L$||D$|$ ,M01U0)E41L$0ЉȉL$9L$ \$t$"9E4Pt$u0 E49s!\$jt$ jht$(D$(E4M01U0)E410|09u4\$D$XVPu0z E495\$jt$ jht$(D$(E4|$ =}4\$<E0f )E4w!\$jt$ jht$(D$(E4M0M0|$D$f E4w)\$|||jQjhRE4M0QU0E4AE4 M0fAh Afres; reQ U0E4A \$u 蕱E M4MU0B  ru0M4B\$QVP  (ƋM49s)\$|||jQjhRE4M0L$M0)D$E4|$t)D$L$|L$ ||\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4s|$8D$f E4w)\$|||jQjhRE4M0QU0E4AE4M0Atry ; reQU0E4A\$u E M4U0B  ru0M4B\$QVP\ {ƋM49s)\$|||jQjhRE4M0L$M0)D$E4|$)D$L$|L$ ||\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sN|$D$f E4w)\$|||jQjhRE4M0QU0E4AE4 2M0A Apiry; exQ U0E4A \$u 7E M4U0B  ru0M4B\$QVP ƋE49s)\$|||jQjhRE4M0M0)E4sf )E4w)\$|||jQjhRE4M0QU0E4AE4D$E0D$|$)D$L$|L$ ||\$E0 E4ujt$jhVD$$E4M0QU0E4A~c}4sG|$D$f E4w)\$|||jQjhRE4M0QU0E4AE4 r/M0fAm Animu; miQ U0E4A M0+L$ \$+D$,;$p+u ȍe^_[]Ë\$?USWV [èat$,|$(D$ .ʋ7l$Ut$Vt$40RQ4‹L$$7>tVt2$QW$ot!<\tt<.uou)|$(8t$,t2t>t#L$$ $ɋL$$t<$.tTytN<(uH|.tAM;w(.+>sG*D$D$Q@(D$ 9s$|||jQjhR)))x ^_[]1))lj$||||PQhR#뽐USWV Չ $[_T$8D$4 D$L$D$"u$|||jQjhR|$4QA$93<$779$x|D$D$|D$ ||D$0t$4QEAt$jPt$  tT:|$L$4\u jt$jht$D$$L$H)UE|$:t$D$4Djt$jht$D$$E":rMl$4E"u$|||jQjhRMQUA+<$-y'n'D$4L$D$ ^_[]ffffY]T$4D$#lpÐUSWV[k]|$ l$t$~Jt$~2UVax(ƃ|$tލF9wȉ9v&(+t$^_[]ÐUSWVP[\|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }%(^_[]E ffGftC,$RWGxǃ9w,$)xD$ hHGftf,$RWf 8 9Xσ95,$)5|$ oGwtc,$RW胡 8 9σ9,$)|$ oGwtc,$RW 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [XZ|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$.a# ^_[]Ð~34$U迟x(ŃtߍE;$wMȉ;,$v "(+l$xD$ h,h,L$H(ht$0Quu]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5"(LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[W|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$. ^_[]Ð~34$U/x(ŃtߍE;$wMȉ;,$v k (+l$xD$$h,h,L$ H(ŋT$0PhRQuuU}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0](LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWV X(U\$;|$$sS >3t$ t7T$$9+ $>;|$$s* >111҄5|$ t;|$$s(* $D$  8t ^_[]ÍED$Urmu&T$ҋt$ tЋT$Di@tAju븋T$t$ tDi@t*t;|$$sL$ <9uz={jōp}}PQhR|$ E}p}}PQhR{}p}}PQhZRwfffffffUSWV[ËOD$$L$1w|$ u *h0}PUWVt$(t$(QR4 GXOL$ulÐXNL$w1USWVXND$|$4t$01>0N xtNi|$|$8Z~D$D$XD$lj<wsGu1щ$T$T$ $l$ TUT$t/L$ $LQщ$T$ ,$TjT$$D$1պ r $t~|$?TWT$T$ Dzt[$ʍF$и rL$ʋD$T$<$t%D$ЉT$;T$8D$^_[]É\$=~}PQj>R;\$~~}PQj?R|USWVP[ÚLt$ Vǃ|$D$u f0x=|4$V~q19tND$,00r7 L$$ r7zB؃u9}B.뮉$^_[]Í~'~}PQjgR1fffffXK\s ÐS[~K\s ht$ P^ [ffffÐ1ÐX/Ku ffffffUSWVX[Kl$l$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn,L$"jWRPj2jQŃ9D$"PD$tP7D$pD$)D$iǓ$))ŅtUT$ ,T$"jDPQj2jRCǃ9WD$"Pt$ t$V 7t$t$)T$ D$@L$)L$tOT$ ,|$"jHQPj2jWH9W|$WD$6D$lj|$)ƋT$ D$kD$pX txҋ9|Wy>TWPڋD$+D$pyxffffUSWV[Gl$Uƃ;D$vc(`|$UW41tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[EG$$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]5ffSVP[ìFL$t$D$T$ $xRQVPQ'x9rRQPY ^[USWV[[F|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[E|$t$l$tt$$PW%t?^_[]VW t W LJWVUF ͐SWV[\Et$|$jW1Ƀ PVW ^_[ÐUSWV[E|$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[ÜDt$t5|$r#u#jV#tjV$F1 ^_[S[>DD$tL$ ttu H1[ [ÐSWV[Ct$t_|$G?wS>1RjV"t3jVU# tۃtjV"t jV/# ^_[ÐSWV[\Ct$tAjVq"t2|$jV"wsf~ 1 ^_[ffS[BL$T$ hP[ÐUSWVT$0L$@[èBuD$\VD$ P=ǃx\$D$t6rR=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$$$$$D$D$D$\$$|$,Vt$8PQRWǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$ht$ :u`nD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\$W$PQ?#\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$D$(D$ D$h л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$LиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$L$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$L\$t$,PV1D D$,\$XPVuD$,D$$\$L|AɋT$0tD$)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$ $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$N4D$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS["|$  w >L$s*D$@--tr0twPu@-7[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[ "D$Hr %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[]!t$ >t0V 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[Þ D$ L$t9u[ÍGPQjpRyS[N D$ #L$t9u[ÍGPQjpR$D$t&L$tu1u 1tÐS[þL$ D$Qss)ǀ[Ãuu ǀ[ÍGPQjpRuS[ND$tL$ t 1[[ffUSWV[ j W1tQ@@jjPo f(_8tU(W莝E(^_[]ÐSWVP[Ë|$tcOGQ9u0$jQPn 08t  G $GT$pw1^_[ÍPQjZRySWV[t$tRtC|$t3~t-0蠜~r4臜;~rPtVk^_[ÐUSWVP[zt$t@F$t*.1tt$Vt 9<$u1^_[]ÍPQhR뜐USWVP[T$J $Ћ*1|t$WBt94$u|$ l$tWyE$F;$} $)Qtu<|uprP $كU|URPQjLR uNURPQjMRffffS[L$T$ hPt$ [ÐUSWVT$ [T$,t$0|$T$t;D$,|$"v+F1ɋ\$ efVPAu+t-t $D$1D$$T$,u6<$0u0 v y u y P t&D$j.PWV!tl$t$ y D$PSL$QRPD$PWU  $t!QLl$|$TG )|$TWT4$l$tNjM;L$ǃD$H=;$D|$ uNfff -t$t$PL$t$(cQt$@Ff$w-j4D$0$D3V3dnPW|$t$8t$HQj%蝐T$T$@t$$P6ctt$6Pj%`$D$@9F f|$0u D$(8gt$|$u$L0VѰƃ$FD$L$@;L$,L$8$ 9L$8t$@V|$,WP轓T$ t$1D$D$,)PQVt$0t$0J<ǽ1$Hfxx\$t$<|$ 9$|$\$D$49D$r4l$4(PRYo l$4L$)L$‰$D$L$L$t$E|$(|$@^D$(xD$(xz$t$$L0VJ=~ $!D$1$D$$1D$\$|$$Rt1~D$$T$$|$D$D$8$Hd\$|$$L$|$$D$11 ;t$th\$ :/1$Hl!9ht 9uf|tR\$ utDtP9|1뙋\$|$tg;\$}aK ;\$tP~T\Rΐ|tNf9~fTtNf|tP뤋\$|$$L$>uSt$Wt1T$ T$G j(_¸hl$D$D$ D$$D$$1|$ D$ l$Pt$ Vlǃt$Vt$ t5ꐐ< t쐐D$D$ t$h < t< tePWult1ɀ8 L$L$D$D$L$ t WPtT$$9s=ȉ81X|$.uQ$rD$09wCL$ 1ɅD.1ɍD$09u$D$,T$PB D$(BD$ L$$J|$;D$0uXȃ4^_[]ÍPQhR跨]PQhR萨B3PUSWV։[ä_~XLZu 1^_[]É4$t$0t$u'_ t E<)׋$΋$x`<$1L$D$ D$$}T$uUy$T$ E ulD$;tM E=t܉t$L$4QPBt$ T$$u#D$<=u$ELM D$$|$uIt$MtȍL$4QPL$t$ $D$$$ʀ|$ D$T$0t-E uEjjjuT$ $!у‹4$$t$E0D$E0D$ D$u?vUPuTE)΋M0E0D$L$ D$tEE<)‰T$Ή4$MuT$$M8t$()L$ )ʉT$M< $/4$T$MED$()L$ )L$$M $D$E L$0T$+T$T$,|o$t$ 2T$t$ 9T$}OD$(L$,ȉE)L$ {D$ ET$ҋL$ E@9tR/WD$1+ELt$!!jQVuT$ !ƒt`EME0MtU@9tQVD$e ߋD$)D$U u E;D$UstjU|İ^_[]Wt$ t$,uT$ !ƒtˋE0tU@9t Q>VE0EEEe jUX|1뙋t$uyb)EۍYPQjGRϚYPQhR訚D$D$ D$NYPQhRqEtfffUSWV [Èt$@|$4u>FD$FD$\$jt$8Ty1D$D$t$<t\$j D$Pt$< ŅD$T$1ۅ|$~QT$ *tA9T$8ut(p9r!1Ґ8uʃ9s1.)D$1ۉ L$ɊD$t$D$ 14$W>D$ ^_[]Í hPQ1܍+i ZPQhRq ZPQhRǂJSWV[ܾ|$t$tt9h(#WV ^_[Í+iZPQh?R_uǍZPQh@R9룐USWV[Xl$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Í+i%ZPQhWR\LB%ZPQhXR2%USWV[Hl$ |$ttt9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]Í+i2ZPQh{RLLA2ZPQh|R"%SWV[<|$t$tt4WV^_[Í+iNZPQhRu̍BNZPQhR먐SWV[ü|$t$tt4WVJ^_[Í+iYZPQhRDu̍AYZPQhR먐SWV[<|$t$tt4WV^_[Í+ifZPQhR~u̍BfZPQhR~먐SWV[ü|$t$tt4WVJ^_[Í+ivZPQhRD~u̍AvZPQhR~ffffSV[=t$t$Vt$t$t$~>.u^[ÐS[t$t$t$t$t$J[ÐSV[͹t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS[ît$ t$ [ÐS[ÎD$t$ P[ÐS[^t$[ÐS[>t$Z[ffY ÐXL$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVXx$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$:PQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$w;t$b\Gn߃^rxo;l$1\,, $*wkdT$Ɖ*t$i $*wi (Ћ4$Wm;|$Yȃ|$ U(!Ћ$:PQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )${(^_[]Ë${ᐐS[jt$t$t$[ÐUSWV([ر|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ "q0|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[NL$T$ hPt$ [ÐUSWVT$[ɉ$t$4|$ |$0t=D$0|$ "v-xi1T$VPqU\$u+t-t$0u#D$ D$t$0t@D$u20u- ^_[]fffSWV[L88 8tfd^_[fff̀rS[4t[USWV[|$ T$D$l$$ht$L$T$(PVUWt$<9taT $+t$ QT"1^_[]ÐUSWVP[Êt$T8$l$ L$T$$t$,PUVt$8=9tS8+t$ S"1^_[]ÐUSWVtՉL$^$D$ D$p$$D$t$$E<%t#P$9HE֐D$D$ 11ɃuۃU|$ u1ǐ u1ɺD$D$D$D$ D$ uXl$$yqQi|$)Ÿ +AD$(ml$$ƃ|$ Qiʐ)mu;i)\fɁf=mD$( 0$Iʉ) i͓$) )҉)у}9)l$|$ OQi)l$$mi)\fɁf=m$@  D$ l$$IʉЃ|$ g$ V L$ \$ف,t$DPQ$j Vh$99u\$Pk $@ D$ $@  D$ l$$hQkd)<4 kd(  $l$ \$S\$SD$\$,t$D$qP$j Vf$99u$H*R )tȋL$ \$ف,t$DPQ$j VJf$9<#9uD$\$,t$D$qP$j Ve$99u\$;D$\$,t$D$1P$j Vqe$9cS9uB\$S$H+HA$I ȋL$ \$ف,t$DPQ$j Vd$99u$@t)$p$IЃȋL$ \$ف,t$DPQ$j VDd$96#9uD$[l$$hQkd)<4 kd(  d\$ \$$l$ $~  \$KD$ ~ Wt$Iu 1\$Pt$- $$9\ \$  9u<$N $@ D$ D$DD$D$\$,t$D$q P$j Vb$9zc9uRD$\$@t$D$q P$j Vb$99u$@L$ \$فTt$DPQ$j Va$99uD$\$@t$D$qP$j VOa$9A39u"$H*R )tȋL$ \$ف@t$DPQ$j V`$99u$@L$ \$ف,t$DPQ$j VZ`$9L39u"$9 9 $91$y L$ 9uD$L$\$7$D$DAD$HAD$LA D$PAD$TAD$XA D$dD$D\$Pt$/t$.RPQjV^$9)9u$9 9$Htȋ\$,t$DPQ$j V^$99ur\$GL$$$Wt$ $ƒ8\$,t$D$qP$j V ^$99uD$DD$D$DL$\$$PWt$ $H‹L$Dtȋ$;t$f$$xQkd)Ѝ4 kd(+dF$z  D$D ljNj\$Pt$!ƒ $\$މǍD$DP !ƒ)L$D8$9_ C9u2$Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$`Q\$щkd)Ët$ Qkd)i{kd)Ɖfd\$6L$D$9 9uL$Dh$9 9u1 t$l$u7y3$9a-B9B09<\$t$DRP$j VZ$9 9u1 „tÜ\$ \$$l$u2|$ y+ $9-A9tfA09t[ $t$DRP$j V^Y $9\$D9u<$5L$$9 9u1fɋ\$hebf tƜ\$u7y3 $9-A9A09 $|$DRP$j W9X $;$9$u䋄$$i$$$$\$\$P1|‹$1‹\$t$DRP$j VW$9qc9uRHx1t$DQP$j V"W$99u $L$ 1t$DQP$j VV$99u $\$1ƍ|$DVP$j WdV$;$s.t/9$u苼$*$$ $W1$z 8-Є$$t9s u755\$]\$$=L$ $<$\$t9u4$<$Ήƺųʉ kdk<)΍\$hVP$j t$TVT$$99u<$D$ ;D$pu t^_[]Ë\$USWV[(s( ʼnƅ~<01WUjP;8{<$D$l$ l$hT$$PD$PUt$(t$89t5< $+|$ %<"11P0^_[]ÐUSWV[XrX ʼnƅ~;01WUjPk8;$D$l$ D$ʼnT$$t$,|$WUPt$89ti; $+|$ Y;"11Pd^_[]fffXq88ÐS[nq88tP [ø[S[>q|$tP[ÐSV[ q|$ tV诩V覩1^[ÐUSWVP[pL$y~X$T$GsY11t5iFs/T$hFdNt%:-00t4֋T$!t0O$1+dF( :-00űT$uЅ}x~vaFs+`FdNt:-00t.։!t1O%1+\F( :-00u҉u, 11Ɂ<$)ȉ0 ^_[]USWVP[kD$tQՀ:D$PytHǀ}:d$j"u1ɉP7Dž1N 9}m>dNhP Cǃ=~ѿTFFF fFdžhFdždFdždNUTCY~Uiȃ1sMt? 2dN1Ґ4zw,9u_1^_[]Ã1ҐdNzw_|eNzwQhfNzwCTgNzw5@9u6ƄdN_ƄeN_ƄfN_ƄgN_̐11ÐSWV[h88tWzƅ~L202jj!jPu W9^_[ÐSWV[lh88tW ƅ~102jj|!jPfu Wɠ^_[ÐSWV[ghREƅt(T$jtVZ181^_[SWV[ìgt$818Vq(18^_[ÐS[~gt$jt$t$[ÐUSWV8[CgM 9QT$,|$(utd\$~t^N9߉ЉL$ |~FtkL9| }_^FD$ 9߉D$ T$|$\$3)L$ 3` 11uP*-R[ H(B\$tr;~N|c1Ƀ|T|$T$9}'4}t$;tt$t}։9|كu>L$dFL$(uVz,T$iFH hFdNP(}m^1+dF( JыV+D L\$jhY`QP ӺljT$Y`kiˀY`iӐǐ|$T$T$|$)‹t$ˁ€Y`;|$|$ |ىЉD$ L$$;D$U}|Rut]9D ΋u}\$`.1iD$ \$WuPVStML$;NL$NH}+L$T$11։Htt$΋\$Ӊ11ىpulje^_[]ÐUSWVP[:d8}tlPQ+4 $` u ` 軝Dž<$}t+P艜ƅ,$~X-01K4 ,$|$1jPUjWܪ/DžuP*^_[]hmP ` ڜQW FUSWV[c88t P蹛ƅ~,01Rl$|$0 u1jP UjWܪ[DžuPV^_[]ÐSWV[|bt$|$PQv` 1WP(t [ H(^_[ÐSV[bt$L$` t$Px(tt[ H(^[ÐUSWV[at$84 8t8PQ踛` u ` QDžtA,PQ耛` 1UP't [ H(^_[]htP ` 踚tW듐USWV[`t$|$l$PQ` UP='tt[ H(^_[]ÐUSWV[Ë`t$l$84 8t<PQt` u ` ŅtQXl$PQ8` WP&tt[ H(^_[]h7tP ` dtU냐USWV[ë_88t(PIƅ~)0z|$1jPܪt j&PQF` ܝjP}ljՅuP趗^_[]ÐSV[^t$D$ t"PQ˘` ܝjP^[ÐSV[}^t$D$ tF t"PQ`` ܝjP^[ÐS[^D$t@ PN[ÐSWV[]|$t$tF PQۗ` ܝWP^_[ÐUSWV,[Å]D$$$(=ΉT$y |F &D$ D$l$jP$LP$LW=+|$t ֋|$ ωjD$P$LV +ʼnր|$t |$ |$G $@D$G~$(PjQz" G>D$Hm~w р(uhF7dN-00tƄ(T$L(T$벽%8D$$;$(P,^_[]Ët$1D$9D$D($@D$iF9D$u19tL<(iFT$9tT$L$ dFT$+dFt$1|$F T$jD$P$LPU\)|$u|T$jD$P$L$L2)|$uRD$$@dFL$ +dFL$1y D$A Ջt$*Tʼn֋|$ $SWV,[ÙZ|$<$GD$GD$G D$ GD$GD$G$D$$D$D$ PQX` ܝjP|$x ,^_[ÐSWVT$D$t$>O<4lP~;F~^|1ɉ)^_[ÐUSWVP[êY88t+PHƅ~#00 u1jP4$t$|$ܪt6BR lP~;yQi|1)΃<$uP詑^_[]ÐUSWV |$(\$$l$ MAL$ I $ lP鐐~;YQq|1L$4$lP됐~;Cs{|61\$()l$$9}aD$L$ 4$lP1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lPL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[V88tU菏Džta 8B0 ujjt$|$ܪtVWP ljU9^_[]ÐUSWV[UVE$fBt?:$uʀ/\$ ujPWjPW t)YD$ ʀ/\$ uGH/t/1.tt:L0.uL0.u.|0/uD$V |0/uJ /u\$ m\$ hW-D$?= t$LD$\nfo/D$XoneiD$Tre/zD$P/shaD$L/usrL$`\$ PWQ D<`h@ WυeD$LhPWm ,D$,Ww$dNL$<lPD$8l$L$PD$$ÈL$+D$dT$e t$f L$gy΁ D$`T$a L$b щL$cyʁ ʉT$4D$hT$i L$j T$kt$y с щL$D$lƒt$m L$n T$o\$|$0yс щL$ D$pƒt$q \$r T$syӁ ӋL$D$tƒt$u |$v T$wyׁ ׋D$1T$4L$ vD$ y 1p h =] U I l$$\$]D$\$HË\$‹L$ [B,9D$,@D$0 D$tQD$xω\$ L$L)T$,hT$0RWQ8|$+D$$ @D$$t9 D$4t9 D$D$ BZz 1D$yt$$1\$x01tDt$$D$9|$ D$Ѓ\$u5K s CƁyK s K s K s y ȋ$\$K  Ƌ$\$Ƅ:>L T9}$\$9Ήы\$$Ƅ:>|$ l$~^ 9L$1>\$4$<t >~mv9} 91\$x1t$$t$B|$1 ʃ{ s {y  $dFK/iFSN 9hF9D$ut$J 1Q΃1rQ̓1$;8dNT;8eNT;8fNT;8gN9ul$t$|$<1퐐+/9ul$$t$11Ƅ fNfDŽ dND$@1L$8L$D139\$\$HL$Diy1 L$D9D$@7D$t$0l$ ƒt$$\$|$u/K k CyrŁjK C K C K k y Nj\$C ʼn\$3T3 ʉt3 L y ΁ ΋$D$L$09l$ |$999|$@l$t$:B1ƄjF9t"tyҋ$jF׉߅\$ p1ƄkF9Y|$4t/ҋ$kFЉ)D$ xW}t$D$,0W}HD$$0l$,|$L ~D$L| o$x_$\D,KL$M\$ 4$8$h $d1D$$|$ D$$d9 4|$~'1D$<\$ VPbt9u|$L$2)ȋ\$ PVx#L$1wՋ$< |$$ʁdNPVRω D$$ƄdN;D$9D$@$h X|;>:>u$XK߃D$$mH$`D$1\$;T$\$pt $ Y I|$8,~;uM}|1ۉp\$~<$L9t }}* $tDA>YY_$@l$U1Ƀ1ɋ$Rr<$w  $hF<$dF$Rr<$w  $hF<$dF$Rr<$w  $hF<$dF$Rr<$w  $hF<$dF91t3 ́ 1ҋ,$u~}<ы\hFdF9uۋ$xt1D$l$E;$uD$^_[]Ë\$ dUSWV։[GtK<€Ѐ r<r Au)E=T$0\$D$$D$,$D$Pt[HD$ D$ɋ\$~T T$ LL$ IdPdPQPR $Ec\$hjat$$D$ D$~@XPL$$\PD$P]fFD$,ɋT$th㐐ʀЀ rՀr Hu+T$,FFD$81+D$0dFdžhFdžlFdžpFD$,F dNUWP Ƅ.dNL$8eNQt$0Vm >L$,ދ\$JɉT$8t,t ;SL$0L$<<$u L$s8t*D$4I<;t<,0\$T$p\$8, T$\\$8FD$0D$X؉dFdžhFD$iF9uD$$ $D$D$@9 $T$pt$X4D$H $T$\t$TL$D$Dt1'i)\P(\w  ףL$iHQL$HD$D9È\$#| Éȉ\$(L$(|\$()9L$D$D$\$D\p#;D$ \$|D$D;D$HD$>X\$D$L$(L$D$LDp;L$ D$|D$#>\$D$ $‰T$D$&T$(uȋL$(;L$$T$P\$^D$@UD$0T$1+dFD$$D$0~~D$ 1ۉT$*D$ +D$$DTT$iFt29t:>iF>kFtiFu1+dFD$$뿋T$\$D$ T$\$؉dFdžhF1+D$H1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ<1i4Q9uB ^_[]ÐUSWV0T$ $Xq9D$T$Dt14@lP~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$ED$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ %麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$)jhUt$ ќT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9Hl$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUP蛛)Nj\$jhUt$聛L$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$L$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ jt$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUP)jhUt$U\$T1ڽT$\$jjdUR褙)jhUt$莙t$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$<|$ 9|ځ@1ɐ)Nj9}N~ F D$ F$0^_[]ÐS[N2 ` PQ k` [ÐSV[24` jtj^[ÐUSWVT$4X1D$UE1yY\$ t2ډ‰k<)x\$$t$$<\$$\$ Q T$QT$QT$Q T$(L$TI$L$X\$jjƋD$l$|$Ft jP^n~ e1^_[]fUSWV[[%l$|$tkt$u|$$1uC)Ήv0|$ Wt$T$,t1Ʌ~|$ ʼn1^_[]Í%PQjFRq1PQjGRj|$$b;PQjHR@>ffffUSWV[[$l$t$|$tU6^_[]ÍMPQhRʐUSWVP$[#t$,` U[t,j"tPx $Hp L` L` 17"``  xuxt)txu8u밾UZ^_[]Ã듍MPQhRKUSWV[#,` D$ P=ZH` L` L` $P` L$b L$ǐ|$$tD$$9G t GtOL`  tGwЃ GЋL` 9tL` DžuZH` u';|$r$;|$s<$$<$C<$1H` t$ .YH` u#t7W詠u^_[]ÐSWV[ì!t$,` WX"``  xuxt&t xu8uj褏u $p@@ L` L` 1WNX^_[ÍMPQhRIfffffffUSWV[ $$$$$tD$$DŽ$DŽ$ $$jPWW$@jPXDŽ$XDŽ$\DŽ$`DŽ$ts1|$$h$x$p$|$h$V$P $h^PQjPRhy^PQjQRAT $ ;$u ^_[]踊S[.ht$t$Pt$t$7[ÐSWVP[D$L$T$t$ 4$hVRWQP^_[ÐSWVP[ûD$L$T$t$ |$$<$WVRQP^_[ffffUSWV[{t$}XjWkE`HM`~;Ep~ t EXHMX WR1jW4^_[]ÐSWV[L$B`pr`~ ;Bp~ t rX~zX XRQ^_[fffffSP[ÝD$ L$ $XQPRv[ÐSVP[lD$L$T$$XRQPV`D^[fffffUSWV[(T$(t$$|$ t&t"q~TN @14$t8t$jR迿L$0A uy$‰Ņ1@<$1qyQuE)ljuދt$$$)1t$ ƉACAAAjQK ֍PQj=R; ׍PQjQRՋ)v1WPV迸 L$(9l$QuC}T$RPV茸 |$(Gy<)ЉAjQt$$jUv$+D$1t$ Ɖ^_[]ÍQ PQhRL$8AffffffSP[D$ L$T$$RQP[ÐSVP[D$L$T$t$4$VRQPA^[fffffffUSWVP[Êt$|$PV1ht$t$ 7K x=|PLfF FfFfn vF$F,F(F $tjjjV|^_[]ÍqPQj>Rq)ffffSWV[Ì|$t%jW聼w jW}^_[ÍPQj;RfSV[-D$;D$wt$ Pt$V詅 ^[茅VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^ÐUSWV[t$F0u ǀFFF tVu"V腵t9 aV);F|Vزu?1FT$i.;Ft F t uV蛲u^_[]Í*PQjL$aD$?T$,xЉL$"L$1ɋD$,T$,tЉL$T$xNjD$0L$L|$,ut)L$ I&L$ ID$EHMݔ$1|$L$L$$L$L$xL$|$ D$$\$9Jǁ|$\'uRD$\HEH M(ۼ$1|$LL$lT$p|$\$QRWt$8P$PHDžs2D$lD$dD$($t$Pe\$WyD$(A2)|$dD$<D$ t-eD$0R+@ D$0 L$ ID$ z D$0aL$ ID$D$ < D$0# L$ I $XD$D$DD$0eL$ I_D$ ^@1 D$0 H L$ I D$09L$ I3D$D$DDD$0KL$ IED$ =@ D$0 '? L$ Iu $xT$ L$D$n6 D$0 L$ I $T$,L$LX$/׋L$0D$|$usT$R ~$X1 D$0L$ ID$(t $PD$0L$ IzT$R t^.$XD$'D$1D$@D$HD$D$DD$T1$XD$8v D$0L$ ITt@ D$0 m L$ I} NjD$0L$ IT NjD$0L$ IT D$0L$ IT1! D$0L$ I D$0L$ IEHMPEHM$XD$NjD$0'L$ I EHM|$1ɁƄ$/x$D$D$1҉ EHMtNjD$0L$ I Q MQUݔ$$L$$L$L$xL$|$ D$$\$e<fEHM$X$u R0Q.,D$\$4D$D$'1D$@D$HD$T1$XEHM|$,D$:L$,ȁ91ҍ$X1 D$xT$|$t$8$u $\QwPjƒD$ƒ;T$,v$ D$83MQ U)ۼ$ $L$$L$L$|L$|$D$ <$\$ > Dž+L$l)ȉL$dL$,D$$xD$,|$\uƄ$/D$(t$P̃\$W>rD$(*D$L PD$L$Wtm$D$PRGv]D$D$ T$xtOU1FA$2$PQhRUD$uD$ T$xD$,)RL$ |$|$D$G $8BD$D$L$ r‰څtOD$t6$D$PRRu]D$D$ T$xt[1ɍT$xt$2$PQhRUD$뀉׋$8G|$lj|$L$ rEE|$tCtr$L$QPtD$D$ T$xL$4tdvL$4|$R$2$PQhRMEL$uL$4D$ T$xD$DT$ L$ |$T$ \$C D$$(B|$L$ rċUtF1t3$D$PRsD$D$ T$xt1ɍT$xz$2$PQhRBU|$뉐|$UD$xT$ Ӌ$(Clj|$L$ UrIҍD$xL$4ty$D$PRrL$ <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v P;E|$8E|$8|1 uT t$ 9wS$w닔twl$Pmt t$T l$PU\ / U| 룋$L$19u $PK<^_[]þUSWVP[èD$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$蒑USWV [VD$ 069rljT$D$uj$jWPH 讔(觔9$T$JHJHJHJHJ H JH RPE$jWP H(A8t!70t$mI$0*)4$PjVE $L$D$ 81 ^_[]ffffUSWVP[3EET$@t$DT$$dpU }jċjD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjP0 )+jRP!2 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]賍USWV׉[wl$3YtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[cm|$hE t$p |$<$ MM$Ujċjl$l$܋|$Xt$`MƉ2t|$D$Q#.t?ƃ|$|=FWjPT )+jQPE. o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[] ffffUSWV[Ex\$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$juL$tyD$0D$lD$ $D$T$D$\$tNjD$L$ttW% ?L$@\$D$4\$ċj؋E\$+ju P* mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃܋܃$$ۄ$܋,|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wLD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ Ry'D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃD$u[j؉ ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋Ĺ|$$ ʋ|$ ʉ$ڌ$؃ݜ$$$$$݄$D|$<ػ|$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$ZcM |$ ؃D$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋Ĺ|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bكĹ|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃L$T$vثv؃~0vtT$|$ ؋t$pxfaȃ|$D|$ ywsD$؋|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋Ĺ|1t$H|$)3jcwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$P eWD$PccWY_VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wd\$ Džjb|$|$l\$WPQd`؋L$1ҋD$DD$4D$R^D$t/L$4t9t\$Qb^D$\$PQ^\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$ta )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt$k]T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$dD$T$|$YT$< D$D D$XL$,ɋD$@xuC|$(t<u7D$x\$L$uD$x|$(5|$0t"ҋ\$L$Nl$$rvjj t$Y D$t@jj |$L$$t6 ruLQU($t?$L$UA.$1xL$^_[]þTx0ffffSWV[t$|$ty8L$tu1 1 ^_[Í ȋPQj5RxrfVL$T$ tu1 ^Á1 ^fffffUSWV[@M1ЃωT$(ЃM$U dE81!|1 Ƀ9|$$PS\$^‹ED$}D$,1 7L2 79vސ|u; uB1Fj<ċj)B$t-W\$RfRD$PVD$ lQL$ )M ~D$$Pt$ VL$ ^T$ 4:t$ݜ$$|$ #$|$@?|$ $L$ $݄$؃܋܃$$ۄ$܋,҉t$$~@CM ~O$VRM$U +jQP )ЉT$$ۄ$ $܉4=5|$bD$b fD$rl$r۔$l$b$‰$ۄ$ )ƋD$L$@?L$ $$݄$T$$wv3~1ɉy1хxL$0,D$H)L$0D$< 1ɉy1щL$0D$H1҉|$<1} wD$ |$D$~D$@D$Dt$tT$4\$LwmxD$D$,$ۄ$܋<|$`D$` fD$pl$pۜ$l$`$L$D$D$8fD$D$8L$$PD$@ED$D$D$D$8(D$@EL$8DxD$L$Q1 ƊT$ "T$EH ȃt4T$ D$L$~D$(t )Љ‹D$T$(T$ D$(D$D$L$؃|$(r؅b1D$كܹ|$tT$L$؃ݜ$$$$$݄$D|$@ػD$|$^D$^ fD$nl$n۔$l$^$$ڤ$0΃nكܹD$!؃|$8=؋ĹكT$8؃D$ |$1҉ID$|$ZD$Z fD$jl$j۔$l$Z$$ڤ$t0N 0D$9tPD$؋Ĺ|$XD$X fD$hl$h۔$l$X$$ڤ$t؃D$D$9كĹ|$\D$\ fD$ll$l۔$l$\$$ڤ$0{؉L$uD$|$LvPD$ 1ثv#T$u؋T$xvq|$D$D$ ؋S<D$1D$D$ 0؃|$@|$Lt$$L$,+L$ AD$)ʋMI9T$D|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋Ĺ|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ6Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QrPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR8NDž~#T$?؋L$؃T$$jj Q9G |$@c΋$jj t$ G ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QED$$PvET$%T$$1|$D$Ȁy0ItL$RBEL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QR: jt$[LM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P:E ljD$ D$L$L$D$D$QPƉ|$Wt$ 9Mt$ t$Mt$,N0L$ x $tPCL$(T$D:Pt$ LVCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj P(D D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj VFC D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q5B D$(jj t$B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPUH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ [GD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[lD$1r 1 9vW<t8Ɖ^_[ÐSWV[ D$1r 1 9vW<t:L$T$8ƃXt𐐐Xut^_[ÐSV[}D$ PHpR=^[USWV XHT$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUuE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[~XSVH[UD$0hjPZ D$(D$,DŽ$@DŽ$DD$ D$D$$jPj L$(VPQj\-D$$D$ D$D$D$D$D$jPj-\ j[j[S[n|S[NfffffffUSWV[+t$|$tK1tt (h1^_[]ÐUSWV[`}uu \$D$4PHD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$Lظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$0ΉD$|D$|PH/)ƃ16T$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$)1.%+D$9Y+D$ىދ\$ ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$L$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$D$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋt$(PV'T$4D$(XPV'uD$(D$D$KL$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQZ D$p '3 |$4t$N  D$0P QVR t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhP; 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}U("P"L$D$ffffUSWVt$F98[}^ |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[Ó]u }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[ë\t$D$T$<n~,D$9r9s#L$9w)QjP" ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffX[ǀb ǀb fǀb ǀc fǀc ǀb fǀb USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[ÜZD$H~( 1u 9r1$PƉ^[fUSWV[;ZL$8?tPS wc t{c ?u1>P5ƅD$t/Fn?tPFF ^_[]1?tPȐP,d )ʉʁ oΉPoUSWV[;Yt$tbF!r VO8}t3W=}Fc c tWc c ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[(Xl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQR E!r&UE!r\U18}$P}T$,Bc c ti4$ō\8}th$P裍1}Fc c t14$}$c T$, c D$TG^_[]Ëc c 1␐T$1Ɂsrr@r"y(6s@sރx @tS[~Uj,tL$H@[ÐUSWV$[HUD$9| 9}T$P7P|$, $r0wD$PjR $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU7<8?t:V}?Ec Mc $t#VXD$c Mc $^_[]ÐVT$ L$Ar)t^Í29pu9w1^^ÐUSWV[ÈOD$(l$$}p)tx]]M4>9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [LE\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[I$t|1q1gPQjERx P$1D$jjWz ʼn$tƒ9tt#D$PW6to#D$=uTtVƋD$fF $tu fF f~vF$F,F(F eOĄ^_[]fS[îHt$t$jt$0[fffffSWV[|H|$t@jWqGHO~ H0 WjWR^_[Í(@PQj=R 럐SV[Gt$ t%FHN~ H V^[ÍٍPQjIRy ffUSWV[ÛGt$atrt!w 11ҊNtgtGɍyw@ؐ+u˽뿁뷁 ՋL$) p1^_[]Í%PQj>Rw fffffffSWV[ÌF|$f jWrG0ǀǀ 1G t WƋO twуy y wG0tW@9t QG0G0ǀǀjWG GG:h2PQj8RW f  ^_[f̀rS[TEt[SV[=Et$ t;F0u ǀVNuFH^[ÍoPQj;RfffffffSWV[üD|$A8uGG Ⱦ uuL  O @G0taW@9t Q&G0GG81t&WhG GGfG u WG t'DV|PVx|GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÍPQjJRSV[=Ct$ tF Ш u Vk1^[ÍPQj;RSWV[Bt$tp 1mT$ |$L$D$t#t8uӉ6@VRQWP026@VRQWPֈ6@VRQWPL^_[ÐXOBL$ܽAA A AAAÐfffffUSWV[B$u hj1$džt.%u%D$PQ?1t+! 8$u! 8u  $t4D$P$UQ*VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQF|$=|F P$FEt$P$FV EtF4Et UMtЅBt N&tEu hV~p VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFj P ;F@NF(șdžHF DDN ȃN艆8hPjQ MPV%$0$tNCn(1V(1^_[]14dž$j$.tJpH\HH H \HH H8 8oUSWVՉ[T<jqZlj1&NL$jP$$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[:4jQ@# t T81t>0|rPtJ_t u8~)1 9}8tQ ݋t PkVt81^_[]ÐSWV[9|$tOW蚸^_[ÐSV[Ý9D$ p|$s t.jt$ 1dž,dž,^[S[.9L$tAt[[ÐSV[8D$ p|$todž,1t$t$^[ÐSV[Ý8D$L$ qtdž,&t 1҃ƒt$t$^[dž,빐USWV[8l$(D$P $xuǂ$ǂ(ǂ 11Ʌt f9 t3Nt9(B($19w;jjWRƉ Hf9u B(9vB($9(t<ǂ(l$(uND4׍PQhR1$l$(f|A@u(ty(f|AuKAjVPR  ƋHǂ(fytf9ǂ $wQύ4֍PQhR1Vǂ $ǂ(#ydž,^_[]Ë(Lyw+jt$(t$(VRu‰4$w$ trl$T}l$ ]r!l$|}-ǂ$o<$_ tߋ\$ )׉{΋|$$7)ʉW $(11SWV[4|$tu^_[ËD$tx4t&jjW! uЉuLJ01뷐USWV[x4|$(o(o(OG0!D$;G9} $wD$D$ Py$L$L$D$QPt$荠 $L$QjP t$譲$D$ Gjwʫ $tNG(P8O 9~ LDLDG G,9vG0 G,Ut$W艏 ^_[]ÐSV[=3t$ t$t$ #F,;F(~#F0^[ÐSWV[24aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>Nf\>ff>fT>\>f>l>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofGCd\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNF^_[]ft19tTNffTN<f\fff||f\ff\f|DtZ z B b b B z Z B fzffz fBr֏PQjbRrUSWV[Ø!D$ t$$|$ 2~F Bf9ljD$1fDN9L$|N>ˉ>\>fl>ffl>f\>\>ttFD$GD$Gg'GD$GD$GGfoffofG\d\|<\dDDf\ff\fDNVf&VNFFNfVfNVFFN V f fV N F F N Vff V NFFNVffVNFFNVffVNFf1fDN9TN|Dd$D|\Df\ff\fDDtB b Z z z Z b B B fZffZ fBnNȉɉNFȉFF ȉF fFfF^_[]Í֏PQjbRPfffffUSWV[Û|$oEtjPu7 EjWu,EtPE EtPDžDžtP̜DžDžU詜W蠜VO^_[]ÐUSWV[Ø|$0D$,pFtjP61 Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6聰 6Y 1KfffffffSV[ÍD$;D$wt$ Pt$VI ^[ffffffL$1s!t11҃9rfWV_D$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[XL$8t$4T$0t'D$ D$ T$$UOʃ H$@D$)BD$D$D$;L$s)t$Rt$WUt$Vu-l$zOT$(T$ $t$f9T$t$s-q)ɋ$t$rQPR|t$L$ fAA+D$(fAfDqʋM OLL$L| v6W| ~uuWt|T$ t$F($ <L$uF;uFf9rfFl$uYztzuMfuH1ɸ*zσ;L$L$ufjR6 |$p uL$ IQ0VJ 1M;L$LP^_[]1f1ɅL$$D$ 1T$֏PQjbRT$(L$?֏PQjbRZT$D$L$ ֏PQjbR*D$L$_yffUSWV([8D$ZPQj5R虿ffUSWV[õ$$$$ t$tl$xa$%GuS1<7vuN| ?-)щ $,19rj/PtI1ɋD$;$iȁĜ^_[]j>i $E9r}Xtމl$U$)$hPT$RQ%T$$ $$$t!9vՐ}/19w)ƒT$ L$ D$$D$$t%ht$W+ $t*+$hW>`1Ƀ89t$1퐐$(j?Pt$͖ taH0tȋ $):,L$D$F19uZD$PWo>9t$3#ED$PW=E/1Ʌ#D$$=@$$T$j>ѐՍPQjXRgꋌ$!1Ƀ8cfffffffSV[]D$;D$w.L$t$ 9w9w9w9wPQV" ^[dffUSWVx[D$tD$pD$lD$hD$dL$$T$dPjD$@FD$9tC;D$$uL(^_[]Í)ېPQh<R0j$jU0 볍P"VUSWV[%$$D$0D$,D$(D$$D$ D$D$D$D$D$ D$D$D$t$TT$$PD1ɍdT T08u y?u8D$4D$8D$< D$@ D$DD$HD$LD$PD$0D$,D$(D$$l$4|$$UD$pD$PD$lD$LD$hD$HD$dD$DD$`D$@D$\D$Pgj$jPd, [ÐS[P'[ÐS[P[ÐUSWV[ûl$j@ƃ#jv@1jb@j$jU+ WU6+^_[]ÐUSWVhL$$D$|L$4Hpx |$8x|$Սr1ɸ|$r:)11tO7tO7tO7tO79uم O1Ґ4Q79ut$t$ ȉt$͋D$ ul$uQDED$ |$ofŋ\$ DA)fAT$fDQD$tA|$0oWʼn1D11|$L$DL$A+D$ fAT$ fDQD$\A|$0o&ftzՍr1ɸr<)11tO7tO7tO7tO79uمt' O1Ґ4Q79u1L$DD$L9D$PjD$$8$D$p D$t$L$pcT$$$VP\$hRD$pT4t$Dƒ T$@|$ D5tcju t$6c twH jP6e 7E (D W)fWfW7PQRP> ED7fGG G jWD$0Fe 1^_[]ø蝗USWV4XXD$D$PL$(T$ f\$z(D$HD$1f|$ΉL$,L$0σL$$D$ 11D$D$"D$f;D$f9u(D$t$Tf9J  t$xLB4 t$4 LB4 t$ t ރ \$L L$f9v6FLBщL$LB4 t$4 D$f9w;L$,9D$$f9t;ŋT$HJ)fJfLBЃD$\$Vt$P$<\$T$ s/9D$0|$tYD$ tPD$ \$PQhR\$T$f1D$4-=/D$Hfpt$(F(t:F;u3Ff9rfFT$f9s D$HFL$L N)fFff9|$vD$Pf)8D$LD$ދD$f91f\$\$ L{ \$ Ńt$LF)fFfD^\$QRP: f9|$t$19t΋L$ I T$щt$\$\$ L{ 4 L \$ VL$ Tyʹ9\$\$ L{ \$ 1 fD$L$Lfif9uD$LfhD$4^_[]Ë\$PQh|RƐ\$T$\$֏PQjbR蕐\$T$\$PQhRa\$T$\$PQhR-\$|ffffffUSWV[8|$8D$,hEtjPu_ E wJrr G&E(uI1GT$0:zD$PVHtHUD$PV|$$ML$fMjPu_ juu] 1u hE,jju\ ljl$wG oD/DD$l$fpjWu] jt$ u[ DžZc֏PQjbRɍI֏PQjbR虍w8֏PQjbRn;E,jjuK[ ǍD$wsZtvG GtfAjWu\ jVuZ DžuE֏t$PjbQ讌ujWu\ rV(E('Erf9r$fD$E,D$;t$FjRu[ jvuY tW‹~ps f9t֏T$ PQjbR薋T$Xb<$wft$><$fD$2E(uEf $fD$$E($EfD$1$8t$EtP FE EE($}fu E(jQt$xsB tt$t$jbP臈э֏PQjbRdD$֏T$ PQjbR8D$T$Ǎ֏֍PQjbRUSWV[|$l$t$FtPBF FF($nf~ F(^_[]USWV[t$0VT$RQ; Ǹ>  kOfL$$Ɖl$;tjVuW 7GfD$Gft$fD$tl $A ;tjt$uV $@jPuT ʼnps5fw,$l$fwWt$U* t$7֏PQjbRK몉l$whf9u:pjPl$uU t_jVuS t{fGOT$,J3t$ $;tjQuU D$,0L$fHL$fH1^_[]Ë$;ujVD$0oU Ҹˍ֏PQjbRR!fffffUSWV0[cu~,jj6S @|$FD$cT$B }*fqDBtjR7T jV7R D$L$y1fuKT$B 1f}tmD$t$ )ωfvt$ ΋Mfq Pu Q( 1Ʌ~D$붍֏PQjbR҃D$K1}  ft$ ukJtdjQ7Q D$tGp0ft$D$Pu Wo' jt$Q6S D$T$rL$ f9uWJtPjQ7 Q D$t0fD$D$Pu uV& t>jt$QR D$}t$ Mfw ED$e^_[]jt$QR D$L$N FE;|$1ҋuT$Gjw6LP rWpD$s8΃9jPu6Q T$;|$uT$$֏RQjbPҁT$4D$jt$VQQ T$L$O WM;|$1҉T$ Gjw6oO D$jPu67Q T$ ;|$u1O}fNt$T$u _1ɉD$T$T$LHt2fBjP7P jV7N L$L$}1룋u fzT$ D$֏D$$D$(uD$T$ LH|jP6P jW6N \|$T$ ps-ut$1ufyu:8u 9u1)^_[fYD$8P4P0P,P(P $P P@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^(L$<A$iA D$AQT$QT$IL$1t$$(77)(QjPz F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPYz <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVy^_[]ÐYD$XPTPPPLPHP DP@P<@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[þt$t$t$ [ÐS[Ît$ t$ F[ÐS[nL$T$ j[ÐSV[=t$ tA\j@PVO FPhjPw F@FDFHFL^[ÐUSWVXձ$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPn FP3nPtPWjPm UVj~jUm FPNHVLN@VDPV^_[]ÐSV[Ýt$ tAj@PV{D FPhjPHm F@FDFHFL^[ÐS[>t$t$t$ [ÐS[t$ t$ [ÐSWV[t$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjV+l ^_[fffffffT$D$fUSWV[MD$$&yd\Ḱ ~? gL$Ē \4D$ ( D$D$8PjD$D$8Pj1 D$8D$D$ D$D$ D$ED$3D$!D$D$D$D$D$D$ D$ D$D$ "D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ VD$D$ RD$$2D$D$ %D$&|D$D$ (D$D$ )D$D$ *D$D$ +D$,D$D$ <0m 1D$D$ D$D$L$8T$jjPQjRE8tD$80m D$D$D$ BD$D$ CD$D$ DD$D$ ED$D$ FD$D$ GL$BvL$!L$5L$QFL$`L$xL$L$גhjjjPQRCD$L$8T$jjPQt$R6L$81 u/jPy _UiK1D:0D$D$D$ D$L$8T$jjPQjRD6t$8|$<7QPWVD$D$D$ D$L$8T$jjPQjR5D$XL$ L$hjjjPQRuMD$D$ D$L$8T$jjPQt$Rd5tD$8he^_[]fffffS[ [ÐUSWV,[l$@D$D$ D$$D$(L$ D$QPj W1|$D1҃|$H1‰|$4m 2NQ;WvRPt,NQW QRP FEE1^_[]ÐSWV[D$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [ȖT$0|$,D$(L$$)q092sVP$D$00$D$ jU0:( Ÿtr|$9rL$EQPt$V jUD$(0)D$ )t+Ɖ4$juD$(0' ŅD$u1 ^_[]ÐUSWV[ؕL$$D$(T$xD$PQ1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0( L$,+|$ $t*D$D$Pt$(/L$njUD$,0( 1ɉȃ^_[]ÐUSWV[Ȕ|$D$ hj07w& tk@ uVxPQP4$9vDt$jW66& t9<$)HL$PV9|$w jP7' 1ɉȃ^_[]ùfffffff̀rS[t[̀rS[t[S[Γt$ t$ jt$$t$$t$$t$$t$$  [fffffS[Ît[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[ؒ$D$D$huLET1}8XM4tI$PE8*$$E4E0|$ 1D$L$j`QPu8VR6(ƃ<$t$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$||$ W L$Ƅ$D$TnPWt.$Ƅ$8u$L$ThPQ $ 1 $Y?l$$PWM!D$t2) $j UW$W1Ƅ,j W$U !UjD$$PU8 ʼnpUD$ 8u D$ 8V1|$TF8u)$Vt$ D$,P ]F8N~4ƅA|$ u9nF@uzF$P$PFt_`u|$ <5$h$PWh h$PWR U|$|$Tt$h$PW |$ u9nuqF$hPW nD$l$ŋ|$$ 9D$ x$2$($,t%t!$u$QP t$|$"$t$|$t$PCE$$t8YSltC$($,2D$XP$0& $0$$tRt$t$w;$r^_[]Ë$($,kc7$QP t$bҋ$0t D$TPB$,$ $$t%(tPD$(PQ% $$(1?7$($,91$u$QP t$|$/D$)ЍRuA8Q`uǁɋ$($,$u$QPW t$|$ t$$tPBA$$t Q"$($,uWP t$l$$t$|$t$P@E$$8$j`3t@8@P$i$t$|$t$PQ@E$$t8P&t$l$tW@$,$$t(O?$($,t t$7$QP t$$t$$tP?$$tL$$s.SWV[ÜtM΋uA~8t:~4~"`N4F8 I9rP+F8^_[ffffffS[.D$L$ AQ jQ0 [ÐSWV[܄|$t$t+jP6 tH  W6,^_[ff̀rS[tt[̀rS[Tt[USWV^5$ M$|$xts,$1ӈ\,tT,8s8uߊ1t<,$ Ot.T8s8u1QW,$M;$u ^_[]ÉffffUSWVLXHD$L$ht$dl$`u tq|$l1҃‰ ȉT$DT$,D$tD$,ۉ\$(T$s AD$8BD$4ȃD$ ЃD$0l$@)D$Hl$1T$ D$$iPT$)rx,D$GD$ \$D$pPUW|$x׉ t$pt$l$Uу x=l$a\$t$pt$|$ WT$x xA|$ ;l$@l$x$\$t$p|$Wt$ T$x x|$|$D$؉D$ )\$D$pPVL$DQ|$x׉ t$pUVу x<\$t$pUt$DVT$x y!!x\$t$pUt$DVT$x x|$+L$l$ \$D$pPUL$$QT$x D$ t$pWUT$x |$ x)|$M\$t$p|$Wl$$UT$x x,(x$\$t$pt$|$$WT$x x|$l$|$\$D$pPV|$W|$x׉ t$pl$UVу x5T$|$\$ \\$t$pt$Vl$UT$x x/T$|$\$ x'\$t$pt$Vl$UT$x xT$\$ |$,tUD$t^\$01҉>89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$ L$HD$h9L$\$t$pVWT$x L$uσ|$,\$h|$tKD$tU\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<st$Pt$t$t$[ÐS[st$ t$ T$[fSV[rD$;D$w.L$t$ 9w9w9w9wPQVB ^[5ffUSWV|[Ør$PU}1#D$=h(jkƋ$$v1ɍDT TDTTDT D T$ u jWt$dt$dc* M;|^_[]ÐVD$L$T$ t$ $^ÐSWV[\qt$t~tT$y|$u 1M H@΃|8t<΃ DP@VP N@^_[øPjj%Q6USWV[Ùp; s.Pjt9H>t̐Gtu1uOHO tww$Ѓ gq91pjPQw蓥1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[\ot$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[øPjj%Q4SWV[ÜnD$L$Pt prxxp| pPxtz xyV&1^_[ÐUSWV[(n|$ l$9v`wDt9xtNȅuT$81$Xq3X7<H71*׋PtIQPEjPQD$ pD$,pL$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y{6ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$p62 D$ L$Q$ЈA1ÐSV[lt$ V PtHP tQ P V1^[ÐSWV[ükt$>gthGt tww$Ѓ gpNjPQw%;u<tww$Ѓ 肜4^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[ljD$t$tA|$1ɐt 9u)tPjQ/ ^_[fffffffUSWV[it$0|$,ttq`3TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P Pt$8=t +l$1jt$8o1^_[]fffffffUSWV[(i|$(T$$<Gx:B tzu?Rt*t2 _2F \$/}u,D$ $#L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wf t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$ D$$8t$$T$(thA9},ߋ\$Wt$ t$T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RT$(1Ʌ$\$PW2D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP# D$$ $t$$nL$T$( 9J9s\$VWP t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ÍPQjGR(T$4PQjHR}(T$4USWV[Ûd|$tpjWG 1o7)/1ɨuOOtVUwW, ~])uODt[wуQDW̜LP=W貜1fu- O @1jW^_[]ÐUSWV[ëct$tpN 1t`~tY.)>1uFFt$UWvV, ~)uNDtvу N @1^_[]Í7PQjZR&lffV|$t$ L$uD$^ÃrfftFGfVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[bt$8uN uRt8F0t~@9tRF0N FFfN ~u VkN u1uVVF11+NN^_[Ív@PQjIT$B=sXDP%[͗&[ÐS[HT$B=sD$ DP%[Í˗[ÐS[ÞHT$B=sDP[Í֗[ÐS[^HT$B=sD$ DP[ÍޗC[ÐS[HT$B=sDP[Í[ÐS[GT$B=sD$ DP[Í[ÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[TFt[D$t8t9@€tuuuuH+D$ÐffSWV[E0t1ɠjWQw t u1^_[ffffffS[ÎEPt$t[ËD$ĭ1[ÐfffffffSD$L$ T$@AJtq8um@AJtxtb8u^@AJtitS8uO@AJtZtD8u@@AJtKt58u1@AJt<t&8u"@AJt-t8u@AJtt8t )[Ð1[ffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐUSWV[ë>l$$t$|$t9t5D$,tL$ z91Ʌ1^_[]Í6ߠPQhR말T$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐSV[=t$t8D$ t|$tT$t121Ҁ9 11^[ÍRߠPQhRC뤐D$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fffUSWV[<$*Љׅtϋ$t}RWPQ$$$4UhVH$yPVjk S[N<t$jt$t$PUSWV[%<$$$$L*ЉՅt$ t}$RUPW$,$<QhVt$Lt;̣l$VPQhUJPUjj LtWD$ hjP' D$D$DŽ$DŽ$ L$VPQjL$;$^_[]ǃLmPfL҃¿+w狔у̃ǃƒӥS[N:t$jt$t$[fffffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffSV[9D$ D$D$$jVjti m uƃm tjljj0jVj3i jIjfffffffSV0[*9t$̀rS[t7t[S[^7|jPt$t$t$[ffSVP[,7D$L$T$t$4$VRQP^[fffffff$D$4̀D$̀fffffffT̀rS[ä6t[PS[Í6[fffffffS[^688t3[Ë[ffff̀rS[$6t[S[6j1[ffSV[5m u#m V>u1m ^[Ðfffffff1ÐÐ1Ð1ÐXO5PÐ1ÐÐUSWV,[5l$D|$@o |ƃ =sdfo Fw%o =uɋo 뿐o QUhWL$L$뀋o |$@l$Dt1o t& 9s8u+po ϧƃo 賧D$D$(D$$D$ D$D$D$o D$o D$ o fD$o D$D$Uj(P׃8^_[]Í PQhR]fffffffUSWVX3$$$D$$D$@$t. [  $D$1D$4|$(݃B <%t9sߐD$$D$0D$l$D$ L$ z{\$$*MD$ H1 w81A*MЃ rl$ D$l$xD$두l$D$념1퐐,AȉӍQЃ r܉l$0l$7 L$tȉD$ $D$D$L$0\$0 $+D$ $ $@ $1:lu $ʋl$ $ $ $|D$D$yD$D$\$x2uMu u^u@uoL$l$(L$\$ iD$l$\$L$l$(L$l$L$\$+EM뿋L$l$f(뎋 $ $ɋ|$D$ x6uu u!u /@t/|$oЍWT$‹D$ $-L$xL$L$1ˉ\$1ω\$|$$D$ OC$D$ UD$$G8L$L$D$DD$ ch$|$\$$u"u u@tɉL$D$D$11D$u D$$ l$D$,T$ \$$Ujt$4 +D$,9$ʼnT$ $|$\$$ u"u u@tɉL$D$D$1$D$$GD$4$|$\$u u u @tɉ/1L$D1D$DD$,$|$D$D$ $D$$GD$4x1\${D$oD$1_D$oЃD$B/GT$ l$ u $ $ʃuʹD$$T$ D$ ۉT$ |$\$D$ x$$D$‰ T$4u$D$|$TtZ$\$ |$؃E1ҿ9T$T$4Ér$|$À0ʼnD$1;|$l$r͍i$00 $rhD$D$\$$jj WPmT$PQhVRT$ $1y1ɃD$D$ s$tl$\$8D$$T$ T$0ՉT$PQhRQ$\$$^z>PQhR$x\$$TD$@;$u ^_[]Ë\$$聑USWVP[%|$t`1<$t5x$~hX~f} tUT$ ^_[]ÍPQj:R<|ffUSWVP[Z%D$l$H1 m \$D$H1yt9~u~f;{uًv;suD$t~u밉΀~t뉋t}u ~vD$$*jt$Pi tAt=}txuHT$f;Ju׃xux uxuxu1^_[]ÐUSWV [#$,$Vf1f $$0~ )$,$0hL$ QWPV/ix[9wQWmGPrm;$$u;$(u$ D$ Pmȋ $ $1 ;$u ^_[]aUSWV ["$ $q if;$$$(J ;$,Ѻx$ #ȋI(ux(u ff9<$|$~hWV$0W$0gxS 9wIVlFPl$,$,PW|$Wu11<$<$;$u ^_[]USWV[`!ED$} D$0$u\$ jV=~ t$t} D|$ |$ L$0 ;$e^_[]ËKu at8\$ XVjjP蜶Vt$WuJ]KCD$L$|$D$|$ D$9C y{1K ꀉL$9Otr:L=t&/Of;L O;Lt<Of;LOЋ\$ jPQT$ 8eT$ ] L$]DŽ$\$ $Q$QPT$ T$ ] ut  L$}:Hu[t"uQL$~f;HuF$;H4L$~f;Hu)\$ jP$P]dT$ ] |$ u<]fǃC ~lvr‹9‰}FfDŽS| tًt tȌt tȈ4 | |Ȅ|$ tȀC fD$ D$D$@L$#=@\s t$t|$| t$K$K$KS$$L$fL$<މt$vZuDD DDDLLDVfVL$уutt4؍<؃ǀ 뗋t$Vtȍt$| t$$]D$D$$LDD$D$$4$4$4$4U$0R&U׶=r,j$ F;$u;^_[]Åt|.u|$aUPQhWf,hffffffUSWVX[Ø$L$p|$lGtG,t$x&9t$|8wPVt$|UQ$$E$ 5BBWhfG@f$#  ʋ$G@ ‹$G% ‹$$L$D$ tyA L$XU|$QWRD$ P$6AxnNj$L$|PQjE$L$xPL$QME$ǃ$fB$) $W 9$A A L$|PQD$L$xPQD$PjD$PQD$ztQ$W$ $11#2#j ,$#B ȉ2jB)׉X^_[]ÃL$XQL$ QUWP?ƅxՍ7Pj C7Pt$C7PjC7PjC$ 1۸$IUSWV[;l$ |$t$D$@t"P ) l$$FPj)5CF|PQCfFD$@ u1ftPf VPBVjBG fffG )^_[]ÐUSWVP[Jl$0t$$T$ |$D$@t0PT$$։)͉ $9L$(B99t$4D$,WPBGPl$UBGUVP誔L$4 )΁r&ԥPQh=RCL$8QPA+l$ ^_[]fffffffS[>jt$ [ÐUSWV[$ $D$0$jU@Et U uEEEj eU U fE@$hjV\ Ƅ$fDŽ$5E d$ dDž`DžDžDžDžfDžhidtkǃhpjP̻ EMOEGEG ƇLJarpaLJip6.ǀ,intǀ(ip6.D$ jU?D$ djVU LPpƅD$$}`hVWъ ƅ_EH}DM\D$ 19s( w 1҅tމ8D$ Ϲրwr tt$$D$ avPd tPǍ$WhhPXE`D$EHD$E\D$4D$D$|$Uǀtǀx|$t$$Whh$PA$<#t<;t΋$doma1$in $sear1$ch #Xj P$P9 $sort1ȋ$list1 $opti1ȋ$ions1 $< t<  鍔$P5 $< t< 0$< w \A< vhQt$8 ƅ_ePt$NnD$ kc$< t< H$< w&A< vhQt$V襇 ƅ_j VtuDU`1qL$ t ut1P6;L$4r+$< t< L$;L$ $F< t< tcPV`< D$<@@@@ @@D$@D$8kj5Pj j$PD$PD$;t$ s E$EtJMP\EDt%uHrPWu퍃sP!yPetuV[ML$0 ;$u ^_[]VUSWV[t$xPdžft91 9s)tQdDŽͅtMtt|%X9ut&xt PW idžtPhdžf^_[]ÐUSV[Euo jP|^$D$F$FrWfF e^[]ÐUSWVx[ÃEL$ L$puo D$jP ^D$3D$fGt$VjWVd VW*GL$ ;L$pue^_[]zTUSWV[t$xPdž|$ft;19s)tQdDŽfdž~}L$1yuVty |+ y|+9qt+<+y l$|5y|59Y\5|5|$9}逃|1F ^_[]ÐUSWVՉ[D$Att$0UP EO $L$(T$ L$L$L$ F< t< tjt$V jPVܡ Ӧj PV¡ jPV訡 &j PV莡 byj PVt kjPVZ  jPV@ "jPV& %j PV PyjPV jPVؠ 1jPV辠 9jPV褠 Bj PV芠  4jPVm LjPVS $`FP#5d$/FP|Gt^ĦGddGtAPt$'F P|GGtݦPQH7< < {$H׋$ut$0UP $~PY뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]PVS?r?D$PVt$y D$L$Ƅ|$PVNS?r?D$PVt$Ry D$L$Ƅ($H^_[]ÐUSWVx[È$$l3o h3o p;o t|P9h@tP|x$D$D$%D$ D$D$D$PjjjQt_ett.T$Lp t{NDDDDD DDpp .j2Lp tǃpp ǃPp ^[ÍUSWV[Kj02ƋD$F Pz2FF蠍(Ff~FF,Lp t Pp 1ҋL$9uF(Lp thPp 9tF F$F藋(Lp Pp rlp RTp dp 8p Xp ^_[]19u뫐S[ÞQPRz jSWV[lt$8Lp t3Pp 9t^t,Xp Tp zlp Lp t7Pp 9u Pp ~t vI?V@?^[19uΐS[Nt$?[ÐWVX-L$ tsAQQBQQAA,Lp tDPp 49u4Pp 4~lp vTp dp 8p Xp ^_19uSWV[Ìt$trTLp Pp t/<t)Xp Tp zlp ѩdp t$ lPQjS[ffffSV[t$ tjV\f jV^^[Í٪PQj5R}ffffffUSWV[Õ$t&j$$P)$u $$$1:D$JL$D$ D$JL$D$D$J L$ L$PQhjrNjh$t!A3APjhjj5t{Njh ʁʀ $4$jjjVOd!ƒu.Ё8u$$! P讁(p$t u|! D$$Pt$]-D$| $W?RPt$m @ &l+(ɀ GGIG G GGGjjuH tTP у1uP VPuJ $tMtH! u?jUu.B(W$t 4$e(1Ġ^_[]À!SV[=D$ pFtjP6I F!u^[ffffffUSWV[۵t$ D$hEtjPusI EwL$8uL E(t6}$.E(! ujUtst9v! tn9΍GjPU t,L$M(}$QVWPUa !@uEIBj7uyH 1WUƅur}$O^_[]ffffffUSWV[kt$ D$hEtjPuH Et}^_[]ËD$8t;v! uWUƅuƃjWU tt$jjPUG !@uEj7ufG yUSWV[Èl$(9s$QP,D$ L$t$;t$,w D$,D$1;t$t$yjt1tK[jutWVx $$t$jD$PVU8u&<$Q;t$,s!^_[]ÐUSWV[8L$,|$(19D$t$oity;D$touF$WV+)L$(žϋ$Eht ;D$uD$ )ʼnl$ɋt$ttjD$PVWL$6L$uu D$,91^_[]À!USWV[t$(9s)QP*$$D$ L$;l$, D$;|$tel$Íh1Ґ4B;t$s9Չulj)‹l$ut$($Rt$,Qu $jD$PUV5u;l$,b1 !^_[]ÐUSWV [èL$ ;l$$siT$ T$9s^D$ǐT$8t 9u)L$jD$PUt$,4u2;l$$uNjD$ 1D$ ! ^_[]fffffffUSWV[ۮt$D$xGtjP7tB Gt\u^D$tR;wUjPW, t=(@PUW 1PU7B ujG(uw^_[]ÃtRG$jPW tՋ(@PUW? 1PU7A uG$ 1랾뗐USWV[øD$$L$ l$DA4DtFPUL$(>A)VPPT$, <$fzL$$tJszft1ufAf9s $fzL$$fuzJV)kftwftfL$1f/f9t;_,$f9r1ftf9s $fOf9s $fO)ȋl$L$fsD$ f@1^_[]1f\Of9tTO$f9r1fOTO$f9r1f\OTO$f9r1f\OTO$f9r1럸녍aUPQhRyoL$4T$0^L$֏|PQjbRIoL$T$0zaL$UPQhRoL$ffffffUSWV[+t$nEtjPu> EjVtE 1t u1@u)d1Ƀ Vt^_[]ÐUSWV([ht$@l$<}GtjP7> G ujU芌0 81qujWjjjU 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$r ;D$uTjD$PD$PˋL$O$t:jjjT!уtRP_ u !1(^_[]fffffUSWV[{|$ t$tGw#jP!džL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RP t2MQUQRP EG/1^_[]ffUSWV[H|$$G,D$$jj78 9Ƌ\$(D$1GDF $PV7:\$ jt$78 ƅ\$(F `VT$ 1L~f9t<9vD$ \$$|$:xfz߃LL$L$,6$tM 1$֏׍|PQjbRi\$8=$roD$L$,td;l$tX14Eju7[7 t%MLH4jP7.9 ;l$unL$1 Gw)f_ ^_[]ffffffUSWV [(|$(L$$iD}wQt$$nM $uL$ I t΋ $t})Ɖʃ9u{\$\U+ΉL$)؋\$PRT$R5 $9~ |$\$?\$$fL}fD}9L}D}fufL}1܋|$EftEftUtUs)ftUfUD$ @8D$$H1 ^_[]ÍPQhRgT$믐USWVhXȣD$|$|G =tŋ\$jj$W/{$jj$W \$H I xfL$4*AD$D$D$D$ |$JDw L$H w)L$LL$T$PD$HPHD$lw9f|ww L$PՉT$ )‰T$T\$RQ$Wo ;$wDw|$ f)tJNjT$ )ωL$ ً\$RPQ DuT$ ff+DuL$fDMfTML$L$D$ |$51 $iEft$t$0pt$T$4z|$,D$$L$l$L$(T$T$|$|Mfv#f|Mt$ ;\$D$XP$D$0p Pt$ t$(Wz!GL$\ɋ$;T$XT$+T$`\L$ЋQL$IL$,hD$(D$$t$ TM+D$0fE<l$ 9e)fLFflF\$jt$,R$WWO t΋hD$0L$$ɉD$(t\$QWl$$l$$l$D$$T$Eft$ T$MfG =t‰T$ fl$D$ tuD$  (L$8 .))ƉT$L$@|$Dt$<\$WQ$l ;$uoL$fyr>TQ9t$$W-l$ƋHL$T$@D$8Pt$L$,fyr>TQ9vWt$$Wl$ƋHL$,T$@D$8P\t$0T$@D$8PEt$T$@D$8P.t$l$NE|$f9s&LuWfff9lj|$|\$ѬƬT$ PQhTR!bT$0eL$ ͋L$)f49wT)fLGflG1$`D$4`h^_[]11D$$tЋ\$PWh1뿋\$ҬPQhR|a끐USWV[ÖD$lAB9w}) >P2Q D$ft$ 4L$͋|$!E;l$Z\$08un19؋$p L$08:T$0jjjjQPR\$085D$;l$t C 1Ҹ;l$uC #S$9)\$u 9~ 1t&1wɉ!u L$ \$0s ,2;k$|C$D$ 1~(;lD~ 9uDžt=+t@,}z T$1'>T$\$021|CT$F\$0C LDLDLDŋs T$9u3|$$j1Pj _1JуT$  1ftbljڋ$jt$8VPRz1ɃFt@HT$*]tjLjfLjfftjf|jfDjfȃ^_[]Ë$V1Ʌt‰ D$0L$ЃVhPL[\$< D$L$fC<DD|?EC LDLHLD1\$0t$ DD,$T$11$D$081\$$-PQhRzX\$T$ D$4@USWV[ÈT$B =tL$|$ t1|$,t*l$$|$(tVz<t~UwT$ D@jf!P=tfOtfO1 NjJ֍PQh$RUF I>֍PQh6RxUF USWV[Õ$($B =tŃu)kjPz{$0Ɖ$4$,zl$ <$u D$$8L$hUPL$Q茘tW$(B 1Ƀt!1ɐ|lω|͉l9uDȉDz|$OfȃfT$r2ٺfDTfDTfDTfDT<uڅt" T1ҐfQ9u$($4$0t"j<tQWs$,D@: ŋJDHjWPV6i`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVh+l$͉ $l$,t$0t$ED$9G u*D$G4$P- L$,1TMGDHjWPVg t&dž(@f8u$dž  ^_[]ÐUSWV[zA =tl$$G)B fT$L$D$ uf͋t P,$Uj|$(todž(dž $FDGjRPVftiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$K^_[]DGjt$ PV]f t׋@f8u$dž wSWV[Ì|$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[6T$$wA =tF)G D$ *$Ffu^L$t P4$jL$t$,t$,jWQPt$DFjWPQetjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $IЃ^_[]ÐUSWV[t$0l$$D$jPj |$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6slotportal [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availableunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdout%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputabcfGgHhiklMmNnPqt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %sCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/HEAD-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted oncannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s number out of rangeinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupno previous patterntrailing backslash (\)infinite substitution loopnothing to undoTAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsrfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/HEAD-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/HEAD-llvm/i386/20260209220454Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Usage: %s device %s device command [arg [...]] Available commands: B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdgetmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyhiddensympermrumpautomountedgetargsrelatimeusage: %s [-o options] special node realpath '%s' failed"%s" is a relative path.using "%s" instead.bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/HEAD-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/HEAD-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of paritySTART array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status:./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s Cannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). unknown %s command: %sbustarget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcache[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. vpd%s: scsibus%d target %d lun %d <%s, %s, %s> t10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISAS proto%uunable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneVPD Device IDs:VPD Serial:entire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:Error in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x %s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! STRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description)LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkbLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_START[?1000h[?1006hMOUSE_END[?1006l[?1000lticmso|^LESS_TERMCAP_%s$<[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0seek errorread error8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.butf8UTF8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFinvalid charset nameinvalid chardefchardef longer than 256Integer is too bigLESSHISTSIZE.less-history-file:.markLESSSEPARATOR.search.shellLESSHISTFILEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOME"%s less %sExamine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):!done#done|doneNon-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/Pattern not found(P)/usr/bin/.syslessLESSKEYIN_SYSTEM/etc/syslesskeyLESSKEY_SYSTEM/etc/syslessLESSKEYIN.lesskeyLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledXDG_CONFIG_HOME.configWarning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"Input preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xless:vim:vi:ex:set ts=tabstop=LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},...skipping... Cannot seek to end of fileCannot seek to end of buffersCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisualback-completeforw-completehomekill-lineliteralword-backspaceword-deleteword-leftword-right#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version line%s: line %d: \x%02xmissing = in variable definitioninvalid escape sequence "\k%s"missing actionunknown action: "%s"LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8;]8;;\Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current filem %c %d %s %s Mark not setInvalid mark letter %clog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber too large in '%s'Number is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Msearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filelesskey-srcquit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollquotesshiftno-keypadold-botfollow-nameuse-backslashrscrollno-histdupsmousewheel-linessave-marksline-num-widthstatus-col-widthincsearchuse-colorfile-sizestatus-lineno-number-headersno-search-headersredraw-on-quitsearch-optionsexit-follow-on-closeno-vbellwordwrapshow-preproc-errorsproc-backspaceproc-tabproc-returnLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sunknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo  timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf %s: unknown variable %s=%-5daccess denied out of core beautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... alphasumioaddrresetvideobootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/HEAD-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/HEAD-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP InformationB:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferHLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/HEAD-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!usage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... Alias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sUnable to determine new working directoryOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifier:]not compiled with history supportnul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguous[%d] %ld Cannot fork (%s)You have stopped jobs. && || ! | if else fiuntil ; do case ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-NetBSD shell: %s NETBSD_SHELLCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionUsage: rotate [n]can't rotate that many";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALL!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %sbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bgchdirletfalsefdflagsgetoptsfcinputrcsetvarulimitumaskunaliaswordexpevalPPID20220122 BUILD:20260209220454Z SMALL REJECT_NULS#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complexArg %d: %sArg %d: %s: not completely convertedArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: %sArg %d: '%s' numeric value requiredUsage: %s [-L] format [arg ...] discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflaglflagillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...] HLPRdfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... owner:group|owner|:groupAB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%hhu:b%c#%llu:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtencan't get msgbufdfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!untitledlost+foundwrong type to dirscan %dNAME=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/HEAD-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRReadonly mode, no changes madeRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedNo GPT foundCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Can't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juSize must be a multiple of sector size (%u)Legacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vMedia size too largeUnknown command: %smedia size too largeCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]gi:b:luaxAhHpW:w %*s %*jx %*ju%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: %lLong_Type: %s Attributes: %s en_GB.UTF-8UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?] (active)GPT part Unknown %#x%jxBKMGTPECould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%ju %ju %u %5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zu[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]UUID changedab:i:L:s:t:U:[-o outfile]/home/source/ab/HEAD-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimeinet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] in_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/HEAD-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediasubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s RATES:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI: or @ speccan't get net id for host "%s": %sg:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point -mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic numberD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:Cannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src Dstdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlenaf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20260208%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lldWriting to networkCan't access `%s'Can't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. FTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)123456789cdhlVn(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directoryopen: %s%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlVn] [ [ ...]] compressed uncompressed ratio uncompressed_name%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] Could not initialize menu system, please check your terminal type. ExitZeroconf/sbin/reboot -q/bin/sh -i -E/sbin/halt -q%-35s %.50s.tgzgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)8.8.8.88.8.4.42001:4860:4860::88882001:4860:4860::8844/bin/ksh/bin/cshrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdmdnsd+nsswitchAdditional packagesaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enter9600192003840057600115200BIOSWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" <: page up, >: page down%c: Help: exit: x, page up: u <, page down: d >Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6FS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed [sysinst: environment variable TERM not set. Dr:f:C:m:p%u:%usysinst: screen too small 11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/usr/share/sysinst/catalogsysinstmsgs.usage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Log ended at: %s # Script ended at: %s sysinst terminated. /etc/openssl/cert.pem/etc/openssl/certs/usr/X11R6/usr/X11R7/bin/XDynamic menu creation failed. /tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s %s: failed to open %s collect%s: failed for %s vasprintf(&scmd, "%s", ...)/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filerealloc(argv) for %s:%%.*s%ssysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect(2) failed but no child died?select failure: %s /sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf ; ; BIND data file ; %s %s; Created by NetBSD sysinst onsearch %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5https-_.+!,-_.+!,/%s://%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" /sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.greipipgiffaithlo0ppptunnet.inet.ip.stats/sbin/route get -inet defaultnet.inet6.ip6.stats/sbin/route get -inet6 defaultiwi/libdata/firmware/if_iwi/LICENSE.ipw2200-fwipw/libdata/firmware/if_ipw/LICENSEhw.%s.accept_eula%s=1/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:%%%02X-a /usr/bin/ftp %s%s/%s%s# Added by NetBSD sysinst 127.0.0.1 localhost.%s %s /usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.conf/sbin/dhcpcd%s -d -n %smanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; donemcd*fd*xbd/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-tffs -o async-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-tffs -o log-b %u/sbin/newfs_lfs %s-tlfs/sbin/newfs_msdos-tmsdos/sbin/newfs_sysvbfs-tsysvbfs/sbin/newfs_v7fs-tv7fs/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-text2fs/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 /mnt,dp%s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d ,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuidkernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto %stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disks.cmount_disks(size_t)(l - fstabbuf) == num_entriesbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%s%s (%s@%s)/dev/drvctldrvctl-commandget-propertiesdevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)hw.usermem64/sbin/fsck_%s%s -p -q %s%s -p -b 16 -c 4 %s%s -p -c 3 %s -o %s [%llu @ %llu] %s [%llu @ %llu] kern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug%-40s %s/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/.sysinst/usrrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %skern.entropy.needed/etc/rc.d/random_seed stopmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/sbin/umount /mnt2/netbsd/sbin/init/etc/rc/etc/rc.subr/etc/rc.conf/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/etc/localtimeUTCzoneinfo/usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%scat <>%s/etc/rc.conf /etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsCan't convert to localtime 0x%jx (%s) preposterous clock time /home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../util.cstr_arg_subst(size_t)(t-out) == lenvndconfigcgdconfig/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'get_available_cdsm >= 0 && m <= n/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2 dd if=/dev/random bs=32 count=1 | openssl base64 rndctl -L %s/tmp/entr.%06x %s rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %sdd if=%s of=/dev/random/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../label.cedit_and_check_labelcnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%llu - %llu %s, %sedit_fs_type_extndx == cnt%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s/altroot/bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /bin/mkdir -p %scd to %s cd %s machdep.bootmethodUEFIwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_ext/usr/mdec/mbr_bootsel/usr/mdec/mbrCan't find %sgpt biosboot -b %llu %s/EFI/boot/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootableOut of memory %d%d%d%d%d%u%usshdntpdntpdatexdmpasswd -l rootchpass -s %s root/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %s/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgin/usr/pkg/etc/pkgin/repositories.confs,^[^#].*$,%s,/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %ssource for 3rd-party packagess,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s /etc/nsswitch.confs/^hosts:.*/hosts: %s/chroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu %-50s %-10s/tmp/checkrc.shchroot %s /bin/sh %s 2>&1var %s is %s Could not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /dev/%s%c/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.cdisklabel_set_part_infoinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal errordisklabel_write_to_diskparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:%s -f %s %s '%s' '%s'disklabel -w -rdisklabel -r %sdisklabel_change_geomdisklabel_freedisklabel -D %s%s. %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../part_edit.cedit_outer_partsparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]select_part_schemestrlen(ms) < totalouter_fill_part_menu_opts(op - opts) >= 0 && (size_t)(op - opts) == num_opts------------- ------------- ---- %13s %13s %-4s %13llu %13llu %-4slibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/usr/lib/emul/aout/emulmv -f %s %s/emul.oldmkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/libmv -f %s %s/%s/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s %-37.37s %s %s%llu%%%s <%s>%zu %s%-35.35s %c %s/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.creplace_by_defaultparts->num_part == 0normalize_clones(target-ui) >= 0 && (size_t)(target-ui) == *num (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../partman.cpm_whole_diskpm_from_pe%-15s: %s%-15s: %dpartmanPartman device: %s %s: %u%-20s: %s%dMvg%.2d%-20s: %lli%-20s: %dlvol%.2d%-43.42s %25.24s%s (%s) %s %-56s (%s) %-56s %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llipartitining error %s RAIDframe configuring error #%d CGD configuring error #%d /tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dcgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.conflvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %sdd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %svmresered/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt_get_uuid_part_typegpt_get_part_alignmentparts->disk_size > 0gpt_get_part_devicep->gp_flags & GPEF_WEDGE%s_%lli@%llisysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sgpt %s %s -b %llu %sgpt -r show -b %llu %s 2>/dev/nullStart:Size:Type:TypeID:GUID:Label:Attributes:gpt_read_from_diskstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt_create_newgpt_freeparts != NULLgpt destroy %sWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.cmbr_get_generic_part_typembr_get_part_devicewedge_dev[0] != 0/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinside_ext_partadjust_ext_partmbr_add_partinfo->nat_type != NULL/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/home/source/ab/HEAD-llvm/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errormbr_write_to_diskparts->geo_sec != 0write_mbrmbr_read_from_diskmbr_init_default_alignmentsparts->dp.disk_size > 0mbr_create_newmbr_freeb:ef:l:p:zinput sizegzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipeusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] %s: no terminatorcontrol_recvdata%s: no arg buffer%s: no args%s: eloop_event_add%s: unexpected event 0x%04xcontrol_handle1.unprivunpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_handle_data%s: writecontrol_handle_writecontrol_handle_read/libexec/dhcpcd-run-hooksexiting due to oneshotdhcpcd_daemonisedhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: carrier lostNOCARRIERdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquired%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: interface departedDEPARTEDdhcpcd_handleinterface%s: interface updated%s: interface added%s: getsockoptdhcpcd_linkoverflowroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlehwaddr%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %sdhcpcd_signal_cbreceived %s, %sSIGINTstoppingSIGTERMSIGALRMreleasingSIGHUPSIGUSR1renewingSIGUSR2reopening loglogopenreceived signal %d but don't know what to do with it--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s--helpdhcpcd 10.2.3 %s /etc/dhcpcd.conf:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start[manager] [ip4] [ip6]%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited%s: waiting for an %s addressSTOPPEDconfigure_interface1%s: carrier lost - roamingNOCARRIER_ROAMINGdhcpcd_reportssid%s: connected to Access Point: %sDUID %s%s: IAID conflicts with one assigned to %sPREINITdhcpcd_prestartinterface%s: removing interfaceRECONFIGUREEXPIRE6EXPIREdup2 %dpid %d failed to exitdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_readdump2dhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to backgrounddhcpcd_handlelinkdhcpcd_initstate1%s: config file changed, expiring leasesInterface options: ND options: DHCPv6 options: DHCPv4 options:Compiled in features: INET INET6 DHCPv6usage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]/var/db/dhcpcd/duidDUID too big (max %u): %sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/eloop.celoop != NULLcb != NULL && cb_arg != NULLeloop_event_deleteeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_q_timeout_addcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initreconfigurevendorclassidleasetimepersistentinform6userclassvsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrclientidnolinknoipv4llnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrarpingfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivemudurllink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogread_config%s: embedded config too bigdefault_configunknown option: %s%s: per interface scripts are no longer supportedparse_option%s: hostnamehostname cannot begin with .failed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %s%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporaryinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentadd_environ%s: no assignment: %snd_dhcp6_invalid CIDR: %sinvalid IP address: %ssplitv/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/route.crt_headclear0&ctx->froutes != rtsrt_disposert_new0rt_setifrt_newrt_proto_addrt->rt_ifp != NULLrt_freert_recvrtrt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtrt_buildif_missfilterif_missfilter_applyrt_compare_protort1->rt_ifp != NULLrt2->rt_ifp != NULLrt_desccmd != NULL(null)%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d reject%s: %s%s route to %s/%d via %srt_addnrt != NULLkeepingchangingif_route (CHG)if_route (DEL)if_route (ADD)deletingrt_delete/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/sa.csa_addroffsetsa != NULLsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_toprefixsa_cmp(sa, &ss.sa) == 0sa_fromprefixsa_toprefix(sa) == prefixsa_addrtoplen > 0sa_cmpsa1 != NULLsa2 != NULLsa_in_initsa_in6_init - %s /home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/script.cscript_buftoenv*(bufp + 1) != '\0'*(bufp - 1) == '\0'STATIC6ROUTERADVERTnew_script_runreasonDUMP%s: executing: %s %s%s: control_queueifcarrierifwirelessinterface_orderPATH=%s/usr/bin:/usr/sbin:/bin:/sbinpid=%dreason=%sTESTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truemake_envstatic6%s_%sscript_run%s: %s: WEXITSTATUS %dscript_status%s: %s: %slocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %ddhcp_envoption%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zu%s: SO_RERRORif_opensockets_os%s: SO_USELOOPBACK%s: socket(PF_LINK)/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/if-bsd.cif_carrierifadata != NULLif_route%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvifif_copysadst != NULLsrc != NULL%s: SIOCGIFALIASif_ifa%s: if_addrflags6Berkley Packet Filter/dev/bpf/dev/bpf%dBPF version mismatch - recompile%03d %s%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_broadcast_address=%s%s_network_number=%s%s_filename=%s%s_server_name=%s%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s leaseBOOTP%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/dhcp.cdhcp_informia != NULL%s: releasing lease of %s%s: %s: short frame header %zudhcp_packet%s: checksum failure from %sdhcp_recvmsg%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %sip_addresssubnet_cidrnetwork_numberserver_nameMS %s: using %sClassless Static Routes%s: duplicate xid on %s%s: renewing lease of %sget_leasebootp != NULL%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: DHCP lease expired, extending lease%s: DHCP lease expireddhcp_bound%s not founddhcp_openbpfdhcp_readbpfdhcp_readudp%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s: packet exceeded frame length (%zu) from %s%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAKNAK:%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressdhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledgedlog_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%s: failed to request the lease%s: waiting for DAD on %s%s: redirecting DHCP message to %sdhcp_start1%s: dhcp_init%s: discarding expired lease%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseread_lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DAD completed for %s%s: DAD detected %s/home/source/ab/HEAD-llvm/src/external/bsd/dhcpcd/dist/src/ipv4.cipv4_deladdr%s: deleting IP address %sipv4_getstateipv4_addaddr%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifainet_dhcproutesstate->addr%s: forcing router %s through interface%s: router %s requires a host route%s: deleting address %sipv6_deleteaddripv6_addlinklocalcallbackipv6_newaddr%s_ip6_address=%s%s: pid %d deleted address %s/var/db/dhcpcd/secret%s: cannot read secretipv6_readsecret%s: cannot write secret%s: adding %saddress %stemporary %s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u secondsipv6_addaddr1ipv6_getstate%s: IPv6 static DAD completed%s: waiting for %s to complete%s: too many duplicate temporary addressesipv6_tempdadcallback%s: regen temp addr %sipv6_regentempaddr0cannot find a loopback interface to reject via%s: %s is %sreachable againnd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%s%s: %s: router expired%s: expired %s %sipv6nd_expirera%s: expired route %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sipv6nd_recvmsginvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressipv6nd_applyraIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %sipv6nd_handlera%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RA%s: unable to obtain a stable private addressipv6nd_dadcallbackipv6_makestableprivate%s: Router Advertisement DAD completed%s: waiting for Router Advertisement DAD to complete%s: delaying IPv6 router solicitation for %0.1f seconds%s: soliciting an IPv6 routeripv6nd_startrs2%s: delaying Router Solicitation for LL address%s: sending Router Solicitationipv6nd_sendrsprobe%s: no IPv6 Routers availableipv6nd_handledata%05d %sDHCPv6 packet too short from %sdhcp6_recvmsg%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %sdhcp6_openudp%s: delaying DHCPv6 for LL addressdhcp6_handleifa%s_dhcp6dhcp6_startrenew%s: ignoring unicast option as not manager%s: %s %s with xid 0x%02x%02x%02x%s%smulticastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f secondsdelaying%s: %s: sendmsgdhcp6_sendmessage%s: sent %d times with no replySOLICIT6ADVERTISE6REQUEST6REPLY6RENEW6REBIND6CONFIRM6INFORM6RELEASE6RECONFIGURE6%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)dhcp6_recvif%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: status truncatedUnknown Status (%d)dhcp6_checkstatusok%s: DHCPv6 REPLY: %s%s: server sent USEMULTICASTSuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix Available%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: %s: DHCPv6 REPLY missing IA Address%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: DHCPv6 DAD completed%s: declining failed DHCPv6 addressesdhcp6_startdecline%s: failed to decline duplicated DHCPv6 addresses%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %udhcp6_startrequest%s: failed to request DHCPv6 addressTIMEOUT6%s: no advertising IPv6 router wants DHCP%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 leasedhcp6_startrebind%s: %s received from %sBOUND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: DHCPv6 lease expired%s: %s: no valid lifetime%s: waiting for DHCPv6 DAD to complete%s: requesting DHCPv6 informationdhcp6_startinform%s: failed to request DHCPv6 informationdhcp6_start1dhcp6_recvdhcp6_startinitdhcp6_readlease%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 leasedhcp6_startconfirm%s: failed to confirm prior DHCPv6 addressSTOP6dhcp6_startrelease%s: soliciting a DHCPv6 leasedhcp6_startdiscovera:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> new path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s ping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlim/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snap ,archivedsappendschangesimmutableuappenduchangeuimmutablelink#%hu%d:[%d,%d]%a[%a]:%p%a:%p%A[%A]:%P%A:%Psat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x/dev/XtyXX/dev/ptmpqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pida.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdaygmtutcwetwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetTokenRingFDDIIEEE802.11CARP10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdskinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZEould not malloc for key entry add_new_key: bad type passed inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!/home/source/ab/HEAD-llvm/src/lib/libcurses/refresh.cmakechcsp != &blank%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^Gkbskcub1kcud1^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdb_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitRCMD_CMD/usr/bin/rshCannot exec %sR%zu W%zu L%lld %d *1*02aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/Argon2dArgon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_number.c_prop_number_allocrpn == pn_prop_number_externalizectx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON0x%llx/home/source/ab/HEAD-llvm/src/common/lib/libprop/prop_intern.c_prop_xml_intern_find_tag!((*cp) == '\0')_prop_intern_decode_stringctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist