'VTjP0%NetBSD/earmv7hfeb ramdisk 08jP<  jP}t tjP@@<@T 08jP<  jP}t tjP@@<@T UjPtpp`AjPjPjP$ hjPjPjPAjPjPjP.A.jPjPjP AjPjPjP/AjPjPjP'AjPjPjP/AjPjPjP`AjPjPjPaAjPjPjPbmDctjPjPjP (08@HPX`hpx $jPjPjP (N$djPjPjP08@HPX`hpxK$jPjPjP{M$jPjPjPFAjPjPjPdCjPjPjPeAjPjPjPfAjPjPjPl!jPjPjP ajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjPajPjPjPajPjPjPajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjPajPjPjP ajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjP!jPjPjP4!jPjPjP!jPjPjP!jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP B!jPjPjP B!jPjPjP!jPjPjP"!jPjPjP"!jPjPjP"ajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjPajPjPjPajPjPjPajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjPajPjPjP ajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP!jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP!jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP !jPjPjP!jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP\?!jPjPjP\>!jPjPjP\=!jPjPjP\<!jPjPjP\;!jPjPjP\:!jPjPjP\9!jPjPjP\8!jPjPjP\?!jPjPjP\>!jPjPjP\=!jPjPjP\<!jPjPjP\;!jPjPjP\:!jPjPjP\9!jPjPjP\8!jPjPjP\:!jPjPjP\7!jPjPjP\6!jPjPjP\5!jPjPjP\4!jPjPjP\3!jPjPjP\2!jPjPjP\1!jPjPjP\0!jPjPjP\7!jPjPjP\6!jPjPjP\5!jPjPjP\4!jPjPjP\3!jPjPjP\2!jPjPjP\1!jPjPjP\0!jPjPjP\2!jPjPjP\/!jPjPjP\.!jPjPjP\-!jPjPjP\,!jPjPjP\+!jPjPjP\*!jPjPjP\)!jPjPjP\(!jPjPjP\/!jPjPjP\.!jPjPjP\-!jPjPjP\,!jPjPjP\+!jPjPjP\*!jPjPjP\)!jPjPjP\(!jPjPjP\*!jPjPjP\'!jPjPjP\&!jPjPjP\%!jPjPjP\$!jPjPjP\#!jPjPjP\"!jPjPjP\!!jPjPjP\ !jPjPjP\'!jPjPjP\&!jPjPjP\%!jPjPjP\$!jPjPjP\#!jPjPjP\"!jPjPjP\!!jPjPjP\ !jPjPjP\"!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\ !jPjPjP\ !jPjPjP\ !jPjPjP\ !jPjPjP\ !jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\ !jPjPjP\ !jPjPjP\ !jPjPjP\ !jPjPjP\ !jPjPjP\!jPjPjP\ !jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP\!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP!jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP !jPjPjP!jPjPjP !jPjPjP!jPjPjP!jPjPjP!$jPjPjP4!jPjPjP!jPjPjP!jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP !jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjP!jPjPjPajPjPjPajPjPjP!jPjPjP!jPjPjP!jPjPjPajPjPjP ajPjPjPajPjPjP ajPjPjPajPjPjPajPjPjPajPjPjP\?ajPjPjP\>ajPjPjP\=ajPjPjP\<ajPjPjP\;ajPjPjP\:ajPjPjP\9ajPjPjP\8ajPjPjP\?ajPjPjP\>ajPjPjP\=ajPjPjP\<ajPjPjP\;ajPjPjP\:ajPjPjP\9ajPjPjP\8ajPjPjP\:ajPjPjP\7ajPjPjP\6ajPjPjP\5ajPjPjP\4ajPjPjP\3ajPjPjP\2ajPjPjP\1ajPjPjP\0ajPjPjP\7ajPjPjP\6ajPjPjP\5ajPjPjP\4ajPjPjP\3ajPjPjP\2ajPjPjP\1ajPjPjP\0ajPjPjP\2ajPjPjP\/ajPjPjP\.ajPjPjP\-ajPjPjP\,ajPjPjP\+ajPjPjP\*ajPjPjP\)ajPjPjP\(ajPjPjP\/ajPjPjP\.ajPjPjP\-ajPjPjP\,ajPjPjP\+ajPjPjP\*ajPjPjP\)ajPjPjP\(ajPjPjP\*ajPjPjP\'ajPjPjP\&ajPjPjP\%ajPjPjP\$ajPjPjP\#ajPjPjP\"ajPjPjP\!ajPjPjP\ ajPjPjP\'ajPjPjP\&ajPjPjP\%ajPjPjP\$ajPjPjP\#ajPjPjP\"ajPjPjP\!ajPjPjP\ ajPjPjP\"ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ ajPjPjP\ ajPjPjP\ ajPjPjP\ ajPjPjP\ ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ ajPjPjP\ ajPjPjP\ ajPjPjP\ ajPjPjP\ ajPjPjP\ajPjPjP\ ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\ajPjPjP\! jPjPjPi!jPjPjP!jPjPjP!jPjPjP ajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjPajPjPjPajPjPjPajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjP ajPjPjPajPjPjP ajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjP!jPjPjP!jPjPjPajPjPjPajPjPjP!jPjPjP!jPjPjP!jPjPjP B!jPjPjP B!jPjPjP!jPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjPajPjPjP!jPjPjP!jPjPjPajPjPjP ajPjPjPajPjPjP ajPjPjPajPjPjPajPjPjPjPjPjPbpf!jPjPjP $jPjPjP($jPjPjP$>jPjPjP+$jPjPjP0$sjPjPjP2$jPjPjP8AjPjPjP:m jPjPjP@H7$jPjPjPP; $jPjPjPXAjPjPjPgAjPjPjPhAjPjPjPiAjPjPjPjAjPjPjPkAjPjPjPmAjPjPjPnAjPjPjPoAjPjPjPpAjPjPjPq p+S4҉|"[t'!\SsBLF^;.BTh!wTZ%c4mwZsw l=7>i(Q1\~ 1j5jJ #8?^.~VD@7yew kEn3sGzT0Pȃ 0}s/?]= ABrbB,iFlmzZRU; ,l!# ZƧ%Y %qd\?/^c5"$0[.,Cرa =W,`65?qB_aQ %?Sz*ez +,(~jww&(,ĽM^(G u6f5^x6dI p_DGWFݶ+u }HSFNƨ=q(?N]o#h@ ^{N]*HI.WU&co r4Yxat . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4`4 (PP   hLL   NetBSDAPaX NetBSDearmv7hfeb3D0D 0p@-F+`fpywh+iK8FV "oȿ+aoXF`P;HYFh#Oc+a8K` FU M)hHF$0ZЛB) FU%jhR"!XFUV0 FU1hHF pCO FU1hH>F3h+)FXFU, I I#hZF8FDUH( Dљ@T Kn:f*oB² *IVӹmQeppG&IFFH TXJh3`pGp-pCF-FK"F)F0F` @IF@F( e K@1 I H! {z"h~p@Yp,RX0p FFmF@)F0Fx H1F. pyh-ApG#sFF `.=0FUFX;nh+J$h#@c`.2Щh0FUt(C+I+H O$)KEp;L9F.20FU^0*;@h-+.IH$,HUF(ѩhHU(ѷ OH)F($ I$H O FHUH00+.,ԐԚԆK-OhFHUI UF(~ЎIH$x!Fj"FU>AF KXph+KJhhCЅK+@Kh+0yH U0nvI|HZ0FU<+nvKh+FuMmJ tI(Fh0;0+ PF*2Fđ(F (0OUF .I:F =!6*F*IF#;Cx'I*F#"IF"hhBIhC#`Ch8FGJKFJ`! KC#C#`#`LKKIK p=# &ւ֯!; D u (8KLhMchk`2B2A khc`##8bh;A1??xE][ p KRKpG p J I:J I8kF[ijG bj IkpCj_ iIG#j( ""C#b6##j"G??:h+#jC@8mF3tBF F@!"FW pFj.؃k"!0FhGI vk0FhGbpשF FF IjF Tk2F)FjjGF:"iFh T:` Fp K-O(MezLFF+N#mK 1FCEr =#DK#2Rc e2BsCai i3i#iDca.#SQ E9C@YI" OUM e3B\(#SСl'k jG??bkHI BFGHIFe(sFFCbkAI :h+bk=IO WFQ&#[@&# #9*$# [B$##[B#&#DJVEB&# 2BB#3B#T#3B#L#3BEE#?A#k 03ak#H0"#k[bk Ik F ,ײ  *R*xBxKp p: F F*2 1L3 L L L L  L L  L L L L L L LL LB ў-CmL#C "kI T6#CgI" T,!T OzwaH1 rT\LAq%eUlr Euad!V#%&#######EJ 9` F T #SY#C Уh!Hch#H####oH## #o"hH#H## Ma!@ B7 0 / '+ 0@0M0bܳгo$0+\ЄK0#0#3OKIK0 #0 {K|H*F80kh!F۰O6;k`B=)E(0+Ikh9FlJmH2lJ2 2:FiK",0;+hgJgHFgJfH\)eK0 #dI*;k`Bj`)]I j`Bj`)аoаUH5r i c [ #C 0+$ 2EK@J!DJEHBK@K!>Jh/Os_Erz9FXF9 1FFFHF8,SFFF 8$FFXF9F9)FF 8 FF #Cr# @! #*4!BF3FuHpوِ2c8{ڬږr~<"B^NHeڢ ڶq|ۑ۟ YF8F9 h  8FYF9 WwFFF>FH00+A,0+#H $ph2  "40+#HYBw 1F9F:F)FF 8hF FF0F99 2" J7:F9FtH!$hqNc#qh0 h qh01  h ph50 R #C# @! #8FVHUHj+ #<@jh(v12F+F i0 3#`Wl5CvCICH^fsh/OOsWE{.9FPF8ZF1FFF@F8KFZFF 8FFPF9F8)FZFF 8 FF52F(H QF8F8}6 f QF8F8n S3FF>F Is#2F+FH#@!2F+FFI|ۺ۾8 F!F I &`9F9|6DB pF Mk( 9rhIFH2HjF0#aj2F!@F5D(ۆB 9Phr IF HH(F.a} Hx64X B#J#p? `"J`SF H6j K(FF(F8*F + Kh# IBFH-}ߚެXߜߴ d߂-O$TMFtkh;k`+%OH(FF#ѫ@8h HIFHHHH8"#`EK`ol&FF4F+hZ*`xf BC۴FOy  D0IF308h.IF*Hl-H0;0+)Kh z 0;0+Khԛ U#K"`$ /Jh3`0"UK `0FE#`K hUh&FK`X  ( -OFDFF; +--=`9 (|LO3;`B9yNxAF3h33`*8h&pIFpHpHT3h;3` lKh  &3h;3`+cKhԞ#i*FF6 "F+D,MFlL0CD< +QH=B00q308h i#U>` | X   (-OFFFF(H%&DB { x405BI%H x ^+\(\  HYF3j( 5O500 x00 x00zH8I"@ h#jF ` IS( ۽0+;J`0+;JS`] @thD KZh B)iBHo $-GF&MFliPO +iBkic!Ho Fki+Ж+i+$4tki+.,<ki+,i FFMF(Ыi+ #"#AFF8Fr(kiBѾ -CFF0HfoL0B̿H F FFB (F()i;F"F@ (-hLF$ KJh30 H-oa9 Ki" 2 #Da X B Kh30a8Ki@[HoX  -CqMԁli p;xY2I +"(7p )(((iiiiiiiiii^.30-.^. LD"0x?.. .@ 300xA2@ (I8@#EI "`bCF;380h"+=Ho Fs۲20Z-.^.#O3DO3 1H8#,I "`0CF;38h"+*..0/li*/YBYA0xB30z*К Xxpb;.0jikh`3k`,i`B,+iBڥO4 #$X#Lc`ci3( ch+F"+b`h!Ѣ`!hch 3 c`x,) ;) +F"+b`F Ѡ` S0x;+`aBу ! L FF R .F3V˄E5F+/`:5F! 8F Fp8DhfIFHH F8##+iaXB <\+9@  N0 ~3h8"#3`3iSIH($H4NF6(F 0+F9Fc I F,/*/"bU"Zp,3iI" Fw ߚ7>J1h8#@ C` F H  %;"@hO1#@; '8L`a1da, *1I @B"``3x S0x *ћ+2x.*rx *0300FF0;0S#h E" biF#`B#10;0+#hԛ8FF*F(o -CFHL#hB07U%B0ЂB"(FF8FhFca1(hAF$#10;0+_ hKMѽ*F9F H0;0+6o#i1F B̿r"((FhBF,8FF0FF;hh+`B]`00Կ#hȿpȿ33D#h  0FtF8FpF -GF3Lhc'eaBF"ܯB ݪSOO +J]00F30)F0;0+4#h N'* 0;0##hԛ=6h`i0;F'Fbi@FF)F(o -C F*LF FF 030 0;0+:#h 2 L#i9B̿h FHF1Fh9F#i5p[9#10;0S hѽo -OF^LF'#iB̿H F0FF]ETh {B۷=F0Ou5D30)F(Y0hP;0##hdԚgDJAF10FSe(w0>3fa0(Abi Fm(:#10;0+\ h68ѽ(FF(K+ih;DB:ݳ y IF2 t7NhpIFHH0;0#h  q0h;0##hԘQF*i8D5+i-hDVo جXF-Ljp/1QXibB?+D",(Fw09F30 F7hIFHH50;0+#h  0jp;0+#hԛ2x\*rx6/*6 X-G#Ll2CЬH!YF on B;@B0 F5D30)F7thIFH4H0;0+#h C 0nP;0##hԙ1%@!"p x +8"B@B0.F6D301FJ(0b;0##hԚ*Fo51Q"ZU8x!XBXAt!+@%+n nB"۵F0Oz  D30QF (?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F~B.n BEE.F0FF6D301F(?30n`;03#h?>?@0nZ x1ZU1 [x 'H1n`+DBݳv 1F2 (?0n`;03#h??13Np DBvp{0++1H CX[ XHF'F6aCB!ݳv 1F2 <(?0n`;03#h??1>F+D++Q*>DJ1h8#@ C`' KF1x!+ I6D /! F2n H+  JC7KL0x +9IKh0xP1E *DH 30 *!i 0x!+0(0/HP-6u0)F307rh%IF%H2$H0;0+#h B 0P;0##hԛ# x )"TV(QYxT XpXK-AhL0F E2Pi (x /9!ȲY(AY)><<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<Z<hHqX<Owb<}%E0 F+n*p*l*0 x + JHEE1 1h(o(FaiF(% F+n*p*l*0 x +1  %(`iE0EEaiF(% F+n*#p*l*0 x +1 (#B3caE0EE!)iah)Hv[x320[ HnX *F(?r% F+n*=p*3l*60 x +L!i (Y(R(3x 1KN!0Fw(@jJ#1O3`J`5E0EE!+СH"1F4Z3x+Hah)[x320_F(? x!+іH%E0F+n*p*l*0x +ݮ xH"4$HVVEEQ H!i (Ӯg/ G/(F(ɮV/ (  ( F+n*p*l*0 x + 1)F31zE0EEch+?% F+n*p*l*0 x +hQJx+?yPIPHsE0EEch+?׮% F+n*p*l*0 x +=22+?JE0EEh 3H$%E0 F+n*p*l* 0 x + 1 Hh8EE`iA( % F+n*3p*l*0 x +1 !B?E0E XTP[ X$Eh _x(%`3F+n*p* l*03x +9FKE0EEaiF("Fn)p)l)0x +vB(%B0BBaiFf(mu7(fch HNh.$#iB? BuۮB% F+n*p*l*0 x +.1 i0F6H#E0EEaiF(%"Fn)p) l) 0x +BB0BBaiF("Fn)p) l) 0x +جB`B0BBch+?N% F+n*p*l*0 x +2^Kh ]Kh2E0EE#ch+?   F;l; ۲+  x +1+2q/iO5[x320]ch #i`3F(?{% F+n*:p*0l*30 x +U1 !3x2!+ ,H"1F43x+1+?4&Nh0F(J?J#iB?F#1AE0EEO%.F0xg*M- *=0: *,6 "9F`@80C6h"+>Hb   & D X #p*"r*#-0x *-[x +*ѥHٻE0x +2H̻E30EE2E#2D#20b30 i`F0;0+#h  ZB (S#b20;0##hԞ-ArIm(~!2C2 xn+Rp+Al+IaiF^(e% F+n*Lp*Bl*E0 x +?1 z!D#!2rCH2Ճ# #2C22 2C2CE0EEaiF(u(ch+?h.#iB?u% F+n*p*l*0 x +˪1 0FӺE0EEch+?:% F+n*p* l*0 x +E0EE4 pQ)300 O5%x320Z:F(?!ich C73 F+n*=p*3l*60 x +W!3x2!+ ВH"1F43x+1+?;NHI#W/F0Fb(K#iB# 9(?E0EE1+?12+,q(o$ch+?  F;l; ۲+  x +gHai `D(0x1;+"Fn)6p),l)/0x +ҩVKhh#iDBFV6T&QI "OM`t(`@806Bh"+IH.`B0BB%E0 F+n*p*l* 0 x +ch[h4HEE!ich+?](% F+n*$p*l*0 x +` 002+fHyE0EEai `DF(Mh"F» H2oC XߚMD #<`@'HS+f]pG x^+0x]+0x]+ +[+Dx.۲+ JBF/F])ѢB F ) F o-GFP,F#xB +.eJ BS@B4O.F6D;h1F3;`f(76>ha,IF,H+H;h;;`)Kh [+\+ 4F( Ht&0Fcx +HF H;hJ`;;`+Khԛ,a*F0F4K"rU@h+)F0F #G X P_  ,Jphx (*H# ( (L01'H0 Y`[x +ЃBMF pL0Kh۹"K&0)F`KhN(J@'0v00a 0(6h IF HB H   | X-O_N`L3hZ2`Yx%)"h5\O%|3hxKEX EF۵F;hOxD3;`AF^P68hZKIFKHKH;h;;`HKh xIE33`CHt h  N;h;;`+0ԙ3hZ2`x"h +SU*3hx*P;3`B@B'O.F6D;h1F3;`(;h;;`+!Khԛ#h"`ZU\+'3h5Z2`x"h + 0oKh+jXX(Н0D< +?Y 0#` 0]FO  X 4 $ (# MF `F`*hx /J`##` (+hx *кB3+`+hx1)6h$I "`(h0`@806Zh"+H4`og*3+`#  #-OMFNF/h*hh0B"ۜB@BO&F6D:h1F2:`E(;h`;;`+xKhKԛN+i"U=:x&*^   Bܤ KFSE*iH۪ Eȿ#FD  {2hYF22`6h\IF\H\H23h;3`+o FRKh  3h;3`+IKhԙD\3PT\*Xzx 1)R0:BN  E ܤ KFE*i5ܫ Eȿ#D.O q:h2:`6th&IF&H4%H;h;;`;h;;`+KhԟՓD\3PTFB@B2h'F7D22`9Fe(?[3hp;3`;Kh?k?m +iU45 X-O} FF#1(Kh#!i #"#i"# SF(@2FMF`h7Bf  E?`IDq(i 2 5hIFHH! : Kh ( : *xKhԙ0+ # " F@(i!F0D3r JF F[hM>o HF }  E!IDq(i 2 ( : *TKhԛ0+# " F(i!F0DNF3* #D!x)7DAK? h  EO QFOq1 Di2 M3KH5$hG0IF0H/Hu0;0+?RC#" !FV(? 0;0;Kh?4?6/ #CHK hKE &`S`9Ho h0 `V:FFb >!hFJ(+Ji +hO 3+`0FF+h;+`+"Kh C "hFB+h;+`+Khԛ&h  XFF$F(:F1F0F(  -O[O[N;h3h3sh3VH`oSL#hRK"`T R $0(F30(<+ # # | FOl E ^AKh 03h0sh;`s`0;0+a7KhV  R2 ܾ' `FSXSP ;Dhh0 KhXhhh`X`KhhXh`X` hY` ; =?a [ P , $ -A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F FcDF#F P -CF LFFh"hB#hO bh8F P#50Fh`0Z"`d1  "`3(О IF H H4`h  X IFFH  X-O]NF FF3h˹IrhK* FG()FHB =pCO5#`o `Ob)F3JoB5?# FP(pCOгhS FPz(pCO3hkh[+x/+2(FPhH)F FPv(@D3h+@!F(F4(8рH"F)F `(#FzJtOa"otOb!F `3 `>F(OalJ ` `P(gH)F/!(Fh騳/! Fb逳G9F@F4lFX3i+@ـsi+YOX8F1WIX"F0;0+@F$zF<8F (0F'F o3i+@si+shoc)FF[ #FOR oEE*O8S=( ]`PF(ѼB'O8S=N ]`P((N BB R1BB; ]`ZF)F3\ ]c ]`JF!F3P ]c 3i+Ksi+s!F(FO(Mi+T ]WX2-dL"#kG#cchCk3B+ ;hS#"#\0.+ѻi3k B8F +ˀmsEsBs 8iB8FB s h0B_j BF7H0ҲCBF# A #h+ii)Vi&J ! X i(j)P+j J ! d XF32 BFPF 3*BFF8jpIFF3BF3DFF  @ndtF(ѢF(Ѩ 0YF(`QF 0(Dh`:jJ!F0(D` F|ajXOrEp3dJ!3j(+?KBsD( !J3j-+? KBsD-;B//3hUUUV-OFNNFNJF!Fk+"FF |! F 7h/(FOOk'(F\Fx4h(F4`4h+[1IP0;+R#lllIllIlIl%H\ !j`jFXF #sal[\0.+ѳi+"!F(F3l+sk!jPF9F(FF Fk+)њ!jHF#sc gG ~x@-GFhFI L( 1L(IjF Or 0 J`#3Or#ah'%O JFAF0FCfюKbml C"mCЊH1J0K`m3 id#eBaoCC  Co C@M#hE+c)@c(@G#*j+[+Z oKc`l+@rcm+@ph+@n"miKiI* F*F#c.e0F`i#d1G+HO|WdotO #ã`#d#3`ce3m3Oe`#3ced&#`#3cedO3e#"2#Od>`O ## 0#cf%E#c#cE #"cdff#cdf###`# @thX~ezYxA#`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@X+IF+H^  E$I8FXj+[b#hA*ѢEEK#n Km KK+++KK#n Km KKKKKI X 8gfgfegYf]feuyu\8FKh<jFHD\ D8 x8FKh<jFH D\ D8 xl\m!J@A DOb!FN.C4hIFH mBh@AiJ##THpKJhhC F Kh F!FH\X x | TK\hjHOHFO h0lKJhhCKAh˱ # 0bKBRK!0I H0KMhK*FKhXAOrDp3tF F(F0@O  4 ( <  8 Kn:f*oB (КmQeppGIOpC O س_гO I * @O г`O% /  | @ = 9K-AFhmF,#4HF3Kh۱3Kh+5 #"2/K!#0,I r+H9FtD)K)JhhC40F&KDhC%KhKhpCOѨhD FKJhK) FFKohX oOrApaF3 FF9F@F:K0Fhv : 4 B x | t <2 8 ThFx"K(FF  BKh[5B I#IYBBAI[bBA5B 5BG 8Fh8#;CЪi Fij h-GF ~K}Kh F`&h@@@ #;C0m+#ajoH|0mKh+| #'7BiKBRK!0dI VibHZh.ijPFiN\Kh#:h!k[HFzh!jXHBXKh#hiVH:h0C_Wj"RIز1C!k #NHak"LKh+g  IKJJhhCf0F=GKhh;FKh3pCO=hpC O0FV he;K*Oh:K*F9Kh<Or@p3l FFi8FI# h ! I!\0?gjH"I"OHj8FKhK0FhZ P: 4 B hi 0pv p x | t <2 8 l T  `HK-OFhEiCj3DDKh+DKhñj3DBK FBJBOhhC55;hE FOi9N!i3hB ݉("i2`#h&˹)F@F&FF@F&9F0FF5OEE1: C@&06hi "2B  E KajR*h*jJDVEF FO  4 t Xh .K-GFhEiCj3D*Kh+*Khj3D(K F(JhhC5y%K5hE FG꽣i)F0F&d'FF0F&%hFG #;CGE '0ajKj(FFE7hi 6  4 t X-CF#Kh Dj4!Kh+!Khj3DKh4.h'lp.C ci#;C/, 7W2k;D B 'L0ijSj0FDh >i  4 tX FFFhFaCF L K!hF/4 F(AkD FH)Fdsh+?w"F)F Hp!F(FFj#1ER,sFhFFFN@( I ,K(F`I!FUNMMp罱N F!LN MpMn#"F1F0F( I!N F)FLNl-AMCL'ch+nFAIhjF#%3u`N(3;Jh(FDhOBM(34Jh MO60F M,IjFh#u`3N(3)JhOBM3v$JhOBM(mFIhjF#O+N(3ZJ/1F8F!I@Fh`jF I#h+N(3>kh Jh@Flm6`幃hF;`+ NhZ` "ppG-OFMhAMLO3J``#33#a`0+?bzFK`cahBСi"h+szKh(kyIhN((l3ciuJh hM\O3`#`XOr!0FM&(`3jJ3Fh s^#`fKcahCСi)"Or@a0FM(`3\J3Fh S#`&#`TKcaOr!0FM(`3OJ3Fh 8MKca #k`Q0O0jpCObi BI_'@IhNp##a0`+@:K:Jh`:J` #!#a*`*@1Kh1K.`O8#"#h0??3(h+$##aZ pD//EKh.A3FHFQF2HC9K# !#a*`+c##l x!U <N@8m t x/%/^;NOFOA1`Q F BF#FHFQF2qH8C[ѻ4`O S3`/6h/o03/P$KOB`OF"K`*?W0GRYBJOS` GQPBOR GQPBIOR+ ` )OS)`Kh(ORO x KMi+ Lch+ݠhOBiFM(`` M l#LcbKi #"#h0 F 3$Jh O0h"H(l  Ki* I OO0h(K JIhhA !V xFFF$*F1F8FM8D-D F,FFFF$*F1F8FMD-D F,FpFM Flh,Nh1i)FMJ#s`hB`3` FpM#s`l`D3jJh Ij FIl x1FNLeh- FFhBFJN#cbs`(F7isc`?/f(f3`h +P?I #c`%( +U#"#h0LKhbr"n(Dg`#s`cj+L%-I z3.h+ #c`3(hE+#c`3 h+3hE+cj+3jJh 3 h+3h+3h+(-K'gbw`hYi(F@A I j I- I8Fl R|!WD1 3K𵅰 * 1MjhB0Jh:*/I O0ZhZi**8"Z`kh+ &Ii!`* *"i`Z` I *@!Y`B'݊BOt'#"h0B(#F2F1hf04  I#hM(#k`Ot l<k蛀m)O-G FpFFO#:!Oxh(.9)/!h0 F(cI9$BpF F!h0( 3 Jh O0x``  0+l F8N Fph(%6Ki+<+)u]2I 2)uT"'#h0 2)Jh8FO0p` b*ڳj+!I"F!h0|(,2Jh J,`u(F!F1CII#h0M(2 Jh I# s`l .[ x剀m-O]zOzK F:hX*FtIV#0[bS#"F#0+:;h+ɀ!0F##eJ.V|dK;FV,1p`J;FLOq]JL3FOQ,@XJXI(Fh ]t0ӱQK!0F##GJMJOQ 錨1팩F M EKh;h+BK VhAK9FCFV,16JCFLOqL9J;F0 耀!5O0Fh z2Kj;##"J#!HF#JJ   L1 JOqPFJOQzg猨1 팩F Mh,lX !V@ 0 >#& Հl8!WD Ր -CXMYNYLh+#3`30 C#i+NKOOh8h MKMI8hh8h.hIIhMlFhjpCO$#C`iM`@Kh+?Kh+(h(!MthM(h("B0 C #i+ ,O2H9h)K8h"`.O3`2C#3`)O#3;hj3b0 CML+h# h#+`;hӱKHh2,蠹K"%hQOSI1F F(FIr / h.Zl !V!V!Vi !W,!WD Ր Հ!V!W-AMI L(2rJh $" L(2bzJh xMyLkj`+\0CXH0#rKsHh]giqI8F1(oI8F1(#i3+j9F=hHBgH?gKh;+7eH7]O9h@F0aH-aH*`H'@A6(\I1rй9h#ZH0O3k`WK"`O60F MSHRHRH0 OH s+ S+ Y+`i(aiHHy+FH2O@9h@FBH@A(4I1"(Н0:H0#7I j5H4I13H1,@CB/Hv(8#'I0O3k``a#H!Vl !VxB%M,p!Vgج~AQJn!W|KFhC F0O0 -OL =OOu-Kh+,I )<,()I"FH+^$Kq"hBFB8 I O00(>0+I HOq$&H!FiGL#(  W) !FH J`_   !WD-OO 8M$8H+hFFh9FYFE$кXO;XF -I (L)Kh+(I(I FO $@F+hAF#H[jGF0+hiRIJF$HF+ k!F@FG(HFKh+II f*hi!k HG("2"!WD 4Z} /!MFHNF'p1FHH鈹h/##p-K)FJ O0 MK0Fu")F1"/#X;9FK JEx#p   hF;`+ MyhZ` "ppG-OMO3F+h( (+hjG(+h k:KhFF+7рL4 F+ FF( F((O3uKh F# F(.@΀nI" LvkKh  (ڨ Fz(оbK4+`O"FL(2$8ZJh P ;+! FKHIH#y/+ 8KH1JIFH+~/ F FEKh+ F(0K@J+hZFKF F(O +;hIB FlG(U!B F(2? F(: FN('! F(!#y/+ 8H0IFH+KBFHKFtKd0[2vJh (;hjGI" L U2@a(!WD !V-O/( /\M+hlG(+hjG(( TKhF[RKhL(2PJh NKhùNNT+hjGJI" L2 (ڷ ++hIB FlG(9KS@ F(1KS#@ F(+Kh+*HL((O;h C#HL찹:h0B`CXKhBAK#BA FM(! F(+H+K#B!WD!V!W8 Р!V `!W4 !W(  !W #y/+ \8uH0uIFH+rO0:hCmHLj0+i;hKB`CXKhBAfK#BAYbO;hKbJ+hVZF`H43h \Kh [Kh+ (94+D +B;+;PHF+7@Y0CکP;h+?ծCO;h+?Ю(hK"`>J(F232;Kh+:~(90+?R̐0+?K.Kh#0B&HL(00;"K!0BAK!0BA%K!0H4+> +<;+ P( H4P!VTr!W8 !V  !V!V !W0 Р!V!W(!W !W!Wx"FKV( 18Jh P0FK퀻Oy$# -w'.BCX)s0F-w6Kh /CY 1 2J#h @I#* .32C O0 /Bw0F*F(uJ0h 1cE D-gw*BCX)sۘT4B I!VZ p-AFDL- 2*s&%' h 0B@DAq#hFi*F.RF+Da0B BA*I  (%K"O7`#Kh#hB+Da'8Fua(#6DBr##h2FF.F3DaKhYi)0Fz)(0"hBDa܈ p1!V!WD8 Li#hB ٥i!*0jKah8@X8 p-AFO FL- C,=iB1F,F&DF"F.-F#DaO0 p-CFd FO-v C,8hOyBv 0O,FF"FF0F#D,0f %FO0 p-GBC̰FFQXUh 1F"hF.V( K$h,4 JQF 4` D!U!V9/!W-AF FFFFK(@.Kh ( 1BB 1BB#I2F O0pCOI F/h FJ>(0xJ#Fh * FKp(/ !F0FJH(0` F(/J3FAF !W4J,hyS0F(4pCO)BCXPh(s U%BA## E `iF(FK>0pCO  I*FXO0'0#"#iF(FNSF( P Q# 18pG-AFXUd>Jl(0>J3Fh F(pC O9F(F`K\\h+|0+(HFF4+@𾀐@2AF(FJ>C!0+F}JhXF+09кuKh+=tJ+FYF EFGWS9F3(FS#JGG9F(FJeI*F O0 M @)FJX^I*F(FO \@$(F<(O P@$(F<0{(4(?y$* #@c#`c(4m$(4*+#@c(47K?Hh/(!(FJH(U(FJv(70R7JKFh Gq(F#R1h 2(F#`c(40*Kh+7$SV 3QJBJA"HF# $@0@*F(F@AqU0+(4 0CJhC J#!V`!W!V!W94Z!VpG-OFFFF Fѥ _0+#`00CEFDF0hC.+FBF#` ' <"F)F8FBL0&Jx3*/A%#F8F-H(80Jh 9Kth`DFFI O0IH hb)F0D- `"D .5F|r!W!W!W!WsF F p$O3O2-( 0. J+Fh FO0I"F0FJ8(0J+F!U0Fh F(JO3+` KhSQT"4  3EE#0!V-G"]YFi4%F/F _(O SF(RF0FJ"( (Hx#3B DBCXRhCEBT#I( O0 "]0FJ( T/J8h OB`CXHh1BBTI(#"0F#-:(T/xJ8% T<-C(M(h z#3%Oh$N@Ish;s`+ 0FCѬO03hZ2`x0B#F4FhcKEUFh"Ui"8F(`( kiSlaki+ (hka+`!U!U8KJhLh+ ##aCaKhiC@ahc@@&`0 I0O0}( Kh( !W!W!U!W !VpFFx3I O0p FI(F.J8(+\/+#+T#`KvB%`f`h` ai`?Z!UKZi !Q` Jh "b Jhr JhZP$*Yhh"JdpG!U!W,!W!W<Kh 8 K M NOh#bhR9F "h)F0F#h!V!UX-CFN3j;3h+5O0 #3b(P0; +F/E5E0N1FpF( J#p`&`FJF7F`!FKJO(F AѿKhKhZQJ)+@K`(P @? hz(;S ́ɵ́́́́́́ ́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́́ɵQ́́́́eiͣ́́́́ͩ́́ɵíͳ́ͷ́́́́́́́́%́-5́ŚYaeím̯̳̓%5̳9=ÁK^4K)` 2I 0I` 7-K,Khx-*+JYx#``#'K"&K'J`&K&K&KKh+$H(π!K"`" K` 0K"`J#`J`J`K `!V!W|`~!VX t/& !W E!W4!W K!V!U!V!W,!VKh(A vKK KKJ030Kh0'Ku E  0FOCF Ib 7~JhF; F Z`}KJYKKPKNtKh(?\tK{JG{K|JDzK{JAxK{J>wKzJ;uKzJ8tKyJ5yK/dKhgK/wK)wKwK_KhuK#0'rI`*+?nJ`nO#< h(RiK"ZakXL#h xCeH+ `x bK#`aKL"p7]K`(@|@ h(@%VK"`UI  ;6%hOI(F.(@߀ch+{a4;i3;aHI.(}i4CIHF.(AIHFD(@JF=Itz EFO rF(Ѻ%(Fq-IHF.Fh+?bJF)IJ(F_& !V!W8 Г!W\!V!W$!W  !V!W|!W<!V!U!WDI.4@;i@FO 3;a~I"@F. 訹;i3;a%(FO F@F#c")F@F(#XkK#FRyi"(F4(#!(7F ;W[]%hYI(F-(c`h(?4!(ǭ>FSI-(Oeh-?Ү47FQF(F-LI(FDFP*Fph(!{(ڣ?IHF-p>I"HF- ! !HF8N 0Fc(?![(0FWF(QF(F-0F40+*F7F4!(FĐF&Kgz0#J!FO KF(FPAFM3I@J `K`K3@C‚ IHLMO.@I0;0+򡂰1 ϔ!VǛn1X9XT\pГ!W$ ՠt!W !W!W TKh0(FVvPK"FV`pNK"FF`jLK"FF`dJK"C`_IK[HKtAKhGKeFKFJbFKkb# `DK3@bCJ2@?# `AKV#2d# `;K#)F@8F\&N0Z "pM h+0K0J`0N7++?j,N3hBe"T#Fa(03h33`+U"KhB!I = KT%`(ͺT#!(3h33`3hBK"`0& !W!W !W!W!V \!W|G 0 .!WD~V!VKhh`pG!U8KhK ILhMh8 KHh-@#!F(FN8!U!WD}X!V`1F"2`FO[?-0*-5,B.[-+̼Ex"!- F4x]/4ѥ!EBEAB;xK"Jh*O0/+7` +,*1 F+Cx*++9F7 x+#2F F(?/А-ѐ о]мEEؿ"E"!W<FhDx/+5CF(@o I0O0`h1FBҘ;8aB8 D0(DB (py}9=d.KFh M,H,L,N-O(FA F0F8F@A(:$I-"H,0@CBH03H M.+ѝ@$H F.FHV0Fb@BF0F+.(`O0!V~J0O_-O]xK0 EFFF @@BFh+ ;Osi#0 ")F{({F[h LcB٘E" LcE𘀲hDF0hB҂FJSI:F C ]&)3\)+Bx0*,9*!0: B((R*B F)D LcD\* FPF&*BhD4+x+3Osi?s*Ѷih;'Ssi0x I:F H\0x+?S@BYF8F+F`II[F:FHD Ld LaB*F;+ La#B#p x*+?gI[F:F _!VX-CFMx"KI ,EF+xGI2Fr\+55B gF(C'"AF*p8FFOcjF9F 8I3FjF_ FXO9HF M2x(F+F038F FC\+B%P( `88Fj F,IBF?ea3aKhR`\`g+P+S+G+8FL F3xI2F0  p+ s+aiAaiAaiAZhaX'!V-AFFFx;I O0 F IO`(F, Kx`h`` `hTa!V K M N Oh#"i 9F "h)F0F #di!VX0Kph[UD4-I"i h!B"a p(Jh)bhz$* УB5$Jci F`k#4p0X ``I ach /"p#c`O0ch/"p#c`&h0F,`83\/+#3TO`#aDF[iB2I 4!V!W,!W<!V0MV#F4 Kh#i!hy/+di,Kh@ Kh Kh@ @B h9F-( h"9F3D((FS(# O04!V!W@!W,F_KFh[y.+Cy.+уy/+˱YI(F蠹*FF2x)Z*,.*,.* M.hv#y/+ cy.##q.9I #+`x.h  5C!F*F(S4+;+ CA@F(Э CA '8F,aF8F&#h;#` I:F =I# +x##a ;x{!F8F(%2I:F =/&a*c* C*M* &iFm*&iF$I;F o Fh#iC#a#И0@F(IBF#iC"a!0BA I;FBF D F=g#ca Kh` ``hTa\t=!WH-CFK FFh@= F,HW! Fѹ I  h(1BBѽ@F#dG%!WXt Lch !@I``( IO0!WXCK-OF_h/YX4+J84+EB0CX@PF,W!F\F LF2BE 1BB( i, {F(v `xU##:9G&@ ) FmI mO0!h @@B*4+ ## 4i;a+i h0J FG !WX"K-AF\hS8$*-4+);+&B0CP@Vh0F,V T!@U 52EBi qBB F+ѽ h0 FA!WXK-A\h&T4OV_]/Fi8h8F-ѦBѽ!WXLhs!LGP=`0I O0JKh S BB L h K`0-j#h Jh  hGb !WX!V!V Lh !@ `( IO0!WX9 L#h !@= `( IjO0!WXmP" 07@ @B-O[NF3h+B C XOB0C XpCEBQFCO#CFGFF(Fh+;1@Q"F( @BBY"(TV O (JhaB C`E`B0CE0>!BEB<i BE""C("FBE/ X##h a` I *I  ##!WX Li !@=a( IO0!WX -CNiñ%O F@Gi\Yd### hj5B!WX-OF-F'K0@=HF,pX! FSFYEHEBBЛj+0 F `v(H%@ FI O!WX D-AFKFFFiԱ@=(F, T!@!jBEB!BB(FO0` h F !WX pGF!KMFFh{x/+ iF8I*F  MF( FI*F(F `XI*F  F M@s`## ##07Kiab`!U x !WX-AMNOilcha3h cjh hZ;h C #3### h Kh!j h h9 F6i!WX!V@)s¿@9@@!F$%FB["B8F*D1F F,BFpP%5 D-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, F(q#"#*J(_2FAFBLU&`##0S' aC'@;#*&2BB ,b Jh O0 M2FcB,NJ2FAF+(B`CXQh BA 1 ,2 Jh  Fn,(JI i     /!WX-CF*KFh7)I8FO @"W F5 /F(70F*F `p(F$``0G(@h,!h0F+J(fh(F1F+B(0F(F``( I O0LF0F FI!WX Q ~ F KFFh h@"T @T!h(F+ 0ah:F(F*Z0`h!WX F!F(O0BB5/3O.//O .MTMTB DFt039TQB+DO06 F"(D,4CO0 TlT FF0OpB DB0[(DDK@,-A]\FO. * F7J#hBD",x/+61JkF@   (EO0 ]+]** .& CDl+F]3D,?*D+FV7`\&JkF@   (JkF@   q(ڹ JkF@   bX    pFh FF*F3e-p@(e"G3F*RF h#(F#`3`pF  FI  Oa KhOq pGOa!Wx0#L#`\3щhY`ah3!`!`h(̿  0O0 !Wx8FxO08I"+Kȹh2"` Iw"FOqF(F O0"`^ -ANOt`Fȱ%h1F(F+rdh 9F F+lxI#F*F @ K J I :O00;+I#F*FK"` MU W  !Wx-AFFOq0F(O0BB! FU,$S #840K;+cK@A@A ` @\K "dFBHY"F (lM"F<tE" !@|??Dy`" !.B`BPH`BPBPBpBH`PRH` hB 8 &2)1)(4*1y/)BCC"(4#$84K+!ٖ(4/5)#4(4C C(43y/+1#3q `-"CC$"8$K) # #4{h'TPYBBqSCC(4BC!X${hYBBA !W!W-CXŰF4;+: 9("((Kh;%(FETI( TI(T~I(T|I(OFF|ẖC@ POR80!+B yEv(FEF(@#"(F(C@ POR809F+B yyER(FEF(@ր#"(F(C@̀NOR9FB +{sE2(FE(@#"(F(C@B /x}E(FE0 EGFy Q8(FOWF:FO E B@i FTEGFy Q8(FOWF:FO EBjѸi F\EGFy Q8(FOWF:FO EBOѸi FeEGF{ Q8(FOWF:FO EB4 PN80:F!`k Fc TO 84  _D WE+ Jkxl<+=+/ Bkxl|+#F Kkxl&+#F Dkxl=+!#F = jx+*k' 5jx-*k( /) -% +# )$ '#F $#F !,FF  X!X؞!X!X!X|%FKHh!XxVKs[hM.h+`>K.`0FH"xK*F*"` F(FF F*hx*h3IxJ\ HL3(F!Fp!Xx!dv(؞pFFF#- do[ls 8H)04 |DHSBHO)Ѳ??=H ,)FF Fp)FJC"D@`?  !,CC@?  !A\@C@BpO!!FBAO!!FBABpBBO !!FBBO!!@Y@C@-OFFt %*F F,U G9Fv &*FFH## ;FG1FF,CMFDFF F(F!F!Xx"K𵍰#FF#e,F F;F2FF F(F!F (Р +N9FF F/. TF F F FJ!T" V!Xxh8 FMh)+8!F!Xx-OFFFFO O ,v,~,7,:]H,##LFF$,|",1FHF0#+F F PH,'+عtLH  PD T'F+T)8h +F F'6JOO6#3FFc8h" ## kK #%#|3F9FFHFbC $,F##k3F9FFHFQCC`.', JO6$4FdOFT" h!Xx-OFFFF*##F#+FF F @+ FF m;FBF0FF F  <E - !X KYh)@"H @Hg!Xn8L$(M(FF0&Khh#%HܲL, g"MhhH /kh#H)L h *"hhhS#S hCh;C`+ 3"hhY` "p h #hX )h!F HhZ`8!a!X$E-G FfN2hS#S5,FT_I@F):F(\I@F)2F(@%F'O E\,@/Yx0)^С\ز({+yxxxxzjxlnxxxxxxxpxxxrxtxv F0hCh;C`+f 2hhY`pCFFK,+hk0hCh;C`+U 2hhY` "pU;+Ѻ 0hCh;C`+M 2hhY` "p0h k2h0A#$I S3AF$ xF10(B0јF$$ $ $ $ $ $F$hZ`hZ`%FO ^'F[hZ` \ PTF)HF FhBhB< + #O;h+@"Kh"I"H {h#zhIH H2F)F |,IH FIFH F,L hCh;C`+ "hhY` " Hp@ ǻhZ`!X!X*`JFh4b!`!XFK aXi0XaO0 K F!XK\i"a"FiF aDDC Kh3 K60 F! (6 (!X!_Kh "` !YRK` !YFS[)0)Fh FF FF)"2F)Fh FFO0R FFO0 FSK)!Fh@pG8 FF)*F!F8@hO0R]pG FFO0 JF0 H ! J HBѲBPh20!XcKhpG!XpFCF h( ")FCBF hC$&``h( "!C CF`hCf`(FpO57MHX+hhK"6 N K\h\-h Kh#F2F(F`hBB Y$h F0!a !X!esF$N Fh+' !<#XC`h(F1F(JF! Fg j` g++ #x6+ cx0+I" F&hp F("D=0+<.+(F"p@N!XK"`"apG!XF #h;+h "iFM[h#a iH "iFC" FYhqdhhhh a0L%jH*F!U00n bB H!U0 J#jhy`q j0 jK#b!X( Fh+уhch@Kh"hh37!eh-GF!>O0FO5F;h3;`hFsh@F+gF4K\b;h;;`#2Kh h1`h#hhF( -(FC)0hSF"Hrh@Fah:";h;;`#0 -!!(F +C! `h!- PC$h`h!(FC~+!X!X!X-C FOF^0Pc! N!h)3_{lCP rJSb$qKh 7+πlKXj(ʀ,ǀ 7`hAF^0hh, `h!^0sjhC$&`h!^0+h+sj+SKh )F Fj)F F@EKh p)F Fp0 f`h!Z^0+h+sj+h,Xtb4Kh NAF F/Kh DAF FN*Kh :AF F%Kh 0"iK"Zb`h!JSj[ Sb`h!KZj*"Kh Fv")F F H H s )!X!d !b-GF!K!(Ft&hl` @EF K^bױ ^0k)hD(F& 0+!F!d!X(-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=FNK+{#hF K(FjlKXj4K"Zb!X!_-AF!LF&i3ahh!%^0hh+#i;#a+ #`+ "i:"a*#`ifb;a;+fj*hcj * +Ѩhhfj++!X-GF4GLF^`fj  oh/[ `i3a/h)i0+/7K7Nh0 /5H ,h )0hCh;C`+= 2hhY`="pxh B0hCh;C`+0 2hhY` "p0h "yhh .hAF^ fj"h;+#i;#a+`?h"QF8FhhhZ`hZ`+#i;#a+`ifb;a!X!e!d-AFFXh`h"0Mh,4h #'hdh3i0F0YhN#dh9F0kj|hj^ R"h *9F0kjkbYvh#F!X!d-GFhF2h J 0chSYKZMhZK0h LWH I9TH A.SH <(hCh;C`+3 *hhY` "p(h JM.+h+`%! FLRF!FF-(=.HFANM#sb+h;+`+5нIF(h " _hZ` ((+h;+`#.Kh h! `hGl+h;+`{. .'!Kh+нGKh++h;+`pb#Kh 0+Уh+Kh K0h H KGh !e!d -!X!X!X1OKpȰhh##IK0۱hñGK &GMhGK0h kDH hh BH b=Kh !FX5K `:Kh 0$,5K"ZbHp!F(h2F dh 9/H 6'Kh "K!h)L !#h3#`K`h (#h;#` LXh#h 3#`K` #h;#`+ H Kh uKh+Kh+!X!e!d B!X!XI!XS!X#O23##KF F^0+=(;N`3h33`x(H!(F")FFK0`h B! !(F B`#`3h;3`#Kh qf !X[!XK-Ch$3 KM)hbKh,`iK`[`hhG(@N%#i F*F3`)dh,"N'`hm`h4#ih3`%(m# `+m 0t+h`qK60KlKi3 +¿S< hK0+T +'cN,@$h$x0+x0+1YKh+@3[h+NUJ!h3`[h Z@# ( JHdhi F:F)Fdh h2 Yhh`@Kh9K0h d='O eh9F(F#F`h Ch;C`+D  hY`5Fp{(F $h,N $,X#Nh0h-[Ch;C`+_ 2hhY` "pKh WCh;C`+ hY` "phZ`hZ`!e!d!X!e!d !b!X[!eGM(hCh;C`+ *hhY` "p`h D$hhZ`"F)F jmh( $hZ`#x04K eh:F1F(F'5$h -KB%C FF;VF˼-ѐ- рx8 Kp(%F (  m0 +YD#x0x0+?Ȯ;+ JB?JB? 0$YKIQ*ٽx03+ R(x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + цK"Z`h`@"` C O3Kk K!h3 (@yK3`xKh3B@d h 2 +Y\#x0xkL9!`` -iJh#c3`gK"`#fJ`fJ` bdKhS#S G`b YK` &]K^J`^K^J` "# [K`OK"Z`* c3@7 DKB@M+ BKhQ`hR`"`+@s)uEK&0+=ѽx0+9[hh+2O3!3#3!8K h"`%B4)K"bB>GF/(o$K%%*F jbB K` U.'K`@*F)F F*  (@CK`Kh+lNi( K"%h bBJh;`[ FFHa$!X!X!e!a!a&~!e!X!XlzKh+ F3xuKh+tJ bB+ qKqKXjhpKBh 3` "iK% j^ Cm #F ^L#cb +@ `b[K"`UKh+?SKj;B! PJ`JKh+h !HN FA .5F"+h `#`# =L;3`3`#h3#`;Kh`:I h Z#h;#`#-Kh r3!(-(Kh+.' D F'K!`'K`'K`#K` K`L. F +h#` 5Kh 3` cz XJ`J`hK`LB Zi3az Hj!X!X!X!Y!X!X!a!e!X!d!e~ . eJi ;ahcL3` `K F`_K`^K`^K`+h #`ZK`RJh;`WKh*""QKXj  NKh+ #n JJBJJB@K!h`#8 $CKhKh8K+?5K"++ѽx0+[@$K"`+Kh+?p b$Lj+ ! !h jS QKFj BB,`h)F $h + `BN `q QmOBH !X!a!e!d!e!X!X!X!XHAKI!X!YKipG!XKhpG!XJFpG!XKȃpG!XK""pG!X( FHh$ H ! KiBF)"hxc*""! !XJF+PiSapG!XK/!0hF3#  FB@H!FpCOH!FOH!FB((PCO (F6"!FF(%F(F)0!ep%LN(Feb3hhñ'3hh!FY&c(Ffii3cafaO`jp!X!a(L HhFai)ipcj i9B̿""`F""a" !X pG pG-CH, (P9F 0 FIAFFDIFF?hWI"F Hh ,   FFFB'nh/ c)F0FT 1K`K` F'T`!a!X-OFhFF/V* F%&:FF;+D@F &\D0B+#!J F-hS`I*FF $!X@ -AF F*tL$>Kh3"1FhFFmah5H 8F A2H 2H )0H1F z.Lk hCh;C`+C M"hhY`*"p hCh;C`+9 ?"hhY` "p4)MH 1FH +h`h3+` KFhF+h;+`;H  HKh+gH1FhZ`hZ`!e'!X0:@!XD8FL h0*xxB%+`h8)F&"(4(8FL h@x+xB)F&`h84ݨ K "0%h I:0Q;+г(,۝rhD!Y-CFL%dd#h3#`|-#h;#`Kh˱C῰0[ChB h;`8h(5+0F!X!X!YD"K-AFhO6Bt%3xF+BQ:*(l<:+5:)lM+h+r.` F.`F*%*q H9F(.F,F,Fs$!eDc-A&MX+h3+`|.+h;+`˹KhA\0+ #h`h;` @ F2H(tCE?p?-'h*?e'h*?_' Y!F8F7L#h3#`!0F6F *O   "h:"`*Jh*?\  O )  !ebDެqc!Xl!X!X-O$&F'FFFFO HF(1   !H ;C3CvK &O h7FFFFh+@oK|BUnL h #h[kH% (Fb=-R%IQIIH[I-I3H[H[H[H[H[H[H[H[H[H[I9I?IEH[IIIM#O O O '&$OSк)Vл,!FPF5J/0KRFXFh3+4н 03C,? &Kh+/I h `?d!XF(а0+R#IJ%II,н 03!XF!P z%F,!a!Y!Y!eDp FN!3h33`0F+ +@h +#kh`krhc`3h;3`3Khp@p!X!X0LFF#h3#`#0 K>00 (F#h;#`;Kh#0@λ0!X!X!@0+@h -OOM FFFGF(FX!hM xc+7CWIЍHp(v(V('O&&/<ЅH+hh+97F+h*`h,l F Hc&H`H]!Fa.+h'*`haH' ~'!a .CQa!egn`sՌ-OaLFaMF #hF(h#h` .؀.:.) .c/.*TI h: `*OkF *Q"OONOOOOONCNSBJ z>N(3h33` hxs8H F"O &/*ј0/+ sF"pAPF@Fj,/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZF3B*`,B*`!Y!_>ڢ-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`33h;3`+;h+_"#caFh[aaNOcihHhBȿ`XhB"3h33`ci3h;3`+;h+3!Y!X!X!Y7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +&# "` FF&~h+x =+T Kh-+x+KhBۛhD(.&h+#h3#`(@d0CK`CFim#h=`;#`#9Kh 73#h#` H 8л 6.  ">9)A+. *FqBF*FO B1 5D;+J :* Ҳ * : "+ &: [b "F!Y!X!X!Xڢ!_EK-OF[i FK G`kh`h`>KF&ZhVh0 0;DE #x+ D`F xɲ)K `(F~&)AO 0D`lh `h`aTF E#x+$Ё+@F  F!r0H!l F@F!dp H!^LEF(TFF &F!Y!f (!Y M L Nhhha#hh3#`#ho`;#`+3h+!Y!X!X8F%0f)FF2 _KjD``b8!Y) FOF{;2F6h#9F`F0FFahhh%( 5`.F*h,`#FFF4`&F#h+%`F! ʿh1-OO FFF[غ*Tк?#xGк #x+4#xSE4T& غ\#x+4!xCx$ x۲+?b+ cx;@" 4#x+ #x+4Ax#xQЙB4+4;Cx+*+Ё+*xҲ*?+[+ѠFF8F?*И 4*4"xB)Ё*FbxBИ 4B{x+ѮAx!)^)5у[x.-?l]-!)^)&ц##x+ +cO x;xɲ)@+?J[+5FZ:)5F[;F>F#HI(F(ШBqx)ѱx)ШB)x?JQ\ BB # pF K .F;]+[E?,7F4`5BЕ  85qE8+\+ F)x-)&ix])#Ё)\)5 k"# ( #6 (ؿO 5BO 5F0+?ٮOFDF؞-OFF F"#x*+6?+4[+=cx!+^+ѣxx./](@[($Xx:($Xx^](/(3x:+ѳc(ўx+/+3F:(ћx]+竱/+"(3x/( P3狱x(ف+4#x/+:4"TL+FfjxxҲ*ف(1 x+ 1B`j`j)@j(EL $BICBx/+E#<$F($0B/#<#x+5&kCFF xɲ)ف(F08F./#<x F1xҲ*ف( F+F+AEӯHH& 3(F/+*/#!F<8FF(Z{.*Ѻ. "@F(.(Ft$3!Y,x!XFpFx3ɲ )F &x<p,XpxQ-ً,p+F F,F+pFF$M$N`hF;C+j`h`#F$h+b*+?+[+3h/j33`kjK$oO` hbahhjhj#kb3h;3`# Kh +jB"`8h8`Fh(!Y!X!X8FM8+j`h`x,b$h!Y-CFxF0۲ +عB1"FO FxV*F !F%vFU*ѽ>L .++*- F!xB`   =) ЁB MB*FF !%HF+D%++2F5!F؞-Gvtv F FO#00F ! 6F0и/ N F-#<=O3h;3`+K!_ *-OF#xF-+ F +@򉀣! *|L[?+v@+0; +m%^# "`0FF%Th+^x =+Y.@!Khj-gNMLx+E\ ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpqK&qMԡhBK yc0fO;0+;hZ:`"yp6bK_Lh!h& `^K^K^KC;`#yp@-VKhOJ!bh,KMW;+x+1+hGN;+`+3hZ2`"p+h;+`+3hZ2`"p;h++h;N;+`+d3hZ2`"pC3`#pC3`#p.N=x+0 ;+ +h;+`+3hZ2`"p+h;+`+S3hY1`xp~C3`#pwZB2`xp+h;+`+ S3hY1`xpx+ћ\ZB2`xpRC3`#pm!aڢ!_!Y!_!X!a稪KZhVhK3xKhW+*?  ̀-ʀ|x:h*?.@A)-x*ДIP h: `* Qp :* : * Q!p : *J P xpB "pQAxp1ɲ )9)Ko~H p9)DAK0xp x):h*?.?}x :*RIL h: `*, Q!p ,: *$ Qp;_A!pWKC0 xp谶IB "pAB p:B p4+KhB/hF>S&0%C#`#pZB"`xpd3۲ +3h;3`++hZ*`p3h;3`+S+hY)`xpx+C+`#pZB*`xpN'M!f !a!_!Yڢ-OF; (CxJ\ O O =!@F!BM 3G ОKJ.h[hh<Ѻ _$O &@F.hKFh@ @@ "" h@*"b@F ~K.hh}K@,'0@+!*+Ъ+rH9BFx+к#HHF R$$FO h49`)-)hH(` p ;ܹ 3O̿F"DO  D @ЀMK)hhD)`LI hD `xDJHKA`pEKF?JDFRF@FLDkO ;Lt$[FА'[FF$O @*-Jh*@B@"(--{++++ K  9) 9))ho~H(` p9) )hH(`~A)`!pwA)`؞!Y!e!_!aڢ * "h:"`**hQ)`"h:"`* *hQ)`jEB*`>B*`\$#"~)hFU(`*["FiL8F!;x+@78F4*@",8FCB[x+@*B$7,tX0;0+70Z "pWkx+Ѯ0Fkx+ ѕ0+x@++y=+ O(YJh;`CE#hZ"`"pO C#`#p MJh;`+ #hZ"`"pGJh3`C#`#pBJh;`+#hZ"` "pmC#` #pj#h B ,*2I;#` h2 `O +Jh;`+#hZ"`"p?C#`#p!N#kx3۲ + 3h;3`+#hZ"`"p2h:2`*"hQ!` Jh3`4C#`#p B"`h 0F9@*F!f !Y!d!_礠i :F@hiha0F I h: `*)"hQ!` QF \8J!hh"H`{jx~*⮺=+?ۮ#9F0FB"`B"`.F!_-CF;KFf0 "8L)FhO6Oa05J(#`4Kh;`ih`/;hfCr;h3;` `p#hp;;`++#hZ"` h0* F$AF#j"`+ i)F#j"`i*qh `s`6C#`ig #jG`` b!Y!_!d!Y"FsKhG@0ٽ-OOq5L&h02O;h;;`+FP#hZ"`"pP0F5D(F0 h"K(FhF F2 #h2D"`:hD;`+ `!J hs!h F+F+*ѹ"3D0FYB#h@F=+D#`;h[;` C#`#p!Y!_!dh-O*(NF(O !!FiFF3t;h3;`0`KahUDи*HF")F3h 5`;h;`3h"p#x+H*FI  Ja H KFJF0!Y!_ND-OFrO+,FFi0 9! 0308``K,ah5DNDM ,|,!,FO B ;h"pRF)F0F(fфй44tO BӔRF)F0Fx(K#FНB ,* *Fx)22B8FtBRF!F0FV(AbЕB <+ +Fx)33B8FRF!F0F9(#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030CC;`#p!Y!_-CFLFxUh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1FFi FC#`p!Y!_-AF-LFA,H hCh;C`+&"hhY`&O"pB"HAF{ hCh;C`+"hhY`&O"pB hZ`W&6#:DhZ`W&% hCh;C`+ "hhY`6hZ`thH lHlKhpGhB`H Kh) Khj3c1 i@ pGh(h pG pG!YHKh2`Zh:Z`pG!Y-AFMFlF+h3+`0j  0j`bKZhB`h`h$hB`g+h;+`KKh3A$!X!Y!XHK-AhN,j3h'i33`@F#`D< + +KhiCah#`K$5bhZ`h`h`#hE(>ob#``O02;i+j#h;#`+chZb`x$zh+3h$nh#+JF!HF>S"!HF>(@F3h"`Za2hchQiWa Dc`F)F+: * Тh:`* H`"`h!`:`*;#`+#+p#.x+p K03`h Kh*.poH!Y L#h;#`+chZb`xB#h;#`+ڽ@7!Y8 L J#hh`hRhaabhZ`#h`O3 ``#3aH!YFLFI#h3#` "!(F>8N3hh( 7hi`#O`ma K"``#s`#h;#`3Kh@!XpH!Y!XF-N!F3h33`>)H)F%?xpCO)#" F",C!" F>(F Ir( F>H)F#" F#"C F>H)F FTB> H9Fp3h;3`# Kh +!X!XFLF#h3#` . O(F}`# K^`#h;#`8``3Kh@!X!YH!XpNM4h+hh3+`(Hi0#j˹#h F3`)3h Jh`i`i[hQ`s`+h;+`KKh3p@LpH!X!Y!XKhpGHpFNM3hB ЫBѬBHVpH!Y)8ML+hB8H!Y8FPM+hh(+h`8HKhB`pGP%Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` !]Or5PFSMhB%RKhRL(i hCsOH!>x `0 hKI `U h:(`GHFK"N '8F 7/8F> `0>hB! h! V! 5OQ! M>9hB >p0$h"F*H 9h h0;$h"F$H\>hB 0F>L0$h"Fh h0$h"F h! O3#`! ! `!]!_P0v@!_nF0+gH3K3Hh3KaYC11N% !Ow3h33`B 0B(&K)Hh&KaYC103[h? ѻB5!0$*h(ЌKFH ;OpO5'Qh сBU`p;3h;3`3 Kh@|!]Or5!X!X8FM+hB+`Ќ'@! F[+h;+`3Kh8@J8!X!X-OFFF 0hI FO_ؐ3QHBݪ IFPhShBE_  ++ +E 90+ і0+k0FЀ F{0#00CEooKpHhpKr@hZCB_G_'B "-"fJ!"Fh aJ !0XFXF"D  Q=XIXFO "!FDch;c`+ F:#h7/"`!FsH( o# X+" "=J!O#7J!XF5J!XF(OsB  "YFl0XF"\D(H@]ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#hFZ"` "p:FYF F74!]POr5(-W5>CR0Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)F'KZhSD(K!(Hh3000+ kxp?+YF8F,L4F69FPFu(((F&vKC;Ԕ Z) "R,B4HH$PXw!]g-G/N0Hf3ic.M/O+h!hP0F#+H+H"!1h OA%H2O yC1!0CE!Ch;C`+#~ hY` "p F+hh"[h*`+ HF 1hZ`!] !aOr5R';MF(F03;D+7Hj(p(g(&'$0Khh[h .H!F`+Kh+KAYC1*H$ FF.)9$H0#N#O0B# cC0F4X8hCh;C`+9h0 hB̿ # #P`p;! KCX0hB̿ # #Q`4F!a!]Or5KKi !T(@B!]JiH#;pG2 pG pG!]KF60 Kh Khy Kh KZC200hI FpG!_!]Or5 -GFJM+i+G?\#+a@F;DO;h3;`(WOhpFkh",`!O O0D"F93k`;h;;`#3Kh /O! F;h3;`.K0;#0#63h0q. pC;h;;`#Kh Z F0 F40O QFF!#F"EPF2B03 *4w!]!X!XFKJFFh`IKJJ` F F" =ĹDK`/S-BK60+N!F !F !F L@/B-6K60+3KN0+O0˹>F1F =ﭹ,K1Fhn0#Nhq@RF%H0h!F !F K60+в-K"a-!F !F  F=H)F=xPIH-0+/!_!X!^!]P* FF JN js0+ ""BO0>"F-OFFF #`iL AFHFFh #h+#h+(F-$0PF300"B.00OKh+OK60+@DE@"P"sGK!Fh0;0+BKh+0ñ !0##FB C )I*#00?#ЬE?O|dE,O4T`$@8`F? OsE!2 O~EtEѐ@D@T`#*#!0DEѲP"y0C0z!d !_!X!]!X"-GF F F " F(0KN0O &@0B(ڽ'JN *3$N0hF>8B4h>2F F0 #h@j"FHOO0C0C0 F64Д0ոД0#0*F!F8FP!]$!M(FH` M,+hhё xH6 l(p(Z($$$ &K6 "0 D@N0h+h!7hh "FF8Fs+h*`[h+!F?4!a-O%NOF0FF`t-N0۱$en,p,H=hO Khh+-@0+M#KO &h>GջF'^F[Qhh+,O #1"9| *@@\F#"(FF(kH)F^#!(FgH)F0++ F  8h8A2B̦!@FXSKF( [, З *!8F F% F(F1h.GK60+8Fx ^B4 s O O z@$("0@#!0F0F5ѾB=Ж0+0F>\F;;i#("F3JAF(FS) 50b0+\FF'Ԁ 0+R0FԀ0+8FV!a8!aZp!]0 ;!KCX!J  0+0F-??"AF(Fp CF+Ж0+0FtpF=5N3h33`F 01K)Fh0#h@RF*H'!F 0+ %K&JhSC JRhB! F! F%0+ Fj3h;3`#Kh (Fp-OsB 0 5OsB-(F!%!XP!]Or5!X1Ki0H0F -H%+H&1+O0B#(M(hCh;C`+&&*hhY` "p!Kh0"hOrFH8F51hZ`M F+h3+`c F,+h;+`F# Kh @ F!]RP!X!XHKhh@} !a FHs h@p 8L0C1"B ۓPUP-H(F#ca823 !]|OS-C!F Fo%0.@F+:F* ؀* =*|.آ"۲+N'#:*'S"U[i DK)">+w++ \*э \"zx#*ѭzxF5K /CFF@Fx0? /CCBЁ""Ȁ)K /CF&KOaO#}"{x +Ѹ!K$"""I JICF%:") }*Ix/ј K$"K""+FO.?L"#>;Fn#X!]-AOFF,ni+k%h-*7]sEO(( &&XUM"hBJ!(F#h;+h+}HC`h!{HzHh.F`h!vHh%`h!rHrHqHdhhoO=޹ch˱mH hh!+h8F-hfH`h!udH dh5F`H`h!dSHx[Huh!YhSLHkVHhh!LGH`QHQH[`h!?@HSMHPh!4;HHHHHHHHAh>FH;`h!DHDH2chCNCOh,=H),h ?H!h0Fh!#h + @F8Fmhh 3H}h!vh!rYhr.M"-M"-M" ,M" ,M"+M" J!$Yh!V%HR%HP!]t1nG C$*0;BpF N F=! FnchKdh0F)F Fc0Fwdh,ppFN5KFa6 N0+ 2$$!aDi+ <."+*UZpp"pp$i"p!]-AF)KFFFh+A*C%KN0+:P!F F=@. Kd F0!F F=2.FKd0 Y!KCPO3C`#r܀/9F܀ FAF=.Kd.Kd-O!_P-A FFFBF O333MKXO ZhKIKhh 3H30KE"QFhFFp[0+-#x+:"FF2x),/*- F=!("#B"rڿ z%L F%LA hCh;C`+5"hhY` "p"##  65S] :+хL#hBK*Fh F d#cU=FKh+FI FhZ`!^(!eP!edX!_f!^ !X-CF3L&0 6/O?U(FBA(K!h= %H5#HF^0}B(1.ܔ^0+P60+Д.0+H6Qu(( WB-ѽ(Д^p/ J>FhKBKA9F`v!^!d px+P(L!#h3#`<.(#h;#`+B"Kh+>нp@:KhS5!#h;#`+M@Ĺ&F X O R0;#0#0p@`&#0@,#$0p!X!X8!LF#h3#`<( !#h;#`S 8@gH)FKh+!X!X8F F@-`hC 8uHWH8F!0)FF F8L&M#hBڶ+h7FOw83+`bhFpC+`+h;+`#Kh v+hh3+``#h#`+h;+`#Kh d8F!X!X0I " <-Jhh` D`KZh`hhB``Kh`ZhX`apG!_pFMN+h3+`ph#hBchh`h3` K`+h;+`[ KhCp@hs`p!X!_!X Li#h3#`KZ`#h;#`3Kh@!X!_!X-G*L+Oj;h3;`3OIEk%3B-3h)0Fc`ch `#h```D00%`hB ;h;;`KhӱGhh"DRi(FJFQFF#h`+D#`!X!X!_ J0 h3` KhD`h `h;`#Kh upG!X!X8L%h}#hJh[;(D`8!_pMN,h3hh+hh3` Dp!_J hh`#D`J[`!_-A$&FU{+@>`oCBHL :, D4C hp$r5UFF-8F ApG, 4S l)F@F(Dh(F F-OK"O&M` #8F3F0Kh+hHp,r,d,+hx.h#b8&0F#!HKHN(F ^J#Fh2`O" # +QKEйIFPxPHIFJxB/LHh:`*F[FF;/?zDHh:`*[FFnF h?g72h_:2`* [FF OQ{F Ohh2h`:72`OiF 9!I(h!F:2`*XF0$J#5h2`Er@3h33`p"(h" " !Y!a!a>(!_؛(?@F/? "1F-A%|L FF(@030!FFHCF(FN0;0# Kh {CKH,FJNJIHH#h3y@F#y\6IF74/BL hCh;C`+"hhY`=N$=O " p)h9y@F* 2F:F45,ѽhZ`1H+N0O؀yyB*h\@F45,$L hCh;C`+ W"hhY` "p*y8FhZ`)I hF F4y4,Ѽ $&U6A8F v !F0FC 6.K:F H]``\PxX KF $yBѽ@0(KHY\n8Fych=U h8@8-AF T 0F0+р'======e=====;=$9==========X=7V='F?'O MF0 +0  OEѫ (@H_'(#Р0/0+-<_y'(@2^0300h Q_,K] ;+#h;#`#;#hEF;#`Z0L0+0_ OF#hEF;#`#3?;+`(H\('&\(!'{ۤ!_٠ܦ!Y!Y!"+ڢ!LH?('U'V'TA+7Ya+WP/-٥XCo}H#h +F"ho2"` ?b? Eɲ )#h!;#`!hF9!`+?0"`* b Bɲ )#h!;#`!h9!`p?Eɲ )]!h1!`!Yp#h;#`H"` b 2Bɲ )#h!;#`!h9!`pA?Ҳ *Z"h 2"`Xp#h;#`Epɲ )U!h1!`!Qp"h:"`;5oK"`*b BBɲ )#h!;#`!h9!`1pAҲ *Z"h 2"`Xp#h;#`pA۲ +S#h 3#`Pp"h:"`pR!"-j"`b bBɲ )#h!;#`!h9!`pBBɲ )Y!h 1!`Xp#h;#`3 pCҲ *J"h 2"`Hp!h9!`p ' '''\(B? (0300h ' ' ?'3D[#h;#`#;#hEF;#`{dZE #hEF;#`\#; V ( 0300k2cshZ:\(`(}(ۉ˱I²#h \; 9) #`#;#hEF;#`+%$("(ћ+#h";#`CF+"h:"`\" Fqh)EF#`#;#h;#` #M3DB*#h;#`#;0FChFF`"EFZ*ۉ+?t0FChFhqKB#hEF;#`#3D12#h;#`p[ #h0F;#`#0F0F]IChFF`"Z#h;#`# [0F#h;#`#F0@F((F@u((@fr#h;#`#F;sh[#h ";3DۉS0F'n#h;F#`(FpIFU#h;3D23Dc#hEF;#`{sh:<)(F.@F&rh;EFK0F5#h;#`#;pF #h;#`#AF0F3Dۉ+S?sh HhB0FHAFڢܦۤ٠"GHB#0FH݉M0F0 Hc#h;#`+DۜK[hsh+C'<+=+:#x X#xF+D Ff0BF`ڊKhBȿ`>/D,$>(H#+`00F`]b0 a)F Ff(40@Fbbe00Fa0 0O2`+hKhB`>/O4<(>(3&(3#+`'|(#&(##+`#'+` `0 (j]`a0j-("`$t`##+` F#)F#h{(3=J\V{/#`OO ;3Kh#h3#`$i#(Fld}(F*K\ 'Hh00XM}(F/FO MK]hOh:`*E{5K*\Fh:`*O=eEF+@Ӏ%/Ā:/a#/mOܦ"T"o!^|؞X!_!^F##` Si3SaM VF0FL!5(є0+HG"8!M*hQaa` +h$`(*h Si3Sa+hh+hiH*H8 F""FapGChBhKFhpGCh hhBpGh!bF FFFch```v`FhF9x(!H!K7ih8FBȿ`F F9F F8!"FF(8! ! !F! !F 1i*F F9`[KXh8 pG!bF FF)O9 FBѰB0F8nK FhB`)F0F9B, h*F1FFHo F8PH#F*F1F##-AFDh FOt`{h;{`-- FDFh(F8&h+Fh(!bpF N L5h#h(F3#`+h(F3`#h;#`3Khp@p!b!X!X8F Kh\- F!$heh$h,8h(8-h!bKpFh FB`hB`BF8#"!F(FAB 6h(F80FT!FFH Fp$8$Mkh +ܿ3k`kh@ , !bF8(+hB(`8K2Kb , $`8dfffg!bpFNh +JhBh !(F8\ KhB`B(F8b Fph+ h +"!(F,F8>h+!b!^8F Fr(KEh``8!b KFS 0hhB` F@9lFF!bJFhpGhBh!b-CFOhFF;h -;`ܿ#KUh;+݀K@i!0F8&tK$`Z!Fh1FFpH0F8mKhB`-iK0+𫀬B{"!8!  F8iOr@!0F8YKV0+5i!0F8xCFOr@!iF9V0 h F8`FK"`!h(1FFEHpCO F8v#`&iOr@aiOr@ !h.=0FE0F`@ *F1FF/Hm - .0s# 0;h;;`#(Kh 0'O)F0F "F(hh*F!FF(F8"EFF)RBO#)F F(h)FF H)! F8!X!Y$$2!X$VpF F FXO0p x!FFH! F8AF-Bh! F8BF -6hX!FFHH@H@$$p-OF"FFCFD#O"I2F8h J!K!N-FF3h8h[%I"F8hIO𜹲hB BFYFhC8hIF EFQF,h+$ 6-$,$ $ج$$$8 !MFh8,C Ѫh* b ! F8"E KhB`8 !R F8A " ! F8 B" ! F8CH.!b$8F KhhBVhFhBch)FGh8`8!b-O$DF 0F@ yKhF`D``ؑ 0tKtJ`0sKqJ`pKhhBnKhB`3h F;+hB FF8 @!FFbH! F8( hF@ FIB(` F8 Fjv+xh!FyF(x! F8b8(0300 +AK! Fh0BF28BCF]h* * *0h!FF2H ! F8$ h*"! F8 BP"!(F8 h* 2P*F!F8F"0;0#Kh $030BF0Fvh B(!b!^!^|%%!X!X-O&JMFOFL#f`+`:F F A L}M+hB|L h-#hX@òs+v+tH.`O oI0FFX,СW@FF@FF000+x+@Fz(0B@0B+ѫh+Ъh FI+H!FH!F5h*ch;c`+ F#hZ"`-"p I F^ Ft&%8F%Khh2$Jh,6h,hQh)/Qh xa!" D"K60˱,Khù,Jh,Jh*1+ K"`b`8 K`! F* F!b!X!X!XF* F@I FR0 Fn(O0&LFPn0J#FH !HHt!d$&RFYCh;C`+5#hZ"` "pN%O(F1FF F -?- !FH@b!F8F^!%ch5;c`+ F #hZ"` "pج-C$MFO+h3+`J#;``+h;+` KhC9X0;3hx#0h4!X!b!X!X Jhp2FX h x3  !b-CFdNF2hQ*@[h+Fq?'"YKhk$[h+x+$$-$-aJ-P-\$s)|jF(F0s+[,c,tOAF(F0йsB,!(F#33k>+[(#`"iF 7L/EиB(FC8%+(KN0&K6 %Jh0+$$K60+ $$'F,FKN b-, ,T*ٓ60+)СBOY #@Q,CA<!b!_!au(-OF F!ѤIhehI(F0I(F(@Àkxp4p+F(@ŀHO !(GehI(F`HK!hdO PFI(FF(lэNLkh #h3#`hh!i`g#h;#` 'Kh+8F#h;#`#~Kh 7@/#3`(uO$&FZh[hxm,@qH$0FF@F6@.jHjN$kh{khxc0Fhh FF@F4@,ц&W(3$%FPYOX -V-%^hf,OSH$w(FF8F5@-,HHh4'9I hBF8/P% ''/6.?.԰<ԐO T(?:j?(Fp5K"h5IhWO .%/?a,F %(F4kF8FP ,HF4F0F4\F@FA ,]H,F W/Kh hZ(%h+x-+kx+%.?ծ4 &\&~&X&R!b!X!X&iج&t\&_' ۾'/O D0+?z)HsD'H0C%H0FF#H (()-h030% OZhXhHDP!0Fp0;0+9 Kh+?4i0030-(FF&t۾!X-AFK"`d%N-,ѽA{Yhx3h33`cYBYA#3h;3`#Kh "5!b!X!X!bpF LF#2 ,D2;+!(FX#2p!bKXmh+(x+ pG pG!b-C' L N131#rQ3@+1;1qUh-hFX2(FAFF{(F|+hF!b!XK@ 8 !*pG!b8F M\2B ! ! }! y\B8!bͰ#HK`"b!*8X"*42d"@K@Jd2`K ! ;K `i !7J !h3`F81K ` F*Kd7)Kh'K&N 'K5h`-th,#x+)F Fu`,%,   7&! Fb"""b>*#`" 7 F+P "@S  CC !b!X!X!X"K [!b8F I'!F F `]8 8BOrOA ֤8 M Lh#h3#` t#`k`#h;#`3Kh8@8!X!X-AFF F*F1F@F7$-D'7 /`h+O0%FhFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+-3 Mh+hq`F3+`nhc``0D `!d!X!X8E F?C K[iB F8@ch;c`+ F#h*xY!`p8KiܿKYiֿFH!F'$R]pGKRi]pG p FKFR& ;+Bp0Bd#<p@pG-G F'!F8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pWch;c`+ F#hZ"`""p3x[HI0F7\0FyF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0FF(ch;c`+ Fz#hZ"`'"p'=F'O֤KYi4L FE@?Fxr+ HH'T'th-Ah h2xh+xB,K=!0FhKh0=!F(F@B!'F=++x;/0;0 =*+O%p=F)F0FA7F/F5F&Fp!_ChL!2hJh F F !d'FxB #` O^8\ 4F[=B|] *`؞-A("l DF: 0('cFF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;!dFx#@HIDF FBNO#x3H!F@'+8Fe,F'! FF H!F"F0F&q''''-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`''-OF+LFF0; #0f% E"K)F@=* Xk.qhղB >IA%`56h;FT ZFJ!dy!dC/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!O7` KDi,hB Ѡh*FAF$.7`'F$h!d!dIKFy F!XDiF0FF(nChZ `0F1#t!;Hg`j0F@5O:h2:`iRsq Ch!F00DGkh`Ѩh*ikh2R"*a L##k`D#k`khH$$TCKFBB0 {;h;;`ùKh@E $ T?5Fh``'!X!d!XKǰh!Khr@ K` K`G]K`"K`@!X!X-AFF=!F BFHG(FcBF+$t="+*U"Zp&41F('`(FA 0FD;'Kǰh!@#K`G]K`!X87\L0`F KH-F0 I"#`0 KBF8@H!d('QFT(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp"( ] !a!a!X!^x( pF MF+h3+`T+h;+`sKh[p@`h1F7$hp!X!XsM,hLH0h `#;0p@;h 0Fx0Fh"``Fkh#0Cc`h#a`5p!d(%O-ѽ@ch"h2`Ԡh)ch F#4h,5[ՠhch#@c``&F!d"FF BhiC՘G(h3DhFKFh(F"F!FeFرCh2CiՐGph4D gh)F8F:0=!8F&D F$hh!X-C' h=F #xr+&&@FKp:Khh#*F1F FCn(p('% . F&'-*Khh,0 h(F! F c\=+   2FIF F(Ch7 3C߹F#C`Ch#C` H"F+%ChH"F"% Fr(H!F!a((=s" FFFChX)> I h2 `#c`Jh;`#Kh O pHh2`)! DRx I"0F|^ch#c`chCb`ћԠh"h F` !X!X-ANO|@ #heh0m:h@Fhdh Fh+Ѩh!"i:@hh0DGkhԨhhk`h`#i+a!d-AOMGFFF(F$F`VK'h=U Fv, e, f,&x,O''OGFC/(hAF*C(S!a(ܽ@(H" (X-CFX FT030;x-+F!|xHM(h*hGI0t`3`0`;0+w?Kh+sCH"8FF=!8F\F8F%A"h##3a%8FBehBh`BB`"B0iC02aC`B*@*% #c`h\=+8FR% rKB 1\=+ 1#30!8Fpch+Cc`!X!e!X!d8F F8`h)FC$h8HN(x(I($(F ( M+h*`hH8DDM$!F(x!a( hxxpG hFxxPxKxpGsF# "` FF Fh{h"+ jfC2s3H!FBxr H!F Khx21 R3B0F)Fp))X̰ FiF6 L& F6(!60BB8BԿ  BA ̰ FiF6 L& F6(06!BB8B  BA ̰ FiF6z L& F6r( &1BB *1BB  F F6 I#\Ch @iBѤ5j6B!F6ؿ%hFF(F68W 3jB8FgFxCx-*xKK"I#`x K " I#+K" I# Ij(H ה<؄)%׌0Fx F!+Cx+x8 '0(F(𕀰0+@𐀰P- - - FF x@ @ x8 -iF F6(E 6(=-` _#)/5_M_AEI___V[!hF;!!p@O  p@Op@_p@Op@_p@@Op@ O  @ +s 6B6 +x(+ #x)+kxbxCO0 TO0QpFFFF(𙀰0+@𔀰0;+{ "+:IWep)F Fv@ @ )F Fj8 )F Fb)F F\(Կ  FF(FFBB  FF(F FBB FF(FFBA FF(FFBA FF(FFBA FF(FFBA)F F)F F)F F&Lcx#x!+ )F0F(  p(++x)+kx 0xkO08 FF#I hX=!IT%HD%-011 chx@ 8b`h(0\xx!+ (  (+x)+Sx+H )()*),)6FH2!Kh )|KhHI3Fh !X)7 "FDxFFJoAACoBAI"F 0*-OF F I,khf/x-*@Zxl*`G*-*(FF(@vJ(F0h320[\F(@>7.mI8h.>7̡=OU;x%+y8FF(@)h`HO>@FOs*њx*LНZI(FF((FF(;hB(Fx.ќKJ#xh320Z F[(Fȿu F,h(?uBK9Fh#(FH0(FvF ;I*F :H 7H=Rhx+K$y F"0p# "`8F\ FFB xɹOBoAE?IH:F nFh!I!FXF5J0 IO*hH?QF,,N!XF54H X *|(*@*Z**4*;n506"K#J"h!KhwlDQFT+c8CKh+J#`J`LKJ`"Zaa`%heKJL`hKJ`c`8 !X!Y!Y!b!a8 K$`QKO2`K`KS[L (F{ #h3#` KA"!:#h;#`#Kh O8@տLx3(!X!^!X!d0!X0pG8F F8+h)F`h3+`$hpF&N F,G#h*h6 D*`+?!!!!!!&!!!&&++;;;;;88;;66h)Fhh)Fp@ȿhkh3Dk`h)Fh)Fh)Fhkh3Dk`dh i)Fh)Fp8FHh;FOK,J`pFF@h1J h2 *D `+2 22222622$044<F!f X--CFFFL@- H9F%##a9F H2F&D,D|#Hu!f -4!f8-O#N(F F3aeKhS#S7`h%!nعOO:F!F(FC ќKh-  L(X4#FS+`sa,FkfKhBh+щE4\. " FMKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI F#\'*+7F;x.+{x|*+z7F^H)F^8F\IO6DXI Fz'O4{xxOxp غW غ%:Aڲ*KKH)FX +R#+R#As2LF\HFH0F\(ʁFO\ ps#;ppua F1F"F(F!f n~-L-TJ-r(()Q ,(.&*Sb FXp'(\("(4 Y>o p Ff n r t v O\ OM ( ^#? F ;HpaF-#(@@^#a e a!F(F=F{pKihL h"h0@)#I SxP`>dO `5I"df PFd(x!Bs#;ps `H#F2F)F0uL"yI#n`:hwHqCF2F)FqHaCF"FBF)FlHxKFl"c!(FrcCF"F1FMsBF1Fn[Jhh(!3`FeBF!F]AFF1FTF(Fj"FF(FQFYse"F1F@JFCF1F:aJFCF!F 10h(6 x"+'+!NFFX0+6L"QF(F"s)e!"F1F (# `0hb0  hXO OKFBF1FaKFBF!Fr c"F1F(FKFBF1F(FfKFBF!F(FN.ȭB,ŭ#Ki p H!f T!f-X hh50h"-CkBRBckBcBl"rBbBd"bpGjF@#80#l#SC@s#d#b I4~(I ]t/9I 4l(I  tn/BI 4\(I  to/Lh"phF F+x-+5 ##bKI # ȱhԢj* H)FL$3h2`[hccH)FCh FG p/U-FFFF)h9%x--41hF FHh9h!9`kh C ;` 5 F8:h--sh "C68 FhJh@(F b8J8(F$( JD(FT(J<(F<((,8FL#h# ##`e`8!f) F2Bh:*J!H2H JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJHt!f!f-pFM.h6FihH(`pDH. H H!F0H!F+hD!f@1:\-CFFFF<F(F!FBF+H~.F hHbԐH'ԏHaԍH#ԌHՊHbՉH+sHՃHcՂHՀH{Hv,}Hqg|Hl!zHgyHbwH]"uH,hsHQrHLbpHG'oHBmH=clH8 jH3iH.+eH$cHbH``H"^Hlh\H [HYHO@VHTHh!@@s+JK_G0F.򋂢BHAH ?Hb>H2I2Q2X2`2g2m2t2z222222222221_2222231gp13 HDРHAFD/H9FB@hHLHH LHHbLHH'LHHLHHcLHHLHHLHHgLHHLHHLHH,HH`LHH"LHHLHHLHHKoFH,hW.NLHHLHHcLHH LHHL~HHgL}H~H!L|H}HzL{H|HtLzH{HnLyHzHhLxHyHbaLwHxH\wKFStHlh.>LpHqHFLoHpH@LnHoH:d!mH5mH2lH/lHhkHo3F"4,? X)HNHaHaH`HXHWHWHh.VHVHVH@THTHSHSH11111111111111111111222 2 22222&2%2.2-26252>2=1>2I2Q2P2Y2X2`2_2g2f2n2m2t2s2{2z22222222221G2222222221P21X221O1W0000ףL:H;H</39H7!L8H8H1cL7H7H+L6H6H%L5H5H5K?F.h0H/L0O&h>0F5,Hch F 4\3F:Fd!.zh\:zBBF !{h8FO 4\BF !FHD ,$ 7&222222222331f3 p32tIFHz 3 XK IK( FIHd !f333XsFF# "`#x#+4 FF|h#I"F x+I3F"F (Fp408Fx;#+MI F`8(Ѓh`!f3 hh4FFFF "!F(FH0`02hB" .h"++x#hx(иB K0h30@ O O X H\ Kh  "CFh"+I !Ft!f H: KYh  "CFh"+I |!F!fpFLh h#i{B H@F IB F FBFH "#%a#p!f>p8FL!h!I*F 4(F K"y` `("YaZ`bya ""`н8@ 48!f0Fh FxC H)F K #`0O3!H)F#`!fLh+ + + H]4+HH]4HH[|5pG-OO 7N}FWF%2j*3HQF|OQOJ"@FOrz 2j*HQF(F }FERB2j*!HQFT y +$))#)F  E,9/FE2j* HRF* @FG(݅BFFF!f>Tu7 FMjj*I 4c  IkjB B I"F 2"FI 0!f!l 8Fx 8 Ih#\%+5#I#T(FF(\+= L J N O8FT; tT8F1+F1FBF@GXt-CFhFx;H1FK +`/O7/!Hx/)\0`0\CFT0P DD+`H1F!fU!f"-GFcIdHbH*aKbIbIH#j_IZHj]IXH"k\IUHkZISH~bkYIPHz#akJCBUJUIKHnTJH0aoRIFHdOJJ0+OIAH\KJL0#LI=HTGJN0#II9HLCJ#m#FI6HD?JcmDI2H>Ā'0B *I (HG3U<+BaAFHFU̱O FFmEUd dEFFOJ*OH#JZ[J I2EB1SJsjqDBOrjAFv싛jBLIB,QaB@CCj1jWBKB XEMF#I :KB"XEы[E=XE5H*F#FQF22[iB 3j+-H*F#F22j4(3j+%H*F#FQF1+?RjH:FQFT1<;j-jOr@F#1JH% H!l!fCj}VEW&!htWEV:zF FFN%"h*o`0o0 !F(F#5+ { JsjqDB I"F LI(F!F !f!lF!f8F Iy(O2 F!8@ FE"0K[i+ O2Or8 @!f{F HF  !f-O$N4M%FOS-3 @1(I 5#pI \F+:!@F(H)F4F#I ;PFp чI@F(?FI@F(u888;x+B0wI@Fl(OFWFOsBFAFHF(+iHJF)FLeI"8FZ (IF(ѧ j8FNAF8F CIF8FCQF8FCLH:F)F4II@FXHOO:L ?20+?-E?*"F@F8P)FXF4@F7e3I@F(iB.H)Fi0$0 &I@F("#H "I@F" H I@FF(GO3F8F 2H;FBF)F3e!fw=S{!fx!f(n!f)))˅I@FVFhO3F8F(se}|I@FBFhO3F8F(3fisI@F.FhO3F8Fq(eUjI@FFpO3F8F](ye@aI@F _I@Fx"O3F8FC(_sf&VI@F퀹"OsF8F.(Jp0LI@FFxOsF8F(4r0BI@FFxOsF8F(t08I@FFxOsF8F(v0.I@FFpO3F8F(g$I@F~FpO3F8F(ݮg a+ؘ0+HBF)F^iBHBF)F/"H#BF)F0>OC _mz~)FĂX CE ,?~)F~E?qIHF0 Fp## ;6@FJ 0h320[@#@FF5 H)F4!+򅀄K :H)F4HB  4M[;+FF )FAFT(oHkJ F0 O 0+C;ڲ*?Ĭ+?R#89189118189118111189EIHF: *F"#EHBF)FTDHP#o)Fe  KE?(?v)FVKE?e)FF0ODB?(?W)F7B?t)F(B>b)FODB?W(?.)FB?K)FD KB=X!f!fHJ!fKs&S[}>"1F F8H(Fp6 I(F K"1F(FNS$4(Bo Hy%)Kh@2D#`O08F&L5+5 I2F(Fs(h+ h+H6 #5sI(FX(HMKH]`(F5 p J I(F@( H2F!fVEWdfҀdm;Q!fЁdgFHBOr F@!fKJIXh!ldmF1 BpG3+P@FQ (JOa F x (( ! F^( @pG#pO0 8 L M!hA8@`H2`h(F 4!!mLKhFJ!h)FI(ݝ0c+ C+S+ Hs+##` m#!C B!!0MIFhFF( ݝ0Y+ F(H M0!F(FA(H!" "KFHhL!ltmI#F"hFM("iF F$ m"*8FMFJ(F>K!F(Fh8@!ht!lt hhTmIFFjF0H mkB If (ݝ1Y+cFHAdr">"W"*Fgj zF JOazzgzGz z ]"7 FFQFF+x$+kx+_(FBUxT)GB))HP;Kh+IФk"#FC##Y@8C++R#>>>>?>>>>>>>>>>>>)? cڲ*H.H,O0F0zg ` P0 zg    @!""mLKhFJah)FI (ݝ0n+y+#c` m#H !#0##, Kn:f*oB (КmQeppGI2׼-GFF"F )F#F-I 9F+H V HxBFE 4"K$")F8F!FH vFhDFhO FQFS)`D0FdME0FJFB6 &/F E#;(=9-OF MH FFJH!FqOAF+(#W# ZB𢁰IF(I"HbO [ r}I";F7C("8F 2F)F FtMtN)F  Ah1FT(kH  Z(eH砀0aM^Nj)FB=h1F((YHbWMQNj)FC$h1F(NHbLMEN"k)FG h1F(DH~#cBM8N)FkAh1F(9Hfc7M,Nbk)FBـh1F('HLcc,MNk)FxCh1F(H4c MNJ )F^G(?1F(5H#F!ht$#i####~#$$$>$^$$$$% %,%O#Xr#J04M4N)FL AYp1FF(,HL0*M'NN )FB?p1F,(!HN0MN"m)FC&h1F(H#eMNbm)F0( 1F( Hce M%o%%%%&&.&K-OMFHIAW(ЮM.h.Oѝ0+@G0`+@BP`0B:0|VaB  `03Fh3SsEbF”FO0 `I"+(# nGBxI `ȹI""HO0F1FF@kh+ FG 5}JO R `J(=ѠDh  F  `QFC?hx4+\ѝ4`+Xى4`0BQSa;RX[hDkB]H a  " aWHy0x|X  FIF  `A?"(CХjkO F0ZF a??@H af a#" F(kB7H aO3B{ 0k[@B{-H a"1F0(K:F(H!Fh>&K[h+?ʮ"O%FO3& B Z B02F;h!F@F%#D65H M&i&|&r#&'&'m'%'|!lt!'$&'?h F0:*F`ڍiBhQ`p0pG02 FNIF F*KKLILIS" KI" FGI" F!FEHmCH!FmAH!Fm[>H!F!F !80p88!88j=X88[888sLQ Hpch;c`+ FTFN(F (0I H#hZ"`xch;c`+0F<#hZ"`x +% YXBXAp@pG88-OF0NFhC.I uhO lCDkB D tSF"F$??O0rhh9FO0O``/shB"FhSF??`BhOr9F D rhh!F/DshBOpp8!8FK"rM"F"Or)F!F!U"!oU!LM$("4!d@,8!!(!n-GFNMFOrF pH1F(MHTE  FBvD0OI)vHDRH0Or!0D&02U"D!oU!4bvDyqKFS BF X2<D8 I 4LFyFD#0#0   F   0D8H2 F3H2!#;FL0E@ r2wR˺BFH"u)D:RH2;H2!-OF dF !+[)ỲXkb BzM-B!BAE2+HBO ++?B6BBH"v02!:BCܓ)LPqFRJ?K?H)ؿF1JAFh} *F#F8HND1*+2+P2+b.J9F+H p(F!F0#XCF'F3FZFQF HX1F6*F#F.#Cs#2n!:[E:z;p;%;4;I;}{;=;::;;<<͝@#;*"kESBT*V>K2+s #F;Pҝ>0)+7JAF7HZ0)+_2JAF3HXE#/I0K0H*ȿ F)JAF-HQF$K2+?"ESB"KJAF#H"HIK2+%*KJAFH)! |*FI KYF"#<KJAFHPF}!zHH2FT0 SE2I2cBy(3H 1PFsFEBAACDC  x2E+?g'#*F9F6#FaK2(@!+-/@(4C+CC@"!XFp=!=z===!± BFu I Bu31+}K2+?'#FF" FFz鈇!JFKF& .B%Е1 FEFzkACd@CEzFOFBsFF4u  FBГ!±VJ?EFz 6EEz13)BpOF 3C7F Bu/F&F=K"PFIFX\2TUF7HLF *CEOHO ##REE:F#3Fi F+#*F9F6#F K2+B/@!?4CC,C?+ >F=FHC;FFe2"F8HC?FW`&?p?C`+? 2+?HB>+>>>M>^>n>z-GB\LF 2@YHYO%VN 2)F8F)F#5"0F8- 2+P2;MHMO%PH" 2B +@T(FLEH 2+u,FF?HG/BH2+;H)F8Fj(F0bvOE*E& FF!0F 2+@FN(F]0bVD FF!0F5!H8"FH.H2BHG.(F0B1E$ FF! FGFHH#")F!>>>>?>>?7?P?Z>KC}F!O"OF F0H9F }\" FI" F# *\"! F~K2+h+#9FeH#"i2BBhJ#iB:{7?i?!?#3N3LB d2C0I."(.Ht+J! B0*Hj#B d2C"I.( HX2ù FH2B1o0"ACE"0H)F:ROu-iA"0 H025;Dp!dm??!(?Fi,/iI FHI F I FNh4h<Khñohhv,F h9F( Kh+Fh0h9FF( F$L44!(F FFxF8F4 `0F0#`kh````4l`-AFhF FF0F F5)FJ3F)FF@D<`FF4-G]Ki L h)FB(dhI<K# Kiѹ Oph +`JOa `0F#h`+hc$h !F*h O@&4%h$` ;9FdF(D%C$ ]`pKi QnKrJ hrHBF&pN0FS%BE .F`?,J  || Sh+ Sh` Bv(FF0+-+ =!HFE$4#4;E$4FGH  |^|[ 8Li 8 ar88C 6Hi/k .N'Ki[0L 0M*F@A 4@#h 4@th+T?+h+!H 4AFl 3H 4AFbH 4A\H 4AV S Fh(%HJ!( 4޿$44\44455 4 h O ?* ](?#OrB?|FHK@KpG!KhpG!KhpG!LR FR!F  jX-GFFF45ILch!hHhS!hH 9F0F,-PF|7FHch{ 2chS$h!FFH $!*7XV7f R]pG R]pGHR]pG R} -Gm(FiFAH$@.B>H5F(F mr@20F9F-%C=> >F-GFXFh FF (Fz8`8H)Fd h#@F UV2F+FHBB HM8hzm@F"h9hZC,m"hSCB >O>n-O$D FFp7m?8Fz FXuH9F(Fz$ F :F!Fsi*xlBkxhѨx@(dOpBx)?)j $;op@B7x)y ,y, ly,Ѭy,,Z( (y(hy(Ѩy()yQHyiy)yxxLIKI $lOrB2opBB0O 3mKE+(Fz)@FOz"OpB op@BЩx5H2Ix2Hx-I}$/lOp:O BR   op@BW+QF@0F`JFCF0F7H JFQFC QF`0FJF3m[EDٺx0F73QFH ZFCD  yC>>>??>FH KH FpGHpGHpG?%?!?>-OFF FFO 'P0BHF )jE!2K P@F 3F8 2 6H9FZF5I ع#I 745  F9FZFF)H)I #j+b#%I2F(+j#bF F!H9FI2F (I 3F9FsBFFHI (I2F(#H FBF9Ft I r(I2F?,F-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhB ёh,F" FX,$٣B b 2 F)FF-HCF*F1F8FI 5RhB)2F,$BH"F)F BF)FHH#F)FCF*F1F8FSIRFF  :mB!chSE =RF1F8FH"I e`tX,AAPAA@-OFm hF FF_C8FzF@fH9F]&0F:F!#lfVci!ipp+pOsBopCB m!O|opNB9&FFhCE|(Fz+p"poj`OsBopCB &&l!FPF"r((Fz&2F(FIFHFz~OlX `bEO)rEn2f2 px3lf"Cl1n2fFkFn2f1  Bp3 in2fI2 3,mPFh3"h;ZFXEBH&e:F)FPF,B>OB-GF` FFF&'#mB #k+kY5!lJq0F$0B' 0# 3+!,0( 9FPFT;F*F!FHFCF+ 6IF0:F)F FF7nB"F-H1-I /!lFhK#mB1n+ X+$J)nHc!FHFC!lJ"mB(+ X+'"mB + X+'#mBn'JH I "m#B/w'iX #d3BUB[sBD00+ @ [# BByH(1Osp 63rx*E*gHF FlHlI (G(1" AF#(11 $(?sE1 "BDDD(1%DD#DspC(1D KK@!JJKH +II((1C(1 D 3{+@rxQN 2- =F FOr!PF${ ;+K; # !  ( ! ( ! #KB"HMe ;F/FF[+?@H?-@;F /FF3{ BB%/ ' :F/FF'BBCxCCMC>F!CC!Or!2{ g3F^ϘBOp0# ()D {Qh)!h'-?ӮHF#"AFO32 +FC%<;Op3-=F qz ). D3sqzDs 3 \ D O D (9Op/@LZopCBR_ѳ}q}CCC_i`/ uOrQFlO00\-@ހO3 ^R`C@ހcFHGI E(K5wDDvDL opC@FBuuu_#_^5-@2P B6hB`+Q`ñ(FH I ( DD#D 0wwsw`IF(@,_ 1BāHFFHI F([ 1_v_ 3wL opCB|1su|1u 1F۲CR/DBڲ B?2- ;F/FF*'(0\-?PZF2#AF  +FSC?/ E/1B?*HDD$O1 ;F 1B皹LI00h+?9yFEH]#*P0B[X3 3+ChB?[X[F7HU_F5H8^"2I 2F(#spDDDe 3 9_FX)FF%H,F$H$I  PDDwopCwDuw5wvL BOuuu`D+ڮ-,D+ѮDDD.D?,EJDFDDZCqDD>FIt(AP-;/h_ӱHFFHI DD_D7wvopCL Buwu%D !BmHFF{HyI F 0 1D/F{FqHOrP( y jH Ch55Sh03h0d BiF^HM^I K(?Z_%d`DBY@FO3DQ_`5'#FJK +|B $DO RP0[E?DZ =FHF#!O31AF +FC!D00ӹ  BB̫ ]#K*F+.B$D$@l ihd0]C`Bc`+FFHI (?DD`+ uwwD+ -w P>JE.?E[EEEF!E>F-C F#Fi?NOAEF@FyF08HAF| HFyF(8Fy1HIFH8Fy@Fy+H^Or!clСk)#mB"H/ X( +!ShB khC`5 !縹HI k" P F H H !FFAFeFFG:FG 8!L5% %" 5F%ѹ 5%UUyZyV@U8YhZ`F F!`FF Fh)Yh Z`Z`"h!-CFNFF5F$ FU-28FU%JFi`AFC!-OFϰ F oIFF(EmN55hEhIhH4 QFdh EO 5jnDB$$5Y0hnx (WHV 5 1+$5*mB MIOH7 O"x2*$ 4!;(hBC@F#"J Z2BB?Hjn@F +knB EnOr!3f;F4J !O ,J jnhSCLFF F  ! "YFK@FvK vlopCB,1#u,1cuL#wL cw01w01wLhC`#T#T2BBHdjn@F +knB mG>!GHGGQGeGud!GL y# 5!KpG!KhpG!KhpG!LR F!F  X-GFFF5ILch!hH@hS!hH4 9F0F-PFyFH&ch{ chS&$h!FFH !*7XV7f R]pG R]pGHR]pG R} H-Gm(FiFAH$@+B>H5F(F mr@20F9F+F%C F+8(W(΀x-T`X.`+(h5FO`_ph!+&phOr@!+F.2KERE aP(Xt5p2" F(ڧ-O ""`=J3F!0"!+PIF+( 6h+ F6+`P+I F+nhh F+&'I F+b(xQ$## F ]`h+x<x6O4x1 -Xhx&-+,ۻ-+GGG F@FFpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h`2,&`lwhd   lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF8F F#T#E#34+gfXX\\xrl|q|pc^cWVFgNfWFF@cbaXXSBBczgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr  F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3!FHX0F zqil , J0hC FKh+Іq !d!l!`FF'F pchK x+`hF2BB' pch x+ `hFh(2BBРh(-AFFFF)FFee0F9FCh`D`@FA-OFHM)nH_#ClK hZw>C ЎOrE1F(Fe S`O"j;h]kUC2Fh #O [br #PF MTKh*FQKhFBiYQF[ӈ[Ӏ# 0 2Rcs 2*sO 1DO F#cF 2爈oO`FFhF 0;0#0[0ch F@ИGF8%J0hC0#0[0*F2FiFF k0ND #9hOR 0i zKih 0iF"i# 0\ FFH,!8!!@!`!d!@!h!lMFFFFH(!F(FP 3F:F@AT n,uJ2BAH!F(FFv( r I Kp@OFH M'! HJHEGMi7 FF0𵗰FFFX"!FhF#H0K7## Khk`hhiF F o`o1!\)-OFp FFF𧀩J2Bp-x𚀕BxX"!F~#0Kx68Kh-~`h!h"KOyCFJFC:O{-lJFCF K QFXFk FB@&;F @2F@Ag ~0F9F8pKFMF&FP0  @A C  )x ں0 F3U3 KhC0 v o3!`o/"OJFCF K )FXFk@FWF 3U#0+22C8 O FFC 300 Oi" Oz2H m  $ K F%JK H    J YJ FBq B <D@l D 7! !\!8!j bwb Jng DFb fj] Bq  JF@FBCi+@ i% l k-BiF*@ %i Z nIZ0D0 DBa# 0 P  @$C C]I h)REq <%D5L D@F CiF+AMI"iLH AIKKh{JH"# 0" 0kZ2!# (F "F8J2IhFD4H (3K+K0hOxOj%i  `I`8 K"`5j 4F$ b `nW@Tf !\HT!Hh!8Ht!!t-OFFFFBB@)Fu Fb#"#0 0 [kZ2#F vKhvK)h 'O@gp :F74p(F0)!FOs#Or"6 B0fK@ Fh *F0F (F\KhF0ZkBiF(F!F%,F(F!FjFFQF"iFK(hi iIk DE" :Kh+Os#{+Cx!F p#"F8F"HFQFP*KhD@F1FZx+@F1FSx+*F#F8F!F(Fe1F@F?!FF(F:0!Fp(F3x+x!FvF(F(1FG@F#C3C@F1FF@b0^Pwb!l!8!`!\!-OlMF F!X"F)F FI@@F4pCKHOF` F)F0+U0[2C ##; lM2H"3C1FC3CO#C@! !H0#X0K0F PhhFo##K#CqыHH(щK"`oPoH0cL0"! zO#=F F!SH !ȱvJh3`0tHQ#"nH(ѮS ! F@s8oPXFQF`0 + POTp@OHSHvRHw(`"! L0#Q?f!H [C"#d#X0IFIBO` (VC Nv PFr,I Bw:0YFvBv O)Kh+ +F:F)H%J\5Bii(h2SC2HBr#JF#Fl vF ABq  Kh+ +F:F HP0JF H0#FF !(!ITJJ2JRJk!)p-OF FNJ2BALH2F#F88#pSx МBp BBpb\5"0F!F0 rPFFFF 3 D2KBiC,~OrZC " <bDBF"[F H;n !@ @;i@ C@pEM*hi#a:k0"!Fo(`0F f#0"0F!Fo  Jhi Jh" ! JT!̜!\!ɰ!KF-OFL@BAET@EAҗHCF\Er dHFj)F` "\50 @FFFF 3 tDKBiC,~OrZC " <bDBFo" 3n !@ @3i@ C@psnDgN @C!PFqjC): s_H]Is"F5kh^YKhñYKkiU5O EQH"FkhkcKKFJhk+ #OsDc sF5 `  O  uUFEUk]E E+Kh{0(T5OsETF5T E `  O0UCEs  5O< 0SB` SB`!ɰJT!P!H!\!L!ʈ!!d-CO +KJFF Fp;F C&H2F+F$L{F;B2#k ee spN3hKMh,hC;+hB 0hvY(hvV#+`3`pT vN!̐!|!̌K"h pG!̜-OFH0$ FF+F ChGFXF $ K*jF(@40k{0tkKFOqFB"qJ0 B;FaF #EAK(FhKh+>CE"iR# B#33"pDi  jE# 0qK!FhjhoKBoKhRoBEKELۣiO #aO cHih( Q;C!Oa<(F[JYKUHihȱ ! Q+)  hIoYEJK!FhA+JI`GJFBJih*CS9QhQBѕH0+eV b=K" @@A`##7H A6H(FJq*JhF*5` *H)J!`S)(fkFF [(FGFТi"aRF3F(FN` I  j 2O ;!D!\!L!!KU!tKvKK!p-Ot$] hF F`+# `v F( !pC0@_8 Op$(5BOpr ۿHh<)rۣF#C )n+)F"  .)FOr ;k&]i@p JFFF;E5S@πȀ<5@D%@5Cql@qCm " B ACH0"bQ@+1-/ہK"G@A`##|HG{H(<0F+0kqCKpHoK"`67 .Pk#b0+ 0.k #O sCO{`w *u4QxєH0+@-w}RK"G@A`##-MHGsLHt(h0F+wI`@HD@K"`D6 kU j(?^SF 0kqC|FF0+ ch FGv $] FSyXm(FF +F:FQF F0  ZosC 3kDg XyI`t!ʈ!tKvKK!p!\!lpFhRV#-B+r3OB#py1`l2  8Flhal0 Fx(F(( I1Bs  8 ! l$hV#BB+r3B#  `8FF F1H F,uZ.J2BAT!F(F*MF*H*Kh+8+h+3`htxh$H F!H!Kh+FH+h FFH+h۱jF 8@FH( o+h+`hFH oi8K! !\K!ʤ'K!*KKKFFF_/F1Fd+J,Kp@OF)Ha'O>h&H&J;A1H0+   #]!F(FKh˱IOr(F x0#p@H(;h+ I" K`HEGMn!K!!\!ʰL!˰!t0F FH#j !F(Fx) )HK+0#p#LLK-OhQF F x+%,F(F!F %$܂&2Bu82BB"(F!F0[F 4FFJO hR Bq>V! .8 &^E(^F0FuFH(F!FyxF+4EYhX!S FBƀXhu }K(F!Fh C `SFwI0<\%Bii(QCL|hȡLṟPF908F ldK h*+`KzhB#B]HAFZK 2ZHVK" zh(F!FBO5zm 00 ABq" C 0;j;;b4$;4L3B2$ h:`OR8KhP1Kh#F[# 0pCOг O?гOޮ#3pi3aO  #32+?z!K9Fhq#3pKh8OO8Fa(F!F eKFXFwuC"ц#3p!̔!xL5T!l UL_!!h!!\! !H!@:#e8b@0  OpYm   +I I HFYF!O[!Oi AQ'J3Am#Kh+?<3sp6eFb(нOxd8 0[m   +H HYFO[+8a8ba@FKPf!!`-O"\KFFPh0 > F0\JBii&QC@ph@rPF0 F qKh+0+mKbhB#BjH1F$X"! ##r#hkhH1BHOOOOOJHch+r%%d%aedl(FhORfhn\ononFn#p00#0 %1hjBOt#0#z0+(H'K"`l+?i#h$H0"H:(?YHzx #B"IH'P(?E#hH' ;#0F -h:#0F-hA@ht5OtO!;KP0x4PP-OFH0g+zF3*sȀ*j0F9FF bJg_JXA +q@#YH7YKh+rXHO@F+jNKh+TMHJF3F@N kBBS;B2FKh;pO#DH(0?OF+O+h^kOy1FHF"9hHH)F#W00XOrIp v(F F^'Kh3JF)H3F#'HF#HpD(@epKh+\IOr +h^kOy1FHF! !ˀ!!QL!ʰ!˰!t!H!!Q!Q!lQSf!\ Oг_U5@0 - w(F @݀K G0O h)pX@ F(?tJ3A`TX(F t(@8K`HH(@5   O*CхKh+?qI3;)s8ңn+5KjIh $ hd0  xH wKhS #vHU# 2FF(00ó ?^Kh(%*:By5cKh<.y.*N0#CFIEGu -w: '%) 5G/fn+*IEu0+Bo9kC3WD ۱0C##K:Kh+? QFT#uF5HQ*0;#u FFQF+Hp~2  ko   ñ40C## Kh+?f  T*QFHJXQ*0;# 4HF FH2  !!!tRQv!d!P!lR !R!ʈRERkRR``Kh``O@V  F ##p#IJh3` Sp03KhOsBFBOrF g`gzK 0 00+C`hLhPmAFkM F ##H0g0+K+hdKh+EmXCC5[H#YHXK"`#p| ouL`opP`n4MK"hB#OpCeF @ +hCKhZk6UkC3 eDV*uѠn;FvmF5(4KF3N`p O h#H0$ kKD }F=2hI9U +m<5@$D5@AplRm @p # C @ C7 0QѺEљk0@FGՌ!0!4!d!H!X!ʔRR!t!l!FFBB0V#HKh;Hw0FH0+?#"####ػ H(<fI"S$!SXY!˰K!-OhO LMKhjB3Qk0HHTDLDHNO EpBu_X"! K$ K K 0%jBapK`0>\Bii!pCNFViNvIhNrCEr1 F F*FFB@Np 3BN  -*F#FECBs 4EB 0(FcCFdJ\5B ~2"heMBr(F[Ki8Fh ]Kh]Kh*n+n[Kh+qнoO XN3hMKh,YFFd `C #FQIBFPH#3`OKh+MKx+LN{hBT3BI5sjJ1BAr2DU )X ?>KhC4P%@CO EBRF6H+Fii$CC @w+ 9Fi FP&H!Fy{hBm;DOJ6#=OSJ:CsEBOb0ѲFF/=J:!̔T!<!!!!!D!!H!l!\!0SX!! U!xSS BRKhC4PU u#s`4sE0IH 0YF jFs`^F){EXF'6H1K EB9KN%0#Bx9j qH EEРeE rPs0D"Z`XFp b PUBEB%@@BBs#F( F H~BxFD e!xS!HS-OFiOTF *@F"8F!FPJ(OݱBBtJ  t hB "O-hh B4GQ!`!4pG-OX"! t#P0$5KF'F3Kh3K`0jB00j1FFd xC ;F(I*F`'H#0MF  B7F-t$ F)FEFKEh0۱ڱFF F)FEx+0F5D!!`T(X!l!!0!\h hPk[kpGKh @pG!lKhpG!lKh &!pG!l-OF$l`.SѪKh hF`J2Bv0F&Cxq#CC#hO+ဝI F(@׀FEHEЕJPFIFH2(h& `;h˱y+JH( #q&&KK"`2*s}IOrFis0;#0#0 0;rKh#0[0( #C5y3#; BR۠!hS -F(F DD)F 5!B:BF F 0"h*׀II F(@̀F y*?J"8Hqz(7J'h/@:F $HF,I;hOr;#0#0 ;h;'Kh#0[0$Jpy7'3#7DB>#hH8H+(?BF F0H!d! !`,TTT!tJ!lUTTT_TQ!\H(?ᮠ[!FSPF0FP8FIBF FF#4F3B#NC;C#Q xFFy3#DBE.#hkHH0 #Hc#3B#{KhzHp"#0JF F&pHv(c#3B#jKhiHN&c#h   !F8FJF F!h F H\&O!!TUTUUUVT!tV! -O|](xK+4HHK"`  HH! E@"#FF9C ЦHK`Hg(УKh3! @#"MK(hZX"! #`0K0.hBDӑKh*@/hB`O ,hOB8-hBB! |]HxH(~H (?{! vFr @@lsH0˱~,h4O F `CzKF:FhIhH#0VKj++bOaJC9h8F .XHb(4IK"`A:h:B=#]@A#]RKx+;h"OIPHj#]0KH~9hjOD8F 0b+jF(@d!Or 8Kpjh+@#OCp0/@8F( ;Fj (F(O sEm (020304### #/ V0I!tVcIVHQv!`!̌!@VzTVVX!8V!VVI!l!|!0!!\:hIHj2]MH& dhh23L Xj# *F(O (6cE *$#P#&#R#(#T#v 013 8(9x.h"`BoV(0+Or!F iK Y(h*,@@"OBp /8F %KFB### #89h3B 6KF B WKQ?j+? 2BB????#CF3Kh+1K#E/K#s;s*K#1'H&K`C3Cs;s###JoT{nx+UKQ?#;C?tCh`D`VVI!\!WJW0T!t!lKhpG!l-O}pJ0hC;kKhB }0ñ4p<9FFd `C#F_I*Fp^H2#0VI; Cx C*SKhRKxݹROQ%x+ ;hB25F*ѩ%EKx-*)pC3C;hB#HFAF#(6KC;3HAF2H(?w}X"!F b#P0##&K&KhkhhAh=(FTHHF#AFd(?BKG<HFAFVC3C(oho!̌WJX!!!4!!ɨWlH5!\Wܹ!|!0-OFܢKpXF!FhOrKF \2FIBii(ACBrhBrHF0(F 6KhKh*u+uЕKjhB#BВHAF_%_FX3jO #D+d܊O2!FF(FQCKThFѱphhm ##X0xC+] F NY0opo}pn`(F!FX*Kh#*H*F#F.4E(F!F8"Kh+"H*F#F1F-N0hF+!BB   h3`rI"hh1#CI"#I"F*F H#FWX!\!XX1!0IXYXeXm!!0!x-O=NO! 4h=h#!p p0Kh+Qݣm+$5+ Ȃ0+@𑀠H(@𓀣m+:$@CE2ݸ/+#H$5 2"n@H-B"kAB@򃀂HIF$Kh#.03OH$(qO?h;03# nAHhK.@𛁔)LHـ)^H ^Hv0+?g#$5"XK1h`ORTKhhRKh#Fs# 0GDT80GHIF@0-B Y0HO$%*% nAHD%8hDDDDlAFrFx.H.H(?A0+н#"K"8`'O`OR1hi^KihKhiFi# 0P0KC21FC: !!̔!ʘXX!\!ʈ UYX!h!h!lXYX!@!HtX5OsO sT#rOr!* `K! 'h*H`9X@"OF k<48dAv8F6@vBqyO j[E|u ")FN(\CKh3c  b1HS#0I*K(*F*F2ήBB 3FB#00OR#K$Lhit"Kih!KhiFi# 0 =#U#)FFABGr3AG  pg!d!ZZ.!!@!h!l!hhtK\ui0 < gJBii+zCL FhwnnLr  @# B@B 8d * <$AC B2FsUKhVh/@瀔 *~;j;E +?n:h)Fig8h5O0 2 "\Bii+yCB Fh7OnBr8F@{i2HYF1Kh{iK.Il(`K!h0inKh#i0J\B J&\%KhK(KhB!0Y@XT!!!l!h UYh!ʘ!@!ʐ!ʔ!L!\!Y!hY 8!̘!X!HKhKiKh0\u < ̍JBii+zCL FhwnnLr  @# B@B k";$5+ݡk0Fj#B("jB("0*kB"/𒀪oB(F "! .bK!B  "\K!B @ W0+L53QK5`' IF 0CEXػHKB CxBp;@KB CxBp;&Bz75K nWFOh;j";E餉F80DX02#K;Fo1F8FxK+!3OJ;BKF"@X\CZT6Gx.wH:F3F!L!@!T U!<Y/FFG BLr \B ԃIBF O   C 23GkBBpщ3+C`nJB S 2C JBFЂPF`np F9F "#JC9F F @803(0$5+#n &\CTkDJzP5XC@ +Ћ DnIB c[X\!AA#@ F#@$5+ݝn'O 1D2;F0oBK$%BFQ# 2A# $#(PBr##Br## Br## Br#O L3" 1F(98JhYF5HXhsh;Fhv/I*(gЈ"0F,N>+KORih8)Kih'KhiFib# 0"Kh+G (FN0F # 0  D 7+CFOL O Y+$BFQ#0A# U!YZ.!@!!h!l!h!}K`)F`됹yKB jhBTimIN qIVv(QЂ(FnNjKjhBThm@B 0F# 0aKx+@[KB@𪀙DjhB5qmI(?mUI@7(?fMKjhB5pm@B AJCK`CE CkhCE5sm[]9"6B؀&:HkhBCEvs+n[CE c]9'6O 5r'IkhCE mF[];A  9DH7/ѻ\&HO 5r'IkhCE mF[];A  9D H7/Ѷ @UK`~!t UZR!!ZZZj-O 8F8F$Bӽ!F@Fg  HF_E 4X[[RM+h %@񜀓C9rS6 KhC/HO;h+oGKHHS$+hDN)hORDi v=KihH5F(F mr@20F9F#%COQOpq5lIF`OQOpq,fJOQaFOpq#dJ`3кР_H!(F"KK(`TJ#hhC)FXH9F(FPI8F"~PH9Fz>Kh *2H8F0*GJ `GJ`e(@JDKh#hC0CY-I|2F(F h0;H)F0;8H)FAOs5IDP3I>(2H)F.X-H)Fh*H)F4&H)F#H)Fp/H!H)F!T!L!|]*!P]=Qv!ʜ!]P]`!p!8!ɨ!!!̘]y]r!l!p!ʌ]4]]]^"^N^u^!ʀ!@Ob4QFXFe#FFFϐ)O*VFɓK6X8SEA0OrACFEphvH9(?sO%Bߛ #8SE%"ɚ@;`p(OлBNeKeJfIfKfHfKfK]IF" O3F)/SBYF0XD[ZF@FN YF"KF)F}ߐ;FI@p[I 59hDHBMCJ+h\7FBѓ0+;,+h 5('18K"hh:76HO04H)h2NOR 5i#s 5-Kih+KhiFi')# 00++h"H!J+hh0*LJ/CKh+!hJKH) FF^!p^!ʌ_\__(_z_I_^_!T!p__!@!h!l`*!H]$)f`6T!#hLH#+h@b^oRHJO|jEIBC  "kBC:Nr wwDAGwC w`DvG *@ܠ *l +h*@𣀓0+#h+N(H)h0F0"!Wp0L%P%Or0#X30@FdQF)hOR Kh#F5# 0N`[!(! `!l!h!\!ʘ!@0+#h+Ho)h"0P%ORc0#X30Kh^Kh#Fi# 00+?W+h !1c#{H%H&(')hOR 5#c# 5Kh!Kh#F,# 0+h0+(هHH( )h#(OR0XyKhwKh#F# 0+hkc)'rHpH()h #́ORc,cKhaKh#FS# 0 +hRL%2@A+hL%2@+hlkB0UH*hk[Bd#h+@QH( HOR)hBKh@Kh#FBJ# 0 0+hl[kB0=H_*hSk[Bd#h+@6HJ( ܀OR)h'KhO%Kh#FZ'J# 0 0+h%KZ\JKFZ)P AF)@R  +F#h+@\H(=POR)hnKh `|!h!la La.aSabaT!a!ʈ!@Kh#FxJ# 0 0Ă+hĢ ,%*@60%45BB1НH+h0u4e#h+@H( OR)h KhKh#F1J# 0 0+h(0+ځx)5ЂHz0++h <"x"(%#h+@ʁxH`( OR)hrKhekKh#FpfJ# 0 0)h8%<5lCBB4bH8+hblCB#h+@WH( OR)hQKh$JKh#F/EJ# 0 0)h@%D5lCBB4BH*hlCD5#h@+@X7H( OR)hH1Kh*Kh#Fo%J# 0 0#00k+h *? +h*ǁK 0+@{.hOp@!FpcL(@#H!FK "`ܹH(ԹH}(̹!l!bET!hbnbbck!t``!\!`!@!ʘ)0BHV+h" #h[HC( OR)hKhHKh#FSJ# 0 00+?􂭆H#h+0B۱CvH+h #h;H(f OR)hd|KhzKh#F uJ# 0 0CsH#h+oH#h+KDkH#h+yrZ! *NBK1R)\BR]H#h+YH#h+<)$TH~#h+4-PHv#h+mfLHn#h+lC<%O|l8CD%O|@Ÿ,5+?#h+dK"`=Kh=K) OrOb`08HT-h7L 5s6 #"''pY+ɲ.kp03B"!p",H@S)H0#x%!@(Fo,%K!`F(Fo%#K`,  ϼ"H(J#p`J`JZ!)?VHJ+FHj BH"8#J( 0SX!ʈ!8eM!v!ten!!xe جb!Kh IpCO س_гOг_ KhK PBOг@OH !l!eF5Kh5H4I0FPF 1Jlx0Kh+/H1F.K p -KxxC ,H1Fx (Kx+(O(M1F8Fl'Hnkh;k`+"HLIJ ,kh;k`+(FB (y, Y,+hZ*`x竉ջ+hZ*`x +Y,n,N,!eQv!ʜ!Le!!ʝe9pF KFFh H2F+F!FfHg p!fQv3KOp-A$-`0K`0Khk9Fo-H-KOaaOp @ao(%K9F%NaO @ @af( F( nH9FFOpoF(,(FoF3h4Ean`+`5`]`O 0aѽ,+ѠF!̠!̜!f!!̨! -OFCKFFhZC;"D2F6B#F8HJFL2F!@F4H^'=FB JF#F1F@FF(8F AFKr# 0B-K(Fh&IsB#)!  DOqOrAaF FF H 70DD#H!pf8f=fkO!l-OFFF8@3RFDKEK"`HBF3F%HE O!ս 9FDr# rB(FHrH0DD!8fzfO!p-CFMi Fu3K i3Oh|2I#B9F0H#i%0F Pea#i*KBE)O,F.F:kL3B 0F#*FIFHF8hkL4H$aCBrAn  @#B CH@IFhI0#*FIFHF;h4kD;hPB!p ff!@!!L!l 0}pG-AFIO hIn  .C#;hC3;`2BBK!Fh H{h2F3{`+FihXe`a!!!L!P-A F MF I,hBdhBHd  #F >CrBB$hiF F2 F`Z`+he`#`\`i,`Ca! !fpF FF!X"hF4hFe0p FhF)#  H0+ : Kh[ H##`  HF H(##` H?!fgg pF N Mi3h)h \Kh32hi(hp@p!!̔!lK"`pG!08FM FEBA H K"h Kh0|T1BPhH8! g&!x!-OFF dFFBB ѣ3C F@IO!ŻHFAFx;+6I:F(FT"YF'pvEEOHp7$)KdriFg8(F)F;FFh/"G,B'd3C #0b9F(FO!K!F0FdK@iF5?#?;p<#4C0xgJ5yJ!\%[K-CB}F F@𩀐0+)U h#O`n(`(hOH+Ob!FLKhLHnKJL5h*8IN3OOx3h)hFOHhF Wq:F63hIFHFiF"2 E[!;3h)hF}(h:FiFWp3h)hFp0#0#04#k$ \3#j $0$bj44OS<$j8D$ @L$"#0H 5L53 #P50"0#"# }TgL!gs!H!lF F\#IB?ѓ); WpLE44b   WqPEPE@@@ @ Or]K!WOr]KpGT-A0Kh+@J`L h(ڡKhA!NIKx+=ОKh+9НM+h+RМHKJhhKh*Pі *LFOPFMOR1FiKih0FjKh1F0FviI h# 0QM& hO)FiMnl h)Fine}h B9iB!}H|H#(+h+УB)F hi6nA(Fn>EFnJ#[M`mJ`+h+E`O;h0?[N3h+5gH+h+59hQM#OR0ci #X4PQKih8FOKh9F8FizAI h# 03hKOHNH((`LKh#KHKK4M"`OR7Kih7Kih0F5Kh1F0FiF'I h# 0;Kh#:Ht7K M"`OR#Kih#Kih0F!Kh1F0FiI h# 0w)Khk(Kd e1FhC2F)FF$HKh h!d!t!L!P!@!T!ʌ!g!!\!p!h!l!̨! !gg!̠!̜;0g:!ʐh#!X!ʔh<!!hV-O@*O>hkB$K Kax!aEs#@ @܀ B@Ȁ(FAFn\%1FHBii)PCAqzJhPFvNArI;h@F |pKh+3h+mK B#BiHIF;h(FO vs\H h CTZJ0B   `O@D\E  " MHO~#Br#8hL3 kB]0;0#;B2#0n;0AO3AF59LOR9hi6Kih8FB3h9F8FOi&/H `)F `O  I0%D3BD 3h+?T:hAFL$0$$0 4 4 0b$ 0 F!!(!<T!̔!l!H UW!!@!h!KpFF @P%8 m8 HICiB iT%0FaD% a p!thv KKi i@P"0B@"@FiBa!tKFh 5p KB0BB 2BB    !F^)-OFp tFFFA(=XF1F(7KhNh[iSE"QFw`h[A0C03i[iKE K"IFh\0a3iRAA!!!xpG-OFFkKMpF$S"0[\OC kBܽ#DJ4K'F[$ S$0kBB 'DX$@@HDH$[R7(pLFn*#\(   [@²\@BZ @² @²IHhFn*%\@ Z\"B  [\"\ACIHhFn*"TX"@ \# T[""IHZ hFn*"TX" \C T[""IH0h-GF F $(In IF&n*F +Ow\O ʿCCwTIF o$uQF E(FH! @TFDEB< `F N~8\"@aFqE:ܬIF2B:FU"D.E"U&E&, U$IF{xE$4IFF!B1Ri"-G}FFFFJFPF(dI2F (bI@F&h(F(D]I*F@F r0 h+XHIFO0 }kkcj`j`+k#akkca#@0#bB0cbklb6/{FI:F@F @0t@I*F@F :0:@IJF >IzQF8"F FD"F:I0F.8I0F 6I0F4I0F2I0Fh"F0I0FB,?z.I00Ft"!8FHF 0' 0ByBOЪ# (15D*2*#0x "F< a2( h@dAdeh@dziThhi9hi ii0iE-Am%OcFF)FFyxCF*FF@FF FM:`1#(F mF-G] F  .%FFFP 6B0`pC_x/!0FbCxr+#`dJcOaT!`FUEB+,F.#. Ft`` F(U0pCODTsh|JOa(F(Fu`F,%&. F (.> F>(W(΀m-T`X.` (h5FO`_ph!&phOr@!F.2KERE aV(Xt5p2" F(ڧ-O ""`=J3F!6"!PIF ( <h+ F6fP+I F thh F&'I F h(mW$## F ]`h mBmFF6EWE#ѐBB*#2FHjKhHB HG(K` i!aT!t-AOB F !+NFF3h+Os#FC (F"# M+hkBFSi3@F9F3hCKix)h" i"aORLi^ Kih3hiFi# 0!l!!v!@!h-GFiFFFQ F;PKhsF8F FFHJHIK` GKhFKhk#+FiRF0F" i"aFFQ F9Hؠ0kBOsuC0(F!FkiD#8F#`"*HFe K (F#!F#"CE i"a*F8F#F*0kB[i+ H( !\j!!t!l!jB!tjtKJ-OLFOKF#h I rOS5QhQfxS+0;O #h9FH#Kh+@̀~H(@ɀ#h9FzH#uKh+uH#hO#hrH# #hFpAO#heH##:F[Kh+\Hb#h="HF#k!h kBZi*?O %#hKD #hS5 KhCGH9FS?Kh+gDH* h1F #h"#F0#hkBZi*}6H i4K5H4KFhByB Py0B҈-B)H9F# i#avH?EvH(>K "` H(dH(34![[j!LjKjkkDHkV!lF^^Fk&!tH!v}Kh+6^3F&ltK`FtK B!rLO3 h 8F F(рE ?ā# BGi#a !h. (F k !O 0 lVK!"J&YE 6Z&`O 1 @ 0 8F(H 0 +O +F#kF4F:J2  B0Q" \AO2H2Khñ1H kӱSC8F0kB;(H'H(%K` 3h)Jp i D  kZCQ@pBO  i"a`4J [i+PF!F!\!dEku!akT!t!LK(-OKMFJLKKKNF#h#A@GJFJh"#Fm#hkB\iD;H)F^ |9Ji%p FE ؀ؐBi#aERF8F  (:S$4#1F@F### )0H#8F### ?PPF( K` 34![[!v!kV!xk!tfk!k8M+h %4JLBH#h 8H( ##CH +h# #C H #h+( !F^!kQvl l" 5pG-GFFFF)F@FRF3FFFj`#"LD&O` FVE`۽#D#  6YH-G%@F 4F FFF F!O 3_#H"K ##Or `KF!q F !F  vmH#: F^ :^Fp FFFr2Fk2Fd2F]2FVppFF F((*Fmep-A @EB ȗA nҍBAӃ Bt ҍBA E|   Akk@P!BBh-OFiFFF%󅰃@B;K@J1:J;HLc BvFFbjF hbhB# ( XFG XCFCPF h]DD"i (XFCX CFPFB)F#bhs!FYGBv>FFel8lyi!@BK@}1JHcBv F5FO1F0FlYP`hT@h3DP0 0O/F OshBihPF 1BB*HiO A B47CF@@PIIPF+BBK@ 1JAFPF^I !lWABLm0mRlym\mWABNmm #k`4 `@0  R#`H`B#803800O/FOs hBiiO 0NFBB47CF @@PIIPF80+K@1J|;80h BhZ`Bh`lo6I HO$PFF]PFPFXFO l&m-GO CiFF j3K@FQJHO0$k+FF+kS(p_kkCE0Fl) F#1F(F#JFOF(#IF0F#RFF(?hl8ly-AFCi&F@jF3KOVaJH1F FY K@aQJ:FCF(F(, F$lKlyn-CFCi& F@jFF3K@qQJHV1F(FQK@sQJ4DI JF#F8F(#AF8F#kF2F(F(FlalynK-sCFh F N3hBF HKFKF0hBF!F p!!LnK-sCFh F N3hBF HKFKF0hBF!F6 p!!PnIKMxQHN$O+hmB(hPHH( (hN2hR[m8FS4Rh4!ʜ!ny!nnQvL h@j ( hS##`!7FHh(j,)F0 F!8F FKhmJh Kh`# #BB  8@n !\!l!pKsh;+oKԿO@bO`b`lM+h Et`) gHggHh(W a)7)5aHV^HW(^H\)h]LOR 5i#s 5#d3#a3UKihPSKhiF\i# 0#$F! $t#|3.h e3# FF!BHPAH :H)h9LOR 5i#s 5#d3p3Kih 1KhiFi$*K" *hd3+7Y)7ؒayK+.HH(?j!HL)h#ORa3d3i6KihKhiFi$_ K" + FpHF!!!nQvo2o!@!h!l!oNopoI"@ \pG-AFFFFR BC !F@F8Ha`, ?88F$"A𕽽#-OF 3FKF F  h3SB/F=FјO:FIF0FCF ѕO;hB$@F(^# F#O3 #TF??FT k7kt-h- a-8b-%ЁI F]i +R#WCWM F0 FAF F F#AFF ;hBЪ F ## cFPm$BFSI2F F(F7N9 FIFWFJI2F F1F FIF06PBPB=I F7FNF HF8IF F04I +s$4"t# FF(I# F F"IBFIF8F F01F FBFIF F0?}JCF!L#I F%###rCf\o~xooopppYtp~-CF jF FF'm6BJF)F F*F!FCkCCc@FC:F)F F7Ck#Cc#-OOF FF 3:F1F FB јKhB4ЗI xmb(#A(%L(АI jk kO0c(i( (F-0(F (F#H4pCO O ,FF F  uh! FF#C,mI FhB"ѴkI8~0 +`b \ $F( Fj WHBUI F'?8FkBk?QI3x/+0F3FNJNI(#$kFHI0F!>  FDIs0F\0AF F0I./$$!8j*9F F0I~rs5rssQr@pGpGI"@ \FFFFJFIHRH:F1F읱*FI@ H>4[2IFH:"F@ I*X2*sF FO0O "8hH)Fs*xs* jx$$D 1S*B*jx*8h(1& DLO2BC;S@۲T#0"-OF&BO 7XFTFVE#+p67 HOJ xLFXO H6ԻD9 \O+ 4B `(p?`ahpp(4B(pFo4Bҁ ?a?`)phpOq-C$FBF&F#FOY(2L]'EE"' F+$+F+$+$+F]E'Q$<?Ѷ?ӝEEҰ Y@89D@X@' @\@+FHFOvFO4ERE8"C-GF$F F0Fj[F# DSF"FBQE(FkR%(F2F)FXB-CF$$Fh'UKF*FBIEO01jBF@E48FC4#R1]pG3FS[hk)FF F0@pGF04[ HP ]pG*-O!FF0FUF@I(FO0'I"F i#aFhF FFHE 4+{I:FCF(F Fk mF`m$ HF) F &F F(F F.4+ FF`I(F}IFFm}$BJ FFVI(FfPFkR*6BV "#NI(F#MJR#LJ(FIIxI#"B#"(F#:FCF(?d FVFO!!(F!(?K>CS HV`m 8F(; FF64Hvh+!J;F!~(FIr{ FF!(F5(? a  mEӫO Fstsssssst t-OFFF!F0|I0FO0!ESB4+uIJFCF0F Fjw #pFA\)#32*X 6+)fI#"0FF#"C0F####"( FjG ԫ4+VIJFCF0FH4+QI#"0F=OIJFCF0F#"C0F##JFCF(@ 1[+)дFOJ--J F OK??K EJ  C /IJFCF0F 4Bf$* ݔ!0F'I1*+"0FOJ '(?)ha3`JCFF0F0 stt>tZttxttt-GFF OaFjF8yԋH1F$#Tet@E#!$4###F840FOcv<F31FOb FsI F;C FnI1 Fj4a40iIH4$$pCO(ВdI$B$0`I$4#_I FU#C=[Ib0XIU#C.VIdF4Os$4U#$tCc";FIF@FC GI:F F#`EFdU"$tIF@F;F)FuFF F*F7I Fr4CQKF2IBF F*F3F F90?_#" F#'0?Q"# FBF?G! FjF FS гBr F0?, F3e#tu uu@du!u8@duOueu{uuF4BB* I@0 I F)4 I"F F7@@duv!Fa(I F ! FT  I! FK! FE4I4jvavv-AF jFjF& mF`mACFi&aehF F^AF a(Fy0 I(FO09F(Fk0I0Fvv$$ F<$*OܘF # pKpOsKNcȁOsˀOs OrF jjHm0 F F -O FyF(C$MF"IF0Fl2F I&(H FFEF;h#h+FNEIO0 ZFW&06H#hSCFW%02FAFPF5#hME$%vwXw |a"$4Q9`#+N FrF7hIO08FN(2h I(F2*2s2hI & w2wNw^-OFF2 h*Fs FOUڋj k2*s @ BO0 0Fp(0FF (Fi+Wi/TУj BP0(s!BBD0(s!BB8?0F9F0F! XFfH"QF@FG0F09F0F"QFG0F0ck0Fi I@ 80$!m#jFiFXFL(-i"AFXF(wnFFFFO0"1FG Fa0 4"1FjG F\0 FzkI w~-CF F WFCIO0F$d"HFAF3FCIJFCF F"3F(F9FFFCFFI*F;F/upFaFwww-OKF Fx 'IhF8FO O !F[`   I"F0FO7kD#C C#I F& $x FN$O3i4V+)F8F,x%-O FF F"IFF!K    C!x*FH' & )FF F*F FKEVJ!v x K*FI(F F*F F F  Xx4-OF FF F)C B C /I FO60F(mBF&I*F F; FYFeF(I*F Fo o   F" ! B9C  0YF FF #@ FC@ F:C # F0I*F Fx;xJxjx hsF F N "0hFF `x32h(FIjO0p& wNFi* s* a*s0O0 !FFIFO0xpFF F[PN!F0h02h(FI O0p& xpF h FLKh(`0I0FO0p F& xi*F4 a*b*&L*1IFs*.t*  FxK!Fhh8 @B h+IO0 # `10O0 (1R01 1*y& xpF ! IFF!2F!F( H#0+F0H p y(V)-GF FFF ) FIyO0OI$ iFHI:F FsOi#"# F#RFCF@ F I:FY0Fj\ yBy0y]y8y|-O!FFFXI F,O9OFHF9F ! FF(#" F FQ FђI$sJ<#B 3uF0EFE {I[CsRBz^B: FTi |I5Bz5F6SFVuI=OC8!# F>0$0FiCFlI#"# F#2 PFicIw4bJjh3`ShOrs`OC#4HHF9FB4iH6{i Yc( 8 F0?>$$0 C@`FBF{F3eOCseO 0 0mmE +JF;F! F0? F4j##h IYF FE 0?  4$$j j 4j44yyyzzz?sz_0K0FhB.I !0@e*HU#$(HB$4U" FF#H"H|! F0HtO0!0jHh P FFH F FFHJ8!hFiFH!mH ~X{{{{{{| |t|2|D F$"8F-OFF!F4"PHKBF9F0FCF+4BJhB0AJ(FL*oТa+"+ hh h`hh4K{3IHFR1IHFFx/IJF(F.I iO0*LO`i`&I(FiTE F#F@2!裉ZFIJF(FTE F$ ! @6(p~(F0x(F|a~]& 9lx|o|FF (!FFiX#vT3#3FHCjji F@i-OFDFF, J Bx &  J  FH B #s@ĀRF8FaI;$iiEBEEш(- B BF8F FOIa%F#bcbั(-HKS -GI8FEKFKS%0z(BJ arF@F4 OF(X 4bCbEBaiAaa eaf`!`k#L 0 BB!iMa%aPFih #h[hBB k#ciCahaeaCi,aa a(F I8F4[ I8F%(F}}v}}}}-OFT, u/*F#FXFhC*F#FK^ F;iCD *F#F@FPC *F#FHFF8iC D t/Yлi+@:hzh*rzR LB{q[ k # ^ b S BzZۦBzV SO,u *F#FPF1FCMCjPD  O"OB XF8F ,u*F#F CF*FC 1F#FHFi  i F F?isF-O iFFFFR tIO64F"S` oIi nId#FZ 8+i;a+i_a(FDF0F!FSFAFZFjc EEРEzVI2F#FHFK#jF##bc3C+i;a+i_a(FVFXFQF0C  ZFF SF!F0F$f#Bv,d iyh 8hbaF^ -IHF g8aW-ha#b##F#xBrtIHFFi IfBq Ia0!f LC+i;a_a(F%dA}}}~}~9~]~iBpGipG Fi(FpG-AgpTE sErڀi FiW dE BEA!!b l𵋰F$! FF8(F IRO0 J !v(  F}y,IFdK"F IH$ I H M NU40F, I>tX*"* IO0**    @pGpG *8F FF +6&( *+!#% 8 : *"+J@!HpK FI*F      JR#0 O0;!@-O3OBF$F@^I0F%F(FhYJBFBUI0Fh FiyO'F#FFFFjxECFoFE4+DIBF+F0Fg@F)F$4"FO FFRE FiAXHPCBzOEF  34+ݗ0"+H*J@!*H(K)IJF0F+IF 0FGC18H#)FO  Fj$XCFjJ FXF5EK9`E  7JR#0{VEW;!-OPFFF#O BF9F0F`BF}KhB(F !(FF#C&tI(F p, A,f,oI 4F F s,# (F0O #jO (Fi#??4jjFe11 4+ Jݗ1"LIQ2BAKK0IIJF(FL!*I<*>DI#@ BO7  7(F0(F0!@"v0F<#0FvAF(F0N/I(Fu2*,J@!,H+K**7+'I(F_{%Kc"SF(F?F!K 81FH#6#FQFr#F FQDA9C0`F  $)~8X.;!\%g-AF)OHhFO NON FFHI2F FYO0 F!0I2F FI;F2Fk(Fy8y03-GF F0?-$4 d9H#OF$$1jj0j&.a(Fh (a F0I:F FO02F FOhF FIKF:F0Fy0Ry8o)-OFkI OFF F!#@dI FO0! F! F!  F ! F4F# 4;QIto`OIt/@(#"!vj2@EBDIF Fs/[- 4;BF3F! F+0! FF(EO O #" FC1IO #" FF+I9FOrvpESBF13F#" F#YF F0I F)_I F; [-#!h F0?L4+ 4+#"!(L rrr>𵏰F FF!4"hFOK :F1F(FCF KhB J#iF F% iF F0I t|t~`KSB@pG\#-O(F FF   BF9F0FHCFJyKhBX+s F'`i+Ui+RBBL # F# #F??F1 F +F> I">HJ!>~>Hm#8$!HH #SH |]{t6 Kn:f*oB (КmQeppGI𵽰FFBV( :,468tPH=@H5CMHv1kF  !FJEH`=CH\?HBHV8?H?H?H#C8HD;HB!j| F1![R,"" GBB04(,H+K,J(F)H=@߽'Hx $!8m#jFGiF!HJ!#FJH1+є1+HeFH=@rt.=KYc zr-GFmJF H~J |H|H(FzJ{KyOFFF$ F m#@F # @F~ i.1FgHp#!#"ji &j`J!"3F!B3F:FB" XI""^WH"Ji+Nр!TKB:FRHB0F&J'KFFF/#@F  #@F + (iPF #)F#:ji, ?iHF~./W-AF FF!4"J.KnF 7Fh3ScE2FF(K(N2FAF(FCFı!I"8F됱!KhB J;F FE"i*T* L*I a+, F0l*ТsH O09F F0\%~Q+B@+pG#𵉰3OF FF :F1F(FFC(+s F!`i+Ei+BgBB<ԱKhB# F##"u)a8 (!$I  F0, Fh, FH i~@pG{ {S{{zzSzzӈhJ ]IpG FFhF @шzrF 2 B-CFF FP Fz Zz  ۉ0sxs+sxl+O&F"iF8Fp#*F F8CjF)F FD'F"iF@Fxh#*F FB7/67.-C FFxk  FIFh  7"I"F 6 5  3 2 1  . 8 ( ѝ0 00**+4'EF1Fh0#S˄7/O0pFpL&"F@!hF6hF4G. pFL%O#51F8Ft-*pFL#FD F5`ir)Fp@p-A FF(?4;;J440rABOA64N  #38NC0 C8dCS00hF)F#@c0 HOCFI FO0'F:FAF0FI F~0FIBI;F FbD0F0 CC0Su8Rl-C FFF(+IC4"!'Ol&K#:F1F(FCF KhB#JkF FxJkF F U*L* F0a+( I  K  IFhr0l~ȝq&  FFIhK8SB@!ԬFFRKh JS BB KSB@Ih!Լ@pGpG-OKFN FOF2F)F FHF3 ѩKhB ШI ?O5o+;hvF($$*ڞK!JHIV(XHFF8FxF(M8F^I(恒I F(@߁HFIL(FgO2i;+A,F4jOsI"Fh︱OF1+F8yIZFP(FvIHF8F!(FqIb(Д!(FnIZ(Д!(FkIR(Д!(FhIJ(Д!(FeIB(Д!(FbI:(Д!(F_I2(Д!(F\I*(д!YIF(F(дTIF(F(д PIF(F(дKIF(F(иѡF()F@F(?z  4e K!>J]>IZF(II F8 IF(?\ ("QF(YF0F8(?G/I0F0(??BsB r$I F{#"v??FI Fj)F$4B9I~& Z9o  h^EN.q+:\.6B$$&1??ѪI^FEE٨IF(?I(?>OrF(FI0F(?F(?OC XFF@XFES"1#??@ĀI FID$$)F$4BV6It I F#HF~I6r*D(zI*DHF(rvI*DHF(sI*DHFz(roI*DHFr(lI*DHFh(rhI*DHF`(eI*DHFV(raI*DHFZ( r]I*DHFH(к1++O31Os1Mn iArEI*DHF(?krV?I*DHF(?[H $$)F\$4B0 F(?HFFHF$42F_C[??@!Ig"!0~I0F(? FI2rqfr+: .I0F(?ծ ~($YF0F(?Ǯ$&$0FI(?&(&0FIv(?((0FzIT *$"wI0F(?ErISF F;$:"(DR>$:F)DBFL$$1??[I$JF)DdE$1F(FKZFRJ+FhQhOrOCAF#FF0F  8 ˌOr ##IFOCke(e \!e(F2F(a$4??+I;$$)F$4B.a\!(F$$1(a??I $$)F$4Bl NR:s @pF" FhF!ah"hFp@hh3SB"FF B J I IjFCI B $pri'~!!ӰF F#,"!#2#c.# #@'# #!K""'K p( K) K* K+ K,:F!0F)F FS@iii!FxhF  ]JKpFx +cGJhx Bxm5@C 0@I @@B=H A i(DА *=#@;@B7УhW iF/Hfh`i# Bx3@C0#I @@B`#H AJi"Oa#JqH<  pFH1F4h`i# Bx3@C0 I @@B.H A6ѧO6!/!p  sF J II "(FF$pah(Fph[x+ F+h`h H$hCh/hB(F-OFFC BFxJxI (F9FsJtIFbh hQFhhoI(Fx(9ПlI(FpF(HiI(FhFFfI(F`FFbI (FbF(1Ѣn# (F0%NJUISI (FD(0+ѡn)|"l0F0onJIF#  ***ѻ YF[ kױ:I9IRF (AF4I 09F=C"l0Fn혹"l0F!n0bnl)lckB(F2h1+#o˱!F(FG0mI, "l0F!nf0k0Fm\0m}r*26>*HWw-AF|F$ F8FFȹ F1FF8FF0 F(FfAF F((FTF((FVIp] -AFFIjFFrF+ CFO0&8FF(А"!F"9Fp:I0F0н0"FI@F+iF0 F@ FFF0X#`O0:BFL?#8FF"FF(F2(! FFFF02#`O0BF&?#8F "FF(F2(! FjFIh@#`O0]pF.IjFFR(,K!,J,H,I F8FŔ)9XBaA;@!F8FI0F$F(F`I F ĕ! IFF0FF F-O0pCi#I0,M   0 7" Oa#J pM#x7# OaM #Jp#xc ,M0!F(F F0D!F(F F0DiG\pIFF "(KV!JH FlF,Fh3SB"FF IjF(Fj0I plƀiF"!hFjIjF FHC&iIFjFF0KOaJHI F-C0)PBaA:@ I F00O0 &CiisF FIjFCF0F$0K@QJHx FFI 7 F F0J II(FF0 K@A J H*0 F I KF80HV`627 F F0J I0 I I(FF0 K@1J HI Fd80Hj>`pIF@O5#`(F$pE@-I (FeFIF I+F0F0 I j IjF0FTFI Fei𵉰IFH8#`O0 F0FeFI BFI3F8FX0 I ( I8F%V0I Fe(F2i FXCHHH])l  𵅰  aIF0I 0exFI`I(F0I2%OBȿB N Fec H D1F8F5 ix$=csFFKF` 1F FO0I*F FC(  |pFIFFxXFĕ pIjF(FmFĕ !hFIFF0FF(F`H ivp FIjFF0K@fAJHz!F(F0O0 p#*]BbB;B2 @@e !#F(F I FF(F` CCH8FKICF(F$0 K@1 J H*L) FKI e 8*`jF IF8,#`O0" F0IH H  IFjFZ0 K@A J H I F?0H &Āi IFjF00 K@A J H I F0Hh &ĀiI#jF3I N%]i FI4F0K@1JHjI F8V`'6F08 (٣a*أWA*أ=l#`O0F"!I F#0I i رL ! !~ J H` "FIH )lXFFF J Im!HONL!(>FHKI"F(;FH3FKlƹm!HJKIDD(F"F H(F sh(FG6h4  1XA`pGA`pGA`pGA`pGJF `l `dpGJF `Qm `SepGJF `m `epGJF `Ql `SdpGJF aQn `3SfpG8FFH0~#`O080 +$ A;+n#M(F>(d #,T CK \!JFnpG BЀi-OTOK @@ DPOx0GI #(DIHD@E FTF0gYI :!#pUJOapRxp#x۹:##pOadp#JJp>#x+!FPFp FT0D!FPFf FJ0DchAF(FG$h7I0F 06I 6HJe4LH0s(F(0K1I0H4AF(FH0I0{@ƀ`@,ǀh"AF(FGi"9FJoI0IJ0FD0@єIJK) FFi:rii~9A.iiO":!Hivj9NV#9H`#Jd#S2I3HX#S/I.Hh#S+I)Hj#S'HZ#&Hqb#Jf#SIHa\#SIHW^#SIHM P@,?;ch(FG$h0"AF(FG ]aXhXr}-OF FF` )F F0?I:F (dFF@9J 9I FF4I FȐ1KO0 F@F x'YF8F萻YFPFP IZF F K0hՙL0hԙM0hՙN0CO06[AF F F (-h. 6Ihh|P! 𵋰FF8FI I(FOF("hFJIjF(F'0h+I I"0F J In;`;h I"F V !t(i8. FFnLI#FF 6@-CF!I F,F0KOqJHbN4h NxF(F^F8FpFȱFHFn,CFJ)FHF$p$(F$dD -GFFyI p0FC BFsJsI `("!hF"!FhFnfmIjF(F0+ј"! hI 0F0bJeIdH8PBcKXh !FbH:xB:ZxBx03 YH!F!d%FUI jFLI(F0QInFOH NIPB KHHIE) v tCM:H )h)0?H ^m (K F0GdjhBьE3h1IB""h.K(F-H@F5+KW/B3(FmFPF@F8hIF #6B 5#'F` %``r(i8iK[el6X $<p FFF(`P1F"FF(h.` F #`O0h p F-AFFFF-AFFFF@F$(#`O0@FF~ #ji!F8F0h Vc`-O%FFFF   GpW;F:F!FXF5g`9hYFhFKFG F5[R F00J+- FA#`O0(  +- #` -GF FFF#`O0:Dj#!ia00sIFPFJ8 0hp($h0-+ PF6(( iIaiybh*=C$70hP( 0hH(PH # FF)F0F0ck xk`i+aI Fh#FMFF$ !FFc8K`T7`TFF !FFc (KeDa7\-AFFF`i0FFB hcaacx chF0`ixO05i`ahcaacX-AFF (!FFcF K"1F`FC/:Fa0 Fc9$ F%wd-CF F ,!FFcFFK")F5FC$/2Fb  ;F0 Fc O HFl-OF!FFFFFE8hO  B "`O0tO  :hO  EJTC<`(hY+ "Fh(FF[FeFG(eh!F  4*h[F(F"FG(eh!F4-G%FFFFE(Fh_h'ig1F h]1FFGFPF~k  4|*h"t[hG pGh00O0 BjF*#cbdiL Fj0O0`h$h0jF+##bdj| F h2#Ah*0O0`k$h08F Fc`ciE``a#`a#t F8@O08pư&IFh%IF0FdF`"I`""H.#`O0Fp(FF FxxFBI DOr!hF)F/*("v!F/&*("n IjF0F0 H*fmtziJIHX1K!-AmxFOrB8< h1`W>v4CK5TX4gK)F Fx0+Kh#FB"FH)F@JCxh320x+H&OBb\20 V@# H]8F6XxT pF F"!^- -7#`%(Fp"#, P۴O,F!0F:!A\"T`cF(2F K"#F FFCF I N8FFI"(FmR*F1F F@vpF FF!"hFjF)F F$p-O<]FF ?J?I  }CF9J;I05J8IOr!")Fؠ4 <]ah(FF 0+ћ0YF +" OC 0IF8F p0IH$h 3CEњ0Mhx[c@C2(ѝ41+ KM I HFrTi!ppFHx FCF h++ &pI r"!hF0"1FhFmx"x!F*(" IjF(F0 h1+h/+HHi Kx;@FH !/F FF Fgh(F9F$hhKxB8F( IHX FF!F(F" FF I I"( J3yh320[ I*F F0O0 O0 Xi:"F0J IIjF Ft8#`O0 I F0|0I (.:i9B"F0J II F8#`O0 "xKI F(($0 I F70I h 0rN:i9B"E0н0]#HLJ^VpGh JB ~BB I H JBFpG JB I H HpG HpG HpGPPgJPPhJB~BBrB I H JBFpG JB I H HpG HpG HpG HpGgJ-O EDFFFF(FBBF)F8FDF' 9^). I2F8F.#P=$/DYFOD E  c  ءEK<h;Q8FOF$&IF0I rI  Fl0KOqJH0 F ICF HR F$iȀiF!"! #I  F(C J I I F0I  pi0IFjF0KOqJH4I F0 I  I F0 I @ii-ACI OsF0?J ?I?H # #$C c #c"@0O3 1I(FI0Q.I -H "<8"@*JxhY2 R'Bx:*$0$'0;D#DAFP#`O0` 4 ,x+I V$2F!(#F"3a+Ѧ Ob8ijXs$#I FN0JI jFIhjF I F00I  o iIHX-A°2F("!0FI2F F0(6'Ԛ'o %%"!8"!$!"!I F0𛀝l * ّI %%%Hl m-!щI F#`0L0нb0+vЃHI F#`0;0нb0+k{HxI F #`0*0нb@)B^sHnI FI#`00нb@)BSjHp8"!$$gI$ F0(+I bI F0@_I F0\I F0 YI" F(@ʀOsBSH6BQKx+PHNKx+NHKKx+LH GKx+IHHH#6;I,2 F:.2>02$+*0>H)-.,C0C**+7H xh300[Kx:+* 1H"x 0H)F&$'i)@F.?k75/?f, @i!H;H .[H(i8ii8iiii+.!(Xb\   pFHdOsBH\ !8B0 I$jF%DED D D0I(F2 F08iF"!hFIjF F0I  i IF0 KOq J H4 I F0I v1ȀiL-AFFFHF FFEO<R Һ-O=I#  D0. Os H07(ڍI ~H0'+ @.F##"F(2D !<(BF'-}K.|H|KF{K{K{K{K{K`(!0!!"F \쩈kԣ2*O |3 SkJ$;2+Fo  O1 BnzqyOa F]IE#\KD pKDOIqDOc1DOCDOPDOSqDOB1DA&k&pDK)F@H|!0D"0 +w T+ D '+?o =/ #QJL 33~@B4@B(JأgvA6B$رO &f13?,!!@C;2%2^A$1B٣zcTc2 2PS;I"JoB1FKi%nEsw{@!ڼ!(#x*+؀H+1ٛ *f;'+ejlnprtvxz|~+R#Wgggg2+(+gx0+𳁛 + H]PFW6"8JFI0+СxH0+#y'FIOHxxcxN;6vFEݸyyy(yDBPF7FHF0+СxxH/0vJB /|؛0+rH!F~zpIeHh0+?rkHIFZFfHReIvF$8&`?_Iv_GF F! 3D ۲+]8&ITH&TPF  9FMHMKF8hBKBsB\GJGK`EFBH7 9@IBJBJBJBys@I)H0+?"zy<L PHIIHT0+?_a DHIFF 1F@H@&?IvF 8&  :I OF F FDo#+L9(PF   9F)H )KF8h(KBsB$J$K`EFH7 :IJJHbx!F2xHHHHHHHHHHHHHHHH{ n$$gJt0%   I  CFHb F 0,Fi  IFV(K!JH ! FL  IF8(K!JHb ! FX0" F!" bH  0@,"!(F( ObiF F( H F  0@#0+ѝ0+ѽ0i+0IFjFBF H F%00I (F$(Fi  IFP0 K@A J H I! F)0I d   IF(0 KOq J H ! F0I | n%K"`pGtpG O4S+2h @pGSBDSA"D Rbb]pGFbFH FSJh+`! Rbb ]pG Rbb]pGK[h" ##!##3br0HO0]!SF! H! F|C H!F nk0H!F hT"T4p(eK%[hӱBF! #*F#!+Fb0!FXH@$  % U U FFHFLHJH$"F DDDK"DIEH4CH>AIBH  >HB=H"!O0(" " 4Hp3N5`"O0Cvh+!3h+" " 0hB+OsB H! FH4h,+OrB+ + O333ZH!T^TTT;U TU.tUU]U7%SKh#0@pG;>+#`Y T! "D! 0"H!"bFI a MF(` IH!Db([ k`0x! v M IFF(Fz)FHXI"F(Fr X h (0TK! CC B K` 03ȲCBKK!`x(0TKI 1CC B K` 03ȲCBKK!`x(0@# A C%BF#CL`BK` 0K!`x(@# C/F۲L`BK` K!`x(@CS_FL`BK` K!`x(@CCOFL`BK` K!`x(@ CCcoF#CL`BK` K!`x(0@CS_FL`BK` 0(шhTIòCS! C_FM` %B۲L`BKK!`xK"#I@h]"-AF!'FBO@F`)FF()FD(77 FhF]I*FlP(FaV `0Fk$VN-A F xn+Kxo+4'kL%FAFt80Fa4(F'x!Fn+ Cxo+0a(=F a(чIFFH VTX-O]F S 4E3Fh S 3 S)FF3F HQFB#@.1FqI0F 8 ` h+@𩀟I(F(@𢀝Io(@G>՘IMՖIGyՔIAՒI;KB 8A(F<0 Nd!@ k` h+𽀇I" F(@𵀄I  `hO@ $4{I 4F(@`uNB$hhU`"`sh+@lH4ȑ  '0HFS'7B h+FWI `[IF.H `Q S3h+?`!bpOER FI"HF #Z"(FFQF FFF #6Ka5H #<F0Iz#F0.J OafA,JBOI 0FOk*F8x -(OwP8F=!0 #;PTF)K sPPF$*VV;VW+WWVW$!WIVW VW0W5W=WFa:d h+@ 4"8F,0@bHFbH@Faa 1h * T P`h!0QHbQLQNRO2F @A 4#h 4h@h+ 4*F8FDT?+h+ @H*FF4 SF3h< , ! ( P"FAF(#0L " h(ܻs'I 4l 4@4$D48O #C? 8A(F$0H)F(OrBac)FFHP 8@~WOWbWWWi-Oh FAF\H #JFZN%h!z%-XвEkUH+BUJ+FUMFUH) )FFSH0+V <BV<MK[hkJH GKV,)FHHFtYFV <% 6繱?ICHh_8h?H`;K[h=Ie:>u:>>::>::::::::< <<)m;>>>>:>>5Kh 4K"`Q2Kh+/K"`i#saEiC#0ha!iCSc&JhC`2iCi#0hD!iCC diCcg!0hFiecC 0hI!iC3biC@iC3 I0hBFi8FI 4 & ~!,!$!0$|XAI hB `Bi"aXBiBbaBiB@aBiB"aBiBao~Jh*[|J!` zJh*QvJ!`i"raZBiB2aBqJ!`Bi"BaBiBaD"`D"`ZeI(FidK`cI(Fi iCa`b^I(FiiCa bYI(FiiC3a`bTI(FiiCSacOI(FiiCSacJI(FiiCCa dYEI(FiiCab@I(FiiCa c(F#iBiCCi#C0hR!3K`0hr!iC`biC#`0ht!iCb0hw!iC b0hx!iC ciC###0Y#Ob " hh  F!0!,!$X%!(\-C] G%  wH#9F@F*h0"hK+i )h2F F#sa/ F*Hj/((I;F2F (hi EOa(F#Jk`h # " 2 h@C(ѣh H2F~#H kkKk kjjKj jSid ]!'1!$8F F I"F <#x/+ !FH)FH8@8^tBx**I A(F@h#F(FO3c`#h"!XhNO0#hhe`i#"!(F#h(FiiF(:F1F(FChsFO3OzrF FhF!ZC(`h#2F)FpO0sFF F#!F`(F##2F( Kh#hBch+ ѥhmh`I*FhHO0p!܀(uEP(< `0 <pG FIBð(>2"#@##" #>#(h` IF HlH#`O0C] o (}@-OFFFFB2%O )FZF`DUJ#D ;I8Fh3`D5#D :<D 3SK<3&C(jH#`O0V<(D+V,"IH!܀@A(f-O%& /FFUF F/u>.z.<#`O0 G J {O O AF!M `IEp %/FFNF(FB%UF7FFNFWGCh(FFF FheFIH(v-AN} x FF!F@FOr$(FL)F(OpMF4F$N4D#I:F0F #Ch N}( 0F L!D ĕH !܄-G["F FFCH,@!(F︱F! "phcW6Fg.fW&F cbaXXSBBczgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 8FlF@FhF0FdF.D#$B\5SE/D"0BP%DDEDSC"B4 2F% R3y)^#JJp>s!tYh_I F>v10hXk>b&0F =GD0p(LJFNI #DU@[BL@r[ CSfd04 @#F#"kh # +u#}+ZJJOzr>vhSC   F*Isd3ddd#s910hXkQ #DUL[@UBr[ CSR #d`  @C!4 @@#FD0rF`!<!kp2_B@Ѐ;۲#O &@;JFKh3A@񳀏O"FDhk0c]RF`"  FXF@FRFXF!OpRF)FOr!heJ\kBcZhOzq  hKCOA22$0ZK00()?h#DU@l[B @r[ CSh0ph( [n@#FtOxfKFBF+hrC2  .z&F>;F! yOzr OAh SCD0@0H0L0#K00C?Gh#DU@l[B @r[ CSR #FfhD `x.D&aADO 8NpAYC 79DA0E<41D4%8$BOpr{H xKhxK <48x08Pkz(@DAF8&FTOsPFF9F+F&$ 9`BA+FPF9F`#O3sWHAF&F0$-BOCȿOؿ# @O 3KL@|*O3BCBs[B @@`p   XK"KBXC2G/2GOBGrG00 `Y @G"z)F3OqOsK I"Aq0DBrOl\B8F/('Bv8'F !PTτ!p!y";FKL<+F @pBMC5jBXSBOϯ!`T!lh!%ZkR0haL4PkR3bisb@bbD5lc@_OSfKhcKheKheKh0cXTc#0HUP0h40PYF @ 0Dbijl!X!d!x`!|F^!!<TB!]!P!@!H+\O`z`Kh+^I# h`)hOPFObhObxiQKhyih$h0+xiOr!Wp(0+FH0+{hCMj0:4D\Bi"iBCDFhInDr  @#"C@!CF#.Jp -K-IfC(AѽJ0+P# 0*G+E;#H.hO`1F F)1FOPObF? "FF(lOb)hOPFY# P#!!!DuTn@th+hj,L#FhjB@KH <8dO{0GF  "KQEA\%FI +B% a`D%4<`DsK B D p0C_CKBuےH( h!i  iK$I{`ȿ`  h{a`Ŀ@;g)#@Ӏ"#x0t[SEgx#  eH;fqI h;3  #f`0fAH {fBdHJ% 4ihj Db-O F\Dh[Ei@ˀJhnREvq nJFh$%* ݠi "@nG\:CBTi i2aAJh*Md zhRETzmR 1B zhREP%PCm@P%* @;0d TFP00F FPC@:Z2:R8  D * , :BYF 9`#{eO3eK!TТ U`!YhJB5smxBpijYh:bJB5smxBpij;bhkX0@i3DOO Qk1Qc1FBi򪀚B"Dh`n&hikQi3DB@򰀎B.hi$5+K2fj $jNE3h#jzkFOh !jjWn1Rk!b@Xhj!Zk`bzh`iik _OW8D3h+aihi9D6hpNkDci 0o+F(#h\%@4cNBii%rCR@Fh^nQ@p  @! C@#@ PK\%BON3h+5 PhOBvrn 1@iBj2Bb8ShnKEvqnZFh$5+ ݡi #@n\CTi i3a.Kh+Gdt{hKET{mS 2C {hKEP5mXC@+'dFQF"2QFFXC8@;Z3;R80  D U!DTT!@`I Sk3SciZiBŮZhBvsn6B UiSj3SbnO nD#1FoE +?$B FP#1@#  +KFOL O +$eB3FP#`6@#`B  @I 8 z @J k08`6x`0@OFFEήfiE>D(F6 @F `i#kDBhhJ`f\B ii%QC FFkk ^ FvdFD   !C FFm+GKh+@72D?m. B3h=I=K*FF 6I2"\Bii%HCBFhqFBrxn  @B #:C@'H# DDB?(3h+hj;[KhsHv+ Khs BZ #|:x* ȹ Kh I 8 UT!H !<QLghcgNKh+303040 40JkhSC#oAIOb`i:>Mfib!`+hh1F8Kh6K\5h0+WpOr!0KhnCF:Fr+h+hiZkFVhQnLdH  Rk&@Ci8CSjcjB+h#hFZk4h !jjUn1Rk!b@=!k`ihiYkI D-++#!`7!D!L 8!P-G}FFFFJFF(dI2F ^(bI@F&(F(D]I*F@F0h+XHIFLO0 }kkcj`j`+k#akkca#@0#bB0cbklb/{FI:F@F0t@I*F@F0:@IJF >IQF8"F F"F:I0F8I0F" 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8FHF<0' 0BgBOЪ# (15D*2*#0fF "F a2( h@dAdeh@dziThhi9hi ii0iE-Am%OcFF)FFgCF*FF@FF FRM:`1#(F mF8F F I"F R#x/+ !FH)FH8@8^t EpG-GFFFF)F@FRF3FFFj`#"LD&O` FVE`۽#D#  6YH-G%@F 4F FFF F!O 3_#H"K ##Or `KF!q F !F  vmH#: F^ :^Fp FFFr2Fk2Fd2F]2FVppFF F((*Fmep-A @EB ȗA nҍBAӃ Bt ҍBA E|   -OFFFXF# " `0F xFPx(PI3F*F "m,3a,M,%A,!JI+Fb< ,P$BRFG701F8FFF hFj$6F6  @  ! J +FJ IF&PF|$61F8F!JVlX 1F@F0pC O+FIF&pfPF|(FO[𰻀"$$`SEB!.AeҎҬ-AF@N0 0FB F[tFб"Fo+FF 3j*FBF[ (F[c x2(*] #!3+BDk\CJ I"@CkT06h+F*&F@F (F['068z0 hpi;` D!.-Oǰ F!FO K F0Fa7c&JFS`cB 6 8a F%FXF!IF Fo̿##{aFK$#Br {I  #XB@XCO0DAF%!F   * " BB8 aJh F!FF 9-HF x  Y D [B  D!FIF  Fp1F8D5L1F8F# 6 6:K:IhbSC2#bR `(u%"#! #& .I/Ocf aO1 c!dq P  #ceKX0R3I *F+FHKh-=(F(3I!!!!<iӓӽ!!6!QSNb!h!zH")Fl" f $2"+8m5`iOv𽀲Kh+𲀱H/ (Kh-@;l;m#n!H<O@"! (( F zBDx0 N6kC 3"z f#06x%j(( &GFB&( KN6{2#Bw #"<"!lK#nA#3'4/5Dx0 !zkH 3" &#x0#@% F((@S]I^H%1FO@F 'tN)F" zHx0  3"z f)F 1ZC"1 DO1BAOan@J@Ih!9(0"tx0F%4655J7IRO v@F Z)F-J/IA@FZ Fx 6*FB.&0O  &DB&#ME@FZ53F 0FZ#"%kl+ǮJIF% 5ME# JI !!L..pTciO O 3+DFF%Eө !E"CFF h6"DDt`nPFELJLI j 0}#H+DD  F%05^AK"q!@?I?H?I!F9I;H6Gk!HFRF~IFXFNXvKFRF @3kV&+K0F@&"#ciD$HZ`[ !O)H&DV0(D ei6HFHv@K hCF:FF0F)DHD G/ݶ.֒.!L!!pG@pG8 FFFOb Fn(h `hh``h`h`(i ahi`aiaia(j bhj`bjbjb(k c( h`(l dhl`dldldPPRRhm`eXXZ~Zmwe(ns fhno`fjf^`^8p FFF FF(R hN`(J hF`hh@``h<`h8`(i4 ahi0`ai,a(j( bhj$`bhn `fnfnfttvvx xzz|.|GеF.8ـ3+5+-+%+++ +p-G}FFFFJFTF(dI2F (bI@F&l(F(D]I*F@F v0$h+XHIFO0 }kkcj`j`+k#akkca#@0#bB0cbklb:/{FI:F@F D0t@I*F@F >0:@IJF >I~QF8"F FH"F:I0F28I0F 6I0F4I0F2I0Fh"F0I0FB,?~.I00Fx"!8FHF 0' 0BfBOЪ# (15D*2*#0d "F@ a2( h@dAdeh@dziThhi9hi ii0iE-Am%OcFF)FFe|CF*FF@FF F M:`1#(F mF-AFF$"`0FFFh3,x[x+(I;F2F S-"F-G= -S%'33g= +dDTOH( FAFDTO($D4OXDOxI;F2F>Iv% I L ONF Hx I HVch5"x9F0F4l- b.ץX׍-CFFFFO 1F(FZAEFtFۏByI3F*F >-G}FFFFJFvF(dI2F (bI@F&(F(D]I*F@F 0Fh+XHIFO0 }kkcj`j`+k#akkca#@0#bB0cbklb\/{FI:F@F f0t@I*F@F `0:@IJF >IQF8"F Fj"F:I0FT8I0F 6I0F4I0F2I0Fh"F0I0FB,?.I00F"!8F:HF 0' 0Be$BOЪ# (15D*2*#0d "Fb a2( h@dAdeh@dziThhi9hi ii0iE-Am%OcFF)FFeCF*FF@FF F M:`1#(F mF0# M xj,h214 F;*O"p $T3 +0PK"`pG"L1FHO0?FH  -OF-h"!F}J`0##hchh #icii+#j$0j#k&ck80 ck@0B0D0F0G0l*L0(#mT0 + gH*@#)KFL(`HC9 \H#COr@c)) F3SH$;bFOI" (LH$#"4f!F(EHI F3d =Hef+fpC_HCD5H5I"FXpF_]yrUBUA "AFjPFAEHFPH!%QF8F~(<FѰ#C*##BBHbO0.exڜ/ڰŇ5ZŒ:@"!@+tC B:E1#b1ڲ$*D*@B 2"+@/!(i0KFh x F13320[ՄB\c|:+iB+fC+c:"EY;E+@̀ 𽀻 ## OPqF$ B,F;5 -nHnL%OD'YF(4D:4Ŕ?EAFf?320_c#x`+`0B#+;CV,"01.v0ۜ:CIJ9F0?:B[?.DJ(?&1F0?BCC>J)F0?CE+bE_E+R *02H*4+F@Cd DT%?&Ow+F@Bd DT# GR@*OF;x$!#B H@@4 ,] #H<ػ#л 5HYF # HX/M:Lۯ;;#OC:c КH!FHYF+ЗHYFO O ҒHOr!F$# ӱ;BЊHF~BوH"FF لHF!F/; C ;B~HFa ;(<;+yH"F=>$+sHFF@&FHI +F/! hJOa(?U! 2F3kd F(fpCOgF#F0F9FC ѧBvCBuLH= #=@EaOs>>a XT; !s !FOD O`OPD~F<:!O EI c@q"Oscf%F;- ; Hй?E|H!FO@(8 B,<HFOw:H:HH9N9MF B 0F(F6HIB 0F(F  }?8?<#E OFE+!!!$튋:F FXFxF b ## )l-5=FNdm~d߅@F 2 3[IP !FD # ###### @#$# !DJ) F& "3$?K)F CE?L:Khd C 6ICF5H1J#` { *IOsB%B"GE ظ#C<B)F"F VA?1B:FHݹ}Kh"!@Ffh:F!F(FC Ż FHKhI"FF h+ IJF ihhs`h:F"P&[[sFMh hJ@FH Hp"!(h hJ3F@"P["`[0KFHr]I[[𵉰FFh3SBF*Fh/4'78F# xMKF*F zBF  OEcqHqHpK" pOaX`2+F@"D3`2 ! +khCWI`f .ձ@ jh{:j`Aqh hmBEOrDHq;F*FD1 @=N #whW (#䰦f#ADIQE#3YDB#*H1F Ԥ@ &! { F BPEV +k`pD:FcF&}"P"4]^^+" "bM^GX""x^N"p"`;e6"LI IkhQ + [B( +D Hk`B13k`KB+ D;%";e6-GFFFF ` w jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  59FFHj&0F ^h"P-CF#M -FF(F@h+HCF:F1FHHDHIF@h?  ?H !!h R0;.h< IC ý@@"P^{^^^X K Lh K*F I#FFH t#4 )jXMIFF(F I"F(F I"F(F I"F(F I"F(F HX"z&pF FF+ * *x *##pp\* Cx+IH(F;'*"*+;.F;B+I5FHX FKhhSHKh\B Kh ) l(OOCOC`O0#T##hFFFP;"F/O#O? F`,HF+Jh`)Kh[ch(I; h\B#(FÈ #*##ty*%!%!-#h)9h21 RX^# #=#ctIH ###%#1h (/#@#X#h#T#Xhh FMNO FX+hh *3h[S9hO  A L#2y b2 F#h#T## K : *B ( QppGI X F:IFF<(8I" F蠹6I(Ft(FXF FTDB 0I1H` #x/+ (I)I!F(F+F)F xZ'O/)p,+Fxr1/*+FK/,FK\"FF/))2*Zx.*1FF(FF2*9F F`Ih7>I_F*3;D3Q+FQ FAF8^FS#CCBQ#TY 5 F( FD hCWF(JI#H6S]F*vX#T#%;Ww,PpXψ##hfffg @(I BH^FJ C @@A,FFaF.SѦI (FW]Hu0[;hI; h\B՝Kh;h+ IHFf(ИIHF`( I# 0yBDoObJFIHFHF"F9FHF26FK"1F(F1Bw 8FQ 8gFB8F (  ( 7O  SE=3E6cKhr:FdI[HN y D C 2 QIFCw 2 DKEFI 6e  +?[###$#TmI-OF; hF8F\ARF(WG(IѤH#XFQFF(uiG*@*LEN+Fr*Q"ϿѡϯEЃՋHF۱`HFZFSF(FLFCJKh+0FbѴ0XCY F)F)F F"C&cy+ F8I*FF8H HZF(FSFÈFCÀ*Kh+0FDF FW*I+F2Fr!NHFHFHZF(FSFF0C3h+?W  B  B 2h*?B FHF+F"F2#y#TX0Z+I F&by*(Ocy+9F F F F*i,ZFSF(FzF/ F{K(FjbSFbbZFdFKh+?M I+FFHBI*FH0F I+FF H$#T9SXv7K-Gh6I6H~6O&܀$2Bv1K2N2Oj0F!F4FCy++Ic h\Bjx-е00;(FIFFPF^(F(Fi,j mjcy+Ѵ0I Fc3h; Ff9FFH> F Fii#h#$#T#K-AhIHM ,j&GF4.,jM#j$F F(F!Fl#h##yX#-C!M -MF+h,I,H>㈚ Fy#i,+h!I#H('$2Bw M8F!FF4Gi-눛0FIFhF (F =JFFhF#i0"F#h#K-AhIHd&O%2Bvӽ0F)FVF5F0#by*#F〴09F Fi#h2#FFFF0I:FH F0F)FFF[ H2F+F=cy+XBXABi+I FHXvb8"OzsF FJR#82BBh$<F HJh+KJIHKh` #@XFLyw3/#3Do?Oa8Fc?"K2R( H#?o)F꫈o3D?$<$4>#F"#hh`hDs FFFBФI"FH$s #"3D(hl`<(h Obj`p XK2;"(HW$4>! HXCF@ @U( Fv #`C`>LK-OFhðF.HMD4BC4lOr!hF2*h v"!FR0 0hF(42Kh+@+h+Gѵ iEy3#3E80#I#H40IH*y3#3BQIH80I NDBؐYRQ)+Ыyq#q+h(F^D #L$DXr$+#hK-OFhݰIHNOaL#H#J#h 0R+#OaH#J#hHTEJIIMHzJI |IwH#OazH#yJ#h0R+#OaqH#rJ#hnHAkJgIP0gJcIfHgIrfLfK"ġeO#ch P +vpCOq!U\F[HOzs"IF@FW# G#`22`Sk "lk bl bh`!i "ibi"R(4H;J;Iߚ$4>'x# $<\5١${X >#X<L#CchpCO+#-C 'OF@Hch hOb1F (` !Kh I!HV%(F2B#c`BKh+IHZVDb`I(#EOAKh+IJFH<##TXx-OFMFFFF8FX#*F840F#FQF MOG#*F0F#FG(J3F?J@A8F>M$8F FFcF5I0萹XF$0I2F0H/I2F-H,I2F*H*Ir(9FO F M yJDoObI:FHFFF@B8F#h8F"e 1F$4,2X J\-AmFXx/*p$O&AFjF8x+ 1F8$ F m3iFH(FFF(yB02F)F(&h$4x8aQ F8`"iFF,F F8$Fh F@UK-OhIH0R+ ьKOaH##KJhL4#+ шHIHO񯻆I`HhV0IF{H~IbxH烉'AIHH: FU 8IEH,;IDH.9I@H*;CJ3FI H0F\#hy#>#@>X@Rc##X$4#\#`-AFmFFFFF(@H:F#F5Or@a0F.9I2F9H8HzhU5IF3H m*i0NԀFq2hmiF-0F* F( o/F0FOg:F0KIHm#NhUIFHD 0:F F0KI Hm#.dhU IFe*X$4#<F#\(   7L4#+ `#"`.#x#+ H#"@H>QF FFJ2BpH"F+FiO F)F{h*:hER#qbB#` Khvj O2BB9F0Fvj#R$#TlBijB ћibpGiBтiapGF+I{QpF F J2Bp Nsh2hR#p2BB@j #$QpF FJ2BpH*F#FN(F!Fsh1hQ#03*F#FHp@ھYjBB `p$ F#$-A!mF 'FkF@FFkFk/..p h)F@i,$ F m.$j8/!FF$ F8#p(F/##pF(Cy+H)FwFL/'6*yB H!Ff F)h F! 5B|(EK"?KBK@Kh ` # O( #4D}`(<`1D'B4(3( 3D(B]S(,2DC(,S,C,S,C,S ,C ,S,C,S,C,(3HW/ :`0#h$,X<B#X#xd~###D# F h=FhFG##` =pG+ռO%a KIHm T#XKh)Kh,Kh2IH F:[h9@# FdKjFIhJ(hU IFH8#$X @m@pGpGaJFhS BDKBKm I H ]"S BD $I# XF L Fh"i DBHh*F`i9F0D.D`$F KiDao J3 Im HD F]J$#`X#MF`+iBli FphiT0FTFha.aK(aImH##2FK $#XK FhCK$h FF`GKh I%#F??KgmhU4 I;F2F@ H(F0#P$#\#X8ML4C0+"mIHJK$#e###c`* H!4*8$# 4#D$"KsFh F;H F!F`nhGKhK*F!F0 KEmhU I+F"F`H` p#P$#\#SX8FL hF F8)FT(42pF KM`khB NTT0IH l`p#H @$X.K-AF-NhC5,KhñȀ)O:!(FpFh#(F;u`>(4 T I(FHIHhU:JIFIH`hU'JIF3h33`,F!F HAٹ#H$#D0*$##𵅰=L##:IF:H##CbF5I3H4M8#3K@3I*+F2H7"p-M.I+Hj.h.A##(IF0FZ#.h#C,F!I0FLN8#KI*3F7"(h:I(h4)hH+h[I JJ##X#`'D-OF\ŰF FNF0# F~HIDLF\E#hEӫzKhCyJzKzIuHLEF0pI pE#y+:pJOq8Fy0S#ykJjI#hhaH.#..2y"h`y1A:KR#D@F:F!y\J0/SKhZIOH#hDy"h`y1A:KR#D(F:F!yOJy"h`y1A:KR#D(F:F!yFJ#y+ EI8FpBI8F(60+/I>H2.. .ѢyF(F2B2"D>5J y@F1A1!D0J0#y+yF(F2B2"Df)J...ly!(F2B2"DJ y@F1A1!DJ0hy!(F2B2"D:J#T`   @l{#7#hKh(K[h ϸpG @$-O(L F#h +9M'h/7 ")$+РKh+'F>Fp`Kh35K(@Kh+)IHIH^#0H KxR+jЎK0+e9+7щK(FIJKKKVH)F4Nh)F0F.(F6 `Oa0ԝ4 + `3)FxH')FvH `YFtNO )B  1F bKF(FlI `  )F FF'80B )#@C9  2FYI(F)FVHVJVI(F(F `Oa0  LI `f4 + aBHAH Dbh"I?H>K ***8I:H:Kh9H "1I6Hm6I.H#3I+H0!O*RFFbh!PF(hT&IFHI"SFOrh|?? 3 9FHIOb8D($ @#h#X7#N#l*e~$'#H#TqKFhM+@iNl"BjKBBИB MeMhCdKhdIdH#` Fs(\Kh+ hg ``hc``h_`h[` iW a`iS`aiOaiKa Dn f   k8 c`k4`ck0ck,cl(dl$d xx||!hMK+#LT$#hhFhF(? Nk#BaBMhCKhIH#`Nk#}yqn f "`"$Z$&T& R N JFB>Ob! F|#`##`#0caa 0#$00&00  # d##Or0fKa4#ca0C@S 2`K-a_Kh*Fд$ & +7 [x3\#=#caiNl#B#i#|3 #ch#h##k#k##dcccf?H#h+=J+#h+:J;I;H>#S8I7H45I 5KoA 2N#A1C$9) 8:'I)H$I(H(I"H 9-;B#IHI "h*N*>*CJDIFF#:F!F3FO0_IF FCKh#4AH[hGRF)FAF0F:J.IF9Hc.#3FZF!F2/Kh)Kh+d#C\V"Kh['ISF*F F'E4 \ HYFhG FF.40FhIF HiIF:5q#h#\#d#`#P$" Q9/-A!JKjh+GJHDKiEKBEHHDH4+?BJ>O434R8NF`h%0 Bo/B30FF(3/JPO?!&K"$ &H@(9m@F5c9mH3h+0DhR`DD)BK Hm##T$#Pk>𵩰N3hIHLMch"PF ((`:hS]JIFH Z"hb+`K"O`I:h hS5#h CCF BchF(FhS+pIFkHPFZO.3LF(hD COccI]HbK3h:`)^IQH]H]\O58FZJ;59;99;9h3`EHIQHbPH^#h۱KKNJhNk#)FKI9Or#9#Q :D3s93hAKxt+>K=K FF(I(H F&IF$H`i#IF Hi0 IFH j0IFHi0IFH`j0IFHayKJ H)FIhIH F@F H)[Xjz[CV0F%B#OaH#KJH0i5I Fq$/ ÈmFI^ FC _FhF hV Fw ` q FLFhFv mpFCy+I2 F7KhF@X(C@<hR^*F Ip@F H Kh3*FIp@Hp<#\PX#ha-A/!F0D'O/?/+0F'pF`0FJ"h0F*FGFC뀄FCy+I#jI F F# CKhF( hR"F I@F H Kh3"F I@Huo#\PX#hFCy+I~ F# C}KhF( hR"F I@F H> Kh3"FI@H4#\PX#hFCy+I> F# C=KhF( HhRj"F I@F H Kh3"FI@H#\X#h-CFx2LF.+ FFCx/+!h-H 2F )I;F h-A!h%H9!h#H#J h"IJk hIJ/I hJI hJI hJiI h!h .#h[I hJJ#` 1V^$elu~D I 2-ANODFF8h "F(I 0 +;#0B#H+pwH!Fs$3pmFFlF! F#xE*Oa&H)FPDF x(`O0#xF+K"Z` mpA+ F DB< +#<H!F*I P@$3FF FF K!FFhF FBI 1F(F@$3𵅰"OL`OI NI hLILH^`KI n,PS aGI#ihF(Цh@!0FZ(a#p?Kqh?+C0`h*F:HY#9K3F<F `(FR.*4K%hpOOpCco h6%AOq h<#"! h4" h!, hC ZҲ7 *_+-+H1F .FAOq(c$3 )DX$3g#HQ0ðFFFJOqK" FZ`*FC0p$3Lbh*IH#c`$3xؘ𵉰 FJ!FhFH"iF F DB8hbq@I O%{+,$3p F JF FhF!hFd NiFF0h"F)F0h!H^p$3FJP!"H]מ)Fð JOqH"C]O0pF FKh*F ZhBZ`C!+I2FI "h!hAT O3@S` XBXAp#F$3d8 FEx- -S*F!FF H@h!FFH8@H3!FFH(7((R@HpGHpGHpG M F0Oa],I M]I n; f+X1 񼼋mZe "ppG-OFF9AHO?H>I8FO51F"! G.  `kex#x;C3D21 *'  VK,F/;є6- - F# `BF!FhF  d&FJ.!Hl"!hFBF!FhFPJ.#(F YFPF'8 FFPF7 /z2$3$3\KFk+%x)ГH@xK)H!Hx;+ C+++}HF}J}H|Ihah@i!iwH! * tKL*F`ih oI硈nHኡd++% hH"!B eH@cHcHcHcHl"aHaHf"`H` "^H\ h+f+ٝ501 040TH3020>j;+ @N=01 0 <0GH ;0:09080706050403020 j+#5H##硈#H))*H,H+H#!i)H)Ih#(H'Ij&H$I jhx$32*1+ :3N3J3n} Gfnx4|5-O$bMFF!FF(l,`0F*F9F&p""##!"FD D dQBOI0FTpQFKIF!DQ(FI>DkCDH+hBH<[р Fl{A)Fh 9FO /#0 FIF꠻ FBF8 FOoh.N F(NЃhkp#HFh FIFb F0 FIFTl+nh0F(zh)F0F@hh8 $3   FxCFиޮI"F 8FL h)F~`h84 dCy ˆry**0D@񄿽@COqJHH $7("KF"HKK]   \ (F((HDIHII  x  0 J #Fh4" HpV 0BBLK5h70 !" F $Fh.!F( I0(p!h)OrH.H0I$8($7(0Dhi,@-%-J#Oq+H>1Mh-Е D! FO4hɹ-Oc-B%OqJH ! FO(h)HOrH0I-! Oq H JOqJH$7("KQ!pF+EsID.&"x Zp+p D p*ݬB"HppF$7(5h$9("KsFhF HOq"`騹H.!J뀱AOrHj#xkIOrHbHpK"!ex- - FJ+FOq Hv`h1Fp@ Fp@q $8($7(.Dx,,x J#FOqHNH@@K6$7(R-AFFa)F0F,F F HA*F+!FHAF"F!FHAp-O$FF FF"F"#!DOG QBBII@F(GHP0FFF!DQ&(=I,F:HDE(FOQh9Sy BNx[HԔy0B y1F !L3x`s;C3D10 ) #hH#"! Ah JHF:I n; f+ X1 T#D#`mZe "p@Ph # ]#!"]-OF!MO 7 FFFF,)DV\*5O `rF#"2K!F@վ?IFH zXHLFBMM F.hs+`6(@aIFH-8$@$@h++v-AF("F"0FAFP20  I FPF(FAF0FUP0 FAPK1+K9FHZhvIO@[ B 8FV#5^ 6AFhP$@ (kzhn] -AFLMF F11[/1 Q-0/1#/׹=K>HZh&Q- !F0FA 6K"!F0FA/2H Q-+3+!+ "F1F"e&Ha/7$HA_ H/H1F "F F_H"F1F#%aH_HH Aʸ$@ (k^vh{hWhhko J F)h]K3`pGL2]KhH\$@ (h-AF=Lm1+;HJ =!OP0"AFF #Os8F3`Os0 9F#h+ mT"AFOc3`OsK5R# )o@# `#*s3FP0 lhPFH,+ Hh#C-H$@hhh+v-GF:LFF11[/1Q--/1/ѽǹ,K,HZhQ- BAF0FGAF0F$K"GF/!HQ-0#xutsCE/ѽGHf1ixHF)1+PF2FAF HG $@ (k^vhWfi-AFKNFF3h!F#,?DI FȹO3oB##C@FP0*Ѵ@ @"` F4B /H"F)F3h+ x+jh+#F1+#j!# CoBB?#)F8F,j2C!oCB?#)F#8F)FJ #8F#J)F #8F$@i i*-OFbNFF3h!FE'O,P . PFP00RH)F|%@F^ FFV IH"F)Ff3h+ @FFFXF@F<h+.PFGP0Ѵ@ i'F1+Ѵj2OC#)FHF,j2C$#)F#HFPF  !J SFd!b )FFHF,8F ! J ;Fd!F")F FHF`$@iIi[ixK-C8KMt}wBEO!/!!AF(F0H)F CF)FD2F( 8F#$<\IF8FX%F ($@$@$B;-OF$HF#L%F!hF F)3h B"8FQP@#9F"hI vk3`#"YF8FT'h C!BAEPF(@#9F"hI54$B6ii-AF4LFajR  2C-HA I+ м*.++ѽӹ!KF!HZh*1+ )F8FA)F8FK"A+FH*-L$%B  H!FA ]@F6$@i (k^vif0% FF#SP\0 0*I"F KjC+F F]1 H!FHi$@^vi-OFCF+F FY K]hN!F*FF H)HHi$@ (j.kpF F&#fP<0 p*I"F Mj C3F F=1+K!FHZh1+ORV#H|i$@ (kk-OFFheKh۱#dH# Pp (%^U(F OFH PO6(%6O QF :F("wDHF O0 5 FOO %i(;B+EIBF B?O%F @F &j#CV#(")F Z E6K !5J(5CF4^F 9F(" F(!B(-ܶS v1@Sv@Sv@Sv@Sv@1FPF#HF########$@ki `kck#^v-CF`"*x FAF/#JH#lP(FOFP o#O3%F%9FHFUO0 X F#CO2B0I2F .0/#C#C  #"F1F%IhjC!F0F3FBF!uX# #5BܻO`1H1F+ OD#)F8F5B j@Fki$@ `^vkjkc] 0FF%#UOT0 0*I"F KjC+F FU1H!F zH zgzg+z;g+;; ;R0;i$@^vkt-OFjNMFF3h!FOZ ,o FF _J _IZ TRF4!pO FHFXIO FOS AC818F hO0BѴ@ = M"@FCFth"*@IBF Ex*;IBFEx(Ѳ?S  T# CYFD# F#F1+Ѵ j2O CKFOR(F,j2C Q#1OR(Fy7F:F)FF @<0h8FOT P0 F")F"FF @<0h FO=p$@9[kk-OFMFF FLz@Ft PFǺlElVl`$@O;0F(0mC3O\Jh+@4+}m;3y/@#hnFcl"F)F0FkH/@$*@𗀸Ԁ 0Qq0#C3F@GKJ KQrH,KH$/#h"kyHFakxHF*chB|+jBwHFNF(?p-JF"l1fIgHmC3dH0/-#h4;%/F?t8 - O@RIFTH >h"QITsLp3FGAJ!DDDu Mbl)F0F"O+0 s2I2C@3+:H1{'+R#LcOP PPO2C@3+)H 4+Yck O O *oF%0*NF(FF*YF0FO0/#h`*O CDE[@FN+$@zkk6kkk$@^vlilz$D(ll@FN^O h +# F%0ckKEE{h `;h C $QF0F$R:FH  `7ckk`#AF *B   hBЊh:B 2D(JhBъh*O;\F NI(F(H#Bx;H!F30+-++.2#;3" #S1FN0 Ϲ m"2 &C '##&0##XFh+@,<,+,#I@F##I@F h$@pl (lp4pV$D(p+vpm$ '#F,I@F# &#FX#&I@F###MF(IHFAFFNr0G (FqONp*h+*FHF I## I"FHF3F #CF t$@lMIFF(FI"F(FI"F(FI"F(FI"F(FI"F(FI"F(FI"F(F I"F(F X4q58FKhIFpF $CF H)FH` 8"F)F $T*FFHD$EDdmFFOahFW I"F "hF mpmFFFOa&W8H!F mp&iF^(ZH!FH!FM2C&h fk`+h  &2F ($EmFFOahFW8 H!F mKh  hiF ($EF-H'MFF(/  ,iI FT(I FP(+*hOa FWd H!Fz|I#(i4: f FvIh FsIhX 0*FhoI F( kI(,!(FM(1F)F 4p9-O F-" F ܡH O`hCM I . *F ڕIBДH*FF,,,OcMK(FOKMOCKM++m KF, *+m +j7FO <[|KIF|J}H}K}K}KSh%,FF ;3L +EmEUOK&d_++!O O *F#F!@0GR3F!20\H M* M#WKXMu8FgpE8FO #V< BVzOs * 3  F BCf+yz盓2F6HIFF H@Or@PCFI XCF@POJ! V<%H` #O8FK F!06I@Y2NY~+ڢ$ڬؤ<B { !Z #BRKOJ#X0Ч I R!BR[F02FIFH V<H` |H1FGPOyCFJFJFCF(FF!FH2F*+mOE*^OK#FV++6ЀOO O 2F!0?WJRc!0?JObRBR[0?6kHJPaOy;FJFJF;F0FFJFFc;F@@PIXHCF1F{ +xOK*I^+FV+SGO#O 2F!SF0?j#BR!c0Fz0?׮ ` ObPF!RBR[b0?(F!F*@YF$,Jj@1*HIF! `  (F!F Ox@YFBF@1c;F! @@PI`  hBF;F@PaBF;F0FQF  J HIF@Y )VnIFHt X-AF$LFF4c`!* H4 T@CD=D-۸1F `ع;`x HbOa;`W@J I=DH$EŇ8FL!hQK*FIhKO2`(F꘱4xH}( "!h Hh J` J`8hah* Hi $uH5%!"%T%P%L- KhSK"IhCH!$uh$uHج$I-OF MF0+<p/6F-M-I3FBF(h(hObXF S(%K"%I(h`#F8F MFJ0h320n+?+!a+'p+q+K"I(h`"FdI"F(h#0Z)h# H04 I#F(h"FL$uHV$gTw$u$upH-A N3h Kh M! L#'h+`!`c'`#3`$$uh$u$up K$`+ Kh Fa K Jh+#`WH!F$ux$uL$ul%!$J-GFF걩L "@< T1'h27 \ bE!T(HiN/z.F+L>H+F@<O"]h27p<B7h7 pEMѐB٢\+ZbE.F"p$+$"!4K2F!xx(<#~H+p,FK@:zм[\aм$@>Zxh7py@50*@w@</*R+bbET2*$( \(*XxB)3x2x(3_x0/ٓdEЧ1T$|Dl,7D$|O Ep0hD@H,3B#A$(.`<`,YhH3%L$u$z %"-0KO2`@H|%!0KO2`@Hj%!0KO2`@HX%!(KO2`KJIh^%!$uH%(KO2`KJIhD%!$uH%(jKO2`KJIh*%!$uH%,;(pm#$$Kh`3C2KO2`7+8+.J (+Xh F(hhxhJOBMT#x0#+`9h"F(  6K`+h+GR(pFFh[ #`5 h( NhI0FLHI0FLO0p##`- Kh K I*F `-KhKKh*P\$uHbJKK`$utj%!0KO2`Kh+KHh@*%!$u$uHtJKK`$z%!(p F!'Kh* ""`%Kh+$J"L$I4!M#h+"K#I(hh*)h!H#hKJ!`(QO3J`pNhIL0FL_(K" h`J I0FLTh0F(jhI hK`K` h%!$uH\$u$u%!PJKK`$u%!JK K`$z$%!LK"FK`#hK"`$u*%!%!JKK`$u7%!-A F(O3(J`(&L'N'O#h+ ###`3h8hx+8F HZ##`#h(I@FL##`I@FL `8hJK1hh xK- FITh K`@Orih@F>J%!$u$y$uHOP\$uH$KJKgK`$u%!JKYK`$u%!p F(%%%8(MO3+`KhK`Hh F 0H!F$ F8@K(н8@q J Kx1h I2#+`hH8%!$z,F%$uHWp@I KO2`](( JiF(HYh{(K"%!{%𵅰8/KO2`(,J()K )I$` !F'H"M%N%O"FFP K`h#x +`+h+h!F(!F0F#)h(K"`);h+K h`h+h3+` K`%!$k$I$uh%$u@KO2`](+JiFw(+HYh( Hh( K" JiF\(%!%-GF hFVI&xpHDD FPPKhPKPHhG纹6IKKO2`GO%H@ݹ*й-)hF |F(F:H1(Y6KO2` FGK[4I F3K3O(F F%1H F#BF3!F-K8F,ѱ(HF FOp.%HFx#K*F(FxF FK"|#r)FF;#3KBF!F8FMUKBF8F{s%%$uH%!kߚЪ-A@MKO2`(X+HJe(C;R#!B#?Ixx|+ (9Ht($6Ih5K6I` X!F3Hh/M$1N1O+h+;B3h۹ B'K"`BK{&J(ѓh#3KH,;FR$ `F)hKh{K"`h+h3+`K4%!p$k$I$ulߚk$uh$upFm@O4;K` mp! FR$ F4J,! /H/K/!(FF F `AObh(Khk'N F1hJ1hh;`+ j-#KJ FhH!F,K O2`!F hZ ` "p" F DB1F i$1F cc H%!&$z$uH$u\,?0# 08=8KO2`0(5JiF;+1HYhp((D.K/Hh+,HdF!F)HYF F!F Ft--h+HHF!FH<F F!F FX-KO2`Rh+Hh!F Fl!F F:%!fp$uHx$ulp(LO3#`нp@ K NMh 3xK3x+)h Hp@4JI(hb##`p%!%%$uHp(LO3#`нp@| N M3xK3x+)h Hp@JI(h4##`p%!%$uHp@UKO2`]((JiF&(HYh( Kh Kh# K Hh HYhs(K"%!;$u$uH:%@KO2`]((JiF(HYhA( Kh Kh# K Hh HYh-(K"%!B$u$uHIs%-Am FFFObhFXo$B HiF( V$ObhFBObAFhF4K"` m%@ KO2`](JiFb(!H%!| @m KO2`](JiF@(!H%!@KKO2`](+ JiF(+ HxJiF (%!{P8 L%h0 KO2`8#B#`HT%`IhHN$u%!8C L+%h KO2`8#B#`H0%`IhH*$u%!8 L%h0 KO2`8#B#`H%`IhH$u%!81KO2`Kh+H@%!$ul 81 KO2` L#h!F #h!F %!$ul!F #0(fKO2` Lh!F H F!F FHF(%! p8<=KO2`p(:J(XhF33K4Hh/K1Hhz,K.Hh.H!((,I  F 1[z{'Khd K&Hh F#)F !N"I0FFP0F41D0Ff " FhAOh8GKJ h;#`)F %!$uH  ( ;$Jm5$ul T$Ј d%!JKK`%! g%!JKK`$z  t%! FOF(O3;`(N#3`KHh"3h3h"Ih H33`;`,, K"ph"@H%!%!$uH %!%!t(7&L %M#%H+`%Kh+h#`0 :O3(,+M !J##`(h`KhFK? + F !,`F#H#pOb)h? +Ob!F H JiF(%!%! $uH$u\$uL%t%t ($Jh+ ##`!J`!Kh9!JF(O3J`LhI FKpK"`KJ`KhKIKhI FK0 K` K` KhI FK(J#`J`KhJ$u$u$uH\%!P ]KJh+K#K"`K`$u$u %!$uKJh+K#zK"`K`$u$u %!$u8F F)F F8@ۿJKZK`%!!%!JKKK`%!!%!(-GF FFB()O0(nhBI0FK6(F@I0FK0(B>I0FK*(&,;Шh,9h%! !F F5%,K+K`+Kh.%)K)K`QF IF  &&%OOd%JKHhhIJh+ FI.%KK`Kh+J KHhhIJh+ FIhx%!$u$u$u$u$u$uHP\!"!^"HK`%!0sKO2`H( Kh Kh# K Hh H( K"`# Jp J`%!!$u$uH!!%%%s F(4KO2`pKNh31hHp@(Lhh "(xkjhI0h#0hSF H Ip@ĺ%!%$uH%!!!"8L%h0KO2`8H##`(%`$u%!"8-A@O3NJ`LO;h+KKLHhn(9+HKh#DKGHh`$8h "DNYh`l;hSAJ`"@Lc hchEE3%;Mch;c`+L(F. (Nch;c`+O(F$ (E1JiF_(ѨZabi2`+c` F CK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhu#hZ"`x +%!${8$uH"=$u"w$D$D"l""$D08O3J`0((J(!XhF?? FAIZhKh-t##%!{#$uH08O3J`0((JiF(!Xh??Kh]h I*FF Fp+s##%!{$uH# 0KO2`(ѽ@H̸@IhHƸ%!##O2K F@H2I@h+ߚ$uH#-A@VO30(( JiF'(XhF(HF`xK*F(FF0FD4 F"F)FF"FI8F"F1F8F8F68F#0JV0FJSMpЪ%!-O@(KO2`(($J(!HF(7xK*F FOpF0r|#N!FLF;#)F;`#` H#KRhr(FJL%!{Ъ%!%!$u(pF FO3J`phI0FJXI0FJI0FJ($hhCJ KI`` Hhhh*#$%!#N#V#^$z$z#f$uH-AFFFF8K:FIAh@hJ}#c`0F8 JhF``B=H"hIAh追$uH#$u#-AO2M*`((A bhAF4*:F "0h#h+#+`LNO "%! ($uH #(NO3 F3`н@ӾHh OF0jh8h I@@hJ #c`"hI8h#3`%!$uH##8 L%h0 KO2`8 Kh3 K Hh8@3H##`%`$u%!%$uH#$8CL+%hKO2`8Kh3 KHh8@ #B#` H%`IhH$u%!%$uH$ $9$>8L* F%hJKO2`8Jh2KHh8@Ծ(OIh"` H{%`hHu$u%!%$uH$F$s${-OMXaKO2` M(JiF(ВK$M/FEяKrhIh)Fph "5>4IOBO#w&h$;iB+FF+21 TzLF+x˹#p0hh`CFdoKqHh\hK`;iB5$+ \+Qkx5;+x+5jxP1@'#O "eF0jx P1@:B  FBS+6S+Di*5B B FS&S&DO;H4F7Fg'p>FaF{(F%Kh.7FO Q6h%F.й%F'F&FE6h.йѠFO &x6!I F0&DFFO DFFF/x/?&I(F'%F,F/F.F <&''x$u$ul$ugJ''/'7'?'G't$y'+XF(?#8PF,.}/#x+@OObYF `J c4# 00+#x+|KKhvIIJHp DF/! F FF# F;-1+x+.9I `Ob>C c5N5O A3LOb%h#`3h+70I ` c%`#Kh>|K}LhhB!F@F,4(;wIOBwHvuKhhuKh/H#/0< F8!F F0H#01< F(!F F1H#1.(? 5\I {[L h(< `XI+((g T h(< NPKh+1(,4M(FLIK(FKO:JI(FII(FHKh.EGN#C03LEH!h#CI(F h#$@I)K>Ih2KhT<1$#H5J8Ih7I(FMP(F3Kh3H(VF1K(F1J1Irh9F(F{6h(,J,K) FFo)I(Fj("+O?,mѹr-KN$uH*x$u${8$D*$Ј$u`$ud$z$u+L++%$y%!(+:+O***$z+b>G+((+ogJ#ѝI( (0OњH$ k2іKh+ЕKHh&-БN%FNKhK2FI4h$IJF8F-ЄKhñK2FIhI*F8F%NIJF8F-,п~I*F8F|M ('"(h**h5FF3h(K ! F( 06 "3:6xF;iJ3h20X@3FO6%F f^J2!Fh:(@Ȱ]XI4443 "TK(3x+O ((@,?i FHdGI4gF(HDI4`(4x*+Cx4/*ZxX4**+34x+9K#C7H7 " 7x-+07 "4F B 2A77 "p7#I4(B4YFs,"sr(?eO3{x+^s<8W&+$u$uH+X(++++X+%!,%!,,>I4 4$F%I4(oИI4H|I4F([ѓHrO ,@ـ8FH@-@ŀ?瀉J#hB#IT(@K))+@XJ2RL ??BEs ??@vH??.Bs)pKh+@#O 3 jI4NiI4IF(?"HXF"aI48(ђ ܺ/lZH9F FH8FH=r*د#@ +xKOHGK#C^LHLJ2+ HHD8FH(F;K@1Eh"ѣK?)FKFw/8FO Hx(FHu66K*F6IhO FHh"+K(F`,K*F-Ih,H~, F FHN&H#x|+! !I#0))##H1-K',M,W,j,,$u%!%!$u,,,--,$L-E$uH-e-x--ߚ,̕KHhX??I`H` BB#H&#I))+##IK'I I K2JhBЀK H~Kh(6а?O0oO`vL8 tK sKh3Ox KO3O0Y ,PeM(8fH׸O00#"!` R! 2BF[Hh"+,"#!`OKTH "3!!x *;*MI!jPLH3!!x* *, 0;0K9J" B!  #:# :#Bq:###:#:#+r:#"BOA :#F(F(G(F8 +@΀ +TKh+@܀(F(H,)$uH-%!-ߚIg$L$z$u$u..<.O&.a%!.$uęJ@A:#b# :#)pzF:FNC0h(#(]E#Hc?DD}Khs|Kh[|KwO hBr-F +?Id,?EsKhKrM'9FFBF#[DbH@;t B2p+r (p# bKh^KHx +?,?$/$-ZM(VHVI *TH,?IKh+DJ0(sDJhFJhBOtA?K hc# _ )F'?KB&82??!FZf8#`^#')G)#Z0 (K8hJh-IF F.J2*s (K) K <K!H#PBBA > 8 2޾ ,ܾ$u.%!$u$uH$uB@$u$L.&..%!%!(c'+1 K#hB3K:P7<$?!&#&H0#&"#"H)#"$#$H"#$%#%H#% m)+')G#+#H##$us" F"IF( I" F@#FF FpI FFXI" F(I2#F 0MHNX Fp@ch++x+I" FF(&&&&/$𵅰#!2Hv0Kh++!F3(I I'I 'OD'M'NB Kh+3!Fx:!R#(+hB #+`!R#[4hdI F~8#x|+ FHO#3`+¿33$z4$ulu$L$y$u𵉰FFHI "F8F3h#3Fl D`$ux$O6"Kh `KhSK"IhC8 Hh3`Ch0!2`$ux$uh$uHج$Oh KhSK"IhC H 13 1Ch0!`$uh$uHج$O K"`KhSK"IhC H! J131#@;`$ux$uh$uHج$O$KF "` Id"\ Kh0YFF F H!$ux/&$uH$PK $`fJ#`J`Khxr+s+I FId"$Id">Kh0YFFj H!j Id"$ux$$O%!/a/R/$uH$P/[FF0$@XN0Y@<# [F[F]#$3p$x$+h+7Kh+?G1O1K"`IF  QF *h@BB &L#hk&KE йٹй? G 1kKE кٺк? G0+(-d$p,)-KBi[d,ڮ(-`$%!$uH%!%8$u$z$OM$U-A!N 4hdHKO2` FApGO I#;` AFF0h1hH>0hFKI@F"`@ ;hF;--k G)F v${</%!$OM&$z -OdM"#JFLFxi #    (:hG]FBFxH9FwKO2` dMD 4OrYi F@tBFiH9F|fKO2`>9F # %S!i@Ci$P\I@BYI*F0F0Ki3THTI3Fhh!`hOH2Fxi0i"ici[ (F((FJ#"ii:H#i$662F;I(F3`p0 8HBF9FF/K(FO2`$k3h(66+ #"!F#(F>*I(F)L*I*N `(F#h0``'H h0h(!Kh3K Ih* [($"Oq(F OrOq(F$u$U /%!*gJ$uH*x*$U00${@ߚ${<0H$u0\%-OMO#LMfj#ѢO;hO:7 hC9"!( `tHВK"`"9!( `ڋH MKh#"Oq97+ЁKh+vрKHhh hFO3#`|K8h[403xJ,h0O2 sH+0F(( 0mKh;+eKkHh4#0hH0+(ѕ97+5[KbHhYKaJbIh80+YKh;+ٸ#ZI ' YH   t(SFKSHh hO3#`#;`(EKh *+7='<0F+?(;h3#O;`KJIh0+?ޭч?"":`1$V@1$y12+$u$u$z2K2[$uH${D$ul$uSKFSLh h/1F@r:F!BF@! h0#h9FDO#0LBKh+ؿ<#Aq! <  t#9s Ozs"!"rCD6h+2h#+'H'K(6 hAF h+h#+H# h*F!8F'`0Н90+ #"!#8F h1Fv( HZ hvO3 #`$u$ubM$z2$O22r-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Orn+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?KhL4S H I 04OaHhK*FH$m@$7d$qH F H! FFhαF,FEмB20!FF"*Կ8FO0 x-OFF9I@FFd, Ԑ<,3O ,,N,K-J ,M)F+IF(hH F! FO6 8 z+F F5WPFCFISFBFSFBFYFhf "PFh0FGCh " F I~&($m@77 x77#7?I08x!*$*(*+FxF2 , ,,Q("*&F%x",5& ,)&3K%"((x%K!*F0"8("("8(\,\x3$K8(3x,",%K3K(88+ #8#8#8$m@8LK (8 K8#8`$8jFF $838$m@$Ј$𵅰MLNN(8{IixF#GIDH#OB1F`(ڂ0)$8+ 8hhlCF 6H(8Kh;`+ 4 hZ ` "p)HN'HCz3,8#H)h "#8F08L 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI gI c 2$m@$Ј' 7 ( TaupGFI I"F @h:m: L#h3$ `KhBN#hXBXA $uHKJ-OFhh-CC˰O!#`h9t#@0s:4 .z@08 򋁵@PF1F@0 P0F FsS @tKJOq h2J{IEFPFMIFPFJK 0DFJ[FFq~DOaaPF2OaaFPFF q0DJ[FfD #HO0hZ`xMc& p`nCh;C`+!CР + (,(\( `nCh;C`+B> hZ`xhZ`x)FJ`hv4%"$;%" FOF9FD.!0F^F!FDFp9F0F*F|]d F$$%"-OFLFF#x{I FMhf`h+ВH!F4 m@+V.!#1&(+0K(F8+p +VCS (}KhFF(&F;+N!RuG58jHG ++3hn^ bI(иaIȱknDh( YHYHhn2O0~A(0+IHknB>(DHZEH}G(0+8H=Kh[hnChZ`x ( (hnCh;C`+`D1K2Hhh (̰)*K,Hh"+OQCT xT(IhnCh;C`+:A#IK"HhhZ`x h 3@ B""p (1)=J$pri2`5$u%"; %:;<%H(6ѕ $u%!$u-A FȀ)M0.hO3+`&O;ik4O0F.`!K"HhF HN(H !(0 "x+J3h20[( Kh;i3#;a,0+L H!h!h .$u%$uH>)>R${DX%!$z-O FpMNNO0O33`ILchk%HKIHhPO0F_FCH(\BH !.#p>H.!&#p;H(*9I"7H Ȱ6L4J6I>b4I2#4#p0#cp2,"! F(#K"F*Ih"#L(I F>(O3 2??0+Cљ (;hch3#c`-0+L H!h!h zy$u%!%$uH>Z>${H>${D>>>>$z2!FJHI H?%&p?F F !CIF C I2F(FF` I2F(FF(I2F(FF9F C F7?K?e?OaL F p% K"-A`KL Mh'h.hO3#`Ht('H !4xCx"+0AF#@<x cE" '`.`"*Ѿ"0+3+#0%$z$u%!n${D%p @BFFhFhFpIF  p E F)F(H!F +x/+0F1FFF(F((]/(а@ ,?-O$hF&FB 0K4$hB#!F(Fp9F8Do O FEB O +hS&6B8F'+hXhSE  DE 9FhQEFfFB3 #%!$uHjF KIhhC0 н0+P#J``P#$uH@th%!(FIH*I 0hKhD` hKhD `h+ JhBĿ` h+JhBݛ$u$u?$u$uJxh320[ "~x RxJ3h20b; * +  O0]@pXT7FL#h+#AOq#F0!hHL#h+#AOq#F(F0!hH0@¿0$z?$z@-C&\5FO\] GBҞB#;p", , <)ծE5\,М@BDU85-O;FFF$  %*УE#F"TcF FP c-R1/---D%-zBc%!B٣ pM-|Kh+{K{Jh+FxZ#F)m-.)ИBT3m-n-mKh+ƀmKh:x#F)ИBT3cKhkfH.-hфF"_Kh#aH.-c-`Kh+XKh+\H/)2cF  )ј0  FO 1_0  2!FpEsF|/yx/)/F*ݼ{Bh.-1&ѡBCcPB<pB74T8y#F/*?5B*T3sF9BXBc/%BP *O< ݙB9"B*p#+$pB>"\TB02*p K J9{BcP#F)ж$ul%% %% pGFFFF1F8FF ,o#`J"` J"`O08FC\ *F"T,##`>BNsh;s`+ H ( K#`o#`3hZ2`x +0@ @.@@-CF OFF8FCsFBFH eIBFaB #H9D;U$BKI J K(hhhhB+`  2`$Ј@W@s@y@$u`$ud$uH-GmFFFF & #cIF@C@FP}I@BnzI2F(FjyKh+6И FqhBi.F2i FiF0%#! bh1@C1ii0eI `@BD4 F~"F9FF^I"F0Fx"F)F0FtBzH(U(ԀwH#h*F0h+>sIB#rHP"(5oKoI0h2nKO2`%B#< F!F FB#< F!F FB(FYI h8~SHxF F+ F!F FKH`F(F!F(Fz,,BHRF F F!F Fb x+?n8H6F(F!F(FP,^/K`/KhB" +FF0 + K#`#ob@ @.BpG!!HP%&K!Z0K>13Hh1hGpG%&PBƂKðh#Kh;Kh,@ C|L !F!F yH! ! tHqJ1 qHqI !<hGlKlLh!h!eKkH(F밹`MxA@+2dLxk#ZK1hG+l^H4xx,+x#Z"p1!h[hG(33MMMI(hHFhKNCO"FOq(FH Ff)hEHDHo1Fx8x + FP=H_3(FZ"p(6M)Fxi8x + F20H@3x;x,+x +x#Z"pMJ1h[hG F 3 FzK!FFh 3%2%2%2%&CAP%2dB%2B%2 (*BC dC,%0dK! ``%3d IrK"`u%3\u!KH`%3`%' Kn:f*oB (КmQeppGIC-CFM O"(hn1+`&O j "(h `0s FF H>I"(hu%0dPCU%(%3\&H ! ! ,CF3ИBH! ! F !F K/!LA FR`A" F` I H I !FIHIClCrPX&CxCK"sLXhI1N[P+x;(FT)FFphI"phK "h0n+HTp%2@PB%2Hج%2PC HP"iF} Khs K\A F(H!F,HplFC%.PCCtF K!h FjH!F HP@ %2XCC K|Al#x[ FK!FFhT P%0d K7FLA/! FHAJ# F+F0!FPF pFx# + + `F+FKl , ,њB10kSFB10x*p-GFMFF|   +hkhFh!FH$FY$ 1C K`1H-1J! J/K"&IXh,1F mV(ѝ 0+ + +pK>1#4H!FJ[ERFEHK"`}%0d%-%3`%2@%2P%2%2%'CPC%/%2HC0Ű*HOr0 &HE0"H*"HOrFM ! FI VKk)F LN(݄B!F 3 HZ FCD D#D0PDQK-OFH"FFXhI&ZI `~J!0Ff|K|I"h}=(RxKhxKn1+N"r sMOFFFO ch;c`+@ F0+H .fK1 /?(@ F F F YI>1+@WK"SIXhUJ! d~N &#hZ"`x0+(ѵ1+F Cѳ(Ʋ (1 # &; (>+ѵ.1+  - & +е1+?~>1+-HAF8n1+?n#0 K"h B K0 ~b+h* "" @BюnBYf HYeHH>%2@e%2%2P%2%0dP%2H%/C%-D_CDv%3d%3\p°9HOr F(@6K"6IXh(! ! 1J!(F2/K0I"hP %,H.F+K>1C `'H'K""IXh%J! ! ! Bp (FFF(݄BK!h 6!F !F H^ FC%2@%2%2P%2D#PD%2H%/%0dDp°;HOrxF(@8K"8IXh! L! H3J!(F1K2I"hx%.H.FZ-K>1C `)Hc)K"$IXhh'J! z! ! Bp (FFF(݄BM!F(hP!(hL !F !F H F@C%2@%2%2P%2D#PD%2H%/%0dD0MF(hJI FZJCchCc`!(h J! 0#ch#c%0dP%/0 MF(h I F*HC3(h! 0#3%0dP7HOriF(a4LhFH M0@P JOa5hF J)FhF M0%2E)%'E1EEJEV8)P"IHFй HI(8@ I H M"FlHn1+Kh8@=8%3 EEXP%0dpP"m I!Hl MHQ[BF*H mp@+mIFPF8H1F mp@нJ5n!jJOahF2 IjF F mp J%2Ej%'EqEXPEEEIH LXF-O( K&ĒO~OO45F`OS`;`KO JRAFёJNh U)ڀIW *щIHPFt+"`+ F+L"9+/+0; "6>`a;+W\c WyO8E+0+їP+rKrIh(F(oI(F ({(FmIF(kIfK@F$(gI "^K"cIh F(haI" F(c FYIF(?lZIQKHJh`dOKhWK`#]0 TIIK/!PFMNIRFNHG "oC##"#"F` F9`(?/ @I(?K"`$統=I-%'J#O1`9J`9Jp$$O4 O5 2IS"PFn ,J`+K,I *I (I &I ;h$J !$H#H(N!IQK%2%1tJ~%2JXG=& IIIII%2JJ.%2J6%2\Jj%2%0h6J%,J%,(I"(K2``p0&I&H!5-"H#Hb c\B\A#J1#<1K Blh#13h8hSh:h IHK$[h[ tI 3h#8h9( %2%0hJIIP%2\J%,KH!@~%,6I s(2H#`1Khk -Kh+P 0(h &Kx+ !!R#K`"L h(HK"`Kh+!nF h+^O3#`&KxCC L! h I h" ! O01e%,%2%0h%0d t -AFaM+h+j@_HF^I .]H\J x/)7>YI"F>2VNDV)ySN3hCSI2F>0OS3`ONPI2FOO>0Oc3`LN3h+f#3`;h+@HI"F GKP``BO;h+):hCK`"CK`CK`"Gw:"I>B:h#3`*(8Kh`KhI"F%-K<KAKS%1K%2%2%2KKZ%2%2%2KKfKvK%2KuI:">`sK8 `0spKh)ր0h(8h@ iK:"iI`>gK" fI:">bK"l!bI:">]K"`_I:">YK"`[I:">TK"!WI:">OK",!SI:">JK"EK"@K"!GI:">;K"!CI:">y6K"!/I:">o1K"!:I:">e8K"p8I:">\(K" "4Kh 3J`3Kh 3J`3Kh2Ho2Kh1Hi1Kh0Hc0Kh/H]/L/I"F>/.I0##`,L"F>%+I0##`)L"F>0 ##` /r%2\%2%2LPLPi1$Lv~64L %0hL%2p4%2|?%2L%2x%2lL%2t%2hLC%2dL%2`%22MIFF(F6I"F(F2 XL:L_JhI %-t HCh;C`+C hZ`xK[h+ ##@%-L! %H`  )Fz%-;\J! %/J! %/00)MF (I#`! !H!F hLDch;c`+ FB"p  KhXBXA0#hZ"`x (pB3 %-7Y9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+%/\L( K @0^"ed""f"HpG(? "de"%-%0\FHLMNO < <Kh2ùoF0F  <T< "*"F8F 4LPLL%-0!MFl`!F}!F}#SC@rp"CCI2C32""bOr$ !b#sCcl! 0#c%-PpMkh FB (h+ HH#x+Dq2;p@Hjp%-LK7nM0DKhIJ*xb Bl " FBjx ԝF H$ FhG 0) 5P%-pF,L-M1 x[@0FA$I F#k`p!I F#k`FPI F@I F0I F8I"FHH#!FN$M+4,B+! F!#!P%-ILLILX$%0iK1#Kh P%3pK"LXh!FK!F"@h(%2P%2%2Hp°#M "(h&F0 +M##p1빴B"#1y#0K "XhBpB*(h ";Kh( I0F~K`n#y#0#1%2HP%2P%3pJ0[ `pGP!m 6VN! 0TI TO,RI %&3h#0;h# 0O2!hF(ݽ0FL"0h!F( #xS+W+B+L08hObt O@ %Kh+(F +Kh+!!FE"F 1+0+к b"F!x @+|'84E x ^+ xh:`* hZ `piB (Ѽ%2@;%0d%2%-P%3p8F L hF F8)F (Рh )F(4P #KCBA@  F F@y! H@'y;+&!0h&)F0F蠱P0F?(F`H#y#P#qcyCcqhB`+x !;#B`+x{MMFAL#h;!+@NX#h"+"`.h0F#hD+y `;+O4NGNNNX3n;3f+2oB۳mZe "p9F 0{'I0 ` n; f+ oB ۋmZe!"p)hHX1! H1Fh#h3#`4Fj#h)FD#`0h `1FHx#h"+#H#`@߻ H1Fjh#h3#`(F%3tM;\pFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,M-CF9I(=7O ! FF6=! FF(9#p FF(Oy5["(FpFHFn4F`y! F4#h+L#h+H##`LAF F(FF)F?! Fpp F\F@y!nh(F#x!+ ` FJ!F!F8FxM%3t;\PM$L%F h\1Oa!JhF IhFFXNO"F@1hFD Fu0#u0 M#y`#y4BT<hD<3hiF8FN !hF#phF3PM%1MpF FFy[ FF(F pI0F FzF!F s$MNI"(hv (h1FI"(hI(h"<H Fp(*I(h("0!HX HO!( HK!( %0d@fN tx tyN%3x0!I$ K,3CL0F0 0KjK "hF FPP|B +! ]4BD)%3xP%0dHv!H,0@O%3x"%L&I h #I" h! h|?@ ! h|I" hH}0(3(H>H< I hI h" h!|I" h h%0d tx tyO$O*O-OD@fO0F(g=K>1vav-OF O0 >FO0>FnHnL8&2F! hah+F"  gI"OseK&&o hm Fh_H4F@F?i(F?fO9OFFFnn&FF'FFO2)FXF?PHO4i@F?G(F?D&F HF9FF6PD ùO2 AF>?HGPFAF n2 Iy F !l(4HE@F?(F? !l()F XFR DC BђD+FO2 m&HJ;O1(FC#OcC#_t")FXF( H6@FD?(F?tt:xuv vvv-CFHFF 0DHJ#&O2` Fo??" F ??4H&4F8C0H$CF-H:FdH;CJG@@p@BgGG/7!KBv)&C2Oc!FXC zs!J kD I, ,."H,H)FCV@d@pDtv K#vww.w=wDɦx-AF( (H% (F*A>$pCO !&,$ F>FHK[h;K"8F3F%oFBF(&FAF2F8FA6DѣZ H+ HJ8F!*FA1%4wJwRwc-OFx]-+@x(,FOO  FD(<012h+, F FPD0>]FHxKh# ]Oav!F ]!F2Fh  LFH)FaGpCO~H!Fk%P)F0F@0F,h+(F&0H Fh0B_г_г@O ! F H!F|H!FxkxxxxFF+ * *pGF xx B0 \ܱ3\ %FA%F/ 3A/ a,٣A( 3(FO0KOh`Z` KhK Kh3 K"`   F0%4%q%B<.|H! A y>8F|!D)FF{ F8Jh3`pG%58Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F8!0I"F`shu`+`hh!Fhp-hFJ@!hFrhFt%5lQzF@EKh# F@]O0%58F F@Kh+)F F8@8%5FFF1F(` +`#` 1F8F `(H1F `K!h0J1F(F_z 0FM FkhB F!!l` 0KhB!pG%5K!i Xii%5-A F xFx9 KF!a F M' J)j/`_J F)j/`_+hCE4F%5T -AFgNsjB$b/("#b #!xwb kc<#c{ou>؆(i*K(c"(Y2(ZН0b03c0sc#s#xCOs$0#0 0"0n(4K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo#K "_ K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕH%5&:%7 (IjF'LH%'Hz(1Т b0P+#b HjH"(#jK b`#j+ܿ##bűfHU0(nfn+ܿP#f0H( H=f H(@th%5z)z$z/z!z4f%K((8(  #&) 1((2 H]HHHHHHHH(#H(#Hl0p#Cp #%5|z<z?zBzEzHzKzNzQzTzW%5𵇰HNL@ 0`H#`K(FF_(H#`z#` HpHkHfHa aH]HXH  p(ĿK"ȿ`KHxKpHM(F+FH<(F+FH< |H{K(FzHx8F->L. (%{x-;۲L+JWVpQCFZx.+CF#X.`"`# o :FXI8HO1@yiF F(())H޿K[Mb)) H޿ K[M 1)HP)Ht5zz:zzB8FFF((F!8@չx ++!(F#x++4 F8@8 L H! * !% ! !#`%5t5BKhCCH@ `pG8"MFF  "!F "!F KhKpo FNF`8 "!F%5%q$ KhCJ Kh4@ӹI F@%qP%5FKhX@0x F@%5FF#XBXAKhH K! z%5-CFFFFr B??(H!C dO0 2??0 H!( (FBH!H)FE<,eT$oIGCH!DBLE4B<d-"F"Cz{ {${;{Uki KhB233BpG%B@8CMF+h3H! ,`8{i-O#N3h+!"OAq;hC 3S,S<B*[B\ dO DDOb8MFFBy۽8hhBѻO 2KEBъi10hv5I hYFPF %B@{~ JhRhBRiKhpGCpGO0FpG%B@;t-O`.3hBB !REB BikBDK "O`iBwthB2??ЛKh"BRi՘JRh*A jB B  =K(@`th^D#``#ai5%F`a C viGGvGh??ЎBw$D S#BBj AKi@"O :F3FiN??PkHYF O0r!REB*Fi,F2kBaKhhBJ``h#T````i```aCikBD(AhRBj3bi d `p````aeCKhSDCv?KihH>*DwO2`(%HYF (ZF Kh("$%r%q{%B@%4[%qT%L;x{Kh+{Kh(v*?siO 1)DhZFO dCv0+pKh+?? f%4%| KhsBC k@@@I@pGO0FpG%B@L#hO0!C#hAqD"kB2"cC 2A "%B@8L#h+Jha hO3#`L h=f##`8hC@3S Sh>Eli $ #S``=?0hB#+b6ki  (iv8h,@O3a=%K!F<`h@Ļ%B@%5Kh@@ipG%B@0F hDHh8#hBC!B 0ZR@hBQT20BS -OF1MȀ$Đw?[+K!F(FZB"O\b+B..+A0; + O O ! ;HF!  >B@F!  5K;+#c+$2x0: ($$%BL%CL{{pFFxM)h! FhlhM)hY6H1F r 5 F@hnkh "` p 5{FFFFرK1A?+x2*+!kxcxSn!(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##%BL I=HFH H H H ,MNO#x+KуKH!4!!8!!FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p%BLKpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF %BLFI I F I Fh Kh+ I F8   %C%C%qFI I F I Fh Kh+ I F8   %C%C$%qJ пò\pG%BL(FIHyH( @F0ӲHJ !>H#FT!p ! FpH#FX!(Os4$(FK!F"p|%C|%BLFIU8I FP8  %C,@DcB ѡ"c+ !@%cXBXApG pG pG*-A FF F|FF<`@0FrF(F ȹ(F2F0FO1 J)F((F( $$$%CFHFHI*FSFI"0FLFxHI*FCF*F0F I@:I*F6F8F<, FZjri8FHkFpI F똱 I Fp F8@}(F8@ (8v-O F F2F(L( pCO5I F,F FpD+%C%5xsL8xhFK (h2DBF(F8 83D 8 8x[ p;B8[x+hF+ 8%C%5xpLXB"8^]k. KO2b 8B x@ p 0F%C+ K8x %C8 L#x%X8O2pKb 8 %C+ pFM F(F@sBD p(+BB KO2bh@ xU;;;%C+ 7F`% xX!*F F (0K$ `pG%C-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@FPch@F0; F;LFh1F(#h`%q@FF"FFpGL$XKjB"!F$8"a%C+ K-OƲhFL8(h+Z($8+Z!](b*O(h088#h88+;#8H1FO +"+(F +08Y#DB0(h((7 #80&9(.ѠxJ!kBA(F(F(C+tz#=)pXde(#48&#48(؜#48f#488x8x +#488B< + 8Br< +?m:7#488Z#488x+?R#48J#48#48!#48 8#488B< +8B(< +#8B< +#48n#488x + 8x +8x#8$h#48V;%CL%C%L+ Khj*(b(5 /FB RFHFAF(ѵ`N"HAFxhH8x+?48(@΀8 ;#88C08xF EyKEFEF-q8)/ sH#48H!8FFD8x+F )cIdN405!FE)oѺ*0xxFBшEFO x O Eث.F (ЈEFٺ ERF0Fv( 1D!6E F@+; +p; +R#[YYYYYYY-= +R#YYYGYYYY7+E+Z/+ѫiFl#+biip@Rhq`p@ #x%F4++ ++L h;+x #`(F `Ax"kixp@x"ki@xKh+p@ Xx!+hj; FhbKh+ohjIHp@Kh+b I Kh.YF(:1FHp@̽%L0%5 %4zpFKFFX`0F)F Fp@%L0NKMi@4@F/#s`c(Frj(Fm Hi, , K!F`@|HZH%L0v\$%LPS^p+LhH7#c`*h&H6hZ$H0h"H*h^ H$hHhHN%h A+F2F!5-ѣh HK"`pL##L H H%L0(3?KU`fn%L;r#!Kh@+<KXhi8 pG%L0COppGKiFH]?Qq!F KhD```%L0Kph\#xK%;.FM%B p]&>#x5 %A!F VJ#`hD` `Fh%L0DF F-G#_Le&-]O`]Kh3s[;`O ch 0 C QKhO0*#hOGo ( jP @Kh0kP6Khܠ0  1+^[ 8#@ch7+?OCOS#;+?Je(EjH")F @ (? hFP0I#" f0+?8e&#+rzJ`2*s0sKh I"!`i#+riJ`2*s0"!`i]2*s#"#YKh+ 2*s "2*s"##"JK"FhyGK"Fh2*s#"#h=Kh+*2*s$ 2*s"##M"!2*s0=(Kh+"!j$Kh  5F #+r;`Kh+ "8hFG#+r;` "8hFU e %4>p%q%qh%q82N*s#"##3`e#i+#c #e+rd;Ck+d#"##ck`i()p )p)#i+ yKh?SqHwnKh+ #}"l hK`blgK`lgK`(?mx bKhC`2*s##"#YKhCB`h`2*s#"#g)ai {8hCsh&LCC`2*s#"#Fai Z`h&s#CsFPBPA d+K.Hh`*K"dh`)Kbdh`d(Kh+@?&J &Ih#Kh+@5 ۭN0hrIFH.0hHIFJ#I h"ZKh! Z0H! %q[%5%N8%q%p%qyx%4+8v!+D^%4L2*s#"#`i(?{H0r2H*sKK H!2*s#"#`i(?J2H*sKK2*s#"#`i FFH2*s#"#`i FFHv0F( ???Kh2*s#"#`iC(?H!L?|Kh0F0F;0F#&abE-F(?1F"#a#hIF fKhKfJfHgIh.F0F޻dH!`IF F( -e& %P -??.O1(F!t#QIF> F(u - -?p(F.]#FIF F(^ - -?YB(F_R3Kh+9IF% F(B - -.%(FF(6&J% &I(Ph`.%#(IFx2*s%K`%JhBOvvcai[`K"` h+߿Khs[#Yyzhy%q%5PS%4+D^%qd%N8%L%5x2*sK`Jcih Dh+߿Khs[#K"`K`chi+?ϩ|0F I#"(F+¹Kh+?#c%qd%N8%5x*%qKh0pG%CL8FF ^$r!F(F8-OFFFFhD%FG E[եB< +5#+p-PF>2F!F3($B!+JhZBB8FZB,<++*)HF,FBFIF2(FxQHF9HF:FIFEK# %CLhZ`F`XxpG-GFIE6?h +43pF#xp+3pc!B" *+*F`xETDFhEEF=?0F+;M&FpF FFR ! 98+hD`4D(``` pO0-MF'O O $ò0 *+pO `& |4O07F e 00;+ (ݝ0;+ A-@,A, Kh+B C Kh+C B 0m+KhB# K"`%q<%50%L-AFFFO d +2F5B$hxxBI)]Xx](g(B 5=`@(/+ '%@,A,,e  Kh+ C B Kh+C B K!h;B# 4K"`D( [d(f(Ѧ縱Zxg*F;+xF0*/*r32i %q<%50%LL h`hhh@%L| FFH(ڽ@!Hp%L| FFH(ڽ@!H\%L-GFWKh''8F9F\)FyF(FzO7!0F9F(#"(F?? F92F!F(F$F(FVOsKEE F9S  #xCcxM+ѣx++xG+ <<+1F FuHEFFQF8F똹shxG#x+4:+F;+!6;\pC HiFH9Kh+ O#HiF,OsB , FiF H??iFH[%p%G-G FFFF F(`FDo`':FkhB@*@nB 2FAF Fb s"D4#x!F ##pkhFB!.KxF B +khFBkhFB '.Kxp4kh'Bӽ"+@+A8F FahkhB F+*ЃB 8FT! hIAhF)*ЃB pGB98,*ЃBpGpFFh(F!F0Fp@{p0!LhFT2?? hiFJf hoFh h h3F(F h!T##`K  0%5%LKhSL h8G h@%p%5L h! h%5O1pGCѽ@K0FI, Fx(#Kh"H!Ma( D(O( A(!(Fd( o(Oq FK`Kh+0 ! FHM#"(`#??(h`O3+`H%4p-OF$0B"t0F0F " HF(HFKHFa 1@FVF@FwF`@FO3{F(@%F&I FXI F0 F Fع%FI F( &&Kh+f(ct(_ЃH (F K&iyI(F O3&sI(F O3&(FFxqHq9fCF9F F(Fv( Fg`Kh@F&Z(]H Y(~FvLKHF9F@F'FIIFHK1F"`lEK`EKhBSCN"CKh3h 5I(F"h (F@3K 7Kh(iO@Q3h#/KI F"`舱I F` Fw(K"FFh(F8$Kh  F8 KhHFQF F??Fd0s7%5yxv%qK%L[%4%5%r%p%4%4%5 %N8+8%q %|%5.,F|FбFXDZEF, *F I"^0:!0JE!Fp.,@.KhN%5Ki0H!* @H%Luv-AFO FF.@F=F\ @F(ѽ;hѠF%|KF"h%5@K" `@%5KFO2h%5K" `%58F$ FF@HB F8@ 8pF9 FrF FzF Fh.ep@ )"!0F(pO2!(F|(FFF FA F1F| F8}(Fa0F8wB 8F -GF!F$'FFhF!FhFEF8G0F %FF)F/F@F8@F('FPF80 M8F)hH+hB0F Fk8FG%5KhF > F@U%5F xpG%*Zx%*33s*0@0pGL#h#H ` hK#`%L-G!Fd Od O FFsh;s`+ 0F$ (F'#8F#p3hZ2`x - 2BOI !HF|9FFu8FGF8@F[CHHK(Fm-AF!DSK"xxBFI4F#x##8F3p xBcxB4;;>FFF#x+5*FAF Fl,D;;+@+A-OF8&F'FF,K,JFq%!8FFF/3'p-x7BxB&-tKJ(/D&O 6 F`!(FKJ)FxC KxF0F9FL FIFu\,D0;F+@+AFHF FF0I F@g8FF(F!D4 F KJ!F;FF`(F8I0FF0F8 F~<8ɚ-AFFF %(Fx+F0F!D4 F8F( K!F JCF$/!(F((F8p;jFH!F"@-AFЀF4F%?s!hFF?C(F#p#+ %+ѧBcx%+#KhB cx#+HzD<#+5<%+#+ѷBrx#*F Fux FZD%+ ѷB rx%*Jh,#*;,%*%5%5-CŰF E$#"(FR??Or(F1F(p5lB,Կ  0K)`()F4*F!_0+F F8*F0F8F(4%CL%q-A08KhF+]6Kx*F,F(Q2H$FA0K(F@FF FDq6!(F'%K)F$Jx$KxCFF8F8ISE0F0D߹I"F"0FVF0F84_8FPF8F+x[(F8' F:FAF F,F8%4v+A+@.FKh#R! F3F!FJF(FcF^)FFF F4F88F8(F8 F$%46F I`I F8I F@  vyxmF iF F0 F m@zhFw mHK-OFhFF3EKhO0BH=FбFxFF3|*-* F(Fx(F 9H!7I F($C FF(FFXFQFD4 F+*F[F!FFXF8VPFqFPF8O-й *е@ "c FP((F(O3H;`F F2P H<`(F<F(F#x+ F8%q\%4C:v*K-AFh F.IO0%HF(?(!H1FA(FF FF8F.F(F*F0F&DD4!D F!F+F:FFn0F8(F8@FF@F8, FA%4isiFh( p@CXBXA'] 0FL#hx(F!0Q)FFuI Fu iF(F<((FF F'0$hpCO(F!*0,)FFuI$%q.@.PFP((#" F#pKFh FiFK!6BBK!6BBѴ??BA &p  %5%L%LHpG8FN DB F,C/*FFO`4KhB Cн@ %q K$BB Kh@ӹ@%L%q8Kh 8$??oF?? FBB   %BDX g1@)p4 Kh"`(pG%L-OBO;h+$AKh+y$%F&FPF܀@󥀸EFDF(F!FJ00hC׀??@ЀzKh+@ˀyKyJhhC@Ā#0 ?? 'qKh+PpK(FpIh hB@rB)!O1!FE(F!FWF F/|0XKh;BBB (F!FO CaoBBu(F!F10L'O kHKhCF(^DKh+(AKh+@H>(F!FF?? FQ!Fa(G!FZ(@"K h9Q(?7PF??%Kh+! ( "! OP# 08K hC K"O0`OJ[4%50%q%4%p%q%p%p%M%BD%q`.|%q%L KiS Kh( Kh+Kh8pG pGBppG%L%q%q%50-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhABOpu1 FO3*F#F&"KhCѹF (F!F8F?? FѸOEAO0Gae(F!F .F%50%q%p%M%q`-OFFFd'p  X FO^oF?? F>!KhùOK h9 (#"F@F+F*FLO yF F (on??0$%FF F%BD%50%|-AF FFNF?? F &AO0<C*F#F8Fh8 MFF+hB(hBԿ  8??4%50K(FFhB pG.K(FFPhB pG.F @F޿8F(M+hB F(`#IS``#hB Jhh;`7h7 F8@7Zi:Zah8%5.%MKhpG%M-AF F"@FDE/8F78! F0F`0F #BEF#wa#a 3+h 5`\`ki,`3ca#hCE'J Fh3`>h8F0FF@FB8F7 F@F70F\`$hZi2Zah%M.hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7Jec8@kpG-OF FgFF8й5`O #!2F1@F;FIF\F-Ѐ= !FO??# ZF0QF#F(F@F x#"(F2QF;F2F1FXF(> \F< * -O FF  ?? O5,F(F!F Kh+sѮK(FIh hBEr) O1!!F(F!FF F(F!Fy(ѡNFF3h KB (MHFAF\SHFAFOFZFFBw>DF (f 8CBCA$O5,Fp .q@FF F +H{Kh.I&TN(wKhCѝ8I90m:F3FF6G(iKh{ к  6G ( ( 6:gw ҉#(е  7F euTSRKh;TK` j 0F"+9F!)HFAF_( BKhkXT FFHFAF=Kh+?+?: ( (0n O .# K`0F" dñ0̮ (0K'"`F F>FJh? `u . .*F F ( ( ( (F F'%p%M%BD%|%N8%q`%qx%qh%q%q?? `u+ Kh[ . . +F FF# 0W]%qx7F F-pKh*Կ""#(F!F#20"%N8-OFFzO3 Kh+ўKhAEOpz) FO3RFKFKhC1j(яKh97Frp , ,шLj#h` ( (0~L#hR (NK@g(SO8FT# CF?vfKhofE (4F @p]KhC@\Kzh+| exn0K`8FmIF II h)&HK" V`#F"h(,:Kh+?"T F F 4I h) / /)v ( (4E ( h (4E4E (LEu /^FFST??{KhC / / +FFNEu C# V# # T"%p%M%q`%q%|%N8%qx%q??pF F!iB ( (< K NT6C+F#3#F F Fv 6 . FF! 0FRKh+} O(F!FF0KH!O< FoF??FFELEuA>O;h;BTO0 khI "3k`#`"QF툹:FOa(8FZh MqI",nI"z8!h!hg hI"l(@Fk=.-!.*<.Ц ^+)#` 0ZH>.Zx=*ј+&Zx=*ј-& "FFELIMHZx=*ј!JJ 3F<.T+.W-.[ki"=.kiYКB""*?x(?uFFF; +L#+ѓ+<\+# p3x+ *=!0F0F(SІBQ,+*M  Jx(f!hkiBԿ""kiB̿""kiB""JBJAH@Ե%M?Qv~<z.!B!F43x +=+ !h"0FCx=+:I;H!h !!F !!F3x + !h0FFxFFk . .#0#hhhFHIFHOd IHIFB3(PF`x*!h_i!hx(?:!!FOz4dUK!B(¿Z`i`D`pG%M K T@ wYc%M JF XB0(O0pG1xF JhBJhZBJhBKh%=%=%=%=-C!LOH8F6!F8F6F6@0F6| (hBF0F O(FIFHF6fh6c ep%M FO FF0BhU;iC$`(%M 8FJi]a FFF F8@P%M JFhp`e  Z  O0pG%q$8Kh+Lm!`P M 80 L (8"!"!%q%M zgHLK0HK0!O`!`O`Oc0 aHH H H H#0o%M T%M%M%M%M%M(  pGK8pG%M 8#Lca#F0biaB$H%`U8 :UU@UPQ H} Hz Hw HtP8hT#iiC"Pi3%M %M%M%M%M%M-CF, F0+3FF>J0hC*0+8F1F5Q[ #jFhFrF2N%3hBOnF%BQ! <,K `'>F F)Ff%KOb!0+ L!M +hB! K!0??ЍBt I!BAJOq+ $! 5 @Q5%q%q0%M %q,%q%q`KhKhKh+Kh3pG%q`%q,%q%q0p LeiiBcia0#`p#iS%0+h0FY]5%M (F FF0@77Kh#F(bO4 F1Kh (A(: F,Ni($$+2io@G;D)FR#8iD3iS'D(F3(гi (F,'хBJhABJhBJhD$(!F0F2iC;)FR#t(СKho%CL%M %=%=%=%=-OLvF FF0??)1+@Ae#1ih+@O1wFiPF+ÿC!i3#ȿQ#0)F:F%)^s8F1FOG(HCD2??вBADv#1-%O kKh+oѸ| O  1B 82??08v+xHFFFEr 1Bs SKh 1C1+#1F!O HDN #C ZE  Ѣ1+\1+ј ! "v/  "S#h(F  Y/KhDE F0"!]60B#H& ")F-H_2BZF#aiBܣiN a0 1PBl1h" =}h\T!iQ"2A#3%M %q%q%5x%M%qD-AFF FFKh+ 8")Fg( Kh0D(FKhDB %q%M %5x8FF*F#FOHq8 8-AF MF$x$1B  2F;F $4%N< O?h/ # F!O8 %qKi(!h,!pG%M K(!a,!`pG%M (FKl8  %M (F HK!FV8  %M ( ! #3` Ch F) h\) \B\A` h+J\B[$)3`\+#C`O3` F( F(vI9$%Ph%|-CF=TF FFF??.0B#p JCc`Kx8HHxv%qH%qD|08(H!K"`pG%4(Kh pG%q<0L#h+% `%q80 L#h+HiF#V##`%q00 L#h+HiF#@##`%q,0 Khs Kh[??ѽ@%q %5(0 x J^+pKxp]KxEiFH?p()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKh`H%q%q^3MS(0Z09$?+GK`0R++D+++BHiF0e *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piF%qpKhSKh+Kh(Կ  pG pG%q|%q%qKh(KJhhDpG%q%50%qFxFFEHiF,F F!D8`FO!xi;hK\)cxS4;;$)#+p.0F(%qLxBh+h FHJ*!>H]*!JH4%pLIF Fb F%p(hS  pG(h ЀipGHpGr#o(C HxKl8 pG%pKliFHH]%pFh FFx-+0''x0; +,##`O0- HiF "1F(,-H ##`/@B-OFpNlȱh+ +Ci G#d Bl"iF ` FFx*\x-(W/$( (٠ ۲)F(+(#3e3#F F(#x++Dġ3`s F39(/(z$ 0 Fa O O F F,F,HVn(0+Xx-(3+(@3% FO@!a O O xF=*ూh**5H=J3h;+"F23+'H'H2U`ci!F G,n6[ 2-ѻ;#;#[xd0x +iRF (x+"QF%%p(a%p%5 𵇰@#@FF FwHW-hY qH煹 nHoqAx  h;+@e_bi*@h+5F-bi--l!i h[ `*`%h.gУh`*M%1[ `*C%-bi- ->!i h;#;#[1;#;#[+1H!l---!bi+#i`#`bi%H!Rbi* Gbi*- Gy-vh+ӱ#ih+H!#i!h3T# +#iih!+-tv#iihK"`l&%LFhFF xF0; +#O F xF10:ײ / "+.`<##`,##`O0.HiF+ܿ3 PC3KhKh(   pG%q%p H< K"` L#x#i h`h!ciFG$4A%p2FHx FpGBЁh ;B$02-O$,M#FF'FF*xb+A#`O XFnh~$5O 1hRF@Fv, A8(ټ- IEIE 0h7FRF#F@DBDAhպvhO # `+?h`2H((ĿK`? pGZKhYHVK" "`"SKhBQKhoo ]WGI# `GKhBIO3 2 13BKhBKh+AKh:K1+2!.0 :J&0h"oO213KxB ,JohC`&K"`+Jh**ZJ#`!Kh{X 13 1+ J 1(h+?eh#+?_O0| KhB?w(K"!ool%q%q%%|%P%qT?%BD?%qH!%qhFh]Fh3F(F4F0F0!D4 FJ+F!FFz8FiF3(I"FHH%r-CFtF#F:FD:F#F(DeEu&IBBA4!!@#d#"F]7L3EE0B@! K2#JKXChFv]bMB@K IhT "FXh`BK"`?%r%LFK\`?K$""$]pG%r8FM K*hB+h FZ*`p"K$8?%v%rKshK"`pND FFB-4Z4(F%|%L%rD(-CFFFIB`@H Oy#0JF3FF0F FR `F=-8F-#<!Fo˿-AFDppFF# 09F#F -(-0F-",!Fo-OFF FO O O :F;0 )٣a)أWB6#4#FZCK A)أ7 O1O0-OFFFO O %BF;0 )٣a)أWB't$F C5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWB"7-"4FC5CA)أ7 O0-AF F$x F%(_^4;FXxn(+c(/d(%(Ns(x("Uk3FF ;CF "U iFhFzhFD #jFx FFF (CFFFFF fO`29F0F(FK FHEK"$%r ( Ђ*KAս@8o!JpF 4 F3 4]@)F F]p@ ǽKh [O`K)F FhEDHKhR K44DhBp@޿"K`k%r%qP%=? %=%5x%LKJo]z7F F0)F F0@KxJ)FJF FN0?8F F)F F/F Kh+޿K"`Q, F8 3%5x%LF'KQFFh+!Щ! "K!Fh!K:h"[ CBF4F0F2&H!)O4)l!wF ##F!FFB $(h >(h2.` F(F2%q%(%4Fh $ h2##`@ pG-OFFF(V_MFD PKPDE pO3`+`&F"#FQF xѢA 2ҲEшBЙE!13B ,`3`#s`k`#KV#U# B 3+4+!F:9 "B"6  :  +!`p F9/ۘE3B#s!``) F#q  /F"@ E"\E"@ F"23F*F%qHpGB Kh8p@Kh8KhpGKh8%50%w KpFh F K.2hOؿ"F4CTp%50%w Kp FhFKJ)hOOؿ#DD!Dؿ"ep%50%w K!hK"rhF%50%w Kph4Bp Kh#BO0ROVhBpXp3%w %50 KhB B32D*t0 %w K h9%50K)phڋK$O6h9K&h<U1 [h??1` U1 [h??#pB1D%w %50NM2hkhB#,hhF! F2.!0h3hk`F(`^??S;D3B`p %50%w K(h( BF8pG%50F"YxX:)ء.)F?)\)љx)И2*pG:pGFpGpF( M+hFBF(1F(4"FnD*`"Up%wHr#8F M??,+h;Bܽ8@4 Fy8%50 #jFhF] "iFhF]8Fx FP+ b;۲+DB"cxj+B+ b+#+`m+ t+ 4(` F8oO0oKhK%q8HKMhK;* F F p M(`ph`p`8v%p%wv|?4-CFMx..`;'#xC+hBГHH :+8 %+'.+𪀍0 p?+ \+cx+𜀍0F# 0#VxF ظK ظBۀD FFtL,S(!   "=                !!!!!!!    !!" "  "_    "e(hB  X@0 9Kh+4=6Kh5Il83Kh+?sC -Kh+?g??]0(Կ  4(KhZ???Ay)p9C?5m)p.HC(a~(!Kh%w%wz%N8%5v%q%5#HBF6?tS(%I!$$U$i!!!!!$!!!%!!!%_!!!!!!!!!!!!!###!$_$w!$!!$$!!$!!%I#!!!%m)h"B Fр+`"p??, #rCjKh)pfKhfK hE9`;1@??TQ! n9`T)pNK9LJhhLKhKKhsHKhnEKhgF@F1hk;KhZeQ5J@*s)p9`B(wsFF??F F+rHFAF\+FQ F?{J@*sqF F5 9 ()"" Hw HuKh,(tQ%N8%q%50%4%5gKh8?4 Kh Khd -U K KXhXK"`%q%p%w?4%5Kh ?4FhhH %i-5`FBrh,gBr- FF FFBrDh,`%FBrۄh, (F`h h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h1# Fc`@pFDhcBv! p0!F0Fk#3kh&``[`l`ch0 hYa` p&,`-AFFF Fi&K`h%K``@h(< `F/B$#J`hXBXA@KBF1F`#F(F( `h1V#c`(FA )F``n:F!1(#1;e`O0%q%(-AFh F^ iBp 3BqڰjBrh"jE~/ۚBj2EEW## MFŔfF!BA۲hjB!BABPBEhC!EEP8Fhp`Fa `a`#ka.`Ɣ)hѹia3iS BB8F3i`F` a`5aKi+ hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAxKhXhq@ h8 %(-C F FlT# Q@r!E#hbhYBѱEZGs2CB2AiF@FEchZGs2  4%@-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fl3hBB4 0"#2"F( F%(K""`ZapG%(FKh /Mj>#bKh$b FM??7 FWd4;h;BO$%L%(%A%502K-Og??W-J h,KhQh #Oܹ&Kh %,F0;B(C2O FF??F@FSEs ۰??ЏBv XFQF F%DF%A%L%50pFh\ KDD  p`1 F14F%(H%@8F L 58@ $i!8@Hj[ b%(H%h8F Fy 8H"F+Fd(2BA %h-O FF #K2h KhKh_!FXFKhFKhBOrr 3OxF@FYF F??+: #?? 3^F%F # Kh@ #?? 8J՜BF{MںK4+Hȿ4XF!FĿ34B!SFF3H??K8+:_F??F33SF??F'6se  B s 6 ),SFF;H8FLFO FPFIF'GFEKhk-mBoRFKF@FXF!F(@6Kh39KhS 6Kh 55K5Jhh+l4I h)k+F*F1Kh+E)FFF 20FFKm-O(lH#"!2b(Zz KpV+JEE%5x%50%q%q %q%|%q%q%(%p%p%q%qE*)+А)&hb"!HLE{ iH00VFMFFLF!??ЌB{ #B{p-i-l ; +TKh+ KpV 2F(X+H!*E%XFBJ[!F`R#` Kv##FEvXF!FS(PO Ku##FEu ڱE+K `"*K` 5E0T0Q5 # 7+!+! JFWCH7_FFR#` Kv8FAFEvکEO7F7x5FFO3%h%p%N8%L8F F H*F#F(2Bu(F!F8Ti%h8F F H*F#F(#Bu(F!F8S\hB5FF%hFF#;`'Kh&J2??NEt ۵??0ЖBu,F FHp F FHx(е??2BAڀj(/#;` Kh++Kj+Op%q`%@%p%(pFF +xKm,K"eK`p%i F F0T,F! #2F)F3F`a#( Fp@0<Km#a%(%LKm8  %(-OFKFF Fk[k(?aOEFr+F FCۨF& B3ѯK!??߀??ˀEy-&JKhC IyFF'F??LJFYF6( #@F F6F O8$ B|XE| 򹀌BuՀKhCBOpùeFFF ??ЋBx BFBu^ڑFFsKh&F&A&oF&F # #JF(F!F# [F(bJ 2 ??𛀊BsWJ2??ЗBz/zPF9Fh#PFF9FF?? FeEKcZcT BpY}F'FRv??$Bu84KhCBOru1eF,KhC IyBuOvFڜBueFeFFO WFUFTFeFF8O WFUFTF2FFBO WFUFTF0F+ F ѸYKh8@FqVKhF9f#FF F4??06B7O4%FEfF??FF(Ѻ?W8Kh+7Kh 8H!C,FF F??Ѹ&4F5F0FF F FO;#O2)FO3LFx#h+Kh+? { ?? ZF#h+ Kh+?BAE %("%p%q`%q%50%qA InJhC`Kh@ջ:}%|%q IVJhC`Kh@:%|%q < I8 J!FhC`5Kh@:%|%qFбI KI h+!I ! I@ F !F ! !F !F:%4::}:-K-Ah,SСO`'! D(F)F )F h!ZI  zK"`bNM/h3hCE+hB +hJ3s[`I K"` Kh#A %|:%L%5x%50%4%qX-CFKFFhHF4)FFFHFp3+] +@F9F# %-A!F FFF0F !D1F`m#wa F(F!Dn)Fam 8 M,hB K""`8#hS``0i0 F0?@%-OFYMMhWI$F0o.RLPF#` F2FOa8FFx0F2h++hHF#`#c` M;x!+BF9FPFP(0 + +XFFx+F )!pwx+!FyFHFFkh`C``hh`3`ZZxx^*3FaEм ,$*O3!!pF\2])!pCx0a+[+\+TѐL[40 p!F3)K)J,Ihh[)ѣ.ɲ)GFcpFDF]cE 04FKJIhhFE0; F;n0 # p!F\BpF pB#0 pnpF%%OoPPVJ FpFhF F+""p0 JIHh hFd4 F"F)Fp@ *26@X%%Px-GF>K I  %I CF FxJFAF0Fp1U(V1K1Fh0Kh/I"F+F {,\,ZxU38Zpx[,[$[%x[,[,ؤ./ * [-<[+%F], Zp3--[-,B 8, e `O\)O: `,,2 `48H8 \ px0ҲH@hBjKhJjIhhB ,,8)P8 xp8)Q8\!p )YKXJ[Ihhm;+I+#0'p+"w+Mi+1h8)x+?o310\i28)DKBJGIhhWO #089389H 8 "8 Fh"+,/K-J3Ihh-89@;891h48I8)x S38)x T"4pBKJ"Ihh 310X28) )Q8x+ FKh [Or@ a F0?8IMxkjiSaԹ#xF%%%TZSISlSTT>%xjiSa1h;+?Z1 R;+ F(miMhQhaOp #haF@30 \+чKJIhh 8"HF)F\0KJIhh X8"AFK2hx0#320[ # FF.Fh ! {ljKkJmIhhZ # FF.AЅB`KaJdIhhFcKh+1#T3 c hxѹ1hF;+?Z1 R;+}+?JKJJPIhh*h3`*` "!F%,"!(F.v0+F#cU5 c ( x* !.`F"U! {(h, !.RF x ( )h xT JD *hBD*`!TOH  +!Q JF @ )hBFPD(0@ x ]%%TTTU,U_-G^$N!FO|`V[p4,Kh+ XCK`Kh0K`h;hHF:hi(FUF.%%%X% % %%U8F F#`KTh``8@F "B`FJQh`CKS`@KphNmh (F(h1FVF(Ch;C`+ ڵC !F Fp phZ`x Ff%-AFSLFF"j*8*\%(Fcj.3`bZh*hFIcjb h CIzh%#c%bh!?J@H>M(>Ikcj%c%hcej9F@F|Fj3b+ј #*ј n*a.j @3`cjjhcbjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?jpj3b.#p"ceBp%V%VLmchh Ch;C`+ڵCСm hZ`x@ %-OFL Fm#hhkchI zKJeX3eK"c#f#cfLMmCh;C`+ڵBСmbImmCF@"k IzhZ`xmHE p` (;е4p0۱~H}I k뀱zI kXyHp4rH $#p0p4m@@Eе mH!k(F#egHp##fbn#hڹ[h#`#h+hch c+(!k ZK F ZIZKzT#cfchxObOHpahMHObo"k NIz$Khh+5h.I"FF z$ #*hsCX+6h!;h@hdI@hjF(OR#F!hFfF F;h!hFJ 3 ]% %%@sFMF(h#I z`+i" ``h libF2H( h^IF z p % WJP-CFALAO2DF[ij2B AjbiDba"p&--\-Jx8h 0@0՘ \*&*Fij2B AjbiDba[i2aAF!"iOR Jh????Эij2*DB aj)DbiDba"iFJDQh*F1Di*DF+D% XFBhFAiF*DFSBAAai a `/*F1F#c`D2D"e`ZU-OJ#L`H!3#cKh-a#d. hBh+@ak!k@h(逫h h)@YhKhB@途Kh`.0+-hh*̀3h+@𓀋KhrhB)#B`+~=;>+R#ja_s_s_s_s_s_sb_s_sbQbk_s_s_s_s_sd_se3_s_s_s_s_s_s_s_s_s_s_s_s_s_s_s_sahab-_s_sbCbab{_s_sb_sd_se eeehy_s_shhi+_sh+ bk"!kph38 +:KphhxBxA0hh)DQh2JhB>`+S"`"d2+)KBhhB?0 )+#d*h+bk2F!k@h0+(?# +K@hhpBpA(lbhB! hYCZd& `fh #"h!sC(i6Px``f`%% %<%#! 1h˹K(ihKkhC ѠM!bk k+hk)h F1zl+M(k+ek5&kj !0F#cA0FbcBe#H)#IH""## H#IH"#{K(ihFu#kwOck:hyKB<#03 uHPxC0s# oI  (ѽ*0+0"!&C06B9hbH9h$ 9h ;h[+[KhLh+Fh.iVI"FF z -5FP "!x O$ GK6hB9hAH9h$ |9h &xCDXF-FXF-6Kh2FB9h&/H%KBF!VDh XF-BF(H|&K9hhFBHVF!K6!I K8h JO hB9h&Hf  K+IhxSE^D%%%<ج%\@thz%@@x(WdWWh BrKkhC qN!bk k3hfk1h jH! #cCeIcH#"aH!(5k+0ZN!bk k3h8k+?%1h k+ x !28F<F8kcc#c!bk8F0k# .?ccc:KkhC 8M!bk k+hk)h lWlbhB! hYCZd `fh "#h!rCki'khjiRhB i "K`"K"Ihzrck9FHF#F(#aFkibk/к#i @̀#i!kH[hz#!ki8Fj#ihZ9D#%%%<ج%%Wn%$O  hhBB вH#9FRhki8Fj^#i!BBODO h_ڣN H 00<Ϩ H<jaki[hcO!rk0k;hk9h oih(Y!Jh C`Br}H9D#"#iO S2ADh"9FHF#F(hR9FiH_`BB2A#Dh "#9FHF( !k+;i3Or@ a8a0kihQI y^ki iskBki"JIi(?h+?y#`miDk+pki3 (iOr@ aha0*i hickB4I"hi(?Q"m"0I#0H/N 0 <Ϯ 0<6Ɯ$k+ 4?J&kh*f3xp(p71B*#"1F!3x0; 2DB%$% %ج %\%< #"1Hv#"H"! R BE 0F7BF$ !H (U1S 0D|0 h0<ǜΨ H<h x0h0KIhKhp%t%߂%% Kh#"I#Hh`~{) Rih% %\pF FO6Bp#~w+{+s+ciiB(cih I ycia$h`iC"ifa!h`i-CFFFF ,}FBI y#`@Kh`O>I8F \`lX.U(FC-iZh`B GFFFg`F;!+!У<Ѳ) *=<h(I*F yC`hYChChC:+h+ ;x+Ч`#0hBC`.ch+f`:!HFhF(#;0B+  HF a%WW8F!Khı`h )F(7h+4 *3!K"i0SBSA3h(F8K"i0B##K"i0BԿ## K"i0B̿##K"i0B##$h%&:"0FMFI*F yiF p0 I yObiF F F M0W K : * B² *I QppGX I0;0+ B0Z "ppG1 ֽ 2L!FXh!+O#w#|+##t|+#t#~+##vc}+#cu+#wc~+#cv}+#u#+##wc+#cw~+#v#}+##u#h#Oc# C SC#`ch#pCc`h#\SC0c`K@"FCsC`@%KphkiAK4( t fx.($x hp|p~pqY}p, F F ɲv!ҲZu"&X%Kp@q`hA`B\`L$heiDd&x . dx<" pB`Z`%Zh"Z`A`p%&X-A4L#hZi5#2JhҹkC#h.J![ikMD,N%,O3hB-%Kh#"hRi( "J!M.#"hRi, J!M$#"hRi40~HA ػ#h[im)FPTh J!M#h! J5[iM9F@Fn+&X%mA%XW8FH`3I  I0"FhHTJHOqM, F8 !(F(#p+x3,IH,LXW%WsX%H( rF"Hx?+Cx۱0MFN! FPR0 Fp/!D Fv(ЀhFS+ !F0F F!F(F2h.#`! y86XWIFH @X6XKD |<0BєB4KFIHKh[i1cxB [x;IH@K,IH,؄@I@F H,I H"F I@H%KXX&XXXXXXXrIFHx YpX7F F"` F#xx<#`O00h"+@0O0 FF*hiF F0I"F yYp<#MU#@BFi3XB0D1DBȿ"0 I"d / J#IOp Ќ%Q%o  I H 0 I"d  J#IOpЌ%% L h( h"O1~ & FN0h)q? @O!PO0$ h"F|Ad)h0h;F"(F F&# `pG# `pG# `pG `pG-AF FFF@0B̿iOiĿ 0ȿB-$KBiC#S)Ѵ0iB"-aҲw*b1ʲI7,﹣k۱2F)F FG0BiAKB(1x"+ Ii78FiF0FB[.-OF`iF8C@+Y(e FFF !^ Fi/GO2AFZFB# iCP0 DBȿ81ѓB3ゴ0DB)ڴPB*OFB*#-GEcڣj:F FGFSF! FAFZFBz;x+{FFB+F%uGE)#%0BѴ0+K2Fi9FB"iF8|02FKDiYKiOi )[hSX:F)F FSF5_FF[!pFFF:F0F6*FIF Fp@[;F)G 6:F=!JOq5;##Di@J@ JOqJ@IHHXJ3K@ FOqJ2J@h IKOqF%T%R%S%QЌ%o%nZF)K159A#JOq5;##Di@tJOqJ@IHXJ3K@ FOqJ2J@J@K!h+ ""KOqF%|%|&yЌ&&%2%F )N#'=AEhOq"K:""Di@J@ JOqJ@ JOqJ@IHXJ3K@ 2FOqJ2J@J@K!h+ ""%%%T%1%4%Ќ%%%2%8F)81hOq5;##Di8@J@s!h@"hI 3#2Oq@ Fh@B8&Ќ)  JOqis J@ JOqJ@ JOqpG%z%4%T%1%4)  JOqiL K!hJ@K!h+ ""pG%%(%2%) JOqi(JOqJ@ JOqpG%%T%1%4)  JOqi J@ J@  JOqJ@ JOqpG%%\%3%T%1%4) J@ iJOqJ@ JOqpG%3%T%1%4)) aJOqiJ@ J@j!pG%z%4&)) aJOqiJ@J@s!pG%%\& `pG# K`pG H`pG H`pG `pG# `pG `pG# `pG# `pG `pG `pG# `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG `pG# `pG# `pG# `pG `pG# `pG H`pG K $` F%K $`} F%I"Ops %TI"@g %2 K` %I"@ Q %1I"OpE %4I"Op9 %TI"@ - %1I"@! %2 K` %I"Op %4 h+#`pGI"Op %4I"Op %TI"@  %1I"e  %I"q  %\IOb@s  &I"Op %zI"@  %4 F N0h)q? @O!O0$ h"F|A0h)h;F"L F&-AFh Fpchc(IpI"! IO09O0A<M(hC``(hC!`(h7@ !`* ap J0C/B<##` 8  %&@-OF,򖃟KhB@iS$@,#! +@Os>Ej#i FG#k FGi+@F P1O ##X  2HFx*@&F&`3i*0B@3O F;FB2FF !0F#: _(0F.BFF #-omBBF 0 QI KhXFEݼݴDѠ %u@ DB"R!(>N=I0 xIhQ8I8H #F"7KBF.&(^F,J  hE&>$(J)Ih2F'HSF FiO  HhX5 BF  0E? ѣ Oc -Uh-um8DKF*FYFDTa> I;F QDB %[X[\"G!72I HO1i9iO1A#մ YFKF*F8DD bEt!jKhDr F!0D3BۚI i@S(F<6(e(2JCh20񼁎I (FG BТiRԴ DBDシ0+ݢi;RԴ Bej%uI rN0hBF0hB#FF8FDF(E0hkNAFD'0hF?(FIF+FF+ E60h@78"F]K0hA+F"!0hA"!0hJz0hG0h<003x(ʁq(Ɓ>(2d(0<(EI L *  u(PE аڰo|`D(/;K[h;OE`jO F@SB+x+0K[h;D>Ev0+?  [R#s"ri7x(c?a80Bi[??z(`(x(8 (8orD(?ɮS &XX&\d%T+?ɮR#CY{-1ڰ?(?ͮ?<(->( ("C0hBo `p3D7D pB8FBֿ1ؿ OаBc@00ozwF.?@W&Yc%(F8FiXh *ui3D]`3@F>@FE&@F@0h%KiS 0YpG%(KhBiS pG pG%-OFFF*$PB*F $ FD!Rm PPO U$()Ky.FFh.=320[ Ը 7I .F=Ez>>.=320[b$d-nT ѹRFIF8FN8F"FBnb"D%%0X-O7IF F`5O*F!hFȹ(F@A >jF!+IFF+H F)O 49FhFH #H(`.0F1FFF FF( УD9FXF  =*L9F F ID FJF!F&T@F   dXx00Q# -O#M`F FF(?0FdF 5 "AF(F(h #`9FhFf4IFhFf)FhFfhFT( F(1BKPF`)00FD Mh ``h)v(``hF  K*(F`vK*xFKhKKh@4 T%%Hn(DH@ K Op(@@ >x-A -M$O3+` F(B !F_+h+85B*iF +݀Y!#]" iF(@Ӏ F(@̀}Hf<   !F^ 0!F n(,`6nMF!F(h0(!F V(h!0(!F KcKh+ o ! ? B+h"$!(6VFX*hX TI2 J(j+h)A(a(\ (?rU!)F(LBp"6B(&B5/F.FB>$OpB>ӷBS(F)US)"BE$4U"B2Yk)"BE$4p3U"B2U& \0(F)*E6V h0G(kՃnczRnhR1 [h 4W /(%:B&%t( FObF dIOb ~ Ob `XI `Obp : (  ` 1I#F"F DDDD!FB a X` FObhFIObhF4ObiF  Ob I & ` `iF {  ]XLK0$   ` F @F Fɲ(=L#h$*!P*kѓ)ѹOp0*`h0CG0#h$h0G#h$ (A(<$H*(7"H%F pKMhFF"F!F(hI8(h6(hF  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " Fl B $B5@5H`\(x+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?{3P,hC) UhPziS)LX7hFL%hhFIF  h h"##` 0IH `xI(FhFIF(F hh) J IF[ =%ߚԍԝԨ$pi KFh "FIF(Fp@ KF %@%,7hF#L\%hhFJ IF(F` hJ h##` 0IH|F `XhF0IF(FF h0Kh[th)JIF[ hh) IF H( %,%|$XsF5M F(h5d!(hB(h=&F4 [!F ?@N Q?,@ J!F ?@>1F!H4@v H?a 5hF (hA!"bC(hBF0IH &!4G:h(h7F F7(h?F F?" FFHT FF\ Fp&pX -OF-F F1"1/01&#LI"F#`fKhTKhNCFm(@ *F!H1!(F<| ̬)wLCs)&)Fx2 h8qI& hz%`lL h@mI hp##`jI8h@hIhxh 7 dH q" x Vȱ :hF\H ##`FXKO0`}TK9F8h|r9hQHPK! "!`` FlO67FP C h C` T \Fė#YFOpF (o03.'z $[" B "8FIF %HV7$],!K h3SBF"Fh K `h\ u*%tp%,%*k*z%2~LZՐ%+,յbh+WH@LVh)ySIF F$#"(FfB*OrBADKhBK$` Kh J( I0F&pO6p%,zz-OF'RK !FT.@ZI"F uX'-6)F !0FBF0F85 FOAF(FI2FID3F@F^I0FpB x%+@+*!:0+x'+5<*++/!PFF(@րPFFRF@FC XF (@ȀT'0EPF(XF,I(F7.5x-D'PR3h/𾀝BѸPH>? >@*@E@@ƀ3hB@EH> >E?HCh;C`+򴀯H<3hB(F>2 @0h50h<!0hAE2 #pPFz/#;F$B{.*?+ AFF(  FhE7(F(?ή DISF. T@th&جX (0;(0(F@!8HF_B@dE?f3hBѸ?LG?& (>?\Oh3`IE JC<6%F(.U H F((8FWФ (/ OpG0ð@Fx0c.!ZF0H"zC0"[HpH"!F%4%3-GFhVO`FB# F#p_-и/-у k20#)F@F[#1) F+FJF4^`XF!FFF"VCFА"!(F I"(F/a*F1F FF F,F F%2pM(FF@)FF 0˱) )D<.+(;`I@HI@pHp%4,%1%3𵱰,I "@0j"F'H'I "@0j"F"H!"FCF$("!JI"I F$F F\녹MN1"OFH1F1)F"0F=F"!F0Fi!%2i%%P%2(i8%n$-O6]DFX6 +WтJ© $( KhH.~IH* Bx'` F3x+PFDVE1,«hi(F(0F(/|сOrkH©`;F0oª2 *shcIP |(bOp((\#X6# IF0F.1F|F(FwP#IFp0F"SKh0DZi sOp")F04,ѧF F (FZ ( \23 R 6ROs82(F#"S,(/0F(,,r! FO3! F'F(>-M rF B:%@u"FS1F#u S5O3U,FFOz t O3+`L )F+hX4 0F( 6]Kh K`rX3C\z%,֘XּX%2%$%4a pOq"O 8FX"I"8FF(𤀋I"8F(3чKMF!A`@!J4#A0h~K@-~J}I[h (y"A`"F0ntHA1s+ ћ1l+oJ2h320YqlH©{(0v "!d!"!``I0@׀]LA]M"`YI~ #"F)F FFIF FBбSIQH<騱RINH8週PILH2XOIIH.0MIGH((@#:48Kb% (? 0F'AI - R^3H©{F(@9I쨿$(?DOrFD2J#x F0J#w F0F(\8# \8-@Ł@$J#y F|,!J#z FsI쨿F(F>%uOlhz%2$Xxi%np)2V%4%3%2%mHOA(?!J# F$\6+?J# FCIHF(?cIF I FI FI FI F~yJI Fy[7vJ F~Iq~I Fm}I Fi FzI byJzI (ͮuKAvJOqAsHOA%\X $%FnI F@:4+fJ#FjI (hJA;F #(AA#AA'Opf(VK XJ\IF(@b\8VJ C\8("QH'NH !#pKJ ("HH'EH !#pAKx+\8C\8>J (":H'f0s7J ("1H'T.H !#p0+\8C\8(H!0 %i\8C\8%$_,FE %%:bfcׂ׍י״%2ظפ:U%D&%3N%4,NJ#} F\8ԛJ#| FKIx* F,YЛ:ĔJH< FsF F9żFF FW9  Fp  SF{IzH43( wI"wHvJ#{ F?+rI"8(pI":gJgHF< FFW  F7SF\I  ZTOO;x+=XIXHFpWKh, !F RIlQI(FMJNIF0F0#KJ0FKIx;x#5J0FHIqHI m ~0F3+<,@Los@I ;2'4TIF hRI0Fd:4#PJ0FPI\ OIX\!EIF FK:4+dCJ0FEI<:>@I :@IAHF(5>IF ,& k|!F  O3 ],Ӏ:Or`"ZJ`O2`"+H ` (# x # ` &1`FF `FO @ B s:OvP#K{K`oC"2:OvP#KqK`oC"2#!3&1 6:#O3CF DO6 D IF 8FQFO300X?iR#0rr#"O 2#~<*F3 3FCF0FO30Z P)0FS"`(8F,CqAOp9L"F" 5K`#""F7aα  OOU H  @%057F3q&: K T>F@"020FFKh*@"`oO6>!F0F(x>Fq10F,1L# $p %&a&+K(hh0(@̀(? +?+h$!hR+hM!JCF48F,K"B`D B@ªOsM$#&F B5Kh+?hªOs$Kh/EK"!Fh#T }1(`0U (h""0"!FvHL/h 1R$,!01(,48 1R8R#$)h1(1)\L $S ,!0pF (LO,!48 R$)?\? EA 1?O P O O  X!HFm+h!@F$1h#RBR[m.KhP*h,I2Qj H $1hh+h$1hFXhKF ! L PO : 6YF O30Q0+@_a(?,$h0G$F%%P% &% %,(( K@pGsXBXApG pGB-O L  O30##h*!*@𼁓)Q-@ЙJOa3 `I `"v`Op(𤁐I b @!&H#hJOa3BJHBFHK!\ B!F8F p"F}K h@h8hCE'p"Yh#Xbhgk Ct/rj*o:h8F3OcxBkG(Y;hO "8FoBkFOcG;h"8Fx bkOcGcm!@++;+Fx+𸀳t+#m@̀*ȀAI c F%/nB$(tcn#5J!23I)I1Mcn#0J!$mC!-Jbv#nC!)Jblm+$J%I+ F$IlYI M Jm;"n*SCJ!IMIIMI&4xJ.dͧn^wlmb z6F"6@%(I'M(IE(I'M'I>m&J'K'M)FFt%I1!/&%#mAF##e9#m5-?24 F/B"F(FF(?%#F)B" ''4@HTK36J-OM+h*aNHeIHFIF0FN7hG+hI3F8F 1hH!F  FI(h)q/x0)F y|b뜩HFbI FHFK`OH4>FER8F%.xM+x!(FSvI FuI F}tI Fy+x#nJ FqIr#pH#F~n(@F1jJBshJiI FYhHegHbgH_+xeHZeHWdI D F R zYF(Fb>8F%Op!8FgF8F%.NI*F FF}Op  [ khC j+km+k +m7hBa+hk x"#h#2OcxBFkG(CF# +~ km +X +\Q#%%%%%Mxl&ߚ8"%,B%(B[} Z(6ZY+{O 8KFLIPF,()mHIFlGH@FJGM2FH0FCH 0F?HFBF F:H0F5F FF 2I1F0I$%Kذ(F!IPFO KF5k `Ob K FIK[ kh*[BIbB FIHO pKFrO hKFl#j NJpx(hbpw^x B6F4@6@-OF|M,@g,&̂UFU+AF64,ѪJI 6v!60F$F0O4 F MԂLH Hh`HK(lcc H,eTDO  ZIZFIZFKIZF;~Ka``~Ia~K ;84vKDK">I=KA#2##Fh h$9kh+Fkz+5 $/8F ]A0,!$ X`(32h#F", `$)B@#3$!)hQ3B3 h0G4#BR$#jhBуj+kz $'R$jh0G4#B $% cXFCz۹P4 @4`j[P3pB3BhF0G4Bؽ@$$&F%F,F.F{hB(F!F ;hjFS6IhhlG(EF60 cpG-CFFh F%F'OUxxOcG  #h bU1Fx FoOcG(I c G@ hKXBXApGbJF PT!ڂpG%0 `pG hhS8F M0i(DX0 10`a18%OFx teh/-#1-!~ a0-`  %i41.nUuF`02140.55FeFC# `K0`# aKa% 50w}F F:OrFD ЉdETAD !LLAPAi#F IF(FA0)2BdFL >Ih9#+3'+"D %h9X]Hh9[]#D !B !5B #<1L P D T PaFH0FLFHFB8NFD8FHFB8NFT8FHFB8F8F8NF! K JB(7FF"@@FC!K&{y%{ {s FiF 8p@XBXA& OAJxI 9K"!H`KJKK J!H KH]ڿ ]%>%X%0%T%1%tOApMdp)chC#K"F#!30F$chJpA  C1p%{8HH E!F MuF(F?(FMI F F8@#ÿpch?FR[)F " I*F pI#F #0@pG| O3(( K J L` J!F H(J!FH %0 =%2%0%tMHiFw I*x I*|@ M] O0 xMHiFw0 M] x0 O3+$ F0K JI F(K"M!H`KJK K J! HS K%%\%X%3%0%T%1%t O3v( K! J H K| KJ! HKt ]%T%0%3%1%tJ#3!+ pG\ pG%J#3 + \FpG%J #;!pKD 1C 1pG%%0Q#0Xh K) !ؑ D !%KD 1C 1pG% v} z:OH%=L"F F FL7Kh #F6J!x | "|!1Hs,/I < p#H"+K !(FU)K #2 #"1#)F (Fp!  }O)Fpb0FO3p2(Fp! jx:J!J~H6"F J J6%&$a }(cOFH0iMxzX8F1Fȱ0FF@8F#J!xj| V12H|!"rOs Kp( i, F7 F@ %Xac!F@< iF O3]iF O3]hFh#hXh"## 8FLch/+ !h)(FB z84cJK( FF%4%0-O/IFЀ`f,O-NȠO =Fİ(FF"FQF HFz(82h[F I %O (KO F FKI"FS%@XF(ѝ0Py+[D0a#0030 f %(i%X%2$%-OF-FF$K$!F0FF)"dF({$!0F?=FF,;3x+h1F(F`0FDEE_5K@G4J5H   "ax V+щE Z! ; $!|F "XF aN F V*KEҤ1F(F"F,D FZ#P)F`j(FN%$!XFLF,p8F {-AFFF!FF#FFAFh8F)F"F=FG(F# FA#𾹽-pC F-$!&oIO옱D " Fa V+эB p$! FFHS+]pGFHS+]pG@o#@q F F'=/puFIFF6@r }I}H}I}L F`& +;+=(x8 [OprInHuqI+) O3+DkO;x+jN3x+#x+gI ``x `b&xcI b#F(F c`I2F;F^Kh!\L@n ZSBwSA2F7O3dTH)( q+ CJ9F0F7۹JHqQ騹GJGK)FFIF FF(F`@ =J8Kh2F!@m O3!3H' .+3N3x+?X1O;x+?S#x+?O"I `` `b(K bI(FZ%I c2F;F ^(1F*FI UI b O `F(F` 5&@h%%\%cpЌ ܈s%z%4M iFH!hF IjF  M]M iFH!hF IjF M]sx%8% {+ #6 H $) N` z0F/<IT  p ,K|+H"|+K`HK`HK`HK`HK`H K`%&%&/&&&& F!F mK@h%|p$}"!F z#"! #  D#<[HȹpCOWH"FhSI"THSITH" }pOr! NMF!"F  "@A"}@AaC"(ۄB?K@2!?J?H>I")i G9K"p O3{(?(@ )(I-H_>(*Kh+!n R&H@&N"$2`B\`t#!Cl 1@33O3YCF sm F/ F t!Q%TZ%0%1%t%:{%%X%(-OFdðFF3qF0IH.h0FqF0FG#FDJ!`!Ft 0F۹2;Jh3` *F!!F F"20F"/$(hGF( FC+JSh3S`XFkh+%I #ICF F0F0F"Jh3`I !FI 0;Kh#I FjhKD !B !/Ji3a%2ܛ&Ks%%%07FCh F+ + HJ#)F F#40JI2+ Fx-Oװ@FHF^KhHLJ%N)F   Sh/+S!`M#\ nh/.V8Fh+@ր!i"hB@р  znL/@ـ1mI ?H 蹂H0鰹 01BB|H{H8zI wIyH"hP3D 1+1%2+h+J  1+Dchh c9F(FG( 7=c``1aK!h;6?&)h#a ODWI"hVK n ** FK3D !B !ci3ca5U*$`iAFBF.FOi61+&%0P&ؔ18$ @ (! sp%Nth4 )F p%60h!F-(I"F  Fk-O]FgH&f@eIFfB(A"^I:F@3!FO4P F ]VHTIFB(RHOIF8((KINF((Fn"BIF(_(F`@F8I:F@3!FQFv 8F9FFFXFz0=+:IF F*FOQF((F0 F,8PF@!Op$"0"-"*f&@(Opx@F(O4@32Phߚ d8 FF4"!F"*FF FF@[8@g -CFFF04"!thD6h6p# F#FZkp3BE0Bȱp!h`";F`%Op ckCE pp"!F5Tp4B pGh0Fi 00  %hB#h)F FlGP A####5G(+s#h" F#G8" F!F F)F(F"F(8@ԽFh"Yj"Vh@"Q-A%Fp'F#hB #p'F"hB"ؠh"?`hA":ch35k՞n.0F_ h+FBbh"3nBhbh]"Vk+F3h0 0FG h+FBbh"3QkB4"-AFF3HCF ZFZF,HV,IFF FZ8F]@FV'IFF0FZ8F]2F#I FZ0F] J)F FTF F](F.IZWC ]LI" F8 IZ(IZ(VtF],!0<D}M ZFL F8C I#zO38J(FIpF(X*I .JI8F`8c J(FIhVO38#8ctbk@f L83#`F(K @cpmOc FF!-CF2F)F0 ѹh FD` mp F: FF"! F N'"F1F(FXB yC ha`! ` h" d| FI@dz M%OcF)FF-CF*FF;F0F F F-ڹf` M FIAdeh D#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp" pO3 0pGo 0pGpLkP, ыk+#p+##,ыk+-N#" $#+Ѵ 2 #B+#V#1Bт灂 F3"+{p+P F !j +Ah#hhhkGb0#h hh[kGbjlhbbkZeke$* - pB) тB3 !B)!V!(F1")N!#!"Oq" {Kk+ ыk+#pG+ ##+ + г ++#3###jF F h *!ac#hchhkGb0#h hh[kGbjlhbbkZeke  :*K"ac{# 00pGhp!-OFh!FF&Op hhBؠh!G#h`hc`KhOh1FlG`ch$#BСh JEXEъl2 ѼJmE jBp"8Fc6p73%$-OFNk FO YE ܵ0+ۙBݪiRgԽiO  hb *Z.BZ  Y.AY 'IB&IB&IBг0+#KB$jh+ѫi"h;DhCE hhaihnG(!p ih;D"kQZ"Z KB0F(Ѣlm#ehJEREIBѪ3 5 O * C Jm )E , Eh-OjFOFF;h 98`p#h_D;k.ջk3+ѓK"6h:n\hniB8$FOpFJFCFI@8F-*hKBiDs C#s1.chBҹkO hhlG(*hwKPBѪi 0ѡhYD k@CS"  gK h;F";F PFIFFQ  "  ;F@ :` r2 hF[Dm +vsh+o(03Opx00 qp0 @BFx;Fh[DkOpvBFx;F h#0hmFKho3BFYDkDdFkG8F)K B,ٝpI x)  ##Ii-0>#c(F3 4  p iIBxL-#F  ' I #-K%X%%\ -CFLFF0+@@OO R0BOpD0B@60BOp(0BOp0BG 0BH 0BI 0BJ z0B@l0BOp^0B@P0B+hhhZjBE-030iSJ/1kkSh_JB_JB^JB@]K"hqZKGh,0aj X x0BhGIBGIBFIB HIB GK GIiC/O/MS' &U & & % () Op0 5I)@@)K"h(Kh0 'Ii-K"hKh0hIBѫjpi @   I#F:F0F-lIB#ѫlpim@%X )E , E%x% Jm  C 5hIB ѫlpim@cIB ѫlm0 _Ii^IBѫln0[IB-ѫl[ns@i`@&TI2F#F(FRJ!Op!JIF0 i-(F!#Y *K0 AIi-ll>Ii-ll;Ii-ll_8Ii-ll5Ii-ll2Ii-ll/Ii-llZ,Ii-ll)IiCl&JBѫl30hP!+FS+hhdBFiiG+h "hhjSFJB` O 3 4 *d")29EMUZ * Jm-C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"İh F0GO1#Op"3# hh0G D𵋰Fl$"(F1# S"#FO1Kh#F)F+Zpl4'x'I F령#+v+m#+e 20 R, F FF///#" "+v!F!FLlmCeX0 F%Kl J !b"O1 #Op3+F\`l`dXf(F 0d-C% F!!F(nOp8Nr%` `@ia a@c#b b$-!+#Y#/+Q`7 5!Op #QF3"+@O6$-D `K@!JH#"2 !JM 3"2#%"1#!FAF(F? F!& c|n {Kk-C+F ыk+1Fi +++г +! fF()O`FW !5(aE ˅Op `@ a@ bOpK"!F0#M 2J3"2# "#c1F@(F F!|| +  -O F h%`h+Fp&(B-hO O  2"!0Fhn#hh#0!8Fh^-@#" h"#"h0G?F/ h"QF"hlGO8 7eFŖ#%"$ E ;B2E #1F(F e  SS E@ E8S(E E(!hS E< E E2AO@F  Y-OFӰFFF?ӲGӲ_G":" :_ :O<:): `!" &O EJ$$#2F'(#@F DDG#)F0Fg FSF "F "*! 7[F6OK 8FK!D|$D<8Fh  #F aORO3Oq~#-A F aklO@ZkVh9FBu9FOOzsCCBu#XCBuOS FA@MOCOC@Ci-AF FñhhmG+hihF@ *OD hB*?н*khp!h `+h1`i h wF (D1F@q  E0#s K`ca3c# FA^ 61D: c; 9-Oϰ FF"!(Pph/! WET0+ + ##3WEO3 Rj FHKh O#F@ =P `eFžžŞ @T0+ + 4žŞ pWEO# 0*F|HYj#B%FWE80HFlG(?@F `32 05HF0lGO2F hh 11  0"G(F #!###"#hFhkG"eOp "JF$ X @żŜO % #SS !vF=T !mFU !eF.N-C<SkI3F:Fn8F0F(F@F0%S + s+F0" XJ!^-&+x+"QI*F8#O1& "F#KB)F(Ckx+@)x`)@ B#h0a9 FlG(0c2F#"##h F0Guj:CF!nCfDBFvAF0FHfEv jBAVFF#CCEFA8  JI\ a6J! I\# %eo%xunj dI 0" FF^Ih"6 V0AaF FFSI&0V" FFLIHF&9HK!h3ObFHR=IFB"F! ꀻ F7L7H2F)FC h4I3F*FV h@@90Na)H)F~h+I*FF[ !F FC }QFBB (F)FFFHFF(0=+BBJ!D|V4 F Ld h(IHI h2%,ib $Sp dF0 FQ#0h0T#0NOraO8h0 I2F8h2F I H!F(F0 @9Na%,KpF F2#K#FhFVF,ж0@;U#0(Ѷ0OrU#0 a Op(Ѷ0 OrU#0ap K"` %-Cð$F F"!F Fu)H&!hF%H$O9iF yG+ Ѷ0OrU#0 aCIBFHJI (JIHI ;x#I:F y!@M$H80@;U#0%T&  *Ol%SOp8F Fq0J T#0ha8&R!0pFih$iF0F#FIF(Fp@Ͽ8F F XI 0T#0 Ora 8Or8 F0F Q#10I T#0i00OrT#0a 8 J@@@Iݼ-COr-F!,nnL%mO&F--9jK8hhsb(sfJ9F ;h(4c{(paJ  PU,HF[IJFF(F& 4(F((Fb@=%dh04([@9#a5-8LJ ,LIKHAL&GFch+M+Fh65HKE<4(>K`@5A!( F(?|a4zy2J9FF pFm-J +F 5OsOs#(Ѿ#K$Lh;`"F h=P h* h;T#@K2JF&!JF"!o2F9FF Fk%&X%S%T& %#&& Y Y%,-AF1HF50I~.NF(94h<@F'+IF FB%HF&Hy(4 K#J Hf0h8*FI&0h"I(FF(F@ /F HHI*F F F\JF ߚ%,Td J!!npG pG-O%,F FB ``.=-;1 DBt  B Ey Ew # B Ey tsBBt h.6`v Gv@@51Kh"0pG& -OFF Ey 2UF FLFF*2vs#"#.w:F3F F)FCsG2]D3F)F:F FdBtI F@ DM7hQ7I+:+ #;0a+I(F[#0#0#0U0 ++ ї(F0#KCIC0(F7;B̿II6v~Xߚ&Jar}zج}8FM+h'D(`2 IBs IBsڣh@#Oc"r#8#& 8@-OOfq-FF$M PTF%Oc)Ft (HCF FU $M^I0T( FD0FO1QEJFu FF\*Fy!`  X4%F'F+O+  e``` Fo0CE&0FR>IP (qд *)#XPBB+Y37B܏0;h+` #0h3`5  +*1+0"t##"0F0Fx"HF0 0HFBFs C( #Brڄ[b# F<Ade-OFeF Ofq F(OX#t "* "O1 TF F "*"O1 DFPFcf#fSCfK#`4ecae`` F IH"bY#0 F9sh3`#0~FmFFF+Kg!JHmKh!JnKi!JCnKj!JnKk! J}CL"ahȿO`hy vۋh-OF Fh"F Ki i S ###"X@O9D sY GYEw"- -r#]B0mG)F8Fx gu g]b% B F FA# uKErFFFF@ GKErڳ b 0'0O FCE ;JhBcӺ@{OX  h ٸI>*) O1[ jpj D"kx[@ ppD(0h3`#Br[b#HF*ѱZF B#1"F& -OF&KFF?h OchB``@`a2chB``Opa(chB``OpachB``+hhZjBE(ch3c`kB1ܧ+FS !hkdBFG+h "ihdhjS8I"FF0F(h2j XrchB``/!#1Giibhhh&I&I&K"h%Khd#ibh!Ii(4EK"hKhNciKh#K@9`"h8iiibh hi)ѩi!hh%p%x%-OFh}FhB HK "HI( }+h (FlG( Hh+D=L 03Opx 0 0 3p#sp#)h mIF(FG1K$ "F[F"F[F&FFF;FXRFO %I( phlG(pFk0hK,lFĕ#0h0hho#GBb[B!Bp phjFlG(𵑰%F F.F hB-5џ#hh#hFXh*F!F@N FF(F#h1F FlG h* 5* ڛA####6-#h*?0#iF FGp#hh#hFXh*F!FOp#h09F FG%𵋰l%F g F0FF8F K"O1g#S 3BFHc(F $-CD" FF! z! #@F(uPLFŔ 4@Ŕ@F0lGDK0"hTyO3FFF F!> h[kG7K"h ThBr *F#F#"0 G(J # 1F###Os""K"K6#2O3"#AF0F #c F0F0[ h0G0 (8Fh;3O0##m&% t r Fk#K hh0G@@0  Fǰ(0 h8hkGF@iYh"&'#h"O1h3#h 0s#hhlG0Fa G-GF FD"! d#!00h[j HFF(?:IP"0P7HYj"F#B55Mĕ 0E0QF@FlG Os"(K1F&K6#2#JF#AF 0F `32 t F0Fp0s hB h@ G 6q(8F O0h[ [m |m t r-OF-FhF0G#h FlGVKhTxwO7FF F@!hkeF[ Fx F#"0 G(Ft!" # # ###hi[k* "!"G#h"0 FGCFR#h FlGF(J#hi*G F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" eG(%(FO &K-OFh#(1+@ہ +h3K@AJHhi.́Jh\(F3OJ#O~OxO FqJ>F"(O2)_CF@=$h 8|+h\ @ O Xhq 0hmFphi&K"! @FcxO@C"!HFcl 1FOp  2s pH0$1hh50$1hXh,@"!FO #d+h0+H"]HOq`!Y`@aYHYaYHh(Y22VI b@b#@u3133o O3GF GKb0F0F+++Z&7F,(FG(##z09K" O4 F-+h9F(FlGp#C !#h;+67hB~@ j8#Kh)"H(FF @3+h0+!(FG\B\A+?ɮ!(F&f%%p u wM80p s s& s} s%, h"Ohh0Kh@!Cb@!$ 0F+OE&O$!(F=(?(zaR hR4 Ch(FQ$4 YhB0F.d 14<B$$!&-O+հFOs K!O2h FXF@! FRF@@FO HFU! FC (@8FK hS"+ 0BY+Nі(1+f#O Se,ARd cErXO !IRBR F[!bqFOplRFIO FhrG W @,=*5H@~J` C 0+0G( 3 rK hB-"O%FO6O 0(8G O ,UFO6 6FOp (!H1O 1F  RHD! Fb@od!}FXFXFHFT 0FP #D 3D FYFFX^XFO >! IFFXNHF0 1F  X>0F F B+K@Q*J+HX F#"AF23*F33#O3eAFABR R#FEѺ F8F@F s?0FfTF[ ~& &   s#f-CMF FtH!O#`*@20F(*0/+ *OaBFF F*Ob FXO0F(*Ob1FHoOa Fl(#x/+0 fx&v  FF*3;DDoFIOb F@@%+@e)pң%CBCA #;08hhlGFF#YC^Cf3I2.D FCFJFQF0Ff#kD##c;0۱Q bh[0BAO Op E@Ѐ#kC#cUNFEFQЩBpF F#k bh[0Pc#A# mBfF 8FK`e`NO3 F2h(z#;% $%x+$XEK ;PFh#BKh,1dB_JhH &!4jh4Dj+H@gWJ(!F\ P$h2DkY񓀓kZ=# # JI&f(F)# lAJ &!*7K"@F!Fhn9J#k 5J(!"~j$m@:+JCF  УnOp\h-&J#F`kh[o+h3Dqh3Dm\@J(!CF F@$!FkkJИG(+#q@#o% ߠ) FPeh#p&FFB9(E+O+ F, P!%J#F "H%* !VH- JF!hJFl. KJ!H`)hkԉk1#2 ++ P"F , جp%xߠ8%Bh!-A2Fjj5 :NO FB=8HO@P"Z5"a2Ja@b1Jb1"c0Jc#hv#g hhCE$#OpE0 Fvj(ۡji j /k2p50L"BlhjFAFlGHGF kRh\gF3 8 a-OF7FFFO p' E6ѹlp'q(a0IF:F30 Fi1 x#"Dkih hb####ice+je8@ii D hjB6* Ѩi@x1Hk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  gK-Oh FF8F$(th! XFF([I #[E$5FOsO H0t@uO5"AF@HKA#2ZF##/@FKEkqhj1 F(bqhOp b  h0(Rsh` DAF*rh!F   ZFIF F  # #ccFf8Ff3hcc0F[ 0sh3s`,O03PW8F8F &/ A-CF FOp 0@W"O1+OkD/ #3/0 /+ "/#0eh'BAij DF(ahp'hq:(bh`!bsa:F  Fj"hO5FBcc"b "" Vch F3c`(Fh 0H逹Op!F(Fz7%-O FFF!4"0F "#%`Br i IBEA  bB! p!``A`0KhO:IO(r\p'#Op B qj(Hm3oO2##K'!hO3E򐀫j+@,O WFh+hRE&l(FGp#E٢hZDk3tH`(v0A mI#+:*@'3+#h ˱E@p XC;k2Zh9X2A9PZ`2A.y'0W ByE@QB<` L p"G `F FBCHC 1DPs`p#hO3BDjUccPQmA+hmkGhhCDb!hhjCDBZm**kB cj+HhXh@QPCQ`hah , *B;F7#* IFȱIFHS )r T R"T "X *%$x&%x7jhBh 9FlG(h+++# 9Fj#Fg'l QF(FGh+ #Br  [ BEs #FQF(F?  f#E.ye#f"F"8030W 3BV @G 0#efEW 0E@p HC98XIhYB FOfE@.:E7!)p1p#hKD S [h_C8hF9F@FhBzF}HjC _`chB7;B7@QPYG FQC2DBBp򢀫Brڧh W BfG F Y {hzDYB Ez 8k8IL Ez 1ahBiB@p b +FIDI rK` #+r"#I K`;kI #;c kC c##ByG 0G `Ep!qBBлk3 #S9kfF0p7F F^9@0b @2p"I TC"FLD FiCDIa`I -O%-FLhF(Fp& #B#-u(Dp!F(npFO p70E"ӤDPԧK$\CBTЦK@]QJH03nJk՛k35Sh0pBp" Fnc#k)գk3&ѧpO p4 p" Fn.lhS8IhhlG0##W<[hEp4  p7.`0! @xKh;O'hlG4 1 BBO3 F&4F0BqBHSOp!e[e+ Z whu T B2E 2!F(FeC'F#+rDBrv[bJ s` %Op 0Bx (`+ sO3 3.@ O 0E0 'Opp#{Ck?8F5UhQkJ[BFL(XFhlG0DkX#j F-z ;B2]J 2)FPFDj -F ,F70>J0w`m'%$ pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504M3h0FlG KFFH#0BKp"0k3t+kqYkh+rj 1h b0F#"0G(R##ihY#BpF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c2uG3H2GSFBF)F8Fb g 043tA#[ BB sp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   Xch b#"0G(9,FĖ##)F"h0GFHH*FhlG2F D ;B2D 21F F d ' hRB   o" DXchB#"0G(  05Xch+r h    b#"0G(9##ahX#BpF F#0jhkGacmam*bmjb"nbbnbha+?_j+?[#mC"e"~*?SC#eNo h   [B3 DbhYC2"0G(zk3r#knщXbh*qh  +dhhBO5l)F.G51. BB10 BB0ih'kjGacmam3bmsb#nbcnbpah0+u"1FGBF2F)FhlG0cccm[j+#mC"e"~C#e706B~#p O4BP$Op 0BP p$~p# [b#VF#CElp!0FFp#F O1F BkO Op Ej' GE$p'0BEe;P1FFG "3c0.!FXFlG(2!`.| Bk5UhQ-q wEEicd4z300B@XQhCВk263cp3C(  kCKkB k  +hB Pp"j  vk3h.9FlG0 72d0##3hb.##5ce6e7p4XFEcXKhC Ћk3Pp"44JpF$M(h%n(h5j+`h!0bO6 Fb%KOqUKF#1 #c#FHP0jBbڠjb(Fb p#!F00jkjR0 V& A M%-OFM-(h)1$a#.@W .@R(!3F1F+F( 5(h#0Q###"GF(+h$A+h"0FT#GF4F&FhB8)h@1<1@1V#CR#V#JVh *@6,O NO 2"! `{K"!`!wK"8F`#h*hhO& O% 2 #hFXh ! [FPF+h #hhw#hFXhrZF! SF' YH#hh_#hXhZ" ##P" # #0JKO #$"`GJ!GHY`"aFJhYa"b(CJYb ٠j0"c?JYc # 3@u3@73o O3CF 1Kb0F0F2.?+l+hTjV##0h0G.@vV!h@2EE@0 FG:F3F !F:F3F F+b4h&% 4p80p Q _& g o W}#h 1F FlGP$%#h+  6 K&.:.h!F #h F`lG"  FG( ####&#!'#FB=ܡ&BYO1F;#h F0GO0>1:F3F FGlh+?ieK@adJeH# g!F#;F2F8 ;F2FX !F3Fp3l!g#:F .#$/7Ls^g{@: iNIF(F$z @; iF(FFI$jBpOpiw#kF+y @= ilckF@> id80F+83I*F0FOpVFm+/J!i@? G(IF FOpi=m%IF#n+#J!i@A @B i(cnFn+J!i@C n+J!iOp#o+ J!i@E @F icoF ztFOpFF"FhFv.3&4@LD)O`T# 40Vp8#*hsC"D lٱD3IDP *hIF BD(@Ё@"YF8F>)h@"8FAD668.+h#Dj+ ݋J1F4B@""+h#Dj+ ݄J!$B@"+h#Dk+ }J!B@"+hB #DvI3PF(@FOaYOx+h#DCCDXIh)r@"!C<!XdJ+ n#y#@"B+hCl!#DCDX[J+ n#y#@"B+hC8!CD#DXQK*[FPJ@"B+hC|!#DCDXIJ+ n#y#@"B)h("D\R@J!B@"x)h \R8J!zB@"h+hx"3C`#DX+ /J!dB@"ROx+h#DCdCDX+$J!N@"B<+hChCD#DX+ J!:B@"(+hx"3Cp#DX+5J!)&& '.L6BIP4B@"Ox+h#DCtCDX+:J!@"B+hCxCD#DX+ 2J!B@"+hx"!#D3`S3##&J@"B+h"IB#D 3D6 x .+h"#D_Q1Z`Fl&082B`R/C23&x2(qBxlB K/D4B }W^eo -CǰF FNxF@b@ #FJ!PIKF"F(F#nG #!1z KBR!OH#_I"F  <#YC-GFSH}dkWX;+π#L1sOpAI"Fi H}G|1@Op3hx-чIT3h9F0FlGx1{S'0cxS@F_F yJ!H# ##H0#"9F20F"2#G(OpphI""1FdI" ""R"ik#h+? xXI& `@Fhd0i;jS"9F&f"QF`,7EbjHI0F@ !$# ##FFi0F H}Opiz2F  F#h+Тh/In&{iv@ b 2F(F1 @ D###h+#lki@' ?IF F H}Gk!Jckh#lHal$hlG#J## ndHO #h+?t6J!`YРD W<["9FO툨"QF87E`Q/B 12Fhx1Qt|@BѸa0F!Jx @/ iBF )2*sJ!V"'!Fx""Oc#@##gU(d!@ FI\JrF!##`# 3O3#cU d!~@ FI>pF5Mʰ F+hX @u! "!)"0(`0+J :@F(h!F Jp4#"CO1#@5 j(@6$J! #"O1 F 3# {( {(`j,@7$#k0Ot##`O0mtpAMO3 F FkjX @u! "!("0hb0 +^!BHNTZ.K"hj!FZ`[ p)K" Q +cb@! =#iOtJ! L#"O1 F 3#G {( {(`ci@$i@$i@$#j Ot##`O0m%t-OF$K%FhF*F (  0FJ!XF#"O1@F+F0HFS##3F:F<)p XC1D%x%а00Ű +&(06Cpdjv|1#"@G O1#?K1"h,1<Op!O0 k[ c E0Kk[ Kc81#"@I #O1mX@J%'J!j#"O1(F3#d{({ `m\@K% n`OuKn[ Kfnh@M%nl@N% o[ȿ# gKo[ Kg &t00 FŰ +K/7MUa #"SO1#@! #{/+ ")FPJ!(F(F8 D{/+#s E01[ 1!*AKt@" h,1<!O01[ 11+ 1[ 1 1+1+$1u@#$(J!#"O1 F3#z(z(` 1+1+(1uO t 1+1+,1u@%$ 1+?~1+y01u@&$# `n&t-OmNFF(FkIFTO [ qEF ` $?Qh{OphiVmB 4F*FTI8F": @ hiD1mBFC '!bIKDhHGJ!(Fh@ idB&"FF@ hi1mBF+ 3F1[ 1s 2J!F(FhOpidB 1K13$1!'J(Fh@ idB 1K13(1!J(Fh@ idB 1K13,1!J(Fh@ idB 1K1301! J(FzhOpidB%%ntL-Oװ#F F!J03`OO >h>H1FKhsвВ03D[hkK/F6B8h(𰀐}1a3;hB@>`0F$P|h0G$}1 }aC #0x"3D2CQX)RCPRXAh)rI D!3JO;h+BѸ7  #0 Dy1S %1@,"U (1O81""0;h[0Op;`OrAF, x 3+fO1"(у}!1F1B11Y,f-c>hO< @i.@0;F"Z3B@Khs 0)F F3`j8N  ά3h)F F0[-Khӱ@##6-K 0TF#ά3h)F F0=$Khs0)F F3`+Oq0 P3I`@ PK`Kh+3W%% & &&& c &%P ܭp "!Ji  O3`E 0 0)1C#80a34$q?hO #80F$@hCE%lAFGջ ##$GF+_(ݻ'(0" ii $!&`E"c09FXFlG(7 0Bؐ+_+ " i 0P#80O0h-GxFxFF$O3`)hBOq #"nhF\iXB32DBCFRF!`0b8a.<` 4% -CFDh,EiF'F&FPhjFTlGh#Br ,FFX04,Elkj+ܫJIh+#+`(h FF;+<c3bbb &TTK-O}h# }M$(h D(+h!J#DhbIfFx)jIH0KhI* I O *h|I0F"DSi#xI0F,#)h !DP0+3ИX.F0 YDSPTJhOFoF#G*h'"DDZDmho#ImGZIF0F  0VI0FO ,#)h !DP0+6ИX0+2F0 QDSPTKhOO FoF#G*h'"DDRDmho#ImG3IF0F^  0*h0F/I"DSjj#M+I0FI*I E0F T+h%I#D hTl+h!I#DhF +h I#DhX+h I#Dh+h"#DZ`dO&&pߚX%,'=KYtChF{+D2*s##` hJ0Ih+ &~K-Oݰh+ˀ$O6%FF D(tKh/@s-𫀻x$1hB4Y&FHF0dJ! 0 DDKFp_K 'D_J) FFS1+^ "Dh)zUI hIFlG F  F$hKEqXК0+QF SR 4 DI*F1h!D l+$(hOoIlF#G1h!D l$h"  o#IlG3h'I #DhED3h#Dl!2!MF((h(?mIh F0(h(?cI"F]кQFHF(h# 0O% %,wa&&9%$1pF FF phBx1x1S%-0FxAD%8 !x(0F F ,"!8$1 J I4# K#3KKu0 &8 ٕh J+ IO2 K JKT]&8  ٕ00X>J`k;+إhݱ1{"j3l@ `(^#10K`0Kh0I*$k#:*  ,0=!F ( 0!F $J $I2h2"K#J#K"J "I2h2 K J K F{J I2h2KJKK JIcih#KKo%&%,T&T   ] & ] -& 5 = y E&t   %FL")F4PK%`hCOI "MKyh0:qXhhBkD";P! 3jDJ" F -H3B>Kh+6=I "Fx:Ny1h0;Jh hB41'D"$#h7'7P#o8G3h,J+DP! 3Xuqoѽ$Kh"#I`"K"zh0:A^hFhBa"#`mX`2,3BP!Jkj$""0cBчO0&7&h&&4߇&T&pu-AF$AF,)h'FO8lG!2!F$&$"(F$hB/WFFE.K@Q-J.H#hk+G#h 1F FlG`BѸ?F76#h 9F FlGB 1BBѶ?>F7hBs!2O2F(Fw J#|1`'O6L*%-G}FFFFJFaxF(dI2F a(bI@F&F(F(D]I*F@F0ѬHh+XHIFO0 }kkcj`j`+k#akkca#@0#bB0cbklbP^/{FI:F@Fh0t@I*F@Fb0:@IJF a>IMQF8"F Fl"F:I0FGV8I0FG 6I0FG4I0FG2I0FGh"F0I0FB,?G.I00FG"!8F<HF0' 0B &BOЪ# (15D*2*#0 "Fd a2( h@dAdeh@dziThhi9hi ii0iE-Am%OcFF)FF CF*FF@FF FM:`1#(F mFO`pG-OFFT ,# uR:E; B #FQF*FXFd kErSF*F#FkBr6 \cErFcFx!Oii@1lAa !Br  B *k"1kB{> a :Ex#71 H B,ucF8E9B #FAF*FHFiErCF*F#F k J EEIBADsEr 6Br:B F{SA,u8E9B #FAF*FHFiErCF*F#FBr h3Bj EzFFؐd0%###"U#"( (F)F 0k#pGB30pGD0+D0pG0%k#F (B05#lB C##d@,hEjB %jjCX@Bl"d 0 pG& L<'B##`36hhh%pF0K@aJHk=`h Fp@0[`h`(F5FTbFBh I F@pFk%O5(FpD1F( 1F(@5CFeK@JH0iF H! F(K`8F|[0+e #8#c3#dff# c`eD0`` F(b8 FkF# B@3hXjB jBCXD`" 8-OF1LFFcB[[EF# 9B%3@B1*F1 hh*F)-*#p(@B l   *FFhXjB jBCXF"hF1FhFiFD1*F F -AFh&F3F20h+CAk WTkBuF6  TkkEOkB kt ڸ @"  TkkEWkBkt +`` FFFFĕeF#0 0F ##"###" H%@x(`O0hkB-@{ # BrO#F -K+` Fk00*F!FC0 A(;i h3`#[b #0C03k+УB " 0@-AFkFF#F\B +i!@3Aȹ2 1BBC! uF$Kh;` B0#0"!F04:F#AF0#(0C0#[ba F)FA+ qBBL0%$pFhV#kFB ОB % K` p(F3P-0й#c04#)Ft(h;`#[B #0(FzFh  " FF(-OFKd]Fh[ПK@JHKh+@KOqJGF]F&`` I#CUIV(^ G <0k@08Px+Ю,3F F6 "!QzC@,@̀6.&.wI H-w +s "!QX +ѝ`0#kI"x"t "!QBF FO aIH c[I8 Gz +wTI "똳! F(qD0`"1FcP#c 7E0 [[  (EP# [0@ 0 3 0= k @nHFf@(>P -IO(7P +IHF(J ((H! F#IFP|<0 I Pn(* +sHF! d]%b& d=K.$ج5$0XQF0  0 0$050#D0Oc0pFϹ=I(Fw`#\C FF0F(FHF;hZk(F #xF`#pb#;hk+@0I(F(4FFCE0k(#GkBBсk*#kBB !F0Bc"4$Pd|Kh Kh8 &&@pG{ {S{{zzSzzӈhJ ]IpG FFhF @шzrF 2 B-CFF FP Fz Zz  ۉ0sxs+sxl+O&F"iF8Fp#*F F M EBt&HLch `h%-CODMFFJ !4  D/DHF@sJ(!F8F FO3d KhQFUYh1A,d&dn%KF[h =HD"Bh F@%&!FF0"F Fh"Fah#(y`a+y+#iC#a*+#iC-OFFFO O 1wxF67. И0+й*+BO , F ѩ+'Д1wx&+&+2"@F;hxa;ia;j+b2EE NF-AF dFF"0F2k"hD"B#iC #a2xa2#a(2#b9#b3y+@+++4;++#a(!Ҳ@J @:++#B+Ђ+#+د+Ю+ٸ++++ ,Ҳ* +"a+###%8(  @ K@QJH`*X8 Mhh#@` 0+hx;##p8%pdh%h) p0yPh(FbhOch"+D,3y(FJah43R#!bh(F)pdK7F[h F  "(F:(XxC$OpF ` 0KD"3Zh F %&+#JA] 0F %h hjjCXѸh!BAA)0 h 0hjBCX Ky+8 pG pGpFpuvUB Fp@p8Cb) F1)sKO^qJHnMBBs MBs#4"8Oc@#r8@ F*I@6BFh5F&@Xl2R1JBsڣh`h"% h3#h1F FlG ¹Ob"@BqZA0@@C"Bq2hO&8@8uF8a@"(Fv2 F 82F82BCFg+KOdq*J+HO2q F(D&K`(FO3BO9F ``0FrO?FFK@2#Os"`#cCcO3(F21iF+P222`! F F8FMkh khB Jt!#D #1l+،BD! 8# %&H8 ^ wpG&+8h  hjCCX%hz0+  rbhF(F 8 -CMF cuFF!"#FJ!e,e.# F;p8!OcH I`0 F M"8F  dy-GFF FF(F2FBtO  s9"HF&FFF ) )+#ERBM)I)4  BѻX BQO Oq 5F(GFO ;))$Ѕ)"2"2[DB"FD"ZD""" Fp@"!O0U#1oU1 ,MO F-ACFhF82B #111111111+h1F8^aq4Bѫi+J`BF2+222.+h43B(2+ѐ*-O$mFO !!FOc O5(F $mqI0s@"! 2Or)Ftc2K13bK@!bJbHd t Z (pbppqbqq4 #BES2O[OC(_2FHFM(R-HFPF`XFL6`+H6+H&PFSCFFF@2E(FO(?1`p? A8pFF@2E(FO(?1`q?Aq0F>FXFAF"3F82F!FHF  xMhFBBp Or D2F!FHFxMNF FOrBVE?qO5q@d*FR5K@ AJH)FFFkCK@AJ Bp"a4+F@ @1r-ALuN G$EO6FEt qi ` B xc p D6E 4Jh` /&%$-OFFFFFΙ Ė4KB"2 #qFA\aEz3()8B,S2*K;`'8FD3B"+*" vFF4]\ ,FEF03+) БB /Op8`Fb t3FB "!FHF iBr"4F $pCET3&1A\I )ИE36.BF Bt1*+O89O  ơ2 )iB8F F HEn/?X1KT&!{#F2ƑD1  NE~ π C EyÀ2*  и#\) * 3+ K@Ta J H~1B| /?@%&* (B y3ZFq;F!D bF(?Ү2ĂH  @EHFD"06D&0B1E!Kp"!(Fz2EO32"\. (2*K@laJu+DADAEOAڨ/?hOsc /*-O FFFFĕ{iJѫB O0!SB<ХJ$4 O4 K@JH~D2B#O5FF s\-F2* 4%+$+,ѸOsK0()SD41 ! +q;h~h^Esr C BAchh C 2B s ڸ?rOs8BT F2" QD1[BB гBA By"Oq WF(_Ѹ?CQKh!  CBpف!FBQ-=v"CF1F]@B(FYF8ZDPF- tw#y{B?0*+"*@t4Bm @ |ES1#12*<")FFhKCF By9cC1 v 1F2CF]@BO(F@B&2%$]C )FHF&Fi By FD" C]CB usevCF1F7]@B(F2B2E sOq Q8FES1#1F22r-ٸ?'@l-ٸ?Osc" BqDFh"2 (&KEv$+g," 4[FF!F0Fpf\Ev&\Fd29DF@ BOq ڿcC7 44"qCFl <@BC F4< *K p"!A#\a BrPFD{3+PF ~1qB?wQ0q#U  - ЎB?f03+1 y"e 1Bp #?N@ /-AFF{FkF(@4 F0F0"! # F  "2"Bw*F;F2"@# F # ##"+K )F0F#ks'h0G#k4 )F0F0 Kh #`hG c#+r k8hP2G kb!I# #`hG c&H~sF0K@k!JH~4O3Ov]#ah:6R-Ch kh0G8uvUB`h Fp@TFk Mh0G#!Oc`hCFЧh!8FSF8F:F(F0F(F F M-OFhFF0+k@6M)0*FP!`P# FtCF>++O0:FP!LP# FwtCF+!K"hO3R[Er FF#FPFYFz+Fv0FkCEE@31BFF@13h!X*FpQF#FGP@t&-GFKFFFO hRL58AO2B|`FFo-?, Cc""@2?$%B FF;`3hP@@I92BEs  җO MNFM+h[3 ўI  +hCK+_(ДI MpKh+J )!EJ;sIPFAF]{ @FYF( ]J@1 q(D! {:#sd+d#FrzKhuK*"-:Dh * rKrI (DqSnJ[ mJND#QFBFFEp+@# 0 qX_J.#Dh`h9t#@0s:A ]4AK@0)p9 c۵ ]V@0 P0c.$ z/CSO"p,J # 8Jd X q*KD)plJw; s۵AEp M$JP {! % 3BR _+#d F4FF@YA.&_&_&_&_&_ =z|&_[&_+&_Qz 2<I^.y 5J9F(FbD+ q0JVD/K "FhCv*Jb`]b@FYF]\#K@0! p {jB?qOaa0FFJ9F(FOaa0Fx| FO4 1Ff0h2ù! F0ж 1 p 4"-" Fh"F 808F1h2[Z`bh`eiUi F8@3h"+h jhZ`jh`hh$(F!+h jhZ`jh`hh(F-AmF FFO#xK4=-Ѹ.&I&H *F! FX# I`!H5 mݧ7#I`H,CFK *F",#h3`BF9Fb0 H|h+Чvh#+8FgF$m@2FiFhCF H FHO0 m( FiFy 5@#BpFF F1H1IJհHeih1hIE#!R""H,0ѧh +Чh9+IH Fp2Z`jh`#+`#jk``ci%bsh"Khz0 IHg Գ Fp@վa Fu0I] C9&pF$ FFF#FaB?aFB?`2bC``p+pFF FF&I'H/ Fj#,AF3"! B1@! F0)"! FC"@! F0F!F(F"hK0I HpHH Fr C9& F" F"sOsFF FB*F"K0IHOs)F2F FCF" K0IHp E'& E8FMO5~O3p1'0%J(F8F`O31 1 CF FFCF R F:0 F0+3D&0 HFV(F5FIF(F/AFTp+DP#L1;L1+DP#T1;T1+DP#d1;d1(F,5W2;2b.zb(F,5Cp2;p2pb.lflb7F# FFFF(:H1F! FD1N33@S,B@C,BS,B2C, FBS,BBC,)FBS,BC,S#N#0@0) FFIHYq"(0Ч#`H9!@)" K10IH@ J&) FF$I$Hq"(0Ч|#`H!@ѽ1+ڧj7#||(#"1 K0IH@Ÿ L&CoOrF!Q0H"H w:hF<1!IP03 F F033S< lKI FJ@+Ff\^p!FbI\#jFFH0"p1+n033FS< F@ ~N(FCF!@t13t1c+H/!d"K!v LG)7F F2I2H`#|DC*H%!.)F0@μ(1D1B0|18\ "T_HMQ-I n; f+X1 "K0I H0@𭿋mZe "p J&8!F HvCFѽ8@ I Hp)F,0H)Fg F8@սwp FFFQ kHD0I F3 Br K F-)FF"#FF##b03 "r <1@?!p@pF81FCS81x1[hh#j11QP8C5CEUH PA\A ! Fhh#j Fdhj,033S,S<_Q ` F s CBC % pNEsBC% px1hnrSCD#C sRC0F $T%usBCvh  F ! 6! 2<1CC<1<1sZF0-x1h F%($(2K1Hm)Fp@"(Fk%(( 'K"'Hmp@ mh81V H!p@##FJ!<1E.C!C+C F,", 0 H, O3,1p PPpFH N#x1Nh5!p@Ѻ+j+1F(F*mhC F<1p@TCoF FsOrQ@!0"H#0  h+F9FF@H*F9FkO0@")Fx*FH9Fw h/ h`2F9FH1D1 F  hxP`a -OFF gF`X! F 2"bFF SFIF h0 F32:C1C2X0#BE HIF. I F #j+032:C1C2!J7FhFEQ0-AF7U< 8,H A׼U2a CБ&FV !F #!@Fx1FFH#hx1h0(#j+% F . FA B+js33S<0"AFNmhH 1FQiu-AF FFF F.d$F F(h#j+/0 3` F)FIHQ F h1FEI FABH)F?AI F@I F 030+icj F0aѦh+\5HAFh+ /H> "! F Fb0"A! FA.9#j+ "HP0۱foQhF)F2Ft FboBiF(F@#j3 FKI F #j#" FI F: FAؾ H\Jv^FQ ;Fxbjl" F@glp+hF=03P=Cj4"!<1 033S<ݱcj030; F0 H"A! Fh0H Fp@i%FF F@-OF-hFFO 8,V)@FFUE  EUE#j+ЩE< F 2F)F F( FE)#j+0 FI32l2F)F F033S<KFBF F A FK F dh-A FNcZG!(FW(,"0>I>H(< ((>(D9H)F(S(5J6I6H@903H2JO1I.H0M+x+#+p<12F;F FwAF#+p#JF%IHp#JF#I'Hh!J"IHb FD!\1)FH1x JI HLxmv"!O0d0(mr0 )&`@HR4ZajF F$I$HJ",  AFH/! 81IH.,, O3,1( I# H81H!FjFa!b#j3 FE F@?-CFFF*xFF0J#`O4jC JHwII FB2S`h F$`P FxJ`O2iFZF;H!FFO4#`8h(U8FOiF0F xIFFj# )H/cjkb> > *** jF9F0F+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH F#" F2+`h`z`1:P-C "FAOqL0NIOH #%LH0Ob5OzqF(FF)F@F7Ѧjh7+Цdh +:H)FW# FF01H  x1hݹ5h%0Fx:x Fx> F5oh 50F)F(*FO1 F=F2`h x`FPKF"!r`x1h`Zh``*Z`+j+#"(FOCF:Fds U U ) FFIHh FE0ѥh7+ F@*h +ХhV+ Хh+н@H7-AFFFFFF-+٥7#:I `9HABIѐ>p/R"BJє>p/%j-Tф>P**F1FA"B+є>pB8-**F1Fx(#j+<#9F*j AFFH)F<#0F]AFFH5F#j+H ;F'FjS>0#j+ф>P.Ю5FFi-OhFFIF F8I"@F OI FtH00A F!FBI FdF(𯀘I F\(d0C0 S&6t0DB F F(ҀFO EG$1FHF LF0FNKFJ4`8FL}J{KAAO6h<1FCC<1#x1h/[ "(@x1h/n<1#C<1$&S*  F"FFHFD 4< # ;k( N(4(6($U(IIp( x( n(O I IYAQO $FF;j FPFS+8  E۱E "F9F qBDh;jhPFS+8  E۱E"F9F@FR0<1#C<1O0 F0ե#` SXmзB T(FKF/!F>x1? *P F4>EUen~4(FS*0  E+P5R Fб"* c K Dc`> F*> FD8ǒp1pFFcHJqF(p1tAt&p?J!?H Oh+8I9H 6(6Hw$p>02H ]3hx1hll1+,HQ"1FF>0 dh%H @&Fl11F+""t#FFP(C  "!,jDF IOr(F0I Hl1+?| 4[hNqKh*hQ`X`pG&`hpG-CF FFF0&K@G%J&H{>#KOq JK@#BѥT#`O0h`''`okg`<`lc4Fb0KO$qJH{p#eT00K@!JH{\#T0 pG pG0K@1JH{DdCd +K𵋰FF@#  0&K@Y1%J&H{ '$DDkB 2FiF b0O0 kS$0;>+٥*#`4Z R( CB(<$DDkB k"S$>04 bX! FH 0 F -$ F"F#4B ?"a"FB(?b"FB0?#bc#es,=%hE+h.hRHh ЈB0jhZ``(F 5FBjhcZ`jh`Cп4h;`b`b`l #UU0hXj k#V0p@pG2+Z`Bh` "a2+Z`Bh` b2+Z`Bh` bcO1F F@ -CFFmN'T0۹3h;3`Xh#l+alGcK@AcJcH{jh+ my F}h+h*A2cZ`jh`0G#+`ckk``ecb.oC"#KFmFU0lVp+5lKE"IF\h l"h2hh?QhkY`Qh `!i`Q` `"aFsha`a0@ |HB ,U CF*FhlIHCF+5oh+?ih@B?\cm/W0S0;YHB  5 BqX0G AqAa*-?)&`F HF~IF |Bc4 FFX-AF#OmFF43OaCF2FAF iFVF F m4((@- ICFH2FF4BF1F(F a$n<XR]pGM FFF3F*FOahhF8F IjFF F` MiR]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpGn<K0 pGnPMLV#O5`(F-٤@7#">FF"CF"=2ѝ0>0F#C0<#) F HN> 1F FF(є> *1F]h F dhhpGh F dh#DFB +"*+ ,F$p FF#/x+F" F( "1F(F|(:!(FPF(\"0oC !# "c;`O0p3p")FR!Kh.F;#Z1 R4oC"# "0F#!c3px.+i+oC"0#! "acO3cc O3c:+}X0 FF1$hdB#`(Ff0$E ( F0i+dh𵇰hF F' h۱ah(FhSx+ai2 ich01!0F*F $hh(#` iB@hx1hpGCj@hF"!hFH "hF hI#jFC$i~-OٰF F#!Or& OC F8H/'8FY#0 Fo:0ѕH8F  0[x+gF(_عHQF$i+yҲ*"#+  *> 0D6<1%JB (FS0"HQF++,йIRF  $$)# #(FK(d(FizsdD(F>0#P0lcd,b(F #k`{h`d`5}`@-AFF - i#\x!hD#` FRzh* - -*FhF( "052i%BD!DB,D#iBdh;F0O0 I" 0I" 0O0 04 %#F3SQ 2AҲ %D"0 !CQS"bCS!^!a"2C!S!^!A""C!S!)""C,0-AFF FF0H(FTAFz0|F H F 1h"(F1\4HH F s8F p3hFZ2`@#p] -AF FF x+#3`#` /!FFh1F(Fn xH)FO0F!"@F # # "F HAF$!F (1F(Fn(/#;p,0h `4-OFFFFFX+x"+ 8<"+@ :5@/x'#;'#0UE~E$9F*x+F\*@Zx5x*/UEs1FE&7F$F+x\+Q,@5-)F F(F ѤxO77#`8F,@E)F FF7F$3n (76666G666K]1FF,E6E#;E`", #DE$6FE+x\+jxx*{9F+F7FFm*0*Nb**,pѪEع7,иE##p #, #" 3Jhx 0 Ѝ xU0J 0+!UEӮ"UE 6Eg+x\+;U  3" `F*FF20 ؓB F0+?l"!,( F7F+g$(7Fm?'XXFxF2 + +pG+FpGXxCx + +pG?FpG-OFhFFFF(FHO=!FP@IBF@H FO O F-IѪF F @FF( "(F[L(U@*@"Z`8F E `8F6F0F  8F NE #0U 01FDU 0SD  U*p/=!8FBF!F8FV(O @F0F(HqEpFh% *i#jBi% "fjUjB `j # 3p, `5, `5-OF1;FFF+ m  w            | ? + X       +Zm=Fq !z   5     G Q [ g q    4'-?(FF{ *F!([" 1[(N7 Z' @# 0FoFh$+Ah 4-# 40C0 )-40HiKhB !#*FFFG #1H?O0 (#*F!F0x#I( #1s@@u-0"p)F450C#0*Fp#!EѐIH!(.*юH4T<"##Dp40C#Cc0)lQI(F#l1I(F#l1I(Fй#l1~0:]tw)F8FF(?`p jHV)FpztN40C0E-41# 2>I(F(4# 23I(F(4 # 2(I(F|(ФI(Fv 4 H)F!40#0 40CS0m0*F #!FFѐH40 S#cC#040CS0ݻ40#0ӻ40#c0ɻ40C30-81?3vO:041F8FBFKFZ(ݬ0BF1FKF8FZ(Ϭ#P4S-81?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZ(p43FJFAFZ}-==!(F4H03I "F(FpF4O0p#0#0 :F(@0#sC0 I "(FFF4p:F(?I"(F.F4p:F'+R*6CI"(F쐱I"(F`I"(F0I"(F([w4!!p")F8FFHO  :FF Y0 #0 RFIFM0 #0F05F(? 4  8|2F9F(?_pJF)FWI"(F(Bw4!p")F@ :F!0?b0FF(?[ O(> 94 822F9F(?pBF)Fq tI"(FF(rI"(F@/?? "D##" F8FIX 4+?cH9FbI "(F`H)F幷0p)FR 1͹ *F(/!(FFO3 4"1Z(?ש7 @#  'C` *Fe(©/!(FO3 4" 1Zn(? 7 @#  'C`s-j40?iX*FpX^40CS0T40# C0HHù40C0;40#01jcYVr40C 040# 02!R0##C0# 2"F@@0OR!>KSP0#S0#T0KsV0Gs^0ո4#0θ-ŀ81?ƨ2#4S470'(?h+H)F-4$ (F$(H-<1 33S<԰H?" F(F  I S`40C30i#*F!( (Or(rcrH)F]40CC0G40#C0=40#0340C0)40#040C042#C#Bb2# -qHQF40#C04{t#``-к$G4{t4{t4{tXHL-hUHD$ (4(FFPH)Fƿ?"p F (F I FH)FpF0(FF#;:!(FFб" +oA HF FH F1H0H=!(FF,I(F iF08FFF0&HڿFF&"I(F QF(E8FFVFF(8HI(F <Fh8FFzF(O6&'%L\/ 8I(F Fp8FFQF@FHsI(F Fp8FFv<F+FH^I(F PFOщH)F(O  OЄKBфH&v1@H/@Ѐ}H)F|I(F FFyI(F FvvI(F FVsI(F FpI(F FfmI(F (kI(F |FhI(F tFeI(F lFbI(F dF _I(F \F@\I(F TF6xYI(F LF&pVI(F DFSI(F < FFf^OI(F 2FLI(F *FFNII(F "F&FFI(F F&>CI(F Ff6@I(F FV.=I(F F&:H)FD!hz1,"Z(x1HP8F  8F3F"#p*I(F F8(FF(FVō%Ŕ;g@QśŢŨŰŷſņ|&V'H+hB@kh+=  ,5EфFO %h#j"`,"3 36 @FAFFF0F0!ܪ >A`=(F8к,`(-?H4P7#P740CC0 40#3040C#C 040##0-?(F4@h2+~ H)F較hh2׼40C0ͼ40##0ü-?(FF(#; F|I(F8WHwI(F vI(FDeG.>qI0F0oI0F(~IC25$e40Cs0z40#c0p42#CBr2#d40CS0Z-?Q0# 0*F!oCMHr4 D40C0:40#0040C@0&-??" F(F 4 Hz +> -H)F-??" F(F 4 H\ +>H)F-??" F(F 4 H> +>ЫH)Fػ `Ļ &+5<Uo-OLFF &FOY 0@6n.81H [j+Ѻ HOLD'BFj(F8O-OF FFF+G%K"`Q33S,S<Hy810FTJZFKHBFO ""J)F8Fh"FQ(Fm22!q @A @2 F]PFO ~4& -AF F)4 1+W1+ax1+]"9F0F"   $ 0g47+Y0 8g<7+Y8 @gD7+Y@ HgL7+YH ( (FA ٺ 1Y7(F ' 1Y7(F '"F8FF(Km T"0F,6v47;470F,6l<7;<70F,6bD7;D70F,6XL7;L7-O=FF I F(HO4O IU#CBbE##"-/#0O3`P7CP7N2[BU#O5`(Fp6/#FN1x)")F#0#3p F K@'J0p¬R·&`(FCx F+ #pN ")F Df7xG /#`O0 F#3pBKOqJHw7p&`(.^·0 K@ J Hw!KOqJA hC`¬l·H8LMT8(F^xU-BF F$P050! P DDP1KO 1OhB%/K'/LO hB4 Px" `V)hF Pl̳h`O0W;;>+٠Z#`4Y  Q@,CA@+٠B#`7Y  Q@,CA@<d@\`3FR*CFO4 F0@pG)F wr0F FFjOV?  *F9F FC]FF F&B<K!J +*ѣBx*K!JHv6 {Bq"X({z<FC{B"`)C+æcw-O {FAFF,@qpH$F(3h<1Y@;I:F F^008FIȐ(I8FF I8FFI8FFI8FFI8FF`I8FF0I8F%+@ɀ3h<1Zڀ FI3 Z<[LJJ 0l+JI+ FI F0𘀲l FI0𐀖P F}I0rj FzI00FwIF F0uЖP0soOr!Q0mI F0_Жx0+@3hI  FQ0;Kl*?(8I FD0!-?#@6 1+@Y F FX2CF@R%H'J"'Ix F0^ 0+Bhf^\11(5AOZcxúx {mXF F(?jBa"F E T FxI 20?Q"YFtJ FrI0EqI8F2(|oI8F,(vmI8F&(pkI8F (jiI8F(?fI8F(`-?`K`J)FFF^I Fl0? \I:F Fd0?0F%(F>0h%%(F?OBQI FM0?-? 0+?0+? FEI2F0?Ю F@I3!A06O:F5O3J8I F0ѵ3hx1hG%*2I F 0ѧ8F%(Fh F*I2F]0? F%I!0ъ-9F F50? 1ZY*ѦO%CF@F(?k F'[*f^\1ĉĒĻ$ĝĭ8F h(FCF F8@=8FFF:*=lb"P$#lc $0۱Ziʱle1F(F0O4 ,(J (J ,( F( J1F(FO40$//$4^\pFIE<;NB H X#`O0p"1F F4 Fj@ F0DFhF1AT1F:F(FAF:H F8I"8Ft8!F@!0H #;FD^BF(I)H}a$.3i y0Fv06I Hj6h(" F_&0 Ѡh+IHV# O#I"FHS(OsB I"FF H$iFxxk$KF &F;F+Z[X#` &F *ѽB Њ Hbchch0H8 e8@-H> 5\X)H(H'H&HX%H$HZ#H"H!H HZHHHHHHŅ{ŌœŚ%.7šŧůŶž F02HLG"B h"B 0hB2,0hB2,0]F F FNK0 )FK8FJ ] b)FKB8FJBFO0CB-<i`uCCBD:#U>BH-OF-FFp(6Ћ?FNIvZF 0F F'#x+HI"4FI" F4 ,O EO E@0F^#`O0 U   ,5U,,*!Fꀹ,=+h+*6jh=0F}8#" F FF *U,,Bh!F(" F FF *hB  ,5!@<,:\ "z\C{Tf";Tb] W^F𵈱xxyKF$[.-x%̹ F9<4p,F3$)[:2p,"p0-OFFFF&B`,Bm#<>0F (@(џV#`O0(яBџ"#|Qjx C   B)F+* FBDPHEٟh7# F#<O. 9D ;B@BEٟN#O [FFFD,B ",+F+##p-OFF FFF%CB*뱻,؟7#`O0TKO X\YF\  x1Fp@MLy"F1hF" xiFlF(Fpy.x1h,#>0B*2F!F0(mh !FAEi!F(FP(џ` /#0 K@!J Hu!K@!J@ xy!PFh FFԟ#`O0Cx+Ё)F1x+x:G0А"! F2h Fcg9FhZ#h Kx+ыyoC@ghXkkgx`e h8h0F"L9Fx+П|#Ix(`e(\-AFxFvuE5|2xEAFzx29FD:xF&F.8x2F!D|2 +D|2%O0𵯰FFF!!"8F"! "1F I f@@= ,ٟ7#`O4 F/ "F(Fi pG pG pG/J0FQhhz p%FO00"%I" F3#OBOq#0IHI#@"Oq#t0IH7 #""!f0 H)"! (`0 IHǕ0`nǁ8FQ(hCй(F#x18@8pF>`ư FBПnO5#`(FFpOr!hF "hFOCB02F)FD`&#hjFIOsh> *FD#hIjFOshxiiFI`LT  ( 1 KOq J HuKh++P@B O0ǟ!CjFlCXBXApGQ FhBF#cgD#Q00F F("!hF4")FhFjF IB + ")F F{CXBXA 0 (i8pF"!(FT k"!"!FRI *p i:-CF<]F1K@!JHuLKm#KO2q}J|K@!xJOb!8 F#pHF1p31caso`#`-F@+hB`hC`FHF;xsmXihC`hC `hC`h/Cso`oDCc`2#jC#b# 2h"! ]um^hC``B 0i.5x1F"0*F-W=E5.Dh /N /F 5ǜhY 1F(F:F/K?G7=Dh F 5Ϭh 1F(FXo2F톳>F65D*"!F0O0 <]C{%IFp(F:F^/?G7=D''&!L-C&FF"#Fb!#6"!0bD0F F/.F!F0FeF(PF!p0 ў2h +(FpO0,F.DBxB Ҟ#`(F]O0##DBӣh@/ "F8FF H} "IF@FPEHF"#D5F𵑰Ni FF@"!hFV {F"hF1Fh-A0h00 "i 0 I@#jF8F-I@iihE|Fi"  F#04C |2""!x2L-C]6FObA  (н BОz#`O00+ѝ0+ۀ+++w*<+6(Fo0@߀ThV8O0+)*+:ـ96սx8F(н 9> :0Н0+ ajѐ" "hI`0нX0bj FlBKx+++vKh #Zx* [h# #Zx* [h# 4@"!J"!F AX0;hFI0}ўh+Оh1+>I?H;0+3;"(F#Fx$**0;+ O1 !(F9 ]*xF(?: d Fq8F FN(?8@/:'B"0+ٮ x6M N0 D F!#R0+i@i ǯ KF#!3 Ff+  pG+#`$`V#` F+ F#` F$`V#`FF+I"O0pG-G%FF )FF"R! F(;#``3I4H8``0ܐ+FJF !QF5&``0ўh+`hB%IjF0 нP-ѽ0cH8`hCи0 F$' " \I`h 0I`h0AF FG(I`h0 a`( F.@@BqBlBp@Bf-OhFFFO#`eihM"i`hCF+FhsD Fh2RJEFeFhai rDB- B hFYF(F!hB`YFJF0F5iUD%DciaB!hC`?HF"O9!jFID]Bgh-AFذF+)#L5FŔ x"hш4(O3jFO!8F,I#6 #`O0X4(O"O31F,#8F"$B0h%-O5P*P䍭 iFP @$#"@h 0! FF@hh F@!Fv0O0! Fm0I`h0O0 B~0h!DBDx#`@@C0F0[+DFVű.؞(#`  `(Fmx` hBٞ"#(F#;`BhhB9`3,1-OFF *؞#DKB ОV#`O@F$F#F&F"FB  `+dAFFF˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#(DFAF\FDZF+2Fўn#`cSc FFF0\8+x #pO0 FFF0F8+h #`O0 FFF008+h #`O0@mShYhm#e@!nK h nO3#f03F$ F@Z8F0P33S<-Ր>0+)D&0ke#hx1h8B0YmkmB Rh>0+  H8@ 2O033S<Ԓ,he1pF F OqF]0`X+ha K0#h+0#pOppOr0 0cSc-OFŰFpFȠFF3 ѪH O0E HOs; S<VOq  F(d0 `ñ*.h( B "JBњh ћh`#+p(0> kpS+ *p#@R,hùOCk q"%? Fp(Os++T0k`S,sgH $@D,FDB. .d9h0щhB C#0$00#)@kFCQ$p$yDB+.<0(1+@Z#;`#.0;#F狱<0s,@<6#p#q<0 0.Ѩ+8##p#cp/KS BB 4.P.A.ћ 5+K0+:Ш+@3##p#cp00+@rF7#;0" F2,3"ZER;O 07,34'bE@t 5cFIWcSc 53B+#; %1 Fq2 5.D..LS<ը+@2##p#cp04D<S(? S,  ҲќBМP  .ѡ:*DEl  ,3}2x)B&ТBFS( S,#Ҳ|BАPB .ѡ:*DE:  ,3V;0W0 Ԩ+@#9##p#cp4 ;$< 4˱Y 3B M#; $1 F 128 43D(1x3B=#;( F x2 (1x3D.@..􉮗W0Z:F!;% 2F+(o!50BbpQ##pa 2PF Cp#p#q .y..LW03 20<1Ի~՗Z0Ѩ*@"FP!cpF3 2˱3Bs:<#;1 " F 12 2.DOs@~+UQ#p#p# q4< #<Sh+KHh03 " O00I H%h" KAh0IH rHȳi & FFF2CK@QBJCHs0 bihh1#` O *: b`)_С`3# *F3F8FO3`:#*F3F8F##a;#*F3F8F{#ca6#*F3F8FY#a!F@ h|#hc```hc`i#!*F3F8F;0 he``#*F3F8F,02c-CFPA}mOq (O3`fP#!"i +`PKHFd#+e#F7V< hIF(|#(1V<Nԗ cV60Fb((n12Fq0bP#CI((EjF@# F,H=:#hta1((=6p(1"Zp(1  #h(\0>`6p(p*"(1Zp(> 0>! A}jF*@# FHH3O0f#p] `FFi0/H.KBBABF!ѝh+&Hi '8F ] i H"F(hBC!F(FJ H(h<1E[ 5# #F0P F0`H"F%i< R8#(F$ Fpx+pTF(2F)F#U-OFɰFTI@FRFFr(d(hZFQFF(mМ1F*F@EHj0FIO)Or3F0F 6#RF[F(h4# RF[F 5FU `0#0,0+A.@ѝ0-N=@#+JOq8F ,xHH$ICF*FHFhH8F(HIO $H*ICF*FFHFo F~;hNdHICF*F`HF]NH`nb@sɃjɖ-OF$M F$NFUb FO, ,62B&p%B&F, ѽ0F V,XB3BѱFV ,Y,PFFHFT5,6#T ,@FT,5F0FC$ɣɫ*-OFF؝#`) FB1F tR0 B O #DBҝ"#1F t60O0*O!FZF\DGZCFIFF0F|0T GNQFF0Fp0<*F M؝#` & FS (ћ(O hG&9FF(FJ03)F+ t"F@A0O0 M I(FA0`#` t04[ 31]aS0[#h5 +D(8D 0-OF+[h@p_0՗o0ZFIF0h#FK ZFIF0hy#F(ЛK+A؝#`T0@$P0RZFIF0h#F(GC "E=0FF(U;  89Fk(4$B77W<0h0  mHW^}ʄʡʨʰk*ˈˏ˖ E ˜-AF@F` "hJ(h+F"!A66V<%w! *^!F #(hAi;(F*cik`jG2 F&H(F:F!(FD(h+F"!'h'`iwciV,Haiw#bR(Fi#3(FcbV##c"F#A=AF(Fcfh0-OFpPFF(45 0#՘J{mH\#2F!FBFhPMO O8xB3Zh*Kl[@+(@#OzrdO`hzsD F|(5 0uJzvHwzgjz {m #xB3Zh*iK{n+$*F F($<и?._J#hP([J   " *" "*F  0uLH  F-0k F$F(\2FQF0D#kr"`5 h#F"1Fh0 $7S : h1FK21 r FH1FF H F@sHC1FJJ ׷̛ Q8 PFHh# F3d8@J!. 8FP+h;+h#F J!hjF FH# F+`Y# Fd8@8 J! ;p PF1FH1Fk*kHd hJ#!+`#FS#c Fd0p@32"b!2> J! FP`6h;# 3F F(C0H ;#h<1T,I Fd@6 F2F9FH#h<12  H@P9F F!/2F9F 2F9F(a F0K@!JHr  #hf+` (ah F F#$ F@W͉͒͹ !h0Ch0"2-CF` F hhiBrjBX0F(h3Y {̀FIFF&H hiі@0 F)F" F6F!%#F"!eI FdN##C"#[ [C#h!{(F h"!K%J 0Fh<12>#F!$Phih" F# F+`# F 0iZЛO*` FQF` FH F 0@M8F0P3 FFȹ HI Fd8@V (aH F8@ 28W͉8 PF H Flh0 FCh0#d8@J! -CFph7X<@N#33C23 4FFѧHC"K0ѠIH81 23ѝI" K0(F0їH C@ &qdh9fX6(FC7v2C(FCܽ33C. (F-h a3i2F(FyIFh BiX< X,r2CCi#3h*6$#i(F1F#@0ci1F((FFHF`a hJFf#i!ffah0Ch0(h|hQK B#3h+E(FCBHX<#k3(hiF(x ?? "k `rEv 4H th|#3cbS#cck Dcck Dc0KE0@,#h+p##`7dX<C (F8H CMXl?v3C`jF F H9 &0+cSc9QV0+?]h+?Y0KE2`jF` FH(F(h+F2F!cX<2CД@ r K(h !(FC7(hKr 8 0FP33S<Hh0Ch0# Fd8@H FI hiΌδJ@t"hb 2qs C ]KpGcn#h0BI]KlJ-OF0PFFF# x+@jmKhBCF:F1F F'Oe> **(#j+;7 cE85# 2F h;F0;#0 ?0"Fx;33FII e" ^"\" B2BFb FHQ#Rh Bł30|H 'Oܽ+h+wI3F"Fx (+tI3F"Fx#O L pB:F h1Fv@dI3F"Fx \P3+ѹR60X6#2F h;F0VI3F"Fx3FTI"F x81F h:FF@F LH0F~+h +#h<1FI Fh hiv h!AK*m,+m##+e'[<+<##F 0B"1F:F h06+7#3+[RԹ@3iO #I3F"F x:F h1FFH HCFV3i+h;3@3i;3@I3F"FxF D(8JVna] ϛϮl#2F h;FX(+h3+!J+h+х@3ikb0kd#c3FDI"F x+iBh8FF`( **XFXH AF;FRF)F FIdhЛ-OF FFFCB AI AH+F O-! F*F-bٔ@+\cz+YѴUEUO.OBK T(F½ *>2DB;ӽ D*7h1F F"0/T(½ 2h P"iP" ʃ !F)FXFXE F H !DkFHF оp)`]F FmIH\h#`hBBiF F^AF3hCH  I6(F ]phiF(F7`.m,i-A"hhF AH uh- xhE( *FAF H 0+1h;*FAm+1h;*FA-A!]O0FFO RZ` FBF!` "a :`"Z` x$:`"B`I2FH0n "FrC H !]  F FFh F!8F@|iK`iHhE(A F>,hx1h K rO32BеhO32#38 h*[h7FP50f000>1(R<(C#B<#+ +R4 F(HO*hGa`2h`"a` B``3h`(hDF0h F J! ~6hBѸ+0-GFh O Աi'h.hx! RF4CF0F3Hp0 ##`  !HF萹`hCh;C`+ډ (0hZ`x +AFhFp(-&1F(AFhFpAF,hFp( "p(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+&`H&cp&`P<K[h;"FFe(HF( &`H&gpF:K 8G&`H 8%L`h%`e`8&`HF "F! 0K87F ,H&`H&gp8+FO*` Ȅ ,`8 F !F" K87F ,H&`H&gp-OFFFFȿ`O̿OO8m0@F4`hBh [(QF(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-GFQOF(FF;hSJ?K))F=I=J(p( F;HMkiBki3DB*n1F F(Hh3/$ F"F F/"9FHFh9FFHF0p;`oB0B F"1FFGF +i@FB< Fp&krT -O FF(@gM'B,ؕ)@,Kh0KIFG0ѕ(0+@O ODcB@EȀ.hBٴB khB9FFi '" E,##𦀻EihKBzl'1FF( 8)i l1b@3E%RD@4%0+Cѕ*0#:F! Fl`%RK'0CTH "#9(F C8De@ E  ";Nl@ %03:F!3*0+,!niE8F_+iEK(FDFH0FF0p;`K)@KhJKIF : Ѧ   D 9FHH% BF*0+BFZ%^LF[ %Z&krT &l0𵅰FFh/N(U=FeCі(0,8/6Ж)@,I(Kh'K'IFGD +9F(F4BshB)FdF(*F!|'0CH "#5 F%(FF(Ж%)oB0B*F% #`&krT T-OF4 FA(0#^&@$/8F0BFn\ B@ҐB FO ((FO3CZ (O33BXF`Bo ٣S@  ј%0+ЬB*8Z!7 )|0B0B!  O2HFF/H`0" 8FSFCF&HIFh FFh0B?o*Fp IFHV%0[B Ҫ0Z!\.c*0+ЬBbp! #`h)0+KhKIFG FFrT&l0 &kF K'0CH "#3P, F@6&kܹpGpGpGHpGrdHpGrdK0h3pGXK0h3pGXK0h3ppGXK0h3pGXK0h3pGXK0h3pGXK0h3pGXK0h3`pGXK0h3 pGXK0h3@pGXK0h3pGXK0h3ppGX9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpGһhF;+`ڌiB (]Kf h\ `p]KpGipFN$V4(F Fp4 , K +K[hG pGF0 S pG0pG(h9!HBpGXK0h30o O0 pGX@FFR;BpGFpGF FK0h3pGTK0h3pGP7Fx M K*Fh@I+F"FH|0L%F` X(9 xH+ pG pGHpGrJK3( FFpG 0;+AA- 3,۲ ٚBГBO0 , 2ҲB+F0-OhF3hCs`,q(FO #"!&qh B  \( 9"0DD 4"FPFDD ` ;ѹ і.` 3 -6$`O0.9,7KFXhB4`3,-$`#\C Y ++$0rlкB@F(:FD-OEҗ #`qk-*`$KhBKhS HpGlLKhBKhS HpGZ0@pGpG pG F H I FlHh IFH|jI n@HWXVR]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBЗ#` I)F `J!Fh 'EhFhBӹh "` J"x46@d(T`x10: (X&l\FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00X`]h;iP!0xCC@! pGh`K3pG&l\8FCi FB "iOBF( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:DL#iQ-AFZSBF FSA'0ip0iF FG2BҔtu(F)4YB7x\*CZx|*@0iF FGhKiBѣh #`t0+u 1R"B0XB`x\(]Xx|(Z32#`x|*xBoiF FG3)YBxB[xBBx|(632#`*=*7ѝ0+3c Fi DOAA3OAi Fi FSRi"OA F3\Z*ѝ *ЙB! F+  FiRiOA F&l\UiFFAi)DXi#ii+Da8F-AF FFFhiû/$ݷ.󮀰F#3D+(+++)Y.ݶ@)F F?FFOݸ &&F#FFa2+FROA FCF" FiOA FRBi)F FR"OA F6i" F9"OA FA(V+FrOA F8iiOA FRi)F FR"OA F i" F9"OA Fi2F FGhiF+'2OAR+F F6iOARFF)F F.?>FHFFi F!AF&N FF3h+#OsB-#@\ CTkK52hh*!Oq30B#@"\C#TKh30B#@b\CcTj"j1N 8F !@pjbZb PTP-AFs*hBPBxB Tx], N ,8x(`!(FA "F9F@F8@F$B0y6!r#BFӃh #`K31BґBx[)Yx.)3 F#`2B ӣh #` K3"`xYBx.*Zx]*3#`&l\ HJh0')б` pG pGFpGXpFN$V4)F4 p , )KS<GFpGF(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6TP-OFhBhOkB"I(FFPOA Fa#h3#`"|I(FFO A#j@"hh1N( ! FO##j@"h`i`!(F#jiD#c2Bx^)3#`#c#hB x]*3)F F#`C-*\Nt1Bx]* XB-*@ׁ[x]+ `)F F(2BXh+KK3U-*@ȁ ! F3#`Bأh #`f#hx-+]+ѣh #`f;Kh"hBx300 W/ ! F#Bӣh #`f2BHYBEx:*BZx]*?3#`2"`:F '|F(l FQF)F F70:+#OsBij"(j1N !kj(bZjb h #`fM&l\X3#`Bأh #`f#hx-+]+ѣh #`f=! F)FF Fb#Bӣh #`f2B YBx=*Zx]*?xh+#x-*@ZB@Yx])"`-& FFWE0+5WEݣh #`f0+#OsB ںE׮:F7)F F?3#`Eɮik"(k1N !kk(c #p3kcQF8F(ݣh #`SK3O YF8F{( QFXFu()F F  эZ"`x]+h+:k>#jiBkxCkp;K Fh/8+9*j+Ckk+@kj+=k+:ѫj?4AF FY#jjg(k@>(j7D@"!(FB"jh;`#`W i\A B2F0#jO@Q FhO0[*Zx:*?@=*?Ϯ F1BF:F)F FB&l\j FpFi(KI h1!I h10Be F#`]#0#0 c` se pIOQ F p@۹XTP-CFi `\ и[@HVB+xChBӃh #`K3"h@)S#`xBxE𶀸Dڸn"jOA Fl]d -*Fb2B YBx\*[x)+)"\! F -OA Fid*Fo6BtZBqx\*nZx)*kѝ%`BUٛx^3ܸ"ڸ"Vt<+_Т0O`Q F*FDVVt, F1*FOA F6#j"Zdq/Тh"o(Q!@{E ! FZ#jifh#` c`[KBV@ O Q>"OA F"O Ah #`KK3!! F ih"+ #`@Kh3* FVB$XBXA0*+"Ѣi;F F52OA%`i FOAi F;F2OAiOA FkB+x\+kx{+5 F%`1BF0x,*-Z"`B1J[xh320Z) FBFݢh "` J"*F9F F2BYBx\)Yx})3#`S+F&l\^ ]XOs!`#hB YBx\([x}+ ! F!6h #`K3ܸ*?K.?hG&l\h^`Fxi?)πء$ڲ * +^) [)Ҁ\)Ҁh+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! FE .OA Fid2F2Bӣh+FБK3Z"`x)+!0Bx*.@?*@3#`1hK*53i+FOA F2RiOA FRi)F FR\"OA Fi" F9P"OA#`! FP"OQi#j!jBbZj2Zb"OQZ#jjBbj2b !ji Gh` C`UKgO Q F8ChBӃh #`IK3#hZ"`x<) >) РoX Fe"OA"O A!h:K)+*3@𩀢iOA+F F2RGiOAR "`${*ZB,H[xh^0@"`h$K*t3,+Уh #`KZ"`c`h*#` F2BFx,*@Z"`J[xh320Z@ FBFݢh "` J"2F)F F 2Btx})q3#`?&l\^ ]X3#`)+*Тi+FOA F2RiOA FR}iOA+F2 FRiOAR Fm "` "`+*O 3`?X"**1BTx*(?*{*JZBFJ[xh320[= ! F7?*?{*?e3FOs3#`#hBx}) ! Fh #`K3X&l\+-GFFFJ ЇhBCL nF KB s "FF'!W%0 F)FP" GDu rO" H)FI+FK%HuPO5" " R""tpOa!hF)#a+DaY#B #}K32BC"OahF"KaaaM``( !hF]c`)@ch FFF !cPFP{xC@_->س_!سo𔀳_kB)Fc#k!cO1ZhFx2*F)FhF_rг _kB@)c#kF D)F#c)1% OسOسOтFOMгOOG9سOeFPF'xGhxCO5гO2гOk#jC#b-?!@`c(@!(FF(@🀠c`kX#cc+k#0O $pB OгOpkB0)Fc#k!c[)F#cxGok]O3#c`h"F08Oг@OUUT S G G V&l\-F5x))D)e)D_F!c_hbcX+xG_+B%s"T}AFk+"ME##`#ld`s`Oe#3`#j[!hF:0FN [rC_Bjk@!0;X!(F*c8FWj#:@#3B<+FbFG"0Bj\E:3Ҡ Z\B B2W# B$ P#AE@#@#W#03ELLBӫBB8W" 8F\,k+?n3PxAOбO бo+?_#jC#bYB8F; F(K Fh+#OsB$K"jh#KhBak#B$&cjB-Ӡk\k+AX@jk30730pB60BѠk@ 2"k2# Bܰ B3#j(F3(6TP8FK Fh+#OsB \k AX@8k˱ K4(Fh3( K(Fh3x8 8@pTP-OF-FF FBԀ2hShS% xCO9س _س_ހ__𥀳`_𣁥L F@_𫀳O𞀳O !سÓOiS' B@Ɂ?0O:س OM(O𑀳O OOOѲh)xIh0FO  QQ0!FBFsSFqF(ѳh+D8O@O3iB"xS10 _*2Fi+kh  h  EKj)bk*8k?_DEw;xR#0+e=   BZљB! @(!DD#DF7#k+E8F' RFYF(耸cl+? ' RF F(83HFF |D [\#0R B,?qEM[FSEF8x3 xBkB8F $ (ѺE~0Fzcl+C 3 l04 +?L 3l"B\ blcC\ ZFعFYEh 2 F(\F w(и?y ¸OqOr#?f $@E( 6  =F(EJ2lX#3 ZFP+0( >F%& &&pGpG pG v pGpG pGpG8#MF`+x %`8Oq(FU( &lh7FM+xD 0(%`&lhFhx[@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!HwHH &mh (  pG pG$P0/ 2#0/O-$M@PHpL` 0p`T0*0S P000_ P000T0000S Q^A 3 #Z20# TP@P0U*  T0 B2@TPT00#03R0S0 SX00G0S.T0S 0) QX 0[00 0 Sq 10H00 R03S XMX 00 $Ѝ P00#03P 03S 0 S: 00[ T0#3RQ R[#  ) H00P 0K?oR20S 0SX 0H0SX0 \H 0X0  Q 00 0H[FI S 0j 0z0 C R9SA 0 S I0 H0CR2 0% L .0 Y0S100u 0 S 0D@!  E PT @0CX 0 0 0$ЍS $Ѝ 0 0 Q 3RAZT00S SA @ PTP<: : H   00v0 R03S; P x@-QM@00(,4`  P"URA\ P0 `U-00ĵЍ~0s \pFAW`&R,- M sЍߜ@-@MQ(`0,0  P"URA\ P0 `UU-00ĵЍ~0s \pFAW`&RTG-M0p`@0W PV P%X P.Y PmZ PNx P4 P j2Wf  c2 ^2V+  W2 R2X  K2t F2Y5Z! L ;2< 62^ЍXYZ-  %2  2  2 2<Ѝ  2 2ZVX  PЍG Ѭ Ѥ | | < T Ь t |G-PQ⼔M00R p000`0 I@P @0S nS a0CSsNU2  0oSm oEPN ЍfEPZ V000U000UEP[Z V070U070PDEPZ V000U0003EPZV000U000"EPZU000V000zEPZO V080U080i0@q@DPZ: DP DP DP`ZL V080U080?DPo DP DPJZ8 V000U000"U080V080U000V000U070V070U000V000ЍU080V080U000V000lDP TyDP  @ Ψ \ L ͠ d T  , | ˘ ˘A-`M_NP 0@H@>S JM+;  6"` `0!P P3P0 (p* 0p 'Dp@ Bp@  p@@@dF DFF PFP`ЍF00@|ŸO-1MM @PD 0"$H"Ġ "( p C.F D`lpY;@D8 (@y0Sn pȱp đ`  ᰱ00$ %0!`үt0p@ !0I .0S+P ӯ0S RF001ݍЍF0S 0K0S R֯ Pឯp 0꬯8D<4! @P 0 030Z  0k$0h,R gH1ݍЍp t , T \ H0@-M 0P Mp 7)p@ Pm _ Ѝ00 0dЍ0@Ѝ0A-@@0s- ͰPP0P0 p` `ヰ`D0`0Epp9X`p E``-0`0E 00҄@p@-@PCM3 /3P5 @@pPC ` @E000t3 8 C>@F0F 00 P4D@@70S VS00 SCލp|@@0S}@0P`0` @0   P@1:E?00@E00 Ȑ d lp@-MQM@P4SY TE /@3PB QP0s* BP Qa0P `rpH @0@ ;pq? H p8 ۍЍp+0si/%@@l00p +; @P0 @0  P@1:!E?00 8p 04E0#S @E@ E@*p@ E00Ǩϰ|  ä ì@-rP`O-$p(PW,0-R`@/U'Y1 0/?Z0 0?Q :?["J P5#I x@t4 2px 2@zhPY@sUZ0[%J @-DM@ P- j jBp P P rp~@P Q X @P  pp0S00S drdpE~@P Q<@P | $r$p*}@P Qqp@P Q>p@0sSL qppw@P pQ 0R`0 la`+nc@PD `Q .S0 0SQ0 a`EnH@P) `QA 0.Se00b0SX0}0SO猀*@P Qs00   1  `  L  dA-@PU 7UP7UP!A`FFqP ``P 0!Eq1pP 02PO-M\0p0     pf `0P菟䟟l  d0P0p SD[1S 0q!S1=S 0q!S10! R Zq[# H1S 0q!SA001 S&R:p' d  Z0VPd p <p SJ .Q  oVyfp !0C3Sz0)#s]Wlkq9nmxWT=b2_u`TTO d0]qa`0pPPA(* 3!R̂ \ A 0! Rh ^pd0R p =d 0 V1Pd p <pSC jlh Ѝ  ` 000p@,ADd0 p@1CPd0P  d  p   $[ '[1 P /R  q R[,  ^h S:pX d0p@P0d0 ;0p 1<65HP`p@,0\0 <Q0 0 =S000@D\00X h0p@< D  ]P`$0Sp@"Dxp@ D ʟ !0\V`dS p@0 SD Q\0sD &[p@ 000@0T,0p@0,0O p@` I(00(0D$0Sp@"x;p@0@07p@L0P dSl0 D&00DDD 0$0p@0$0 0p@0 0p@$(^0y<P s =R 0m 0X0HL0L\ S@Dhp@0 SY<QTH@L^ $hp@0 SCAP  $hp@tP %0P 0t v> 0d0?`000T0?P00<0?80|0D0?@0x0L0?H0?X0\ 00 0$ R p@Q"2"2B S"2"2@0 2 0S,0"0x0$0S"p@xyp@00sp@2/0 S *$(P0<^00 =S$00$0@LX \00h000c0; .: 6S ^00\$0/,>! 0E  0E $ $Â!2c 0R,,"΃0,!/#1    (  ͌ ( $ 00S %7 @:h0p@@0dp@2/0 S *Q00 <S$0 h000c0 : ,:6S \00^$0/.>! 0E ! 0E 0%!E!2c 8Q \?H/)L 0 ́/0,0S$00#0S >! 0 $  .1@0HL  h0M 0C00000S P  00] CQ 0e 0 00 N00 00S \ ++;  +; i= =M S= =O0yz O-M@p4<k`00<T00 W) 0< PL  ?0P  0P@v>P 0 1?1000?0 0@ p0?0:  :K<[ 0+2;!44p0000  000W :0x0PZ 0TPM dPK4`P0S| Ry R u R q 0 0A 0qS A ?@$p'@TpET0}Np0q A01<쐝 0vD HJ0 0I0!l00R0(S1R0 x00 ,0& -$$ QP|' @  "0@RS0S S  x{p@ X Z 0S0Y|0[x0 Rwt̰ [[,80>C0: :J0'0p@`P V x0S ;Ї000@pD@ x0@0Pe l  0 0 ^0 0 0 R1 R?Y0 0 0#/!!  . /J㪐 B 0S!0(0S00#0S>0 Av.@ B Q PS000S Q0]; 0 yq  0pqK;0Sr@T`p VP} 0 ?oR20S9;00ߍ!1;x@!pwq@1 Q# 0  pS@'NRp$ \TPx0 P0,P\000 0  ZR 0S 00@ :x` 0}p:0S 0 0Y0ZS 6 x  qe x] xU xM xE4MZP Fp@:0SF L6)P L@(㏂@"bX02,:"  @b"R0% P&qLPP& @dT0@l70p@;q:0x`P帐开0@@pD@nP ?v  # K R#0P- q 0X/0 U#10">/ 0%)$B@C "!!b0C0/,[0U @`0&"0 S@D=A^ >0 $|pq8 p@8@e:#00:0S8p̰@1x p@̰p[@%< 0 "2#@T!9!Q  sP9T0090S  @0&"900p@9T009T00@-@ባ aBepʣǣģTL00P 0 0R/P/ / 0 $  DP 0 H Sp@-`P P 0@ #  TQp Pp / H  P/j.0 0# /P/x000@-PP Lo>O@ 0" P0 0A-@P @`pP@0% P PPA-`X@@P jNpP@0& P PPA-`X@@DP H@pP@0& }P PPDO- M` pP8 찟`萟 PP P oN@ & TP P0S ` Ѝz ,/@ W 3 n0p0S |A-PpQ `@Q P@D 0DB(000S  N <@- M`ppPP( v8  00S@ k80"S" 0p000S0 7/ ЍW80"S1Ds\0pT000S @ Ѝ1Ds$   @ @@-@ @菣O-`P MU PP2S8pPK P@N P K <10`0F@P6 0nS# =%PP00Q Q {P  K@^ B"  0\Q 0 000oS@d000S rpp Ѝ4  eb` 8dO-BMM@p7X 0 0QDP:t%PP $ EDPr0020P0 C `KP@@0 PP#p 0P0  0PPp p@P$ \zРD 0 dQ`k`V` pP  r| 04P @PP0 PpS Q P17 00BލЍP/U ` P Np@70SS  t-PBލЍ j-0H 00PPp?  j 6 P00 0O-h!0 ^0 06D 00 0<-P`60   CsoI00!6 00 0-PP{6 00 0 -PPo6\ 00 0,Pd < 0@ X <  H   t l <-M 0  PЍ -M 0  PЍ >-M  0  PЍ ?-M00 0 =PЍ --H( 0P    0/ 00p@-P,U@p6,,0 ? P  5/p| xp@-PxU@p6,,0 ? P  5/p L@-@P 0003/ 4@-`@P 0003/ p@-PU?o@20S 0 003/p4 p@-P`UV00P00@Sp$ 0P5/p `p@-PU?o@20S 0 003/ph ,p@-P`\.@Pp5((0  @p@/ p@-P@P p 0 003/p -@- M  )_p@(0$003/ Ѝ@ Ѝ/t @-_p@0003/( DO-$M`Pؤ@ 0 0A'0Sp$Ѝ"50 (P@@4/$Ѝ O-$M`Pؤ@ 0 00Sp$Ѝ40 (P@@4/$Ѝ X!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// ///////////////// H t d P l ,   t d P < (  ($0(- C^ 0C$Q :$0S 537 $05, 00 $0(00#  $0 0@-@$ MP05A05#05!0%0%vP$00$0Ѝ0$0Q  S,0 5,37$050$0/S 5<37 $050 0$0/0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-0@DMT؆p 0 \0 0  R \0 \o:#5B$0. 3,0 @S 5#37 ,05Q0,0m,0 S 57,05 50,0S R0#0C R00CT,@DЍx:#5B$0P$p 0 ]T@d 0S1 `@@0 SS( S R 0C#@ Z0 R,0 Q ,0 0,0 RY@0S80S ,0 S 5>37,050,0 @Q , 0R0537, 5 05 , RS #0C 0S 0C 0S 0C`V 0FV")VU* FRQONMLKJIHGFEDCBA?><;:98765bV5?Q/ R,  a2! A,0!  @p 00 Q,  \,  , Q0@0RfV ?R0@SQ  b@S9 B88  C# 0c1#00FV , Q 5075 5,5,00SQf05= 3 7 0,5 ,Mz@0 u 4/ЍpG-PRM[  `Tp{PCa@/P @1< 0p00p. Ѝ80S&  0< 0 p00p10S0< 000@ pp10Sx 10S X 0 @< u100q100 $ H @ (@- @MЍԅO-EM MpX@`PFp+' %D0P@&T 0 D@0PTx 0  Q`  VEލ Ѝ100100 tL @-`@M pP2.P% /C RP$  rR$   0@ P@f rR  Ph 0 @YЍ0 Ѝ@0rS 0 0 < A-`@#p 0P/S /iCP @0p S 0 S o 'p@-IMM@`PP p 0: S X0 0wp IލЍp0O00@IލЍp|000 Tp@-IMM@`PP p 0: S X0 0Lp IލЍpY0O00@IލЍpQ000 P-M 0  PЍ 0P 8 Q  8 //p@-@P P`P w PP u sP  p@*PPp-404-0 M  0 ЍЍ/(0P --M  Ѝ Ѝ// -- MNP8 00  0 ЍЍ/ߜ00-@- M@OP  Ѝ@Ѝ/O-`Pq,Mp;  RP$ Ppp @P$rPX P@ @ 0 PX N ,Ѝ000:Q!0P00,ЍF͌(Y P>C͌ 1S PD>JB͌81S P=̌[ P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@P@P@P@P@P@(@P@PP@(P@Ppx@PqP'( @Q78 x00C40S000C,0h0PD 00Hp(0LP@ (0a P[ ,0` 0` 0[ k V2 p @T   @T,0[ 00 p @daXh@0 0p@piP' W 0 V `0 1S@ ,00 0 A1S D 0|0 0?piߍ00m,,P࠳0A Q X,@<00@ P$8 Z&  B  @R=     pW  PpW0,PZ  p,匰$ [ !p0@ @pP X 0@0 @RP8<0\(04 0(0R"DHpLP@1H00PXPPL$P0P0 001P0,0P00T0JX0`P `<@@(p08`0P0J0DXKD0T0p`,  @  V f`p[0@0 PU0 PU0V,  @ Pܠ就ZP 0@P_P U ` [p0 @X @X0 0SX , \ @@ , XH0 p0尡_D0|H 0 >p` p  0W  0Hp `  0V p 0G` P  0U `H P  0Z I P  0Y JЁJ P  0X Kq Pp  0W L^ P  0[ M,00@P0(p08`<@,  B U+@@0, P  , 0T0H 1ʙ D@  |>p+P0(p08`<@0@4  P ! , @PB BZ [ Tb0p㸀`, 0(P0 08@ < DX\V f!`pX3@ 0 P U  @PU 0V,  @ P封[P0 @P P U `0Xp8@(P0@<DX\Y2Z,< ,0pPC`@ U*4 @,0@1  ,Y0 0H 1 DP  |f=p}pP`@@0 0 0R> $0SF 0P,00U 0e1$0PS7 0H @ @  Z  @ Z , @ $0Q1B/P`PqP/ Z   `P 0,0 SS,0 P 0`0C 00 `, U# 0 0 B 0!0`S:  0 P 0 0 @ T @T0,00 0 @0,!,0R0@0 @1P``P$P Z  P`$` 0SC 04 ,01 X 0h1 0S3 0 L0 P @ 0T0p00 @nT0 ,00 P @T 0Q1V@` @0P T  0`,0 S\,0 @00C00, Y# 0 0 B0!0@SG  0T 0 0 PU PU0,000 P0|,0Q0PPa-@ p @`p|0P: W  0 `@ 5 0 0R080000SO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @w0S py0S 耍 {0S  1s0S N }<@-M@ @ 04@P$( ,Ѝ`0@-M@ @ 04@P$( ,cЍ0`0` 0 R/DDQ @Q$00?H/0|$T0P0/ D @  R #@ R 00?H/@|$0P08 A-D   R'P?HU0`@S,p10 0D C  \(  @U2@U #@ R 00/|$0 000tP h H ?30 R - D#@ GR<0@ 0G//|$O-PH4M  0pS4ЍP$|  L0!100+:|@Pa 0`D0ZP`@0PZ0 TlP V@|`@`D:P! ?3 R #@ R< Dp H0L |" 00( 299`P0S R,@PR @P0 : R0`Sr4ЍT `@000  0`Pv @|`|$0 00_0`0` 0p@-0PU 0@S &PJ;pp0p@-@P 0PS P3$pp0P0% H -? \| 0DR0 0 0R S0@ 00\R  /|$0 000 0 0 /CO-MpR@l2P0`0Vu T2*PP0LrL 0@2@Ÿ8,吒002唒圂  $ T X  \ ! ` 0l01 0m010p0npp 0@z0匲 0吲0唲0圲0$TX\`lmn 1 1Q0'0 0 0 0 pЍ|00 0t000x000`0\0X0X0T0P0P0D0D0 @000 h (d0C-pP∂M@ `P `2Z@0@ @ 0""BBB `@"C @@CC3PU C* pP pK 0p R\ @B0 @@@(P9 0 @@@(P. /p* #p& p0 @m(P  &c000S :3S ЍP ZB{2T@ T`Ѝh0SGpPb@ IA-Z`ppP ZBR2S@ T* 000 R AX A SdȀ1[0@-0tM,@ CS*>-0R< CKD[1C+D;1C Q11^0fKh[+v0x+z;0#0| 0:01_01o01 R 1 R 0S8Ѝ0Q x0 0 0D\l0A Q Ѝ0'###|<>*!f=<@<0l 0 S/<,G-MTؤPpk @+(@xT($p 0CS0S|3hPXT$: 0Hk{+K[@+;, @`-@8.@0@ p <8%`($P4x,~@fhjlnkp{rKt[v+x;z |#!d""e"#-@#`"h# #:p R 0S |(@0800S \ЍQ (2 0 0D'~l J @@\  0(PU(p00Ѝ>A@J@ < ^v#x:'# #H#p--`_|o}pzrwytzq{n@|kh}hv `afghijklmnopqrstuvwxyz{|}= D F=d;X;@9 :A-'n\PP p  @ 0^(PU 0(`8O-M`6 6006006000Jҽp−00SVF 9 p :p PP_ ^ p?P4S S SV0S$pPr 0@p   $ `00 4S 0 0 40 s0 0bR$ 4S4 0P%00Ѝp PP 4P4 $0$ s 00bR 4000P ?21 R R0  ;0 $Q B q 0 ; 0~pP/4 S S040S% 4 000r0  cR$`S ,4051E ` prd0  ; 0N p PP4P0uP0PcRT T4Sz0y$0P s 00bR4S 000V0SgpP 0@  ` $A `00 4S 2 0 yS 2051E `@ pj p 0$ "P0 s0 0bR40 ;0pA P= pi 40 s0 0bR4 4$R2P0$0$ 0Cr?o  aR2$$1E00#?c p% p 0pU 4 00 TP0uP0PcR TTe40 s0 0bR41E00#?c0`00$AR r  `R$ $ Q 0 0 0 4 00 40 s0 0bR 440`00T0! P00U tPtL`LTLHKH`GlF  :0*- 0 00044 4EDO-@PTDM4P0+ 8 `$Qi w :Q|#R3Z 300S 8 p &pp <0S p 0S A2WX R J1QQ00AQ0S  B=#ZQ 0*"R S 0A"W0( DЍAPAP Q P70:Q !1 0!0,: ADЍ!  |p p 0P000@ 0WZ  6 8t a82 B#3!0 00S P0 @ 3!  ?pM0@ V0S0:3S X00P00I! 0*`00 <00 ( 0 000p@-@Pa<ppp@D0D0p@-@  @PN<ppp@0A-PS"P @pT $T`0 @@TPp00<V> P@P@P@X@-@P @P !P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o" 4 4O-P0MpfS`pdvpJP U0ʍ p 0rr I"Rp 3S(0$00 0PK TP  0XSڤ%$ T 02P50 |504S0300SR p0SO 4SI 4S 0d/、 @V㌑T2p" =PS 00@p2Z LQU P P qP ᭼᪼oY=t3@x2 P[ 00@x2X>3@|2  Pn 00@|2gЍH5S4S 4S0?o20 D $l h $ <% p 0$0(0fX P Y P Z Pp2?;~0p220PY0$ 0rr H"Rp2XF  P_Z<3@x2\  Px2?;~0x2V  Px278x2Y P<3@|2Z P|2?;~0|2V~ P|278|2u1S0. 4S*yL%R'oZVd  P_x2.#@|"78x2XY~Z->#@3@tx"|2KZV/  gP*x278x2>3@|23p2Z0@p2RZW8t2=3@x2>3@|2%P ᨻ>3@|2P~ Z<8t2=3@x2>3@|2 P>3@|2, 3p 3 2  00 00NȠ00- $ Tx Xl l  \pT 0t 0x|" Rp 7804  P X0 0//O- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-|\ Q |pPl0@`P QV00` kPB ,0 R0200pP00 DP H0P  H  ర帰 就帱00S0L*<0 800 s * ) )A-@PEPp Pp@p `EPE`0 2U @0 s 2@ p@-\`P@T 0S1 RT0S@@^0SYp@G-l@`pS0 ST0S"Q0S 0ST0A-0M`@@᥸P, , 0 @S@j0 @ 0K~†"  2 0QU  P*# ^@Wۍúk2pw2 '8X - LM  R  ʂ0   ЍPX0 Q0H00S :\@- %n/ȼ0 0p@-P0S :@#RA# #p `0:P #c#p# B0:#!BA##T0 P-0M 00S ʃ0  A Ѝ804  P T0 0//Lp@-P,|``p@0@ 0SP0P0:3S 8 L40 00 :#p O- Mppl3 dS0`P\0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S p2051E `px  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y ` 0  S $q 1lR Q   ЍPp   B/oq"`Rm0E00#?c Ѝ 0T0 P00ϧ4  X.\.P.L--, +G-@P(c(3`pZ 80$ RG V ʌ3S23SnX " R >8 ^T0T 00:3S 03@-ppP`/]@0< 0@-0 03, ppeP`]x<0< 0@-0034ppP`],0@-PP MP* 0Q@000xP 00 02000*Cr Ѝ0|P H00 024000*^ Ѝ0\l/ P0 0@- M@0:R P% P P Ѝ0P 000 p200 Ѝ0PtP 4000 P[l0 000:Z!0\ S0 0 Q/p@-@Pp80pPU,Q (00C 0PS0\@Tp8#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p (@L0pTЍA-PPM Q@`Q00?`FV`V` ,p (@L0pqTЍP/\ , 0 B0/\//A-M`V,P@p (@L0pETЍA-M`V,P@p (@L0p+TЍ@-PP M Q@6`pV00Ӣ?/`FV`V` W 0 @pLT Ѝ(1@ RR( RR T 0 p@-`V,@a Q(0P0C0 ^ S0Vp(, 0R S0/0@-P0PU,Q (0@0C 0PS0 U^00@-P0\0P", 0 BP 0 PU0,Q (0@0C 0PS0 U0\0O-0 lM4P1*YCTb ,P@QC8 @$^;RC 0p0P00@0 0  0k-P8p4S-`60@PP# @ p) ,4,  [ 0  0 ; lЍB 09lЍO0O-0:$M $t00  PU $ `@Ta 0 `P ҭ W):0`SI   0s@PH$Ѝ@`00S S9 S0PV!W(0004S$ЍO>0 @0S G 0W B20RP  pGP V 0pG P %W  P @ G`QO-M00P0SH3 `3S,[*Y> @00! 0@ @00@ KTP0 { p @` ֬P @0S  0 `PPEЍ` D _P 00 C40/Ѝ @0 P )P0  0 /,400 000S :P /NL0 H0 0S :-P /N400 000S :P /NPL0 H0 0S :-P /N 400 000S :P /MH@- @@\ ʌP 0 @|MpȀ0 0@-0@T J 3$S B0pQ _8@.P f @M804 000S :P Y/LX PT 00 R0S *P@04//L<000 000S :P g/KL0L 000S :P @-Vp @5/K0 0A-0`V* Z 3$SP! #Rp@4S@pp3Tw AbB0tQ 7A.K<,0@- @  @^J\000 000S :P o/J$ȼ00O-` MX$ p P 0 ~p @wP  0 Prp@ 0 #@  Ѝ@IP  P /p@-JP z3S P`4`0P˪3Vƪ  0s3 S00 0P 2 $R 0X0S H03 20X #$04p03ppp@-jP 63S @P4P0@⇪3Sp@BuA-`PX JSU"X p3 @R S$ S'X 0lAQ0, X0p ,0\ 1B0010L10|10 A0 XP3PSSpP4PStpp3Upp@-@P X0P:"C0T0XppG- Ԁ\.P@p  `ᶪP LTL VW PT WV  H000S8 0ᛪ0 0 E|O-((Z Bp`PmP@9P ( T3gP+ T ]P 0  @00 0` WXP @ RX #@(  !0@D|0@-?S0Pp   0 P0X( @`b& p@`^  0000C 0$0Q 00/=0$0Q 00x/=0X0X0p@-@R ` 7 #@8(P?cpp=d0p0p 00 ?o2Q0SX@078@08Q@@//<00 00, D | 0P0q00~p  B PY 0  0CI40 SP 1 ЍTYS00CS``STZ0JS` ZPZ0 P0C Z!|0 000@-@P`Pp0^0C (,, 00^00@UP 0S 0@//P 0S 0@//P/P/P/P /P/P/O-PP! + 1СD0 , 0S 1H``?c`@ p0 @s'W#갑@W0 8| 0 0p@ P @0@00C i?0 00t0X ?o 2 R0S P 01 //ǰ-(^,0R0^Q!R@!1 O-MA0@0S3, @ P `p0S! S#A 00 `0C``P  (0R0 (000C0T0 02/p 0P@S(  Ѝ  (0A-S$p4@`P(0P@SQ Qa ppQ p 0p(0p(0S/p@-0P`@ (0@SpP0@-0^ 0 @ 0 Q@RO- M@`P VTppC0S  00C(000@0 T0@ 0 S `%,0 R@p @ⴀD R`DpԞ `|p Ѝ@0 S RQ Ѝ,P ,0庝0P `00V  ppG , B(p!B, A0 T`  `  0Dp4P , 00@Hp`4 0Tp `0Dv@U   PB  0SQ 0 0$ PC 00\R >@U 0 BQ 0C R G-@Ph 0pS: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R00 0U1Q0/P00` 0S 0 0V(W ѳ`F`V`0XPU0P`W`V``0 @p 0 $p0PEPUP 0 0PD Q P/$ $\/ P/4A-`PAPQ@P1p0$ VY 10 0 QV$ F 0R U ERpL @10 0 QV$ F 0R U E@p:   0F  Q SC$ 0R U E*p$ 0*$` P0`00BTP @T 80@Tp` 0U0 A-PP0P`00pQ0 0S:@$0P mH00@T 0WP, 0S) 0@- \%@T \8x ƌ8 t ,0@0@PU 0P0U00 S0/0?o2?=X?A-P$@`V0S4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 Q0@ B( `p0,0,0CA@1` e0S( X @- 0B 08SE?080$ 8R  R 00S0!R$R R d1S80080080 O-`QMRDp0[~PPy ሰ P,r ᯚP@0e W4* H0X S 0` @``F @ 8  < @0H0|0$T`8  \0 @`08 d0h0l0p0ЍzP4. 㶙P( :"R! 0 RH0SI 0p V0 0 @@  ʧNЍ   PA-@PM,Q(PD Qp`AR   B P2 \/X* P%ʤ,APP D0 D0RH0!b pH000$`P@0SЍPЍ @-M@ 0 Ѝ@-M@ 0 Ѝ- M ЍO-Mȁ`@HP `JU@p_WNVPED 0    PI ԚL1D00S*Y p$`(D0@p`0S00,0UD000@UpC0@aCY Ѝ00H00H0t  P PEP` V IIP ЍP @|$ 0@-@P0M0 t l 0  B/o"  lPP ;Ѝ0PЍ00H@- @  0M0 KЍ<P-00 Q08SM$ 03ЍP8 /-M 0  0N NLN ЍO-QP00ph04`p 1a!1 101 S1 0C s020C s0渰S80wD 0S 1 @P 0t@uPTs00p4`h 00`000 00 `( 0000 00 0CQ00( @0 0 A\8 `( A^(   `   BQ  88000"(0 R 00(0 R0 0S( QS 000 0!0R !!01Ḁx0Cs020C s0渰SD 0Sm1L0|100 p2 800p0] 0D  1L0| 1 p 0p0J<Ѝ`0BsP,00s0 0 8 @ 8 8@8 0C0C 0s0 0<Ѝ YZ YW 80&PU,`0A0s0 ,pNq ,p  B   S @ T=\ EA-~,UM5@P`0@00?5p 00TP 50 05 0@00@0  00P P50 0@5 0@00@0  00P 40 04 0@00@0 00LP 40 0@08@0400S@0@@0 0 (P !R 040 00@ 0,@   8P !R 30 00@ 0,@ T!R   P 30 0 @0;@0  00P L30 0q @0:@0  00P 30 0` @0:@0  00 P 20 0O @09@0  00P 20 0> @09@0  00P <20 0- @0;@0 004P 10 0 @00@0 00P 10 0  @00@0  00P p10 0 @0 0@0@ 00P ,10 0 @0@0@0 00P 00 0 @00@0 00P L1S 00 0 @08@0Ѝ00@P L00 0 @00@00@*,l`|0@- Md@d0@P006S 0  Ѝ0,0 000  Ѝ0@lp@-PQ|A`@9 Rl1000S 1Sڸ0  @T @TU p 0  0{ pp!R!& B(0r 0(!C RC$0!0R0ڸ : h2T000S  @T $0@0| -M 0ЍC-@PP `?/LN \_@pG ࠱ L@DI\ JP 0$ PC@-PB M1@`0@0 !p Q,  !1pP0 01 0@00@0 "~, . ~,OP6T10 R00S Ѝ@~^P, - Ѝ 0pP0 000@00@0~ 0 0T0 @00@0P l0Pp  PL0 0L 0f @08@0 0pP$l|`A-@`PpQR,010c, 0`Q`A /? O-lM 0 P0:3S?@0T800U X\ $0 $ 8 @8 @ @ 03@0S?PL? 0000DP00 0S $@P80@080000h0S $0Q$p@8@t@T0, a  @v t@T h>0<00 RP0 -]O GD0U0pEp0 R= 0 R PP-WlЍ||  P 4TDl$00SdP000S+80'8 0080@080& z 8000V ! B0C 0k8 0 @00CTqL p<0, 0H0x0p00C, 0 Qu9$@0 0h80 0  p`[ @@[ P<0@ ` p Z`D` <0`pV,,@ ` p`D`  R00CV008YR0I000PD Qj P` L 0PTH `E L E[ D | ~px!RQ (R $R 0  0D(0 (0p   0D 000$R_  4P 000!R; r L4 p  0 00<0d@`:Tc T0`P |PEU 0DD00AUPn<000: 400W 80 R 0,P0A0400aC0}<@P 0@ 0Dp p40I ǚ 0Y Z q  aT0 R  P RL[[.0 S0@  0 R@@(H LDLJ ,LZ LD 0B0 B( BH0P 00C] 0Y80 0,0 q00 00R80`0,@0,0 000`44 4 .Dp[m 0pG0W0 8000P4 pQ S4S 4S  0S<0000QH5S 0`   8 P 0  `@ 00p0 `00P  `000<00  B 00@ @0 0p 0 @Q R dP  W @0YT$P d1S  9P  R{ d1Smw 0  00D00g (00pi  0D Yu000P(h@T 0(p`P@@U H}HPP`p(,00 @0-,@`0@ 0HbWgPR p0SO 4S4S 0S00Q0S9 L5S= @0 |; P =0  @` 00p00 @00P   `000<00  B  '<0000Q0P  0@000 000P <  U P$  <P 0   000P"  =0 0  0  R! W h=` P0 0`1S W = @P0 0pL5S <00 00RW >` P0 0L`0  F000( >P |00 `C0`  0000P  g 0 W@< 0 0LWp3Pu ,@00@ GW ]0S 0Q0S@4S0S 0 0 0? `@P0` 0"WH5SH5SH%  R Q R3   0 `0 @P0` 0HW}00  000iC`04P`p( PkA#lyA-@P`M`2 0p0 R    8VxtP0 000 000P 0  Ѝ{80 @000! B/ 0C?0Ѝ0 000C-@PM⬐0 48# \`` Pd0phlprP ЍB80 D000 0 B0C 0/ ?0ЍЍ@-@P @TO-PP ! 7 1D00S0H``?c`S., p !@G'T :#| _p @W 0 R( ?3 S 0S1S0 S  0 000 0R 0R0 0#0  RQ\ R RQ 0P // /p@-PP @0 @T $0`U VP `ʊVp`=0P 0@PUpT` @岊T @pp  ! !@-@P@囊T R/0A-p,SP` @T @兊T0`PS RQ A0@ R ", "Q//@-`Q.pP@0D R "! "S0 R "! "S ^ 0N R ", "Q^pPV@@-@@@0S (0P0C(0=}lO-Mx:xzx*0p(P܂ pP H*40\` S  @s@!dRX@jHQ00) 8 @Y @B@0@T ROoB@TP `NNQR0)\ 4  |  bR\ T)` R&D) R! CP'I@0 8R S[80S  b( 0P00B(0X@0C0 8R CPf S ^\ d(  00Q D800 <08,0RJ0H 0@0( c (P)0S700S00l0S# 0 S 0 80R#0l 0 P0S  0P(0@P(L70 RЍ47 0, M(,04 SBGg@` & ,04 S5(&0CP ,00xP0S (0P0C(0p&@ `&0 0@,@ R 50(600 80RpfF`@000 (P0 80@P0,@Sf 40 CRbڬ%% pp% t5@04p,`Y ʵ| `nR`F`V,00P0S  M( 0P00B(0X``!R 0[^[ $ u $0 0C,@00000C S[ pH400@4 0,0104#0{d4`000P 0 ^% (@(#P@ ,@j4 Rw 0U, q  P+ x# & l# ,@(@?QWy, 0 #\ (7 ,@  P '0,@( R @  P  @ $@lP " 200  0 l80 S \ 'H2 0( ,B@0S  ( 0P00B(0( 00P0 ! 40,`V7ڬA@ 10,`4 V0`F|!,`0 xP0S Q( 0P00B(00@&A@0S  >( 0P00B(0 0@}|| dh{{(Xzzzzxz yyyPyLy8,xx`xD ww w0vvXvvuuduttt(t,ssslrO-ds M`3p\C@4 P ?804080,c`,0P Zn38@3`0T'#0CS 802PL袟 50@DS,00S0 0l0S R "0 0 208@0P0T0hP XRP4 @P 0, 0CS P 20 0 P1084 0, Ѝ04S00h0S40~0T104  @ P0P归<1,`0 R*T$!P0 0 @T 0 R 0 P$ 0 0 00 lP @T000P0 0, l0  8@0SRC0PE@DP8@K 00SL008P qqtq4hqlpp|ponnnn\(@- 8 40,0n(@- 8 40,0m0 0G- @ *BT _\O 0@T0Y XpW ,0 qR`00 0 Q  PV 0V00 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/O- M|upP+ p5` 80s. X SD Pr 8@R!1S 50 50 P\`崦 40 00P 40 0400:@ p0 @ l%R h%R 0ʀl20 h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SO\Q*SvVrE Q SVW~V= Q SV_V5 Q SV@, Q SV# Q SVWV Q SV Q@S  ![=0Y2 0 C S :Rpt p2! 00R"R ŸU0 8@=0A004 1OaLO`PU* 0S 100S H0Y 0H0,  Z000 0 0 00RYpPU Ѝ0 0 !R 0ʀl20 0 !R 0ʀl2 %R t5S 0ʀl2Sy Sw Su Ss Sq So S^lklh|S8h(p1P0Wd PRP% L QK\I4 00ʃlœ\ 1:t“ @-'^# tƒ'΃r 'tƒr /A\ !B\ r^tƒ    / 1P0C 00` P=ʀ: l2'΀S00r200 /@P%0000CS 00000000000000000/pp@-P@M@(\\" rf Ptf vf0 P P 00 $000 0xЍp8lPd-X\\ rtv /lȐ0 0 t 00S `0008=0!@00 R/@-Mb a441 @-00*l"R @!@ R  (1:'.r"tB00 R @R  AR DL8aHa0 000:h/p@-`AM0@P0*l"R R   P 00 00@  @ &Ѝpx   P `00 0L@ 0 @ 4  @ @ &ЍplXD2C-0HP` 7$ L400pP pG0`00 `p0pPP T@0@0 @E@00 4,PpR%,\ Qձ(X  4R! p@p G"RU HpG U  $ $ 4 S0 0 , 4 `8Pp04, 0@ 8p@<,#PU0 4Q0 0C0 Sa 0( 0C0, Q00PSh 0002 !0P00$0 0  0 H 00 p0 Z00pG0C?00t 0PSI`FJl0@Dp0P@! Wu0 0pGH W00㴢1D0|0p~dЍ#p` 040T aR040  P0I P~>dЍ` t~0 0 fD0p@-@`Ppp p@X V0 0 0N0p@-@Ppp p@AHp@-P@0 @  0`pp p@-0H0H0p@-@  @Ppp p@@000@- 0Pp/ `00p@SL,0L .W @0*S /SR@@00@@@@0 00C@@0`` O-SMБD@ HP 0S p` @ 0Z A 4/  Z8 $Z <RD!  . R !!! > P   @0 0~00  HPr 00 R0S0 0?൤P4/ZWЍ H\r 00 R0S@0刀0pP4/pW , Q" @-@M R ! R "R pP^  0 0@aЍ /@-0QM   S S PpP$@4R @ 7ЍH00- M %ЍI@0<< -M ЍhHp@-0@R P\RQ ^R3 @%c ,R'Rq{ L @RQa0 L !a}0 p  % ?{ R`VD 0 FR;h!@P`   ^0@! cR{E0\R:R '  px @i%L {i{bO-M  zPP 0%  0  S  g ` @s\,S0Td 0@ @  0 S$  QS%S  +0BGSSQPNMLjiIHGFEDCBA@3>=<:s876543210/.-,+*)('&%$#"! 8 0 S{ 00PЍiR%@0 0 `fv`  00S1.R0S*R 0 Sg@0 S[0@0p0dR% @00@  d 0 S20 @0r 0  0 0J0 St00@ s0000  00000 0.0 S0[0@p  0 @  c% 0 Sr[@0 p @0  00c% +%B0 0@kP0 0 @ r 00  C C0000< @0D@00T0 S\R Z I00 S#0<$  rn>  000S0\S 0 S00 C0  T p@-@PM0P`0S PS   0 00Ph 0 Q00QH  < x0 ЍpQ0?(?>p>A-M0@HSD!00@0p0S= `0  1N;AƒKa1#bP0 P  8 g=M%02#cQP 0 pW$P@PW 0fSPЍЍ 0 Ѝ ~HA-M0@HSD!00@0p0S= `0 u k<7@ƒCa0#b1 ! 3>C120BQb0P pW$P@PT 0nSOPЍЍ0"Ѝ| |O-M0@S!0 0  0000S, Phqb*cE8 0 pƏ⊡ - ?DB%.b CĠ #W =W =pP[ 0000p{PQ  XW   RRl`?xPP U  <0 lW  l0SU $@a(0 ?"K%ᚂ!b  P嚃!2c 0P 0 02#c0,0P0 pX00$0PB0P =p@H@Y 0S`@Ⲁ l! `p`l Y00\Ѝex$p4(0 ,(k@C3>C lᐡb  ! 120B P0Q p@00K$p℡ (0 (-8 ?T p -000 Tk@@0A@?SX>T0 p0A0Ds=Q=S9|7I_hm}^0S -00X.00  X@ E0l@! D0 Cr 2;0X'T OP͍ R'R ͍T0   R'R'Rp@p@I@`VtP` 00040tP, 00000V0R 1X!RL 0BS11ऀI PB=&@DQ1VTxvutqqomlkjihgfedcb^][ZYXWVUTSRQPOMLKJIHGFEDCBA@>=<;:987654321/.-,+*)('&%$#"t1S 0C11ऀ, R 3@ RX*P  0fp 40P040OU7 =@!1ऀ0100L1S 0C-11PSU #,Q!*P  4 P@6AT @D=AA0@a DrQA DR3@D1@ڕ#0S ?R ;RH p0S %S0 0@a0Ds RA0DS13 DOS !01000@Sl00l0 0St00t0QU PE=@Q1P OU?=-!1P@ Q @10Ds R-1!ORTP=@1p=1 !T!R   B!!0 @RS^  ?R ;R QeR p0SP %S0 00     00C2"0OQh0͍}SS  0S}S}S@p@r1S 0C1XX  l R!#@,Q*P  0ep 40040@N, 40,qߍ! 1K00PQU PEQ1- @@OU=-0@0@P1Q %-1 1OS00@sP 400@,T 2 sP 400,X d(XPPÐ@oᨂPX j@|yvQA@pQA#QU PE!TQ1- @OoBT 2 sPT 400,Si000 b0 0.] 0 nX00@{.|O00L&@D0Q0VT1/.-'*(&%$#"! w dR<*@00N!@DOo0B00@000- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/ A-pQM@P 0S! XB yrP W`V! v00* V U{ ``ЍpPU00c ``U @ 0 0 R Ux 2U`,P0S U,  hD<p 0S R s0r (0 000SU00XP E  p0(0LP E  p00PU<ݤ0٤ 8 |  0 T ,   0R@-M  H0S@ 0 Ѝ0A-pPP U) ,@T`V 0PS |㠿@P0DV  NP FoA-pR `Q 00@ PPz % WP QP (&K0 GS  qP  v 0?s s0 0/r R0 /r R0 /r R   Ͽ|Q Aq0U ?pQs0p pWP·Q| 0?s0S #  pP o   1@pP V0?s0 q%qP w0?s0S   q^ 0 ?s0RSqp!U ppqN q^0?spWC 0pⲀḏx$SCPC " X$6  Ž0?"ss0nQ6 sQE fQ+ p00R00U0S   pP:!pP!pP# $ pP Vq$pRq pP$V    p03?/U  R00   0 S/r RUp p0?s0C-@|aMx!P`p 0a P q00n0S< PЍ`P P 0  p R 0S 0PP  VPP004P`Ѝ 0 1P @`+` P *}`P  @ nPH H0D@ /  H0@0H0H0nUp@0 H P4 sUD fU< L00L0@P@ RP00W ,0 0,00 l 0S000 0 0@SH  $03?0H00H0H0@ HH@,0, (s0?0H0@0H0H0, 0H0$?P0s0?0H00H0dO- M@ Z pP pY ` `(080H0lPS 0  0u0?0 JZ0w / P   P>Yv / P  400 R0 , 0R0 < 0R0 0L0S00@ ЍA, R ;< R 05L0S @/0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\x  :Q  R00\TPA-p0 @`P`VR lPA0 uW000 x /   0 0 0Pk 8  O-@P0 $M 00P p+m`pV`300 ` l P  p] m|7PP Pql0P l00$Ѝ 0? ll,`0 pV 0(0$0,0 P P2/Rq  0S00eP_ `V X P/r 00lLp0@W@0H0D0L0: `fS. `00    P pW Ͽ|P|0nS sS`ov v`X P`5_ `00 l$Ѝ P`_uP$00>>PlA-`@0PppW!S$ kP uv0Ͽ   ?0 000  0 0Pj0A-pW@P`S k0S u0  00` 00 00Sj0O-TMD0D $00, 0K:080`P ||@P00PP9 00PT P8?PPkP  P< U 0:T 0-$,P `T 0`0#1(00 0p0,0sc ,00s SP\ $,P9 0S6 ( .S  ROSD = ø@P# ᾸPP] @ p@t , R 0?s0T 0S00 R00 Lg>L00S P PF 0 B 0S t 0C 0 00 0000n080TS 0 0P40000S-X 0j0S(`9k TЍ @0@SN p@tP00 000 000f0 JPlV 0`p@W  W0` Pg  (\W  RYX%Q^WQi @pT0/0FS G, r ,0 zP 0`20G|0SE0G/SVTSRQPONMLKJIHGFEDCBA@?>=<;:uz76ks3210/[-Y+*)aokp0W@ W8 x5p0 00@ p00@0<58 0000  0Pp`pPp`00h3 04 P Q 0 ?s0T R 0!P 00Pp`00 00 00 0 0 04 0?T0 /t 0 S00Pm`p <@PPT 00L<^4 8 QTW0L<0@P[〰Pp`L 0 0  000s0P 0`2P p@tk p@tH , R 0?s0T 0S00 R 0 0 0S00FP x[POTP TP0  j 0 0`uP00U P pPu0] 0@s 0 $ P0P8 0  ji TЍ 0  "0`d0  hD   p0<@PEMH0<l<P/$P0 00 // o0@-M@0 KP 1N;AhLBH gMMl1#b 0 0#% @B4d0!PЍ0 op P0`0>// n0@-M@0 CPp k<7@hLBCNCl0#b 2 "0#AB@C1d\PЍ0 n1P00&>// n@-M@[0 9-8 ?=<;:9876543210/.-,+*)('&%$#"!  " W a  ,!00 (ЍP P 30W 0B00> 0W9!00 P ~Pz L# W0 00 "rP 0SI !00 cP00"200W 0 YP 0Sn !00 cP00ʄ20W 02[D +a  <PR  cP00n020W 0_0 "*P 0S  !00 cP00XW0 " P  qcP00`ʌ10W 0!B0[D2/'D" 0JP   XcP00,W0 " JcP0000W 02/'L"P 80S ^!00 0cP00ʔ00W 02/'L"P 0S D!00 G<PޘLݨDܘ4ۄڼpڐcP00$00W 02/'L"P 0S !00 cP00ʈ00W 0W0 "uP 0S !00 cP009002[D 0 +a W  XP_  cP00&ʘ300W 0 FP 0S !00 cP008300W 0 -P 0S !00 cP0020W 02/'L"P t0SL !00 lcP00t20W 02/'D"P  YcP00g,20W 0W2/'L"P G0ST m!00 ?cP0010W 02/'D"P  ,cP00ʀ100W 0 ^ P 0S B!00 cP00%$100W 0 p P 0S *!00 cP0000W 02/'L"P 0SE !00 cP00d00wW 0B qP,  (ٴX`ք׀\lԠDԈcP00400W 02/'D"HP 0S !00 cP00ʘ00W 0z2/'L".P 0Sp !00 cP00@00W 002/'D"P>  tcP00D10W 02/'D"P!  acP00Mʌ10W 00" P P0S v"00 HcP0010W 00"e P 70S ]"00 /cP00_L200T 0a W  P  cP00t30W 02/'L"P  0S /!00 cP0030W 02/'L"P 0S !00 cP00%ʬ20W 02/'L"tP 0S !00 cP00H20W 02/'D"ZP  cP0020W 00" HP 0S "00 cP00ʠ10W 00" /P 0S "00 cP00@1000[DW 0   P v0S !00 ncP0000W 02/'D"P \0S !00 TcP00 p000W 0g P B0S h!00 : Ҝ,Ҵ`h`Ϝ4΄(cP00000W 02/'L"P 0S$ =!00 cP00ʔW0 "V P  cP0000W 00": P 0S "00 cP00810W 0{2/'L"qP 0S !00 cP00ʜ10W 00" XP 0Sv "00 KP 0S !00 202[D +a W "00 |30t30l30W0 /G"$"00 830030RW0 /O""00 n20W0 /G"2"00 `20#0Wh!00 S20Y20pW0 /G"p"00 B\20T20W0 /O"'_!00 1 20W0 /G"gQ"00 #10X10hW0 /O"@!00 10s10W0 /O"/!00 t10l10d10^W0 /O"!00 010(10W0 /G"2 !00 00#W0 /G"k"00 00\00W0 /O"!00 00|00 DͰ͔̼L̄(ˠxx$ ʰ<hʜɘɔɘxP,,Ǵnjǀ|ƔƠW0 /O"d"00 |x00UW0 /G"!00 n0000p00X00W0 /O"!00 T10r0W r!00 D810W0 /O"d"00 6l100WW!00 )100[D0 /G "ZH ZH  0/O"W:"00 200W-!00 8200W !00 h20*"00 "00 " 20A w PH T @ "00 "00 !00 !00 !00 "00 ߿"00 ڿ!00 տ"00 п"00 ˿"00 ƿ!00 !00 꺿"00 &P  [D0 /G"wwP !H H  0/O"0S!00 j20p" ꍿ"00 _ꈿ"00 Zꃿ"00 U~"00 Py"00 Kt"00 Fo"00 Aj"00 2 00%13 @@00 j43 P00HX3 p00|3 003 003 00!3 00!00 @- M{VPLOAQ"Q@\Q\P 0 0 Q P 0;B 0` 0 Ѝ{F Ѝ3Q Q 0ALL1\1 ^`0P  010b0(#6(7`0{F q p   ;B Ѝ [ Z/ /P 0S $0S 0S P? @4@P//A-0Pp`8P' , R( 0"0, 4000R40G@BT@! DV @D8 =,0400G6,0 4 00(@  (8/P8,0S0Q 400 @-P04 R 0    $ < @ S. p T P  +ˁ0P R $ R  R S /0?>]DE08MUz 0PEt@ T 2,0 SRWd @D'w h0`d>0zp=?0UZ 0PEt@T7p0pp@>?00SA 0??000CS>0S 0@7sN?0 QP?0 C/(0 S@p0(0W( ?2Q5?0U 0PEt@Tw0pS =0%T0PEt@TU C0 ` 0,0 SP0\$ @Dʈ7~+D?q@D0D 0B $0Sp0  0p7?@0+'8w<#0#Y \20?K?HL0#0DSB?0` @p  20+0 qS2@D0P0;T0G?0 C2q@D07~D@N s Pl0{1r0ರSl[0PEt@[UR!B"0$ 8 Q 0l0S>0X p0P0tXp0  yP 40 /@k @400@p 0O?0( 7(pc40E?l 0H[m0PEt@[gU0 C00Si 0 0000 r$1岐T*U` $U\ PEt@1岐^ 7sQ0D @C7{D7~D@NqJI?L0Y$0SW$   0X@6?p0 (rX0p@+P7~@D@ 0@Dⲷ'q @p0F?l00`P 000/ S  hP00S   0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@P`^1@0SS/Q  < 02!0C 0  S"$0M< @0 QG Q0c  B Rp#p2W S Q6 00S/S` @0 < 0@0S2!< 0l0^pP[ G R R 0c ^  R S R 00S  0Spl0Sp0p0C0pp)x 000 0P,04p??0x p0 0 0 30 Ѝl0Spl0@@@^a4P 0S $0S 0S P?,A4 BR/A/Q /@o/A-<PXPv@ 0(+`3/PPs 8pWF ( 0(3/pP00@a  0 Q    +ルP04 S:oSS0C0P0T00C0T0p0W0Cp1 (0 8#e8pPp00Cp0@0 0 Q    +DP04 S*p00Cpp$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|M  80⤰@ 0    0xT0SC0p@X0s\pW0 p  p0 |Ѝ0`\`V30sBJP:P0u;J XS1ZP05 0Xs00R 0xPS0RSCP RT@!T0!01 00P200 0! P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00S020(0@0$00($0,0@?o 200040C0 0000pP 0S@3 :^N $0%3!`@3@!(0%t@&!<: 80C1 ( R@P00F#3 0Sx $Q Br $ARVJ  ` V  \ F C 0 Z(  V F*x $R AR  BR W 0 Q  R_, %Q  RY  ! LAS4 @P  010(0! 0, 0( $0W 9 7PO-p04M0C000 CPU?PU@PUA0PUAPR@oPP 0C R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`؟ 0P0\QpY 0@SQ QKW0 S  RE R  R( (pQBWR BQP"S6Qt0S R: 0S S > 02#03/0@S0P P0W W0S0(0 Ѝ0Sp>00000 S *S0SWq00Q RG0@SP20 W0Sq S00U0 00#400 00 0  0#400 0 e0S0c0?o20 Ѝ0 0S&+B(l0S0 B8@ B0 #22c0# 0l0S q0002 R0e9S ;0 0t0 0  R ,00S0Q01$ QP0 R1 2 00 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  Q ! 0P B R PE [ P ! X*H 0 ,0 SR B000 0 0 0 0 0 S0 S 00R01 q00 I R}0ES IS; [S3 gS3 90S0Ck0Wi  2RC0SS@ S  00 # #8 00#"0  X0 ,  Q R I   R'   0P P0S0  0 P,0SQ4: R 00, R  R [  $ R  9$ 0P P0S0  0 P,0SQ: R00 B000 B000,0S+  Qg0#0% *0 B000,0g  S  0Q| R00 00#40|0q00d0SZt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SWe :W㴖H 6SX \0l S B8 0 l0\000SFK\ R8 C0 l0\0 00S90 Zt0(l 8`R B  ^C 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l S:t0 SW S Sl 8`0  W 0S0 B000 ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs04!ƅ0 0!1001  &6`Rt0l 0C` t0l z\0S B80 l0\0C00S=r#  #800#"0 00_0 0000i*W6F &RA \ R80l0 C0@0,0k 50 0 005 B0  00L0D!C0C  t0S*l0\06\0l S B8 0 l0\000S201\ R80l0 C<:86420A-`pPSq@PG Q00V0SH81 0P1 : (0sQ Q P00 00000 |0 `ap" 0S$t l00\ R6S S L0D C0 Cሤ060P5#0Sppp@-@5PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO- M`p80S04< 08Q1S00PP 0 0S| $0St wpVkV`F0HSt0FSRp WnZlFYo᫲[eV @(& `4/@Pj  J@*(0`, ` X  P "L  BPT  A4  6/, ` 8(6/L ` @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0 ЍOv `fh00$0X(0 | Ѝ",0  000%8-M 0 DЍA-PHPUPn`0@0 0 Q    & 0(3/@PR &@z☚ 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 n, @@ iL DD d&!_0 0C&006 0&;> 0$0;/ O-Q$M R0   0S "r ! "0`pß P @`0$0*) ` "z0 `& qy0v0 p0PAr0!1:SuPPQp'9SuPQ(6SuPQ+P5S>3uPs01@$ " "@QP`0.HR P \!R!!P! \ ++ +P ! @$ @$ $PD!"  ,Q!$"0S 4` @`R@DPRT`&R v`a &P%uPa PR d& R,| &, pa R,d& RP%uPQ&T%,| a R%d& pQ&T%,| % C 00R  00#^s01 #$Ѝ, ,L0Â""`BV2c' @l  L  P xC-PRp cmN P  0!\00#@B .P @N1R C 0 @$' C-PRp cmN P  0!\00#@B .P @N1R C 0 @$' @-@P |p S]Np`@` 0!ȑQ00#B   @-@P |p S]Np`@` 0!ȑQ00#B   x00@- S]N^00# @L   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C>@@ P $B0R pR 0`RpR`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0\`0 0@0@0C 00 Q q00H 'ᑒi7n/0R#@-qHp@#/ǠⳞ 0 A 0A  00JR<G@ 0 q0CR Y> 0 BZ0 00000C00 JR 0^ P0 0U00 0S@\ R 800SC0 R00@\<ЍW  =xQ / !02@[1Z Gೠ69#6pQ^p N ÀA-P@`QT0R`PE+~P p0T S#|T` 000U0 S@S |jT00 T-`0R V1|T0000` S +-T000 0`0T00 0``0O-M@T00R!+Z+8ʀP c W ~㸐|㸀iQ6s0 `IP000P#406`0cXfx0Z㼊PḀeY6Ps0`PE000`#406P0cXx0AUVq`U0uPPPP0`#406Pc0CQ6T T0P[Q p@`DQoob`V Qf0W Q@z㷀+}hpY6`Hs0000#406`0cW3sp VfPE0Tv`wppp`0p#406`c 0CUVP6AP0[Ѝp尀 phYp6`s0`H000#406`0cWsw0 Vf[ PEpTf0v````0p#406`c 0CUVP6 P0jP0e觮  P`6e@pE SC0t@0P@@@0PP#406@c0Vdv@Q@645P0V/0P2 `fP, ATq6`f0P0pAT6qv`fpP0bv`wp>ʀO-f6M⼖S0 #`P  #  # #  #  A @b9 Ts0@ Bp000@p#4060c^~00἖&R @ P$ p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಐpiX>s0I000#4060cWsw0 0@༖^ hD B@n Tr 9s0=@Np000@p#4060cR#r0&0R἖f b ^9 s0@P B0``00@#4PP06c Qq0&0Ѝ0἖=0἖9 x l ` T0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4&&&&0|A-@ s0`P Q!r  pp "$  a AS2s 6  u0U0U$0Q  00  0 000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@, R} 0p&]P+(+0O p ! RBAQ j  &!R:P3 "[w6 S7p3 s0000 #406 c 0CPp 66 O.V G.0 0R0 0xS0  0LSX4&&&&, Ѝ O  \ P+R +R ,RE R  Q ,` &]R3 "[jP ЍOPj 0r\ R3 "[&0 Zp:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r 0 NΌ⼦  Z*r   "$ 缦 j JPp Q ἦ & #  P3 "[A r :s0cq#0r   $ :Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  0S A-@pP `0 C~0@YTUT @&P %/@- M@Pp*`P ` P    Up L9 @P Ѝ蠘 @@ Ѝ蚘@ Ѝ蕘@49T  Ѝp@-P)@P @@Гp耘 00p@-@)0P 0000o 00lp@-MP`)@P P @嫓 000p 8PЍpPP8U JPЍp0p@-S P@ `0 C0@T2 0 p%y1r1FP@p@%0p@-S P@ `0 C0@T  0 p%t3i4FP@p%0S p@- `@P0 C0@rT @pp/0S p@- P@`0 C|0@WTp%y1r1FP@ėp/$0S p@- P@`0 CX0@3Tpz%t3i4FP@堗p/$0@- M@ P :p  @P Ѝ0臗@ Ѝ0肗@ Ѝ00@- M@ P p y!r!F@P Ѝ0k@ Ѝ0f@ Ѝ00@- M@ P p t#i$Fp@P Ѝ0O@ Ѝ0J@ Ѝ0- M Ѝ- MtiFx Ѝp@-@P%t3i4FPPpp@-@P$l?o2FP p#00pp@-P`@P  ;0@)$p@-@@ @-@@ @-@@ @-@@ @-@@( @-@@8 @-@@N @-@@d @-@@z @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@y@ @-@s@ @-@m@ @-@g@@-@a@p@-P` @P  0@#pp@-P` @P  0@#pp@-P` @P  0@{#pp@-P`w @P  {0@i#pp@-P`0Pc @P  g0@U#pp@-P`Q @P  U0@C#pp@-P`? @P  C0@1#pp@-P`- @P  10@#pp@-P` @P  0@ #pp@-P`0P @P   0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P` @P  0@"pp@-P`0P @P  0@"pp@-P` @P  0@"pp@-P` @P  0@y"pp@-P` @P  y0@g"pp@-P`y @P  g0@U"pp@-P`0Pe @P  S0@A"pp@-P@"g>t3GP p!0P 0pp@-P`@P  00@"pp@-P`@P  0@ "pp@-`P@"aaFP p^P U Lpp@-P`@P  0@!pp@-P`@P  0@!pA-P{@"g>t3GP p3`P  P `75p@-P]@b"g>t3GP p0P 0pp@-P` @P  0@!pp@-P`@P  0@!p@-@R 0@u!p@-@H P$"l?o2FP pM00pp@-P`@P  X 0@S!pp@-P@P  0@D!p@-@ @ @-@ @ @-@ @ @-@ @- @-@@C @-@@S @-@@i @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@" @-@@. p@-P`@P  0@ pp@-P@P 0@ pp@-P`@P  0@ pp@-P@P 0@ pp@-P`@P  }0@x pp@-Pv@P 0@i pp@-P`e@P  \0@W pp@-PU@P 0@H pp@-P`0PB@P  90@4 pp@-P0P/@P p0@" pp@-P`@P  0@ pp@-P@P O0@ pp@-P`@P  0@pp@-P@P .0@pp@-P`@P  0@pp@-P@P  0@pp@-P`@P  0@pp@-P@P 0@pp@-P`0P@P  0@pp@-P0P@P 0@xpp@-P`@P  k0@fpp@-Pz@P 0@Wpp@-P`i@P  J0@Epp@-PY@P 0@6pp@-P`H@P  )0@$pp@-P8@P c0@pp@-P`'@P  0@pp@-P@P B0@pp@-P`0P@P  0@pp@-P0P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@pp@-P@P 0@pp@-P`@P  0@zpp@-P@P 0@kpp@-P`}@P  ^0@Ypp@-Pm@P 0@Jpp@-P`0PZ@P  ;0@6pp@-P0PG@P r0@$pp@-P@g>t3GP p0P 0pp@-P`@P  0@pp@-P@P @0@pp@-P`v@P  0@pp@-Pf@P  0@pp@-`P@aaFP p#P U pp@-P`@P  0@pp@-P`@P  0@pp@-P @P 0@pp@-P @P 0@tpA-PG@#g>t3GP Ip`/`P  `P `0p@-P)@g>t3GP p60P 0pp@-P`@P  80@3pp@-P@P r0@$pp@-P`@P  0@pp@-P@P R0@p@-@Q H0@@-@R 0@p@-@0 P g0e0p@PP"0S "pw"0@- @@u"vHL\P 0R @-P Q Ȍo//77P ᴌ0t 0 @- x 8 @-P Q @蟌@ f<0< 0 ( g$0$ 0  t @  x  0S p@- X@P`@@CPpiP p@ JJA-P`p" C.@P  +P` `pp!@P` ! /! `//JTp@-P @`PpP p@*@- -@P $ 0 0 0 I8A-pP -@P"  0 0 0 P-`P  ᥅` P0 /,0, 0< @H h@-@P @ f }0 0X ˨-A-M `V $P 0P@P-pP  0P =ЍAЍ/ЍAЍ/ U0 0t 8 @-@P @  }0 0X xTp@-@P x0 0 0R0 PN-0P Q # p@3ppF2Hp@-@P `0 0 0R P,-0P Q " p@pF 1P/0 0 0R /EP/<0 0 0R0/P///E|1T@-P d0o0 0QP  00SQ "E0P/0 0 0R/D@-@P \0 0 0R  ,0P Q v"00Dt0$P/00 0 0RP///D/A-PPM 0/o0" 0P R Ѝ R0 p 0 p,`P 0 S  R @  `P -  00Cd..A-@PM 0 0 0R ЍQP 0 y 0pE,`P 0S ` P `P -000( ;$0$ 0 xB. Ŕ P H0-0/o 0"^ R  R9/AP/D0 0 0R /@-P oAl-4P/D0 0 0R /@-P oA,P t0/o0" 0\ R RP Q $Q؉f O/@,d,XP 80 0 0RP ƉÉf O/@$,(0A-SM`.P@U Ѝ0 P/P +pP 0 0 0!P* S'P0S0"Q00" m+@P X U0 0 0 @Ѝ( P ,>P 00#  R0SSQ///  @-@h  0p@-S(M-"@ RS#  P o` `P  P 0(Ѝp(ЍpPH  S0  (0$ $0 >t=x P@- @ᇁc, @-$@@⅀ <@- M`@pᩋP P 0Q!s* 030 Ѝ蔋0"S@- M@Ppቋ` `#pq  000 Ѝu0"SA-Pa`#A8@P l95(r*pP  Z(@P S +iW@, M(0( 0  t;P 0P S0 P \0/S 0 P */\03#//2P S0 P \0/S 0 P */\03#//-M 0  cЍ-M 0  XЍ0@-M@P0  @0KЍ00@-M@P0  @0>Ѝ0@-@P ,0 0 0R8 /P/0 0 0R /2S!Q  P*0  S */@/0 SR* R0:/ /8XP $0 0 0R //7P $0 0 0R //7dP $0 0 0R //7,P $0 0 0R //6P/\0 0 0R /!\  P *s00/S :6P/\0 0 0R /!\ P *s00/ S :6LP/\0 0 0R /0\ 0S/ /R0:5P/\0 0 0R /0\ 0S/ /R0:5lP/D0 0 0R /2 S/R4P/\0 0 0R /0\ 0S/ /R0:4P/\0 0 0R /!\  P *s00/S :44P/\0 0 0R /!\ P *s00/ S :3P/\0 0 0R /0\ 0S/ /R0:3TP/D0 0 0R /2 S/R2P/80 0 0R /! S *s00/2P/80 0 0R /!S *s00/2@P/40 0 0R / R/1P/40 0 0R / R/1P/@0 0 0R /2 SR/1dP/40 0 0R / R/1P/80 0 0R /! S *s00/0P/80 0 0R /!S *s00/0|P/40 0 0R / R/00P/@0 0 0R /2 SR// P H0-0/o 0"^ R  R//P/P \ /QQP/Z/8P/P \ /QQP/Z.P/P \ /PQRQ\/.pP/P \ /PQRQ\/. 0S@-M ppP `   Ѝ@( RP +B 0R xR#  P 0S t P KЍ P PS O-MM(@P p$`D1000000  00[ Q`$ 0`;/0 ` 0S Mߍ bP 03/P 00$ 0:/P 000  0SMߍ|=Pp@-@0@02APLs07LUa`L~0 0LWLP V~u0|0 ^P0ppO-KM Pp|O03@0 0 @@@$@@@(@0 0Cs0S[30 0Cs0S[G 0fSI W"S_ [Sz 2 0 @3/P 0`00S 0  0Ls0SR3 /SU p,p`0 S S   S S/S >S S 0 S S FU  RAaP0/S4 0(00>S7 S> 0S 0Cs0S` /`/OR3 0As0SQ ` 0 S S/ S- (S 0 S S%`FV0S pW0(00>S`0   $ 00 0 S =S`B`0"S0S   0"R R  "RC$ >R|0 G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R@" tR Ѝ mR8 pR oR sR ;R@' ;R@< tR ;R@>P P"P \P@ V  P U WP P pR ;R@ uR [R\ BR񏐮fk]\"R /R@S00S@Ѝ!1 0  0 8Po 0 +r  R7* R0f* \Rc  uR_ #PZ p  RU*6+IP0%0R"R    O       SP Y/ Yy  ͕ 0  YY#*-"-   )& lߔ`O-@p` 0Gs0S OQ3p 0Gs0SQ#WWR S @0  Z$@ 0S>S 0 @>SSS @@ @sP (0SP  R @0$W' W0S@@[@ $_PV `IP @P D >P0Sݔݘݤ@l5G-`-M,ch"@PZ ,vppQ pQ 0PH h```SI# 0 p gPPnu5   p `#Ѝ0p gPPJu  000 gpx#`0#Ao/A-PP "P`p @!@Pt#@@!@P p40,p0P4080<0h  @-n@ T@-$@@q qw@-@@O-4@T ,p P @Dp@Ѥ@T `P煑Q@0< <0 PZ PZ P׬  @-R 0P< P 4Q ,  D )@0@ 0 , (0( 0  h8 Ddp@-M@4 00R0SP,0SER 1`V- P` 0 0tP 40, 0C40P% $`ЍpS' R"W"Ѝp Z0 0D Wp yl0l 0D NX cT0T 0D E@ i<0< 0D < $dռ ՘ t PA-@`,p!PP W 0 !x,P0`R",P0`C-`0M@SPpD  qP8"00Ѝ!0 UP ,0ST !0 KP ,0S(0S0 0 0+P 0S>0S0"S0:S 0}S "S000"S P  P d @@ 0P !, (0( 0\  Ҥ0p@-S \  Q @PmPhp 0 0 m |L0S 40 00$  0  0 @-W (040@-S , 0C40P @ @ <0< 0 >( $0$ 0 5 X Ҁ480O-M@ Ѝ@p` !PP @ ` @ЍȒ W uluPP0 m004QY  4 R] , 牡 0Qw  } P 0YIW  B B!/e,0 P 04 `<0 4 0<0 ={P,UN<U8U+qY&  ᔡ@ U P ! uPP) L 0,S<SS> kPI @, <0P` 04 <0x<:! d,0P ?uYP {,&x 2t0t 0F/l` W\0\ 0,cH D0D 0 Zl( x T 0dp@-@PP60S L  Q<0  0p@' 0 0K/. Pp@-@P 0`0VPP p l0 0 0@S<0  0pPp( $0$ 0K/ $8, ̘`0O-S M@PR z`40SM x `vP@ ЍYP pP 00 0Sq 200PX 0S. @0R*  P# [` P 0 IP 0S $P' X H` ЍO=P 0  03/P  40R 1#PP 0 0U/mL 00C 0P |`9@zd `0` 0U/TL H0H 0]/K 0  |Ȑ  ˘ɰ ˌɌ@-`@t0,S<SSa 0 0 !$ LʀPG-V `p0VSV@P8 404 S `  S` E000!,0 000,00$ 00, ,0P ?o 2@ \0S0S P`P :  404 SS`  `D !@0@ 0c/, 7(0( 0c/( \< `G-PS @- Y`' T 1p 0R  D B 004 00R% TP 1 0S 0 Gad 1`0` 0i/k0,S, (0( 0F/Z tl 0pG-`P& 0 0R! 54P 4 R @,0Q p  ,04 P@Tp:80#  0P 4  Q@-P80080/p@-P@80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@4 lx0G-S@PK Tp 40SF   P@ P P 00 0S>xP7 0 03/P0  40R 1#{P' `P 00C 0[P  @ꀐ pG \ X0X 0 8 404 0   j$ j`40S 0C40/ 0 0 @- jDx0p@-S \  Q @PPp i0 0  ip@-@P 0`0VPk0S R<0  0p@^D @0@ 0 e, w(0( 0 \t i$X i4SG- p*W`@ V 0P 0R `00 (\` "V 0S  Gw@ <0< 0F/f0,S h`8A-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`P00S@#:p@8p@-P@*@pp@-P@y80080p@rp@-P@m8@j@@pp@-@P 0 0R`PZ40S ,0AT Qp@p@ a0 0O/Q4 dA-@P 0P 0R Pp`-8040S ,0X ,0QP<00<0PFPD @0@ 0S/, (0( 0S/ ތ cP c@p@-@P H0 0R@ p`P@plA-@P1 0R`P4P%80,0!qW&  P  1P ,0P < 0@400<0AkAD @0@ 0W/, (0( 0W/ bH| b$,X0P D- ?o2 ^0S 0 Sf/0S /p@-`P@qP (0S p p@ $ > 0 //@-CJP0p 0 Qp b<tO-IMP ; @T `p0 R 2/0.J\ P Y  9/0  p_PV @T!1 0 003/Y@ 9/T IT T @T@" 000Q 1/0I' P70S+ 03/P. Y 9/I@T 0 0( 0 0 Iߍ 0 0( 0 0( Y 9/Z 0 03/X T0T 0( ap `h `Dt `H _h$ _(P0/O-MM(p@ ~T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT0 00=P $ 0R000 Mߍ0 #,0, 0H , R00 ]8 0/0/@-@@ A-PPMp`2 0S/ l@0U  UU 0 B/P 0CU/PU  U0 0 B/Q 0C#@ T@! dh;@04D .<0l 0 R* 0 0@p@  cV Tq0P@LqPۍGq?00@ۍS0up `p p *q0P@j p@-R 0@S PR :   Pp 0P  ,0 `09\ \0 kL0:H H0 c80;4 40 [ph [ x ZX Z8p@-@Q PPpQp0@-S MP@PA` Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPUt p0 QQ Px, (0( 0 p WD4 0S p@-P@ @Pp 0Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ #0 0@ ( V|l0p@-S+@PPU Q PpQp<|Pp/uP PQ mP Q>p@d Q0 0` U|0p@-SG@`PU Q Q EP<@Pp PU Q 4P QPU Q 'P QpPQ P Q/P >p@  c0 0| S,A-PP4 0Q`pp XpW*1@P&  -P V<`p p0 8/PP`<``Q# PP P 0S $P P PP@ < P P 0 R8ʀp@-P@PP i Pn0@Kn@p {z011/@-\M@p`P \1S! 0 € ( P 1Ѝ P (00p` P10 m @80A4 40 $0B 0  Q Q@-@^ P ^%QRS  T00QNRS"  TŒ 00 Z0 0 P4G-@R(MP00Q P 0 ` p Pl `0T?o20S00(Ѝp`0  0-2/    S-0 2/     S0 0000000 0 00Q0/0 0000000 0 00P0/p@-@P(MP`/ 0S, R00h$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  M P0V00(Ѝp@ R 0S V00Q0000 00/@-@p00T000 @-@T @-@T000 000S/@-ht000 000S/@-hԘt000 000S/@-hXt000 000S/@-ht000 000S/@-ht000 000S/@-hӘt000 000S/@-uhXt000 000S/@-eht000 000S/@-Uht000 000S/@-EhҘt @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#x$0 02#/0 00#/x0 02#/T0S@-@1/00/T0T0p@-@ P`0S <Pp$lpgt/000 000S-/@-g-xt@-000 000S/@-g,tAo//- M0 vH0 Ѝ- M wDPp ЍQ0- M Q Q k 0 Ѝ H0j Ѝ^ Bd0($/0(/0$/ 0Y.<+ < 0/(/$/R/-~x` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@j P//-~x` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@P!f8U5U5E03#0@3#C#!@11@  /  }8: S-v P Sd0 V Sb0?0 !-0r-w0-0 R0U 7RJ @Rx00  0r -  w -    RB R7 Rx 0  r-w- R4 R. R$ R  x:0Rs  ! Rs0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- - S0S t T A0a0-0O-\A@pP8 ^P8  8]pP% 00\` 0@T ?gP0=S AP` AT BX ! i]\ i00C-PM\\"@X2T 0D$PT@g X`P @刐@@@@fpk pp fp` $Pn o   p[ X0p 0S8@<@@@@0R040040&4&&0&m]L1L 000D000D{]&X  #i0S +dp@ f f  ЍoЍ @li0 0 f yf uf }}}Ǩ||O-Mp`@cP-TPk +T @`0Z ǯ0 Cd 0;d P  @00Ds \a0DSW0DA0DS70DWUY:P Q S \ hP"00 0U00S 0qS 0F0 0 Ѝ0S U0 Ѝ0T W 0p@0` 0 XR 0AA B PR W p p㙉 㙙 㙉A㙙I`@Wpp~BX0R"\0@-0 M@ 00 Ѝ0@I@PhT00P Ѝ0˜p@-BR"^p@5@PhT00PpO-Mp`@bP-TPk +T @`0Z ǯ0 oc 0gc P  @00Ds \a0DSW0DA0DS70DWUY:P Q S \ )hP"00 0U00S 0qS 0F0 0 Ѝ0S U0 Ѝ0T W 0p@0` 0 XR 0AA B PR W p p㙉 㙙 㙉A㙙I`@Wpp~BX0R"\0@-0 M@ 00 Ѝ0@I@PgT00P Ѝ0Hp@-BR"^p@5@PgT00PpO-M@Q`@0@HP8U00B PR"Snyg R ug rg00 R R [:0 Z : RV  ЍW [ :0 Z :R R "00"00-M000 0 0 000 0 ЍO-$MpX0HSP3L0 @#@0 000@ 000@g0 0`P g0"SA Q, 0b CR!o)pp y4$;R`P ` 0*S# xS! S: "0 @F`P$Ѝ5%%;R`f"00f!0 -X0 00T0 0P000zP00S6#0Q``PU 01Z09P 00$Ѝ!0 ?/%1R`:*%6R`$0S`` P 00 0 S`d 0PT  `P< 0PT  `PqqHpdpo@-M@" | d@ 0S D <0 0 |0 30Ѝ 8(]@-M( , Ѝ mD90 0#0/[00/ZG-`ApBP@Q" Q J-XP 0R B P10Y O-,MH0p|8@ 00d8 P0S00L8`0S <( ,(,, @ WPT0+0CP 엟@ p@ z 0  00J D0@@S 00Q? 00X0-SQS0 < WP0-S0` 1 0,Ѝ6060Pt v`6 0  `,Ѝ 0 B @D@B@@儦:Q` 0+ B RR0P WV :R 0S000 6@0| | -Q0505 0 $ % 0SA `=R P B 0Z  p`@ @PpP@pT  b0S$` 2P y  Q Q p 0@RTZ  pAy  0bZsRx h400S 0:S L `[0S04 00+ C# :S$ T;Rm0S00X0300300S 0:S 3053W 0 0+ C0:S0:`$ 0S0  :R 00X! 0#0, 0 0S000200S 0:S 20?`0JSR9 0 0 `S``P0S,Ѝ  pAn q_ *(200S 0:S ( @˿1 0 100S 0:S ⹿Z 0 1S0$000x100S 0:S ⠿00C 00a,1,!0 000S 0:S }000+ C#F00@te ` p 0 0D0G0Z10@,(YYY|mPY@lxXH8X0XWWDWW  +@ *pTH4 ) ( ( (R0 'QO-`2pᘒ0 R" P@T6l0h 0R1-[@P8-T@PA T"RPP 'QP? -@ Q0P  :R7 1 0 0S! 000P@P:T0S! 000x100S 0:S XX0 ?@0S,1 00@P 0:S  WQ 0:R0@ 0S 0 WP0 0P|00 h0h 0 nLPPnPx@mtOOOc`0O$NbkNpNpNdH Wa@-`@-\ \ \  0 P010  0 0 R s 1 0R L^0 s 1# 0^b00400 00 tbT00a #a` #`G-P `@p0#03w00qW@D T@! BY 0 0R ! ZP  @ Ga0 pQP@-p Mp! @`P CPP% 0@p0` 00 p0@P S Ѝb00@ b0P@bPa@Pa@xh0 0 Xs(0@- @ @X~o0  ~A0 zA/o;" uA@-M0 0@v0PЍ0 SQp@-@ S00QUPQSp S00QUPS00Q-1@R !0/A-pR P@a@T T0 1 !3/pWG /p@-@PT 0p@/p0@-Q-@M4 ߊ- RPPoP 0000P@D0 Ѝ0RPRa00A-P`pc@PE 0U0" V W0 p`Pp`PoP/ 0 㼀0@ 00D $P,`(p0W pPpPV W |px`p`lPP```T`PP`Pa00lHpHp@-@0`MP1S ,0S  W$0S  W pЍp0@-S @&R0 P @0P d0 0001 1 00R` 0 p@-@0`P1S ,0S  W$0S  W@ppp@-@Q00C0S0 PQpGP--M  ?Ѝ Ѝ/ -- M0 0? ЍЍ/0P0@-$M R P@0S$  S"[  B0!0 00 0G$Ѝ00[L0 @0 P 0S$  D0Xo4XCP 4000S$/00//C`WCDWA-`d!P`1P 8M00400. @  Q ^  @2 OV8[pU 0 0 40 30/8Ѝ @$[Up  2V@p@ pW \P\ 0 P 0 @2/[p(@p@# 4XlVR- M ЍA-!M@44p psP2 0  pp }PP!@T Cn`4 P8TsP6\P @T@0S x )}\ H0 0 <8 30 !ݍ400z}$N (]PPHV[[O-FM M@$ĝp3 0ZT0d40X (`d 0F00;GP0S 0F mPU 0 dP(00A`P $PvPq$Uh ,Ph(,AP *$U , Y "2 0 d4 30Fލ Ѝp 0#P1`P[P [P: / pP@ @U  <`W= WI 0! 0 0`0 0 1Ptt0$0SP / p@!0 P  W00! `0 00 I00  `0 00 ;0 lE ||x@TxTTxTxTTTD S S NxNXShSXS4S R| Rx RpRp | 0p@- M`0 P000U] 00@P00nP0ݡ0 T L0 0 0 30 Ѝp]P]P@ P@-@M1P ` p0000]T T* b]/00@ 0 0 0 30%ЍU0000 @@P00nP0ݡ0>]P:]PU00P  O-MMP@@``"t"ĝ2 4,0X0|4040@ `0   p 28px`00380 @P! 0 2P}1\00S! \0=S0`S"`V`X`V `ሀ\P\0#S 8PU  800C80u\0 @x000004GqP\ @|P x 4 5qP 0 hT$ R@$ R lONNNHNM_8$KiLK$JJ|3JJ0S800C80  0<0PPp`8p 0 W ^W0X0P@5P5XPE\0 0lPھ5 00xC  {0PtU0Py0Se Sc $PnW +(PgW $,P`W  7Po< R1 !1 0 |4 30oݍЍ0@[  0,O  @P <080<0 S  P 8pW 0   0 <    `OpPы P͋ P$b[0S @vTp40lh8pG_C-pq04`0!TM,P@ p L !t x0 00  zP!Q P,P[PQP0 '@y` P0 0 L0 30 TЍPy@ ,XDMLCL-MЍO-p!1\M 4P@`0x!0T00q0 ㈐倠儰0    yP80Q Q,P\PVQP2P 0S 0 @|y 0 0 T0 30\ЍpL0  @PUy@ ,v1VLDHdHdGA`-MЍO-M 4Go$  0020 f00-05P THPi 1 S S   x#@ l# Sa  0s000 S ST S0 R R R R B RQ@  BQRS 0S1 @+S7 -S[QUp @Un0S 0S 0  400_op`R0+S4 -SF _WPPUpwV WPR2 Pp S 0QUp @U40S\ QO 0 000+S_opR0S @S0 PP G_opR0S @S!0 PP`  ._op`RU7 0 0 2 30ߍVPPpPp p~ S!@B` \ d 0Rt"O-`l2 hŸMM@0 yP08006N M.0A 0;PY 0SV ܀ +O+B. 0 H 0 B 0>P @P3H0: S4 d10`! 6  # $F`@& ,-@$ (a ,,0@ 쏠@$ @)b!,`P! @$P%@$͌n䟠@@ @ P&` P $`PM,"+ Pl]!( `.!+ `&dA+$ `, `&  $`eQ &`- +.,`뿠.`$`&` ( (` &`%,`&,b!Ϡ$@ `͌*`*@ `@$P `P@n]@$ `@$ *@$`" `&lO4@@ꯠ@@@`M $`  ``( .   ` eQ- ,` `, `&dA0` &4`..ba%.   (,- ,,$.`ϠP ͌% P.0P._PP&P%$P@p'p'b!p'@P @ P%@`@PlM P% P%P% `"`&n_PPP4P,`](`(`( ()),, dA`  .0 " !0 " "m "eQ !⏠ $ !  "0fa0,`=, /H @$+ + @c1) $@ 韠. +.뿠O @ $PaA4`%,P!!PP`P (P * *nQ *00 0&`͌ꯠ0#(`0#? 00a00@0&@ .=.lAo$`0` &` Ϡ(c1 P &,` P͌  PPnPP`P`%$P !!m lPP@Pf, @],(@,@Ϡ` `0 p'0`͌p'0p'`0eQ0@@@M 0&la  0#0pp0#pp p }  dA 0 ,͌?)$))gppP (P(p ]((,p pplp` p `&p `&eq`& Po``PP@P`++@`+ ]@ @@ +nMo ( ( eP菠P  P 佋P,$ p*0 p' P% p' P%  0! b*LdA0 00,0<0`) `&͌040 0k_00(0 `=&`. `.$o` `$ `&l` `&(`&`& P+P%$o0``@c1@PM`)P `&`&p Po``, `,n `'p͌p0#0#dA. .0 p=lP @$@$c1 @,M,n0#0#͌0dA.= .`&l,p @$@$c1 @ p,M,n$p0#͌0#dAP.0 .=l @$`&4@$c1 o@0,M,n0#0#͌0 dA= . .l` @$8 @$D @@-`Hc1LP 0#0# `80m4  `0 0 30Ѝ`0+ EF/N Iv 2A!#L  00/A-1`Pp00.!؁0% "0 0%0?S@@h F+0hS@H"p ` # *!0S@@:p`F AF@-@ M1`P 00 00R0 0R1130 0~? S pp 0~? S U PE "0 0R1<308 (0 0 0 30Ѝ_t ؄^ 0 0@-PQ0M@000   M0 @R C0(0L @0 0 0 30Ѝ0)|PP^@ א]G-p!M@1M ࠐ0 (e050,UrP&0F T08APUo0 ;u0+ X@P   :U0 U OPbOTP O@XO@  x0 0 5 30܍Ѝ 0ZEP=Pᘹpp`|Pa]\\H- M0 Ѝ@-Px lMt0p @`00d00 @0 (0 0 d0 30lЍ4[[D  13L @0+/ gE#ͫ2TvO-tM0 p03?0P+D0 Eh0@`p$000#!00`c<e $P```&P `@ek4L(p  8h p!, Pp'P0 pap=Ffk TDp  , e[dK|l`  j, 4ˆn! ᘈP  !`k  < g{!4 l[L(  , 舊ilL8 ,` h a LlɆ`H`  !h` ` 0`adK`` ` PPlˠP%PT`p ` p`HY`&k`p ) a{fii\ )` die[ P @ @fk@$@\ (aˠ Ih`  (i D荎p`  *` \8pp .*X a{ndK   "ꭌ %hie+!4P, /HP P0P P,@nɄ@dP* Pa0 0) P%fkj錈T@l@ P eZ\0! M0,0p (6m:Glɇ % ! h e[PPPPPXHp$Pp!P`,l[ !0dKmn{ @ . aP ,  . l̈`4&fk   ,la芄 !  <@`lɇ @(\ @h  @$@p@. pp!l[p,ldIapp'n p `k g},d 0$  , dK ! a,<j D' !lɎ `L g{(`a* j荆 a[ !, 8 !l@ lˠ @@d`` @.`@`@$hpa@n`(pK p ` `& ``{)Thfl D !  )L` $ *i PHa &dK * 8]fk ͈ X `  *h@00 p)p` p'ip % e[ "gz `0b,@N=S9J.@n!l @ @a@$(l0 @䫆`"X@,b+g{ ͅP@@@!D` H` `` aD$ j! T ``PP,P%`& PL`4lˠ[dKj p  p'` a{ b* n%$!  P 8e[` @" @$ @ fkLdI$b8 !,a ,   "n H)lͅpPPP%h P` eZ`$ `&`d{@@@$b+ @$flM, .,lˠd 0d $,e[! <a\0 &<0fk 000#` 0 dKa{9 . "n -T, (!lɅP$\`k  c,:" b+ @  ` lˠ. np p p, " "ac;͈  00*P 0#0 zn c- p tЍG-`p 1Q0@@e T0 U?W@@P@@P"W*TP(@T(pG  G?  Pe?  W*0@-@M P0 1 3/1 @ cR c B  T 0E P,̠,ĠD 80 0 0 30` Ѝ0@.HB @B0Q* 00 R * Bx@-d z@4  R  *4 8/" x0 S\ R `0S Р@- dV@ 4 *8/t,uBxM Ѝ/;R! /Q/--M  Ѝ Ѝ/0  0c㾱 <c㹱A-M `Pp @0pp pO Q ,0pp  pC G ,0pp  xp7 = ,0pp  lp& P 20 p A@Q \ 1 ! ^ +0̠ Ip`ЍG0 Ss  @-@ !M1 M PHD0 `080,p p =P3 * 0 0 8 30!ލ Ѝ"9p pPP =P* @D0*@5RG>X=p@-+,@@PPp@G0PpC-PDAlM@0SH UP?q@@p@C` C$0 `(`C@@:P$@@@C`C$0`(`C@ @nP @@@|CyClЍlЍ'& @- MPStqt1@p`PP@@T 0Q P Ѝ$ gSP @ Ѝ@ [SP"0S- -S?@0 0000 ` 6 V RP +R@@D!0DSX 1SP0S +S!@?@!@h;8*X ?P L0P00 1 R/@P/!R/9 @$0>R0 00//9@-MP `@ pbCpPU0D>S 0!3100 0KCЍ>SH 0!3100 F00F0094/-p@-M@P@U0 ` ` {Px0x 08 R;0Ѝp@Ѝ/0 a0T( $ ]8X P=Q@-@B 8XA^^14/.-,+*)('&%$#" R"  @  +S@ -S =S  +AR@00R- - ++  @     0RuS/WS\0@-X0CSLE ;0P0R ^ @@PSPQP@^  0  0 uS0WS+S -S00I0 0+S -S/0 0 O-LM0gS` _8@(P  㺮pḮ 0 0D @ =D@Th87 00`0000 0 pa0FSX% $00+V@ 0-S/0=V00| 0P@ X B R d \VS  "=V  R   P:0@$|D M=uD R "0@$   Y 0 S:$]D@ `-=UD0S 0"0C$0 WX    `V ,Vy`PZS  Z0P$1D $=*D R "0@$   : =Vq +0FY?o20S Zk 0W0 00X00@ Z$D P<C0Sj$0"" Ⴁ@ 0 T000 , GR;(I?&I0$0" GR|<IC @a00S@9C0"SV  T3* 0 S?*-/+  @ LЍ'}`pC~p =V  !00$C P$p<C0S  "2 @$~C00C@(C@LЍ}$|C P$M<uC0S$ 00C01DsgC00 0+\-L`k +B XRp R  0+B p-R +R XR 0 -R p pWp@PPQ`4L-M 0  p`Ѝ P 0 @-B/o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`0+P0U PU  0 iP PB@B@PPr@UP ,000np 00\0p@-0P`@T 弫@T0rS 崫Pp{p@謫媫P0+Spp@lj圫A-P@`r\  00p勫<0p0 ` @ 00p{@- M00j0P0@10 0 A 0100S5;p@& P 50 0 00S00 Ѝ0 0 @.0㡬A@5`0 00S ,*A@ Ѝ4((t $ |l@- M,A@! @0P00 000S.׫p P 0[0 00S&0 Ѝ"LAt0 00S@7ت֪A@ Ѝ0f$b^'8t, 818!0@-Pp M0S'1@T0 `0`S@# 0SV00) 0S"PWA0S% ;p  Ѝ|#t0@T0S \;A00@40 0 %t G-HM`00 0Pp p@ HЍ@ pP 0  p Ӫp@ HЍp@0S @W 0P RṪ@O- G1@000` ͌0  00@t40,0`$ ; 0Q,0$ jZ 4A$00 ; Z00[0SP$04 @0"H T(02@`0 0,0$00T Q S #.E!b)L@T(\/H0#"A $1?"!!#6  [ <ЍX300(0j<30(0c$30,0E [0Kd K {2\ T400$`@`P !; Q0[ QP$`40@x QX$:6ST00R0">E1c\H0T)L "1 #1O"!`00(0 0,00/2#!D 00S8 5HT1>O0000T`;0S 0 0 @000 10`00d`00@t0 d`000::000S@< @TPG-@` ``a V00"5FPP6 pP@ 0S? 0p R0C@ P 0 T  0s00S0 00 0 01 Z*o`@TvpP T !>P>00@pşO-ph MMM`T㰰D05>$5T0$0$*0*U@@ R R00C?o2 00⃰0S U0  S0E0'0Sw0000Sf0d+0^4 0@ 03/0S| 0@4$ 0000(@,00F$003/P   0S00*  0.S @T0S0V:0S 0S , P8 * R  cP $0D Q01/ 3 D1 0(0P00 0S 0 P80: S 0" $2 MލЍ0S} 0  0 0s00Sz P@T  0s00Shl=4/P 0 0Df00m0   0D y 0.Sv0Sa 0. Sp] Rv  @% 03/0  00.SJ Y P D0 =P9 @,  2/0B 0@ 03/=0Sw 0 eyBQ=0/(0 0 @ 03/0fBcB0_0\O-TpP"KMM \ؔܤ $ 2 /\@ P@`P\/\  `W!1 0 4 30cKލЍV6/\T*/ W0 /\ \@P  P`P 0   R  ; T/R  * R& R 0 00  0* r  R@  (03/0S0: SW/80Qڦ0R</8`0O-M$MP@ `%0  ~S <    pH 0/SS;R! B00 4ZS *0H 0;P4S 00C PR IR*0S0;R 0X @H p S  ! ?*OO **S1 @s000S ?S! [S!^H QM00@ S000XS 0H , R @ 0Ა@< 0 0R  R QX Რ@ P +@P[ "t2 0 0 30ۍ$Ѝ@\0D  Sr 0]S!^[0?O0!0?O0-0O]S  s000-S]Q q0 ]S 0@< 0]0?O0o  0BW 0R S0BW 0R S@^ 0 Qu  0A0 00?'0Y p 4L-0PΤ*0H 0;P 0!^[00  @#Q@b@`spxQO-MM@`p  @ 1^ @P@\ [\ {\P }\U PE0]\\ \8(~PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B0S008( #0 }^S0CV 0F 0C   h1  @ ]RR ]RR { 0A- M`Pp 0S0 0#0{S @0\ @{\0 pMP Ѝ0}S0S ЍA7: 0 @-Mp M0   0000 00< 0 ; S@ @T00 ލ Ѝ;^`N P@T` \T@\`Tiލ Ѝp@-`Pp@0T@D1 0CP@DP }ty000p0 S. *S8 ?0Cs\#S 0 P/0S /Q 0S 0 0/ 0 R/@-@"R,$ \5 BP   @ R# 0  0 BQ R 00\R @ #  "R 0@T p@-` Q QMP1M0P050 x 0 0 5 30-QލЍp @0  ̠p @EOp 0 s\sPDl8  0P0]׸ ~ĤĈּ5C-0eM$`P y500S |E p@#S!k80 phP$ 0S $%P @ 0S80SЍt ` p @0S0 04 0  0Sx t刄刔p 0fS0fS 000S3R0S <$ 0000@SV 0oS 0oS0nS 000S3R0S # 000 }5P 000S3R0S x# 000 h5P 000S3R0S (# 000 S5P( 000S3R0S5 " 000 0#S 2 0@ R@@%P00Ѝ0 S Sd #5P 000S3R0S (" 0@00q  5P  5P4 000S3R0S+ ! 0 00T 000S3R0S ! 000EtP `K@0S0 @  4P =Qf%  0P00 4P =QT%  0P0 0 0 0@0 +tP0ՌX`dhhl@,Ҭ8 yX x0Dp@-PT4P f@T$PPP 00p\@-,@@P00O-@8QMR0X0008 00TP~ 4p(p004 [X  6U (8 0 0 30 Ѝ`s?0l0` 㰨p 00Y 2  ٟUO ? 0 0 0000S'  A8 $0p P6<000S[ 600@6@Z 02 600` ṟPvZpJ A|\#R PA|\#R QA|\#R VA|\#R~ SA|\#Rw RA|\#R IApP#R HApP#R GApP#R( LApP#R@ MApP#R6 NApP#R, OApP#R% DApP#R EApP #R FApP #R 0X:U 0 RX H 0  P  00   G0 TR -Z -0S 5 00p5pX 0 Y[ 500@5@ 0    0@q0  80   㽞0 " r  0 " r   r@@พp0,* (@(uT  P;00St[v+ !5 oh500k 1m  ggc 0(@ 00F VV0`0`  X`H} T`F Bv?0 -50SY00<[$ |X0 ]  $$&`HP  r[_ V;0;0N`\ - M0ˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFpP P ЍpxG-p@`@0S&@@Q0)Ȁ\@@\ ?  P p0 R * ᫞p0 ᣞp0 ŸŴp@-p`pP`PF@T T0T0 R@@:pHP00/A-`Pp@P@!0S |@@/ R"@`@+P00'40@<T8@- 00 àC-`4MP7&@P 0S|0V ! sUpЍ  ㈧0P;  =R6 0Q*G B&R&>$#"M = -okgRpY WꘀqꈀvKSБpI0X{FH = 0 L4t@O-BMM5%005 u0 0p5 0040   +0 P 40 4P P@\ P 0S l400#S \ P 0S 4d44`0`\ P 0S d4`0`\ P 0S 3 0   \ s0P 0S !c30\ f0P 0S c`30X3PET`0L + H)P\ K@P 0S (.PP[[ 0P200xS0xS0Se "`2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S bH10\ 0P 0S rb10 ! 10P 0 $0000 0000d/P gl g( fxD,y e  dd( d\8@l\L<(p@-d@@0S P Hp@P@P 4kP ༤ppPp@-@P0P 4P .pPP /P YPp@`@`@P$pH0p@-@P0P 4P pPP.P -Pp@`@`P$ep4,p@-0\PP 4P ׍p<`<`P@Dp@-@@P00O-S$M<0O (6P@p0`U 0E   5000s 0?SO Sm *S 00 *Q @S50*QMU 00  q*QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[  @[[  \[0S @@0S /Sx .Sxv 0W q 0W/Sn.Z] Q /Q pP } /P P$ЍQ /QT 300000  ^[![00 0 00 @  p /S \S? S -RG P0 U@ ppᷰ0s0]S^0 p S w tm p+ 0Wm  0W/Sgep @_p2U/000 /ZU0@  0s0U ppᷰ~]^^ \^  @P PӣU@  p~^" @@ 0^ @0  "C0 %p@/ -R|O-Mp!0@  "  p` P 10230Y ߍPT 0 ӘpI  P: [ ;` 0 0P P) @@ 0  ὘p@ 0 ᢘP0P S P %">0  "C0 ᝘p@. -R۰O-Mp!0@  "  jp` P 10230Y ߍrPT 0 KpI  fP: [ ;` 0 0P KP) @@ 0  5p@ 0 P0P S P %">0  "C0 p@ . -Rrٜp@-`H@P@ ePpPpPP R,p@-`H@P@ PpPpP|P Qp@-`H@P@ APpPpPeP Qt0 00 -H- M0 S0 0 0 0 00 00\100 M\  0S08 00 0 0 30KH Ѝ/֨ -H- M0 S0 0 0 0 00 00\100 M\  0S0 8 00 0 0 30KH Ѝ/8 -- M0 0'--M  --M  A-`PdpQp @Q PD@(0 0000A!]Ԑ0P R   0//wD(ǟ $7 O-LM00D00P6f/0,A  00 0S* R 0 :R|RF  @ 0 P 0` P P P4)PuX00X0G : #P % X00X0$` E @p$0<(0 p$000p5$ 0,  pl5$ 04 `E @P)D @850 $ pp$0% ,00 D @T80_ P0p<@`(p8408@$40<K4 0p@t4t 0p5P4P 0p*,4, 0p4 0p$P3 0p$T 3 0p$ 303p$ * 3|3x3 t3@a@0`00400,400,̠0 Ġ 04!!8..<""@ ' R 8 @0Ps@qT?  A@=@9@5@1@p㔐 (   p$   p㜐 $ R , p , (p p㠐  P M 10@Q0 P0` B\P"#$#< 00 1@q@t@p$005T0hAW5V2H@00H!x0 0 D0 30LЍ Q10p"  f(PX00X0w tTw,(dp\P c|tXd,<X|PpT<840x48xDp@-@P> 0S0 7&0@0T9  T04 0R/Q T: T% 0 \/RT0C"/QT 0C: B0PU0P!Th00pX@@PP !04@@0/S$@@@@<$hhh<h(YA-MP@%L0PB @!0C`0 0 0   ! 0b0C S/:-,+*/('&/$+p`t*0 00S@ 0S 0Sb*0"S D8#Ѝ T1r0:R*00Ѝqv{p| |@-@P6 0S/ %@T3 0T/  0C/Q T% !@# *0P@/S  B3@T@!0 0!  T B3@T@!@@4@0/S @eeV-DM0  000弓p 804S DЍp@-`P p' P@ 〔똓p V U phۓUX p` ̓ɓƓV@V,XP?o?o 0@-@c^?c(0C^! ^ P@`c5$pC&5'&`c 15D0c@00Q!  "0Q;:0 /0 @- / 0%D00D0;B 00@ 0/ E0 0%D00D1;B q1@ p0P/E0/! 0QPoo A-@@aT?a(AT# T `Ppa6ŠAnj6Ȍ&pa 376U8a P0100S 00#!Q00;:00 /0 @- /  0#D0  0;B 0/ AC0  +0#D0 Q1;B p0P/AC0 Ja@ @-^q@ JV@ @-Sq J@ @-q J@ @-qPP `@-(00 ?0/R//R/?0S/R/P/R/p@-MPP`V e@T x00qЍp :   4 p@`$ wL <00 R Ó,@-(00 0S@rDG-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BPPX `h# @4PPY  @A-`8 41Mp,0P00S9 @200S ^@#@3@,,C000RP0  x0 0 2 30ߍ襵@P PP Ph(P0$0宵.<$|O-PC 0C,0P(  E Ϡl b0,0 W0r 00 000ZWj 0  30 S0pP( 0 0 0GWW0 0 P(0P(PW%SH7 , l,,0 Wv>C 0C0P(7 00 0!0W0.5  00P(,0 ,0$I"I/A!b!b0C 0P(  0 Br0 SeP(P Wp , 50 P(W 0$ 0 0W  =0 P( WWph 0 ;0P 0 p0 S 00W((Pg0 0P(\c0 , 0SP( 0%!E0?d"c,02#,0 0/ 0 0 000 0, , d ,00C0P(G 00 000{ n1, , N W,00C0P(w 00 0a, c0 =P(Y(P000UWb 0 0 0-0 0%P(/ Q 0 Sj 0s< d`K` 0 000 5v.1E @r2@00dR1Bn0n$d1N.b2#II   Ϡ@Dl@l 0C0c0Lnl 0C000C0 P US ZSP @  P810(00 0$0o R0P  R0F P,@051E1? 3ccK?) P L@#(@cQ: ' @cR # 3 h0 0"1  B00,0DSd0,0 6H 6( 5duuusxS *4 00(00N~0 S(0| ̜ |L̜@@ `WooO`F_O  OG @DV@r 4 00N~ Q@ `(0┱Pa 0(P0 0V(PP @ ACLCq| \^JS S  00S3P0Sp z H/o("SPzX1?TQ(P9 ppp@,CP(#'0 B ,##Pp& (' P%!E"ad2c;S,0<2#MP P(P @ @C>0P( $(0k  @ 0 @0@0S 00@0S 0@| s,0p0 0 0P , P(01(000C.$0+,30a\Mc^ @P$`x @P$`Q   0P , P(0q0(000C.$00 0$ p  l0P. , P $ (0(00c$00M0 00Ѝ01A-0Q M@HPP PM Q%d1 P01$T G@@ Pp ʵ. R! v` PdzU  Ѝ0 P0  PgfF ` La `ᦳU-"T 0 ЍX  0 01"00D $ $kPjjjkj@-0M@ 0P 00Ѝ@-0M@0P t00Ѝ@-ݯP@hp@-P 00M @`00,00   P00Q Q Q ! 0 x p0 0 ,0 300Ѝp ,HY ,HS ,HM0@P/ P @/G-X# p`V@P0PES  R D PE@0V R  SS0@0D@R@- 0BAs @ Q0C@R !@O-` M( VP? @P>  OpP9 001Sp Y Ѝ0'0P@P 0 0P 0 0 =00 !00L@-RQM @PЍTT @Ѝ  00G-`-pp!p1 lM0M050?PJP @ pA @\:^ X0p00 t勳0 Odz00 TV.qύ@0ˠ (, A@P  Ph X0 0 5 30 ݍЍ 00@ 00 |00- $  M  Ѝ--M  Ѝ Ѝ/ -- M0 0Y ЍЍ/O-R쑟 M@ p` R00?mt00P @ P 00 P ! !  4X\3?OP2  VP W6 Vp[XPp0P`0 ``f`00 0 00n Ѝ`pP" PC0 P P00S ЍpP V pP ``@-@ M-(0S2 0 (0 pp1/`vqP0)  0 0 PUoR <0PUo ЍP`TP 0S  0CPo00`P@-P M(0S: 0 "(0 pp1/`vq@0/  0 0 @ToR <0@To1`V ЍP`T@ 0S  0C@oOT00G00 e2R/p@- @Tp E2 Rp 00R0 ο P 0S PcP0¿ 00(徿 00 庿0 S,P 4P 8P p@gp@-P$@@۱Ip@Ա?d}@- @@ͱI@DZ?,}Tp@-,PP J@ṱp>} 1!0A-M0 @`00S P  0 XR0P P S= p5( U80C0HS60 S0QT.* @DT*T( D0 Qs0U   "Q T #R.S 0A a 0C "T #R Ѝp0@p4  R  *4 8/z 0X\S 040:8 R РS /&KBx@-Pp`P@P@0@D尀 ᗰU   ]z>V@-P`@ 0 @- G~@ \\\% \!00qP`\ kqSHX70000D00,00 00#U00 00p;U cQVFP@|dQ ^1 \\00SdQ Vl60100 U =U U 0P060000  l 7PEuP000RP00ES0100C0{ U U 00p 50000  M70Es0 0_00D%00   00Es0$% 0W0Cs0 20M0?Q000D00000>-Q004 ^QV00/00 K 00Es0l0W0Cs0 000ESF0100C0\A#o,%Ao 00&Ao  00=Ao#P 00. 3010pS%;U d30000 00 C10PP 0AnSrXGFEDCBA@:gSKIC:-$ 0PE0P0_00\00]00T 00U 00P 00K 00F 00A 00<007002\00-00"cQ`adQx@0PEuP00Es00<00pL00 p x t  */\ \p[ 0/ލ Ѝp` @ @ָ.<0 @, [? 0 /    <P @U00 @>00 @?00 @ 00 @0000A-@P Q %P`\Pp@P P`V 0"S Ⴘ00@p@- PHaM`=  4QP00 P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P 0<0 0   0 @da0`@`(P/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/ @-@A0 R R:\|\00\0S Q0A|R  :RRO-M M '0pĝ 7 00D40t4!S SP G@`V 0P0  pP 00S D  P R($'  b0 00 ; PM00P000xP ` [0@`0 S ZK :SP\ \S S SP0TD*[0+ P 0`0 SZBUP@0#SS ZP5@P00S0N0STD0A0:p%5 0 D4 30Bݍ Ѝ:SU @0T:H@DᄶP# @pP@DU  00 0S g00@ ppP  @'4@00S0 4 p0(040,P$000= Pw 0:RL p0Rt4@<0 0 G0$<4`P pdPY pJ 0:R2 P0R 0E`F00S:S:00`0H FZ#0 D 0 @  ᙶ 0CPp`᏶ 00D,Rp00GP 0H@D IpGP @ p :00`0000 0 0(S,P p% 0`S `S"0 SRC @H@00P~ ~ P1@<P1 04`40080 p07/p P e LGF--FTd@W@ @@-M(@;0@@0?PЍD  { { {G  {// =A z {{ {G+  B`{{// =A  { { {G  {//=A0@  { { {G+  B`{{//=AQ@-@0M P 0 0#$ ( ,0T _ P 00# 00Ѝ R 0Ѝ-$M 000 0>yP$Ѝ-$M 000 0.yP$Ѝ-M 0 0 0yЍ Cz Jz0Bz/C- 0sM @Pp0^010X0pA00tA庢0O0`P0P PV TA0) \ 0  $@4 (0 0 1 30sߍ:`P_\00- $  M  Ѝ_O-M`0?000301S01Z P  pP0%%[ p@( 0S0 R .> 0 3 30*ߍ]P0 P P0C S 4$0@D 0zSN~}`{zyxwu1lj0 ea`^  [GW000P 0C0PG 0SH00E 00 0 0 0 00Sn 0  JZ 񏐨m:P0( P 0P0C0S0000D S9*S0= $0R $ (p0J p 0, 00A@QD?g^Y T0@p Z3p80P @T0C0808  0S>P 0 p0080 80 0CP/ 0T@0 0  0S0- / #RR 0T000C0 p0 / #RR p0T000C0 SP P0004 0@D }1T@!@=$080 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Z} 8 00C0S_000@T80:S XRY    0$] 0        00080$ 0CP000&}   $   S|@ @px`& ZʱZ|  }6P {1P 80(P# Pp0 T0C0  SP 00C0S@I0 S0  @ p p,0SP00S[ 00C0S000]0Ze p @ p,0ES[ P 0@0C0SQ0Z0 I @0 pES p PS[ R, 0@0C0S 0 S000L @+ D  p@ B R W. @zP 0 p@0C0S[0000WX +D @AQ 00 R @ pNTA 0Te@AQH 00 R p p@XQ[@AQ   R @ p0,0K0=0=$0Z #  R #  R4 WW p B PR @  PK0 SH 0iT nT  (p B@R  00[K @ R񏐸D" AR> p@ B R 00W@ NR- p@ B R 00W @_ (T @ B R 00 R@p )T @ B R 00 R K 0 S @5*ZZ 0@0$0pT 0U04 08$ 6 `00 500S 80SG000:[aP 0@0C0Sz0Z0  @a0SH P0[ 0aP0[ 0`(P$@p 0 0 0[ ,$P0W 0@_p8p / #RR  @T B   8 008 80?03SS1 0@T0C00008000% 0SP 8W pA00000P<0 S9 0@P20Z/ 0@8pQ:8PB0 S? 0$0 s_T?o20S0 p@0C0S0 S000Ἢ Pl 0  B 00 0?@0Kp `0ဪpR P p ᩪPZ 0@DpP 0S80 00C0S0000 S @, pWp 0`(P$@"  (p B@R r 00 Rh$8 ^00 "00 P [ 0@00P P]U t@ 00 @P00P `, 4 ` V   v@P  PP0000@4nPP0WM 0@+P0W 0 @1P90 S6 0p@6PB0 S> PP`9 7P0 S/ /J,P60 S3 0 p,@P 0Z p PP` yP0Z 0@ W @ ptTbP0 S R" @t[$ S C8 SDP0 S 0 p@0,0:p4Ĵ @-0.P (p m(p` P1P0 S 0 p p@  (p B@R  00 R P0 S4 { 0T@3p[Np 0P/ 0Pp00[ 00`=<;:987654310/-,+*)('&%$#!  h^0DS13b0 d 囥 P 00Ds0S 0S0 S  \00T3p00 01@000@0@PUc*$Ѝ@\ M00 a P- R@ ^^? 0 p0  YP 0J ZS0 - 0J ZS)1 0000 $Ѝ 0S0 H100000\  s  p0\ 00Cs0S00 p0 0p0\  a  p0\  b  p0\  t  p0\  n  p0\  v  p|0\  f  pu0\  r  pn0\  @ph5X QA-@p`P P=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 A & &A-P@p`ᏤP .T T!0DI1(0D,TS0 Ae_T $0T"@%0 !1 &4O-`'S 7WM @(0無0T1060$010 y Pr0P 0 rpj0P0 [0 0 190 P@ @2U1 p00PU`p! X U0 1 #gP00? PP P5%0 [PU`p 0pGGq WP1 P! L`pP+ @ 0S V L0 G0CSa1  5* 00  R1  4' 0(0  R1 001 001 001 "001@\001001 H\ UG `倡PUB 0 p9/P00Pᆣ儣 傣 倣#3 0 T1 30Wߍ0SIP/3#0 /[㙢P 1l3zh#h0 [X 00(0S 0S,0  SZ 0P00CDp(0<@(0X(0- p`0480@ PN nn90p@ 0>@@\@TL 8@,@ Tn*0 4L3>|8050 W (0$ 2,@0 D0R #<`Y[PPZM* < 7000S00Dp P0 SR000ڢآ ֢T 6PP2,0Z:@1d@ 0%$0 0%$0 R%/@- 0 A-L)Pp`@,0 $5 S9 S@T @dT V,0``<,0L0S00/S , @ 00` cpp@ 00dPccx0x 0p@-@P0S 0`00Sp@c(P(M(K( <t(1(0A-P (M`@P @Ppp 0 00@姨 P' 00CS(  p0 0 0 S0;1:(Ѝ 00?G0?G% "00(Ѝ0 0M 00 0Ѝp0Q/0S/S/76O-Mp`@mP-TPk +T @`0Z ǯ0 0 P  @00Ds \a0DSW0DA0DS70DWUY:P Q S \ P"00 0U00S 0qS 0F0 0 Ѝ0S U0 Ѝ0T W 0p@0` 0 XR 0AA B PR W p p㙉 㙙 㙉A㙙I`@Wpp~BX0R"\0@-0 M@ 00 Ѝ0@I@PGT00P Ѝ0dp@-BR"^p@5@P3T00Pp@-LMpP` @000KP LЍ`0 谚LЍC-P!M1M `0p00<0! @PX t1 0S P(3 Ἃ  .cP* sFR P $PsPP) 0 0 < 30*ލЍ o9n5G㨀R 0 P P0n SP0S  X@UPPP(冋(IPDtxp@-``@Pap  @PpPaPp@-M@ $cp 0: S  ap  ^Ѝm00ЍO-p-$@`,M @<300P0PS?o2P[$100 @e0@$0 p @ 0 T  0 *O 0H@P p0   qbp@D P"0S] @Tx0 pH W*@0P   T1P [ 0 AZ Tf@Pf WP#: 10 001[ 0 P0 0P P 0 S 0S[ r pK0@ @`$0,Ѝ0 ^00 0$00S$0gP0ȖP  000 ` `p`~ p pP p@-P ) @T @#T0 0p  O-@Q M0" pbP` @[ P51 5*P@ 6/P  00 U[ I:P PU@ Ѝ/O-RLM<kQp, @<000$0@ UP_ 0WP@0`p00< 0G000p 0 `8/PppZh*0d 0 0 `P `RP(0`4``p,0 PV :/P W X(,004`V1 011p1*`G0p 3/P00[ < 00[G   pW: pW0  [:p K (08/(0P <0 0K00 p' R `P0S Pp0(06,00S 3/@Ѝ R[0(p0,003/pP 0S /A-M$P@ 0P ]00 `pP zЍ00pO-}Mpl"`d2 (0H010j PP d@Pr 2 a 20 RF \Y1$@ 0 01  0D00Z0  0@00, .48p<`0, PS H0 03/``(P%  6!0 0 1 305}ߍ          C  bῐP ṐP||bᯐ``bw X<D ` `t `xPP00/ 0@- UMH`00L10Ĝp! 0H1Zp@%ZP&Z0P\ p  S 0!8 ,0 0 L1 30Uߍ, ߰4 $p@-M`@YPPPЍp [P fYP aYP 00 0P $O-(p,@PfYP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV 0P``b@P V@0SZ V@ݏ00 ]hG-`R p@P8/P @PV!1 G-@Q0MP`000Q UI U .00P!1 0 0 30ZЍ0p )P00 S0 00 00JYPP 0 ?YPP 6Y0SPUp!0T  3YPp0p p PP"Yp 0 P@ჶ0 YP ܜ H/ 0R B  / 0R B   / 0R B  / B/0  Q  B / 0R B %3 % %//Q0 / 0R B    /0S :p@-0C@0 P 00 0p/0S :p@-@0C0P  00 0p/0 $000  / 00$0  p@-P@gYP 0S S pp@ZYQXP p@KXp@-P@MYPp >YP ?YP 0S S/XP p@)Xp0p@/p@-P@$YPp >p@sY :Y0@- MP@XP Ѝ0 YP 0S0 0Y ʄ0 0S /p@-P@WPpXP WP WP p@W0S S  /0S0/ R R  /0 /! / CR ! / 00/ 00/ 00/0 0/ @-/ 0SAS/0-O$(0Oc?S_c00 P @ P $4#4#4P 0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1M A0 030<6SPF /PYB <0S !1 0 3 30;ߍ(#@. R R  R pP0  R p  #~ 0S  % 0 0 , p  ~  p O-IM,M`X$@PPJ L4 pI 0$000 0S S  $I3$ 0 0 30Iݍ,Ѝ RJ-  Ⲱ RW#  B J=00h)J=0h0 H<0H H0 H H H H H}4 <0H hP |J- 0SJ=0 H" 0 }dJ- 0Svp0S@ S# UV J=000pO J=00aZ> O< BRPe ;0SP Iu0S 0S  0S0/S S0S J=UV0  0"R #< QS( S DJ͍0 ?1嚏*0 0 000H0,0NP @(& 00SLP P P J=00Z0  QPJ͍{P ( Q4 O8O-`\$@X4M Q@p0DH 00010P0CS+H5('&%$#"! DQWX000S R|  R RY_`#X3 0 0 30Ѝ8,30030H 0 D@pЍO{QWX00VTVWX "0 j| =X%: K 0 l" Y|pP5T30Sy0S D ," H|PTVT00P 0Sj!0 1|T@@O 00!0 "|piT 1i #YxP``1p\P0 ppW@D 0   {T00? Ypp} 0䠟䰟P0 0pY@D 0m   {T00? D {PTpyX  { ͤ ̨ |@X 0T(G-p!`1FM 00104 P@p, ,P PV PPV> ]0@Sp0 00q0 0 0 0P 0 0 1 30Fߍ Y:wp0SX 0S eP 0 R0C A-@ 0P`p0  0P hp@-MP`P@@P@T 0S  R0S @=PPЍp6PPЍpp@-@ppPPp0. SAA0Cq .S .R Q P -S /S /Q P _S 0 S@-FRB0\R 0R: @PTT 0S`[ DDpW` UZ ^" DPD`V` S`" @@@0T\\ /  R 0 0 0R0C?o20SL`V0^ R 0\ 0R 001 S0 S 0R U ^( D@D0T 0U ^^U ^ D`DPVS` D@D0TS 0R0Sd!0@- $M0  AS0 0S  R lQ  hQR 0S0T000$Ѝ00S S R' 0S  0S0S0S/R /0S S/@-n/ 0  00S S/ /0S//0S 0@- M@PPN 0PB@F0S0S 0S Ѝ0/@-pQM @`PQ Q Ѝ0SS ЍS PPV0S S p  0`00S S<0 ] P 00 Ĩ<|`O-@"M2PC<0 `:0 0pSP0 03/P 0&,`&<(0( 0 SS0080R0S[ d RDP4PՔ[I WFKp:0p 0(p,@ 0  pC 0pR@P0 0 3/P @ 00lSPiS`fSVz80Si U% &<(00Sl&<(00SD u!`P E0/o"SQ]pEorRF(0S D0Wpp$P@0L@C<0Du\= W^9 @0 C ,0P5 0P,0(00(0'QD @$4, 0 0 30~ݍ4ЍR00&<(00Sd &<(00Sf  E'UR!`{ XK]0p(PW,@D [o <0H 샟ZCAh`X [. p0 $0e   3P $@r @0S S000 P0S῅[UQ <0LE0S/ R00UQ UUU0 !U UD u!`P'pE0orS  R E/o"+H2000SኅdR00T$0D4Q0 D tA.<0@RC@D0.%\00S@@>R@/D0zO4 00Q`PL0 03/PD W 0S<0 0 `0D,<0.RC@~9&<(0@` 40 `@%Æ0  0<(5$%0 %?R (0Sp  t @ 4 3|pQP QQzO4 000Q`P0 ! ` P WpP $0 0R T4 4S Q 4S 000p0!QP0000S 0R $R R $R 0pvO-SM`$0P|4 00D10pP  P  Y8p0$ 00S  0  Pz 000 XPv @@PY 0  GPZX@d#\3 0 D1 30Sߍ0000!Q @T\ 0 .T0@T RCSQ d!"Sy*0 C DD@Q00 00000000 :Px0=S| P0SM SA SB 0S 0 $P0sZ0Sa P00 @S @Rd!"S1*.T 0 Pm  MGP @@`!1 0 0 30\Ѝ0 SRJ 4@PF  0 `P 000S QP`P@P MKT # P X0 SR @P  0 S`P000S`` P 4 q`P001`// |pp@-@P@P TpO--/ M@0?6  p& 0020    " $ ( * ,  Xx☠  0S0S  p! 0 / "2 ߍ0S0S`;0S ^01@3>p p  0pW 0 Q (.0 ^ 0S 0G?oP20Q00S0S  00 p P `0 R   L" l1,`0S$]0 RS S0 0 0kpP  <p0 0(0 $PpW g872 G62 0W00S   S  R  R Q ^  ^# \Q/o" SV RW0S! 0 PvQs +0 0Sl QRh 0pS[ %0P,0U ɌP , 00 B  @0PpW ,00X ,P8`P<`D4@pW 0S0S  R R  R P00  0s:QXQ Q ^ y0 @PppWpW?P U0S} 0p pP,$p( S R  P  \G P4 PU( U e752 E62 0U0 S\  ^"SpQ^*\'P pU,5 X 01 0p`0 `pVWP 90P 0J X  0V``P P`TPXP8 0S0 0S p2 0PQ/o" SCRp  0IPViH0 PL RI 00SB RQ> 00  vpP 0 Pp0 Rp  RSpRolRn  P:R \ P0 X0 0P 0 0[. 0[(0S 0%05f 0ZX PU0@S =>$`X000 0XPU @@PP ?=U@XPU0 40$`` 000 NPaPU 0S S00S0 00 0RSQ 8`4@,PDp?oR20S PsPpJ U& @PP ~~USpp7 W<2 pp~P ,0,0pP  0P$ p PP ~~YP`$^p~00)}P 0 ``PX H X:$P PP}@P HEH HPT X` @T@*$P @ ~,20(0 00p`$@ YP` pP@ \@|pT00F T~0 t0lh0p $0( ppt ! H0P0 FP4 F, L LGP00F),|,0V Sj S ^ ,`Q ` 0`03 ,`Q0 QT S F  ` t  ( f(f]x P 0p0$@0Y0Y(0 0S  00}PPP `0V 0`} 0R ``  }00`0$`k$` uF,`N. >s I LGP1x00x0 }nPppP @$PP `0V 00`}T0`}O-LMℱQ0 P@     `P00cPF 0pp R R R0 T@R0P p R ((0( IP00 V pW X 00 'XppWV$@LЍTR|RtG-XM`@RP pP@0 0      0LP 40S0- XЍ mP |  0/P |8<8 LP 4PPI 0 \\,O-M8B0 0,*7:N0j 0" 0# 0M : ! ,-$@ lȃ *, !9 )M  #8 " ۦN b.0,D*<?A0ꪂ 0! ,e64L0lȊ 0" 0#0D)O4  " *Db- ( ৃ㔋Ja 9p ,|Opp0ȁi 0[eF0#08p5``  p " l oHb-`` 0p!}doOa` ` p,meHȁ``0 0(p0#0OnoF5``  Dp " f,nOb-``  p!ccJa` `S7Oe0 004p 0#0 c= 5":-K    "  Bb+ P!0  P@0,0## +N@  0LЍ3 E7FN, 0(Iv420A /0A-`!Ӂ000@@hPp0"V>0: V0hV@Hp` L0S@@:p`F Ap@-PM0`@ 00 00 |!7R8 bx b   D 80 0 0 30X Ѝp@8 ~ ~XDŸO-< 82 M4"0 P00p  `. 0\ @ 0 XS@@|[0 C" T. .0N|0[.\'^V*004!$1 0 0 30@ ЍT  r Aa B8 LR\ P 0FS0 S S X[P0@^*0^0 8< 4^*0 8<^ ~ } |- McP ЍDD!@- 0(M S $ A \/o"S R9/o"S R L 0 0 $0 30)(Ѝ@@    (  0$\ S $ L R \0  R ( $Q C { { L A-p4!01rM @`P0X0100^pAtA=i0Oyi00TAV ?2D 0uP" 0 npP 0@av0P 0` X0 0 1 30 rߍP v009P 00꧂ z y@00- $  M  Ѝ x -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/ x`p@- M`J@P @x0`0P0000 @X@E0@GT  Ѝp xg\ X1! @-`0M000D@p P@ x  La@p >@ 0 0 0 30*Ѝ>PpW @@T PU 0SP@6T00@-00 wl v 0p@-P0@ 0p0v(0Pv(P,P v 0\0PP 0P 00,,gP 00pB6$B 0@-@ 0 0f 0  0 0 ɒ 0 0 00@-P M @0u 00P 0 =?o02c Ѝ0l1 00 0p@-@P 0U0 0pp@-@Pu0PPu(0Pu(P,PpO-P0Ph `Pa @000 S S0 S S `zpPP 00 pZp8 $i@P q0p00S S S@ 0A S  AP 1 @P 0S 0000tP 0 mtP@@2@2P20 O- M`p@,0(Sv: a(TZ0 T0V 00SR 0 RL@D@T0PG 00SC000@D@D0P0S, T0X  0!0J0@PH 00S#0AX0偰00  )0S000   0S& p0@t0ppt(0pt(p,p@ ЍtP  (,@(0  Ѝ0 00@- M@P  0s P  Ѝ00 0 $$ 0 `P Ѝ0Dp 0$ $3 Ѝ0O-LMdU$`@P0 @@DuPI$rpPE 0 @@7uP:$PPW* 0`Q QD QR Q) 0S:00S} brP  ` 00 0@ p R  R/ RY R 0 @T: ps 0J[0K 0 LЍ   @ Q`A@0S:   0 ἐ0  ,0  p 04`0 0W G   ` ``@`` @T: 0s00s `^ \LQ  QA@ \V ^ Q\ @ , p 0     S QARU  R  PP@T( Q  AX  " X. X4 p X @  P@T(:;X X X 0`p` 4  ` f  Q@` `` W `p`Nr9 L=<'QO-b P`ѭPY<aq(0;[ p970@$0` $p3? W`(0,`2(-`P [(0 # 3W, `0!(-0P SQFf& U`V3Z` `V:PV Y5WW1!030# 0 r@000W; SP81 `3 `#S41`F2s2`Fs1`FS0`Fg`F0v`4:0;`0Y SP81 `3 `#S41`F2s2`Fs1`FS 0`Fi`F0v`0809``` p@-`M:p& @><p) P0u00 @ J0@:t `0 0)P Ѝp;:q00: / @-\(,@\ \  Q:^: A Ͽ|q<Ͽ1?00:00$O-\MP @P0( Y 40:;pɁ B$`; -:^*bI:1 喑a@9837` # ^  0008` 19P80 @A4ƌ<ŠaЍ /r 0?s0q1 2/3?10 0 0@-S@ 3/@4<A-pd Q㹉7I@P-7I @P @D  T<Ͽ2/ p `6o`FLPV% L`B, `F Ef& BL&&"L`F, `F Bb& BLQ"L`F,`Fw&Tp}" @D  2/ 0t 2/P HPEV%ApG!pG Ev' BA'&"AG!@ B BA!" A@!@ 蹉 Q7IP' N ^<Ͽ2/ `@4O@DL@ F$L B, PB DF% BL$&"L@D, @D BB$ BLQ"L@D,@Dw$^p ^ ^ | x 1t 2/P^$^/ ^+ ^-  2/PT T @D 2/ P @D 2/  2/Pw^u ^ ^ ^ Pl    \ X T  uC10 @-0@0 0 0L#d.\ 0@0\ SC@ @ P p0  0C00 00L  00t@ _ <0@- M@1 < ` ]O-MM&(<ਤ |$ `!0,06@@R@@0TL06Qm0P00 (`0 0p0/ 4 L& 80hP H TP6&0  @ < P0D0(0  P, ?oR20S <0`1  D0`V 0` 0V XH S`X.h0SX 40PepH5`00` 0VG W80? pr50= 0Y% W0 $`@X400)S d00p`( pP* 0}  )\4  0pe @ 44p0 ] 40 pS 4 0pK `0SnP l0P00] 0 `#<3 0 |4 30ݍЍo`3` 0aT0S ,0ST<0`1   DUo _"2 0 |4 300ݍЍO880 p$T?0prR( _W^t2t"0P0l2 `0X \@dPL r_`GpFW.xD `R- V P d_@  ]_ Y 0 X1L  000 .)Y`GpF 0 ҺW\@`dPl 0  źVL 0 ེ 0 㷺 @ P  _Y 0 ঺0L  000 .(Yn ^\ y YD Y&T M\ . M$ L$$P$0$ Z##< U#<" U"""""?$!t!\!<! O-tM@@  `+VPPhP0 0 p 0 0 `1弴4Sᾤ,0   (6< 0 V 1P806< 0B>PU  0R408 00^`1S   ;`1S0  0 0 PJ0 0 P7P P P$0 0 sP0 0 gP0 0 [P0 0 OP0 0 DP`1SxYz < PLp0pW  0R 0^;pW 0pW  0Rx 0](pWf 0pWa  0R0 ,0]pWGpWD 0 PS 00]`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 0p01 00p01 00p01 0xx1p0 [mL Z]tЍ tЍ 0 ޸10 ׸0 и 0 ɸ0 ¸ 0໸0 സx0 ୸ QHh FX8 D8h( BLT(dxX8 @-p0 AM@M 0`$0 40 0 q7PP0S T@ 80 0 4 30AލЍ.v Jt J0,@- M@ p  PpF7`PP 0S <0000 Ѝ00S.S 0S ЍȀ4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30Aލpv I Hp@-P@`Q  @Q ZPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0`W00 Ѝdp@-@MP`s0S 0 @S 0S@V00ЍpO00@ 0PV00Ѝp0@- MPM0@0@0@T  0U Ѝ0l0 0P^U:H@@ Ѝ0840 P0@N Ѝ0 <$4PJQp@-`M x00<@P 0PU  0VЍp_40P 0`&Ѝp @@ ;PX :0@- MP0@0@=@T  0U Ѝ0p0 0PU:L@@ Ѝ0<80 P0@ Ѝ0 :I,|0@- M@ T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPl@L`D d4 X0|tP0@- MP O@BP Ѝ0 0( 0P& Ѝ0 0@- MPh0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ0 6Mp@-@ML `P 0 Q@0P0<00 0. 0T @D x\000T H0 0 <0 30 @Ѝp@Ѝ/T.0 P.st @l @`O-MP`@PP = ~p z0 Q ЍSr RSPP 0-S  0+S  0x# P   00C2"0d  .S 0 @ Tᘀ@@ ✀(P  S #3 @ P 0RQ  S  # 3!# 0T#+<'(0+8 +((0'<0'4 0(< p 0(4 000Rp 0T  @ P  S #3 @ P 0RQ  S  # 3!# 0T U 0T @ \  S #3 @ \ 0RP  S # 3 # 0T (0 0 N 0N 0 0 0 00J 00 0  ;3 ?O-@Q dM0 R & @\|)g/O2 0\0^mnb`AS0N0P0_>88H<Q¯a&sf~e~rHpl0W0E0T0=b0AE1D88H'ᓾ  La@L<@<d+b@ "gࣲ2X0+k/s +s'sZX0 H Y J XL , @ 0P0( L 0 $ \ 40 T D0p < ` H |:Z gY gX fdЍ0& @0 B\0@R@0@j x  0 0dЍ@ Y 0X    H= $xdT@-@pP0D .R\*^QA@0T.S p@- MP`P`@?T_0 v> 00      dWPc ЍpC-`@ MPp䀟@POP @U UP@Wy@ Ѝ k@P@p0 0000  P< 0S0Y@OoB@# , 7C-`@ MPp䀟@Px@P @U UP@Wy@ Ѝ '@P@p0 0000 v Po0S0Y@OoB@# + t 6p@-@Pᶶ00C0S S u P 0` P㭶p,X`u0 0C0SpSr P 0 /X0@-M@p  000x00 !R !<PvЍ0p@-  0S0@Q0 R   =0H04S zPpl@Q0R Q    R Q  4@Lp@-@@P@0P`0pp 0,0p@X0E 3DLD D p@-` P@0pp0,p@/ 2LHA- @@P`p0p0 A 2LC-P0 M`p0qp@ H0  D@ <8 @Ѝ 1 2<LxC-Pp0 M`p0Gp@ (0  @ Ѝ 1 1L0 00/ 1L0 00/ 0L 0M 000Ѝ 0LXA-pP0 M@P`0 p 0 p`Ѝ 0L0M 000Ѝ 08LxC-Pp0 M`p0p@ (0  E@ Ѝ f1 0LC-Px0 M`p0p@ 40  0 L@Ѝ B1 /L<@- @  $M0 Ѝ .LH0H 0p@-@0pP p@l1p .L8- , M $ 4  Ѝg .PL3 R) p@-P`@V  P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-MP(@p,` 0+0PD0 R  P R7@ 00  B0 000 0ЍW Q\.Q Q. 0 .Q ^ ^ 0 0 p@-P0@S` ֹ 00C0p 0 pO-Mp<`P@P*W3*00V.:Y `+ 0 0 ppZ, } `0 P P0  0P 0 0000Ѝ`<0 PFЍ p `T\PH@- MR` @ P0ASA0A p0SA0qp00C0 Ѝ@0cP P 00P`O-MMP/͍(08?  p0000=0==0P >0=0 x?D 0,0=L 0H 000 0 P- 0S@  P0P80H0⯽0 A 0Ps000-0 `-H<  $@Pd0`F$(H=0``$`x`4/40d 0T>0 04PC40 0IP:WW 0GSQ6EO"Qr!|~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  0P2 R 0S .S 0S 0S00S.S9@0X) x9d @0f 0P 0D 0 Sh494(.440000PJ$ 0@B 0 CY 00p040#( #,  @4[(p@D0 tPYwʈ0 jP 0 0pPL800#$ #(#< 0, (80$0C00.0 r  .00Q(0A =P00D 0Z:0D H;C'\7  0 0 30 ݍЍ0WXhL7@0c@7X@0` 0' _꯽P080H00 0 P@i0 p0P00_60꯽P080H00  0PM0080 C0PC0H[D0EXu U-@0d D; 60P 0 P(80 C 0_P H[80P@C@p<` 0PNP 0 P0  >PePEd 0@00J 0 P0Pd 00D8 0 vP,0d ) 0 gPDY< |T @P0d 00 0 QP0DK 0T3Wk  0 BPDD PU sp0XE@H!QN 2X0 ,p@,0(00@DK\(0d p 0\30  0  PoP: @,p SDKPd 0 0 PV@p,DK0d  0 PD],0d D;d20 0 P280 C 0iP*D P :@B  PpSP)1!0 Xo .,d 0Z00Z00D10\  0P@HP : pPWTW# P@ù 0 P0TE 0 0vP00d0@D0SW 0 gP0d 0  0 YPz ) (<8`Ht(, `hL8h @@ T$(  l \h $d`4hp`\ P 0  #@Pm 0 D 0PaWZ   0 PW1@H05 @0YD: T 0 PB 0 @Cl10+W X+Ad 0@00 P 0 P' 0 d v 0 P0@DK 0T*R pPTDK 0d 00Y 0 P+@0X 10"3" 0;@000;@020!20;@00030;@0S10;@0100;@=0;@ 0gP0D 0 S@@pT P0tဠ$@ Up  R @ Z$ 0d   09P@T+@0X 10"3$ 0;@000;@020!20;@0000= +@=-;@>@ C+A0X 10"3$ 0;A000;A0200;A====C;+A0X$1 00=-;A>A C0==C;}X 5@0.@  0P=80 C0rP30DK 0T*P\x p$P P 0(Wk  R @0 Z$ 0d a 0 P@T0Pp*0@* *JDK1#00Y 0 P@  !V5U5E?C0 S 0 jP80 C0P0D{ 0PCUQyD@倀 @Tp1 X2  0d  0 <PX 7@0}80P@C@( 0@:(H[7( .PX0S X Md 0@00T P 0 P0pd 00DB 0 P 0 d 4 0 rP0PD[S  0|P>@0X>@0 '@'@8@( 0Z00DpG@P 0Zt 0 P+(0d 0@>0y 0P 3'0d D=0e 0PX=@-0 X80 C01P0D[ 0SC* *J1#00 SH 0 wP=0pPHK0 ᦴ=0D[@pGHKp=0PHKp 0 PP<@0$P(0 PD[ 0U{:b\<@0P<@L,0 @<@0{4<@0w(<@0sP  pP+WWA k`P@V 0 Pw0TE 0 0 Pn00d0@D0SW#| 0 P^\;@0=P;d 0p 0PLU p[P0d 00 0P90WDK 0 P- P  0DK P   0P80 @`jPC0`DK@ P0 @EP0DK 0S 0  PP  @PTT ypP`ᾳ 0 zP0VE 0 0qP00f0`F0TT< 0 bP9@09@0 %@%P%PP0@@2 D;80` 0 <P80 C@0PH[U0 H[=0 0idPH8 0 Px%p 0 D @ Pq7d @0 0 @Pb 0 iPZ 0 PR@l% 0 DK `PF=H{0` 0S;p`F=0 ` 0H{ =P. 0 P&F@% 0@  `Dk pP=H0p v0S pG=0 p 0H P( 0 P% 0 `@DK P=H{0` J0Sp`F=0 ` 0H{ P| 0 gPP$ 0 D[ @@ZP=Hk0P @P=0PE P 0`Hk BP 0 P 0 2PH[S 0 (PA0 H[=0 0^YP=<4@H8$0 `,4@0X 4@H$0 V 0 $@C4 0O 0 P`c`30= 0#@C3 0:P@ pPWW c`P@ 0 P:0TE 0 0P100d0@D0WW 0 P! 0 P% 0@C202"0 2@0 0 Prp2@02@|"0 lb`P@ı 0 P0TE 0 0vP00d0@D0SW 0 gP 0 ^Pa`1@H!0 $@0@D 0Y:l 0x!@Ct1 0h 0 <PLa`WD1D!0 b<p߼|@ތD0t $HݼX8lpڴ @ȄlؔxִդdՐ|<$\,$ȰȈӬӠӌLԀӄǔҸҨh(` 0$ zĤ+J X0X! ##000 +J X  +J XX" !" +J XX  # +J XR! +J XX! " +J X 0 ;J 0PPUD rE0@ 0 @- MRA T  ,@0 4@(@@0 0404040040, ЍM- (040 1Ѝ03/ A-PS`p@ W@0 V :00@PU D"PH(00@V:DG-`X: 0X: X : p 0 PP X*!(00@P0S P UT0 $P"  P@QA-Mwp$0P@S` 0(01$0,0v(`Vf0Sb(0S$P1,  0(0, S,400!PR,0,0 RMU,,  4TP(0T0(0 SP$PQ0(00,0Ѝ0F HP&,  (`, \:, 000\, :$( ,00(0 SP$PU 0"ꄴ00(00QA-Mu`$0P@Sp 0(01$0,0w(pWd0S`(0S$P1,  0(0, S+<0<00Q$PN,0,0 RIU,, (0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P%,  (p, \: ,010\, :!( ,00(0 SP$PU 0"00(00QC-XP@S`A%Q 0<,&?G,q`pP@T`SA%QT0<(,? 3:QP  Q QP@ 0Q P5 `PVp 0P P   $$P V0 P pl Ch0h 0 2T DP0P 0 )< E808 0 p K4 J J0 0க@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0000-w-x 00 000S wS -S rS 0S /xS /  @-P@20 0ި 0 P P//0S/ S S/0S/0S/@-@ 0@0T S R RT/ ?/PP/=?0PQ/?SQ $0p 0 @-/0 FlH ??SQ $0p 0 @-/ FP P P`/AQ/Q/Q Q/?0 H0pD D0 @-Q/?S0?/0?/H E`QP00 / /@-A 0  A-UGP 0`0@Hp0 P)0S#PHPpp@-@PM0` ES aЍp  Pڠ0S p@-@PpP Q 0S PPH0SHp@DA-X Pp@PEX `@P``O- M` V$ p@KV P@0P RV F!0g0`F `! Ѝ0 Ѝ08H`0-RBMM č dd  @T  ֢ PS   H(s 0 @-@-`@#Ms MP p $( rN TG " r @$@"p `P圢0 "l2 0 $8 30ލ ЍTB^T"P@ 0p '0 B^P.!0 HI100A@  0 $0 P \ AL+\ -L+*)B'&%$#"   \P  h\\\\\S{ h8LrD g4 x @l` gX e0 $\   /G 010/C. *    /G RA-P(M`p |@ 0 @0@0 PP00T P@ 0 (Ѝ > > 0?G0 5CS @/0cS#:3 3Q31:0CS! 2#0@-@P S 0\\0 0NO-MP` p p@P-Y\ +Y @0G s`"p" @0Iq \ aIQW IAIQ7 IUTPRQ å@ 0T  R0 S` 0J0 0 ЍS T0 Ѝ0Y U Pi piAPpb0 0XQ 0@AA \QUPpbPpbBT0R"\0@-0 M< 00 Ѝ0@f@PgT00P Ѝ0 p@-BR"^p@S@PTT00PpO-Mp`@ởP-T0P +T@`S0T W p  S 0 C 0c 00?00 2  00, P @p0 Q 6 P Q  S  R- " Q 00Bs ^a0BSW0BA0BS(70BS%| YZ  P Q  S  R " ɤ"00¤"0 00S \0F00 ЍS@ `?0{0T0p XR 0AA B PR W p cp p_p `@ XWRppRBX0R"\0@-0 M@ 00 Ѝ0@%@PqT00P Ѝ0 p@-BR"^p@@P]T00Pp r  Q0?0S @-P-- MY ЍЍ/G-`P㓕00PE !R !U5  ᪓G 0SP PU pWU@@aPp X 00m 00 @CpGp 00_ 0 @0 0TOA-P`PL@L@H0 @p =6U  ZI A mdp@-@P"00C0S S u P 0` Pp6`u@-@ 0`00@- M0 / Ѝ 0000 /O-QPM0p 0 Q0 Pߍ0( 0 B`P 3 0000P @000 " P> R R R#Y@0S 0D@T:@D0S Y@D k @p` ` V@D[ R C0 0 00 R R0 S S ୌpP   KoP@ 7P  V[*0@`[W 1000  S S S S V *@ `zP 00(B`F P` ``p R @Dp୙0S Caᤙ q V p  T @D * 00BC"(B`F Pr `5CjljH1H0@-pLM`P,! \ D - @.0 P) V) pp0 0川 0 UWP B 0 |0 0 D0 30LЍ-WPLpp  @ BTN <DT tA-p`MP`@T) X ``00k  0 WP B 0 ЍX`` {@BT ЍVP @lssX0S/ 0S/p@-0P00 00Sp0@` 0J00 Rp F``0Q00pO-p`#@\3OM TQd0 h`0410`1P0 Q 00岡/00 Z.` tP 20 00 [ .Q  Q\.Q O :!Q!PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O 0 P00J `` ᗜ0 0C S::  00 ` D:[ 0,$@(0000x0 0 `P$9P00 0 0 41 30Oߍ Z_00 004 <PPW U.R  :ŽP cM 0  0o xO-M Mʟ S0 t:pxe0瀕0D50t50 H*0 00 !2S> 0*0: 0 D5 30uݍ Ѝ90$0(?0P(0 0 pP[S#X` (IA|5  00 @P0 $03/P @@[: !232040` ԛP0H`X`U( 0  P [pE|ŝ< -8 L  p @D ,T0XP 0  C0B `P!0 $03/P @ ZT   0` S 0G R @x TH:(0, 0@0(0<Q 0d0D 0W  Q B/o" RO h ZO[PP<`BpP0 0 00PV ! R soQ \ V\pp0PX 60$03W  <0SP0 B@Gq 0PS!P" SPSP@Tp`0S 0  0X@@ @PC0@P0CX@S:@p `@堖R@D0PX C0 0CS:咖04 R 0Ss !S8 0B'RSX=@P<H 0P%AG! SR4 0 80 a @P@0  0@Sx8帚Y 00`S18 `•X`0P$0 S S S 80S/P0 0S0S <0S0P厚P0X@T*T0D 0R*P  <0X@0DP<000H0m4 0 0 @P0 ? 0@SL0( @00R?*(PVP PXPO0 CR00Z]@0 ,(0@0,(0H8^ PzHp50XP CR00@S7>@PX@$03/P X L0(@ 0L0B>0P @0( 0(0(`?0  0% @s p ΍ 0 00X8!?RTb( 0X0PZ0.P  0 s @PR0 , 0 S<0S0(P@0(0™@T @(DP >0H %@, ,4L @0(1Q *(@0P(0Y P (0(@@C 0L0^>0P  @0( J@0,(0 X $  h  0SA-@`M05 S Ѝ0p 0A=PP4 9P/ 80 0PvP  0 "0P>/U 00S S 0p>> 0 ŸO-` BM0M 00S0. SP p @0uG#"0 T6 0p pIP V00S 0  0pW%   0 ဝ 0  = 0 =q 0 j 00S S `I ts sG-Mp0`<@P0P0 0   0 p`HP=Ѝ 0 <PP A-M`pP@P , 0P (   &0@Ѝ, 00Ѝ0@-RQ$M@8P'0S9 0S0S9  0 4 0 0 0@PP 00$Ѝ0R R# / 0 0$Ѝ00S  0 00S000/S S 0S  0 o^< tO-DMPP d$0h X400<00 (;0P ,t@`p=0 `@P P ,0 0P0ç RR RR$ 0 0 Q Q R R d 0ۅ0 P Hs P@p`@Q Q Q S*P ῅P 0Q@ (PC%< @P 0`@ 0$R0 ?0IPB Z0  6 PE Q 1 ߒ  PE4 U!:  PEpϒ0 Sh CF @`0  PE q [p5`@U* @`d<b< 0  0H!41 0 <0 30DDЍ P8ھ P2 0 0 0Ǜ0 B` @ `00.<,<  0 < 0000w00 `@`@G PPO p@-MP@`80 00ɠ iЍp$$@-M@(9$  Ѝ@-MP`@JpP0P0 D0) 8 00 @  TPIЍ\p0@- MPP@T p00P   T 9 x@ Ѝ0:@Tu00l!l A-`0M   p  @P 0S  0 C R?0,,0 C.SU 0 Ѝ R0 XR  9S S @ PE U   RV48< 00 O-@P"P,M $  P / 0 P"H2 0 $0 30,Ѝ("2 0 $0 30{,ЍOs00:[  9 [; q `p@ P @ PP0- `V( @PUV P? `$pVᰀđYJ V 0F S0 s Sb 0:[@  P 0:UV 0S 0$ S`@Y$p`.[@`$pVPaFV L p@-@P (M0`  $ 000 0 p  D+P* (L @0 0 $0 30(Ѝp軙 0 (F d ,O-lMP #03 00d00 P / 0 |#t3 0 d0 30lЍT#H3 0 d0 30 lЍO@ 0 4 0 0h 1R LTTp` 0q0S P q v XP 0`S q+ v00 X0S `X#V"40@b` 0@:0Tp0)`VX 0 SX*  0CR00Q:@}~v`40b@ 0P\!J0 *PY9@Tp. V00 SP U,*VT:00X X- X@`( ?R0 J P `+ RV @pTv0 S:͘ 0 +: 00@`S 0E Ta$O-pdM`@ P0SL (ZA U U U  0 Ѝ0` R{  ? 0Z' + ᰇPP 0:/pq 00P @ P 900  0 0 0ljЍ警p p 0P  * R + L U[ 0ppP 0 00SO  0 00:/pq 00 `Q0?R < `V¿=X0`v R 0 0~<0 k0P :/{q`0 b 00 0`VÿR <0`VÿpX0PYKS 0000S0O < ?80A`^ 0 Y,ࠣ࠳FL` 0`f/ `0:/pq= 00  P @ P W800 0`Y 00 UP&0S#: 0C000;PT` 0S  0C`ÿ  B`V 00Y 0 BI Q  @0Q 8000 00 Έʈb 0 ˆ SO- $M@H` \0 #p p 00 0@0H`# 0 B0S0 Q6  R00S B 0 PR ` 87 PP  00[U X 000@PL  RWRY 00S ` R00 SR Tu*D00 Sm P^ TP`p^[  C 0P CTs ^a Q `  H`@%3 QY/ ᄄP+ 0S " P 00S U0S S" S' S- PP 0R00S0 0ՑT $Ѝ`dP`V=W WS SSQʇ 7p@-@0P0FG p 00p0 @pJ0TSF00-M0 3/Ѝ/ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ R R R //00/00/ R R R //00/00/ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P 00Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/Ѝ 0@-RP M@ R R Ѝ0003/P PP Ѝ00P03/P 0@-RP M@ R R Ѝ0003/P PP Ѝ00P03/P @-RM@ R R Ѝ003/P 00S00Ѝ0 0S0003/Ѝ @-RM@ R R Ѝ003/P00 Ѝ 0 03/ЍR0 p@-@PPeP P0 03/P U 0 xp@ 0/003/P U 0 <p@0/@oppp/xA-PM@Qp` Q Q Ѝ0 03/P V*PX 4000  0003/P P P PЍAR X 3 P` }0SP4:8 ;A-Pp`@P  R 0 R 0\A/W 0A/0A-@MS`pP  SV  P RPU U U ЍR4000SP Ѝ VP 0SPU34 f3 P`S8<(#00@-S M@P S S Ѝ00 03/P 003/P  Ѝ00 00 03/P 003/ Ѝ000@-S M@P S S Ѝ00 03/P 003/P  Ѝ00 00 03/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 / jL0 0 / i8// 40//O-M0Sg Ő@P `%!E , ,L R^ Q XY@.PR @PU XM@RAS0SI <  cSB!  S   X9"S`Pڴp@@ P pG .W`W0P@|Wd `@FT0S0S V *000FЍ0X`.00Ƅ(00AQQ!X@R p P\ ! C]R" X @D#cd`!2br   D"2b20Dr 210D0Ls 0;S!S" Cr 9" X00Ls`@S \S X 0@@SQ P`Sp pg 'h0`0xpg '0!"4`0kz004EdE(BO-$MhY@ Lt 0`pP`([Y= "P @d0Q P @ 0Q㓐)  P @ YT* PYw [\Yp .Y0D0CtXr0Q S.Qk ` P@] ~Ph  IZN0xSK2 000 B P0XY /Qh ]QMP R00   0 ]R' PR " XYnP   R J b"r R Z zA @ R] .RP`@㾐@ P0D0C X1(00$Ѝ諐00P   Z 4   \  PYX R0Q  S0 T 4* @DT\@YX(@ X00ɅS ` T`4* @DT\@YX eH40G-pAQ@=*0S& R4 @R`0P0! 0W+  0s0 0ᜠ   r  P 0 S00NAS 0SP!0QPP00W(00 a0 RO- MP3P#RP30U p`\ @0I @R: R R& ߏ(000 ЍQ*@ ĠS? A @ G0RP@R\ 4 R @4 S0A Y*@T*0P0 A\ R!"ɑ 40S0 4 0- M ЍO-pS,M@ [ p 0pS 0S0P^h @^W \bSP0[p0Cp00`p 0$PU P0S @Sg  W@:U `PU00 S 0Y* 0 B>\ A XP 00M X"0 Ġ?  0P R SAS"`!0PU`00\ (00,ЍP(00P0S 0Q * 0F S 0S 0 `  0AUf0S " ! WE@˅X0y  ABQ AAE\ Q Ԁ  r  0B>S. 0A 0 S*P R0 S P\0^$p  ?0B,40[p 00ꔎ000 0RLP቎00$H{ p@-P0 M `00 1000qp !@p < 40 0 1 30ލp@: Z YA- `0M P@(q0 0 100p 0 p0 (0 0 1 30ލ: YT XQ:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q @-A?S SAQ  0SLB؍00Ӎ(00N/G-p@`0TS'  V WT_ P@0TS P?^ 00衍(000QSp@-P@` P@.P`V  0R p/pA-APUQ?UU@A`pP W ځ1AP^(00Y00U?00Q A@-?S SBR 0@S A:005(00/-- M ЍЍ/@-M@ p TЍR/0-S0 \ S 0^C00O- M@P ` fP-Yc +YQ0Yd T@ @Q 9`paTPx9`pTP" [)SQ" K0Iq P0aIQW0IAIQ70IS| V[SQ;+Ꙍꔌ0S \0J00 Ѝ`Q0YXP  0LA@ ^P @T@@BT0R"\0@-0 M< 00 Ѝ0@b@PYT00P Ѝ0 Qp@-BR"^p@O@PFT00PpA-p 0rM @P`0^010X0pA00tA0O400  TAV P@P $04 @ $00 1 30rߍ{8 Q Pd00- $  M  Ѝ P  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/ OO-QPM@ ^ 0pS000!R !3  >{PP E``#Q9\*Q30A 0#1#2#4#8 + P2   ᆂ0U A 00 pQpIP 0@pQ 0S  Ѝy0T @00Ѝp0 0A-@P`p|0 P|$0M 000Ѝ MhT,0 0p@-00Sl@@@p\P\\P@PK*@P   M4t| p@-P@ p@A-Pp`7t@t@0h@ kU  0<0 x -  AW LX T7p@-@+P0S 3/000S@ A-P p@` F  o000 *@P p@-@PPpp@!1p@- BMa@0PD`040  D 87PU h10S ` 0L!  P4A0@ P; 1 0v 0 0 4 30/BލpᘊP `P  6/P Q Q |0 0`vl0 00P z0 0 u `Z6 J J'88 I&h O-MqQpAP@ pe a$` Q00]y1PI 0SP p Z [ @@P *0[*pP *0P U:Y *`P`PSP@ TP@ 0U:W z*@0@00`GQ|00p@@"ЍPЍ<0 0u % H X, d @(0@-P $M@0P T0 0L  0P $Ѝ0l G-RPL 8104Q0SA q@p  #)/>0@S-0a50000S -000%000 x000 \000 @ G (00 #$6@##\"""p"dA-`䀟0S@P$0S!0Pp @P0S PU @@P )0U)00 m4@ 0@ P O-dM`ሀ!XS3 R0Q#000SYC@0S00 h!0X#000 L3 0  00P Z s@3Pp00 300VQ QN  QI P0S_ 3/0 0P@ Up@|RP00SJ`" 00C0T@dЍV8B@@@,K$20\r , 00SO  R1$ 0 $@ (020L 00LP 0S 0 <<00@0000P 0 S@$0<S( @ ( 0P 1S@iPQ 00C0@@0$ 0 $@ (0P< @$0S( @ ( 0$ $ (0 Cxt8 `L \ t @ | T <4ŸC-`,2 M08@00051E@PrgQndeax$ O-/`?M ࠝ0/0000  Spܐ l Wt 00 0S` %SP %0BUScYF?@nRL?&1& , }f_5-= 0 0 30Ѝ51E,0O(d(p,`d 7 0@ 0n)L4I2I00@P0D$P $P@H4((@T8l0ԣ< $,@\N>?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0$DHd(T,@VR gR 0` Z` 0 S 0W0 `0R C S`j 0 `0 IISQ0C 0 B2:00P/A!b  W0 `0R C S 0II Q B 0/C!b`: 00PbW0 `0R C S0 ~`0Q 0900P@W0 `0R C S0 \`w ~0Q 0H900PWe0 `0R C^ Sa* *BQ0/800P b bR  WE0 `0R C> WA0Q 0p800PW-0 `0R C& S),0 `0 l_`7Q 00P  W0 `0R C W* *BQ0P / b bR  D' 0 W0 `0R C S Q0P  & 0 |W0 `0R C S Q(0P &  0 bW0 `0R C WUPUP Q0P  & 0 AW0 `0R C S 0Q 0500P)Wt0 `0R Cm Sp0h PX00\00`0 0d00 x00 |0 001% WK0 `0R CD SG 0M0 S0 ՜ W4G0`0QC+ R`'W$P0 `0R C W0051E!2 Cd0bSӢ Rӣd B3PR  b0  W0 `0R C W 0h   phh0 S0R05`0P 030~W0 `0R C W0 `0P S0020\W0 `0R C SW<0 `0R C S0 i` 0Sh @ Rpq p pqc APX1  0S! -RC SA,! (1QH<00ϠPWl  `(,1Q$ `PAP W,0 `0R C% S( = < ;L,LHh! H    h<0$ 0,0 ` 0S  P  0P W G S ` QBP0l `0 SD 1hW0 `0R C W0S4 1W0 `0R C S0S$ W0 `0R C S 0UP u! 2|0LII< @P$D?HA1cd(0T,@N%!E_d2dN`Re0eϠl 0 bSӢd Rӣd B2PR  b0  W<0 `0R C5 S80Q<3 00PW&0 `0R C W"o 0P? 0``:#` . A-M@pP`(400 p00@00pT p`pFЍ"00Ѝ(@- @MЍ (<C-Pd@ M`0`@p N@@0  @ @ Ѝ '4C-@`P M\0`Pp -<(0 @  Ѝ 'p4p@-0L| ^ࠓ P0L|@ T.^ڪT00p^p衁00pp@-@0M-S` +S`P0 P& 0.00:S V00c0Ѝp;0 P <0!" :R P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <0  0 P 0.S 0 }P 0.S  m1  p@0 f0@-e)P L@,(@l^3f*Sk Sq @ B 0T@ҜS_e P#Q@P Q\< 0\QTP@# N$0,@L ^0#S S 0@0C @l^#3S0@0@;S0C^:= 0|40 P /0S/ 0 S/0S/0S0@//O-M01 S @ `< D`P`HP@L@ $ 84 / H`<0n/^`#x "xH q~~N`AN0S/"w ?'P P00 #1?B! 0/Z0S< # Jd"p J㩀A0S'"̃ ?,P P0 0 1>!0ϢZ0S* *Bhn ^a Q R SptQ)|rLk  NQ @( @\O N(  @,\H 0 $ `q @@!@m#W`ף pC@)n$A[ O@:(@P%! P,$3#`o0RS@0oS]Q\H NQ @ ( @\O N(  @, )|`rL$0` @H@mHQ!P$W׳ pC @*n$A Q O@:(P%! P,$3#`So0S0pl0E) L\H NQ @ p C$  @(" R P`[ Ϡ! +P@. PP` @ R  Ϡ ,ό@ ` ` ቢভ` fR$  ` & , Ό(` Y`3`# 0C Qp{ , SWl08?Op 0t cSQr`0;SdER/` ;0S ;0`0qP 匀Q@``Pe P0T UTN WVU V08P0PPpT0@`? 00?0S  S   P0T  ;/PT P0RSR@T@PV0PP6~00 4 0S< ` Ut#~T00ЍWV `VT`pPp04S Qy4! @Q!Sx8 RT0SQ Z 0SJF|Flmph` p8`Q Y:Q@PTJ#M @AT剱PϬ P ;N0Q8 5@0(<2@0\?5O 0>;N$0S33K051E010@)6w(.L@x/ᏒL`F(b@b BV+kYC  2,Ƞ @,c,0? wD@`|o'fl /B/_@@00@01>A@W "6e"$.B@- c0 v(: 6S X00[$0/!+>0 (A O!2c0Xÿ0+"  ?00 #2>[?`FW' @PG`m1%0 p:#0  ό"!/ W n13:$  p C0!".#2R> ' @01 30 #1`0U05? B4sppp0 0/S [U c0 v(: 6(aS X00[$ o0/+>`!0 Â!2c0Xÿ0+" ?00 #2>`T[j@tc0 $ Zv$: 6S T00Z$0 *>Â!2c@T0:#I0$BNo :HLPsc0 (a o0v(: 6S X00[$0 +>!`2cX0;#0(``8?O0 ` cQ0 R$I"ITY BqgqgpC(1 ? 0c0u0(: 6S X00Y$0! )>0%!EÂ!2c0) XLß8\?H)" ?00 #2>r?E$0CI"I0P0/A!b,!b S3 1I B !.50c((H<" 2c4 0S/  `00 \000U PE 0 S0 0(0 P P$0<Ѝ8\?H.+N)<2LQ @ 3 \O!EOό"!/ T(@[:.+N0 pC#". RD 7 0@0 030#!R̂"*h  “5.2L O\, 0C8PC@D10@e-0Q40000t )1 ?0c0>u0):6S Y00X$0%(>!E!2c(\/H) L0Y("0 #2>N` Qt`O 0#"0PPQP02%> 0<R0  0 S! Pvy00Ѝ0 S. 0Q0' V 0V? Qt9`0O  "3 P  PQ P0V %  @0R Rh!Y0h&P l6Ym&N0@0W㉱@ 10:@W7  tP0WP@-0Y@0\0C0 pS.0h! /O0 BQP PsP t<,S 4 @AR|ZpXP 0 S RZ Q\ }Q! 000 0 ^\ 0 # 0 C!@0m@!FSp@0G@Sh50P0 Z 0hS01Ӄ!10 "0ũlY0Ih0  0 000 01Y& <Y90`S0S >S@`8S*S0S -S0 C R0p@0GN<)hh0`hlpt alЍ*YY -Y00I S0@0ISz0   S ,S;SQhAl b ;S,Sa Sbh^$- ^ 019mPhj0 @K19mo\Ϭh6Pc^9l ukt bhp& l&w&, 000 @ 0N\hPk@PP k @0 P 1 0 0< 10,p00P 0,S040uP 0Sh lub`$ `(岧p&Ft{,l6.Ow60k 0H!S1ð1e,p0P,0 ѠzxwA-PQ@B 0S !1h ? @p Dh6l6 `V`P 0:S UP XpHPhnW nP0PT`X\PNLg@_`P`P`T%`P tA-`PA@pP ZnPPPW=pPqpATW  P>UH QP x1x!0` t  0V0 m``@ vc=D0C0C P S\@0d@D/  @DQ0?P0S00#  1PWPࣶ IK0U0h|,vP@L0HH  p 0 ;l;0: r:,Ĥ49 @9q0@-$0$0@!R ! 90 @-\F<l0hN 0Q S \Pdr 0 \ F<h0 0Q Sp/@-Nr 0 @-$@@id)@ x@-@@@ @-Td@$p@-PAP  @`PPprP`v0 2p@-PH@@g</d0 E?!PYp Ɛ7,p@-@`PNT000SDd80 @:p p66 0@- M@PF0 @~P00p0(0 Ѝ0nP@-M@540 EόjP00p0(0Ѝ6n0@- M@PP0  EόTP T $00t0(0 Ѝ000p05mmp@-M@`P0 P8P T 00t0(0Ѝp 00p0m,mp@-@cVt00QU d 0P@Hp00 P@ p,4 |p@-@PP 4 0p@0 p@݈p@-@QP0 0P 4 0p@0 p@,ܰP0 0p@-@PP0 00 p@h @-DM`@ P 0` 0 m 0$0 $ 400(0jT0 (0Sp`DЍ0@-P X\0H@0Q@̌ 2Q0p@-P@000S 00Q 0"*X T 0SZHp<02@T_b 2$2 PG-Pp@b0jX` T[0SZ 0Q I0SZ0 R 0 R0\Z0\U T R 2R?T0Q 0 ^ 0SZ0 TUT@@@ 02 ^?<02 Q?<0p@-Pp@{d000S T00P  0zP@0ip.b $// H0 @D0- P000^ N  D0@-0@0S $000S 3/0/p@-p?LP@TpP  0 3/P pc@Tpl0A-0`pP@P UP gp( p?p `@/LG-@R p@@T ` @D◆%:/PPA-`p@PpXT P t`P @L2L€0I00#S €^"R6.`.4-0O-`A Mℱp@|| P2 0P2LB?0T- P R; S P@T" V0S !Q L/`3/L2 S1P2S? T030# T 03Sp0p0@T@@P20CP2P2SW pW ЍS @  L3/L2 S @---x-h,,,8 [A- p0`Q M0010.P@ `0xQ80|Q8O8V@1@@ @V FTA@>0@H @0 0 1 30ލnT 0  | 0- 0 M Ѝ t -<0< -0M$0 0 0ЍЍ/ ,0--M0 ЍЍ/0 0p@-P@X_`00C`0Sp S u P X0` X PX_pX2`u ٰ\0 X0`00C`0SppSr P X0X /X -404-0 M  X ЍЍ/ ؤ-4 4- M00 XЍ Ѝ/ XG-p R`@:Q !SJ YpH_0"P U U * dJ0`00+P2P d 0 B 0 0._ P0PU` ``P+P I?jpC0 00 _m0T @0 0_ I&jp--M  Ѝ Ѝ/ -- M0 0) ЍЍ/@- $MP*pp`P3 {@P0 !0P(/S!ʬ0`@0 0 0 0 00  $Ѝ0 }a$ЍJm0000@$Ѝ 4 @-@^0SC^p@-P`@wh R T0U:T0T:p@ dRQ@-00p@-@!PR ! 00 0S uP0B`Q0AP R 0 U00Spx\P0?\P `9\P 0 l 00 RA-`#P$@ R0 ,°00aRK 0  a0R00S 00@0A PA05\ &l plL<0@^㖌 1c000A X \00X00S PAA0 S< =<;:97310/.-,+)('%#" wsrq" %: spR V@8VL0V & a0 Q V  T  4ЍPPؠPPؠ0 ## 0B Q00C$RNKt P00  x3 0S0V `1!'  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0 @#"00B 0B Q$R8 x 0S p V0`1 ! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B@ Q 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S pD 0V `1!dx$ 0S0V `1!W V  x 0S]0V `1!F +  x 0S p (  xz 0S px) 0S0V `1!x+ 0S0V `1! x 0S0V `1!xn 0S px 0S p 0V `1! py xp qp jp& cp \p Up"s R 0H0py V@ `1 | x 0S0V `1! | xm 0S "pT 0V `1!t ; x 0S40V `1!e ; xX 0S p/ T-  * p# p$ p7 p#l x 0S0V `1!'P x 0S p[ x 0S0V `1!  xi 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S bpx! 0S Vp@ x 0S Hpz 0V `1!  x  0S 3pe 0V `1! PZ = X PU 8 S PP 3 N pG PD ' B P? " = P:  8 0B Q@  "0 B  0B P$Rh x R 00p V@b P  p  P  p pO p P  P  P  P  P  P  P  P  P  P 0s 0 S ~p  0V@`1! P $Ry@00 P | P w P r P m P h P c~ P{ ^y Pv Yt Pq To Pl Oj Pg Je Pb E` P] @[x 0S pP 0V `1!p PE (C P@ #> P; 9 P6 4 P1 /O-oMM@X /D0? P006000P!R !0s00\00  0S   R ,?ܐX 0, 0`00  @000<0$匐@ d0T00PU @%U0T  ` J 0 R 00S0$U` `P0r P0 0FZSpnm kjigf-c/0`AUTSRQPO<M7p!GFED(BA.?>=o;986543210/-P15$6"P Rr0PPL@H40P,0 L@H * Q  1 ,VC }0PPar0(P@L0H04000! R PP  8 Rc 儠`@VjS 000Sr0000Q$1S 000SG?000100Q$Zq (0@DT0L(0p0000S!Q* bS@@P0Q 0PC$U80Q0$吰0000S@@0S , 1 0,000Sx0| 0t0 | 7R1|0Pp <x0P0C@0 0P<0 t0S-0r0|0s40 `000$00j }@IR  p dQGd> 0$0000S;00000Qd$0 00 \00000S00Q$|@Tw000#0(0R qN000P@0 pC$00S R@D00(0( 0@0(0Z<00NS `Vr0}p @P@ (PL@H@4@UQr0$:N000P  Ps0\400<(0J R Rmdp 0! , 00g 0@5!.00  0g@0SQ000GpB!V+@~@p$p0 `FV\pQ  0 M000P dd@& ` Q ,0P1s_ 0P 0H LR00\0S @?hP P0$`T?L0H0s0000 SpUP 0UPEI0CP QW (LXX ڐP? X@@@TT40 0ጀ@JZ P@QJZ  40 @H^@( MM따吰P Q 40>M 40 P 403M P 40Qs oEZ(V ?@ 0`P$@ IY\Q L P yL000P p4 10R0bB+ S- C S!!/ N L ccS!2f00 ` a000AF0NQ*pNn0 U00Cd0d Tr0 ( ( @@  Q ,0 ,1Ϡ  S ,WSD,01DϠ Q  Q3 ,0P y,pp`V ڌyp0r00T R 4A R R R4 (T HL( ( @ 0D @0S0C CY0S  U #R   CU&b # 3S RUY *CUR"W + W@`pG@0S1@FZ`U00 E000DT ЍY:`?C0C1 0 ЍO1 0S  ` 0SQ @e@`멟P/ P P0SA0D@  R=U0 0U,  sR  Y 0D@ R(U 0U  sR Y0D@ RU 0U  sR 0 0000D@ 0F `<eeO-@؄dM4P 0{VS0 0 @PhV0ʳ?G ` 0 `  @  YR Y X\@P *:X X ?C0C@Q K; t:+ A A{ zZ`pGW BBL3 cJR040$00p80 0I?o R2<0FR00C00  BRq|20 Z70  dЍO\00C QA΃@a a7̠0C@g  A040Z0b$00$0W$0p0C$00gp80M`P PdЍIoᩒቐh0pG400PD0P0(P00\0Sp Rmʤ10[00ӥ?+ [ +b +xP`0000   Q0`dЍ 0   D [ (0`P (0 [00RY  ( R S{\0S]0SZʶ 0 UuDP 0 0 0 <  dЍO?҇coCa?Ɗ(`ȳ?DPy x a4Z0 R1 @ RC$0X6h0P0e $ R00Z00S R0 0HJ B$ 8Q 00S2 0P0J 0P80E 80@0P= W0 Q <  `R$ ` $ 000 Rh1 0""1  1 +00+R 0Q `  4 R J [: + A H$ %AL  H3;B00SD21+S| 0K  +{ * r0  qK; P7 `a{+* p 0  J+t+Z SP0CVd  s9R  Hr ` S( : + @ %A +1;B r Ba J ( \ 30 c0""1 a  30 0 a P  k( ; $$XKZT4 R[0 Rcp X@PP  0PP0S0SH Wp 0YZ Y 0i@P4 00PHX= H Y9R p nDPe8@P80E80@P+0 ;0P 000P0 D00[  B DS $QWp F 4 P<` 8 hP0`bP R50 $B$$$PQP 800 SYXQ& 0P<` PeW 0SW ] pP`WUU 00  B ;[ 000PP `  1 50S,0Px 0 Q < }p 80!80 `4;bF +0{* p@ 0 r  +s  Pq 9J\0 (R0?0S ^0$000\ ` 0 .;0  Q `{ A *N pN@  BB*N*0 r  P`r< `  s0R H0P`0fXs40 S`%  @P 0W 0P0  pP$00P0$0H Y0R p&p$09PP    !aL$0pP P ?0b$04g40+40PX0 0C0@P 00S40D RL  B DGDRX0So 0  k QQ(0S Y Y~ R0P<`0@P{ 00P9UT 1P[ DQ+0 ;:00CH0+c  +" @P% %@k0P0H   1 (Q Y2 Y p b )& PH| =pP5 pMXA0S 0  : Q Y0P<`n 9UP Pk 9  p R R R  !**R WpH P` [P `X 0SOP`P R~ Y p  1 2 0 +h( 0Pp<`0P9U<` X[ D P 0 P/0#S00/\S00//P@-@00@ R P@Rp@-@`0P0PR* 0PpP R 0 R VpP0 @!.0O- MPSWPE@!a0p  P V`":  0  ơ R  RW0  * 0 S 00CX:XPE* R P  P  00S 0S W0*!1R 0CX:XPE* R P` ЍP0.- UM,@00L10J    M` 0    PFOB n8@-L@-L@-Qp@-P` 0E` R @P  \J00pQ`0`p@-`NPy@P  FJp-M ЍpFF|~pq1hpqpq1`p- MS ЍP/> 3D-@"M @Ϡ#90c 0WЍ0 00/ l-M  0 p`Ѝ  p@-0@Q r P p0 S!P00p PP    !I @0O-M`pDA@0DQ00P;5X# @0S S] @   b 0P19  P  0- T@@  0  "W @TQ 0P@020  0 W` ЍQe @0R AX00@P00  p 0`00R-@0QMW 0000`VBoPQEp0 0 `b V 0 <T@P@00)R"000@000G @ 0Sd0T 02a PP @ 0"0! #000 $ @lx`@P 0Q/ R  B /A-`0@bSP)p`B @@AV * D0 BS   `yQ0 pg3701@V * CQ B   eQ i PPO-p -@M 0;0 0 PL0 l x $Pt0-P-+*)('&%$ \c000P0(0 00@ S0040w`@ #T0`Cڜ T0 @t@00@ S0`\ 0 EQ"(00 tp0t00+S\ -S80800t000C ^0St`t00S 1C`\y@X 0l@ 0 A00S< S6 ?o2D0zT@Xg  XH  ڐ*8 g +01S B 5[XӰ00S 00S0 %0hSH0pHp |p p E Px |0p0|0 pLW( |0 p0|0 AH  R Q8 $pCWM px Wppw0p000408 S|  H00S~80H000$0 ˷00 00@ S J ?( L0TT@9 PT    !aGx0. @PI x0   !UGpP|p E `P: RP8(0L0( C0EL PP PE0CPpPU00 S 0SPEpGK(0S}EQO00SW[  `P   PP 0S0Sc p D0P S X+ 0S#i W<H08 S0l0 x [0[| KpQ 0Z00S@00X0L0p 0#Z00S|0P0I hd\ 0P$0 dQfh[xp  !f $x Px 0 S B\VH08 Sp  Bp $  XP0p |00@0C?oQ20S K x!)I 6Zɋ;0S     0SpЍ 00XS PtP0P P0(0)x Qt000Sl00l0R x lЍ ( 0 RiS IS NSt@TP t 0000(S0l0 0x 00nS 0x tpl0PI `P ^ `H0pH00pW|UWX  @P `JT t 0h 0C ^0t0^00000t00tp@000t0Pe P00W'"40bHC0 V:A?CQ0C0 `1{F`1{V bR\zGpGp04656(0 H0`a 00 S  Q`a <V f5740S` t00S l` 1CQ?tP00C0P 0#00Ct00C Y2` >.t00C0N YL`\@"8Q@a@jt@mP* t00Ct0d Pt00t000000x l0x Px3 p00p0s^H0|pH00ppg  1 01 po W'"1bHC0 V:A?CQ0C0 `1{F`1{V bR\zGpGp04656(0D 2`a 00 S  GD0 0l000 )Pw|H0pHW 3 01 ` PeE  OW 0@X0I$Px  B\ 0S. p 0 p 0R00`P n0P$0 $0@r > Pv LPnx2 Px} H0| $0C BH0| x:00 W0 0X0 ዴH^@UZD0{S相zI87 S' )a0P$0I  p l0X 0l00Sp0K0S xPx,  |00C |0 0V TRTPN|0 R# 00S S SJ x? 000 x  l"!@Q*L000  0c2300x S 40S 00P0l0 M"000Sl0000l0z @0 pBxPx 0p0|00C|0HR00x0  0l0L"0 000000@ !0@l0 0X0I08000D000cD0  L\I\ R0t 000x0Pl% 0x Stp 0p( AhH0x0H0| $ | X ,00[a K Px H0p0C|0 PxK !\ \  \\Qʡ 0%^@|0 T[@0X 0@00 bX :相[ "|0 S|010180|(0 &| l80 `0!5S 00 D0!  l  `` HP x000 0 P `I 8@XXQ8@ `X]Q 0ӓ" 2  0D  @  J1 l000 ` P Y 3l  D0000hA1! 0 ` ` ` 8A+!^0 805 `0800 0P0l0 AWS!00l0AWa 0Sv p0x |wQ0n80  0 0Cp |0!0l0%WWZ!0l00H 8R0PPJ 9P |0 x 0Cp|00l0Px90Ss'@  000x l0Sc x 000080|0P0l00Z!05 l000# [00Sx 0 WZ 60l00 3S 00l0 Px  p`1`f`Pp00p0!0l0H08 xSl 0S!0l00S40040|0p 0C|0v@-~00ՀG-` 0pQ`pp@PP PP `q0Ws #8z *8 A"80A# G0 BW`E   3a V F A0Rs#8ᶐL)80L#Y 0U 1 PP R`P    !zA@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 X  \60QR T0#03\0SuWa* G0V*0F@S3 F\   I0WN 06S ЍW*@DPD@ Q0; Q0Q l@ l@4 Q:@00XS Q0nM)ARo 婒Y" 0^0 n12000 QP0Q0l 1 c0R:|00Q )Q 0 J O-M<0 :THT8@`00Sp 00Qt0P00Q  EB0SG^E@0= PQa @0 \ ES YH P 0S S SC `Pb@0@00 00Vp@ !HT q Pe 0@S50000S Y 0 @PQb R  BPQa S@0D0CSڣ0SPW 0S] ED00TY0 p0TDX@N S0T0@ T  BB! BeP DRy`0 S0 S C U 0S S S HP@"00ЍRq  BPQ+Q~ -Q  NQ @N AY  ^!#AAPPn(@Ѝ P 0QP0Q 0S00 MS S80S "000 b@0 0YH"00@B{`P D` 212 Q`rQ  Q P PR  @V 0Sf Sg S @00ЍaF PePfv0 S_H@"00ЍP@0M@EPL K`"VpK`W `2 p 1 PE@7`DQ@!80Sj80S 000i U U EP 80S800c8080S `T0)  RP!@L#80SU80S Q0   B @P Pwj 0`e  BR "@`P3 `2d"P1 5 F$ P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPU 0 BP @` pV  p0 BP0U`0@-M@Pd ` 0 B0C2S   @ JB@ Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ F0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/tA-PU0000`A1 !0T a2!!p(  T2!ERA!1! 0T T0E1 CSB10R 00@-@MS: P @  0Q P~@ЍA-P aM1`p0S3 U10AT !0S 000 >@T0  0S00 0Ѝ0@0D!1S<000S 000 9tH 8p@-@P00p R pPQ`00App@>D `80 0QApp@ 7thH00  0#10/sP#8s R#4#2#10 0// /A-`P@100("@Up0p 0S1pP@P;pP    !c<`~P081#3S412s2sS/1J //@-@P0@0O-0MZ  @SpPA PaU* F B  D  ^'* 0H X0C0003 00ZP@T   `d`` XZ P` @T@T 06S @ЍG-0؁@pQ$A/ QPiV&10SO`P[ 1q0i000S h1 {0P4 p@ PU `@00SbPP# 000S 00{PU 0C  pPpd0iiV0S 80^ (0R0i 3t@HHG-`P塢0P@Tڃ0T P$ Zp !p D0  i )  \2!0L\0C0003R @@JpG \ -0P1 0^$23\ *G-P@p0@DTE1  0\D*32P ::P  @a P@0 0S 0SQ 0PApPEQ%Q  3!!@ V 0 0S03#V`F `F` 02NS @0@PpP 0!QQ!P3 p@- @A`DPD P 0`0R @ *\ l0D1R %& 501 P%&0;BpR `C5,5#11C,C-` MXP=@P XzX0W6Y0 W   0 C~GpGp50cp0 Ѝ  0P c2# R   W C>C0C012`0S0/0 R /@-?8aPM`8@nPP5 jpP/0 S Q/ ĭp! 0: S(QP 0uPP@0 00x0  0 0 m ЍB00Ѝ\PB00BO00 -4 bp@-@>400C0S0 P<4pP  B R /@-0rSL wS aS@ B 0 @0S! e C+Sr0 SR)# @0S@@0S0S0S0S@0p@-S4 @3P00 P! !& 0S 3/PP೼000P @ P 00 `00aa3?`` 0ph1P5BP 0000@-@!R !P 0C 0 0 S /J1p@-@Q1P00SD 0  QO ;000S% 0'$0 3/0:s00P0p00P @ P 00< R 8000S10 0P/E*P0P 00s0 0@0 00 pA0 @0 0 (pt-Ѝ/@-A@QS S S A 0 6@@0@%6@@0@ `6@@0@5000 0 0000/4P 0p/@-kA/41Su C-P ! M ae`@`2/A/0@0 pf APMOĀmpZ@Q 0pePU`Q 0pePJQ 0peP@ Q 0peP6Q 0pzeP,Q 0ppeP"Q 0pfeP@Q 0p[eP  T Ѝ/@O@p,qhQ@-P @41S  P iP0@A-4!@ `PP/1S 0L1TP@MCPPPU!RMPPP 00,1q>00S@-@0 @c>00,1R@-@1  0@P>,J>G-0⤕SM ? Ppw`@P WQ   z .>P 0 ~p $ 00,  X 8 4PD` a=@ =ከ PP X P0^4P P3S@ S S0@4k:P30a D PH $bP E1 0N `,00(<` Y5EPXJL 5P 0 p '0 Xl PUi A/ QŦp APXae`@YS@ZO2  !2/@PGP( TQPC 0a0D!NB1\ Q!:X QfW0 p$4q$vPw R"1`qQ@A `  ލOp倦8=pl P0= 0``p%=p"=Qo=Z. P, 0  8P0h 4`D <@ <<P R <00<@p<p<p0~<`<` X,Lp`O-@(P0P!0`5R5s`(P5QؑP- (q ,0[ D D S 1"1 Ocꁡ P ر X! JG< 2ؑ@-@ 13/, (Q0@-@Q *00 2l< 0 O-SMf `& 0[ p0P!W G QZ Z R U UUU  =<00PЍ5 p% 0 P !@P 0$ Q10!128PP- 0T%S@0 2@5X  00,50 0$50 0500500 5000 S S ;00P p / 20 2 P0 7p ,0^Wp W|3Wx# 2[ 00 20120GqS  000 GE8w? @pP31S 088 09(P0 "  (P 1S0S1S ()1 29 21 29 21S 28 2FR5S " 08 㟤PP80b @S ; D St<@ 0, !pSxS<#0^4%0^8&0\4)0\8*0R4-0R8R,.0/ L0H $^(\"p+R'+ ; 0RR, S$ S(S< 0 +;+ ; ;2 SQ<0SN@pMX00 0TXS 0 I0;i0$ U"* 0S @0C/[00tP0: S 000 R I R0?00A@V$ 4- p"00S X 0C \0 RK Y P000W 7p 6P 0@ox , o`nhR Q0P:Q0Q:y'@-@-@@a $ @; Tp@-@WPT#,PN$ ( p@1 = d @- M@0 @ P 0S  ЍlO-\MkeG3@aPdF`xF0p P  $,04@< @PHy     @(0-C8`DLpTpP `` ` @$ . `&(dHnfhlȠ 0#PPp' c:P "  @$b*P `&gzeZdLfl `,``l̠ . "` n0#P%,\ p'< P| P, @$ ` ,.dH```eXlȠn `0#  p'`c: gz P% " ,e\`   "l̠fjb*   @$ 0#.dLn p'\`& "<̠|,r$PP Tp(pP0, `0P4P8PP<` PP` P @P@DPHPPP 00p  $( y",`-"C0 4@8F00k0e4G0 0\ЍA-@p 0XMP `00T00  00   &@  0 (0 0 T0 30XЍ{ `h1O-`0X! 0M@ p 8`P   000 0xp. R+ X   h   0 0s < 40 0 0 30Ѝ[gD @-``QM\PDYf0S D@P P3UЍ,ppePU1  @]@P tЍf0S OpL#*pF0 00 p@  p T@     TO-A@t1IpZdM! B0Z p"0\00P?0 0 "[@ @ `@  @`T @@000X0SZ- 0 0 \0 30&dЍ  0 0$[0S     $@  S U  \,(0O-MD`$ p  $0D0    !0   S P Z뜱@#CP  \荐 _ [ W  @PF x$Z D Z003006F  P  P0 0e @@ P0f0`00d X (0 0 0 30Ѝ ׀bH(8 Ո 00@- 4MP00,00 @T d 0T T H0 0 ,0 304Ѝ0$  (! Q$1 A-HM0@P0D00 `` @T( 0T׿ pO `V 0V   h X0 0 D0 30 HЍ$ $ ꩿ= d 4 Ә 0 C-P04M`0,00)` @ ppW:T p 0T )T H0 0 ,0 304Ѝ$ Ml $ Ҕ 00@- ,M0 P0$00 @sT ` 0T P D0 0 $0 30,Ѝ0$ > 0  ب 0@- ,M`0p P0$00 @CT ` 0T P D0 0 $0 30,Ѝ$  x P O-p1$M0C!H\ B簀 0r s0 0C 00@`PX  BQt !   Xi U P @0 uPp   r@ RSZ 0 `Uv`:00s0!01(0  0R 1S0"s0&1!U0C 01 0VH05 1H 5#010C001 U* `@ ` X@ 0Bt@S~e[{zyxwQutsrqpo'XPR* UO X !    } !    tL 0   r0P@@`uPt@p[0 s0!\ 0s00s01$Ѝ00 0  r00  r0`Fv`00s0ZS0 ` P0RWC-Mp`h@P& cPP! 0!0 0r 0000 00!! 0 04000000@PЍЍA-@p0P A`q800P0P0 00S   L| P00 0 00 0LS$1   @p P@  `0  P 0 0 0&lWO-MPp@Pi Z0 q 0  㲱!-@@^C  0A 0 `PG 00!Ჱ 00 0@0 0D000%!Ppp8!P@Ѝ 0 0 `P 0 0! 00岱0 00 0=P 0 001p@0ᰠP@Ѝ pA-LPA u` uP| pa |\ L|挀@ X@  F0!| @0 B 0 0r0 r R  B`r ` PVP0 0 00 000 0fO-LMP.x0`tp0 @20 Sp40$0 ,P_ "1p 0Cs011q "  0b0]004P0S q, W $ 0G 1`P% pW 0p00CwprS񏐤S 0`4   P  LЍ 1! BR,*0S00"B pW 0`0 000CS^[ZYXWUTSRQPO71 0X       WR   !@8 B   D0@<8 8/ 00Z1   0`Q!01 B 0C001 0C s0 !1 B1  0 04S[  0S  2 0pPO  M Iq[C P0`\010C0010C0S 0C s00P0010C 0 @Sp  0C s00\000400S  P   LЍ1X" 0C s01 1 V00000 00`0s 0 MP 0 0 0e 2 @0p0 0` U  CW *r  Bpp G 10p100 0  pCp00 0000 6 2 0 p00SL 0P p00TG- `P@PH `V4 2 8 0 ` Q0< R  O  P; 1` 0C00C 0t P"0 0Rp  2pW 0 10C0R p W0 R  p0Q  {P ` C-P@$M`pQ 00 WW 07J  (0pGW[Y8WV4S0GS7'00$Ѝ(0}W# ,0p110C RB0 s0x 01p崀 P ,0p1! B Rt 0 jp0 P ⼁pP 0 00(0rτ⸁ 0p0 (0P=`P) 2 00  Z0S 0S 0 X~弁 0 po 0S  001 P^ W1 W 弁QW# W(0X6W6 p  W  ~P7 H⨀Hx긁0(0弁z(010Cx0XW( p  W  WPHx꼁, 1 FP 0WS?q X0G ,p⼁ 1 -P X10C0xX弁 X0H 1 0ⴀCሀ !10  P p p c0Cs 0 ]각 0H㨀HxU0! 10崀 pm Pp@-@`PP i0 00(0`0Q0(0pO-Mp@,0 01 PD a`F`V. `s`V P @ `Ft@@c 0P 0+00P 1 0@P@ 0 X @Ht@ 00@ 2P   00P Ѝ 00ЍU= 10C0SQ _P `  ᴑ @Pp 뼑0 S00h0YAAS뼑0@ S 0I 10 PQ &P> 1@ 0C 00C1PP. a0 S00 ,@VTK a 0R% P0F 1P{ 2  PqQP  lPw fa `_ AU1PE@D @`@Dt@@! @ 10`H PA1U @D0PEt@ @C10`@T0:1 010`C1! 0P!0s0 0B!R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ _@-@P H  0( @ 0# 01H0 0@0S(00S1!R00:X Y \c/ C c/? 0@ 00S 0 Y@!SR@T 00 R 00"00\'L7 0 2 30ߍH2S$70< R(00, 4``,‐\ 0(,0(`B40᥷ 0 P p (pV:: :J'` #x6 0~l6_W0ࠓࠃ4<Z00Sg  0\ XppW` p```ZX 00S <  Q(( Q -`p00S !SR @T y000S(00r<Qm 4Zs p`p Zl X`G 0SR 0 OAP Z\Y〰JX  R+ c/k@) Y2 !SR`@T 9000S $0S !,0 0S 0@T` $ 2 P!SRPU 000S?00 ZY〰 \c/ $, p <Q!SR@T 000S00\c/@@  Z ` V&Z"0``0S$VX``&pfX``x2 0

@-R 4C-S MP@  $3/t` 0 PQ` v4P4S  $3/000 Ѝ00A-pd 4V:@T@T 0P0S  00 S  0]@P0`0dp@ B ! A-M`p  ~@P0: S(9PP ˅P@ P 0 ltdЍH00PЍ $$4/p@-P$0r0" @`Pp$U04  0B0 0 1R  0 p %  00? lL 0 ASL @- 00S 0唳4O-SMz@ApP`ᇁ0S*0S'  TP Z !P0 00 Q   0    Ѝ P? 4  0  0 PQ0 \$R P/(M@p 00q000S0 0p  4 S  $3/Ѝ t00o00kO000QA 000/0@-S@  R   0 0Sp@-P@T @T 0 bpp@To{P`p  0S S/P/O$(0c03?c00 R  0 !!!0 ?oP//@-@ MRpP:Q !SV@ЍA0 0`J P Fn@GЍ0T @0 0O-0S) P& 0S# p@# ,0aT T 1 !3/Pp@DR00C0S T,0p@2P ?0T` BB \|  i V`! {0  `C``@ 0p0C0S 0T `p@QQ   D R !,03/`PIʼ0@00 "R( Y `10`!P0VQgRJ,03/`PY M 0p@D0C0S T@0T p P@0S*V* 000vP@DS*`A 0`V:0P 00``F0 ``i 0Y0C00 00KP  0 0C0 Z `0005P s00r 00n0% p@-P`V @`0@D0T0@T ,0 3/0P`ʼ0@00pD0Spp@//p@-@P|00 0 PpP 00, @ \Pp btR0 q R/ S/0 0@-@00S- 0 ,   0 P @P 0 0$0 s0 00R 0   0  0c05 a@-@M`ppP` p zP0 :CRo  S L D0( 0R Ѝ ; 0 Ѝ;0 `#3 @-lM0@R0d000P C 00  "2 0 d0 30lЍ 0`0S p0Pv X"X p0 0R0```ppLP0 ```0S$p!@ "Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00  00 %  w 0SQ ` 0e p pp 00 p@kP겻  ` _ _?P=p@-@0MP 00Ta V( 0T1S OZ0T1S0`00U TX!\!R Ѝp@\!00Ѝp@ۡ00U\!X \!X0 000S/ [t0 0p@-0PUp@0⹡00TQ廢0`U TQUP ⭡pX1P0X1ꪢ0T0`X1 [th0h 000S/@-@0⒡0 X10CX1S @≡OT10 @₡ [t0 000S/g Zt0 0 0S/p@-@0PiU00 \A\Q X! BX!R p@Y`r00OT!岡00p@N Ztt\ \0 -4M0 0,008 00 0 ,0 304Ѝɺ Y Y ,DxO-M@Q`@0@HP8U00B PR"SR0M@ 0 000P0 01200 P0Ѝw00,0@ @->S0M@   "00!,3,0 tP0ЍS00@-@n@n 0p@- M0P@000@`!!0@PP  PP< (0 0 0 30 Ѝp芰 14h 1 0G-@P p`PR#W  @` SRQ Q` 0Bj ?o/o0CS 0c1<ÀWR( /o?o BR  0b1<ÀO@Ϡ0U0S?ሀ?᠟0 T RW0 0C  W 00U" 5o `104/o?o0Cs!  R 0b01ÀW W02??o40@b1C<à)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGO 0@-@%P  000 H/,0,0-M 0 000 0mЍ + RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGO 0 ///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 000Q0@- @P' ST0 C0 ^@DP \T0L^ Q^P 00PPQPS@R S Q0 S0 0 /U/ S RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P TS Q@DP  ST PUPQ P00S @Q R U// Q#/   //s R RS 0 0/U/0 00/ R S  Q  R  /SR Q 0 / 0U0/ 00/0/R - /P0 0Q00/R0  S 0Q 00S00/ 00// Q#/Q- S  BP0C S P QP 0U0Q- S Q P 0S 00P 0| 0 @-M0@000!00%k%k00k !k4 ,0 0 0 30ЍǬ ! !0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/ t@-@p@-0@ ,p^pPWm0Pp}}////// P//O-̱4M`p P U x0000 "0&0*02000( 06/4ЍO0 S@' 'S㶐0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUh00\0 0 S00,00@~~~ }}}}}}P/Z/[/O-M , 0Q< 0000<0p0 0 40<  =<;:9876C43210/.-,+$)('&%#"N TO tpXgV` P<`<@ 0BPV \ [: Q ^ [p4S0CP Z0Ԅ0˄ R*h 00CS0Cc Z  ˄0S*] 00F `1!00F Sa`   0  00S r0- b `G `*V 00F SP >`5%00F S8`4`1 0`@T u 0   0 P  BUPe E0`  0 0400x00uN 0SU00PF@ U0NP\d BPV [f* QeAQA` Zp˄Q*[? ` 0 0 00 0`lV `` 0P` < 0*`倀`@`r 000  0uq 0SU00j@P `<  0 u  RU  P`/ 000 0 /`+ 0 R .` 0y`v\` rX5`00< 0 0V 0T 0uS `@0"".!00d0`NE @K`< 0u 0 R001%:@$0,0 P(`Pᜠ+ @ R! ⪠$ dVP0  c/* P @CN0 E C @`i 0u00 0 g`@ 0 0 d0R`\ 0@0 N DE @@ [04  AQA`0 Z 00˄Q*0`\ ZEA Z?  p Z ˅4^ H x 000  0H [00K0D"42 0 0 30Ѝ 0 0 / 6   # 0 ` @P01`000  @ 0 0   ]  0 @s0 ( 0 @r   0 0@ r 0@@ 0e E0 0 @r  000  0y0 0`P_ 0$6T0  0q꣨ ,  p`0` 0A-`pP@PU J0PEX@S 8/`upW x 0SS S 0R / 0R0@o/ @-xoO-p !P1CM M@`00440@  0 @0 44 30*Cލ Ѝ0`P 4 PUP Νp 0 dPL+   0/   lLP @`PT 0STup P```0SPU @  Y 0S(ڐ- @ T |- \ x X < l Te 0d<0v?HL00D0< 0h S1S D 300S S00`01D 021帑Y[0P0S|000x0@0<00SsATp D0CPo L0PPPym 0;[@@ 0 ᇦP @0PP D0< @0 < TL D0 L dH0S  P0S Q <00ox0. S00P00SS |`P@*pX 0@9/PU +: 0 6 30qmލЍpW? <@PL0Py !cL0P0   8 : X0X BL0x<000SJ0`0KD0`Sd0c   `@p0G0 $ VG 00P`/.$0G A D(4, !00 0 4000F00(bPPB U0S0  QN `1  8 l9T0 X0H0[H0  o,0H0: $0,0 0SL0@ ( ᐐ#/E)b,"aP 0S @0P ɚ8t(@' 0 4 H0 H0PC Q   0 0@ P0`1  8 7\0 X000 0 1 01z 0H0@`00 @ aP& h0 Ps d `1 s 8 60 X0aO00 0 0`04 PW80&D $X L76P40@!/@ 1   *  0 @01q峐1W @0@D ` PT!> 0v/$ W G $   0 T$ 0$ 0W 岏  v@ Š01粐0a 8 4P|@ X00H0   aP0kL @0P ə8t$@$ 0 (0l00H0᳙8$@# 004 2!  `1S 0    0P0H0`PTgʌ PH ?`!!! Q;   <38 @ X0 [ *0P RB @ ZaV @*Px 0|@6/PA0+S .0CS:@80P3PtPU a8 L2@ X00`!8 2@X{l S0d01SD 3h0h00S S`` ``P19 h0 kaP0 h0*`P101@PDpodpP 0@ 000 _@00P`00P 㸐D2 P x0< @ ,L,Dl8,D  TP0D Br DR _Pʆ0l0P0@|@ ~l06SV `vp$0c[pY0P0{ D0P TP0D Br DR _PS0l0P@N0P [8D!@! 0⢈| RW00 0R 0`1 k 8 10 XP0[0  )Y.8!@H"H 0u$0 P 8 @2 X@0[0  )k P0SZ=008"0" Gd Gr R000 P T Br DR  R,#^Pʏp0 P @ 00`PhP 1011S100u8 30 X00<0l0l00e8 4L@" X@0~[0  )00P8 t4 X0i`mW 0p0h l(0l0c0l0`@^0P k8%@0%0 0ⲇL0+S .0CS"E@C0P P8p%@% 0◇ `00l0-`h0 8 )f"!P0@ ,8&0& s84&0H&H fs8 h6@lX\/ /M-   0 C R1#0e(6, Ѝ /M- 0S  R BC0S N  Ѝ /M 00S 0 0 0CSЍ/RЍ/0@-$MP@_P$Ѝ0 _P0/0$Ѝ000 $Ѝ00@-$MP@^P$Ѝ0 ^P0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-P#2CM M,p@0Xd0,401$D D$ 000 S  - 0p p P@ȡ0$ \0Z PN00A  !< S 0 Dž\4 0; P0 00 00;  P0. Sa @010,430CCލЍS  ?a 0S0Q( Q" Q *a     ;+ 0 Xe a aa X@ D$PC-PH AM@M`p0 4" R3 60 @ `̄ P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R@@T  ऄ@ @ `ꔟ ۄ| D\ڬO-!1AM 堡M0  0 40P]pPLp)PG `vPPB @ t+0NP7 0S4 `  0S+ 00@ pxAP00@S 0S0S 00@ K@ @  @K GD ,0 0 4 30AލЍ d L@ O-p#3CM M`P0@X0,40\@`0S  .S@0SV :T d1#T#*0 40 0$ 0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $_000$0D DR @@ 0S+ .S& 0P*0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@( 4P/d!"" 0Sx0h 0@$0000^0@P@Tk0!0$  00$0s}0S 0S B_V0 qO0  1_ O-p0\MPh2@0`"T V d0US#:Š@Č&Œ0/O 0pS 0 \Ѝ!0(' 0  @V X0 F0 0S^P0wps^^0崐SUHPP   B RX00 B 03^P ^^^^ @ຐ\Ѝ0 `F 0S0  s^w^ ^0s^0S 0  @00\Ѝ HC-@0 Mp`(P"@D T@()^?Xpy^뵐0  p^ m^ 0@00 Ѝ(ѰѬG- p@ᶒ`ẂP E0S@P0WU!P @^@<^, DGp4^D0O-䡐 MP0S5 @d @V%0V@Q\ 0\\"  p偣 pp p +; O-aM0 MP@060[0L+ 0 qT =0H `t@01%,d!0"d! . 0`1111A0500P 0ʏ 4 lJlz@p", d1 0d1s, BP< `@ v`0H SD@_i S\  S S00 Q@0S SR: C0SQ0 0CQS00000X9X\`P reGaoF( 0e-0a.F$0 t"o#G i$p/F v"e#G, / X  +0iIP 2#S;S 0 S" 0 S 0 S> 0 S 0 S 0 n?R 00sS2 S S 0(( n9R2 S S0S 00 S S SS@@ `0 ܁_A0(0P@ 0, 0S? r5R2$ S S400R00S 0@0 S S00 PP0S S 6}_  05   `X;0K PiTP ReP $0TP $0R@~  $@Q$0P S( 0d10d1 ADV|ᕪ1|WAp 0τ`0S X `0`H@DSH .S0SX P`.HX00V0S 0 P % +0$004 0 6 30!aލ Ѝ t3i* S S00 QP0S0000(0+OјP.P `⸀1 PDQ  00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X$00 $Ѝ4[[[[(0 $0 @- xv Xp@-@@`V 0 CQpPaᆆP  `FP    p?P 0`0p@-@00 R \\  $0!0D0 0@  ( $ T@-@PL  0S  T0S@Q弆@zQ4P/0d 00 0Q,0/01P/0(00$ 0/p@-@P0`H 0(0 P0S  1T  0"00`p4p@-`0P@P  PP 00p.h A- @0S  P p00   ($ 8PP(p`P0T*O- 슟b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH DP (0$  (p 2 00P9 ЍP Ѝ?00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-`@ MpPQ 00U,0`V( 2S * 2 P13/PPF `P 0 pr 2 00P Ѝ _ Ѝ00PO-1PMS-:00 X0*q`I`[ 応p@ p W  R 0- PtZ 2< 2ЍPЍO-MrX>*`00Q̱P@农0p@ W [KPE oP0# ̡1PE PU0 Y 2< 2Ѝ1PE P0 0 Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍP"! ЍG-MpZ Rb'*Q* U@0U @ RD0 a P X U 2< 2ЍE@ЍЍG-邀@`ᴑP 07 pv`p IpcV`F1wv`010 R 1\`0!B L\ L| P~ \!2 B!0C2 pp@- @TP ` PP  pPp@-`P@Q 00T T G 0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-`P4M@Q 00 Vv 2+ RJ 13/p* 0 00[" "0$ 0 004 p`0 9/P 9/P F0  ^ 4Ѝp$ 0 * rq0 ܚP 2: 24Ѝp`?(0 0,009/P  S< `55S0@@dX0/ A!, a3,1  np[ P',0S=  0R , E 0 S,( QS#<$  ЍX@,0wp 0G 0pW,,0S0S  Q S$0 00S$0P A 0S/?s0 Cr  0⢣@0@ꝣ@0@O001Sp@-PM a@zP8 @0,000bP8Ѝp>|/G-`0",2M MP0Yq0 00?w @^  0R1X< )5S0@ZV`0/ L,. l3.< 0npF YPX!L1  0 0 30I؍ЍV90PJ8 ᫪8000S ! 0E\$S\(,̠0Z0  QR$ Clpp@0@0 O00{ ` O-P ` z@P H1⫲0p1q  J08 10000N`ⴜA40O-Sp M@`0S0040000 P0$ 0D;!@ B  9[9 M^ Y L[0 \T 0 SO r   P 0S  0"  !2#$ S C$ Uz@  US SRMS5sP`Uf 0 ᒢP 00000 PAL0 ЍYD U$DG PP1 PDD00CD0 0 10CR@ x0慕 B Q" 0sPP @0C 0$ 10C0S0l]P]1 C 00 l@0@ XPUڐ0Sʅ 0P! PDp0DPU P兕HDAD{l{zzO-M@Pp `0V5Q 4帐 Ym*^ޡPP! @`V ᆠ0Q  VQ`V  0\ἡPPЍ0S ` @0 00S#@P 0S 0 0 000SQ 0FP00080080ЍO萜0 00008(8%40PЍ0J `0 0C s000 00Cs000 0 ` 0 I ಐ 00 0n 0p@-%> S0!`$P@  @00CQA$0@D3@N0!R T00@2p@;: O-0 pdM@/Wp 0P$0_ 0  PX $wp0 000 00QI`@0@0( 괰\ G  p |||0 0K0 0Ჰp`@ Qڴ0SPPG  K0 |P L@ D0pz00$0( 80@s`PP0<0H00 0 pP`4 ,  BRz r @T 0 ^~pPa(PQ0SEpP  0 000{ PA0 s00pW70H0SB@PCLP ᡛ0S 0Q0S<0P0Z 0  00c 0000  Y0 S[(P:,4 Y    +<0 000 000 P'T0S0# P0X 0 XPUU `,Pm( A0q00L0Ⴠ$000000dЍ4 80@0@ QpN0`0˟PP `^ ,0~pS ,0p|0,P80,8@0p,P-,0S?8@p00,P#0p4 O-\p? P0`S0@L$P x AwP' Y  0z S40  0 (!S$10$10 10 0S0jP  0P0 S0ZP  00S 1$10$1(00O-P@ M` Xp@pR 00P 0 1 !H0Css`ɻ 0 ~r P PF`P `0LPP X Z `0Qa Q 1 !rY  pG0 0Css00噻0 H0H   A 0@000 0@pW* P 1!{0P0Cs0 Hxxn0 pW0qs0 0 Hೀ 00ഀ00B000 Ѝ@000 0@psQ0 C0 0BPP @000 0@p ЍA-0p`@PQ"  0\U@ 8T8 0PX APQPR0 B0Ӳ0Sr 00ô000 0 Ss 00C00000UU800C80O-P0( 0S 00Cs0Z@ ,WPI  0S"@P  0 S 00Cs0 S  p`V S@  0^P@@A-`P 0@T@ Tp Q Q\ٝPTG-@`P 0S 0S  0Qḝ@PS" 0 00ᲀ\S: 0 BS P= \0 ᜝P  0 (!0S 1$!0$10 PምP 0 㾐@pᲀ 0p 0 S 10 B\ᾐrp gP $1 (!0 $1400 O-\?  M0P`p0CS0@L P u tP& 0 0  eP 0{ S0 ¹ Ѝ0 0S0P 0 0P000@- M@P p10 Ѝ0O-M 0`0p  @DHPpC 9 P -z X  0  ‰r 滰 \ Lpര0 ``p0000S XЍ 0  ᬜP @ C0C r 000P @G-`d"`2(M @0 0$00w?0Rpj2 S:0JS 8PP 2 S p 1 !P ZP崀@ Z1L PH: CX ": L01|  pո” 2 0„ 2 0 0 $0 300(Ѝr  B0@ ൸1x Gp  0000`0p 00 pP202@ q p0A-p@MP`Q U00 2   Q `:1Qp0" B\1"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00? P#\0 : 2 E E0P VP V$P 0  ЍR00Ѝ0PU Q:(0 $P0PU`PRrP  =sP 21 ss@--M" # @ M)<xx  0Sd000S 3/i <=P l\8 80 0(Q/$(0S/  kL<<00 R/( 0S/  kT4-AF hFF #x m/! FD M)h1 J#F I H@ F0khBF1F8FAG5 `X-OFhF*I ]PM*F1F F>BьK<h$$*nO@2 !   0^рI B(Рb+I+GFF"FFFFF&F+FFFF05[K"$YIFYH $ C C( C, C CMLNJLF 5h]KI(F"7HHHJ) FF(FF1h>FCHF" 2h*7H(a5L2h>F O !OFbh:b`*ƀ FAFw )@($*] -t/@ -@,$Z^ P0^I K0Y)F/$*q$'*A $B JIHd U@ $"$ *08 %(F >~& @ XOX$Z$ -  .I/HJFd SբR )H" "`d S?DE4 F J' -w'$*- M 0- 0j1 ^ 0-E@? ["hP `x<碉"`0FJ-OFhFpI \K$J&FFFFD!(F9FJCK^R(7G((>йfO  9h(mH8 (Q utttutttutu?O Ox(e(X( d(!uI hO sI hB:W" -ђEђx ; `iKh- (,й6*aM F0B^I"FI F(FJ[,!FY3IF3H j0K!hfF`cp+IjC*Ij+(I#bW%0+@𨀢l#l*G%F@K #lV<ԣlV<0F`#m @B+k8Fl5FE( ܰ 8HbX~C& k*+#m+Q!Feccl{@B!(I `ObOs* @Bck'flYE@&k.@EckB#kcccl(9F l](9F a `Z"(((@B~F@A[uI >@I#ccV(( 0hFcm+1hjH5hpCO(FF5hak(F 1(4l  j(F28cm+TH)F*lbZ 0cm+NJ1hNH78FHcm+GK:F1hHH cclЕ8+h&0BF.[ШhQF1,#L,!1.#L.!10#L0! #12B2#4# [B4#6#[B6#8#[B8#:#[B:#E`9F6rݐ`ݨsh(,hD#2B23`#p( E(S("IFH s( x(фIHjKh|K"zK""xK""uK"!3; (NsI j! fpI boHF(AgIlH0lH,^K2#hJiI_H@ZM)iѺp(tUM1+b.@SL]H!F\H0Fx(S23SK"VI FUI AK" hxhS!Fh( FL chx!+"AHh+/I9Hhx+ 0(7He6H6H4S2kL2+T 1 ~Xp& :C $ 4i Xp"M&"L#H)Fa4!H0F(2+?PK(F"I(F9[i-GFh Fx2I 2NZ'O2F!F(FC,KhBO;D&Tp0Fp(v("K' :(!hHF&0 hb/%hO /!(F0Cx++x#C(F ( H)F;F0+(F< ~!Wp! " O#"  P ~F ~F B7  L ! p (``Oܿ#c`LI` ZHNK!8  (ŀKh++'+шK"% XK"!"K`#~Kh+JzJ6 *uJ! +wKh^wKhtK`wqKh+ 'rK"`qKh '+.#cKxdlHkI#FkJ(F FF FeL hCh;C`+ "hhY` "_HphZ`+:#MK6 0kGKxSSH(f#OK"`@K0+cAKh+_ =Kh9K(a7K0S8Kh;AKh?K`v+ .K60+:H5H68K$L ` #1q L`SKF0+(H#*X#x+x+#xM$&FU 41F\,ѓI !^x !X!X!a!Y!X!X>!dLج!X(-GFhztI ZsNtK$tO`3h BY#9FPFFPF(EkJIF(FxB2h(.cI "a+R#$! (  PI$$MI (KHJI (HHGI (EH,У+h3==M#3hq+FD(@6I@عf*hh#x320[ F(FFz!F~#3I" F0 aH!F>KI (Hh  ~~3N3T3Z@ tB3d@th3o@t3zX33/Utg3& hd -OFhFVI Z|L<&FF5FFfx `oSBSAJc`K9FXFJCKтK + iֱ+\5h0F T0@uI2F R(&G((1H8 (Q CCCCCCCO%h(d(f(!v(!XIh!O%OO !%%+=5 йFI |%EO33.chW*+=:!@FhkeW*`3x;#+'6I0F1-K`  ")FXF|F(@.I V.!@F((I@Fp0F$I0Fh0@F-ch ``P0; +onn4nn]nn]nh#")F0F0FF(lh+c I !f4D~$& 4N46!fGpZp9F'FPFFhzHmiB ѠhCjBђh`oТhiGȱ)jHpZG9FFPF',F+(j'8F.ab@-GmFFd4La`d5`5 `dR5`5`acA5#aaH"HFO&AF:F(FAѡi)@}I" 0F8h7yh)wI2F :uOA86(!9'-15VQpī#fB Љ#55#53FF#5#5#5VKVIHF AQIHF@@NIJFJKh "!H?F 4h"+ BI "!.?Fh"+ 4I "!?Fh"+( (I#x Kh0#m#5v#cas##i#1k#j3#bg#X#V#TI f#iAB%@BB!I!f& p>0AZsA `i"!%O hB ѴbhBє%BcE#;`#55KuhO@ #;` F%b-t%*oX#&! -g)bX#&#JOcevڃJI -N%:..FX#X#!I5s lPpCO#55>.Al(-@F#5b8F-@FaHHaKaJOa`K(F220BFVH2'XI\F(Oq0F LJ(Fq%OI(F(FML #3# !E*F l  .?H>K?I(FF22Flù:I <h#+ " 4H*2  /I0JFCF0FYJ FBB(" .#I2RF H21FOrH(FF(Fj~@FFP2 B<~!ht[!f* 1;8~<_H_Hch;c`+ FF(F (0#hZ"`xch;c`+ F#hZ"`x +% N-'c-@F0OS00OS0@HAF-5@F11+1[5H3H(?d0J-Hq%+I)H}-)I X0(?@FF#-2I2@Fd(I #=-?e0FFI2F HOrHH  ")F$H|(xC!f!ht~<dm!f(-CJh(KZ`,p$NO XV[8F)FiF `0;`0+ AF 4, X0ZX "p18!(-OO#FFFFFO   AF:F FA ђJ ,$l-&Ht(c(S(P(FdE  Bn( t(#Fa(J&-d-ХrQBQAIxH" ?FsJtI F!d-A R-S--Q-mI*F (p-wr-Bl-",;X*XF2F # X*"2^IXF 0[I X*" WIXF 0UIX*" RI XF 0OIF("! X* ""IF,<XeFAI"F&W\E&6BE:I XF f08IDF@5J6IF(F X* 3IHFJF2I(F>1JYF(FxF(F0+JIF x*I J&IxF$I r,@𖀒"F&X*H|H!Fx FYB2~& 2&w3RD~22D2?D{2M2Z(D|2i2v222D}22223 [(I HF(F,%KB.=s@3B0QF(FFYEW(O 0 IMFZFF*1F(FV"PFFZF(F4IRFH RFFO;aray3)X-OF-#LO8222 23322JIFCcѐK Nh2)L C C C C@-dR@SY"03`d20hc @pCO#d210hC3C2Cd2% FI I+@ekO@C:Fd(0aC9Fh+@:cHz(IR( 3(B/(C18(BEGIS8'(9^8888888888888b@88fj888r88888888(  . BA8(#0B###6N "#20hV x (2h0I *KXa&#d2"# 2#2#2#2#2!M$!Njh4U0F, a#2232#2K/!h0FF3x+?:0Fk0Y:!A ~p!A& @!@=F#;3x;:0FH06:/!(FbFF! yx9:(F40":/!XFN"prx*?:XF!0耐{x+?:(F0:I .J#O 2:I8h(:h3h\ I3ocOc3]J N;F2I0h(2h;h\#BٌI*DX2@N/!7h8Fp8F RH2hpCOрKa*6hX|/!0FhyJ3FyIyHiHwI 0FZ! |oH*: Z0WBBVsgHncHcIOR0F H`IB [H0F t !ESBVH0F'w `'r#3FK `>Kh3;Kh?KFX`CB?CIs!cAHO;2#23=H2+?si38H-O #::*F!UX0?XF(?F:!UX07`%HX7`d20i+: 0C1hH0i O33ao" 0a01hH8@F!& @c@n!@@p!:3[@@!(@@A)A[AxAAAV#1OqH1hVW+F@CI AQ\2T72P7OsH72L7H7O \wTs`L7P'?+鈗"2.!2銗P3i`uh;(FX`(4pI*F hnJoI 01hmHZiJlI0i 01hiHIHF9FT-@!@)F GF`_H:0i 5a\J!  iYJ! FVJ9`>3232 32HM\2#SC#)ZFD PObB\"ZBX28K"Fy()@Dh&԰FF`h L2F HOrXF1(H20rC'F:F0@Hl#P2#H2"2*Q+@QKZiH2BIAB<!AdrBAdeB-[!!h!!n>pB!2o22?+"\@3?! 2JBYCa L '8F 7(MPFP:PF(7:: ƥ2 bS! fQCFp2(F1hCFqH2  /lKd2+ٮjHgK1FF\PFG9FDCCFE5 L  HF( @3B  23B  NKo(Oere1IJBsOc\2:?31*?+?ᮗ!2)*׮)Ү)ͮñ+ F#@2AD2BAH23H2*? Ev&F+S2"C<O2B+vN ( xiu?@IH.J Hd!(@ހ IܻB|!BWp!CeC8bH(П흛O&8F2F2Os"H#2F2?#"H##"#2F2'HP(#8IF F2+Db.@|K\ibzF2+@wH+vH!tOO O#8F#FhH F(jK6!.!,߿$0c 03+ 2+@ZH2O08$)CSHSH(oQHQHf0FO (LI(Dg0F4\2::E,2:O :LF$>IFXF : ʹFFS"IF F @{i3?ĮB1F,H#C9MKXi/1,?c!F#H]2C"Cs EH*(HH"(HBBCC-CEpCCD!DCDD!h!=CD&EE>-O]M-#O$ 0F+FFCOka+FCO@E`JIF0FFXYiYD#aiD#0KhO ;Ȳ OWOajJFb6/!(FMF(FP `KOaJ eHF&FpHFFHME9(FF(2 jOabF(@׀Ij y+c+P+UT+]&xKyIFyH, d*Q"ak}sQYsiCaRiBaYH 09iB iBiB8hJ7 *?1:!PFHI F"+CHBFQFQFV( AF +h 8I:h) x 5In)Qxo)2)#1J1LȀ`!F Fr}!I F n0I  F   D<`BI  ya;0!+I JTm,  I 5!H!Ade5556-OFP FL'MNBF!F(FC-$G00EH&'DKh"! (?I z0ܻAZлCAڀaK"TaܻCL𕀛a"+=AEIS`dhW, oA "!FF*FQFXF^B$ѤKh .πM+h tO,h&4khBY?+ 5u(f(F(*R(g8(S ѧ====щ====S==& h "hyI  hx#+ hUh h "( x+"hmI 0 " x+uhr hF(l"hbI hx#+ h (?\ h " x+?Q"hVI 0 " x+B#?#!F!F8FZTKPFTTH@FL 6 4=+?Q0FZ"P F CtQx)Rxc*p*b*JDDDT F?,O 'I DTO FEF..O@,F'!F8F@F !F(F(ڀ4h+I*FM I"& ~!  .N #F `h C& x3 ^Ihh+63.0VKh TK#B 2B2 32pA_FZ  EIx h310[BI 0F GFF*?a;IF\2FCF!F(Fvf+?l(F (KѺ pO#(F !F(F^%2BBEpO(F x2FCF!F(FDpO@#*?B!F(F(,  @3? (F~0H)FpOO(F Dв! Xq-O%FFFF' ZF1F F C>ѧKh#0B@)0 +w,,@V' qOa`F(𩀸@ЁIV'*(@AF FHBF@h+I"FA(Ba8(€(< /27K`E}Kh x+ EvI D̡FE|lJSh3S`wEt#O o";B 07idI8FXbI8F0aI8F(@𛁰hAFT(@hYFc(@7hQF8FXph rhQI gOaq:F`F KIq #3h +F y(LFY !F=I  AF(D0 (D  E$B@F> QV'hF\HV' @V' %I ( i0FHhI0FV#`BF 6OaqJF`fF(#3:F 0F+F F~XX!& XAW+WXsX[VXX}Xf`V'6FV'FP*F(PFF(_I@Fh^I@F@\I@FV' ZI!YIHFhV'+ (?k iv PF (!F POb P/!(7F0FsBCB!#"9Dr# P3p!CF'5J0F5Iz0F0۱̠#33!F PF+F G V(I 0F\00F F D=I#"DH### h"G5K-5I#"=HoC## h"5,K ,I#"5HO3#OS h"""K$"I#",HoC## h"K(I#"$HoC## h"K,I#"HO3## h"K0²^¶‚~`!8Ľ& Pi)xX»tH8LpKhK[h FTBPJ#xh320ZԞI"FH FF"HoC!F##"KY`yI#"HoC## h"K`hI#"HoC## h"pK4V|I#"Hc### h"_{K`FtI#"{HoC## h"NnK84kKh0srII9I"=H , (VLI "X )?bOS$4.FHObT4++(Feо?HU 8Jd!F F  4H@\$6/Hg0JR,JC !Zgx#<$6B@0h Pbx ! x`Z"B8I v`T(? " F$AI tBz Z O ?qUI "Fy I fǃǫǶǽ²x!5 `-OO3LmTFNF4#FF JFAF8F|CFCѼKh43#4/; y"!"!HFX&`́4Os44+@J 4Rh*sy@!@0FF3@oI2F Z-;C-_D=-S%7777777AY777y77777O ub=--S%77777 777-K7777k77`K" haJ x2+?4?0\I X#443##4NI#"RH### h"LKY`FM#"KHO3#Os)h"K B?*hCI:I#"AH### h"#"OS:H#Oc1h" #"OS2H#Oc1h"#"oC+H##1h"#"c#$H##1h"K`#"oCH##1h" oBO3H##1hOBrK!& ~!xtHpìü@3h(4x+XI O P#M!!"0щI2F4+F \C"4p /y6Q4"I/ p poIOcnJQF0F`iJjIF04dHRF9F`JbI4 !F\J^I+ZI"]H \K >  SH"0'OJTI$"PHg9F(GOr49F y0@JFI C 4+4 ?IC1j#C3J;IbC:Il9K-J9I,NGj#Ie1j0 $Bp -I]o 0ZС2"(F0# I#2FEt(F0qH1FxOZQF TF(gIRF|Ѩ"!8pŃ5Z!-ŒŦŽ6J6-A\p!i $ 4*|+\ 4$Z4 t+rPFAF*F0FkB(F ܡ$p 4y4+5HJF;F1FOs/yXFTWERFYFy(F:FNB&I ?iyIFO9EzOc 4 44IFOP'EzOS+ЃF;F >OFIFEzt|IFOPEz Ɗ-GmFFh"!pBBF9F FC Kh<,@ @85(S /19//I//W//w/)///////////////// /#/9Ui///KIh#r#40nKhj}KIhbyKhn([vHO2wK!hp0C@ p0KnKh GlKhCjHOrlK!h<8dHO2hK!ht._HO2dK!hj$ZH"`K!haHUHOr\K!hVJPKh NHOrUK!hGPHHOrQK!hK!hp0Cu*HOr8K!h\%HO23K!hp0Cp0KHF0.eerO RFQFHF]F?? F^h+ZRFHFLEF F,IJF ~& T׮׺Hݳ݇ -<@/xx+h+HOrK!h{d4W#@/! F#CKOaJ.FF ih F m& M5Z[-O'- FF:F! %LKPBڡI l:F! ()Fr0љHX 60іI'vFO5FJIF0FCяJh @ @+@~<;+@(IC84(ƁgP8#5:T[E_dPhCC`"^x ( ZI hCc8;C8;xhCPKh8oHNGJ x"  DI8 RR; ?I"x ( 7I< 7hCshCSh0I fC@`-Kh@; hZC~hCzhCv8;C"xF ( IqOsBIhCThCPhCCLA@bMR`"P^^^_"`m^~_ _%_B_`& _~_4"lxF( I&"vxB* {IKyIhyJCcyH`# hsIhuJC tH`# hboJ x* ?q iIO iZ#fI#^dI2+aK nN(?i\I YKMP(WJFQ` ;F[ @08`( {*(+ KIhHCIH.2s<+D>2BKhBPoCEFFOs"p``~"z`hZ@K@ hFF[-@ӀBր +ҀI1" 0 / . - ,+*)('&%$#!+FFHBh єHTtB H8;#"Oqz0фHb8;#"Oqf0{HP8;#"OqT0qH<8;#"Oq@0hH*hՃ"x+"y+"z+d+{+"+"+;!'xy;#z;(#;+%RK(RID0,"!(1JI|k10?!GH@+FI 23Bؿ#U@\T2@"h @F5DDC0KBDU6=+&22B@ph_p^rAـK)!rH`aQRS !" "(IK0k K% "!(I h<# "!K|(1IXa*"xa[aga"4"^+`aa"af "KN(ڲI˻d &.chIMFH4;FAOq0(򹀧KAOq%"I N:K*F" "(1#['[[[KU4Q#U%U1F Nq<;B󌀐I K@0<2: @:!:pˁM}I @TVz @9!:I`"2BUڵPkI`M @_Ki[haI`9@Հ0HHI2"YI O\0BUIjiRja*?3QI1F r5f80IK xp(!p H ȿ`8@HHI 4# AF( {*F, jh+}@F)I##p+t CLh+`@FHHV?6C-A~8@@"a"b$Q%"" ""P"b]b:"bxb}XI t;JxO  Eh  bIFFHd2"B`+?®hW  #0+@𙁡2B`2;ddBKʌ#C  d2h?𪀚@񎀠hhOzr# FSCH Kp @@  Ճ ݅؁CD #IBgh2E陣i' 0?lo∰H zF0F' B 0QK   :(@ b/% sEH h h3SsEbF”Fk  d0O E B #(∰H z;FF0F32Z +5(+U; M"HC;|/M'K ;+; 32Hb 0 v K'; C  H;"b""xbc&b"PIFH0#! K 0B  Eo ∰H zF0FJ JDzHD O0E'8FHF   ;+_Va]]<GR#2F9F F(?/ax)7  "$&(*,.024gH fHfHfHfH1F F#0'`H`H`H`H`H`H`H`H`H`H`H`H#2F9F F(?\H#2F9F F(?ޭax) THl FQHQHQHQHQH^#2F9F F(?∡KHN#2F9F F(?EHB#2F9F Ft(?@H#2F9F Fi(?ax)9Hw9Hj9Hh#2F9F FV(?!y4Hg#2F9F FJ(?u0H#2F9F F?(?j+H#2F9F F4(?_'Hc"x"4c[cccccdd5dIdadzddddddee'eLeZeekeyeeeffflf8fNffffc#2F9F F(?|HU#2F9F F(?wHJ#2F9F F(?sH?#2F9F F(?!xnHvhʮ1F F0+]+?+w'N∰H zF0FZHN5+њ  ,/ :* DNH2D ܩ oO   ; 3 FF;   BF F/A0I+E1JF@FL@*H :%HJFAF0@ ' HD Lܪo + H X/HO0 ffgggGg&"Pg.g=g<gB-OFFIxF-+4 F8(=ѨK$"`OO FF:F1F(FC9ѢKhBw'>3FS}](FRFV)X/DDd(Y SIF ($I F(цK"@Z`d+ '*!$DtDOvKh DdDD4D$D$O O XF/(FYF(F%)F FcI .ўJF(QphUKhb "!RHSbWI2F SUN[h "!+OHSSRI2FMHSM-7OI+F2F SmMJMINHS#JJ#IIJHS!F! ! ! ! ! ! >08I8I2F!O020h+1H`+L!hF -K?F(FS*I"FF @  & !O00h+H .H)F FTH0F6#4k~btB jJ$(-OFMFHKM(FHwhK(F+`;x-+04RaF88F0RYF! V+8LFFO D+?V;pD>V?D;+Ѥ NF$3`+~r+UR+i+D t+x+  ؑءV Obn=FQFЋS#+d0BF;F< Fki+ 2IL*sj:FIGHFHy j?IBHAH#":H? kicj1I6H5K"2H#k.H!Wj)I/Hp > j#I*Hd%H#"OH+H [kL a MObV F FS Ik($)LDshx*:B FJF F/Ik($)ԀLDk@K$33sh N8Fsl+@9F0l"FRCF@4h7+0h FHO4$h3+@0+xg+AH0+= I Jh( F Hx$4p$4 $4$3 Y +_H,@[Kh+Xh|FXH  RRRR R RR  /FC+Fd#b F- @"p$@I0FW>LO =I0FMO :I0FEO 7IF=O 4IF5O 1IF-&xh+?TWx+?S +?OiQh)?J2a  h0$=,?~(F1FHx80 F#)FC(3C<0C5 ")F FO[B H,F $3V $4     ` <-GFh F퀹OOL)F:F0FA ѵKhBv RIF D(DРb++R#U_o}wKh 6#$6#(6#,6#064#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rHr4&r<&Z0mJmKnH) FF`U#PgI(FRh(ZeK #D#xhaI(1^MOjO W(@F #+p#kpWHSMP&khCM`>FOH8HnP(=h1!oF(f.@9CF@+?HR "+x++ .F0F37HrF(Ft !8Bak,Jhkxh320Z<#XCKX`P&BD#m 6۲20 Ѹ:8(3x$p$@~ (&p~<[$@& -CFF$IFFL"F9F0FJB/ѡKMh68.I,iLI F I F AML*F9F0F(C 2BF}I}H}IBF{Ht(p@(A83(S ('y'y('y'y'y'y'y'y'y'y'y'y'y'y'y'y'y'y('y'y'y'y'y'y'y'y'y'y'y('y(('y) ))'y'y))!)-)1)7)=)M'y)[)gz(cci+_Osci+X#ca7ci+Q#ci+K#ci+E#ci+?#ci+9 ##c`#a#a#ci+(@####`#`##bKhr`ci+Osci+ ##i+ KIh a(߮#cb~$Em*N& X7]:ܮ-!#j+?֮chh+Ю&i.̮W)P h)Fb(ۮqI*F #i+chh+&i-5-gI0F6(dI0F.pcI0F*(@-S4-(-=-?S%*+'+'''+MI0F(cj+?L - -~W)_'3е AMBNn(cAF@H"c-ei#"jihZi##"jih(NHhW)W)A" 0(H2??#H.&OBF H F JHٲ2 C #B"F`j(?ѭ i)F Fz(1F Ft(AFHm*]d~-OMRNF\ F'2F)F FCMKhB<(=4OU/@F MR(f(O#4'*Oa[6 9I* N/e a*(@ `(>pCO@гO5 `jF!(> d ZFOa0Ff40F/Klh+H1F  F0!F*PF `jF!( `jF!F( H aOw*~$E -CtML%&I QOghKH8X<8KDX@8ZK`XdXhXpXtXXXXXXXXXHhLhPhThXh\hxxxBFD8O3l8cHC #8FF:FB? QI*FF NyL H ~K<}HFX|IQ(@nK"T(XPvIF(@fK"XT(pHbK x_K_J,]Lh8C<x%gHhXeH(cId aKAxLJ^K8(BlHEM&`h$ dh@K$RM&FL*F$CF@9M#F"xIJ!|h #<,y( F#C   P(c (@4hQ0IF"F9/I FQKTP+I FQ K"h(H'I FQ0 K"T(X(<"H!F:7!I F6(@K"h(:$^$m@ Ќ8#888187Z8H%8v88889~9 %8]8P8|4D+R#14+14+4+4+4#4+4+4+4+44+14+4+4+4+4+4+2Q4+4+4+4+4+2{4+24+34+3I4+34+4+4+4+4+4+4+4+4+4+114+2#/I2=2G4+2q4+4+4+4+222233C3334+3K"(HZK"X(T(K",K"hK` x+?KIh hK,B,,2,~K",|K"H({ zKFh uK,:`|x`kqK"L(fqOObrH9hZo\? H*FFH 8F"FF8FO 8F"FF8FO 8F"FF8FO z8F"FF8F rHJFH jHxJFH bHp"FFH ZHh"FLFH Q(FPR Q!F !FL  !F !F I +@Ā+W2FFdK88+D FO'F(?V]M<; j(x h UK JOb FoNL? \P)FFcH #8GK<+>6^IOb Fo!  :!h,ȱh MH!LI KI { ~FH!F(CI mBI i@!h0FF F5FKFOb'F F FL[h P|Px 0 ,8P+ ,*OK",+-:F)F0F 8$m@>x$: ::$$$$:&Ъ:,7>$:6$:BI$I:9$z4u:R,8+AF= ,,8+Л-GFhFpL"`h4pgI1F(F#3p2+"l!߀\I @- (:VI $9(/(-08 v(%3331F:F(FbAIKh/V#PFJ+xh320*(F(@I" [qh@F=OO O )F9HOr=? 5K5J !4 3"1I /I -I +I (F (I .p0&I!%Hn%Hb$K(F4,!H4KMi i IFI4+FMi(??%-АM{L~XM+M%1MR6JJMXDPM`MqM l"!.(wM wI,ť 1#c1KhBg:Kh(^ 6KhV8I(F(6I(F(/K"`n(+b(9(%0(%.J08`c +R#=9=A=)=)=)=)=)=)=)=I=)#;`8hmJmK( FF- 3hx-*+*[xK0 nV{AF=8F(8FWWHaxCTHaRKaRHzaOKa!j!!NHF-ci (@ V = vF?Kh;?Kh#iC=H=M R  +h+8K9Ih蘻(5H! (h & ( F?? *Kh#c*Kh+!(HS @ 'chF(N3h+a(5`Kh+c%4yIyT%pyDIyY*y`yiyx%5,%qy%p?Hvy%q%wy%q%qt-OFvLF'hsI Pg`BF1F(FC*nKbih:CV# 5!!(h(=U(@!*aK!h" _H(]I ,u(`(G(DI(FE(;4VIFFVH: a+R#Ag@@@AmAA@A@@A@A@@@AA@@AhC`h#s7K/Jh+Fc`#`t##aqO 0!F(IHF\IFPF!|V#K 'h!uOhCsKJh+Fc`##H"FB(?:H5#a2# H"F2(?*H!\@!YBid% ~%UX& جUUV-OFF I N(ڟI T5F,ĕ0FZK %F@F O/H"!F@ #0% *K`" %)K`m$$ &Kh)À 9:9l2!K" `6@%x0%X%(% %P%|%(8%T%X,`wl:B%t%,Z&ѲQ%%$%x%%0%%Ѧ& %|(?r %8`,G1H % +H %C (-X!(FOF(?P&O #XD#A#p3B #*F!F #O3$3CF?-  %(F9F$ (F$ F%| +ѯ H %tP&O\T&OX6  $;,Y-OF˰hLF&FF O3`RFAF8FFhяKWE!ݹN"HFF<HڈIJF ~p-a-b=-   " 4z-->A|IoC"{H## h" 3sKqIO3oBqH## h"  hKh`6OF[5 8FH pC_&##&^J#aX)Fa 0YVI(F0"0P##bNF(iNI.л0ѹ-JIJFIIFGI 2FOqF( " "IF0F2(9IOf N(5I*3I 9F 2  ! (1F8F$  &I&J3FF(?t#I(!II@)Fd`!FX*2X* I&_~[& bQ1@thG~<Rq<(;I lO0>rIF8F+O  BF(h+ >W+IBFvh+ >L&I) #DBr#DFGF0+OqB #BHh+5EFV >! HFNx, F8FZBІBFFF 8 -O(-OFF3}  0LhI FvHH 3}I Fh(IHHO(r! $X dK! FVKhO3y3v3U3L0 F?!FD0 ?! :0d OE?@#FFFX1F8FKTJZFCL{(F0BYC3YArZA0 [vabD# FFDCF(@X@0BgK gJ+!3VYC3Y0B@$^MV(&M( 6(~?(s4(O h$N8(S R#PUQPUPUPUQQQf('j8(?v(?sS QRPUPUQ%PUPUQPUPUPUPUPUPUQ4KhVMZNC1Kh4ZD(L%E=$9X%CcX%e0##*#X?%H%O |$x$F;F !Dv(1X?EH#[4n84z & ~]CUm(ѓH0B)F D# FV!D:F(F;F !D E тH\3 4'0I#Y ?M0xIxHA APh+@փ )FDS^N~N{ DfNu Ad ?gKhBNhX^@@ۃUD",0@كWIZHA1X1(Q,QYCB(!X#NJYB?zMH0EIKHAgA ( (C?IFHC3#CCSCCY?^b XF\( $YF`7HA;$3K4JF2J +!2[F0JX D,K$! j)K*I"A|A.0I#H,KXFTCF+AAFHA!FF(lh+.HA9n8@;0=^v}iz}J V@Lb~ :X21݀CX3 C 0rIFV#?VY1 30rV#?EY3!rF?:0IYYԛHAP 2F9F?J(.ݗHA*X2RCX" !K@0яIHK@?|HFA(XF?|Al(oIHIH "K@F0h+xIHA-YH[<, h+wHA*h+?ޭh +?حX#3"SX2kHOq0 ~h+eJ\IeHAeH@0 lh+_JSI]HA T^FXH MIYHAXHAWH A ?0<1Z_RI" A0OHLCFMH81 Cc81,1"EK,@0N.IAHAH ,1":K,@0#I6HA0I3H> A0XCX.H怘@xdF+HA!X C@XTFFI%HFYGԘJF V0AFV#>0:IH G9@ J$2BW}0 X1&N2V IV"TJJHLKKL FA0эIH! F? SOqF0чHA y"K@0IHAa*YY\CsYb Ah(4tIyHbR#APFbS"A3ahBh X*okIL  A ?YfHxj+HFbS"#j)[hhFh A AYY ?hh.>NZԟF2 TR՘PԋEIL  A ?)F FCx1>Nh-?+j;3F"!@mh 032F9FHF?3jK0F?0FA0(Ovhx!h:՛j 2Rh*?!K@2k`h F`Ahh,Nh!B`zj9 [&o U/ PD,HAX@C@APZNsHiNmX?|  Q/0@-0 ph P ^0o@0 , 0 010F@xFp/10!O-bM M b [ !b1 0 0 30`bݍ Ѝ"]\ P\ Et   $e Hp;` 00Ġ80G( Gˠ x<9p x8_S0 @G `0 0 00⫪ 0媪J པP x8`@##[*ᲔP 0` l840G 9V ` 0` l840G8C`|<_|_x??0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/^,^^@-M @!**)Ѝh  \/X-M 0 p 0 S 0*0 Ѝ$/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*//7*/>*/ 4T*///*/@-@9@*/*/*/*/xGxxG6LxGxGxG竘xGyxGxGHxG˔xG1xG.xG xGRxGxGkxG)xGDxGQxG砻xG笔xG xGsxGxGxGxG;xG.xG&xG@SxG程xG=xGxGpxGxG?xGxG1xGRxG0pxG(xG*xGxG xGxG' >ExG.&xG'xGSxGxG)xGdxGLxG^xG磙xGExG3ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.maximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesspaceuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorssectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u1601803203606407201200123214402880usage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mls/bin/shSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. passwordmachineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberraectbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noatimenodevnodevmtimenosuidnoautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE11.0_STABLEevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv7hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hfeb/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.centropy-file/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc /netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICmodulesbasedtbgamesgpufwmanmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdmraidframe/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%cr%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1181: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %sv6v7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2efsnilfsminixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error%d%d%dWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646tolowertoupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d Кpxtm wA~}}ςυAψ=ϋAϑ ϔ`ϘYϜϟaϧMϦMϪYϰ϶ϼ 1YuEб]M au ډ-ڏڣ9ڻFLQq(V\ %[ %djs"|$}Ѓ&Ǧ+Ќ-eF8!А8!Г# @@y  ~ U@@ׄ ׊ E" ) ג 5ט @@м }מ @@פ unblock and -DNO_CONV?`|``fXfL`4`d_100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %s%s%d%d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): ???CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendormalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiB.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLinkl x EZ'<Vl#v v_^F<>?PATH= tؤf|dsؤcmlr pnv b    EOF reading here (<<) document#E#Q#Y#]#a#f#k#o#s#w#|#!############### # #&#+#0#3#9#@9 *<}-+?=e& @ϰ&&& &&&,&2&9&C@&&abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'!f 0(!ed1(!eP1(!e8(!e0(C5!e0(!e0(!e0(m!e0()%[n {YB L7uQ)f3X)h 2I)j )l  eߚ)n%X)p$)t)x !/6'                  *<*<,=***$&L(6s*>**>a*Q*>] `$Y**~***+Z**>Y*-a+}+%HA+ p+p}++ ,7+$ Ϙ1+,+2M)(J>]+:KI+@+G+M 74q+Vo.H.P .V.Z.^|.c+.h.n.r .x. . . .2.<.B:x/j/q/v/~}q--///!//O/YO/*/yK5/'//}///O00000#030#030203131 #2112 1 @1&@1*231200202022Q 0@000N002{2 /C$/C0C$0C0 0*00$0-11040<0F10N@0V@0^ 0f 10p20x@2.0 2>////////2 1P@@@@@ @@@ @%@,@4@; @9@?@H@P@W\biqw} À@ʀ@ρԁށā      # - 3ف 9 @ H O V  ^\m}%C_r}`{!O!S!XN-!`!e!k!q!w!~ !!  ! !z! eOn l v      {  I OE          !! !!! !/!;!K  %-5;?FZPY`ir{{!O!S!XN-!`!e!k!q!w!~ !!  ! !z! eOn l v      {  I OE          !! !!! !/!;!K{!O!S!XN-!`!e!k!q!w!~ !!  ! !z! eOn l v      {  I OE          !! !!! !/!;!K0E+-4:EtEEEEEFF; F F F F GG-GDFGYGxGGGGHH)HAH] Hy!H#H$H&H1H2H3H4H5H6H8H9H9H:H;I<I=I7@IFAIZBICIDIEIFJGJHJJJ*LJGMJXNJ_OJoPJQJRJSJTJUJVJWK\K aK(cK2dKmeKfKgKhKiKpKqHsHtHuKvHwKxKL LLDLcLpLLLLLMM#M;MXMpMMMMMNN"N2NNNhNnNNNNNN NNNOO!O4O?HHHHOIOaOsOQOOOOOOPP<P<P<PUPtQPPPPPQQ.QJQRQQQQQR$ROHHRRRRR/RHRS HS.SQSdSwSSS[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]T46@6F6J46R6Z6`6j6t6~666666666:6666666,7777777(787D7Treturning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblockLLLL        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readpG@r0csf]@@w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-r0zzzzzzz{"{,{\{f6e |k@6R:~~~~ !/xXlL`tl6R6Z6`6j6t6~666666666:6666666,7777777(787D7T>@]f-     6Lk~4P l!>#>$|&>1>23>4>56>899:;< ="@1AEBCDEFGHJL2MCNJOZPjQ|RSTUVW\acdXezfghipq>s>t>uv>wx/N[p&C[u 9SYrrr6(4>>>>>Vh333Lk2NV(S>>>>>at u@U @I(@>,@*=0 <+:@@ `LHFS0eC4UFS0eC6!haHdInotNeedEFI*s(ҺK>;Qn|n֏- q+Qn|n֏- q+Qn|n֏- q+Qn|n֏- q+$Qn|n֏- q+27T=Gry=iG}6BM;t?NZWmCĄ 3KOOfryD¢<#*=(~РD3h& \M}-ޔM@jy֬-ıܹчH6-ܹчH7 IZܹчH4&I􍂱ܹчH6F:I􍪱ܹчHTFI2ܹчH6ZbLǠ6 %?ant'S@ۿ )Ѹ1*@ە )Ѹ781ۏx )ѸuǕX@p`backupstore_gptstore_tbl\ͻd@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapssetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus6printallmaindo_setifpreferencedo_setifcapsiz sfiy***> **60*X2<UU%0;GS _kw@ 0@  @init_current_mediasetmediamodesetmediaoptsetmediasetmediainstGp 6  `@ pmedia_statusmedia_constructorD`|PPpaddr_matchYYocYYsettunnel' print_link_addressessetvlansetvlanifN:tN  setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan@CFIsethidessidsetapbridgesetiffragsetifrtso0nvuv *JH|Ly *p@hEU Аinvalid major numberinvalid minor numbertoo many fields for formatffs@YY Y!Y*Y6Y>YF|YMYUY`@YfYqYxYYY YY VYYYYYZ ZZ- Z3@Z?ZPZ^Zu@ZZW,ZZZZZZZW,ZZZZZL4]*]  l@$+ bnorripbgensbextattbnojolietbnocasetransbrrcaseinsL4]*]  & @ϰl+2@]@8>L4]*]  H Q& @ϰl+8]@2]f@j.HL4]*]  @L4]*]  & @ϰl@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorL4]*]  2l@*.c, @  %@ @ bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacbnowccmsgrecvrpcrpc_getportrpc_callsendrecvlL4]*]  @8>@xȰCZpɣQdʅʬKˀ˧%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@aBrC؁F؍IئLذNؽOmSab ce*f ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataz~<[T\ =& %2 %0" %t.8%I%Zb%҄ҏ%TҮҽ%1Ќ% % % %z%4% % %&4%\/%39J%VZ%4dZ%0u:%T~K%SӌӔ%RӯӺ%SЌ%Q %o %n:%|K%{ &z!%|3Ќ&y? &K &collectl(hTЌ8"6R6Z6`6j6t6~666666666:6666666,7777777(787D7TNAME=6J6F6@Tmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds6R6Z6`6j6t6~666666666:6666666,7777777(787D7T edit_fs_type_ext , E Jm C 5 O * * 3 41L ]e u edit_and_check_label 6R6Z6`6j6t6~666666666:6666666,7777777(787D7Tdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz ^Q fU f h e h b ` g aI b `o `m qi e/ n d bQ ] a h kM m- ] ] n a1 a# ` c `disklabel_change_geom~ outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default &8&&t&Tpm_from_pepm_whole_diskgpt_freegpt_create_new0 9  u -    ]  m U qi   Y  ! u  ! I 46Z6F 667T 2!|r0zzz{"{\ 6R6Z$'*/446@6F7=6BGK6JT6Z],@`d7j7/t2gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eC4UFS0eC6!haHdInotNeedEFI*s(ҺK>;Qn|n֏- q+Qn|n֏- q+Qn|n֏- q+Qn|n֏- q+$Qn|n֏- q+27T=Gry=iG}6BM;t?NZWmCĄ 3KOOfryD¢<#*=(~РD3h& \M}-ޔM@jy֬-ıܹчH6-ܹчH7 IZܹчH4&I􍂱ܹчH6F:I􍪱ܹчHTFI2ܹчH6ZbLǠ6 %?ant'S@ۿ )Ѹ1*@ە )Ѹ781ۏx )Ѹ Nr6AF  mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new~  } Y M 5   5 +  ?    !  i qi +% .  Q 4} *5 %U        5 6Imbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************zcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2[dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionbctdefghi{jkl?mnopq/r*s19t0uAFtvLwxSzcyjApB}CDEFGHIJKLQMNOPQSTUVWXZ1(416:D|U~a}ljsVY`ņ| (&/-5B-HNV[k5tdefault_configread_configrt_compare_proto  rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt rt_buildrt_delete sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_inita,,3=FQYscript_buftoenv("/$make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DCHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp{цђѡѪdhcp_boundѶѿ}]ʡ dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa 'Q 'Q '] '] 'I 'IUVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B > > > > > ? ?) ?A ?Y ?q ? ?BBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~`LTL\ @pnlcs_pathXn bc_base_max  bc_dim_max  bc_scale_max  bc_string_max  coll_weights_max  expr_nest_max   line_max   re_dup_max   posix2_version    posix2_c_bind   posix2_c_dev   posix2_char_term  posix2_fort_dev  posix2_fort_run  posix2_localedef  posix2_sw_dev  posix2_upe  stream_max  tzname_max  atexit_max h| 8Ph !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%KC00`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'B@;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54<Ҳ؉9I#ը32D=%[όh(doC_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ<Ҳ؉9I#ը32D=%[ό (doCCAy7FnM8O?ZwH02uOs<0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzVQuޝ3r(Ѿ唵V dj٧IY:Jp,.*ap+ѿ#K`j ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx6|0pY9 1hXdOj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHO @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::pDǡǭ͉͹I[\@j mXm`Nml'`mt<m|mm m lpl|`lll ll l P l l l l l l l l l l l m m  m m m$ m, m0 m< mD mL mT <d x x à , hX $ k$ x X  x o } Lk( y   \ k, k0 \ ll 0k4 j k8 k< k@ kDkH <d xkL kP kTkX k\ ,k`,kd hkhhkl kpkt kxk| kk XkXk Xk X k k k k kk kk kk k Lw@ .k k   k k \k k k k l l l l  l l l l(l0 l8 l@lHlP lT 0lX 0l`0lh 0jmmmmmmmm m m m m nnn nnn n(n,n8n@nHnLnXn`mnhnpntnjkk k ~~~ ~$~(~0~4~8~<~0~@~D~H~D~P~0~X~\},98U        (8HDCGFL}}z\stng|x~t}8$nmbrDxdict  h\L xdkey| lpHdataPbool8@PPPParayH|H(DPht  (4 P\ t 4@X~|H08||` {{~|  (0|H8<|`HLTX|`l|tx|VdhlpV  (,4<@DLPX\d|lpxh (08@HPX`hpx $,8L\ht(D\t0DXl  4H\p$8Z4D|$$,(X|$,H]]^^X(0\$T|XXXM 0T$I   $ 8< HP X\ | |(0@HP`l`pxtx ,4!TX"lt#$q%&')*+,$-4@.LT/\d0lt1|237c$,DLhXpx#$q%&'p((0)L\`hlD\4HT\lx $, @H T\lt|,0LXhp $$``D`ۄCkkkkkkkL@(|  (08@HT\htxX8y<(@Tl,8DX|$<Ld\t8XlH`€¨ (D\Àäø(<P`tČİ 4PtŌŠŴ$8Ph|ƌƤƸTPP dz\ B$2P D$1kkky<hLqtfD&:&}&,&C@'+ElBX 7<'9 >E& & 6T&&0~Pd&@,<'.f;l';x<'*e&'<'9(l'~ bjEjcfhklmo o,p=pRp[qerluJttvMw|wx%xГzОzBC\JOPSTVVXZZ & 2; C дP`()ƹƹ ^(mei u 2& \ZP/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin!Y}-+?=###%%%}!_!_aEV e F IMi L $l *m 2C V>TV*VT*6*l@!0|TY>T6Vt tU t t l<|%||1t |XXl Tf4fTmml@\ NNt a| :lLl^x(|oo| ]t @ @| ppt * t * tv vlJlK#}#}$#5$E##}#}T""# #}$#}#}#$(#}X  '@@L4]*]  & @l@8...... ...... lost+foundAd.##.4pB,62 .<   % z  $T<= *Y6 !"#N$%&'()*+,-!/*141@2L3U4Z5^6%/Xqppppppppqqq. (prog_root)`$$$$$[ n%$$$$$$$$<9QF9}$9e9s 9r)$9|Q9r$9 9i*9$9x9ؘ9MG@9099199%9M%9|m%9%9%9&L9%$9Y%.9z%39rЌ9%89~%9x E9~9|%9a%>9$9r%C9Х9%H9%N9ψ9%T9 %[9mϠ9}%d9xϋ99}%9%j9P9rq%p9Ъ9%x9t!9x%}9t!%99%9%9u9%9%9%9%9%9R9м9}$9}^91!9s Ϙ9I.r9%9M9#V9%9x%9x%9%9]%9%9A%9 ϟ9%9%91/\9s %9}*9&9/9#N9.9{&9r&999rM&9&"9|+:9q +G9} `9&(9a49)t9}#^9gJ9a@$! $=K$= %TCOE DIFM<<EEE!e<E+5>E,UtE+pF,|F-"Q$F>%yCF`&+F`&cF.F%F%F)F)sF(i?F9%#F)i%%,KENF0PKc%aK$l/sK)hK4%, !"$'(+-.03569:NL%aL/%20~NdN%2hNdN%2dNdL%2`N/K)NN)x0aN%2NL/bin/shy@z||||||||||||}|} |}|}|})}4};|}B|}M|}V|}a}l}s}~}}}}}|}|}|}|}|}|}|}|}|}|~Z~~~~'~0~7~>~7~E~Q~\~g~l~u~z~~~~~~~~|%CL~|~}4~}l#}~N}r}~7~Q~g7?~u[Zr~~~~~',b4 z  * . ` d f o404?sz _###)#*######%%&&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&''' ' '('('L'L'N'N'S'U'W'W''''''+++P+P+U+U....////0000>0A00011/11111122 2G2PMN`|ף0RTfhk`oooop"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|  ( ( ) )oK_pp0J#%')-Y[  : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----0*0-00ooprt} %&,,&-GQ).1256CCLL||װ /vz       8 : ? ?   $ 'FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB4@4@4G4Ujjk0k6oOoOoooo-0Fgi{тхыѪѭBD6;luuڄڄڛڟڡگ!#$&*06DJ+ + + + + + +H+ ""+ +H+H+H e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it).. ($  (4"@>tKQ^"m;x 7   #28  (!&98BL&7fW)cm5ve:%6-4 +,-.* ?&Ec-/9/G'SF` y"  7f   WmkRkRkYcWbkCkc kG ky wb YMYrWca?%qNob>@%qB>%qc>%qDood>%q>A%qD>(e>%q3f>%qSkF>%qg>%ph>%qQji>%qj>J>!%q`&k>H>HK>%qX>cL>x%q\m>p%qn>h"%qo>`&O>X1p>PHP>HE<q>8%qEmr>0"%qs>(!%qD\S> !%q|yt>T>u>%qV>w="%qh)Zx=(}X=A%qty=%qz=%q$9"=AX~=!%qla?=9#==A%qp=%qP =%qT,N=%qLj=(=%q@ =%q<Y-@\=x%q8q=p%q4=h$%q0=`$%q,2H=X%q(h=P!%q$=H!%q =@!%q=8(aG=0!%qVj=(%q = %q= =%qA=%qbv=%p<<!%qx <%p!P<%py<%p+<%p<s#2D^Vblv 9 (-;MVfz>@,:MY^kx%r (press RETURN)wcwx?@?@?Ltags643{}abcdDgGhHilnNpPqrs tw xy !:#=%%-e^H-i^C-k^UKWV~ V4_% U Us Uy Ut(Udt}UDtQ T| TTv F S|1 FS${ R RR FRTvy FQ|9! FQ{a FQ4{ P# P] P F OLvq F OTNvim$ O$; NN 2$N4\z 2$N\ 2$M\ Md M$ M L LD\L[dKu FKk FK$g FJkva1uevvvy~uY %vu fKehQi]-_3^;`Cv v%rv1\v=4vIZvUZuZuZuZuZvZv ZzuZuZTuZ\uZduZmu%XzR=SzETUYz1eyzzP{[Q{-RzSzT{ UVyWxuquwyu<=>?u5Z&uIZ0u]wEw-w~5MuSwwww5wm{tTu\t\t\ttZ&tZ0t\]](]N!x=x%x wxxmxUaxjkx6@t4t t}xxcyyiyQy9y!yMx{gyy|}|m|]|}]}M}=}-}}}|tetmtutWut]}}}}kkstt&~'}(})}~)~i{}~S~I%~~~~~9~sfs5& sM]tse]|s}]s <s]s]s]^^^"ZP^&xo^,^/^3^=z^E^X^```,bc3eLeleffffgg gg#g&g)gh\iAjll1l>{lKljl}lllllm m5msmnOnnn3(no ooooFpݜpp%p=pMpYpppq>qkqqqqrs]tt1tSuGvx!yz|||}T}~<K`%-p *6m\@V$5y85R0uAe *@I^pz*<Vr+ik~- /C_}\0AScnCM%W{anrw} !5BGVk[ $9FRfml9e ".7Ls$Rv!UCq ]$NmBS6Z ,f"CWkC+:./NHpbp 3AIN_j3] &:{ch{$$ښ7z$0\طpLVq~ 6Abv ججAb -{ g ?"0;d <4rMo<'<O\dns}P4BNT\gnu~ÈÙé ,>EO{`jĐĢWĶ#/:CP_sʼnŎœťŸ Ŏ{`&;HPd|ƍƕƠƸ .IXiwǂǏǛǠǭǼ-JRw˯`̭̾'1BX͓1Ibtquy~ނވދޏ2RޓT/ҝ)u7  T"(.2":BH0MSY ^d10l&x's(|)*+.1/ftp@8"2@c  Xy6> Y# Z? Y7@ XQ WAp V5Bu V5Cz V5D Z: WE  V5F 7 V5G  V5H  V5I U Z U  U  z9 } }{ r1u r1e u r"0>MZhu] y\ ] \  ( ,         C "%/ Nx 2 #Q 5 8 E H R U ehlptx| !"#$%&' ( ) +* 4+ >, D- K- X. _. / /L0L1 j2 n3 t4 y5ؠ6 ~7 8 9 : ; < = > ? @ [ \ \ ] %^ 0^ B_ M_ V` c{ n{ | } } ~  -dd-ddTdd:dd:dd x x@x@x`xxxoooo#o#o#o#o#o$o$p$p$p $p%p%p$%s%p0%p8&p@&pL&pT'p`'pl'pt(p(p(p)p)p)p*p*p*p+p+p+p,q,q,q,q-q(-q4-q8-q@.qL.qX.q`/ql/qx/q6q;q;q0q0q0q1q1q<q<q=r=r >r>r$?r,2r42r@2rH3rT3r`3rh9rt7r8r:r4r4r4r5r5r r !r "s #s  $s %s$ &s0 's< (sH )sT *s` .sl +sx ,s -s /s 0s 1s 2s 3s 4s 5s 6s 7t 8t  9t :t$ ;t0 <t< =tH >tT ?t`@ tl@!tx@"t@#t@$t@%t@&t@'t@)t@*t@+t`&t`'u@,u@-u @.u0@/u@@0uL`(u\@1uh@2ux@3u`)u@4u@5u@6u@7u@8u@9u@:v`*v@;v$@<v4@=vD@>vT@?vd` vt`!v`+v`,v`"v`#v`-v`$v`.v`/w`%wCw$Cw0Dw8DwDEwLEwXFw`Fwlcwtcwdwdweoew#w#w&w&w0wwwwwwwxx xxx$x,x4x<xDxLxTx`xlxxxxxooxxxxxxynn n n@n@nnnnno o  o o@o$@o8@o<@oL@oT@o``oh`otoxoooo o@o  ~33333333<Xh3333 }(UTC33  % & "M " &M " % "k33'<339gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA8 33UU33UU33UUtpt Xt@&( |xxx (x   @ 333333333333333333333333333333333333 33 33` c\c\ 0000000000000000 '0(3333`333333 (root)`33 $ۄCkkkkkkkL@(8lnpr(t8lhxdHService unavailableA4aeabi*7-A A   "D687x-oARZ>J4T`0_! CH$ D4Ap%?D]kuVr<ޯt]:xPX um#%3Oj͞cy߭{uo{}G|dԓ1{|dfyՉ=QO3{~q>y/L62g#6Koz+l2_'u2?"NDeAܿQQ>u.-K9e-{ﭶ=j~GcYWZC׶[1ݟ""/~EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+o.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BhHiiP  V  $bDDgHHt(y]]'<]p]5]@_MSGTXTS628 5040 5065 5082 5104 5107 5112 5120 5127 5135 5143 5146 5149 5152 5156 5168 5177 5190 5219 5234 5781 5815 6498 6786 7494 7550 7624 7720 7895 7918 7941 7947 7956 7978 7982 7986 7989 7992 8097 8300 8539 8980 9418 9453 9468 9480 9486 9498 9547 9567 9607 9624 9641 9656 9703 9741 9789 9871 9995 10131 10172 10210 10247 10282 10292 10341 10491 10497 10502 10506 10526 10636 10656 10662 10676 10688 10699 10736 10770 10794 10896 10933 10955 11054 11109 11167 11178 11194 11246 11414 11621 11792 11856 11908 12183 12736 13268 13703 14041 14374 14487 14502 14511 14671 14842 14992 15156 15179 15203 15218 15293 15433 15610 15765 15777 15857 15958 16004 16030 16100 16111 16120 16133 16159 16174 16190 16203 16258 16269 16284 16488 16721 16750 16765 16834 16908 16981 17011 17049 17103 17522 17548 17577 17681 17787 17972 18084 18199 18303 18990 19249 19389 19425 19595 19636 19772 19795 19832 19877 20128 20224 20278 20377 20388 20425 20462 20489 20498 20532 20539 20564 20591 20626 20640 20654 20683 20697 20714 20723 20745 20763 20780 20791 20810 20836 20854 20877 20894 20909 20924 20942 20969 20996 21018 21057 21075 21107 21335 21409 21452 21498 21645 21801 21845 22124 22151 22510 22694 22846 23027 23174 23332 23353 23401 23411 23419 23430 23441 23451 23458 23473 23485 23526 23556 23595 23648 23706 23727 23734 23753 23774 23781 23807 23829 23849 23871 23902 23939 23961 23975 24021 24050 24084 24124 24159 24187 24235 24244 24253 24258 24267 24276 24293 24297 24302 24308 24312 24350 24359 24386 24406 24429 24448 24475 24497 24529 24545 24550 24560 24583 24605 24622 24639 24652 24661 24670 24676 24703 24710 24734 24755 24779 24792 24811 24836 24859 24875 24881 24893 24923 24931 24971 24982 24993 25004 25021 25038 25052 25069 25285 25589 26037 26253 26517 26789 26841 26877 26913 26964 26981 27019 27033 27040 27057 27060 27065 27074 27086 27097 27106 27127 27169 27207 27223 27254 27279 27314 27370 27410 27431 27451 27492 27521 27569 27802 27837 28044 28063 28100 28161 28199 28238 28394 28409 28455 28503 28526 28562 28572 28582 28593 28598 28661 28709 28753 28814 28847 28948 28966 29105 29127 29250 29264 29274 29297 29402 29458 29574 29605 29610 29636 29675 29685 29728 29738 29754 29769 29787 29810 29840 29861 29887 30084 30127 30131 30137 30143 30148 30159 30173 30202 30234 30246 30293 30343 30383 30410 30426 30435 30478 30484 30492 30496 30516 30533 30545 30576 30832 30881 31457 31484 31516 31544 31596 31602 31608 31613 31634 31650 31672 31701 31842 31976 31989 32125 32127 32129 32131 32148 32161 32179 32206 32210 32216 32221 32229 32235 32275 32277 32287 32302 32319 32353 32385 32423 32452 32481 32503 32546 32572 32616 32752 32826 32828 32908 32954 33002 33107 33209 33248 33315 33322 33383 33447 33451 33458 33580 33649 33937 34075 34216 34297 34344 34350 34373 34419 34422 34448 34491 34556 34618 34688 34756 34849 35068 35093 35097 35133 35151 35179 35221 35265 35329 35379 35455 35477 35529 35573 35612 35646 35676 35707 35732 35741 35753 35761 35772 35784 35803 35827 35876 35893 35917 35960 36282 36285 36299 36312 36324 36331 36342 36349 36356 36365 36375 36392 36408 36458 36466 36474 36484 36495 36513 36530 36551 36573 36582 36592 36619 36625 36635 36654 36670 36688 36708 36717 36728 36735 36752 36771 36792 36802 36819 36825 36841 36856 36871 36892 36914 36933 36943 36948 36953 36971 36990 37009 37015 37034 37054 37074 37092 37097 37103 37120 37136 37157 37170 37178 37198 37222 37239 37247 37258 37279 37285 37297 37319 37333 37342 37363 37381 37390 37424 37447 37474 37506 37529 37549 37560 37592 37608 37619 37632 37655 37677 38185 38215 38246 38274 38288 38489 38711 38878 38965 38982 39000 39017 39046 39093 39104 39123 39145 39224 39416 39444 39562 39584 39725 39744 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_STABLE. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_STABLE ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_STABLE ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_STABLE ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_STABLE ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_STABLE InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_STABLE ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden?Die Festplatte ist grer als der GPT angibt, soll das korrigiert werden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS628 5040 5078 5095 5110 5113 5116 5121 5129 5137 5145 5148 5151 5160 5172 5184 5193 5202 5228 5239 5778 5805 6371 6671 7312 7359 7472 7565 7599 7618 7636 7644 7653 7678 7682 7686 7689 7692 7814 7999 8227 8747 9098 9127 9140 9153 9158 9178 9197 9218 9277 9294 9308 9330 9375 9401 9442 9520 9638 9752 9806 9835 9867 9906 9912 9945 10068 10075 10079 10087 10111 10193 10199 10206 10218 10232 10241 10274 10293 10305 10415 10477 10496 10615 10666 10718 10730 10749 10801 11005 11213 11404 11464 11513 11783 12245 12914 13340 13662 14087 14219 14251 14263 14441 14638 14799 14933 14953 14986 15000 15069 15182 15354 15489 15509 15621 15713 15736 15759 15818 15833 15854 15869 15890 15910 15935 15949 15973 15985 16003 16213 16463 16484 16500 16553 16621 16694 16731 16757 16833 17290 17316 17338 17445 17552 17753 17826 17910 18010 18505 18743 18894 18928 19063 19107 19246 19287 19332 19379 19623 19756 19818 19912 19917 19951 19985 20000 20028 20061 20068 20093 20111 20137 20144 20159 20174 20194 20234 20251 20271 20292 20314 20329 20349 20371 20386 20399 20413 20425 20437 20451 20474 20497 20515 20558 20609 20646 20831 20894 20930 20979 21070 21200 21253 21513 21560 21921 22071 22240 22380 22500 22632 22672 22719 22729 22737 22747 22755 22766 22777 22791 22816 22861 22894 22927 22962 23016 23041 23060 23082 23087 23093 23126 23143 23170 23188 23209 23231 23250 23260 23290 23316 23343 23392 23420 23447 23500 23510 23520 23526 23536 23545 23565 23569 23574 23580 23584 23619 23628 23659 23676 23703 23724 23744 23763 23789 23802 23810 23826 23857 23888 23909 23935 23948 23956 23967 23973 23997 24007 24019 24037 24048 24068 24084 24110 24132 24148 24160 24180 24206 24212 24242 24256 24270 24293 24312 24331 24349 24367 24590 24896 25314 25515 25755 25939 26017 26072 26139 26179 26202 26236 26247 26255 26278 26281 26284 26290 26301 26313 26326 26356 26400 26413 26426 26463 26477 26488 26499 26510 26527 26538 26585 26608 26657 26898 26931 27186 27207 27240 27293 27319 27346 27502 27508 27551 27571 27590 27619 27626 27633 27640 27645 27694 27732 27766 27823 27851 27896 27913 28014 28019 28096 28110 28120 28144 28267 28348 28458 28486 28491 28507 28536 28544 28585 28592 28606 28619 28627 28646 28679 28699 28719 28935 28966 28971 28978 28985 28989 29003 29015 29030 29063 29076 29131 29189 29225 29243 29261 29279 29316 29322 29330 29334 29355 29372 29383 29405 29583 29627 30329 30353 30387 30406 30451 30458 30465 30469 30493 30504 30509 30572 30693 30816 30829 30963 30965 30967 30969 30979 30988 31001 31028 31032 31038 31043 31052 31057 31084 31086 31099 31111 31126 31154 31198 31245 31261 31283 31294 31327 31347 31396 31496 31550 31552 31617 31666 31715 31819 31917 31958 32049 32056 32117 32181 32186 32192 32301 32360 32611 32752 32879 32947 32984 32991 33018 33064 33067 33088 33133 33184 33243 33312 33359 33464 33607 33632 33636 33670 33687 33711 33763 33814 33886 33952 34050 34067 34098 34134 34168 34192 34216 34249 34269 34279 34287 34295 34305 34316 34330 34356 34404 34427 34447 34488 34787 34790 34804 34816 34823 34842 34856 34863 34870 34879 34889 34906 34922 34970 34978 34986 34996 35007 35025 35042 35061 35081 35088 35105 35122 35129 35142 35177 35194 35213 35233 35243 35259 35272 35290 35310 35331 35341 35361 35381 35394 35413 35426 35450 35473 35486 35497 35502 35509 35527 35546 35565 35573 35592 35612 35637 35655 35662 35669 35682 35691 35712 35725 35733 35753 35781 35798 35804 35815 35846 35854 35867 35889 35911 35920 35941 35959 35966 35989 36008 36035 36053 36073 36086 36101 36122 36136 36143 36157 36172 36191 36736 36769 36797 36826 36834 36871 37183 37360 37437 37454 37472 37487 37509 37559 37569 37586 37608 37667 37825 37849 37979 38004 38130 38148 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_STABLE. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_STABLE ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_STABLE ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_STABLE completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_STABLE. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_STABLESalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_STABLEEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS628 5040 5076 5093 5108 5112 5116 5121 5132 5138 5144 5147 5150 5153 5157 5169 5181 5191 5221 5233 5666 5693 6269 6629 7314 7375 7453 7548 7588 7610 7628 7634 7643 7669 7673 7677 7680 7683 7805 7990 8218 8747 9165 9194 9207 9220 9227 9247 9266 9289 9332 9352 9371 9394 9438 9467 9508 9574 9686 9800 9854 9883 9915 9954 9960 9993 10071 10077 10081 10086 10127 10264 10274 10282 10301 10315 10324 10356 10397 10410 10535 10593 10612 10731 10787 10839 10850 10866 10905 11155 11327 11499 11554 11589 11842 12249 12551 12822 13183 13363 13682 13702 13715 13904 14048 14244 14378 14398 14431 14450 14551 14706 14894 15081 15101 15180 15278 15316 15339 15429 15450 15473 15492 15516 15546 15590 15623 15646 15658 15676 15944 16263 16294 16329 16393 16468 16538 16569 16599 16691 17182 17212 17229 17369 17510 17707 17826 17973 18140 18698 18994 19175 19220 19383 19437 19572 19608 19668 19718 20009 20118 20175 20272 20277 20312 20347 20362 20386 20419 20424 20449 20465 20488 20495 20512 20527 20546 20578 20582 20602 20620 20632 20645 20663 20687 20705 20724 20751 20778 20790 20811 20841 20871 20896 20929 20964 21002 21255 21324 21379 21440 21558 21717 21771 22032 22083 22459 22614 22758 22898 23006 23191 23221 23264 23274 23282 23292 23304 23325 23334 23340 23372 23416 23452 23490 23527 23575 23599 23611 23625 23633 23641 23672 23689 23718 23739 23762 23771 23790 23802 23846 23884 23911 23955 23983 24010 24063 24074 24085 24092 24102 24111 24145 24149 24154 24160 24164 24199 24209 24239 24262 24291 24313 24335 24357 24384 24396 24408 24427 24461 24494 24515 24539 24552 24564 24577 24583 24609 24619 24630 24654 24664 24684 24704 24721 24747 24771 24784 24804 24838 24845 24874 24897 24920 24936 24951 24966 24981 24995 25183 25488 25919 26110 26345 26533 26575 26625 26679 26727 26749 26790 26801 26809 26833 26837 26841 26850 26861 26872 26887 26918 26964 26977 26990 27020 27034 27046 27058 27070 27088 27111 27156 27179 27239 27491 27518 27780 27798 27825 27874 27904 27935 28067 28074 28123 28146 28170 28199 28207 28217 28225 28230 28283 28332 28372 28438 28471 28515 28538 28639 28644 28721 28735 28745 28769 28892 28973 29083 29111 29116 29132 29161 29169 29210 29218 29232 29245 29253 29272 29305 29325 29345 29561 29592 29612 29618 29625 29629 29644 29663 29689 29698 29710 29764 29822 29857 29876 29893 29905 29940 29946 29954 29958 29979 29996 30007 30032 30210 30264 30955 30974 31009 31039 31085 31091 31098 31102 31126 31142 31148 31223 31373 31492 31505 31573 31575 31577 31579 31589 31602 31619 31646 31650 31656 31661 31670 31675 31702 31704 31717 31729 31744 31772 31816 31863 31879 31901 31912 31945 31965 32014 32114 32168 32170 32246 32301 32351 32450 32545 32593 32683 32690 32751 32815 32820 32826 32929 32981 33227 33388 33543 33614 33667 33674 33701 33751 33754 33775 33821 33876 33935 34004 34051 34156 34299 34324 34328 34362 34379 34417 34470 34510 34586 34651 34745 34766 34804 34844 34880 34904 34927 34966 34996 35003 35012 35020 35028 35042 35058 35086 35138 35155 35176 35220 35562 35566 35581 35592 35600 35619 35631 35638 35645 35654 35664 35681 35697 35751 35759 35767 35777 35788 35806 35823 35839 35857 35864 35882 35899 35906 35916 35947 35966 35985 36005 36015 36034 36047 36067 36087 36108 36118 36137 36156 36166 36183 36197 36220 36244 36257 36267 36272 36276 36294 36313 36332 36337 36356 36376 36401 36416 36420 36427 36437 36446 36467 36481 36489 36509 36535 36552 36560 36571 36602 36607 36620 36642 36657 36666 36687 36705 36714 36758 36782 36809 36824 36841 36855 36886 36910 36941 36948 36962 36977 36996 37541 37574 37602 37631 37639 37676 37988 38165 38242 38259 38277 38292 38314 38364 38374 38391 38413 38472 38630 38654 38784 38809 38935 38953 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_STABLE. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_STABLE est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_STABLE est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_STABLE Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_STABLEExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction MSGTXTS628 5040 5081 5097 5115 5119 5123 5133 5142 5148 5154 5157 5160 5169 5179 5192 5200 5211 5236 5248 5760 5792 6284 6573 7118 7164 7268 7354 7390 7405 7423 7431 7439 7466 7470 7474 7477 7480 7591 7776 8004 8480 8814 8843 8858 8873 8881 8895 8913 8934 8985 9001 9011 9031 9077 9107 9160 9217 9328 9449 9493 9526 9565 9599 9606 9639 9716 9722 9729 9736 9765 9877 9883 9894 9911 9928 9937 9966 9978 9988 10089 10151 10171 10291 10328 10384 10398 10419 10456 10666 10841 10990 11025 11077 11297 11614 12141 12506 12796 13189 13324 13337 13348 13494 13673 13804 13938 13958 13991 14010 14093 14208 14349 14474 14488 14596 14689 14718 14738 14814 14831 14849 14865 14884 14904 14921 14933 14959 14971 14989 15190 15429 15456 15473 15529 15591 15651 15682 15706 15765 16111 16141 16158 16266 16376 16516 16590 16666 16744 17236 17456 17567 17598 17725 17761 17889 17916 17956 18002 18218 18342 18410 18510 18515 18551 18587 18601 18624 18657 18661 18686 18705 18731 18736 18751 18766 18785 18810 18822 18844 18861 18874 18886 18904 18928 18943 18960 18973 18984 18995 19015 19044 19073 19097 19132 19167 19194 19381 19430 19462 19510 19607 19740 19786 19978 20008 20330 20459 20599 20739 20856 20991 21035 21078 21086 21096 21108 21120 21128 21139 21166 21200 21239 21270 21305 21341 21388 21408 21425 21443 21448 21455 21484 21500 21521 21538 21555 21573 21590 21603 21634 21659 21690 21721 21756 21783 21836 21846 21856 21862 21871 21879 21894 21898 21903 21909 21913 21948 21958 21987 22003 22029 22046 22065 22086 22102 22115 22120 22128 22143 22169 22188 22216 22234 22245 22251 22257 22278 22288 22299 22317 22339 22356 22369 22390 22410 22430 22441 22454 22476 22483 22508 22523 22543 22555 22572 22589 22609 22628 22805 23089 23399 23579 23790 23978 24044 24091 24146 24190 24210 24239 24251 24257 24273 24277 24281 24289 24299 24311 24326 24345 24381 24392 24403 24442 24454 24464 24474 24484 24500 24518 24567 24588 24633 24877 24903 25157 25172 25198 25255 25289 25324 25466 25483 25532 25553 25569 25598 25603 25608 25614 25619 25658 25693 25723 25778 25811 25857 25871 25950 25955 26009 26023 26033 26057 26143 26191 26297 26331 26338 26353 26380 26389 26428 26435 26457 26476 26492 26510 26542 26561 26578 26735 26766 26773 26782 26790 26797 26811 26829 26848 26858 26870 26911 26956 26985 27006 27029 27048 27086 27092 27100 27104 27125 27142 27151 27170 27316 27358 27868 27876 27900 27918 27962 27967 27972 27976 28007 28020 28029 28075 28201 28292 28304 28368 28370 28372 28374 28384 28398 28413 28440 28444 28450 28455 28464 28469 28496 28498 28513 28524 28539 28567 28611 28658 28674 28696 28707 28740 28760 28809 28909 28963 28965 29033 29073 29118 29193 29259 29294 29375 29382 29443 29507 29514 29520 29619 29675 29951 30075 30186 30248 30286 30294 30316 30365 30368 30389 30434 30489 30548 30617 30664 30769 30912 30937 30941 30975 30991 31016 31064 31100 31161 31215 31296 31318 31357 31394 31426 31450 31477 31503 31517 31525 31535 31543 31557 31570 31582 31606 31647 31673 31690 31719 32043 32046 32060 32072 32078 32094 32106 32113 32120 32129 32139 32156 32172 32215 32223 32231 32241 32252 32270 32287 32300 32326 32333 32341 32358 32366 32383 32407 32426 32445 32464 32474 32485 32499 32517 32537 32557 32566 32589 32609 32620 32635 32647 32666 32685 32696 32706 32711 32717 32735 32754 32773 32780 32799 32819 32844 32861 32867 32875 32885 32897 32918 32934 32942 32962 32982 33004 33012 33023 33046 33053 33067 33089 33106 33115 33136 33154 33163 33194 33210 33237 33256 33276 33294 33315 33329 33349 33356 33375 33390 33409 33954 33987 34015 34044 34052 34089 34401 34578 34655 34672 34690 34705 34727 34777 34787 34804 34826 34885 35043 35067 35197 35222 35348 35366 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_STABLE. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_STABLE zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_STABLE zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_STABLE zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_STABLE zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_STABLEWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_STABLEUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log run spool ... ... ... . .. lock . ..