08Pj<  Pj}t tPj@@<@T 08Pj<  Pj}t tPj@@<@TU Pjthh`APjPjPj$h PjPjPjAPjPjPj&A.PjPjPjAPjPjPj'APjPjPjAPjPjPj'APjPjPjXAPjPjPjYAPjPjPjZmD]!PjPjPj (08@HPX`hpx$›PjPjPj N$dPjPjPj(08@HPX`hpK$PjPjPjxsM$PjPjPjFAPjPjPj\CPjPjPj]APjPjPj^APjPjPjd!PjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj!PjPjPj4!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj B!PjPjPj B!PjPjPj!PjPjPj"!PjPjPj"!PjPjPj"aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj?\!PjPjPj>\!PjPjPj=\!PjPjPj<\!PjPjPj;\!PjPjPj:\!PjPjPj9\!PjPjPj8\!PjPjPj?\!PjPjPj>\!PjPjPj=\!PjPjPj<\!PjPjPj;\!PjPjPj:\!PjPjPj9\!PjPjPj8\!PjPjPj:\!PjPjPj7\!PjPjPj6\!PjPjPj5\!PjPjPj4\!PjPjPj3\!PjPjPj2\!PjPjPj1\!PjPjPj0\!PjPjPj7\!PjPjPj6\!PjPjPj5\!PjPjPj4\!PjPjPj3\!PjPjPj2\!PjPjPj1\!PjPjPj0\!PjPjPj2\!PjPjPj/\!PjPjPj.\!PjPjPj-\!PjPjPj,\!PjPjPj+\!PjPjPj*\!PjPjPj)\!PjPjPj(\!PjPjPj/\!PjPjPj.\!PjPjPj-\!PjPjPj,\!PjPjPj+\!PjPjPj*\!PjPjPj)\!PjPjPj(\!PjPjPj*\!PjPjPj'\!PjPjPj&\!PjPjPj%\!PjPjPj$\!PjPjPj#\!PjPjPj"\!PjPjPj!\!PjPjPj \!PjPjPj'\!PjPjPj&\!PjPjPj%\!PjPjPj$\!PjPjPj#\!PjPjPj"\!PjPjPj!\!PjPjPj \!PjPjPj"\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj \!PjPjPj\!PjPjPj \!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj\!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj !PjPjPj!PjPjPj !PjPjPj!PjPjPj!PjPjPj$!PjPjPj4!PjPjPj!PjPjPj!PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj !PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPj!PjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPj!PjPjPjaPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPj?\aPjPjPj>\aPjPjPj=\aPjPjPj<\aPjPjPj;\aPjPjPj:\aPjPjPj9\aPjPjPj8\aPjPjPj?\aPjPjPj>\aPjPjPj=\aPjPjPj<\aPjPjPj;\aPjPjPj:\aPjPjPj9\aPjPjPj8\aPjPjPj:\aPjPjPj7\aPjPjPj6\aPjPjPj5\aPjPjPj4\aPjPjPj3\aPjPjPj2\aPjPjPj1\aPjPjPj0\aPjPjPj7\aPjPjPj6\aPjPjPj5\aPjPjPj4\aPjPjPj3\aPjPjPj2\aPjPjPj1\aPjPjPj0\aPjPjPj2\aPjPjPj/\aPjPjPj.\aPjPjPj-\aPjPjPj,\aPjPjPj+\aPjPjPj*\aPjPjPj)\aPjPjPj(\aPjPjPj/\aPjPjPj.\aPjPjPj-\aPjPjPj,\aPjPjPj+\aPjPjPj*\aPjPjPj)\aPjPjPj(\aPjPjPj*\aPjPjPj'\aPjPjPj&\aPjPjPj%\aPjPjPj$\aPjPjPj#\aPjPjPj"\aPjPjPj!\aPjPjPj \aPjPjPj'\aPjPjPj&\aPjPjPj%\aPjPjPj$\aPjPjPj#\aPjPjPj"\aPjPjPj!\aPjPjPj \aPjPjPj"\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj \aPjPjPj\aPjPjPj \aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\aPjPjPj\ !PjPjPji!PjPjPj!PjPjPj!PjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPj!PjPjPj B!PjPjPj B!PjPjPj!PjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPjaPjPjPj!PjPjPj!PjPjPjaPjPjPj aPjPjPjaPjPjPj aPjPjPjaPjPjPjaPjPjPjPjPjPjbpf!PjPjPj $PjPjPj $PjPjPj$>PjPjPj#$PjPjPj($sPjPjPj*$PjPjPj0APjPjPj2m PjPjPj8@/$PjPjPjH3 $PjPjPjPAPjPjPj_APjPjPj`APjPjPjaAPjPjPjbAPjPjPjcAPjPjPjeAPjPjPjfAPjPjPjgAPjPjPjhAPjPjPji p+S4҉|"[t'!\SsBLF^;.BTh!wTZ%c4mwZsw l=7>i(Q1\~ 1j5jJ #8?^.~VD@7yew kEn3sGzT0Pȃ 0}s/?]= ABrbB,iFlmzZRU; ,l!# ZƧ%Y %qd\?/^c5"$0[.,Cرa =W,`65?qB_aQ %?Sz*ez +,(~jww&(,ĽM^(G u6f5^x6dI p_DGWFݶ+u }HSFNƨ=q(?N]o#h@ ^{N]*HI.WU&co r4Yxat . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4 [!4 ($x $x  $$$LL $$NetBSDAPaX NetBSDearmv5hf3D0D 0p@-$,0C-`!A圁圑M!pW0 |! R0B=00 B  T=0L 8 R<B 8!4100!0Ѝ4PP "=CP 0p00S  0 P0P      0 3/R ! 7000@080L"D0@&&&#=@&Iv $0p@-|@PtP00 R 0p800 p0  B0Sqs D&&@&0 0 0 /&@& @-7"ˌ@- @-."ˌ@-80@-M0@@(3/P $ #"H08 : S( 0h 3/ 0P  0 0Ѝ000  1/qpT0S 00ˌm8@@-@7PЍ@N zPЍp@-(`Vp80@ 0 3/PP!8003/(Ppg@-@P`P c80 (0(3/@T PVTPЍp0&3 PO-MP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A8 000+ xpt| N  ЍO0 P % Hpp 81/qp4 a!  ?P p 4 J!T0S4 tp0 0 0 0 "N0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0h004 8pX  FЍ0&Op@&ˌR/ R 0 0/\\CC B 0R00!/0"SSS S S S S SSS SS SS SSAQ0A/C-MhB0 0  T+0 0 8 #  ?$ Ÿ ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!d!!4! P ` !4N4 " BXX P!d44M4 " B   !d44M4 # B  d44M4 /0M8p<0@! zM` @d44M4 Ѝ&lMb&XRۮU@-@R10G-A `00P4 82#&PP0 (1/qp $ 봀嬐pUЍ0S0C080$0( 3/P 0 `V`PED0  Z $ &ˌ&$@-MTA P04 00#!8 0 (1/qp$ P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p p0h( 3/pLp #U0* 0P`/RP `@&ˌmTS@-P   $q    ЍH&"O-IMHxM0@S`. 8S+ #= ( 00S( 0 00" ! !x00# #|0 & %IލЍt'H 0 V0 `S 0F0XWS07  S  S $0S1 ,7000000S 70 060 00 6RcL 0Rr0C0C00Q0 0S. ,B< 6l|P0 X$  ( ( ,PU0 0$0 0,0(0000 0S $Y# 6&姥(0S%0 %00   05 K,0S 0% %Av[ʔ5d%`VN / V 7* M 0  8K8 04p$(K M  0 K`,00 0 00,00 (0$ @DG@4 0@ `$ M840$0z'(0吃# M 0吵c#`p4`00S2 ,0S#!$`V % 1!040S \ /\ * WM 0 OK 0 JM %1! i `0$`[؂O &0#u0$!(!0j0% !0`,00 0 00,0@0 (0$ Dq,0S 0p804< $`W쑟PP[  09000#30UPZ0V40? / V Ё'* L 0  <J< 08p$(J L 0  J0040008 40 P L880$0y'(0吃# L 5"p8`0 0 0@0 0D8&H&1 9h ${S>']I\& J)K7URl Zs~@-p`PP@`D LP Ѝ`3MU@p@-XP8@T`@D p LP<opQ<PpH&A-AP 0$ P0 0 SQ ( $0ħP qOh d`P, 0R1@a@qU`0``00aPTOi 00CS000    0,`0CS0000 (00Z/U R %O:8 4D 0$00 0$ 蠝&T%q&*&T0 S 0SP/P/S/@-g蠝&dp@-XAXT0040S+@! PP P0P`04 PV R@40 0PSU40 ^*00"  0PE`PP 0P4  S U 4P0C SR40P 0P = p蠟&&$ &&p@-@8P0 00@0@00000p$& &G- PP0 xN0 ,(p 0 R`GvJ@0(S  㩦PVNk (.)?$00 0(0 <0V0? 0":NO8 4@Ђ`ƟT%*&q 0p@-?0 @0P@P@H 0P 00S/S`?s8P+pppp@ \P(D8<\p&(&ZJ&؝&ˌp@-@(P xP 8@M\ 0T_P9p8PP(P 88P 0"p蠝&`%@-P4@(P O8P 8080렝&HH @-yP(0 00<0   R&(%&@@-<P[00`F`0"P/  K P) 0100CS0G'(P; 0堑0 S,ڐ  S  PyC 00CS00  0堑0CS00  <>0Pz&lT%*A-`AqW ڬQ1ECe R00  C0|004PP'C< 00CS00 t 0q0CSQ00 \R `R `&T%*O-0D0!10Pp Ѝ0S/  $SPPPPPB\ X`T:00CS00  ]0Q0CS001ԃࣟ! P 0 S)"Rʜc0U```00P 0b0CS00 n=1 Q !@o!S/ %S !`V U 00 0qP 0帱0CS000!000\Q00`PR# !RU``0``00BPc 0a0CS00jl0` 1 1S 0S11a0Sڐ  S`l  P6 0a0CS00=?10`! S:`Fp00  1S p<a0S ʼ1`0 BRpE`  S`l  P 0a0CS00   &T%*ؠ&E( Q 0@30/@-E&`01S @-@0!S @>P /(/P /&^o7@-A00 S1 RUVʐ0\00}PBpA 00CS00- 000 @ R, R uP Ѝ00!S HP f0 Sڰ 0R0CS0000 0 Q  tP   &؆%T%*?A-O0 R ,Sp WX ! GYQ_YR\}}}}}}}}}}}}}}}}}}}}}}}}}}}}|}}}}}}}k}mn}}}}}}}4ss}}}}my}}}}}}}}}i}Ljjklm`nXoohpplqTr}rs,t4uxymyL{}{PP00 nR pR lR 00 S  PP1S 'PPPP0 nR pR lR 00 S1S /PP0PPPP0 nR pR lR 00 S1S  P0 S00P0PP!R "R  R$ 000@ `PP 0 nR* pR# lR$ 00 S{Py PPP~0S!S -60S 1SkT ^P0PPpP`T +0100 +0X R000@ <PL 0!SP 8P00 nR pR lR 00 S(0S 5 ^d.PPQUH  P G@ooG`GoobPVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 SH)0S << P0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PP~PP0 nR pR lR 00 Sw1Sw P zP0PP  P P` 0 nR pR lR 00 SR[P0PP;P P0nQ pQ lQ 00 S 3 PP=; 0  P/p PP*0S\ `Vl0ViV PPPVPU$p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S0|40S402P0PP0S 0 l0C0S030 S~1S 2SqW P000@ 0S0 0h`PPw 0 nR- pR& lR' 00 S[1S[!0R!S X 40S1S 0c `PPP 0S0L 1JP0PPPr`0 gRG  R7 0 B R= `唭@p?=0"S; b#pR1 rR1 U0 R 0 S( 0U0b0 * `P'00CS00 P00 S2S 02P00PP2P02 P P 60b200CS00ULWP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"؆%& $$';&T%dWlt,Y&ؠ&-o&$y;`^!2R000#2 0# 020 2 2020P0PPCPYp PPT0S) `V0V PpPӒʈ0 nR pR lR 00 S,1S,02P0PP0SPӄʈ0 nR pR lR 00 S P0PP QR000P0P00@h `P 00 00 P0 nR, pR% lR& 00 S!0R!S  20S1Sm bWW 0 P0S0P0PP1S 2SqXP0S 0 l0C0S030 Sp P0010CS 0nQ( pQ! lQ" 00 S3 00SE;` T`@p;0"S8Y`r 0  PP00 nR pR lR 00 SK0S TPP0SPPH0 nR pR lR 00 S,P `2S1HP0PP P   -@-0 0 ЍЍ/'&-0^S0]S0]S S]S[S .0L0S^30   Q  ]Q RoG-`ጁP@0 SS&tPD(!,RF`a`qU`0``00EP,8;M( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a 5P0  0@S  0Gcꘟ&&&T%*& (&!p@-0 P< P@01SE0p0S S u`Pp@0P 00S0PP00 ZP l0X 000Q;P0:0 ,5(ꘟ&Y&$&&'T%*O-|b|B0 %Q + \r\P00 SM Y< U 000}"P$o: 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00.P 0A0CS0000 P \S0P 0 S 0t00S|hhP 000S Sq 0`00 Pkꘟ&H&&&T%*&&(%A-0P0 0p@ W 0 `BP! 0 R00R000 1BQ9@X @宩@p90"S,$@gR000ꘟ&H&yO-ScpгM@00 0GS TcsT`0``00P9` \X00C0+0&SK BR D R: Y J @p RgPY9n 00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?ˆr L\ DR-WpBp@| \   P 8D @<h00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq0  bH&&&T%*O-M0@ 0P 0k (40S  0 0 000 (0 7pP `CԳP0 S pSP(0Y01ڜ Y   $ w$Pi8~` \X  BR +@30 #   BR 200S 00  "30 0(PP0 ߍ000Y\ Y   $ '$P  BR 200S 0 z 2 P004 Q' 0 p1pG Y<Z  L1 P78 4n0H00CS0tX 0 00"2 00(0 oP< 00CS000\^W 004 00 vT00S 0  2< ~2Xb`(&H&&T%*&8lO-㴡A0QM0Cp` 01 00C S00`NlЍr 0 P5 3P!` 00000`P00CS000  [  E0S00CS0x00` P  P&$&&&YH&&O-M R B000bsp 0soЍؑ؁0S1  0 0 0P@ 0##੟ɐ Y Fp10S 0000000p0CS0C01; & \" \  00#0L\ 0C000@00000000 0C LN + &$$&S\&&&&&A- `P 0 0Cs 0x 0t0 l  C A^  00@pT }A@ 0\&$&$ &G-p@P0 `R0  PM(S%H0  d x.P C0 ,( \&T%*@- 0 Uc%O-GMdM0PS@p$Q403/P $0: S500W +., P9:5?05P0: S 0SP0: S 0S 0S 0/S& P3P0S2P( QP x#0L PN++0P 4#]P;]׼P ᵤ/mC/PgCPpp2P! 0S0S r$XG X00CS0kFpp Pph pYWr TTk\H Z0Sh0S0?o25c 00l?G YU.0.0 !0G=0JwPT.0.0 0G=0INeP804@pŽl0l 0 0  L00S   寽ˌ%w&&ԣ&$0\ 0S 坽 ᚽ&wˌ0L0S/0 0 0/0@-M0S    4 ;$pthqЍ\0\@ X0R@P0 B ?) 0Ѝ@\꘣&&&",<& &P `00CS`0p S00 P0S X0X /XL(%: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\@T10S H10S. 00 00,10'`p* @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?b) 0ǼT00S ꜣ&N&&",&&&&&F&ԣ&s@- @P@P `PU00S @GT CЍp0t  Q \0 \@-T (P@$UU&&p@-P@Tp0 0C0  $A @G-@0Mポ(3$30S` V0Ѝ0 0C0{ 0XPS !$;0S 20Sm 4 "; $pRt ❽0(  pH20S 04 $  20S   0 : SK( "0 08"$410S10S51!0 0H 10S|10S : S0: S t`x81p 01Rp(1 B?N( 0峻'Q p| , p埻P^, 00S &У&&&nN&",&w&~&&&&&&&F&ԣ&1O-@0S$0010S 10S,0001!0 q0P0S ЍOPa0HQC0P  0]0`S)p%QPPU% Ѝ  B 1`0    0S[  L0  $R,   V ꜣ&&&&&$$&410G-S$0@010S 10S,0000 0 0P?0`VG`렠pPUG m0 0C0 W dp0$S,  `YpP T`ꜣ&&&&&$0G-P@0T$@0@S 00S,000@0`0娀S㨐@pVG -0 0C0 W ,$p0 00 S p0$S,  Fp` ꜣ&&&&$@- M @ p ЍT  P \0 /P 00 0S@SQ0   0%0p@-P0S``&@P (PX EA⡶@P8= %Pp&ˌC-CM@& 萟P`+ +`T *F0 NpPPCߍw ? @P+w0S ?@P?lP@0%@- H% 000/$&@-0 7%@- Mo0P!A00P00!0 0Eᮚ  p多 Ѝ "$ D0P @000 l0l! k pX   DH"$  (0$&q ˌso'FO-@Te-MQP UPn 3+0Sr  VpaP 0S ZP F ᬹt00CS01p0pЍ0S  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx:P PCP1pPX ~) 44 Rl( p< 0! u0 X 00CS0p YX 0 P 0S  xȸP P X0: S LP@P P  X0: SᆰPX ူpPἙᎰb0S ㌲  g P=  Pr 3 R (咙᪱P ዙ0 ¯S , !00  A (! 0  A {{zٸpe700@0 hP DSp leP "*0S FX0;X0XYP ;TP *0-S .PVApPx0S  HOpY@$&,{%(%"8mˌ0s@-@ `P៰PW 0P Uᇰ幯巯ЍpU }z\@嫯婯0 ZP4if@4$C-R0A-~MAM0pS P0` 0`P)p! p~,ZP s)@!1P~܍Ѝ0 0`ͰP`) ~,=PPW) ~,4P `0 0寰PB)x W Q `104 0ᗰP*)0( b1$ma,00CS0 .0 /O-`UDMp E0%00000 0000SHHV"4`0p Q 30Sa4PZ|BPZ(0d$1Ϯ000 0K<$ᱮP( $00V 0030p Q  #ᔮP0 0(#00V0030l#}P(`#00L3000DЍp(0: S ]0 S" ٯP 000 S|2"00"0 0R0  Rz2`2Vn `i S0% 00 0qpC(0S 唠00 0p) W W)2`V%  ? " 10 R0  S0R 0!CQ:++R:0'WW`a~0@ 0 "T04[@T ;0W ` W00l W0~, ~l0`Z BP* BP*Q*S  Q T0`$H&&@$$|P'h&Y$s$m8@&& $}D00S/@-~M0@0S~, ჭP~܍H&$@-0p@$0l00S Ѝ00 00Q ', /P$H&L0@- R<U/P 0 0 I/H&dQ'&CA-p`P@ 60PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@Tڬ` 0Q@Pڄ0  Q @;;S p@P00T@ '(0, D/( .$H&&@-,BPU` Vb0P$00 p?W0 pGWhPh&0 SV.00P ЍP#ڀ;;S 00 0 0Q P?PpH1p0$ppQ mQ (% 00$0SP ( .&0S00&0ES00&0S &0ES $0Sn.&0S &0S }&0SPU t&(0, .$H&Q'{E"t!0SX@-M`Q0S T100CSD:.Ѝ0S0SS/ 0070S S00.S@0S0T0pS0p LgQo 0 p T0\Q0P0 0{P000S$ʲ/H&$@$ mG-PP`0  ,p@P"ڴAQ"*Q 0Q P 0Q%D  .ЍP 0S$H&@ @-PtaMP d1@0S2 SU@D;00U0p0p 0Q%!-Ѝ P0S(0S 0Q%  Pڌ0U 0?   dW-0 P 0ҬPe% 00 -$H&p    &m O-Mr,M R(`RX0E@FP}0 0S ጒ000 S (0S d  T"ֲpL20 08"0JɲJ? "00²To" ?᧳܍,ЍT 0S =! !媲!0`夲 㻪10Sx1pp1 008!0J≲J?08!00,q00$1(`(0 C0娀Js m00 $0 Y 0x  Z0  ` Qw gT@$%H&Q'&7 B Y dQ'Hq &{ & &$ C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S Q1  0S ȫpP (0: S0 0噫 p10S10S P6CP K0 0 0S q4Z 1 W00 0S00p0000 S(00(000 P@0S 000S x0J!P 0+P0p0 0X厲$&H&4Q'Q'0Q'P 0(03/ t#P 0AS0 @0a3/P|4C003P H4 C(P(40S  ĦP T 0 0  ⹦P 0R S = $ `0Sd003p0St00PP p@S`3`0Sd00/SXP, A S0 0  xP0SW 0S = $ `0Sd002p0St000S "SD p 0 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P |1 Hb X RP$PP ,1P 0 P E @ ;/0S0S P0S 000[\000*4S 0S 0Q'P'D$JQ' &DQ'&Q'$&Q'Q'& &&%&Q'Q'4Q' PpAP4( 2 ۤ 040p%H(P'0@-PM@ 7Ph00S Ѝ0 $ R\ 04 0R\ Q'Y0@-MP @PЍ000S0: S|PBPU H 0ޞP 0 0Q'O0P@z=0 Csz Jލ Ѝ  К Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40Pz ›P#כP 0`0 + C`\ \0Q0O0S0(4 008 00dQ'x!Q'xQ'|Q'T$P$<Q'e /O-Mp@ W 0DQ 0S8 00<000SPP0C080pG0S `0S : 8 00 x! x3  P< @0  0R X2@ ?@G Q*@0 :0嘰 R P` hЍTT t !  ` `@R'R'R' R'Rs@-Ѝp@ 0@`P Q< 0$ yP 0 8P'0@-@MPPᡙ00<00S =  J"Ѝ08Q'G-`QM MJP Y@ #p aP p 00PP=! SR J(Oݍ ЍȚPJ]8 = $ HL0RP J(L00 0 QJA8 PT"7XG- QP #000aq@T+00CS0pT0 0S0T@ 0 S@ 0   JP 0S@ 00S 0 S P $P$$P$|#0$P$P$D$D$x20S X00 00!P 0 000! " BPPP  0!$5$!0 0!0 㓝z I XB (4 : S>  S8  S%  S04 0L! 08!  J 1P6 S  S0  S04=! 0400S -Ё ;ЂЃ"040+0 4vP0P 00  0  O'TសS+<  i4Q'T":m@-=XM"@p:(s0 XЍ7@-@Pp ;P Q Ѝ00   DG Ѝ0@>G0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-@@+0CQP0"S : Q%R0W^$B0CBSB 3b 30,@pQ0^AC S*p P@-*0S ^*00 S R( \000C R@30 ? SR@*:@ 00 C@ T \A C@T2  0a0C R"  p@-0C@0 PR"S :$B QN%R02W" 0C@Q `@ 0PpANQ0 C S*80P @-  //Q'A-@4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<=2 @ 9`3@ <2 3X2 @ .83" *2 @@ %2 @ 2 L 2LP 20Aⴁ娑00 RK aR eB Q PAAAAAAAAAAAA !00000 00K1]PJd1 J T1 I 0 I Hꈁ 0010 L01Pd HdQ'x!tQ'Q'hP'($y%@$Q' G 0.Q't$y%hQ'$$ y@#吘L#匘n@'0  0 G 5가z0P  ,G#,1 F  1@ P00F K5P|`1*PE1 E 1 D s1 1C1WPC1PB 2 B 02 A @2 A P2 p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C 0 0S3# C*SS8C0U Pg000Sv|30Ueڌ3PEPhPN0000S3 Y0P  /hP'l0P/`0p@-0T L@LPP@0@6P6 თBhP'Q'%dQ'x!A-` @PA?\+ \ *\.  Q R( [\SPQU  !\@@]^.!Lo \0S8 /0S 0R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ Q'p@-@@0/SN00N P`RpPQP`Q*C0CT0@"03L00Q*pQc|! 1@-M MP AaqR P/yP 0P0Sۍ Ѝ.S@T|`l @ @RdQ'!!!" ^o$" F"e"u""O-cM M33 "p3@3]PW00 `00S 0f00 0⃰P` 00 `;RSVz 0 0@;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0  0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S 0S s 0l 0 x@T *0S0T00  R S ( 0  Q' "#%#"C-`PMM RP  p\SP RT P0S #  0S=\S R. gS PS$ SS GS (ޓ(0 0=pS sS0S00 R @@@(PP~P ᲓW@P p bP ; 80 ᙓ ۍЍ$### Q'=#n#A-PP 0Sp`p(@PL P`40 pR `@ @ @## Q'X0A-TPT`Tp@0T  SU 0@ Q'T%$`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0 04ܮP 0S/  00p0S/  `00 @0/S000 0D$ / Q'Q'Q'(Q'F$c$A-0j40@TPp 00S0o`0 00/S @Tx0T0o P0 SD fP04 Q'Q'Q'2A-@0PS' 0`.S0.S0S/S \@WP 0 Q CR S.R  S.R0S/S { 10S410S 4P:4 CSR ! Q`V 0/S0S.00 p= 00C0V0@0E `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0T T0A0 B!"00؆%A-@QpW : J(S20d 000CS1000=P   0 R ⨁0≎ᩑC  S.@ 3 b 30  J(LPu[[0P001  =ЄЂp 0(ZP0<x SP0@ LP00 0 CPP t00 08P` #PJ>PP P >Q'+,;,Z,w,,,,P'// Qp@-(0PS$ l` @P|t 0000\0 `%V0 $ @pv!,Q',M-O-P`P Ѝ#>:J084YqW V#/0p00K0CSt3l IPk 0<00D3  a  d 㒝 (|qp  }? $00040J0H1P tq@0 B<(1P lc<0 㓍 H K06S 0S 3 CRUꈀD,gSy K CRZ 040r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $R (4 @ 04&"**0000 02S($0 *4($0)40($84  R  KS 0 040r;;000 0KS8  0( $ R' R'w--Q'r--|-O-z4MS@- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA | 0CS@P hDP0P 000@aT8@po,\'A-ppP000`G6@R60 0M60000CS@000SA8S'4S'p@-P`@T PV 0@p@@-PG-Q=0@T: 0S RW@0 Y =P P0 S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R0'o  -R0(h )d%b#`0 ]؆%S'S'0S'R'00 @-R'"10s@-P0`0nZ0`0S@ P 0R@P@   $P@0S00S 0ST P000 R  ЍpR'$_'0$B1S1@-L ^ԡ,ThDt8\T @@~, \U P1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP !w111O-`pu딠 %RP@@W &R X(4! 0[00 @ P@P@ ЍR'10@-4M!@p T` 0 P@4Ѝ0@P SWP@V P@ 0 F2P@( P@ :XR'jp@-@P0)SpR'O-@D4M`pTV TY T( T) #T! @$TU "T 0#S@P  +4Ѝ'0DSYG x@W'0I S@ 0 0S@P'Y00!p0pF W! sz!P l0 @@! `0 @PWWM'T@@p4 @P@ R'111jO-M8Pp`4! @00 R@0DS U# 0 \ 00S^^ :U 00SY` p PU@ 0DS ЍR'tC-`p 0BS00@SP! @00P TP@@ ЍR'G-`d0SP@! p000 PP@R'@-M@`P2PL]0P  IR NRpp NPpEp@@0SP@ $z2ЍR'1PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P03.3Sp0@)2PH0@P 0,aS@3",$$$Z'$_'Œ@P/-0 /RRR00S'@-@PMލ0/S\ }wp xwp 0RP 0RPOp@-`\1@P 1D0p@22 0"SP VpS'2p@-T` RpH0@Q 8 PP 1pp@S'$2O-pHWR 0S)P |B000000000CS020S 3@T  Ux U`WLbLf1~82@000/Sp?EpPI0S0/p0CS0oppW00D2000pA0P00 f|00,1 hU` U00CS0810S 00CS0 0W00 pR0S/S0@D00 2@ P  R*0000t/S0S }P 0/0CS0 pG0S 00CS0001@1@1@S'8S'4S'22Z',$$$^oOA-p`@000uP 00CS000S q00CS0Pd00S b%@ HW 406 R0S 0Q8S'4S'!20$S'T2G-BMP8)r0@T%+V@P' 0.S00.S000/SSJX20Pp  `PF } ePZ( `V+'@PP "\` YA0 E`k0E}J@}0-S0SH1@T@@UPT0uPwX0S Tp! 0P0: S W p/PXyP PW .0S| *p/PsЍ0$K2,\'|N2,2S'[2g22@-$0Q @ (0@ ? `0d00@T !1PhoP0 `0~@Td0 0,o 0hP@plPT 001Pl 00$0`0S$'`0 S 0D0>60S >0S$0S 00D0$ 01C 0d>0S$0S h@HnpT@ xP H0N7S 7S7 >0S800SD -00000,(00 0p(0P =&0S67S300S 0 0S+00000P= 8  bk = , flp@ P <P ,`,PQk<0 M<8 V  ,( z%P000<<0S @3 @J$ 0 $ R 0T0<<r1,Hh@T: =pP`P I00CS00 G 0PppI@T4`@T @ t[00CS00 G 0 H@`@T0k PU#00CS00 ~G 0 :_G 00CS00 jG 0  bBPP @07L:0P @PPHP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 vH$0SP0077S 0C8#8S0)SS C708#8S5CP0 Q A!QF8 R 0 00 Q0 -PP -P R 0S0(0(00(00S 08  @  (00(00@070040+70<00LP7 l7H 00R0( ?$0SP007,GQhJ 0X'000 000D7 <'004'00(0(7$ 10103/$60 G6& 6& !FL0S TL68 \6  @ Re 4 0  ` $E$6 @, i &00CS0 rL]60S 4⏕P 60S%,0%kS55$5 h0 MX5,( ,0Z0000",( 0T#E0$0(0S,? $4 50S 4,0S pyit<$040S 0 @0 $BPDT!? 00<0$0 0C0 000D00048` \X/R00CS030S P) 30S*T0SXRK38 P3 L3 3\ T30C*00A< 3 0 0S '|0R"C"0 0 3 BhSL00S0P}0l"0C0000QFKP28 2 2 B 2\  <*0020 T0S!00CS0 1 R   01D0S$uߍ;10S 0t!SSsL1 08 L0H@pKip10@0@0S0  @0SH1 0$ @0S 0 @0s0 RK0S0   B  @0S @0S7S@<N<0 @00S x`'(_'HS'$`'$_'0$t\'8S'5 `',S'4S'P`'<$`4X$,\'8\'l,y%@$($D$50S'S'!\'(S' 15\B HS'\;@,0S0 =,0Sh@LP yFT0 H ,000hG@T(0S p00tg ,0 0r,oD)ZHE0/HS'0 /HS' 0/TS'0/TS' 0  /HS'P@-@(P@f<0 QP cR   P5HS' 0S0/HS'00@-/0M0@0EP hP :0: Sp  Sd PЍ0hP0 : S# PPx`'50b5p@-Px@x`M$P*00S z#0`000``09"`$#$ЍpHS',\'@-Pd@$0'0 RP  B R    HS'//C-LM*8?8 p(0@<P@ `D `$0 DLЍ"x5@$A-@P`g pWU \NI" 00w(p4\'xS'O-pWC R``%` P0S:S2EԐ@ @0S,W@  @0T/S/00o 000S00P R:R0:SPPP@DOm"S"$$,$|S'@@-PM/p 3먐PK  0 @ T9gp0 @~0!0P} 0pWZ0S 0 `Tq0S m0S i0 Sgp @S" f`P T T T0P@@T >0DS|S'Hq A-@MP`Rk4P1000  8p"XZU h#CB Q PBLBQ<C 00AS 00CS00 B 0* 00CS00 zB 0 ЍQ PBB000M |00CS0 TBBHD00S @0`x`'555ˌ@$8S'5554S'5p@-P@@Pp 0S%SpP @|p@-P8@Pp 0RPp@L0L-  R0S P P\ 0$S'G-`@嘀0唐0P0|Up00CS0h00SG0S0 S 0S00ElPPp8S'S'$4S'0A-`0@0pP Q Q:R@ @:QR@P0SwppR %RwDL%Ppp0V:SP0@w@x`''$5A-`P倀000|Vp00CS0T00SAq0Sp00Mk@T`8S'S'4S'0A-PSp R+ᙇ`a@T"W p000t 0 @0 0 m00CS0H00S -`P `@|S'8S'4S'p@-P$@Pp0@P0@-L@000@00 {k00CS000S@8S'|S'4S'O-PM/`@ 0P @@@ (eP000 m0S i0S e000Ѝ#   P@ |/P @bPR R R R 0S  0  " R0""  " /R0 dpP>Z0 R"000  pPZ m P2 @@ 0@00Q  0S/R10SZ $P %pP A0000S R pJt#P R  R (eP0 * R; R 60@@De P R  0o T@0000S R   BR =D R9 7 ax`'5$|S'<$`58S'5,$54S'O-@M`p&PP'0S*[ 0ᬲ000`0pSw|2!| S6hB?01 P@PЍbPEU00p`@[ Q H0@V  0P!0X ZWYV M10 0 _0S& 0s1TP P*X 00SW0 0 S0 P 0SPYT 0s P k@T6,\'S'@$6T'x`'$p@-P|`0000S S@K000 00 00000CS0p00Spp@8S'4S'0@-Mt@ 0P0000X0>00(K 00CS0$00S Ѝ0@Ѝ08S'0$4S'@-gP 0S?KO-SM@p`%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩l|00S"" 0R1PW>= >0@ TW 8L> kP 4>>0 R @ T Ѝ>>A00CS00 4> 0 00 x100/0PXP! l ~ZZW Y>|>TbPWr>W~`FmjWxWtWq ~W 0` @ p`.>`'m6,\'q6T6"6J66666@$x`'X66w67&7C7O-MTBTRp60 @0`V' VV:V  VF /V   BR 7` F R! R  |a[  0000SH=B@P $p ~[/R 0/S 0?a^P Ѝ_^ @TW 0 BR  R  BR    BR  b ] ,$T'Z'0$|A-(A0S 0PS0 0aqP0S00 P000dg00CS00S P 0SRh`hp0P RP000@g000CS00S T'8S'4S'T's@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@! ` J@0S00S=STL00 <0 R0AD1U0 S 0S $\'4\'A-``pP0@S  R R00PH @T'O-Mr؂P0B0000 0000$`40C~ $4`PP00CS0E0S00CS020S  H_P+0S 000P_P vf P >10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (Q$P  PAP 0 SR BR  R  B ~  ` B `FAQV  RP PT',$8S'Z'4S'HS'1O-p0PSp0 Ѝ1嘱 @` 00Y :[V0S @ xQB `P V' Q`:00Q @ @% Y0S" S_P ZP@RP PMQ DoP @@` T'`'T'l$GA-XPX@X`P0p00|e0p0CS00S T'8S'4S'p@-PT=@g80 @ pT'Q@-pP0G`0S `*00E@`PP P `R@ Ѝ0P@@0`SP0S0O- Y X0 S@0 S@HY" \YX0 S@0 x00S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x^\| ]\Q000``S XSQ0 0 @ 0000xQvS^ P[Sd:Q" P-Qf]Qc \QQ PP $ ` $0( {P1 0$0 $`( {P%L0(0PP QPQ P !$ P80QP*00$eP e`0]S0 S 0p@X'\PP  8QP4\SSPP0 SP0S p @3P7O- MP@0?S*S3 [S;0^S!S00x \/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xPS@0/SR"@ RA0$x RP  R \$$Ѝ]PX9$P| 0U0/Sd 00EcpP $0S/00E0S``0` xQP 0S BV/00D0x RP0  Q: 0  R/00@>0P .Z. B/o" R  P V0 ;e$T'O4S'0  Q0@-0 @\C\0CC/x^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0S P $$$b0$000CS0H00S < 0S }0PT'8S'4S'p@-@ PTp 0@ @@T'G-p 00 SQA 0P `V L`R`F@ V pplx@S`` S =QQ RU  #0P   PG- M⨀0`@GP0  ~(q000e U00SV-00ED`PIPE@T Ѝ00CS0@Z' RO-@@0M-S`P S! C Rd?So @Sy 00C Sh 0 0D`0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 D7Dp@,PW@A0S 0g0CS00  P6FBЍ666U0000Q00S h6h pR`&XV(0 0S 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 RI 0  U  Ṛ~0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   c ~ ]   0S  QAQ$AQ!   Q R V  BR + `w#~  0 BR儡  BR  ~ ~  `K E a Q~p 00S T 00 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  004\'\'Z'T'040$Z'lS' $`'l$O-0$M00 Z0 0H'0=j,W0J0p0 0 7'0` 0`F#ZGF@Y0/ 0o`6@P Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG, A!9 6`0`FP 0 0S Z?0Y : 5% @ @AQ TK[Y0I Yi @ ZD5  A0B F0  %5T 0  Z @00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R'%x%&&&&&&0%'''''3  AQ AQ~00AQ ~ K R  BR  ~00  BR ~~0 0x @0RP[ 2 20AT[ @T 000S[@Zp Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0000 0P  00B 0C 000 0000T00 0qP 000l0 GR00#S000 B0S0p0 G0 B0y[m$Ѝ|00S[0000p0SQT'`',$0$S7Z'\'$_'k777O-0M Pp0 5 500 E 00B 00~S P0 0`Z Z":Z =Z Z! Z     BR  W NPR 0 AAK J R񟗋L,)l,l,,))*<**Y 0S`Ѝ0S 0S0@S0=S( ( # #00CS00 w 300w00  4#00CS0 0 u #000P00u00"00CS00 00 00(0S 0  CR  SR`0C 0 Y 0"00CS00 v 00v000aS000 S 00CS00 ~  BR   Zl!`00000~00  `  000{  BR !  cP  AA ^  ~R[=Z0SV 00|m h ` `'l$T',$$_'Z'x1G-Pf0lAlS 0000X1Xq0P0L1 ` (V0 S;000`0`0CS0!0 0@' p G 0   X 0  R 0 00 0p 0$T',$$$Z'$_' T' @-0 @,$O-TAT`0$M`F*Y $00(((`|X' Z'$7/@80$Z'890S/p@-@PP1PL1D8a 000P0R 0S"00Dy05#0s  0C?o2^0SPwpP X_ x0CP  PAoQP0S*00CS0p,00Spp@|X':95rO8S'z9a94S'p@-@\P0P00 V@00CS0p00Spp@8S'4S'O-@LM` R0 LЍOo,ؐY) PPY  0SPs  0 S S S PQ 00SЀ0S@LЍ0S~22 F! R0+  p  !R -  x"9,p 0T"0 -, p0 sT$ X0 p+00CS0+0p W +㴱p^ Z 00CS0s+0 00CS0g+0 | 00CS0[+0Ѐ YZ:+000t + #40  +  +P S#4W 0 w0p@ gd +pZ*0㙃#ЀC;`|X'$5rO9999j9990 @- S  .^\Q0   @S0C ( CP/o" R O-PP10 0%SW P t0@S!!Q@ C$0S 0S  R-S %S +S D1@@YZT X@1 r9 002#00S 0S 0p?Sp  P T"@` PDP `0@00SJ R Q !" R @$99|X'9:G-$a$N0S Qq0m0@SP @ *ĐР0Sʰ00CS00 "* 0 t+0 R  0 S !*|X'",\'5rO"::D:9@$A-pQ@`P00Sxt10P 0S XjPp pP@ gP`WP P11@I*@V Q@ T0`p0S0 0*@00CS0)0 S 0 000SJ 0 S 0 0L:P:,\'x:|X'5rO:;`@$800S /@-P `|X'8 P  /Q 0SZ//|X'`060S/P00S/D0Q<0  40 A!0 S00)0$ Z'<$|X'5rO:G-`Q0SS@00SjZqP000M:T@0 @C$ Q 0000CS0L10S 4q000$100S010000<>00V 00CS000S 0S @pWZ00萠 @E0 Z=SꙂ! P00 R @|X'8S'4S'0$A-@S`!1pP@! H$' LTl1@WVK \1N0S. U 0S0PMPLV 1CTp(U $$060S& $$$V''U 0S PP K\KP HHuV WT0   Z',S'Y'|X'0$$9*pG808 N R S  0S  P Ǻ0$O-pRB0M`0  pP 0S0S ЍP8804000@00 #"P%:T 0S0 10S 160SdTf P c100CS010S 0S 02, \ Q R05S00|) \~  ^Lo \ \ \W@~  ^Lo \ 0S 00>TP 000^'8S'|X' Z'0$<$4S' G-pPE@P ?P1N0St `'S@mLT @iLSpS r㠠`@0S0S 0S0S$`@Y 0 X 000 .0$$j9|X'A-@P.P PT0Q 0S xlP@ pP@ ZP@x|06 R0S@@d`Q 0p* 0 0 Sk:,\'ˌ0$@$O-PTdTt,M @P Y8 U0!00S5 @nT pTU P300SU00S00 ,Ѝ 0u(P M,P t0S 0SD3 P#Zp `X*00SL T0 @@0 0000 QBZR00 RiUX +*Y ^  \2pP R  Y RRU@  *260S'  @ Y00P'  P0`0V 00' 0V0S(0S0S 0S06 P 0Q p%@J0S 0S @sԀ0U0X0S 0 S0C0 Q0SY UX ) @0S 0S:<\'|X':,\'::0$p@-@IdQ000` R 0S <1fQp 6KR!r0S 0 00D1  S @` 4` V0P 40``0S`0S]00CS0X00S jp800P0V0S 㹾8S'$9|X'5rO4S'@1A-Q40@Sm% qP`0SP00CS00 F% 0 &0Pp Q.D!P%lP000T00CS0@800S |X':":ˌ9@$$98S'4S'@- 0@0",\'@-@ @"p@-`@00  p 0Qp\ PUA%00p|X':A-db 0@Pp0U RP@ЍR R =RU "0Bh 'Rf 0 BRcddd8d`cPd\db1) PU ^ S \R 0R  p ` Q\1 0 0A Q "Q."   Q1 010p} 0$ S0." W p 0p: !0}RQ 0 0\ d0$ \0" 0z Ux 0"  PE@r|X';;;;C;$";(;A-@$tM`Tg 0SdPUXfhfXgXg0gffdgg4h0 000E000PS V 00CS0l00SG E  P0( `R0`008S'$$Z'4S'T 000@0A00CS0/00S/8S'$$4S'p@-$@P0 0C0C0p$$Z'p@-(P(`@0@D00C0p$$Z'( A00C 00 0C0/$$Z'-A-(M@@`DHpPpPVP u ٷT(01 0P @ @p@DP`U(ЍAЍ/T (01 p@K0 P ᮷p <X4O- PtPT P BR 0@ 0 P 0MR   0 00  " iPS dWoPJJC !PtT'=<<\',\'C<G,$Z'$$,C-PBM3`Pk܂000BpB00CS020S 20@T[UU  r0@000w @ C@00x @ C0 @0 0Dr000  w0B  x0B00  Cr0P 000w P C00x P C0P00E 0 OpA01 X(`ЍP<=000C S0 0 B\  P0#RS& 000RpPP 00CS0 +J 눐o@G00CS0800S qqA00S i8S'4S',\'<@$<<<<<O-p㸃Mf@Pe`P#0S 0S&30@T#UP3W dsdd 0SUTC401 <`ЍSVP aVp HVP@ W0S ?UPPm Ÿ 00 C RS * W0:ꗁ;#p¿   P  ( :ApJyI$WA0 W k@  0@xt[  XxtRY  M p~ Wߴ @0 A W0Ӵ @0 5T0 S @P 5I0SMT0HS xy; 0 ᘴ 0\1Tb=,\' k=@$==)= F=3=q=U==Y'=Œ= BR00/00S/@0S/ R /0@-@0000C S  RR R1\ *EЍ4>>000C S0S//p@-PP n@P  P l P TPGP 000C SPppppշ QX0 0@-^ @P U@R000/0$p@-`@`P6N0Spv@Tp???d?@? 0  p@P0$X';L>G-pPR@^Q6 b@0S 0 % pW@A00CS00  0aq吁 @ Q 0S  @TPL$aDqD0 R R @TP@00CS00 b 0 Q P @1@UT@Q@`Q PGD`V0@ H0$P>>h>bd@$o>y>>>>>80 \%P0@-)0$>>0S/p@-@PPEPp@lEkEA-@1S@D`pPU 0@P00` P\'O-@Pq刑00`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \`T  PT<0@@T0SOz\'0\'>>>>0$A-PRB00і 0`00S 00S0S006X pW6P 2P6p60S0S60N0S60N0F0 0CR?o20S  0-S0F01PQ00SQ0 0S1P   000S  00^0 PA! R   R0 00$\'>xS'P0 y@-X@000D00S 00CS000S 8S'\'4S'000C S/ @-1'P 0  \'G-0p PR 0S5Q 0S 0@ 0CC10?`@! &,z`` `@r@j ``] -R \ -Q0S `0@T0:SF 0R@1T0:Y " @`@@ `0 T 0:S  @`,@?:\00|@Y00 X @0 CB!08( @ Ѝ衬(??>>D$"P@-H'D0P  Q 000CH Ѝ/?\'$\' $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0@:T  ($\'e?R?G-pR@ 0S PP -R`@@$0P 0S 0S@0-S =@T 0T T@1@DSq0000@CA!0`@S:0\:0l0#1@ T030V:0 000CS0 10S @3  0 #@0Sp` 0C  0XZO0a0C  R0 0CS0H00S @0S ~B\'{???8S'4S'?p@-H@HP080Sp0u`0CS0` 800C803$Z' 0R @-@T UB 0 B   B /@-@0S@p@-@P0S0ڈ00@0B2 ! ! !!  !!p@-@    @$ 0S/xQS  00 S/00 0/0S/0/08 0/=P/P/0/0 0 0@-$t@p@-`R`@P:P t00P pd0 Pp0-S0S0 0pV ($00080@pY'X'@$O-MR 0p0뜒b"p%Q  X @  [c { R00CS0`Q``@320`0@Ѝ X @ ,\[8R /^ P0  BR (000Qp 0 S B R  [000>p X R  [R.@@  B@!0   Q P Pp P  Q  R P000@00 w 0 C $,$Z'$$L$0-@0DM P R`ή0 Ph h "  ŮUP 0T<0< 1 0 01 0 $@@@L@@@-M@P0 G 00SPp@`T*vpPT @T?PLP @0 ᗮPЍ@$$,$@\'@ Al000S p@-XP@T T D0T@p8040@p 0 /$tT'A"_'$d`'0@-@VtT'p@-d@dPR\PpO P 00008  P8 9 >p@:$$NA-DR0@T @ B 0S 0 @0r 8 0 00CS0!0`)V*V V v va A r` 0F Shh<hhTh V0@000 @\V. |V ;V&P0 @ ;P0 @ @0 Ppx&P0@ @0o|P0@ @00@0@p P  00P000K0  $$0T'4T'G-pc00@ T T+P,0S)㰀" PP @n }@@`P  0R˯P `FFa@@T 0  $p@-`0$P P g 0R$, (@R   RP3Pf    Q * 00000S@p 0 BRp@ Q080@ p$7A@-y0 000$@-@oPp@-. @fP P @0 000p` P 0`@`$O- С`P0 $ @CPp/0 CR00SY%3PB'V0  H100SD (100S @ 0YP@0@Y PX @PW W! V! s0 @00(pGWVoP0V     u 000$LO-KM 05P0@00400 Pr400D0$Jc`P j 0S Y> 4 0  |4 8ct$0000 `SH4 ` ?,4$ ($00CS0c 0Sf@pW 0䃟RPp *0PCp0pC0 Sڈ#sV@0   0 0C0Ps000=0 000CS0030S0@2 0 2 0 02 P B1 2R Bz0u`0PUZKߍ20S Td2h@d2dpD000 0S V0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PP@0000 F@!00CS0 0000DP38 .1@@*pb0PC2P \00 0-,M00CS0`f R {00^$,S',$8S'$$$Z'4S'kAO-pἯ弿M"/0ϟ/0 QO  `00202280 00\/20S0S 2Y I @$<$8(ܳĬ/Q00S; P.Q00S2 0P0C0p0000Pb\.00CS0*H.0p210SxPpNTP"Pg KPEpE U0@#S?$$$$$$$$$$|($t$$$$$$$$$$Գ$l̳$p6p Pq00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@WT00@S"IWL'PGBp0000Pg<0 0CS00C0~000P0C0l0P@+00@S0P@ Y p0P0C0t0E`0@? @?o2;R0S 6\P \Pp ?PPpppWppUpW 6;E SD 5:0 S0 U0C *0?0%3?P00 Q ~ B  PA0U!*00%60%3?00 Q ~ B  ?PA00 QPA~P•3U5*00%90%6?00 Q ~ B  A0%3?00 Q~A• ?P B 00  R P B P~   B u300%<0%9?00 Q ~ B  A0%6?00 Q~A•  B 0%3?00  R ~ B   U?p00%?0%p0PU 60 d0 e00CS0? 1P@0H21SZ0 0#<R00SQ 0SJ60쀟SPV 0P@0 P>WUT@>P0 |P0 &PU000@$P0 Ѝ $$,$$$Z'0T'4T'AAAAABB:BY'X'؆%@\',$=Z'<P0 ,  0@0 0 S 0Q >W @<P >P" &P0000000p0p0 ((0 P0(0-P   pO0YP0  0{P BP 10 }0 010{W0E000C00Q#PpIM}PP 1 " )00 0: <}P,p S0SS|l R 00CS00 - D]oEp@-@,1 RP-!Q)Tp D/o"PQ Q" P+ P' 060S  R 00S0WTp\ TR P R 1S80 ӡPpSᗝ\'tS'0$8S'4S'@-@P @  0PUPH@-@P UP 0 P/ 衬^'EQA-@ 00CS00 |p|P ` }?U UD?U!P0P0CS00 `ˌlG-@Pp000 T`l 00000CS0L00SGŴ0S 00S 3.@8S'\'tS'4S'P P0  /\ Q0 S//\'C-QbMP pWw10S 0S@@U@21q0pWpS ,20S@20S YU U U@160S@@0S1N016 RC! R?0S@@0QM pF 0S1 T9 T Vp Y0BTT0000 00E>S/00 &XppW a01ЍCwp@0N R UT Th ER60SЍQ Q"!030\' Z'0$(\'PO-`@T庝P P@ᴝP 0ᯝP0FpS@` PBPBP᚝P24 匝PP`tDa0S! 000%-U 00CS0 PT40S 00CS0 40S P@U00P@s胟`1 R 0PU TgR@`@VT c刃@Q0S 00S 6@@TP@P @PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tu@X PбБ@DP; ?P`1 x10S PP0-S0SPV @X Xqp0S@ `p:0S5 0@0U000P1 qR (,pVP  00CS0\00S 0U00 PqDE6E@$E\'8S'4S'ElEUE<$wFTA-@P⠀0` Pp UTA0S 00S 0@D0@o000CS0 00S XP\'\'8S'4S'p@-PD@`02S@20CSpUV02p\'40T0P?o20S 0S//\'C-p@`1010r!Q0@S10C1 ЍqXPU X2宼KP%|+롼P 0S ᤼\'lS'$0@P/!!R /\'p@-8P\2Sp@EB?\Bp\'0-MM01`"R !R X"R   1 1d"1!d2S ,PPh1, ,PP H!0,00 P@P 1, @T0d%`0P, U @T 0S P娴00CS0 ! $Ꮩ00 0$0(00D>S 00 #ę"!031\'lS',S'8S'0@- `"dz\'p@-@HS'Pr0PPp0C/U00pp@-T@TP0 0P0 *0 0000CS0p00Spp@&8S'($4S'A-@R`P  k#0PPEU`pp WD藝0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP00000 00CS0h00S ưsDP`00000C0 _'8S'4S'p@-@P@0SH00Spp@00CS00  ($0($0($@-@8P妰)ЍF-@-  Ѝ Ѝ/-$0@-  ЍЍ/($ -p@-Ml0, @P(0 0`0CS0a0`1@00DЍp@Ѝ/G-@'`cP$ 0S! pᴓ0S00CS0>0 " u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 ' F($0Q($@-@@($@-0rSFF0G-p0 P0R(0帐@0=00喉=`ᒉ`F@VPpPER000 S=S B`` R`ĥ`PGA@,$Z'$$0@- 4@ 00C000 0m)Ѝ_'G0P P PR00/0@-@DP^ ^ R0L00A-( 㴀 R P(p`@pW p0S 0QPU  0S 0S   3/P@P00,_'0SfA-@RP1U p`pp0S'STP@HAM'PP,  EBEG)G&Gˌ+A-P0@S`p    3/@P@PX #W p0@=S0U 00 00CS00  0 00CS00 x 0 T @$O-@00pS 00P㜠Z 0 ᦆ@PU* Ѝ`V Y   [ QʁeaP`0p_',_'0@ R P=R/=R/A-`P0S=SPERPU@'͗\0\pV!0@qpT 0S 'uPVpp@_',_'1@-`0@S @ PPV 0 `<' Z h  `R Ѝ@.'Dq   R <0 2/0`' 0R , R  00 0000@!L@0P U U0 N00CS0`00S Ѝ@uY0#L 00P P Ѝ0$0G8S'_'4S'|0-GM00l00 0KP @0 80 Gߍ 0 0  e,S'$S'A-`p= P U@VPp ኔPZ0DP @SO=  0V  @(`ЍA50CCG\0-GM00aKP00$0 0  Gߍ,S'p@-!X@0`P`&@0U<B0 `00$0U p@_'[GbG;L>-!0$MP00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝ\'iG(\'xS'0$X'p@-@XP`000T 00CS0p,00Spp@耬@8S'4S's@-P@T@ aPP0 P00Ѝp@n` OP 0 @A00000 00PЍp@_'yGA-PpU`A0  %0%@TP@ h0@00`,_' @-@P 0S   3/P 000A-P@`T PP 0    R   2/P @@@ pP =@@LS'C-pP0@rS``PW! 100S T! 0  ЍC]nP pPW@0F?o2T0S p@T410PU 0P U  Ѝ 0=SP W P! W0000000 l @0 L @  !W Pz$U,\'}GGs@- P`?@P 0 Q   00 00CS000S 2ЍpQ     R\ 0000   $0  $8S'4S',A-`pĀ@TP0U0  p l$&i$0S R   0 02/0 Q$00 0000_'$0$A-pP`@P 00`PPEPvT` eTp` fTxTp`X @V R@G,\'PP@- 彪 WGC-pܑ0P000-S`@TQ @ 000@0CS`0Vl10SR ЍCj Y@P=ᆄP ~0 @0 0 0  0 00 00000   0  RP 00 00=Ss Tt0T 10=S100C0 0P00 Ѝ8S'_'$0$4S'  `'p@-@PTpt@p@-靴PdP@ \"NP@ xP@ IP@P(P0 P pUGG,\'00@/0 S0@/s@-@c0 0P`Z0S V0"S U1r0p%!*0S`0X٩000 @0C?o2R0SЍpbH؆%sH@-M@ pP ލhP@D 0RQH0PP0@-M@ OP ލGP@D0 SPH0PP0@-M@ .P ލ&P0RP 0RPA-@`KPI0 0SC PUA PPPYpPJ! 0RA"@- 0-RS# 0S00 0%" Ѝ0SX00T0 S00080 ,忒P$<PH0@-P0M!S@0SPЍ0P{ 0SxPUo U U 뱆Po U P? PPEUR||D|,8|||`p P  P  P  P  P  P  P P p0St00@jT @0(S0)S0 0qop@-@`P(P} 0Sz00CSt@`x,X|oopPޑP0`@,TV%@`!VT`@V@`@ P`@P`@V@)Fc0S0!SPpp(S0)S0S pp@-@PpPPEjP.U)440op=Pp0\0!S0P p(S0)S0S 勧pGHH@-ا0F㎧H<$(0@-0 00 〧xS'<$H@- @ R1P\ * ㈧ЍgIO-@M`<!T0pD P-R lRC 5R -R| `G@P{2 000E @PppGWP АPW pGP™儲PE0%S`x`PXfpW ;sR R`6pTP`2UPU W@1 000 PPP@U aDP@ 1 Gp &GPt h9\v@P F@P0S0Sp@Fp0 06 X`0 R P!q *S00 R dS pv \  ǦTTso"؆%q}III@$ITI0@-DM+0   0@@DPU# @0 o     ;0 Pxtt, Ph DЍ0=<P QJ>;p@-000S 00x 0p p0p@0   PU P@P0P H0H P pW Pp0S'0T'8T'$L\'\'X$@$($<$D$p@-ߜ0@@B]0 0@0PU@0003l0A  R 00CS0H00S p@^@C0PClS' $X'0$8S'^'4S'P/p@-@PTp000@p@-@@aPTp0   SC$`$t$$$$$$$$$$$$$$$$$$$$$$$$$$ @p@ 屌0000  堌0000@ p00C \ /p@-@P5 0`P  S'`&%&`&`&`&`&`&p&`&`&,&X&h&h&&&&&&&&&&&&P&P&0 0 000@0pN0 0  0 000  00 2  0 000  0@-@PM  0  %  0 00P0 0v@Ѝ0@-@`PT@ Ѝ0000p`@PP000/0P/  R /P/ 000/`' 0P00/`'A-@pP 0` V  V @00CS00 a 0@ 000CS00 O 0``'@$A-p@`xT [TP'T/ 1Ta "T* Rᛤ1  !\0DS*<)<)<)<))+<)<)D*+<)<)<)<)<)<)<)+<)<)<) +<)(+<)0+<)L*@@7T/T @0p00CQPRApET@0P@0  aCPBW0CACP70C00CU@W pRx +0BpP d0000 0HA A00 Ѝ,pP`'؆%KG-pʉT@P@UHޢP00`E (Vs`0@0`'"L`'O-08iP0X0,9,M P1@01.%c|Px @0  000P@`V8 0S5 0S1LP X h%p|80PEAU,ЍP@@\V $(8P00CS00 7 0$ %V0%S@700CS00 7 0P`۲0p*Sp`0.S0@*Sp@Z(=`pẲp@0xZ0WZ%Z A0J R'X0J S74343434343434343h84677h8h8h843743434343437434343743743437Sh83T743h8h8h8Ѕ\P  ̈P \c 0\\ s00vZ t 0 W\\#LQ5455555$5$5$5$5$5$5$5$5$5$5$5$5$55b '\ \\ "\  \ M\^0? \@^0-000fnrtvaet 0P030  C 1 01%v똓`P Wd P` Q d2  Pd  x  s0v0 t 00 儲p B`0 0 =0 rt0  il c)v t0 < <"0P 00t  |j  v t  j 0et 0^h0P $0'S"SnA^X0S$ L v t   0# 8Œ0$E0$  Yt 0#v t   0t 0NVBT^0 <d`'@$y%:LALM^L؆%3'a'8(ˌtL弉0C-Mtq 0P` dp @P 0H p@PH 0p W  ; PuY <YᒉPP0 0ES, 7P L0ES^Y0?S0 -S00PH0,Ѝd 00S00H <PH:LLLLLL0s@-@0 0 \XPX`Q {Pv 0Ѝp@00  PVMMMO-Mp:zyPY聟葟衟000SЍ@P 0S =`yPP X00 ec[lP 00 Ta4i[HP 00 0P  e 0$0l[وP 0 0o[ ψP 00 ȈP e 0(0 `Q 0 SᶈP00CSL je0 0 0SMMVMMCMMM0K00M00P0D0 0C0D080;800,0/(<0Q8 00,,<008 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@e0@-d00$ 8 Ѝ@-@4嚶000@-@4咶000@-@(0(S00 0h0,0Ѝ`t p@-@PP$GP[`8ߓ<ݓ@ۓDٓUՓ\ӓ`, 8`V0,0px@-@4P800,0@-@4F8#0,0&|@-8-@b( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ PW ЍtM@-PWnt M@-PWot M0p@-MP`0@-S00(000 0P  PP 0( RX  0 0 S40,J03/Ѝpp?NLA-@`PpQP-U@QbP00  PSP 0-U  `0p@-@Px @0P ,pT 80$P< D0TP$ <0<Pp|p@-P @0S 00Ppa'Q+  0 BR @-o M- 0 S^0@Q 80^  ? 0  / /ᡬa'a'Lp@-@dP`V Ppc`HV40 0a'Hq3ˌC-MPp`@T HvV@P - @$       @     T  | p d X@<  Hy <u@ 0q $m i  e a ] YU Q M@D@ <$A 7t@  < S S  SH  D6 C"VyP   W        uȅ@0ST  l" X@ x@W dt @ Dx8l ,` TL@4(@  T4 @QV \ T@Dt8 0d| \ x Lt  @p8l(h d`3[@V RNJ FD|B@l 0@:TY Vl2<08 *(@@V  S W   2VxApr`VЍ00 d @&V   Q  0넑 @0l  T⫬l⩬@ pO'O]OeOkOsOzOOOOOOOOOOOOOOOOOP PPP"P)P2P9P@PGPNPVP\PkPNNsPzPPPPPNPO.ODOQO^OfOlOtOyOOOOOOOOOOOONOOOOP PPP!P*P1P8PNHPOPUP]PePNNdPNNNNNrP{PPPPPNPP@-/ -P%00@-( P 0 0 qa'7Q%PQs@-@`ц0 00#S@7PƆ0S 8 S00S 0 SЍpˌQ0S/#Sp@-@,P(p0P 00pa'ك@-PRP@ p`p 0R" Ѝ脆0"S0SO 00SS  00@O؆%@-TdxPL0 p@^0"SSЍR(a' R@-TIxPL0 p@C0"SvSЍ?R(a'ORp@-Pd@0S 0S 0SS <<< U   S(000P 0p(a'w[nRp@-Px@Ql P0 0 RDa'RO-P`Mp` 0S@`;$ , P 0S ߍPꃯ0Q 0S @s?@0P P@ P@0 ST WpU: 0S L  09/PV 0``(a'RRUS+S@-g0S S S8 4 ЍS$ ЍSˌSKS T7@-lP$ R`tR;@ H$0S p0 lR  `R Ѝ0(a'TT g'zTTp@-@P 0Sp@ |0PS P00ᆩ00SpT@--H@H H`HpHP0SB00 TT%N|C-PMP` 0S00(p0 /pAP" @/Q `0p0@1P T0 p'PH$0@@ 00ЍRDa'(a'T0G- @TT< HRD2DD1H#3( 4 /, (+0 '8 #4 #4R! !4S !4S !4S h!4S Lp!P0S t0T!T0S \ ,LPp8W kЍGps0S. a`` Ẻ0  0 0US !S| !3  \0US:3 0U  $0x pPU%}U9U@UGUNUUU U\U"eUnUwUUUUBBUUUU(O-Q ,@QlP0QT 4QP@PQ,}80S,00 80<0S804 <0P<kPP<dP1 QB"9Z묱`8X0apS pR  I <0R\BP 00< S88P0S9`(ՀQ +(΀Q $@P0S0 BS `a 0h R  R* P*ha (ZUUUU V(VhV(a'V%WRWxW;V|VVWO-;$M p*b 0P$S [ ߍS 렲@PT[D @P늤4 婫0X ZS' ("$0f0Qf/ j},2!S!R !SS衟01,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2,"b"!4b4# ST 0 ph#> 0"448#8 R* 0S 0pUj9 P 0S 0 pG1Sq j  @1S j2 f/j v}01T T%HM g'(a'WWVEW}}WWEV"XXXXXb'%A-P@p%`P %R 0R000005Sw D $0f0Q, yO  (a' g'XPa'p@-@,kP  P$p@\c$0@-0S ,P(a'@-P  Pa'O-@4kCM: MP00 8P( 8dkPP008n80p0S :oP  @00 WY | P 1(p` x pD P$4  X p:0 $0 %P$0S W$02P P pGGqr~P,圙圩$ pW 0S$00k P$00 P$00$0 P$00  @~P pWa 0SY] 0 0$0P @2 8$ 1\ x$ M[(P $0S  S;Ƒ8D0;RZ,( y~P  %o~P  f~ P 00$0P$0S ++RP0 0  J~ P  00$0gP$0T0 @9~ P  00$0VP$0`0 (~ P  00$0EP$0X0 ~ P  00$04P$0\0 ~P p~P  0 0$0P$0d0 ,}P  5 0$0 P$07 } P  l50$0P$07 {} P  (50$0P$07r jh} P  40$0P$07a Y(} P  00$0P$0x0P H} P  00$0P$0|0? 780aJ0S0S  P0X:h XT0 0I070t 0 ST 7 . 2Z/ ` ዤ0S 1 س#0000S05 0 3000"0$0   00$0 ]P @$0!SL @0$0|2$ 2 , @pCލ Ѝ0S 0z  QP0 wZ0P!A"Az0S 0崡0S 0C RS񟗚 nc nccnc nccncccc nL 0S0 0S Pz  0S$  |o 0 S Pe ~ 0S$~  |t 0STsl 0 Sk PI b 0S$b {>W (a'YTR <YAUi`iei/YEYOYPa'gYvY Xa'hha'YYYYYYYYZ ZZ$Z/ZCZ^Z~ZDa'؆%ZZR0s@-`PU V  PQw@P hЍp`PD!y<0 j0@=V ZQ$00S M@-~00$p@-@5S4 0PSP p@@Pp0S 5S 1S KPp5S X `Pp@ LPp (( PpK(a'Pa'c'[edArdAE[s@-PA1(`(000;a5S 4 5S Pz~0S v~0S005S  Pt p0pP "5S ЍpH HlP8 (a'WEVfdV[mdg[$0sPa'gdx[@-@P f/%y@Pa' 0 I$g'md0S/!  -3@-Po\ P 0S S@@ P@Ѝ0@ Ѝ/(%p@-4@4PQ?p@`    @$aa@-Mp@p0l Q d P0cS CS SS 4$sS00ۍ0 'J+b%b0@-MMd@ PP 00YSP ,ۍЍ0mPNb^bpb 0 pf'%@-@M,0 vP  ۍ~bzp@-$P@ 0 p@O%b'f' @-YMMt@ p\YލЍ<0< S <fCPژ10YS<0<0f rdAbbb*@-0gj z gz z4 'z'&z'z{zgzzz{ Ѝ5b7@-P0@ 0$S0S> 0S6 TQ+BQQ+ QN10S+ 8@0 w 000!C0ASLx,x,x,xx,x,x,x`x,x|x,x,x,x,x,x|wxc0A Rx t  Ѝ0zg{{' Q{ zg{k Q{ { { @ 'cc@-MX@X0T Q L P 0nS yS0 $ 00ۍ 'p Uc|cP `00CS`0p S00 P0S X0X /X (%G-P 0p`0t@P I pGYwT@Y @0 @QhHzBPp Eypᄠ 0  a U 5w`V` ` X= Ѝc v%O-M M@hP`ᓡ\%\TuTT0S0#!pD P syP  v P'p0 p( P   nTt`(p P  VP ` Z|P<08 Tt`( p P  UP  0(0Ss`, p P  UP  0,0xSXs`0 p P  UP 4 000$Sr`8 }p P  UP  080Rr`4 fp P  UP l 040xRDr`< Op~ P  jUP p 0<0 Rq`$8pg P  SUP Y 04Qq`$!pP P  <P`P8apEbWWnF`0E `F 8ġu됳0A"S0#1` pvp P( ATwPH#<<" Xu wP0S 3/ PA  P,ࠐRx%.A <p P" 4SA4`S>;4`P92a0C" 20< S :A(M"YAEx5|%.A p` P0 x5< A B0qpA"A 0Q<0PAHx[0x5< 0RA | TP 00 00S pP0`(V R s S 0 00 0`PXލ Ѝff$xfCf-gdg ggguggf'% 'g - BR0 R A-P@. R1!&0 !0 X0 X0 tX0 ` ( H, <0 08 $4 < $$$$P T 嶯p0 1R0S*0X`p\PQ Vl塯ALh#idm*i4i@iMiTi_idimiiiiiiiiijj9jajyO-pᔀ 2MSR R@`aX 8QU ,[R 0rP Bap *B/r@PdR0OppV 80: S \"\\r0,0}=00 @$@(@0 7p $,p`V1 00 0(0So0P0*  0P3@@p  눁刑刡T ! h`!R0$@(#(pPA(G `F@ @p  0Q` 4 ;$j 0qp`p g,< P`  {c+[('wdTnhnnxd nJЁnn%n o$oSo% >o PA-M @wjPH  ojP( WA$t  00S `Pt0"S U1r0%*V t  }00S ps0 "Rsp%APdPd `尀pTp0 <A0Ѝeooooo p#p('ydHq=pC-p@P` Q @qP 03/ ЍC@@ R;  Y:p @($Wp('ˌ 0 @-@('HqP7@- WP@TpP HpP804 p Ѝ0 p('wdP7@- 54P@, pq Ѝ0('d@kp@-R(0   7q%O-p$M0@QHP`0 00000X$Ѝ i pk@ P  p 0 S 0T@0SxtZV\ TW 0 @Dq.rp@-@P3P1P' 0P, 8>0P  @0P 0P 0Pp@p@ 0x@dp@UU@@Pptcidyara2rrbmngntsJշŒˌ+r0D S/ 3C5C$1 4! 8<0/0'0@-0A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @0' 213/P/X'A-PT0p(,`oo@ko,0T@@DA?@?0'@-?00@0 (20,20l0P!P300'> 0R//G-0`p(,BP l E2o@PPW ,20CS(20CS G00'ssp@-M@`42S%^  E 82<"@ 0(2,"Ѝp@<"82El@`,"(2H0X"\4Ѝp@0'$sssst t+tttus@-P`q  n0SЍp00S@qq0"S1Ds@-$MW@4l0 0 0 0"%:uA-P`0 p @Tʬu> /,s0d  ? zgqp  RЍAL` 0S`@D@, l Ѝ$ww0'A-0ppP@`pl4!14P S H d" R S R, 01pxU0'xp@-P0@0S( pB01p0'O-TM0(00,0x0$ #0P㈰匠s80@300<080S: (2,3`6(0, 40Sk404 D$0@?Hk$0 0Ak$0 00  8k@ D00b"d:P =$00( ,00  0 RL0 $R0 S t2000#1-R0" 8LL`P@4Lgx0P00S dwP  ^wP  XwP% L`᳔0L00 S?  k0< |g2<jE%KUP1*6\"?C$50jP@\2S@0x0XR@x0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (00,00 0 h$P @TЍ P @~0'Rx$Zx'(%ޜxT؆%Gxxxx-s@-@00CS0 )P` Pp pt<0 P00CS0)0 Y@oЍp@Ѝ/(%xޜO-0` p<Pp/B$0e@O 0eqp Ѝ  R ЍO1t`L0S 0eqp `BE,Aj 0S $x0'p@-P@2S t`0n/(2)j1!41#41U @0&"UU  p@@PC @n@Tp0''V'G-@r,dg`P N<` VPmYTLE J$pS,n0U !VU ! [E@s_Ps iX2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@t0000'cA-@PXPAds 2F{i t B B$R00C00'O-Q40 Ѝp0QSP LaXR XF0 pQ 0>80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ y0'>ycyO-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q  32 $450 (, T02Sx Y< ЍPT 21倰[R RS$ [0 0 2S Y pP:Y 2p00`@p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$Q00C0@@PAy`d1S  14 8<   P00P2S. Y  a14a8a<0#d1a#h#0)S aZ0)S ZR0 QQ !Pu800 0Jd0@ :  0S8&0' {\{""{$?{N{c{{W{||{zz{{ |U/|||J|MzCi|r|A-4RUP@P@DЍp(0PPB1P@XaXaPTS <ЍA0!14!8!< 1 11p1 1!1<0 1 1 ?01!1<0 `1 P1 ?0<ЍA0'b"||}}3}F}W}i}z}}}O-0P-4M`@,0 q 0Sၴo_l,P0`("p/o" R 8 0t 0(  [ 0 U䢑 Zz @ pD H L( @` 0t0x0| 0XS T0@˟`( PX=0H @`21S /0.30010204458<0 TTQ6 R:HL"T 1"R. M4Ѝ0(Ro_0hP(0|H 0 P(u( 0 P(lx Vt  @D H L(@`0XB`(@ Yw  0 pt0x0|9pW2SjX 0!h ?  49 ܂,j  R    0$  $   00@P`T 0 W0S 8`p@W 0`S$0 @0u 000 V 0S@8Xr\" 0d`@,@ `SRp 00 RW00 0w,p0S| 000 72PS XU9 @`@ hw@ ` 0R('0Q0[042 @`S`Q $ 0q ^A$ D 0 H L@   @`021S  "/0.0010T0 320445 8<0 T @` @`2S 00 0P52S X@U @ `@ 0S4 2S H"%>0$0 0 0S- 1S*  X000P$  00SX0!14!8!<!14!8!<X $ $`LLD(`0 S( 21S$ / .0$40 81 <X S  PX 32 $45(, X\ 00$0p@`\3"Rq2S. l _50 00 P 40 00 PXS (00D#$0 #(#< 0'4 0'80'< p 00pr0 @2S` BT0`l#PX 0 1<A 80@@,2 0C0@0@p`(2? 00@@0`Fa ?`1<A 0?``@@,2 0C0@0@`X(20? 0@@4`Fa?`?``0S 2S@ @TJ041S0Sg 0s XPX2 0 RS  0BPTo_P(L0'b}}"'}~f}ˌ!~E~X~g~x~~~G-p@B42gS0双,r,bP42SD 0P*U42S 0S vqԁP 42RSfP:g42S]1!$1(1,ЍG0Sd S ^`兤d 04Y2S L` ` 0)P"PR S0SЍG+@D 0ЍGSP 0Ѝ0'~mX'~~~~/~Qjt@-0@M0@ pp`PLpߍ\ ~a0  0AAP \ =ft02S 0S " `PH !SR 0Pz10'@-0Xa0 0LAP d2S8 P(~$!p! 2SP0U0 $tp"b Rp\EU$pT0 00P d2SP P@D Ѝ0P0!!1 $0'mdm[X''A-@T2 @PP0 !0P1P,30  ,3Q #   >c09T0< p@8 PA ,0S ,< 00S< 00@ $ZP6&0FSʆ`p'P0S -S@= RP00@@P,0S ,^A0 XOP b8800  0 R00S' 4410XAXQXa40C 00]C]1d0S0Sd0S0S C 0S C CC$0#4 ܍p PS Pꨴ'"Bx+p“ғؓ$w0Hq0/᜵'0/᜵'0/᜵',@-@-   i%G-P`pBd@0S B 0S X|9 ~U >T.Y0S 0S @ U뜵'BH-2V-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  &C-M Mq@` @ PPݍ Ѝp!rddPp=0D@@rOP,0: S0RP00 0+PP P81: S  S U r-+PP6,3,P%PPPU r#PP @Pꜵ''ˌݕ@-;0P  44 0 Ѝ   ꬹ' 0@-4S 3/ 뜵'@-Ec00 @ 0 $^9c@p'@-3c@C]^^)c@@-p PL`@@0 7/0P S Ѝ &]004'O- MM06@  @  @ 0p$000 (0+P(LL唺@ ܍Ѝp 03/0P0  ?#P @$0SP (0SDUI)+`P 0 W U euX0YY 0 `p  W p[ 0S $P % 5 2e@uUT \ 0 @W0SU 000 !00S# 0S,aQ!=P00CS0"@ T 00CS0! P @YT Y@DOoB 0Q   @OoB\ 0 @0  0 0 SNTP'(%%p @-0M 03sc000@So PP* R!PP<] 00@  l 0PS ePQ `Ѝ0S X0S R0S\0Sͅ\ 0/@ t\0Sp0 @ 0@Hvp 0S0S塅 @g0S喅  @"  @0St儅 @D LP@ @0 @ `!0xP|"%#   T`    P @@``a/ ] x Zp h 0@`P'\'T'ޗ8]iؘ% G-0@  05P 0S< 0  Q*a nPPZ   0P` f pЍ!URQ PB l P_0 p H0 0W40p P , 0Q0   040 04! !$0 0 0( 1 0, X0`P` PD 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0pU00 QP    0P 9P y9pP1S1S1US1S 3S3S3US3S,  pP0p* 20212 1300p 0p5U00 QP  7   0Pp00S1<01@040  0U40  QP    0PA0O  A0m9P 4W ء 0R  N eYX`V P0E;[ 06#++R`HX< $0S,0,  RT0C[D0"#1P0P  0QL \0   0P 00P00h00dl0d@Ld~™ޙ!&RRaArrAaUI`ؚ,T@-p@`P 00 P0PaT 00QP  Ѝ 0P< !@ !0 P0CT 00QP 4 0PI@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  k 0zP000<ǛG-`XpP @ 6P W Ѝ0!0呗 0SXY DF tX0 hX0 P )O-@,M0p@$0l@`P Ppr$PP L@,Ѝ ]0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S 0 Q q 4(  0L $ P 20 2 p(p,"  @ "  p@! P0 S@  2"!"0  0p@<~\Ϝ0P s s// /לۜO-M`@PpP0S Ѝ X  H r0A D00 s/ r ql  `*P0p@P q x `0 P 0 00 P 0 00 ` P s `0Pt P0 0X `<P FXkӝ2NcR0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0걞PO- p`0\PPX $P  qQ0 0\Q@T(2 R0@ P" R S C0BTX t0D s  3 0 TX  R 0 0 p| P YP  L BPTR2 Q PE̞HzO-X`0Mp@PPdЍ Z0Yl0L 02 R0 r00 P葟P#ر 0 STR rH 0/KP U  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX0!  0P0 QP \ bP G-@@P`pP0S 00S <0s+@qa$0S  0S 0S,0(  0  `0S"P  S`pl S HD@pP q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hTPP 0Wp0RQ@0͟w:@-XP?`\@#@3P@T@TpW @@T`L`'O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ00 0O Q P P0 W:00 0O Q P PLR 0 WP<0T 0qB`'~eO-M@L0S<`@DHp S!-P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:꘠`'0 A-B?$@[`/p0S T0ES PC Tp@@0T?  C0`'0 PK %/`'O-pcM 1W, 01 SP0 S@0Pp(0@@D0 0$04@|D0' R$ X0`1#b#<000< 0,00%O<00 QP cߍ0P@4p(0@pD0 0$00 C``02# , PV00a280`F0L0L08 SD00S   80< 28000,00N<00 QP  (1 0H 0  RR R0(10D04L0 `0L0C < *9P. (1 0(11  J   4 ,0B0 D0P 0D S140S  ZI@(1  0I@0;+ 埬 P(10(10@4 40 0S_ 0@ H @0(0/os" R$ 00 ,P 0W0(00$0@0 pS@0! 0C@0@ 0㓲" X 0X  PP  :X R: U$0p 00pP0 4n U/0 00pPd(@\Q UpW$     Pp PK/\W g0x!P0p0p0q P$ b QQ#hQh  0 U P p$pp000 000 0p,@Pp0S*0  Q b.0 Ab  @ @bρ G?@ L0C@s PQ*W w 04L |1r 8 <|1 0W4 8 <1t0U`0  0\|xQ1PP|!R \  P PPL0sPP|!I6@0|1|Qx1U0P U* SR   1S \lhP@ I0@ 000014hVTPP 1|!RJ PP 1@]300 0Q (0R| U$0 00ppPt, u/M00U0\`0) $ 0(\T P0000 0 0T 0P0 0 0,E@W 0$ Se1Sb I_1 S0(0YRhSP0S 0Sl \d|RR P0S02S 0S0SV 0\2SJ\E|!2xQP >PPx 00I@ s 1 |1P 'T$P PPPPPPL0Is0PP@1@S!U @[ShSP=PU p|1WS P@ |qppL0Is@ppP !SP| t@PP 0 1|10|1#40L0s_?00010PP$ K/\PPP05P 50Ph00h0Fd 0ES:\P |!d1PHrH"HP : 00|1@2PPp818 ,80PI 020SP0 S0 U$0 P 0c000 000 00 0,@ D00S< 0,00K<00 QP80,R0 CPI Pd01S\+!0\&P %4QIP0%8%\@0 Pi`'e~%LS]`'|ڡϜO^o/Ln٢4KbG-@p r W pP\aPP Pp( PK/TD08QP0Q:" 0PS00  Q pJxPhdP80 "8 R 00 05 !$x`'ȣ-ap@-@5%SQ% 5%QPR 5UUQQp  0Q   0Q0  `'A-`hPp5{@ @ 0% Ņk@ŕ\`'O-OMPp0P* b5S 5唢@TE  QP@ ET \T 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0iJ JQP d d0P Eh0K/0h0 S0D! ,qr0d 01( N j  S  S,10,1#40L0sK?000/1001001#40>000310 00 000T0 CJ(%,5QP Hd d0P `'&H'/@-@ P 0 5`'0/ᐿ'0/ᐿ'0/ᐿ',@-@-  R 㹫%G-P`pS@0S  0S X| U T~Y0S 50S[@ n됿'BH-2V-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  vC-M Mq@` @pPPݍ Ѝp!rddPp=0D@@rOVP,0: S0RP00 0jPP :P81: S  S U r}PPP%PPPU r*PP @Pꐿ''ˌݕ@-1+0P  44 0V Ѝ   M' 0@-4S 3/ 됿'@-R00 @U 0 $NR@'@-R@LNMyR@G-MM`P@p`PR0 `: SW/H`0P  rR \R00A 0C @H#@ V& 0S UP0P帐`0PPJ0: S,^0"<P@TP&Ph `OP  `PP @u3M`@ S @ S@PfPZ PPn UD e-@+S R Ua<PXp!t0# PU\00`0L!0t @P2 -PQ0S`X `PP0 PP W80% ܍Ѝ~n|PUz ftUv TrU Ya FoF F@ 0`( "4`#/ p@-"440 @"440 P"440 "4400( $0 $(1L XX-Lddhhllppttp p@-"440 P"440@ Q0N0K0DDE0@@?0HH90L`LPPTTX~X\{ \`Kp` pK p@Kp@-`"Q@Upf@p@-@P 0 000pA-P@M4Q->C/->?n}C@X=X\:\79>/9>:>C/:>CF/ 0? AC>/C>mG/F/E~EnF/G/ 0X J~pXW}m  $$((,S>,/S>G/F/HHLLPPTTXX\\O-P@`Pp !"441!"441  $$((,,00Q࡟\5 S L5s`PҀp0,$ $Q p W ^4vTrTpXnX\j\`g`dddhah`l]lpZptWtxTx.0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P \`" :x"0S1 \ L0008t 0 HP( $0000S m0  0.P3 p\t.P#0 0;"0K 0 8 @   0 0S r n  P1 "].P ЀL00 0P0 H [ y 0?0 X0p20J0  000r00S$ 2j0 H0 h0H [0 Z0C 03#  4 S 0040EP!mx1 0FB 0BB0  k000C0 0 S  8  0000 1    m0000 0 !0vs  0t00S ,p'F'+ ('$$g9'X/'QcԲ'٦l^oG-P`M@HXpAZ 10S t10S 00 0O P<ЍG(PE@U> 1 RP1H i0  P!`. H 0S$00S U  0S  PAP` 0@`8@Pp1 ?>\10A0I00 00 0 V0 (p"(p p1 p#(,` W Vp`0PQ%d0SP 1@0  XPP00Ϡ^P0d000 A'|''''' 'P0p@-P @?C>800P( 0^!SRp''֨p@-X`0SpL0LP0@1CA0Srp000pj'' ' 0 0 /'O-H0MS MPp` 003/ ލ Ѝ30 P00 +0G000 tp¯0 @ S 0V  0=0W0P3p!0S& @3Q2Qg 0*"  10 S" 0[0 02H+ 2R2 t R9X:000\P  $$+ "2P Qv{ {  Qt Qʰ1+!!0Q3 !03H0 R0C?o20SF P1 B <+B0((P4 RP& P g P 0S 03/     0P  0`V c9|'''''2@'0O-S㰄0`P0 V0RM#@M( , : S T \p"(5R4<R P  RSV 0 0 h0S  =V ,=v0 唓B?P<0` 00p0S 00W \ 8ő @5D0LT 031 a> QPP WP 0 R0:pp'@0@-P@80\U< S0 80< 00p@- P0@U0p81 R0p8P@00S 0SpsP0Sp 00S Tt0S 0T0S(3p@,_''h$'ypp'By@-@M`pWP 1!  P xp`V( e 00S0H0S 0 0 P0L ,00Stt, ,;0)00Ѝ@L&P0S 00`ЍF+p'''0'0''0@-MP `"@ )Q Q0 $0ASЍ000꟩h5O-,Mp0@P @P(0S @P,Ѝ` T0): SR 0Ḱ0 s:$  !  刡 Q01:` V `3 V `! w P t(0`S @P0!$0 0S:R 030  `(`!\Ő\  ? 娣 ? '0匳 j:0St30Z SZ d3 R #R Lr<3 R ?($3  R0\ 0㵯 90 20 00C 04$0S4L3 2$ 夂 B *#2T)p20S h{0 0 0: S S-  S5000000sS 1 00108q' 1Zp 9 x*e 00 0ˏ I0X0 &Q0T @ 0`; C >!000T00S 0C600>*%P( 0ˏ d  0T0 C c;  뫴 h''|''ũTP'''U '''''O-lM3P@ 0p#9`!\P  ? 尢 ? &0 \92儲0S0 S 0h"S 3S Tn@X >820p] 20SPs \`X00X010S, !9#'00X0S 0 0 `0\ *l!00ST06 0,!S0\P 0_P80 20 00 04$04L3 2$ @  *a"0(0S 0PX P& PlЍSu pp5\t2`d|''TP'''U Բ'0'0''''O-Pl20Pp0@P"`V 0 0 Y0 Ѝ 0k Ϡ?R 4G g@ WULQUW TV A0 %00100 @ ": @TPTpF@TP T  @T 0  P T 0 !00V02 0 %` 0 70 7[@P 0 000\000 %00S0`0000 |''4O-Pࣟ4MX{3Xp0 raPp0 g3G0 GA3B3w T 3(<P 4ЍhT+a83 0p R OA 4000?02@20000<T 7T- @ @TpT0y6@TpT 0 0 0 @T p & T 00  08m000XC` 1 0b(P 10010SZ 뉑  4000?0娱  0 +70   7Y@ $0>  10@(Pr 00 p4000?000S* A0 0000 0 @0S$p0Yl 0 `00P $ 0 00000 $hQ'|'Oo@- ]묪%s@-@P `0S 0S 0 7 ЍpO-MtE M`P0S 0S Hp P 0Sލ Ѝ 000S  P `0S 0S 0S >0S} 0Sx 0Sdu0SP.0S 0S0 08Sd s/2#' 00 " " 0D@? !? 00? 06 06d!! 060 pPdu0SS "04 0 R0  0"? 0 , R( 圠*,4ï0AE8?S% 78P0<P0Q R0" |:0S l5hbPUt @0S H*Db@PUn ,!0SP@PPDPtH0S  `>Cn* loxl%|0S l,l?0p00S00/%P 0,0UA:000S 0S PL1 H0S 0S,0S P  G%P   000(\P 0Sr P PP Pp'5?Xoǫ,Mrά-T[x'%߭O-PH0pS`M W0R0: P <"p`G,"0 S m20SQ _Ѝ౟࡟ 0@ 0 000CSY?00 1> R. !P\!0  S  L P (  . 80< 0 @`80< P0 V P0  ?$A0 S@ `00 R 0SQ Q\ 0'Ѯp'''ĵ'''00S 4 /'00S0`( "4`#/' 00S/'O-M,M7L@"p<,W $ :00S`HW ` pIP( CXP 0 0 00؍,Ѝ:00 (+P t X%XPh0S  0D j@ P i0S  , C4 ; [; W   054%00! ?0S S :00/0S 0 S :V0 0#03 R00S l:0S7 `  0.2P: 0S R< jP0 zS04`Ə@5 K)Q9000 B?3pQP%90S  0 0  0L 06P 090S, 3XP09 SPp0 SYQ980S5  V0;R00*h0S- 8((d0 #0 (P ed80S (0 0x0`  (@(70S 0h0!7'(5SW/V S:'<V  3 #\  RHSQ; 0 0B D U0$00(p aL7 UPP0vX ZwPe P'000z 0@PP6BPx"zh0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt ?A7#Rp 10S0AL 0(  Z$0S 1000S 50S $0S 0#  t ?2$0S 1000S 50S $0S  < 10S0ꊡ  0_000 04 0 S 00  000 0n$0000 #600SH40S l4P P @pt3000 00S1 LPX S00H00S9 0S 30S2 \P&  0HIDP 2 prLtoPd<2 0Q\00&& 0:00@0S428040/<0a0#QP8`\@P 1P0H080a0A`pp3PPU0\(85  @5D0L 0T 32 b< RP1Q 00pZ800 3/ UV 0 P` P00S 4 \0S@ 4H0S*  0 # P0L B#P]8h'''X''.0'0''|''t'Op'^'m߰'''''>%''''XwҰ)86O-,,Ɵ,|M@P,0S%40A]HDLdP T0AX  65 $00 ᨥP 0@, R<5@|Ѝ 1o\%v' R  `  0p`oQ0P  0_S /  p!.p{0Pp?00 1> p'@` 글t|$\5Sc%Ϡ<# pD ?'0 0D40S<40W SW ,4,t`V0x@@0`S 0, dq2 0 [0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A 0 Ń># 0S  90S\00T0 @T`0V T?  @`@T` 1 0X20qA000P0P0$V !500 0 pS ;*00p0 VTX0 @ @ PX``W0`3V5L R 01`7: R 0@ 0 00   0K0 TR 1VS0`   0P W@*  A 04 00'|'T''''P'''''%p''U '9 O'sO-`pܐܰ 0M @ 0 0  BRЍ P PU QP ~` {{@ pQ RP Q @p''ĵ 0`( "4`#/O-dMX 040P0\1 0X1 PP1PPp 0,0SdЍ0S 0,`@d10 `00䰟@ 0D RpT0 :N`P 0R0A ST TX0S @PptS'|'''%'' 0000@/00S 4 /'00S0`( "4`#/' 00S/-'O-MH@@`MVP`,:0S 0P *S *`0080< 010S y0 10P X P )  P9`0S 0S T)D P00 09 #R0p0,0S01000)(0 0!"4410< 000800$k0P@ ` [_V@00C0M 3100 0Sz 0 0PtE0$S 0S '00P7~`| .0X0S01,000o)D'0 0!"44,'1px 0pp00ppP*0S  YPa 0 1n`YMPU `@  [ T80< 0 80< @00C0 Ɵ0 00 0Q.*0S  P  0"pWWލЍ0S 80< 080x5 0< S dW0 00$001 _ P 0S 80< 0805 0< S W0 00`S $`! B("( p  ᴑP@180< 0 80< U00C0 80R<.PSR$ .R  $PPP3P`080<4l3 R0 *30 0NP2 0 0q$Xp0AS񟗴0إ$$hhP0SS 3 00#20S40000LP x2 =#R0؀20 0 #R0tQ& l20S`20ST؀0  P  : S000 0 0 #R0 Q   0 FQF?d!d  @10 S& LV#R0 š!ɡ0S  0R {ؠ 1P 00 00lPd0`P00C0X?P8\  ''''O''@^o'Wɱcױt'ֲp'' /Wal{O-WM M&0AS}`@, vP7 _al hiP }P7 00[@ , 7 TP 70S 60V6 X 00`06`00ĦĶ100V0:6 Rp0S8`@aVwPV}Wލ ЍT P@P (  5l 0S ` F Lq@0 200@(0S S㜕u%p-`pG(pP* 5 0  B, !D ]850SU 00(000]/0n 0S U(0pAp-0SpG(pD bQp(?T,p040xpS@09Y(0G5 A,0 S1 #(R& S000000!Y"!"7 dxhp9  (  ]/%   ,0 S1 #( R S),)-*-{ {d` p 0S(0S , /2 p2W (,@R@ )'Ax 0T!W"!"dh ZR@ )'A 0 T dx@0 (0S 0$ QP 0  s00 } 0$ 0`10S x10!l10!00C0L10!P0 X00000C0!" }pH0S|@0{ 0 0C0v 00@qꗳ'ɳ'' ','p''%''8'Ll'xt'r^o00S0`( "4`#/'O-M̒"0`1Ca2@Tߍ0S p@FDAG@DPd0l p`函00@00C0 00 R2PU 2PUp0 0S0S)P@R1PPUPRPU P0:0000S 00"P D100C0(P X `PH.0P0!p!0 000LS" dTaX|!Pe 0 0w  W000pATt' ''%p'x'''('ȴ/|g'ThO-`쳟p3张PM @?( \P  ? 匣 ? c0 )`30SX30T ST H0 S 3 S 0!@ 00000CSFTYr P 80R000303L32   ?(` a Q2!,S Q0pB*L`2@20S P P B PЍS x 'Pi?00 1>!  R1[ 10SJ0!T  0 S@1`0 ? 8(00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 :Pp@|''TP'''U '''''00S0`( "4`#/'O-lMX ⤒夢,p200,0SlЍ0S 0,P@d)0P PD媻00040P1@ 0 0 0DRpT0;:`1AQ \`X00X00@SS̹p\t`d`V %P 10S  0ͺ@P=P 00S  0f 0S  Q\ {{00刹 0Q  000T  L  <0C|''Բ:%''t'b'+ȵO-MoM@P_00 ,0|2?0SX0S $5Sڄ0SXxPYX0S $XmX S R<f8?`0Vd2 P\20+! `" d" B+00!X d"B1h21$\Pl2ڬΟ\0C00p21`t2QB1l2? 2l2V0CL0=SLq Q\20B ,( 0S 0『$5> *]d>X>0S +0 0객 S0B$5111`R B- 100 ST $| 0S% 4 0帀- 00$%BR㨁0`S<B11@%L0ᨷPP  U PN 0S <P| *堀<<0S 0 00\0 bA?L0<5A?X0 =<0T0.H0+; 0VHRQX0h0@ @0 +8 84<ϠQ bx{ S P,0 SZ?^@ P< x;0S @ A>+@B@  C+P$; @@ &000P:J*y: :0S 4G0 0؍ߍ0<00<`/  `!.0i0S ,pd' 0  j00y+\0#Q  0 i ?T %0܈St90o So d90S 0l)S 3S  0S 4 r0 0t80S 8 0S8`0`80`O 88o;\Ş&"\ `  0 0Ϣd h  pBnj `b"368+?P囓)<TPD  0RTT07P pDP0W`C ?Q `,00C[S +Ϡ\<#Q  0h ?\0化S  7/0S P#D60夦h q60S 00t&\Q`\uX6PH60S6@65;o\Ş&"\ `  0 0Ϣd h  pBnj `b"36e  `$5S8b&x( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2V) 2D%S\2/< L) 2%Sd2/?L A)W=SL5s45`?? p`00SF[ 2$Sd2?/0?  (2l$0C(2 2Sd2?/0?  (20C(2`D0P ST0030^`0 D0 d^"{ `"{,00C[>@% ?A! |"k 0AS 20 2(2@#0C(2 2Sd2`0/0!!!`pV0: 0`P  Phdqz q08PPN$20$2<0S4 d~% 2,"S\2/0?! ! 2"S?ԀP5/`20PZd&p&0 0 %Q%000$5S `0t63 03080D ` ßD <R ,2`0,2! 2Sh2/0^>^00\0/n|'''p'''x5]I'''%T'ö'''x' '8 '1t'N'|''''''P'ŷU $5St2h ` 0pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0P3 00ᆡp`Y7 0$S\0000S7囡!"pW`㵏X7 0 %S\0 000S7囡!PpWO-PLL`@T(p  W @⧴joA-Q0 % C@*r`! 10" q0SU 1ϴ0a)0 a*% 1t10S 0 0T 0@# 03A0S4 K@ 5*< 5 000S 0 0@TPYUATt0Tp Pd0 0S L P<0 0S |'p't$'''t'ٸ0/'0/'0/',@-@-   X~z%G-P`p1&@0S 1 0S X|( mU -TY0S Գ0S@  D'BH-2V-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @PPݍ Ѝp!r᛫ddPp=0D@@rOP,0: S0RP00 0 PP ٬P81: S  S U rPP%"P%PPPU rPP @P''ˌݕ@-0P  44 0 Ѝ   ' 0@-4S 3/ 㧬'@-4%00 @ 0 $ (%@'@-"%@2  %@P/00@-@0S  @ p'B0Q0@?o2P  R0 P0 P0S 0 0SS  0 000/X xPPp  P R 8 4 Q  0/TTT8 '''''T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/''T8 T 8'0p@-000 0 00@P22=000=000X0X0<0<0@0@0p \0\0H3H3L3L3P3P3T3T3u/ h p@ 0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p H3H3L3L3P3P3T3T3u/ EEP  4444K4K4h  5 5d0d00000-P5BP5H5H5=Ch S>S>p@0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//'4O-M X hDhhdhP@quP@D@:0 0 P\kP SЍ ?0p  P\PP0S 30S30S xtp3p#0Sh d#S\ P P0S D=0RS Z$c*0S O@"\5S2 2\5\5" 0C"?o20Qh [řX24 q'8d p$2 ?:010S?,A!Ϡ<#\ Ÿ P  0B ? 0Se0S 0āh 00S |!\5St1\5P l10S(` XA. L!0 0@! 0 * 0S  0 0 00OG@hpİppHT* 0R A { ' '''g'p'('G'f'|'8 'T'˹x''t'''''"89 O-M *0M08pPᄩP:"O >80S  :P'"< p0: S \ gPލЍ48H0,hSO )000S  007 7009   凱` ケ8 |8 v[V``Z`T7P`VD  7P Q ᫧P  ᢧH8P0 0帯86 R>0 0p 0<&0&0P7p0p(60pw>0 P0p,2S# *P *P *.qVXZ hY 4[ 0SZ?관X V. 07  0 <\:P$V, Q3C ?|PeP 2S|3%8 S20#"20$#20PC 2SB404040$4`02P&V20A2\0@22 00C`/ `Fb 0 |{H ? 0`P-tT#0\`P`Q=S/0 5P` ( 2RV0 S0S_c 5*< 5 3 30S 0 0`20S 0咮#0 0R V 10S `2R\\0SD{2= C0 ,0|"t000 00Cpb&? p0("l `0S10S!0 R=S0S lD $000E p 0L%000X30P%,q *, 10S @S0 0'''9,'''(''ѺG8ʺ''#,WzͻT#ҼgBT*Rt'}6Խc1T'lwp'Ŀ''''&''''' ''M'@޾'7'' 'Ws'|'''x'''''=SZ0SR Tp0 <<00X3P%0*0 |00S 0 00S5 0 >0S tPq 5*N> 0:#: 5(1u 10S 0 000S(PPq00*1U 10S i|0 00<cQ0,zPr 0<0*(25 20S I\0 0倂0 RL%r0L%r0H00q" T 000cH00SPFPr*\2 20S * #0 0 00L40q"  400cL00SPs*4330S #0 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*d4\40S $0 0 04t R,5S0%45S R! t004e0SP*$5v50S T%0 0 00刅(0S xQ$ V0S0< x (%0S8Pȅ*5I50S ]p&0 0 08%<5HSR$ ( H00850<S_^P*t660S /B&0 0 0܆@%D5LSR$  L00@50DS6/P<*EL7D70S |'0 0 07 70S ,帇 0R" 0Rz7 0SQ `@IPLX  Zp@ Tʰ8 @/  @!. A@O@@'P 5  7,@0$)P0 ( 4   Q LIϠR  5d)l)t) )p )PWpp \9  1 P, P'Qڨ0Q, D0 0S }Pz*:: :0S NaD*0 0 00S \B0S0QQ 0 0S KPz*a::0S / +0 0 0P -B0Sh 'B0S !B0S^Q  "Q  B0S&!  B0SQL<Qk B0Svq A0S0 A0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*<<0S -0 0 08=0S 4=L=0SHm*T=jL=0S ~0Mh =w P%L5s0SB B-000=0L50P5?T5V>X50$E- 0 0B0T1 `R.B!!@tN00 00L 00*q>>0S ,?.0 0 0@P0 @DT@8 HLd Lc B 0b03"4 `@P Z( \?0S  8 H4L0d @ B b"30P?0S  0p00P6@ 7|6PtE h0d& 5000T60S 1S <P06  (6@ 2Q uV @ 0`P@@  04 8 <%c#!$c4"%S 50S TP 0 0 G ``0  0 04 8 L H$C0 5L5s0P500ߍTt'''0 \P/Q/ 0 Lœ|  ,PŒPŃ ,-TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S 0P 0ThSXSZTsTP`UU00Q AP 0S ?@?42`P"hR0"00S8 lr003Pb0S* xB0S* 00RE>0X4* 2p610S J]0 00SX:XP10S L:1 PQ`1*cX1` H10S 00 0H10S <*:,1 P0*A0`00S 0t 000S 0dP` 0弢 0嬚G詚'''''' 'p'|'''''('P''- '' D'j''t'|'O-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP Zt \P  ?HH  ? }0 )2r0S0c Sc 0!S 3S  00? 0!0! !!0S`0 0 0 `Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*Y0`0S '` ` `Ѝ0hS  $  B$ $ R$  B  |'''T'P'''U '''t0A-P`p`ATR 5@P<[0S @ M1p0A'80 0 1S/ 0S/'`0 5 /H0P 3S P 3S P///|'^FPO-0(P,0@4p8`\ P P0P` 0S 0 S   000 00 00S 0 S P0 v0       '|''Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐp0` R!!  P/! 0 P  C1  1 @-H0` R!!!p!o/ 10#/C!000P/@-T0` RH","""  /  /C! C!/! !/@-d0` R""""  /  /C! C!/! !/@-eqO-$5 SW@ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ .PP` PP` `esP P7 ( p 0S  ˀߍ<08 H(00,0 0000400!4 04$0D0(0P uWZ  pTp p*d X 8 `# 8s ,s s s s 0,0s0 s  Ꮨp 0`?`a8SPb   00*P*00W o 0* d@edA zd@p$w5G[nA-PMPp`;@ p@P  0P6PU00 ## ݍG-MM`P@p`:PR0 `: SW/0P  rR 00A 0C @H#tp@ V& 0S UP0P帐`0PPJ0: S,^0"TP@TP&P  P  ۗPP v@u3M`@ S @ Si@PPZ rPPn VUD e-P@+S R UPXp!t0#PU\00`0L!0 ,@P2 ᨗP;0S4`X ۸PᔗP#0 ኗPP W80% ܍ЍnPUz fUv GTrU @Ya FoF F@00S 4 /'00S0`( "4`#/'O-p\1T1`00Pʟ 0 h  X 3#ˠ121@ R` 0Y 0AP!0R00S! 4% 0%#s(0!ZXl000Z T00 pp8P,0'|''p''' 00S/'O-,Mp0됡`P@0V000,Ѝ00 ?U0$p$000 000P$00S X00 ? $0P000  $90ğ^ P Q P +Q 1 & 000|]2Yq `[Pl3  ,Ѝ8QPXLPD3P0QSt? ` { 33 $`Q0B$0 $0h @bPX$(`0 $0R. 000V0A+lP2  Q$``! $0@-P$ S0 000B`㼱"3@0 $0V' 1 1S2> 410S t1$ 0R00 00?000P+ 0o(P0$00 00{ $0 0{000 0 R  000`@`00S @|''p' <X'^FF^b'Q'',O-P1AQ P1a`3$MS0_ 1Pr1100` 00 0p8000P0@T <3P$XpXT 000/ 0bP'0Ġ[@    0S 1    MP PD0$Ѝ|'@'''/p'&'p@-P0 % .  @Q 0S pPȗ# #3 l0# #:>0 @~0SpP p|'^Fp',H]R/G-P `$ 0p@V` 0@`` V`@&!D`( G-PC4 `p 00ȠX㉑ ,Ƞ0 ,$ Ă Ƞt h,Ƞ 0 0! ## ?Ѝ  :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  ^0@`S ppJ` 0 U 07Π 0nÌ ^VQ 0V>  0P" G`p P 72 b0 RV1Q0V"0  P 0 P$ ` U P ``ЍsJ 0A-1àQ`P |0| ||^0@Sp࠱ P$` p@QL ࠁ PQ s} p@-@PaSl0l lle^0C800S   00080P4 PR*Sp0 , 2 ,0S/`0@-@0  L4/,Ζ0,0080S 0  -^0@辖'# ,0@-S ,0, ,,^@TP @觖6 O-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D5@D0  00 0P块 U0#03?\[[UX `0P$0<5Q 4傗O0$0 \=D 0 XR @"<p!8pL0(0$0 0H(0 0 `,0`4  0 4$]HP$0 PT40  (00\ 0PA,05S00SUSP3S` 4 $ `UQᶓV  `F000<040@00 C3 4`00DHpL`<0@ RS80 0 ,H0 PpT`_@P,Ph3Q 0Q+ 0CQ 0SP THpPL`P@ ЕT@P" P0pT`V@ !ᾕP` !T@00P0 0,03p(0?D00T P rHL PT0RP H-t0, `S24040S@p( D0> 0 P  X Z 1!<(H >`400 0Q 800800p?(00T 0`RZ@p(0  0 P 80S0 0C800S   0*`GO@  D e$@$\Ѝ0$0'1LBAWkHY NBAWl ~ G-0,0S0 a\Pᚒ@`00qW40S*Ѝ! 0 P@P   k@PpF A-0`c,0@Sl0l h(\PpᇰQ H0< D 0P@DT@<a C-0`c,0(PS0 [p@[Q |0l x@PEU  0P !  0 P P Ѝq <s X0sC-@0Ђ D`P 004 0yP 0Ѝp''RX0sC-@0Ђ D`P 004 0^P 0yЍp''0A-PQ N`p@0P R   T0! :@P 8+4uPe,'''@-,@P,0S <00'@-,P ,\  D Ѝ'p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp''|'27@-0S S2+, R0 ELi `Q |x PCaQ* Q( PDP <4B 5*< 50d30a3  220S Ƶ0 00@ 7.Bp#x3@ Ŝ ' 0P z`XA 5*< 50d381},10S ᑵ1 @ d3S, CQ,aQ$ 0AS#MP R@0a3d3*0Ot00S cvH0 @ S Ѝ08t''|'5kP'''' @-o O-0M` "##@0p $@ 0$0 ᰜpPc0S@P@# 00") qp=$ĒLtUhUaU$ bU P?i0E SLUTT,UTTTTTTLU p 0PEqp p Up`y%UG-@lpP ጙp`:D10S:E A p= o09 6X $$ fpp+ P%W00S $$ V`p YPPU `fV rV GTP$$ : Dp$`y%!=Z v @-#o A-@P`pPW hh` U  HA<4D   A gZB% @- R0Ѝp` P@YP 0 R SR  R $$20BR R P0 t,, P/00#01"$# O-@  @T \ p `? T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C-HaHqP@ @ 0^ \ ^0᳀ 0S@ 0S@ 0S@@00\ ?\CT:^ *$@A0607;00@R0@Q 0BR !C 3O-`$0P@P 0z'0 0Q P 0@ Ѝ #PC-P$4 p咓`㓁(`@ 0oQ P Ѝ  P404-0@-  Ѝ Ѝ/-@-00@   0 Ѝ@ Ѝ/-@-P 4( F 㹎Ѝ Ѝ/BO-MPp`@PЍ P P 4S x 0ᮍT0P$ Q$VP 0S 4S $ X 4P S $ᄍSG30 0 !0!p`0  0 0  0 @P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڜ  0 `  xB   @"tPY 00pP0Sp'ˌ+O-$MХ@pPP? 2R 4S  0$Ѝ0m Q Q0   RSRQ"  "S 0 0000 00  0 PPἌ4S 0S,  00 000 0 P0P0 <00SS PẐX  , 00`V4S 0$R V P0 RS  0 000P\ H0H 0000 0   H;pFUWs~G-`Mp<P@P$pn@#TC^t E@0$4$ 0840; p+np !₆px H4$$: S! R B.T vpD $4S8 (4,$0.B.  fp 0 0"dR04<$4,$(4$t0K>Ѐ 0  E  00`d؀E$t0  kP0`P 084S    0p 0gp 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"d@'>d@Uk@-@P 4B BRP ͅp <L4( VЍ@QЍd@!@-@Pp P P 4PS 4 gA- @PP0T p ` `Xp0 p$$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /O-`Pp M@6Pట` `P0P0000F V:Ѝ 1000 0 P6`P10 0 ,P U P"%  C$$0A@-"P@-@ t`RdbЍpP *P 4U R 0 t,6RbO-!PR0_otM`@R(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 T m0 $8  'P P  P rA-@pP`P 5/p 4 5/p 4 C-(00pS4P Ѝ$d@ 0 D  l 0` 060 ( 0`WP O-0 0P딀匠p@T Ѝ` P `VH Dp 0 ݋@t,+  A-P(`(p@0 @OT )O-P$Mp `@Ȁz뼰0     Q U Qx0 p `p X0 \ p`弉00P0 : 6$Ѝ" bd7O-PQ04p@ 00` ЍP P0S* E g0`P      04 p p#p p04pp  >Ml0s@-SX`@ PR0 ?o2R0S Ѝpt,R@- iR sR aR p` 4ep@-P@P (`Pp Fpt,p@-@T 40`PP>ppt,iR@-- 0 aR bR LR( *sR% tR@P 0FP0S`00p`(j0 t,p@-M `@P`j P00͵000S  㸈Ѝp")-2QG-@MP Q  ЍA~␀ p$㇆`Px hB~0 00  0 `PP  ជ11LzkO-$MH@`&P ,`$ЍPP 0 0 "0 $ Y># P0*Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ P 0000 0 pP +4  %$\ `  0V,S( 0$84 0p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 00PM 4$$   $ 0$$@xp7  .N00S 0@-C^M E@$ʇ$$E0\ 01PЍ0 @x("(!ᯇ"`#XT 80 Z @塇P8垇y%u&0$ 8O-DMP`p4 *2<0 *p 0S8 ! R4!DЍLRd a0BS)S&,,LLLLL,LLLLLLLL,,D10S 4 |P $ @P  [@ 㷃䰟P   T ἲ0 C0@   T ᪲0@ @ P@pgCy%t,EGm(%QA-p`(P@ᑄP 0p`P @00! 0$0@-@P$0S 居@讅O-20SK@0SD00J@ DP 0SD0SA \^<40$ 400#qpp, 804<0SP$ 0I,00 JP tbU@ qU H04 8PpPTЍ$$0 $(`VxJ0Y `0 XW0 0 0S$ (0 [ P*0W0 000$00(0 00qpp 0 QP Р 0 Zp , 8p p ,  y% l:O-Cnpሕ FDM@P# ᴈpX50S LDЍqP sP 80Up#  0qp PPp0#F$$0e`P P  0@40P0  0 H0 0$0#P  P 4  0(0$0 ,0  4 PSf 4,  (WUXtVP 0T 1 T00 S :0 U 00[( 0 40 40P (, [0V [(Q,UX? U0U0Xt.P p (V,#X@! 01p8 0   U 0 0CP_ Q QXX 0 0  4p P 4\ "$p0 0S 004  $ 0$ R40H Lp $01S 0S p0`8#8&h$ r/0$0s?`mph4 4$$  y%g4K p -KC-P$M0@ p` P!! 7p*0S00 P 0SP0SM \^H 0T' 10S#!Q `O.NP. a@ P P P((((((h((TdpT T w,$ЍP`iy%4p@-M(@,`6#,P X0m P00͵00~0S } }Ѝp"-2@-WM M`pn@T8 G0S @^< P} 0$$ 0$$ 0x 0|xP x x}x 0jl}m0 $8P}L}#<Wލ Ѝ{ˌA@-0@ n 00 0h 09Ѝ衬@-Ma qP@Pwꀮخ Ѝ@i}` e} p]}ЍY}|U} p!80pp\XT0 0 (@}8>} P @08 0@TS Q2P  Ѝ@!}} $m0 8 0 0 ` ppx}1S1SDPЍ@|!'6ESak""P `00CS`0p S00 P0S X0X /X}(%G-MMP"` |" |:2㠢堂堒rp@TݍЍ | | `Vj @|   `"0F0 BABP |0S81 B-Bt|Bq|o|$ ! @|<#§P%$ !P<#Y| pm0 $8D(O|$M|# b@B@|0 B7| 4|   E0S 0CS 080 | ꛃfj ˌ'K"-sG-0㜂MpP `@ P! ᤄpd20S$^PD(@6 lP`Pa@ P0X8@huP xP @ЍPP p*PPP0S00" P 0S0S \^ 0 Q  { {0pW u{  q{ Q h{  }   up X{y% fj@-LM@P`4 q 1D0 p T  P 00S 0iR TR a0BLR :lR s0BST pLtLЍT }p+ y%l 4 @-0$Mq` 0 0@P!! ᑃp$0S00S P 0SC0S@ \^; 0T 00S!   0*a@ P ꐹعTtpT T  4$Ѝy%0 4-,M0$00 0 00 00 00 00 0 00000000 z,Ѝ7@-@ P00A0 0;0 05000 P   S Ѝ0C-M@pP ` 0 00000 0 0 0sS 0lSp@ P$0㓄( Pp l@ P 0㓔) :p Ѝ@T@TpD C-`PhMPF @T8hPP= ;qP/ x@P+ .&w*00CS񟗆LHlHHHLfP P4 yNP o_P 0Sa epP x LPq`p HjMP  4dMP  ^MP  XMP  RMP  LMP  FMP  @MP :MP 4MP .MP l(MP YnP  SP ZPY hNP @X `NP pwe PMPU p"80xVx MP P R2")LP p nPk NePU p $ 02#W:0 $NPE  :ePP? [2" LP4 !0x|x XMP) !0x x MMP "!MP "tMP #`MP m0 $8+0S _oP  p  $MPp@0T ᳢u00Ѝt,Ey%  'B-ADNYf u~ 72<%   S%O-@-슟zMP` p :0S ЍO 0FS iS:C>`C$T/P YT Ѝ!PP Y P9Pf0P0  eP00$$0YPYaodP xdP (0YPTE MoD0 JP $0  4 Q=LP 4P]0P 4 "P$u pP00000W000000S 000$0dP `d0P(0 mPP DDD/p`P /p$sPP04 KP 4`P `P @ 5JPn H /JPh @0 SD00H0 RL0$ 0l` 0qpD  R$4,, 0qp 0`} ~m$4P `$$sm$4P`V+d`P 'dP g&tdP 1mP'8,0 o`P o8&? ` 0qptjp IPV3p o  IP   IP  IP   IP  $ IP  X IP q@ IP  ( IP q/  IP r IP 01S 0r/Ss?p, ղ Ѱ  IP s/ ~IPz$$l$4P(lP䳟z o`P  o$$0` 3qpS, p0x< JPj <pP < <(< JPZ <P EIPO  ?IPI L 9IPC 8< JP <$ 8 HP3 8 Z* 0c$ Bp $ ZlP$4`  0qpp$ DlY$ -< ^800$00(0 000M$040P08\ p,` 0$00P00T0  DX@0`$$qp$$l$4P000H00L0p`"$4'` 0mqpf$$k$4P `E\y% t,`QvB7<2   :`RUrADNYfu~ S0@-M@ P   bp@ @8 2mp(0Ѝ0  :'iF@-SM@P, b0H0P0X0`0h0p0x00 00T 0 0\ 0$ 0d l 04 t0`@pt 0 \00 DL`|`p9 5D Sߍi@Vib!in@-@  #  T0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01P A!AMsP8 0`0?oS c`2 06P. 0I06s0 0A. 00P0P A \As000 04sލЍp` s0 0A. 00PH0P A4 42A@rv`''"zwss@-6PP  s P  )@`T ЍpP  00SQV  ur@. 0 R !O-M@ Pxp*p"̱`P"   aP- daP:`pP dp|`P d `OFP 0"h 0R00  p!  6FPr 0SohQl @ kpal vd! R R RZ  0PW l Z ` SX (s<JW 0j0S, @ hvkP@ `pkpd HQ L 40R !01Sp0S 3/p\ U 8 XQkp \ [ 5@ `Dkp Ѝ8 :g>JˌG +]A-p_@P@`PP_qag` Pjk`P k`Pk@- GP ЍgA-MP p F@P00p`ЍpP 2 b4 jp !0 LGi@-@p @A-P`_pPX00cP@O?0c 1 FA-P`_pP:00dcP@:1?0gc  F@- $`EP00 Ѝap@-8M@ POEP1![7_P ;c0 Q0s0S00bPP  _@iDt `  b< P_`iV8ЍpdyH mi0@-BM M@ n 8p 0S 7  /  (0P(@0S700$0/ (h 0dP(@0S Bލ Ѝ0p\@pT@ip@-Mt`^PP bP@ T0T TV6b  P4 p 㖯ЍpU mi5@-M@   pЍi@-M @DP0 C6 p  1Q0r R08C88 1p`Ѝdy kiis@-`P p@@@IDP0 U6H@Pl2a P@ L)D^P 4 nЍpy k7@- P@=pX X PS^ P@00 <<60400^@ Ѝ0* kg7@- P@p` `0LծD&^ P40 005{^@ Ѝ09 kp@-M` ^PP00ЍpaP@Uxl@Pd㫮P0 +p@㚮8 P@ PP En=&?iV@-$Mp]PN00$Ѝwa`k@Pp d0 pPjHP P`@ p$dncxi@-B!o ЍI"@-0M00 0  Pphp `k@P4 ` @_hpp 0 dpRP00bS nm%mU nnPxi ˌs@-@`.PP  1p$ l0mp@-` MP@;]P ` ЍpX (   t`  P|]@gDvi 0@-,M@ PBP0 4 p,Ѝ0 0R0s0S 0 $0=`PP 0 D]@IgDyH fkp@-P-hp@@@\PH0H HH4|`Q P$qmpR k@- P@kBP'00Ѝ  p  BO\ ˌ@-]!@-MX @IBPD0D DDU40< 0~ p$!OЍHyj kiX@-MX @(BPD0D DD440< 0] p$OЍyv kif-M0( 00G P ЍiV@-@0=\ P$0$ $$4 \@ k00@ P/a CRWC/A CR=C/@-00@- M@ ?0, 0 p㸬 ЍiP@-M `@ @ؘv {< <G  nmЍ  ;?"Iq}bd@-F@#[PP ㅬmpL`P`0 P000mt0@`Vm`` X0h@ @@@@P0D mfdk03/` 8$"%Q//// 0L0L0/8$ 0T0T0/8$ 0\0\0/8$ 0D0D0/8$ 0d00d0/8$p@-@pnP 00p00D S 0A0CS0$P>P 0@p8$@-p0`' 0`P/ R/8$O-04M@@ !T20. DPeďůp˫ 0$ (`pVD@PT P p1cehT6l PP@ p 00JP`p R  P Q R/6 0TS $ P\(P  1/ P /d@0S Zep "SR(0Sdc\ 2/P W0 [  aj`'ɚ;O-MMPp  X p`%; pP$ 1000$ -k ӟ Pep M Ɵx Cep Q Xk k8 p$0Q k$_ X@T ⟟X00@0 0ePkT 0 @0㇟ ,0@4@ep 0$h0Pl0q 0X 40,@dpDg 4<khj0H0S $P31}kH0S=I0S:Z`@T 0 3/@: " ⟡렒M0S:00%  p"咡pM0S  Lk@ Dk @03/@r JI0J/dNpI 1RTa`"%J` 1 0 d1 T|p 1 d\!1 HjD`#%Js!1 @ t1 x!|1  jP@Tf 03/@0 3/ݍЍ :{i~i8$i_is`' ^3@Ria1bdO-@PpP  p ɩT ^X@\XPT!㵩X!`P `㲩PTU D1O0S 6jYcWchhW P.Z  P'  X@P! K0S 0 L0S 0M0S 0 N0SO0`S PPV i  `'g%@-,MP@wpP X`P(  p0S h9P =P00@ @-0, ,Ѝ+'8i(5 B_@-P@@0P  qG-@XXPP0 0`@ Y㔀[p[JPP  ᮚppP  H@@@h@\ 2's@-@{X@P00Ѝp[P[@P <` 定Pehu 'Ms@-@QW@P0 /[P[@P T` 党PFJN@6\4 '@-@d L=PP0P PPX/L 0 S@@00 >00Ѝy= 'c%0@-M@hWPcWP ^WPtYWP d0P P P P{< PDp$Ѝ06'7i:s@-@+hh KP LhHPH`X P! ,hЍph@ˌG+PG-M`@PK `ppP"㳧(  +  [ ap% (( px" <@T t8Pdhl2P\]h UR TЍ0 P1e@Pq $@ap 变5ht 0R ,hk)g g` p\|Qhp R%P\h gmKP;ЍGfQ\ 0Q    1 0PgP0 RS@ gg # g0` R P U 0pD```` P  :8i(i]mL w~\5D0 "bd Pp@-P`@vUP V  V`P ``` 00pcUTpu`A-@T 00`Pp [ 0p @-MPPg00Ѝ`0 000p@ 0 P *Y0PO 0 p 0 `P0G-@(P;00`( O P1r0Pp*0X!U0"R0 "00"SЍG0P 0,  \p 0 @0@-@P _ @O-`,@pP(0V0S 8ucP$P$P 40S 04S 0S(0p(`8P0$0S(PeO-M00X $000Ѝ 0Q`?  0Q> 00 :PP; XK?pP ,,p\.,4@[T /j@P00 D20800X5Tl (*H( R R[`/"00eUx 000 !Po0"0CSi 0BSe 00Sa25!445^ XpbPPT  Ჰ$pP WdXB  0 Ap; 0STw /PPZ!08!10#R0 0i8XdP Z@ H0 YP@T 0CS00x C00 X ^0:T 0CS wQ0x L @0aD\W@DAD\ 7@D@SB@0 0#0  0@D@ T]W@jdTl p㵤 ]TPa^< D]^0 0 0`0a+! )A-X Pp@`&PR00(B0PI 0 p 0 `P0O-$M`@ HpPX8 P W0  Psp` 0p0   0QA-@P00S 00QQ00S xAtap0 000xSXaTp`Va`   @0؆%k0Ԇ%7ep@- MP@ bU U( 00P Ѝp0 TPTT@ !F!0P!!`^PP  @k 0 A-p`Pp@ @P(㤠 Q AZ>p@-M@P`  `ЍpG-SMMPPx!xppX!\ p@!H F/ u$@T+SލЍf`P 0S0 S 09(00 1 ,0yZp4B@(0#70St0 00#00M/X0``P41S 80X4M/,`h :{i'Trop@-`M@jp 0+SЍpP  }  ᭔ R #D $Zp 01S 0/S A35 i 00S/@-@`'A-P@`TpP @ 0SP %A-P@p +`PW`㟟X PH0 000 0 p`؆%:i@- M @ph h` 4P?00 Ѝ00 1pg 9i@-(M @p V  6P00(Ѝ Q00S L F4P02 0 p0 :E9i@- np 0QSЍS   _'./ 04 8 <\ S $S DDD S/8 S 00,/(/$/PPZCPP`gUl 04 8 

O" D AJP7e]o@- M @ppuh !3PT0T TT%0H 0p@@,O@ Ѝi}y@ i@-(M@! X 0 p@ @94 p 6(ЍZO i@- Mx @03Pd0d dq<%\ gpL 0D 0^p, Ѝ yY i}iA-M< Pp!0P 0(0, 00` 80p0@@`@$`4 <0^PT100 0(000808 !p' ѝ  ! P0@ @   :RԀ00C@p0 00 p(Pv00ݍ@ T0S p㚝@ 0 @P0  S  0(m /i8`7؆%+@@-00Mt @p` `qrPL    8 p$f0Ѝx pi%A-BM`@( ` pP 0 P P PP  8 ! ll pz l R ]lmU#0P 6dp 6S30S |]0dP 6Rp 6SP@30S <] 0P 6@p 3Q? ]I0P 62p 2Q8]8 X "p 0S0 `]8 pu p t  p 0@\ 4PpD2Q <]Bߍ10S {]10S t]q] 0  `0000p]]PU0``0` Rڬx1000 0:S RL HP<;]`(PpQ 2]V pWP ,\.$]H0S L] \~]q]`0Q ] \8i(iVi') i8iii d؆%/ 0@-/\ˌeO-MM`@ <0< l 7KgKP〛7[(0'S` @0$00 `F@( 0R |P~$0S0'V$0$:0 :0: 0:$ 0:0 :0 :.\(@!0! X p0 /C BRZ  0  00=C$0Cɟ"! 0P PE ^p PdyE00X90IppcppCppPpp Spp@BppA`$ 80PX0` [!0X@"0,0,0S> [0( 0B'S(0؍Ѝ 0$0d(S   BS>C0CD(S Q:ȟ "!! CR  ##9C0C"!% 'S>Cǟ>C"" N=C0C Q 0*S ;S. RU 0C'S<L=T=<<L=L=L=L=L=L=L=L=L=<L=L=L=L=L=L=L=L=L=L=L=L=L=L=L=<= ===$=,=4=<=D=S07768666$82S# Spt 0S R Sm &S|h 0R  |T|0 L4[0, 0 B@, W0S 0S p ![p`W>Z 0R0 [`0S [0S 000 Z00C!倥娀`pXP0  @ Zp` Z0S W  04 8 <$S Wf0S  +Z0S 0ZZ ` 0dY1 pG4  `000L04HpY400 03c10S1և!u Zp 00I Z3 $( P  #P# ß P# iZp|P3Ip#S0S l[Z0S#  PTZS8NZ0S $HZ s 夢 `0V V"    0`1ZV4+Z0S 0X#Zg <Z` 00dY1   0G p00Z10 `0&"R 1 !o 0B0I Y1 $( !P  $P|! x Pt! TYpLJ|  lhd`\XTPLHD@<P0i-26g<';' $bfl+$ˌ{@"u+|P+3O88PEPCU T0Yglwp@- M@P`  Q4P aPp@@r: Ѝpi5@- 8@'-P(0( ( Ѝ@y @- 8@-P(0( (u Ѝy 0@-MMP "KR@PۍЍ0@2: P+ PP@$:ۍЍ0@P0S0S1iSIc0@-MX Pfp@@:Ѝ01$k@ir@- P@,P@0@ @@ I\p$Ѝy A@- P@,P@0@ @M >p җЍy 0 /$/-@- M,00@(000 P  Ѝ@Ѝ/0@?o21  @@@@0-@-  YY ЍЍ/@-@YkQC 0S/@-'-@-  vYrYU ЍЍ/-@-  hYdY ЍЍ/@-\00S 0  0000 0XpЍ'T@-@/PHOOp0vQKp yp@-pMPڬ2P0 PS 0P@ 0 0 00 0XFXp HlP@@ ((@,P0P4P8PS%00!0310@- Mx 0 zW@P \G SLPP @ , 0@@gWP 020Ѝ0$#p'\@-q4P4 @W d {W'U%P@-d0 !X !T@0 60\ (0000/   Ph0@-d`  !TD0 60\ ,00 00/   P-P040#^4<\$0000/   PD0 40#\00Q 00/00   PL- 0:# ^4 0Q$0000/   PL- 09# ^4 0Q$0000/   P 4 <# \,4Q00/00   P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00   $0@- 00fTP ЍH$A-Pp@p`WЍ P 3M@P p7@-0P@U , PT Ѝ0᷉A-@0nS0oS@p p㩉hP`WPoT0nS0oSUPPUPP'+@-cp0 VS%O-MM`<(0p 0@0D00 p0{Ip0S SH Q 00,0 0Oiy` q   p@-@PkP0 0/SpN p@J  ' @-k 4QN; %O-`@ Pp(,夐D렰0 0000 ?Yp0@DTq oPX0 `P@㩏Q9 O4y%t,l, Y @-M@A> 0@0D00 p0HpM0S SH F[Q 00,0 0jyN럄` q   p@-@PP0 `0/Sp p@  ' @-WN% O-`(,p崐崠崰0@P0 Xp00@DT oP0 ߁PT(Ё  +NA+'Ot, y%Y -MM0An @H 0P ,0@iHp Nm p@-@PnP0 0/SpQ p@M  ' @-j 7PM %O-PM@ P0Gr`"DXp)20 R. +x   &  x `!p 0 *00)0`VpHpz 㖎uPfPMP9 9P$ GP g@PpgffffDggfgfff8gg\gUP|0 0|00|0|00|00|00pt`x 0PG~PyKHp Z,0p0Y00t0V0;;0x0U&0K$00|00|000ЍY00t0t,y y% Y -MMJNP0 @P300 0kGpl0 0 0N/0 4 000@0NL8s  7@-P @00Lo SϜ 0 Ǎ Ѝ0 @-@B0P @@-@D0P @@@- @f00S 00S0?  㛍Ѝ p@-@PP0 㕍0/Sp p@  ' @-} @-:i40 0000,00(00$$0 N|L3Da %7@-P @000PS\ 0 P Ѝ0p@-@ \0P ƿ0(phPP,@PDLp@L' O-@H p妿PH ׺DDDf Vp,60pGWQu 2@FPmmlllllllllllllnl\nhnllllnlldllllqlqlq`rllLrllllllll n0PC@(0L P@=q吁H`( L0`Dp.0KSh0  R <( Lh0 ([J0 L( h0N/@  0.PP 00,P 0.0T0 PPT0 K0$00 00000|00x00t0 0p00l00\ d0X@,KRݍЍ~'ms # N}p@-@P{P0 0/Sp^ p@Z  '  R R @-ފ/n@-@M0P`p 0C000 DPPЍ0P0 0 0D0 |C0P Kfs@-`000/@P SCP0 WЍp 0`( "4`#/s@-`P@X00!  Pd00SPPP @;@9  0>KЍp'$ (002P0/0@-@CMP( P41010 0000000 0P L< 8 KH00Cߍ0Cߍ0@o꠆$ HqG-`0@8Ppp6 Ƞ,̠Č Ƞ,Ƞ D呼4$03 00n4408< h0e,b<0pE0< D(0|0040<0pp PH00ЍpHPD PG J'huv$ O-$M0 +@0` @PpT V0<00$Ѝ 03/ Z0p@ ' 0P0:@ 0 `  p00P LH0@3/p]P+ 0 P 0T@Pp0  !e|+P P @0 ` 0  CJ꠆$ C-MM`p/ P  P@1L#d8$#4d4# N@41@D0 0@000 @p ߍPHڀ@Td8$#Td%4'G-[ 0MP@,@{0P` :0P`P{] ⇻ 00| 0 P  Xf0L 00<0ppS0 W0S000S p |p`  hP 00P0S`!0!D0D00W 000 0  P0b"!4b4#P0P0Ѝ 000<0H'~'-0-M 00H 0@P ,㒈? zg Ѝ(5@->d IGN%O-PM$  0 @00@"b0"p0@@" Qp20a0CS g@PDt00p00@⸊p .! 0zP!z P )0S Q   p @zLz [!!D P 0S Q    .z @z'  ]p j+ְAp t 0[4S08pS @p @Ѝ?Bl,t,y%$ Y 16d@-MMCN@80 0@ 0(00 0@p ㋇ 0 VH"SH!PH(>0P( lIH,f<0P , TBH0L?HލЍ48H(4H 'E77@-P @ *0Lo SϜ 0 = Ѝ0 @-@<0P @@-@=0P @@@- @)0S 00S0?  Ѝ p@-@PዛP0  0/Spn p@j  '  0`( "4`#/ p@-"440 @"440 P"440 "440ޘ( $0 $(} XXyddhhllppttp p@-"440 P"440@ ᝘ᚘᗘDDᑘ@@ዘHHᅘL`LPPTTX~X\{ \`'p` p# p@p@-`"Q@Upf@p@-@PXUROpA-P@M4Q->C@->?n}C@X=X\:\79>-9>:>C(:>CF$ 0? AC>C>mGFE~EnFG  0X J~pXW}m  $$((,S>,S>GFߗHHLLPPTTXX\\O-P@`Pp !"441!"441  $$((,,00Q࡟\5 S L5s`PҀp0,$ $Q p W ⪜vTrTpXnX\j\`g`dddhah`l]lpZptWtxTxK0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P#` 2R  0  ?<#΋ 0 `x 00`0報 C c00d0 `c Ca c0b0 0  0P!\pQx 0& 0Ss $$TGQT`P@Uۅl 00 ЍO :0St hhȀv XȐPoUP,''U -TTt0p@-`0S[\ @ҳL00S000000B0E0p '$PP4 00/000/B10B1/101/ zBW%O-eM  dϠ 0@Ì `0 1P50S  100 R(0S\ PpЍ ` P5B` bL RW@QWR5Н|PP/ R, P  "D PD1  2D1" " P 1 21B0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C03`0S30 0C0 0#0030 3#00020SQd  0@ `?5῭0 ST0T00  B 0P SX0000Y0,d00? 0 0@ `5?᛭ 0喭댠 ,1#  0六 ! ?}0 00C000 \S T10S  2 dϠ 0@Ì `0 10! 20XGAT40Ax8 0 B0 080$0C $$  $ 400@40 08 R R` /  `1> ``& ''U u%$O-MM☵`, t51^OR0du@DSiaH519_9 ?E 0S/nE ?0?E4[P`؍ߍ 2@ŒD 0L 04;2 0d04 0l0   0SF0LSia441990/`&22220_E0? 0 040hl 0@DU 0L /0d4;0 0 0@$ P` 4 <0#0p R0C000psG9x'x`P20S6v 2䢟 0 000`0x  `  ᎬZ ~X PZPQ <,: 2\0Q0@/,040<09(080 P? 0P@-  0@őD L 00 /4;08f8 0 d0@0_ 0.1r 0傑PV N8`P} 0 /{\0X0`0d090?{(,0{ P { {F 0@Dő L0 0/4;$0 8!8 0lh d 0@Ì `01$''A8$H$''TO--)MM,0=0?0(8$08D0D`0S> 80pW:,0 0 0 ='''''X4 P@P`P1 P@ 4 'p83 Ep@ \3T@  C@SPp *T 8@P lC(J0S0,5 Sx0<0(5002 0,%S0022Q04>Y 0Q|y>Qpp" 0 04 0A Pk>C 040A 0b>: 0 4QY>1 00 Q*P>( 00Q(G> 004 Q>>1 p00W/0G,\3Sr1\s vXXT1X0SD> X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001= p4uP 0\0 a Q#' '$$'''Z 3 ''n  ' T!'D!'$ T'$'''2! dS,QS18$Q<4R:x= @0\5 ?>C00p#!3x00084$0<0D04t p@pu000pXsL5P5| P4H   ?8@`D ? p?iu`XtF01o&"  A00&"n0  4%8$05<4RH= 22 p8400 0 0<SoPx8N @ʫP@0 ? @P0峩PP* ? Ჩ@PP(5#R0:㫫P@0$- 000[0 a`Ә%"`0 ?001>0[`0 c2#, SZ QZ3 ?001> !00   B^B0[P`0/2"0$ 0  ?GV`1V`#T0`10F 0BI ? < 0B@TPἐ' 嘀 00B1  B[1 ` Y"B !!0 R0C!I0B? 0 `똀 0  B![!0`S1B 110S ]<5u @P`x1 0F<Ĕ84CP0S`84<Ą-0$5BPSQɑ,`RB@L0 0 000060S|0` ?4HL4P0@0 6@lp;'!F5Lp00R  QD{L7\5?>C00!#4t x0Yx7(T0#2! a, A3 31  0 j@P0 04 ` s 0H$4  $ ( B, @%LV.  R*h 0(E < <(b X H( \ P( ?.@Xd@+@B@A.@B,-8 He`  @40 `Ks ,p8d A YZQ  jsZ0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423tr0S+v~됺 ~z000d0S CQ c6Rc(`P 'z'z {'+S; @ z0犸 08z'(sȊ (+S|,; 0  R0:1P000\xP2#00,Q@@00 Hp00 R00!&(0 ㄬ0Sc@ R: QP0 넠@t: 1J0jF 0eU`K%00S>'^Fb!!!'!' ' "(%ht@%6" '"T'U "T"\o''"'$"''8 ' `00Sa  0 $#% lr$0+ V.N|00S  C 0=S, 0S 0S0$0! ,00C."$\ ^  00 0?d 2 B< b10 !9$1H p 3PP04SP0 0R0 S00C0 S 0,0ᬨ0P0B 0,0ST& p开8嘥ȿ+" < Q \%l0R@.  (0 0 @DU`@40 4Aq20 R40@ `0```0T04( s 0 r` pP3$0X`0< I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01Q0C00h0`0lR#00B1 d0R*8%dU0   (0 0CH0 (0( 0 R R` ` Y 0$5S  l01` p0000S3d0%ST0T00! !<%0SP5X0`0`P500Sd0 0s p   j0000080@ S`Q qH0+H( 5P+H⴪ pH000-ᴰR㰱 ,  BU 00S0000T0 10X0岑0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4040CS T0C0@ 0dw`h4  80QT:  $5SʬG $`$`(0wV0S ,4 T d,04  0,4 $. 00`  VjZ0S   0帀0 Xx0#`x X\># P 0?d @ `0 < T9\%R `i0SP,xi\`/ `ƌ$  $ l0`S`  0$5S  l01` 0000S1dᤦ0<*ST0T00! !\*0SP5X  ``S 0d.먐 *   $ 0z00080@%0C40 0400T$*, Q`?0@$00$0l0h`0@ppT:S $S0ppS $S00S`@0P{뀐 H({ 00@|o8p`0x41pY70I@X!@z@000T: 5@$\ Q 0@08(0  (0d0O@N 0NC n 0p 10SP=0S0 000S.608CM = R0ł."\5S 00 0 d 0/ @. `3,0 0$ $ 70000S0S 0,00C0S0 d>0S x60S 6>0S 0n 600:*,8]P>0SNc C>`?0S303040404 0#pCVW*LuV.啣PdoV.GVZ0S ?0 PS?\5=S,F??^ E?+0 0S 04 K dLĒH 0@Ì `04 1,$0S0S 04 3 d ,04 0/ 04/)ݍЍSngG-`RMXr@ uPP` quPP` ` P P7 ( /p ,0S  Pߍ<08 H(00,0 0000400!4 04$0D0(0P .WZ  q/pTp k/p*d 4uX~$ 8 `ᨧ 80  ,b  ^  Z  V  0,0P 0 L  ᅧ /p 0`?`a8SڊoPb   00*P*00j  0* d@edA zd@p$w5G[nA-PMPp`;@ ;np@P  0P6P-U00 ## ݍp@-@P&P0 t0/Sp  p@  ' R/G-P `$ 0p@V` 0@`` V`@&!D`( G-PC4 `p00ȠX㉑ ,Ƞ0 ,$ Ă Ƞt h,Ƞ 0 0! ## ?Ѝ  :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@O-4MX00\0p0`P`ᢦ0 ,0, 0S% P 0 smS;aSMSASB0C0b0C SSSU0@0T 0DS d9R$ 0 d"P T 8 0U$UQUDT P 0 sS @ @ @U00@@@ X 0t0  Phs0S00 000 000 P4ЍSr@-O,@, 4R2%"' @-0 @    O-@0p 㨥|`GP0 00000ZI00SB_: W `B?F ᴐ''P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p'0P  C @-r co`/* r#s@-PL@` 008Y2V  @rЍpX''* #s@-PX00SL0@`ă5#000<82V @rЍpT'X''* #h10 PS/C-@PQM@MP`6`@f$a ڡ1 P0p9 0 T:@6S0O@ kD6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PTឡ 0+ۍЍT''X'p'\'* G-DB`p v/PP("(r 0F0( 40 n06# R 0 !q0 60C 0 !q0006&0=06 0  B 00C0( 6V0:!$``Vp 0,0$&? $0(0 6 C c0&0 $&? 0`L0SV&% V0: S u&0 d ЍGE1< ((C'* ##$7$X$A-Ta00S FT:p.PP  0 0 A1S0S1 P @D A01 S Lq0S @2106&0006   B ! ! 00C 00'* [$O-GMP@X@+?P>U㰐Y  0@00D/60d& 6F @  Hi Td> R`$0p2 h XSQ 0@H0} 0 R (cR 5-0$00ᓩ (00UC(0  , (0, P  @R 0 0 $0Fݟ 帼0 060 6Ο< 0 $0,娌D (@(200UX,0000@h P  D`0 0H\ d04LP* * 0T0;L05h/L0So h.;PU ờPc  'L 0R V0400$ & \`# @ \  110B0]F0D$Ac0PpepeC0CP!P`\` :00p<-P`0"  X 0(0d0040\0080<<0(02,0 0C0(0C)@ p 000 SJYLj 000 pS D!*&A 7 @ s0|) 0 ( "*i0 6 !"0H& 00 9㹆PpD |IH&0SK9 R070Dlo$0S 40S `PD@ 80S<000 Sg0C  0Zp, 0 001(0@`@ QHR'0 Xx0S7 0S0?0S00 0  C02#(0/7P p D)PPXP 0R SHS SQk`@pb Spm0 00 Y:Y:tV3006X  0+(01 0J0 JDT  060 6&4Ħ(6Y:$0TSL0S d0 P V50SapW~@0S 儐D5L R d0 P# 0PDT%_oRU+E.&0#(H6 C 0 ᓔ)6 4՝ 0눔x ܠ6`U0CT 00C0CSX: BǠ5Y1 21[0!!!0 Sq# 0 ᓢ" vr 0 0d$&S: 060& 0vg0..xGz 0W4#0003 .pXk0SMf`F`VI l30SA .W .D3PUBL0S \0:`0l f  PP1z P#W37 (6|0X0000'09630 ;Pp`.m~f` C.p` z(X27'X0000v'f&1 #?1# 0RP  *d "x 0 |P0PPP!f v*w`P!\ *P 6 p!dS!PU:< U*!:0U:-0 ,0 xp$L0S\^UB: 5'\'s$`'$X'$$%G%\$X$%p'%h'`$QSN%'x'&'&P'>&{&!T'&* &(%ht@%""\oAK("&Q'v'''+ (t(t$d$A|$+ (''X'0Q:BS! n0 B6 sPd  00 P S %%* 㑐  0p1Pl1  !7P 8 `U&@1`P`60U/0 x x L0S `0 1 #'$/%17&\X0000|_&&09020 |P((  /0 `p|2& 0x9Df0?o2U+u&0#6` c2H屛 H0 HDO&GߍW@G-`RMXr@ dlPP` "lPP` `P P7 ( J&p ݞ0S  ߍ<08 H(00,0 0000400!4 04$0D0(0P %WZ  "&pTp &p*d kX/ 8 `Y 8 ,     0,00  6 %p 0`?`a8S;fPb   00*P*00a ⥔ 0* d@edA zd@p$w5G[nA-PMPp`;@ dp@P  0P6P2$U00 ## ݍ@-`p$  @P00S0?0\$ 0S 0 =kS\F\GL \ dtHgL0 SDKT ЍE%KUJ%FZO%A_ 0 ((@-FPP@PpP`P Dc,<<E0 PZ,U@*(+ ,)%)A-p`P@ᵝP V 0 j(G-`RMXr@ kPP` jPP` `?P P7 ( $p 0S   ߍ<08 H(00,0 0000400!4 04$0D0(0P O$WZ  $pTp $p*d jX 8 ` 8 ,    0,00  ڜ i$p 0`?`a8SdPb   00*P*001` I 0* d@edA zd@p$w5G[nA-PMPp`;@ cp@P  0P6P"U00 ## ݍ@-0H@\   RS0@  0 SІ%0 /(Q@-$ Q:Hu++O-@-yM Mh ‗`010x00@00D00400\00L000 0<0$0H0(0X02000040080,03l0<080404h04d0F00G0`0H0040P0050?0,0 SR hX0S "PX@\0L 0H0- S @0D 0 ?0i/#"p$ \0@ SL0@0p$ !P P x$ 0@baaPP##!p$ fv#P T4 \H0aS 1L\ : SRQt9  '@P@0j V@r@DOoB@b} P pY00S  Pl n pP 3m`PUb@0D 0 t0@ 0$D0@0D QP  D0N@ [80S~0x S10S10S00S11011|0 0180SL0 RS 00R0 R0S> /_,0P00 @R  T_\0Sj 1Sg 1Sd 0 @D1C0S [  [ *0SR3#:\00<0S @!0S ɈP@ T <0 0P U8 JPpD8]P@@11 1 1 d000\0`S`Sx0S4\0L 0H?0$0 Ip+ p`PpC0S)0p2 p1S?V?`#)$p& a1S)p Q1SAe1S X$#$"p< k 2"OKK@0DKP?`|L0OK\0K@L0 0Z0T0Q0S<I[# [ [  ? [l0S |-80S l0Sd0h 000@0D0 0#h0S  d0S   T*,800S0 [0S0S"  0C0T {0#Su0S0`0S SX e,0S , 0C4,00`00l0S1|0 0S010S 1h0S(1d0S,140S /㟇40P(0&'B0P(0 (pp(fY!0P!* Rb R ᆔV000S(dR0(0S00[X`1 00PV`5U0000Aa0pY㤂 ,ᨵg'HUU pM 0 pSf:Yf$B0p<Up` u ?2 0`SM:(!XR&0S ,1 S$40(00p000 [ 0R5 R4*P (!RP5P"S4U $R,1SPP,Q,1 SR U |\SRQ SP" 01S<1 ԕP3P%P5 1CP0ȕY [0D  ཕ0P000p+!`GP1T0b# 02b!b&X 0S [ ) Y': [ᗕ00ŸS#,!T0 S:0㈀ 0[傕00@ŸS#{00S#? 00T0`000Y00 ! 3 qW5e:0+a! ` +!  G0  B [dQ [XQRU10A+!2"?Y0 0@b"0` t0 +! 0" 0@G0)0S1!YV*0+++,, ,)ˌ0,i4V,؆%,i,YYy),,B--S-,,y----L.#.|.../?..&/.Q/s////I"00j0x0000000000800%(1gfff,. U81RRaArrAa [0 [00S 0, S00R , t 0 [0 [00 \U* 0!A ,10QR0XL%101S0S0010 [0]S 03 $!q515%000 T0%P0S %1,0S %1\0% C?0Y0  %>00E?00!0D%1L0S X%Y$! p%t%Pr(bRQ%%,Q% V%H0S yލ ЍS0315q50 [ 1 1S|0_ ?#H02!`!PP dH?C#q!Y 0 T02#H0ג [00H <080$40`0P0#40d0,0#40h0@0$0Q l $   Xt  0|0 4Q0X080 S 840S d8“80 0l 0t%x$0040S' [#,q4 0W0W03 W00S pZ@ D0pp>0S p p T (  p ᚖZ [,1L CS/o" R `0 0 0 000000P00d00,00h00\0001010100 [L0 @ 0  1$00(0$1,0J?03K?03)001x 01100 0$L2?@1c4 04v 08#$0 #(#<l 0& 0($t ?Q X0Q40S00|00o00 0 R  S4XT I@'? $ pH TS l (!R R S 0 S7071011H0T RZ* J~Q\0 [0+0  S  R   0S* 0H0< 0JR?o20S F(0 00 25 010 0P B24 0180S} 0`( "4`#/   k B* {S@--Kg A 8 /eAD00@- 44@4P\P 0B"" (-@=B'(@-> O$!u1%G-@P ` a!>0rP V0 0  OPP G؋^pP`0/X 0b0S < b0 fV (x,232s@-@lP 0  9X X0T#LЍp P `9$ 0"(ˌ(M2@- 04#$$04IQ   D# ЍU2ʌ@-$MPp   @w1 @00 !0 0*#))$#1 p#9`P\pAT#9D#TV@D:$Ѝ#]2222e2p@-0M,AP`  ֏ 0 0 010R  2   $0Ѝp@"R  #   $R ⩏0S1#$$ 0("( 18#! 0Ѝp@"0Ѝp(22323  @-jpa(C3L@- L0@ R0* 0 #  (P `00CS`0p S00 P0S X0X /X#(%p@-`e@8!RP#<10<10 .810CS81V <1S 0<1p0 hmdk`0>Pp <10C<1(0 810S81($%%(0@-@-4MT '"A`#"d "hQ "`"R d2RK" !d2SA |= hk0:P{PSP1A k> * +['Hk;[E{7 P (+S PPP ! 0 @@zj{ k[@  k[+S!4Ѝ00B:|k{{'*k[+S!@@?-C6?Y@0(]3(z3333$3X(x((43p@-j0d2S(@0@-0S0@d2S`2"R2$(@-@ 081 ^"44”P -Q\4M2=p2 04?o??"@p@-0@ R R 0 RS000p\RP 0SP0PP'R"R `0S SP0%XB{B@-@ P l00S\ 0@ !0R3 @00SP P990)))p@-P0000@`L?0@ Q-00B 0$10S !0 0C!0R3^0 P 0 0 0*00 R(((((((((()(((( R  C=00pPPd 0#0%0&P/0@0؆%)))B%A-@P`pp P0 SR 0S0B0Q3 4@0 0   u))))P 00CS0 S00 P0S 0 /(%A-P@p᲍P x ᠍Pdp5`2`V :<<0/S0 R0Sp/Q  C0 R@ `/RR FR .R<@` FR_P @D T0t/S(`0/R /\O$"%B^oO-cMM000@00<0<0<0 <+00} AP 0S,03,0,030S3S08hllOP \|\ kT ~ }00 3 S ᘊ@@ 0T S S00 0K#=PC@P0S+K K_30S3/S:K+ &K0 @ O@PT[K>P 0$t<  t0  t$  0S  08xS`S*?S DS . y000Oy*0C P K+ C 00CK+ ★00CS00Oa0CSP/D./\00D.D.$1D.D.D.1D.D.D.07x7D.8D.D.7H87   \PK 0@P( 0@09  90S|90 0K  K V ׉D  6PK 0 Y PK. K  ⺉  PoK P 0K. 80  ⠉|  @PU T80S7  ∉$  P= 8<08808408007,07(07$07 0707070707 0707070'70  X  ⷋP K  PP 070Sx'0 0C!0R3x X70S0Sq K 4 @P PRKh <+PK 't0@Pp[ K> 0 pt`hP@@0V"0T  HT\HX0Qx0pW h pR000QSL00D0QŊDD0@T0 ` X\ X0S 0V)PPP PPz K 0P@0 K. K>x%x 0 P `@@pP @ VG|  0S$0 0C!0R3 0S0S 0`0P `0P c= 0,C 0  R+ .t = v0  d0|d0`@(4 gyKR p 1  1 S 01 \Q \HHA/p@!bJ L0 S1P00P0P D0S( X3 R  h  X   `H0 S   \0T0 S d`,@0SG @DUYC    dP0S|& x 0 d  RPcݍЍ 4     ?PPA0S, zP ̇  +P ⿇  Pt ⳇ  PPh@d0SXTM000+ MP[0)[&)) )B)%BBCB8Fw)$;>aC%C = )cCCCCD'DFDlDDDD ED+EMEmE]CACvC))gfffE`EO^oE$)EҎET EEEF FF%F@0@-0iS03S !b>ZP))^Fl0@-@dl   L @0 0 )|FFFFF)@-`0@Px0 B0PU1 S2P T0p0S @0R<<4, 0p Ѝ$))Fa%FC-PD1`0B8! Y!tMR!p@  10S  tЍ000iS00S 00S  d `PW @ 0  P ( P000 p 0pf W@000$))F%))$F`0@- B@T0@T0@1 S2 0P   0S $)O-tQ0S hhT @P 0S <@  .000PU2 )%II)0A-0S N넀pP` U0(@TP`0  RF000S B@)%I)IA-p`P@P 9_p0S` 00 0CR?o20S 0DoS 0I%JIp@-/0@P 0Pp SRp)@-8i0S$ $00  0 J)JaJ>J%A-P0@0`/0000 Sڤ/0>+b T0 P<uP0? 4 k00?)*$0@- @00d}0@0Ѝs@-@P`P @TZXX ?0 00?I}+"+R  +  ЍpJ%$0L<S/ @-tP*$$2O-@`CMV b@0DXCߍpTW B/ ኆ0 S'44x'xpH♁ j@t1P0S8Q 0SD{'{{g W:0000[9*0S 0 0S 0 000R*Q 0S  `X0 c#.$cc4"0,4 4Q0 P 00000S  ` )*%JJK(&*)D@-= p @,PI 0@0$ \3O-p0]MS DD峼@c@C < 804#00RS   #0/Sp"& >RPP "NSW  0"00RS[  0"tSpd"lL>PL"L  PpHBHHHr0SPY : SVH`P؀/0 h10L<aS$ 8 8  @ ( D `  P  \  T ؂ +b P< WsP P p`0?0H @P (?P)PD ~ L P ?PAP|]ߍ)%)K)))$HKUK-*K$KKiK() K)Kp(P\Pd* L%%L@-$@0 00: S()G-@ q `0S+ P 00S 壻P0 S00P R HRڄ00S t Y `JP 0 Y00:$00S ( ))%:LSLwLO-AMM`P@g8pP 084 0 AލЍO/00 09/P7 0p!p u `Q D D @P <PD z@P@ H  C >PD b@D tȠ帰`TAލЍA. 04B   R ;0 0 D E@D W`0 m 0 D W`*OL%L^oLA-MMn00 /R p@`&PP 0S P@ۍЍ0 D &`D @P 0V jP`*p@-0@ @P  P@p@-@ @3O-tM0 S tt刺p00RS`3`  T3T#0LC4#S@<<tЍOo0 (PL   |+x0p`00C ࢟ಟ@L<` L\0@ DWI < h`VV#W K@Pp L<0@'pl0xSiSPcP 0'0@$ 000 L<0@ p\dXL =tЍ0 0C0`10S 0S`%0` S\ X h0SS  5850S d00X00\ `0F0P!ac 0<d )%M))$)K$.M%DMGm*nMyM))MMMMMN)k!NBN[NA-MMp`@PPx 0p)h!h@PX TL"r< 0ۍЍ aD D< / PpU U`k p0P a˂ xZ0S p T0TP 4 H벂8 [EpNB%|\*)()NNS@-P@-H@4#S 0 g 0#S 0^@ $0A-@P` 0 P0:| 0pp ?}0@$aH00S$`Q`QjQQNQ))QQ())) R 0`( "4`#/@-@MQ 0 3/00؍/H)'0*e#(("1"00@-@MT[0Q@X0T L0LP  @  E Ѝ0@U@*I()0R%0P @-0  ()VR%0@-Q 0@T0 R || 0AS@ jЍH0H Pr~ (  $ )*%}R%mRA-p@@P 0 0S({ ` `b `*RL0@-  Q4 0P ((   Ѝ *()R%@-0xP 00S@%*S`  P@` 40P  $ 0 Ѝp*()S%R0@-@0S 0$P B5/x00SdPP 8tqpH0`P@} 4 0@${ '  Ѝ)*)()HS%p@-hPh@4S 0SP LL H H0P0$000R0p 4/*()|SS)S *0s@-@0PS  40B3/p00S\0 fpH0@P`} 4 0`$'  Ѝp)*)()S%p@-P,@P@p P @/ \0p@-XP0SpH`@P S P  ݳ @p)%*%S1A-Pa0510pS :pj@P 00P&P' {zP P1}F  0 lt P#}8 T L0 000@,A )*))(%EGm7/!T*p*C-Mla! {U\ X  000 @! nU 0A0  08 !Q  0"Qv /r X. , PU g  000 `  BU Y 8#`Rp000F"N t FJ d,00@ PIЍ)KT%5T()\T@TmT%)JT[T`)lTTTTO-@ḣEM08aSP   됳0 @00T*0 ?o2Q03S P30S D3 T@#@(  0S  Eߍ0S 0p0"0 0S 0"p! 0 V- V V:   B B B0 0 l"p0S0S T 0ny 0P- <hyPZ 0SF 噲B  B B B0 0 !  B B B0 0 !V! V V     \!+=\+]H*))%aX%)~X%X()X)sF*Y )XXXY("*<7p@-@0MS WPP P P ۍpV0S60S X00P 60Si ] ""442hWhW004488<<HHLLWWWxx||W9^EWEW:^EWE""442""442T0AS0،$ ` Pk PI lPdT0S40S xx00[XU R O!"441$40F""44"2"44"2"44"2"442(3(,0,T-TX*X\'\`$`+w 0# #100 0222#0 2 0 (0#(0/,0H0T0, X0/X0\ `0/`0d 0,dr20i0005/(0, |2-02R0L " S" 0x30=00 2R # |00# #X0/80\ /`0d 0 %0L0<040h00S!#3 |t p1S 0SP! Da! AQ꘎| ( ۭ9-0CS  n R0 R R 0N\ \0|Tt0- =09!m)lT*)%CYk)^Yޏ~Y%Y%YYY1ZYZC-MB2P000R0 b 0M0 0S q쑟=聟0=P  RP 0AS^ꨑܐh=0ꄁp0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ<0=ۍЍt0 h0P0`0\0S H,@()S()T*)))Z%)XZlZ}ZZZO-AM30A(0 "S $U+p0(У͡0AC 5/0(0#R00 Q#00h2P00 (0S $1(#C5/0(0,0S3,00?0!P#0,0@ 'P Aۍ<ЍP(0S +p0(У͡0AC5/0(0+p0#͡$0+ $  BRʠ0@SP (0S 1 P@0S& 0 $00S  BD0S 8#R00SR 00S \0l 9P tl+x3  P8P0S()T[*)%Z()o[) [%;[0 ()p@-@0SS()O-Mw0< 0 0 4   ؂@P0 80 0 @0 0H0@0LP0D`:PPP S  S  S;  S h0 `p SK  S"  S<60S 00 (60S a6v0S -Pu% 050S  Ѝ50S P 0 L50S @@ | 00000%0p,Z0S40S  b40S   P 0 0 8&& V00 0 `40S T 0  30S  "30S30S  ? Pzt 0> V 0 0 8&&P30S` P [L 0 0#p00 020S  20S620S wUP-tB 0 rrV 0 0 8J&G&20S 0 0 m"p00 0d M10S 403/ ++!TcV00 0@X10S00S 0 0 800S  0 4\ 0 3/`V 4   0,8` ()[%)[%))*x\[$[qrr[*)T \"\ۮpF\W\s\)*s,uh\A-1(   0 !S@ 1 1R 4S8 !4|q04|0`a@00S/ P0S  R+* RS-DP- !0 010000 QP 0PT0 $M %P ЍPB!0P;C0P|80S050 000 0 @ 00 0()()T[*\)\Z\@-Mxc0S llfhChS0S Y^Pr0#00,l R03 2r 0500K rP5"0C590C990C9000lP|n x0S \2d"`2Q09T09 <0S 420C90S 20tS|2"CC2P4xr 0R0%S P dry H=;#;S ;0``1 v0@%S ) <0+C? R 0 0B 0S 寨\2P 00S )XI 0STP=S 000Ѝ)%\*%*`% )))())w]]kT("*I))))O]]@]]`]]])gW]^))-@-   ЍЍ/%x07@-@0PS P qH0 <d Ѝ0000S 0  Ѝ0@W)L^%)q^%|0p@-@PU 0UP qD 0<=p000SP 1)^%)^%p@-@T`P T0:pGP 0S 0@P)p@-@PT0*p/P 0S 0@TP0@-@h  0  xh0 dP0 P80 < 0@ ( 8&*|F^^^^^^9&*p@-P@P @0 4 0D !0R3 p)^%A-Pp` 2`00CS0*@ T 00CS0* P yTnTyDo0 @00  0 0 S%)-@- T L00S @P@0P!Ѝ@Ѝ/%)`_R7@-P@00S#P p0 = Ѝ0R00SPpt0 dX00SD D0P<$00S $ )_%M_z_)__%_@- @  P   P  P  l$P l L\0QX X , H@0R_%_____`J`-`@`0@-@MPPPP<  P$0$ $Ѝ0PK`[`b`8**0@- M@ \0 00C Yj6 ۍk`p@-@0S g't00SPdP 0@00o <p@04Y000Sp p@P`)`%)`%A-/`E]@P@Dp/Ѝ/SpPP 40 003P0000S@-@0S  0S 0 000h00S@ Pso <@04000S @``)`%)`%@-@0S 0 000d00S@ PDoY 8@00,00S @a)`%)a%@-@0S 0 000md00S@ )Po+ 8@00,00S @,a)Da%)la%C-0M.S4P@A`p0/SS f0 0wU ! V  P  e  _  Y  Sp  xMX  dG 00@ @;Ѝ)$a"aa+aaaaaaT@-;aA-`Axp@P` lP P;00 S00ЍU008.*ab-bp@-BM @P`0E CR V iWnPٙ0FS`0  BލpAS iP0P S00@$Nl;⽙Hq8.*BbaA-P@`h<0 phW R;A8.*a@-M BPI; i 0SsP  hP-;0PP p@[PP 001G0S8 0 00T10P0N HapW 010Q05 S:; S0,P!0P0  0P 0 P 0 Ѝ  _S-S xCp00 0P0;C8.* U8wbb؆%b@.*)b0@-CM@P0, ! 0   >Cߍ0b8.*@- @ R2008.*b@-$M0h ` X  @PHpP$ЍPU D)0Ps:buT8.*ap@- M0P P@  h4`    Ѝpb8.*-\M0 P  \Ѝb)Q -CM0(  Cߍ/bb 0`( "4`#/p@-`Px0 R  @  0!S` X: l!>T0 d0 DopP.*ccp@-@PU U  0<1 $p@[ cc%cP 7P P / //cdc-M M? 2 ۍ Ѝ%4`00CS`0X X0 X /(%O-pQDMDЍO[@xz`pP !W200 u00020PS0C000@@ Rp@T3 W+X( U U P   k  !g0 .   k  g` .0  )p8M !p W%d@/ P.*ˌX.*3<0S/@-@PMQ PЍ@ p31Q``X00CS000000,"1PЍ@L !0S SL   d0AS&lؽȽH 0S0PЍ@$    0mf1hS fS5004003001 200}j0CS PЍ@3=0(0<0$0;0 0:0090080070060 05004003001 200Z1jS$ $RNQ Q GD=8(3 xVPЍP.*+d@/ BVd\d"edT0 ydu/ / dddddddZddjdekeeie0 ev1 eO-@Rcp@-P(@P fPp@%0S $  R RA  0 @- \j1*@- (0 0$000 Ѝj\hjjP P Pjjjj@-(M0D #\S@3@#:@ (Ѝ 1 k7@-P|  @P .UPP @ePQ ,^ Ѝ0>2*1*0@-@QPM 41a! 4aDaS@$0d@Oo@@1e% 4eeT# ! "Q  R P Q T%< ʨ @,[^Ѝ0%(T h \%T @ 0P" $ @ k1*>kkk t0@-Q `.@!@@QR  01*1 3*0s@-@ `R  P.QUP ,]0S ,]|Ѝpp0 !PU U H 04BЍp@!Ѝp@%2*>1*k@-@T T 4 0(& ЍЍ@,Ѝ@'k1*"!Q p@-P@ T p@<l   p@c0  p@]ˌRO-TM0@0"00 p`0 @@@$(@P P}TЍPPb40 @@Pthp@T:TЍO0 EW y R@x   ;y0P `yK ,\100 0 S0C000  Q,4P 0` l0 0`f L` `X`00CS`0X 0@X0 X e1k@k%EXk(%@-00B Ѝ@-0  : ЍO-4 P@pa TAD -Q P P PPP@D`FRPP00SP Ѝak@-0@ 00 Ѝ@?@-X hk%@-k@-AMQ M`@0Vp0dEaXQX!0TLU0P 0/40 Aލ ЍP00 ! !01 ?t0> !R 0GS@Pat6 p6a<T0 <,<@D@`0H0\ @ DDo4*kk-kk"kl9*I;l_ll@-9*0@-6S 4*l@-RaOaLaxIapdm/@P\" T3> z@ v4`, p@ll5*5*@- 0n%@-0h@  0@ 0\0CS @C؆%00S/p@-@8PU``p840#U:PX 0rX0X00P4080 E0X0p`P -7@-@0 P0 0PR*0 B Ѝ0@Ѝ/O-dMPP d@ T0D 0 S u0dЍ`p | J ]  ^`!0 0  _0  ` .0 V0BGP de؆%#ooC-@㸀帐`Pp@"!0# U 0 pp p2 P@T0S0s P    ЍZ0o(3 7o"\ SQR$SQ S0A NS 0 1S AuSpRU\@E@PVT @A d`d;*Oq%%Beyq0@-P$M@0000 PPp$Ѝ0 R p -d0 0 1S4o0000 0fqd;*BqO-lqM 080@ D @CT Ѝ0VЍO'R`" 1!0 0 @@p Y PP 0 @@ p R Z xx x00CS 8g,$d;*x;*q r6r`rr0@-P,M@0 08 0 PPKpf,Ѝ0 P   -!! 0Q P0P=8 08Q( qd;*%CŒrp@-`M@0 0( 0 ``p"Ѝp R  ,|P10 01SL0L 1S*DIP Ą!~qd;*%rO-DMhZ2 0S 0 00 (0`P (P(0 %"`P(` P@PDЍ`(Pvp ( $0  pp$PpDЍO(P 0u$  (0CS-  X,S崱堑P`p( r00R0S W 0G0 0,,`1!0< 0( (0(Ps p( ^( U((0$ 000  00 0 000  00 0P$ 0 0$1SH"<!!!! d;*rq%uBrC-M⬀`` (pYW0P0 000 0_PPQ ЍP"@P PP 0  PPpЍCc 0R 4 +0W400(00 (Pr 0SQP m0 Pp0!00(WP0Sxpx1ShG0`DS PpP =0PS 4rqd;*%uB sbd0@-P,M@0080 PP{p,Ѝ0 R  9+0 01SP zZj{e[fk0KZe[KK[K+Sqd;*BsO-pbM0MSP@ =T S zP8"8+J@ x] G X:80@ 0 p2o1ٍЍ] p ] "R| * X RX X PR*1 21 0T 1S1!T0 0*~T 1!0 0*rip+X 0 <c8 Y@X  0 <R'd;*5 ˌ+#s4sO-JM{ M`@PW3 *'tBt%StO-ԿqM`=P `G@Pp Up#*0Tp?SpDp00[C|/`P0.0809` R  0P1S<K'@`  Y00 14@Y0 ,@@<@%@&eG0 0pP@ @WX!3W0 SC0JSI $ x =EGP@8PVP p080(V8@ P T@pVP3Y =y - 0S qߍ,G0P00T tY 8ޯ80Sd  0ScY0Sp VPY@VP,T VP VP040 }VP040 uVP pVP040 |hVP l  `_VPT Y 8ჯ80S4  0SY0S BVP T X 8`80Sp  d0SX0S1!R0 0:q~dVP9T] 0`080 Ro aBQ# p p p p p p @ H p p p p p P X p | p p ` p h ikklgj   p p  975X 8 8 W(   RX R0!P  : <0<00140kS00   0H0t9Xd)  `X 8 į8 W`   RNX R0S*  %00140kS% 0404@T0qS4ST:k $X 8 8 Wt  RX R `0  0140kS0 S01X40S   0H0 4@Tt0@s;p00k4@ThXfX01S_4@Tj0@sq /A&0@A4@P900.04 081e P8BM80U08080S@00 @ c/4 4 6@ @@68 80 p@ @0Y-1 `0400<0,0@p'W XT0H?o20S T0H?o20ST0H?o20X0S0pp0r1!05 1"\04 @1@SXa 0 V 0H0tc?D`D0H `5p`"@pH0SX ZVH-0A1 d! ^`0D00 0P`qpW* t1!0`100CS<$H$1"@ =D@P qߍOdoob4S t043(0 0,0c?0040(000, 3p?p;WP,kI RT=00D@l S`P0=S "8 R0 8 SP 0=Sd h"8 R @`  SP 0=S 0"8 R  qߍO( TV04@00,0p@RVD@0S 1SL X*  APP `V-,  0 0(00,00 p03A6/00`8T"X#Q(,@\PX0,S(` T'&:V Xqp 0V0"S ,VA 0 SX0T R: d;*$%vtuq1htttt `dZ+tottfu.uARupuuvuu;vYvwvvv wv(3 (w;w]wcyw%'wwww>*ww`Stx;*00S, S S0&P00CsL " `C0P LPT00T0pP*pWC6h0l PJ000&00' T00.hPT0U0S!@@T T T0P 0$00L @@ @0' \@00 J00.0000h 0 PP\0 pp WqߍOJaU0S\0 ,`h00@0 a0000( ,0p @-3P@  | p d X L @ 4 \%Q|||||| }+}R}t0p@-P@T`HR P  vp@4$p@ 8@*`}}@-M @ BP( " Pۍˌp@-IMM @`*PIލЍp P0 [0 pUhP 0S 0S0 0S  Pˌ}}8@*@-M @ PDۍ00 R  Pˌ8@*H-p3M℃M`PPWZ@PQP @QP@ P}04QPV 7 ץP00S , ͥP   ĥPPi P tjQP ,A[ , PU,G!P0S 寫V! J1! 0J XP RB PQ  0 UxቫtJ|!|1h @ R$BP<  <4S J %P hpRPh 0R :CoP᫲ P > PP00 S5VP0p t0h0p T(8@*}pzˌ}}~~IE~!~2~~~?~r~%~O-MMp`;.pp P@@ p p p0Wıp0Z:@0S QލЍ0 0WR@P` @PLqLL?HzPP(1 ZpV㟉 1Z SP Z.-pZP Z.20Sa00 0Z0V9 Z-P Z.X@)0T:Z^P Z. |dedAi8@*S~~@-0` 0 0TPP g0 P@P TP Ѝp@4M(PP DEЍp6 O-@-tM< 840$PPwtЍB40P(0 ( pPU  2T T T;xTP0t4$0TMT6P0X4XT$01P0H4HT$00SZPT(4T$0P04 0S0R0S00 0 0 (0@` 0 0@TF*303 03030#T0 PTً(0@`P@,@pW6*40S 0dS0ktDᅄ x  0` pt  ;X pl X `%(m0P02R$0L 0BnS01 0<0S 08 S@ ?@0?D000S, 0竸S相0P ?LT0  4 JP 0L }L?L 0HuL {H 00{'{,0 0,0@0P00D0@ Bn| 001 0X0 p`?d 4 $;` p J?  4!; h$ p X0  0T0 {0h `0{'{Pʟ 0L 0PL$0 p{TY@B\]h'-;I4SR{ɀԀ, "7d0SP0勤d4 00kS% Dp $0Xp p $;` p} 0@U 04$;h pq h0` XPɏ 0K 0pK$000@U  0`K$00$ 0P,0S0fd0kSㅤ7 q 0XpQ p2 4``$;G p( 0U 04h$; : p  4" A0"X00 T0@ A { {'{  "PpǏ A"0PU  A {0 {'{DK 0=K 0 7KT0 Y@"@-{ ف%A-`@4pS  P囿T0DPEE$UX MP00MP 0-< 0P (3MDPE@D`@*) ˌp@-P@Q0 0 pqMP @0S \F$Pp HeFD 00< 0p R$4$P%o*?+,+++7@-3800S ,0,0 p o*o*lpD*O-MX M0S1 HpW-Q88Q8`@`(0 q?0+ a=P 0  0`ۍ Ѝ0 000nS ?S aS ppS qS|0 | C0h 0<0L0@0 0 p*o*Ro*(%`*qԆ%{A-X`0S L00S @P@@0p0pP00*o* p*o*T0@-@@/3@00SC',0, 0S00;',o*o*o*0+tE*RC-PtM` 44E  P RQ ğE R`S It`F0Q ğ R   TDR 7 4* CR ` 0S $ LN44 \ P2004ß@Q [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+D`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0垄00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ؆%Ԇ%++++o*PA-@@P@T .@ P`p0SlZh0 o@ P ,0< 8e(0@AP%o*L;R++A-@PpP0@S`00|0 Rl  R 0L 0S @!P@`T !+ p*t*P%@+,7P@--0 C+ڃP@--0 7+иP@--0 ++P@- |- 0 0 +o*d+P@- j- 0 0 +o*+P@- X- 0 0 +o*++Pp@-0AM 000 0@@S;-T1 PS" 0S00!C:P 0S0n>PP 0T00aS`0 00S`0`0 C:PaS` 0` 0R`0 0@0S0@T@ @0Q0 00S0V'Aލp+k[,+VQ` ++G-1MMP,<4 1ݍЍP0$C:P 4@@~0 uPZ30S Scs 5@PQ h03 cs@0S0S PU~\30S5 0P/ P30083  0(3S 3Q 0Q300?o2&Q20S 2 0[P0002@0 0R R00 R ?P 02D"000 H2 2Q T100?o2& Qy10Su 1@P0001@h, K0 % QP0S0T瓣b ,PU Q 0S 0S0 0P+ 0! 00 0}00Q Q000?o2F&Q|00S h0 0P000<0P+w*+ pD*o*o* +p*+,+VQ p*o*$+C-PJM Mp0 000 0@@S+1 @Jލ ЍS2 0S! K9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(ȁ! 9PY#P͡0 +8`0H 0H<\04* +(p*pt*o*9xF*p*2p0 @- 0蓆p*+0 @- 0蜆p*+P00P0Sp@- (0!0pP@/`PP 00  00S00P|0x0 0l A40P T400?o2$ S0 +o*t*|t*҆P00P0S@- )(0 ЍP 5P 0"Pd00}S`00S T0To~0HP80 0 00( 0+( p*o*'8+ + +p@-0PP0000/9@Ppp hp@P p@'2@ 0S80 0N00-~+t*/+o*@YP00P0S@- 'P0 ЍP8 g5P 0 P0 +k~8+@-M P'H1 ЍP0! F5P 1@@A+8P0P`p {0@P.+0@0 S0 0S SP bPl0  Q 0S L0@=P000$0@+ׄ*+ pD*~o*8+ p*@-P1'0 ЍP 0Sx 4P 0S0T$P0@P00 ( 4P+8+G-@`pFoᨂ@"DP 10S 1ЍGO}Y(&1 ЍYqP YP4Y! YUQR 8@P hPPPAD1 ЍG4C,1,qPPpP&6U@000 0g#T6U@ pV(PPP 0RPNA`b5|0 @0<000X0 =#@0 6#"+o*+߇E-A- MPb&2 ЍPO0S!4P 0 1CsCP 00|S 7P /P 0t_Cl1@h@) PP!8Q@a@q@0S 00CS0S )0 0 S  3P0^0 T0000^! "Q|00S p0 00P00D0@+`E*+ pD*o*-ׄoo* p*p@-PPMM%@1@ۍЍp|)`1(@PC@@To)07,A/P@xS+P;10S `{00CS0 U000 00.ᙴ0  0 .P,)@')t$x+>5t*o*o*-0@-M0P 0P%h1 Ѝ0PP! 300CS00GP P5 1{0S0@ @P @2P? DU U0S0 @ʤ @P @P? DUl0 ,0S0D @? D+?Ho*P_jr|o*p@-0p@P0 p@$\0\`0XPS 0S/0S0p@6{ $M00p+ + +o*p@-0`@P0 p@$L`LP0S/0S,p@{ +00p++o*YP00P0S@- $0 ЍP J2P 0hPL00}SH00S <0<z00P 0 +Ո p*o*8+P00P0S@- ]$0 ЍP 2P 0hVPL00}SH00S <0<z00DP 0 +ՈA p*o*@8+A-MP`+ T:p@pET` 'P+ --W+ '-@0 ۍ萎ˌ8+@-P#@0 ЍP( 1P  +H"@-P#@0 ЍP( 1P  +]w@-P#t0 ЍP 0SP w1P 0S0, i1P+k}p@-PH@P#<0 p0P0 Pp p*+p@-0@L@SP#<0 p0P0 Pp p*+p@-PH@Pj#<0 p0P0 jPpe p*+ÉQoP@- N#(0 00SN@++o*ˉQoP@- 7#H0 <@0S 0S Q+o*@-I0P@-000P0S #P0 ЍP@ 4s@P@$ = B+Љ|p@- M P"1 ЍpP! 0P 0b#p`1`>y0S@1D0 0S 1( P&P0 0S 0@T 0yzm&`9@P `= d@ &0@ 80 @ 0@3/H0T 00S00SF&+oo*ىtE*L. o**T0+0 @- 0*$++0 @- 07t*+PA-PPPPU㈀ Z"00Ppp@h0hPx00P0` 00r8T,0PA h8+ +o*Q++P7@-A P000x00 Ѝ0P"0P%0SʰP 0 00/00S@ 0 S  @/@00\+,80 S +<%84 /P++o*^o*o*++iP@- !0S000 005 0P !0 0@P 0 0 00<l00lPL0H0D0LP 00 00 p*p*o*+p{z000 0@-S$000 0  p*Tp*+\p*000 0@-S$000 0  p*Xp*+`p*p@-@Pp@0 @- 0Ċ,++0 @-z 0ъ(++PG-R@Pp PJ!ЍP`|P? wP< rP`TP5  -PT. -@PP$$`. U(1$1@W 10SV U00@ $ $``PK0 0 S  kV Up0l0@W T00S H0H 0DD S 8  4Qn~Dp*Hp* p*Lp*Pp*o* @-j0+P@- |0 pP \00}ST00S H0H w@P40 , 00$ 0+X p*o*]8+ + +P00P0Ss@- 0 Ѝp0` 0S P@P ŗ0Q R   L 0Ѝp@v$Ѝp@++o*@+Ƌp@-P0@PK $0 p00MPp p*+A-P8 0$"0Ѝr0S 2 vP80S10S 1va0@ ` D60崁S Cc!!b"  A   c# P0U0CtQ00CS0< P?00CS0@ P7,! -PS0p00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 S+u*o* p*5ĉ*ĉ*y*(%*qP00P00@-SM  0 0Ѝ0Pl  E-P 0D)qpP@ 0 $0$U@00+ko*P00P00@-SM `0 0Ѝ0P -P 0c)qp L0@0PE)4 00S 0000+ko*ȌP@-0$0 P2/+Όӌ@- (0@kP0 @-o*یP00P0SA-쀟 00ЍP ,P 0?0`P !PPP 0RP9@9@@8. p 5 H' '00+`P00P0O-SM  0 ЍP  n,P @P@ 0R@`9p`-|0 `@P040 Р00000@@0 DT+k4+@+ p*τԄPp@- s0 0p`@PP |P lP@L*p H H080 00@+ t*t*o*A-p`P[ @Pd0 `AP 00-4 RU0 Ao*F p*\A- PP   R ЍAP   R  @0S00Ѝ@`p+%o*"sA-0p`P0 AP Pp@P @A\P 00 R00+o*F|p@-PT@PH0 p<00S00p@(t0 0Pp p*++o*p@-0@p@SP`0 pT00SH0p@@s0P0,Pp p*++o*p@- @x@RP~h0 p\ RP0p@Hs P0 ,sPp n p*++o*&.O-MMPQ R3 ٍЍP0# C+P 3S`@pX 3 | P:PP@P)W30t'` P00S 0P @B0S000p@I2is2@0SP$S \S00P" 0   0 #" P00B   BR 0 D )b30 7@0SPiR0PS 0 D)b20}7@P1sh1 0S x10SL1h`10S ,0s00CS0.   20 03/00S 0S 000CS0 S0  )t200000i0 iX 0`S8 +*u*ĉ*o**؆%o*ىo* p*o*o*@-@P 00P 00P 00p0- lM X00S H d0 P000p o*o*o*xG*-lMT00S D d0 P,00p o*o*xG*A-@6P `p0 0C0SQ3  BPP 0 B RQP 4 0 0C0SP3 p@-P`@:<)P &- 0S1PS !|-pp@-+`)P %)P008 -hS!0RՏ6Yޏp@-@P V00PU 86 ;PpG00p@-@0`PP<p0 .0Sp 0h R00 Ѝ0 0S0C B RQ"  t*P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  B؆%G-`P(P @ AP  APU0 00 P0 10S / d(Pe P*P@[(P 0pS42  PpA*:PL(P p9*P :>(PQ p000 SP 0S 00S1 @RđU|0 -h AP0 0 U **) 0 011 0Ѝ @p) P0 0S000)0S 0PS S St0 0S 0`S@)H0pW ),p1 xt*P8@p*o*" - BR0 R  P R +O-!M M@0 P<@8@4@@0D@@@APm4`0 p 0S 0S 40S 0S Lሑ@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /GpTKX`V /5PUp@ @l0S ;G@P dP XP HP8>0 9000@0)@P4'P 4@P@)44:'P 00(<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU "PPP @ @ PpW "pPp3 Q  `3 + a/=0 080 S( , (#(0 00 0$)"00 0R S"  c`pPR  0(0P Z , e0%T00S9 llX% 0S1  + /=0 0 0(00$@0S0S20}S9o, @/L&P00Y@VN 0SK U +H.$+H!+H!H` D+.=0P 00$Q$`(0 A `00+S.=0  0`0@@DcT@@0P/MFP0,00(S  Zc@p1mp*~Ðxt*o*p*C>a8++%4p* p*0p*O-iM M8hLdlOpt͍40,xHD@|0 0PH0.600K/p% ,A'@0'4QD'8aO?ⰐV=La少H'TU01p 0S `1PP ~d0sh0sl0sp0s0St0s tƽU 0S V|V?0S ;'?0S0 /EP,')'P?0S 00SV4 _ 0 0 .=0S ~ʾP' Vi<, )0S ~Om)վP$.`>`N0 0 ])00 -QT /=0S-=p R( 8p p$p0p-0 R4P;0 00|S <hE0S;0t QILM H= $= 7`X[,S-H;P0S000  V$ ::+ 0S 00S -0Py 0Sv v&ܪp1 ⴌPPP 0S :DPR1X :H=PPW xPx0SV x0SZ +0 0$ PE$P %L$P  0`!U/1\1X1T100p `10T1S 0S \AT! 0S 3P p .UR0 0 0S 00S P P]%\K8UKύ00,! 0!4 8!0R cPP000068401010c/QP`P VJ6_04 PPtPt0S4 0܍\!PU@x`PTv B 0k_0P0/EP80S UPPk/=@ꐗ P, L,00S Xk?/@80 S00?o2$PP0 +P60S P 0S`%P 0SX%6Fp嘆V3@P3x)t,Ql60d6qP 00@T 0 _5P 00@T p0 P5P 00PO OM``ElP<Jt')AP<=060S(`x@T*4!@&K,&$&5uPU<4 HTr 6pxG*xGQ4p*8+ݒGmE%HO |H*+SI j*-Nhp*ғC"p*u*ĉ*`>*o*o*| t*ԄL^ltt*C.:t*+4Ɣ) $bdڔ %؆%9IXڃ %̖\71 p*$2o- { t*[}Ǘ4+Dp*@BxG*ԗY$p*@p*Ro*#H+8p*@+0p*PA P_ 0*S0 "Q0T0-SP 0Q $0G 00 S$0 0A0 0/R< *R0 0Qp80/000S* !0 0'5P 0, sL0.3Ls<P 010Ss⇾HP "Ph~P xyP qPT~V /UnZf Z000XP SP P  ",FPY Y V` \ἊT U#4K/IR032 U 0S|0#0 0ux#2S 喊T$V ֿ$4Y0SK?0 0T| V ῿Ἷ4t cᲿ}SKP|D4 R\T0SJp40C $ 00 00Q$00S00{s0Q 0 00& h50S0|0 5i80sw858p00 RQ ;0S50B:p652Sd & R 6 P ;D6P P P @F! (6L6`l0Əs l0l0@T? V  %%PˉK'20 0  2 R@ 20"0C?o2? 2 ""0A0L6.000 R ;R TA/P 000 R RT 0S>0S(0?'"( ,0".0S ?0.T0.͡@!͡!..R0n"0R0.͡ 0$PP#PP0S0S80S#PP ڠB۸(H000.R0@D0$ .0 pwx'xT PVPT p\ X1X\ P #P U x U R90S 90S9yP $ 0S @DT90S YpF∸1!0S   PZ0S= S E#H: H:` T00R0SC rPqJ  %$P  f.P Ub d:0Sd: P _*+ ϠP 0; R#*  L;R.sr ZO%.Q!03/P\p;@ v; R0 ;Q;C/,0 0 S dh lp"0S,|< 0R.Kp n/-0S 兽000S ~000S w000S p00|iލ Ѝ0S 03/0S ^00s@- P@7P  y7P0P #Ѝp`P  f7P 0 FUpP Ѝp@1 0S S0S $ H70PP8<1HI@-M0h 00P P10S 0S00 0 Ѝ  qQa @T0 S 00S 0s 0 :P 0 S000Bp@T h-P 0|S ᾼ00 0S00 0000t*o* T xG*xt*0p*E@-$M`p P%00000008@*0P/S:S y@PxQ@V刼P $ЍUf*Pz @%  %0/0c=PP":^=pP@P/000 09@P00)`0@@DcT@@00@0CcS1S@+mPP00/@-7/,0 @  000,/@o*I*@-&/x0 @ d00S X0X0 p ش<0000S /@o*o*o*lI*@-.@`00S T0T0 p 8 10 10S .@o*o*lI*l0 @- X00S L0L0 p 00 101000o*o*o*lI**`0- lM@ xDd $800 p kuto*fo*J*0-@lM@[ 00 00 0rS sS phd $\d P00 p ;0F(d o**I*8+Øo*J*@-`PP@ 0@s8#80@U 0s8#8000@? KP VU 0A0T0Ѝp00CS0 S0 S 0 /CO-TMp|00?x0 X"? 0p 0A.0`P0V0X B@20 @040SD H 8PZ0S= S DV0  ˳@P*-0S -0#S -|0Sp l1 R XaR 0# -tp uTЍ ?$0000  pPP-0S -0#S@DT|0S ph@"\$0 V `|#L"0 0 "@B8p*o*O-BM MV@@$@ AC??0a>0 @@@0`5(p`5夵P<$V PP)|50S5W h% 0\U h0X,U S00H00S 0S  0S 0 S  R 0 00U!$$PP$p 0 ᦻ7@P$ p `0u`8 4 ap0TS 00   00Bލ Ѝ3@@30S VW@@c3!g3 0  U@ L30S.;V50G?o20S4 30S0#3 RJrTN20 CRk2000/ U)U00e @0B>W0pXP44220S V: V `2HV"h2000; "00E 1#T0 CR5@V-U 0S1   00 0V #T V00T0ST dT(U@ 1 p1ݺL10 CRVT$10S@d@0 @SP405+( n"10S (3/1W0     0QR\@\0 RZ P :/ 10 YS P 9/0G I*l  +t*u* p*t*o*u*t*$6 0+؆%+}u*dp*-A-` @T y0 ЍAЍ/p00$  Pxx:bl0 h (o:0S@ mP 5/}u*+I*l Yt*ˉO-FMs M`@  @H+ D+ 0@+0$0`3$ 0(00,@E0P S{+吺0 3 Fލ ЍUE0 @,Q(!2@@Ȳ@aGT  2  FE 0 PD0P|2d ;P `"`d!T !0S 00S ,, 0d ù fPP dN@0S00?o 2)P %06E6D01@ @"p l &41  D0(66S0d000 d0Aa0PS zP wP s00S t0 |0ZHP@ 0 @0б0h,@ʱ0?O*hp*4++ p*Co*ғO*MGmu*-u*O-JM WMsn0p0FXv600S00p ~9 㸱P塙X6   60 9㦱PX叙JލЍD60 0000 n97S 60Sa 6 `H0050S# 䵟0S5 Q S 5R "P 0S 500CS\5|`00l;0S P97S, 5D 58%8堸0S 500CSX0$000(00000 PN 40000S40܀C XSX @4000C 0h00d0$ 0`0 P@ CP 38w!>\ 0h0d<` ((0#$0#c# $c4"$( <7$("", &R h3U0 R0S R3""4408'0P 2X偯0097S0000 0㋰ 0S  |0 偰p吘8'uP820 00$0 j0  ) ipP 087;P0g 97R` S㸁 0S [10S/ 0S+0,< 00 00,1 8P8!81 R  x 0 ) 1Z&P 0S 0097S;70:70?70>7='<0S P0s00UX0 s0Su [X  TI*p*,p*t*O*|t*p*o*Tp*o*\p*t* p*ϙ+ԙu*TӚK*ޚDk}O*5c 2@-`pBWLM LЍ@t 㒮pPk  勮pe 0001Ἧ1 0S<0 |q?!(⯯(00 Q 00SZ=9Q ='/@#b?!"/op8j(0S f(0#S 0(60 8[pp V(0S R(0#S wH p:p 90S0 000 0NLЍP4*00p*,p*t*MbI*͛A-0H`D0 82V p R R B`R RB`b2 Q  ,?00EoE?AA?R1 $!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 <@ (0S 80(3/0@p*8+8p*H+$p*τp*o*t*J*t* E  p*o*+,p*O(+]+ˌ+@+ޜGm%i*t*4+-HORDp*nǗ /0`Vo* QoP@-X@ P0 Y iP 0 @ u*+@-@0 OЍ襞0 Qp@-P,@P@pP @%@-T@0SHP40( $0R ! g*og*i@-T@4SHP44( $0R  g*sk*"0P |@- P@T Wp`W VL\ P  R/%O-@pM`||T oTP ЍOCT <<@DT#Ѝa 1 !Q Q@宭P~ ЍOr 8S 0S P pP 0 卭P 0 X  . 03/00 0$rꄏg*N%s8($\!\R% R (8 -0 \ \ \; (R ( R (8 "\  \  0 ( ( 0!R/\\\0^ 8(0\ "\0 0(88S08 S 0808g* %p@-H@H0 (8@08080$8P  Up$80g***@-MAa(8S T0 S جi 0) P p p $8S 80pP\ UP 0S ,8S0T (8S 00CS0 &0 p0 08B 8$ 0p3/48S 0S 00CS0 S0  P0R H@ Ѝg**(%ى  T P/@-@P(P u@-@@0s,00p ޫ0Co %o*t4t$0 00/O--KMPt0 P 0 0SZP=9 =: k{`Z0 A8 P@  Ak QP@0J03 3# `#(0{x吪Z` R\ @#[43(004# 0f` > [ (f" 0٪`< -(00<0f 0" Ǫ0` U  S  R( Sh"01 0;f#;Z0S;#;0 d΂*"?;#; 0 #5;0?;#;0@#5;DE!啪X@\ `U0XUڸ1QQ!0 P IP= A9 Ak{H{7{Z{(0f@<00<pP3 0@  @-l@Oh@p@-Bd00` pd00CS019p ,P P00 @R0S"P8Qd`d00CS0+#p "P \Pd00CS0p000S 8A0QPA p0 0 `Vqp0 Pc`d00CS0p 0@S P,P \Pd00CS0p `V0 0 %Pp@+ %դ+A-@lp`$P@ .dPP @P PE  P@OoB@+O-(UmM0S p XEPd 0S ̈mߍ0.1dPP0͵)4P'0P0S SUpG Ph4P PP P0CS\  `  p- P P P0 PsdLP P P d0p P 0? hpdpdp P 0S d0p P0? pp P 0S0S df0 P P d00CS0p\2\oO P Q4280 0 dAQ 00 p1@S P0S!   Cb"c!   c# 0\S81Pd00CS0p0 dL\0w0 p P`, ^0!S^0C0 dpPXX ip*Gm+ĉ*"+'Yo*؆%y*ĉ*٥o*u*0@- @0SᛦP  WP 0  00@|0  pღPX0 PzP40  0qP0  ؆%+ Q,00CS0 S0 S#0 /1A-0aS0P0P3U P 00.S Ppd1lydP X1@P L0 P1T4!4!00,1 $$ U 0 ! XA0q000 00000P0 0 0pS0000PTl0l0  @U x4 P$0` Nt* p*1u*u*o*6So*+++ڃ++dp* Xcp@-@P | 00t 00l lP0h @Q0T0 L0P@D0@ C80@0S, 0pu*o*++ +xt*,p*\p*`p*o*u*P0 @- <00S 0000 p o*o*o*lt*A-@+Qp0S `0S p 000`P& 00000S t`0S p 0000<0uT $ po*u*,p*0+O-P"2 AM MR0xB p" R S4 P n04 S` 4S4P  $Aލ Ѝ4Sg1+ ;004P/S ++Pąꐡ啜pU0儑p 00g000000000S L1o_<1L$1 R100CcSppW100S 0oB 000000⛝4SU00m$DmPPTy P00*p*+o*lt*˦٦ p*4+$p*o*-o+u*GmA-@Q0qS0`00S Q`Ѝ0L+P P jm0 R 0000@ Pl00}S0s00T 0S$@,]L t* p*+o*Gu*؆%+O-P聟a0AS000qS4M Q 1:L4ЍPF H.P00lBP00XxP"LD P$4A(!0.200 000&@, A[P 0 @ aP 0$0吠qp00P0}S0s00U 0S(@8K Ct* p*++o*Oxu*u*ӧ@-0(@( 2ᯏPp +A-`Pm`piT @P @  @P, @UN@Zt@-@P+0 A- 0@0PS0p`0밀P" P 0S 0"S0 R S  p`"R"^ 0 00 +t* p*+2 +u*0@-M M P   *@Pۍ Ѝ0hPlڃ4/Sz @ P;0@TP/POO-@pP`W 1@@Pp3:(pF#谟`0X1 0C`T@10 10S 0 SY G0J Q0"0S*00 020 ЍP+o*@-@P0P0 @p pP0 0SP0 0-@Ѝo*ht@P+P  R @-U Rx000 0R/`0000/0S < S0C00S/ S/0CLp*Dp*Hp*Pp*0@-0 00% ރ0S# R 0S0000S b0C("( R S             Ѝ ؆%Ԇ%7@-P@0S 00p p0ɚp\ׂX@0S 00D 40Ṛp( Ѝ0@ł Ѝ0t*ڨt*C-@㌐pA\`\P ^T1:00"\ \ L 9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR0%R0PMU20S2 2"0S0 CG0Q .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10N[0N B B0 ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0S P^*0SPZ*@PL0G RX QP 0TJ*0/SE*0< RS=*09 S  7*+0S2*> @ S,*0 0 0GS$0P(0&o*E+ +" + +/A-p`P @jP0  T  `00T  ( 0@ R   `FVp`00CS0 X' PpTD000`000 T00"(%4C-Pp` 0崐@TH ᭠ 00)a@x0@P`0 \圠L0L 0 P 0 Ѝ*?o*Kg(%mwo*o*G-M@ `'4P 00T 83 `P!P #T  30S+  `Q `V` ՘p0E. @00002y!P El"lE@Xπލ ᓗp`,0T $ ᆗp Tⵀq010@S  ⯘ 0$ 0/ 0$ ppOr0$S*F>C0S  ᔘX4 `$Q(00SZ=9Q =(/@#b?!"/0 05p4L0S H0#S ZA0AS  T0 0000 0Hp 0S (0% 0 pwP0T P<00Ct*ȩt*Mbp@-@PBp@ p@-@`00CS0pP0 @ 0S0`000#S V 00p0 PA-p@`pP0 @ 0S0`000#S V 00p@-@PP` P < Pp0Sppp@-@"P !@-3dPH@-@Ldp qP@-P뒪@-0lMPQ@00 00 T  40S P 800 P /0 0{ 0 PACcpW' 30S  @ @@ `hP N JP `3PJ P g0S 8 回000P P02 卞2 PP ؜00 @T    P ɜ0 0@T   P lЍbP 0S D@P@E   l  P@  aT T0S %@P@&m  M0S @P@_  ?Tw 11@T 0 x0P`pV PP)000N 00 0PhQ XwP@xt*@t*o*(p*r H(%lw+_jr| +o*o*u*ĉ*`>*o*o* + +7@-PD1 Ѝ0Q0S 1 1嵝Pʄ! 0 CRhA R S0T!L1P 0S44,!S [P 0S 10S 0 0偝@ @*0@0 @"0 @0 @0 @0 00S 0 U+o*+ o*(p*p*pt*5o* p*Rи++y+++d+`+h++@+<+p*00S#@-0M@, J0 P0S8*f@0Ѝ0@p*-A-l18C8S 00p1  RJX1P+  V ,118C8S WpG(BwP`<18C8S0  zЍS R   RKNP0 UA0QLLD!-,+-+P> ,+,+8-+%*+-+|(+,+)+,Cp@-BMd,@P4P1 Hz74,!. 1  ㉍1PP,`1=<qᨓʬ,+P,+,+8-+%i,+)+*+Wp@-BM&p,U@P4\1 T8!,1, PP,` 1<r> 04Ѝ0x(+%@-`0S@ P0S 0000q20\@ox(+07@-l000Ph@ R R l  R  P4ƍ03/ Ѝ0Q P%x(+$%ˌp@-` A Q1S 0SP IAP00p000P P0 P0 xP hh \0L@L  "  \ p%x(+vP1Y+%%*+00@-18C8S 0P ㌋%-+,0@- $@0@ ,+8-+,+p@-BM` P@0 S`0018C8ST01y0 ƍ0Pn00x0 ՄBߍpB/ BR 000P y0001,+%o-+,+ 0?o2 0/%@-AMmj R fc b000000@00  ᶄPڶ0 q ᩄP 0SS WS BSr0 +▄P  Ts0S  10S0 p@W W18C8S ؀0S R  D   |P W 0@^S00CS00  S00 P0Sv,+n *+8-+|(+%-+p@-PH@P@pP P P @% 0/@-雄o/A-@PP" p00CS"s $t t t t t t Dt `V TPPᶦP0 P00TAN# 0S P0000 !0S0R 00 A-PA00C!SaXp `0000CSPu (u u u u u u v `00CS`0p S X0 X 0 "S  Ԍ0S`00CS`0p SX0 X ! 孋X!㹌᥋0 0P0 Pc000 dᑋ0"S00HA"4ᆋ0 0P0 -+(%ˌ0m@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 G-@|pP2 pqp =`P`PP2 00PF 0P ( V @P @0S@0SI"00@6PP?P PPP P 0!SPۊn~'X-+m%A-M@PP\1  f f@P `p崀  _TPQu00u0ۍ0 P 0@ 0000S ᠊  y P00 Z%>Gm++Hp@-`@.PP 0 (Hp(PB@pXs@-@P` 's ƃ R 心 㻃@T|WЍp(R( d(0PP @OP ,KP *+f@-xt yt 1-+0@-M@@0(@,0 0 @P Ѝ00,ux0 nPPPP0S 00@SPH| -+%*+@-(,ڭT-+@- @K ElP  呁0P3P xωt͉h '\ ~ 嬁Ѝ*+xt yt qwzf@̷0@-4MP4PX 1<18C8S 埉A 0 9 0 ˉP FDR<P8 >0E, RC 3 /;P! 71PP 㤉0(0S$4Ѝ0=R\00ES~ $     tPhN`\XT H@L%ҷ*+%޷m-+Qu*x 0@- @3*+m-@-NlT-@-Fl0 R   ЍЍ/$/+-@-R0 R   ЍЍ/$/+A-ARp`P@1T ᧀpP7(`@DO-dM@Pc0P0\0P0 0 y8p800,@(P40@0`@P p0p,0SX ,0S5TX L @@[ X  ( 0 0 ( (clpsP T+,0o0,00娂00T񟗾ꌂ 8 p ؃  , X x  t ( Q 0S0$S;90S  dЍE3 P ( 0C,0P@@ ( QQ , 0C@( ,0u( Qh 0C@( ,0j( 0C`@( ,0bV@_ ( `F  ( 0C`@( ,0R( 0C@d( ,0JV@F @C ( Q @0C( ,0; @8 ( Q @` @0V @,T"80(5P6 <(<60S! X H P ` t t , 8 R0 X (b0R040880P(<[8 8 (b0R  $0 >P  $0 P H8 Pß0000S(b<@SX (  P0C S,0( X@S( Pl0C,00 S( L5XCs$/+ĸ߸ 5Mn߹O-lM($ ŃPƒPU``8@ p0   0<02 @02 @0` 00M@P h @` O`@0S( P ؅օ@$0 lЍH?@` 00 S @.  C< 8塆0ЍC0%9l%UA-Mp^P`ЍAք0@: SPPT@u`P00S 00 0hQTP1 }p P PU0DsLS<(    Ё\$/+O-]M0 M-SPP D@p~P3 00S0W0S( 0S#^ ` pPi40S ]ލ ЍO~v/;]ލ Ѝ [ W@ppU0* RX < RP A}PP(Au M}~P F}30v: S+  뤳 0P@`qP5  }P ph ` 0 0P00 0S 0S0S` - |P`K}`|v `0S 0 |P |V |P `z{ R ~<MRK |pP \ *~P x!1Z[  0| }.}[|p`l< 0S'HQ!000vB P: v?b z 0S-vr|pP vq$W ]ލ ЍObP-9q| 0Sl|pXP P : R S00 R0S A|PPhVX}$/+%\ۺ2A(X  6Kaw(% 0 R R /0@-@P0R0 APCU 0APLU aC\ACP 0^0\0R0 00@- @P@@ R!P X/IP00S D00S 80 &/"I#PM[+8/+k+<+)%@-Jf@-鍁Pp@-P@لp 000//+p@-P@0-S@@p IP0Tpp0p@-@0@MS`P0 @ K P@ЍpPU P]$ e00P0%/+/@-@P @ 00S@/+p@-@PPp00Spp@N/+A-p `P@P000 P P0 0p_"@-@P P0P00S@`/+@-`qdMPU> 0S; FP2 @@?T/  `00 @ C @  I00 *S 0 000?0`?ZP10#H H>P cdЍ?\ 0@-$M8P0S 0@|@$Ѝ00%0 0//+0 R/+A-@0QS`0@S` aO<+-*սp_N=XNgvOؽmO-xG+0  /+0  z/+@-@(=St00S h00S\00S L00S  `400S  Y0(=/+4l+p/+k+k+k+0P/0( P/L/+/+0 A/+0 $ 0 -R  UR +R  >Q @n?y0:S f?q0cS .S bS S@ @0,S@pS wS0 SP,  KP 3xPz@Pv@Pr@P0 0  Sx;P;P ;P;P lP ^"@=+=+=+=+'O<+o% >+ȿ$>+{؆% 0/<+ @- 01SP R t0 T!WP R HHx@08 0 w@"P 0<+ҿ(>+ ֿ 0S 0S 0S 0S P////// 0S# @-@PPPR0 `0aR R S R0/0 R /!0 R0S //@- @P| , 0#-?00&3?=0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0+>+%@l+%@-@hP\PLP <00S0P>+>+%@l+% Q 0/<+P@-YwЍP@DP @ $?P0 ux0T! _P P0X!P80T@ 000 ҿH>+ֿ<+@-@(.P)P>+%00PbA@0CQP//DA-R Pp `@X@@Ѝ`>P@\@P0 PP@@h>+A-P` @Pt pP `P @P  @A( @tT |N^fs]p@-Pl@P XPpHPpp@U p@PpE*pO-MM`p 0@P nP0: SXvLtX   ?P $ @P> ލЍ R R R00 P@ P PP @ xPP 0"SU T 0S0C0ʡ 6/ >P 0mS PGm%%%%P P / ChF+s@-@P` " 00 B0ЍpA-@<`Pp R 0S pup@@-P`( p@0` G Ѝh>+@-`@ (8R808Ѝ< 0 CS  8 0C 8h>+pF+p@-`Q@PRpP0S  /u$0Sp %up@0S S D0V@ ` 0V,  uU  p@u%%T(0 ((((8 0 ( /h>+%%0 ( (( 0 ( /h>+%%C-@!`p0S Ѝ @oP0S 0S 0 ( ((089P 0 PP 0=+h>+7@-P@@@@00S Ѝ0 7Ph>+@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08n9 80 8 00S08`9h>+/+@-0AM0 08S0Ѝ0S 0SP8 (0S8p0`00 0C?VRh B(08 80C 8 0 CS ڤ 0`h>+/+@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00h>+/+s@-@8 R  0R0` (0 RP08 80 8880S Ѝp0CR80S  00Sʵ808h>+/+p@-p@XU N8PE``VH0 (  p8Soppph>+%%(080S @-/h>+p@-D@0S PX*8 P 0( pph>+%%p@-`xP@l0 R(0p0CR0R:(0 ( ip00h>+%%7@-@@P@P  AP Ѝ00P$ /h>+0S/0G-P0`Sp@U @0pP0 @@@ X P00_q]q @ P00k+P R/-@-4@$P(0,0P $8  h>+%%7O-P0GS` 8(hS?Pp $8SDG(R008(h8! 0S0S ] Ѝ0S08R00(hjP08 0h88S 08 ЍO`0F?o2P0S `&0 S PpP0@S <  ` p l l l eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)$h0V48H"3P( 圓R( B( (( WPV  mPPl;D9rH80S 48PS8P p08880X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 00PJ``` P Q`*ZXP@$ 0P=+h>+F+%%hF+pC-0 M !0@P 0 0 B R   0.S 3 `! P`4HP X7 Ѝp0 P`000C/0 !GP00h>+0(8R/h>+0$P00 /h>+00S/  D/+d O-MⰑpW]$ 00! 0U R`PQ PpX@0QSQ0Z00p@P9 p =iP 0: Sp  h P)d0 R'0 X& Mp@X K  0G0  x*HgnnЍ P00pD/+%%k+-Th 800S ,00S 00Co///+/+/+p@-|PPF@T p@``OnT0S S VS 7Sg@ @F+p@-@0S00S 00SI8P 0p@qp  00S Rppp0P@ ^P0PL0@p<< SP@ ]8%4l+p/+`/+|G+Hl+<+@-4=@>4G-@ ePT0嘀0  0`0p 00ST V0 000S T28 H+<+y+A-pP1 @0000`  (P0;0 A' 2 A0  PP    P $5X A*F+p@-|@Pp$R0%S!S0C Sp S} $ 0C SnD  7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP 6m0S0pnp0 p@Z0 00Sp p@B0!S $P m$t00Sp$dP`p@&L00Sp7D00`Vp(\' p@4pF+/+D/+"p@-P(0`@p@LF+A-`P0@@@p0P/00,0S W HT T 00A* ~F+EtG+8^p@-MA0 70000\0  b0  ]0  X0 S0  N0  I`P0S1 0 9m;PU0 D<<080 ЍpF+)5?JPXCtG+@- 0@%%0PiP/F+< S /@- 00@4 Ѝ9%[@-@r0 @ F+|0p@-@M@T 0S P0`P V@Ѝp`F0PS `<+@-@D( 000@S 0F+@-@@P@-@G-04B-0,2凋0$r0?0@Me`00S0S  A10S x0S 0S45L0P P (2oP`0S P 1_P 0SV80S! p62O80SeV|Z0SP0S[ /S TS S S U U"*8=P d2Z 0S B:1! "1F+/+|/+y+ Ul+k+k+ˌk+ H+@l+tk+%%D/+E%%^T/+1>M^c"ql+}/+7S< iS0S P0 P P P 00K`P iV 0FcS񟗘h  < ,  < <   | (  h   x   P H  l l d   X | ,  L 8 p |    l    H ,          P                               \ 00E.U S``ydP ePeP= Q0S`Ec 0SP0@_U0b ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  {@0#0P MP 0 a0CS00 0`/P  ` 00P 0Sa0@S @P000S =V!P 2,00 @0S 0|$ {-P 0S.P ,Ta0ES000,P ,0 /UPnUU0ESf( h | *U( @U6 !U[ Pq 0S US'T60S# PP pf0SLW960S 60S0 97R0<  K60S07S ;07S 00,'#Bj|C/K10@S @0007S9 :<#0CScP A=P 0 j0S e`q0 S (0!R0*?0I$80S { n0 S h(0!R0*?0/ !R00 !ı#80S!R0Q !R0 0!ı 9 09 !R00 !ı\90S!R0)!R0 0!ı !R0*?090S 90S `0 S 08:0S y0 S 0  "n H8L!LjR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0~<1yP0rP0~i0S 0!ıT; [5 /U;0S0SPl <@ $<D ,<H  P 2;!W?P@!R0 0!ıPH &,P P !R0>>0i?Pd!R0 0!ıP& !R0>>0Q!R0 0!ı?`P,E kP ?qp X? !R0 0!ı?`P+!R0 0!ıP h?`PI P 0`0,`IP>)P 00,00 &20S?"V 40 PP U U ?V"R0 <>P|P U U +"B0 PlP U U J"10S %PXPs U U.P!0Pl`!` %(P0` !R0L1 0S<10գ?0/0 $!0 S00C00 C!R00 0S00գ?0/0 000 00iS #h0 :P00S08028D/+%%^;k+/+H+|G+0l+00S/=+p@-@/!PpO-S`MPp`$`@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0c80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 60P R* 0;0P   80 IfP f [0J0C=+0   /G-pȀWY+p S@0, @PPP ZPPE0S`0S P B 0c 0R R@0`p@-`R P@ Jd0P @@@ 0ppM-@Mp @900PC  RT0Ѝ `? `m>P ?0? `P>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#8 0 k+/+|G+A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ#0 DPzdP fPP Q gR 0S 0R   R E0 ik+/+|G+@- @ @F+ @-P@,F+ @-P@{,G+G-(2pW pЍo]PP) P0`z]p*c@P 0pqpTd J]b]? SZ Fd0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP+D/+G+p@-`l@PP<J,<0SV@` `<D IP+pF+ 0 F+ 0 F+7@-`P@ PP 0S  P Ѝ0F+Po/@- + ЍˌA-`QpP P P@P%U0P 0 P l @icT @P 6/PXcU|e@-~x 0pl ll0P \ \D0P P<0P@04 4 %%'%m  P1C-M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@/+/+/+G-@M`0PSS003 @ R S0\R% :R R D Z Pp P0H3/0S@@ R0Ѝ7 P/@-gp S( x*wbЍ00S @  h g*\0PT T O( 84qp ˌxk+ ,G-@P.` p(ppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(V0p  S MP0F@ @%%%%p@-@QP 0S R SppQ0 QA QR P/@ PRP/p@-`9 PPp@p>p@, 0@-M + x@sr  ) PP  000Ѝ0/+PG+400S/@-$@P P@xk+/+@-@P  /+P/ @-p@''0@-M@'jZP|Z00S@)PaP DP OP AP )dP oPi|0t00SЍ0 ?ZPP0 00qpHZ00@+)x/+U%O-M$0S 0S B0S@ R u P 4X ЍL >@j Pp 00n pPPP`XEP H@P  PPpP30S P``30STPQGPN ((@(!P3`00P0`0 t P0`0 4P T ( ` 0bYPk& 20SP `JP   @( YP YY |2 hd2 p 'L2p@20WF0b,2P 0S P (ZP11P =)&0S )/1 \ P HP h1 P`L10S Q` 010 (0 qp 000Sp 0 $P  R0  [ R 03 0P: l X /+/+El+0PG+ˌ`/+/+dm+|k+L/+t/+/+H+%%k+y+(%UP0@-@/+00@-/P '@PG+ZEA-`pP`VVPU@JTWlP0y+ 0 /+@-yP@0 @ /+ 0 /+ 0  /+p@-P@@P Pp@7pp@-@`P*PpVU p@T Pp PpA-@Qp`P g-_)_U1G-@䠟@P`  @PUЍp pP^7BP ^8p0SkЍG/+@-W00S@ @y/+0 R/%R %R0 sR0/@-(@0SP00dG+G-`dd@p00CS0 ᜋp PP 000 P U 0D IS  `^mp@P@- 0PNA-@]0 0Rp@`0S00 R0S@00`<P0S U  P@00%%%%O-M@D`(p!PQ Zf`@pW*p%pP` P` X Ǿ P UpV`PC`0` 00L0@0`^Ѝ8᧾P `@00%%%%@-@+pFPPP Ѝ@@@@ L0L 0P0`^] @] Ѝ>Gm-IA-PPЍ0S `p@@@p\PP D00@ 0`]^W VP]VC@-@ @|A-p@`P@0S 耟P@0S0# CV* UR@ R %S0P E@# CV* WR   R %S8 P0d_)@/+/+C-EMPPEߍ@ 0@qp `, VPڬ嬐P ` P:T0S E|P @  M0SpI`P  P@=+ l+A-kX10S@GkD1 RpP? ,%@ 1P````P 0p0000 00Ā`]\P@pW >@p\W Pᐈ0S\Ѝ '@\@D/+E%%%% L0A-0S@`r@0P P@]@p`Pu\@r\p\D/+@-@<P 0P oE@-M@P Pۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` l}P JP H$@ ЍP  PPC 0\ \ ` [V @T P uX%XTP ӇT@@P@T 0l000@l`<P#@ṇ0S[k+D/+(E0A-`V8@PNpP0 PЍA#mPj`@@@@0 `X\[[@[T ЍAoЍD/+HR-M UP  @oЍ0@-P@M0SP T@]] UP0!@Ѝ0@T@0: S 5*@h]l+(%(%@-M@UP͡00 0Ѝ0@-Mj0P@u UPh0  R\P0  R\ tu p0St00Ѝ0/+XG+PG+/-@-@P P0@/R@-@ &(0@0TC$@k+@- 40 R\00S@@hG+Tl+h00S /pp@-qp $qpP@ QPpp<+@-P$P3#0 R/  hG+O-$Mq0S|10S%9@dP`\100CS0S#P`vu @ @P`0S00S$Ѝ|P`@n 0 堠0圐00 R 00  00 0 0 000000  000000P`E k+k+/+/+$8+H+O-M#Pj  "qp 00S #P ЍOl0 `F0`v40 ЍOiW /+ l+)%H/+hG+ k+Hl+`k+hk+,H+<+k+8%k+H00S <0P/000S $0@///hG+$l+Hl+/+'G-pP(,`@wP"V $10S1`V``ut 00S000T T00 0+`~+00Y J*0Xs@P W ЍGd"VX V 1/+k+hk+,H+k+O-M`NP P @/P! ЍO "qp@PV00SЍO0Ae"P00 0@bЍk"pP@PX!p 0^!qp0 @P<+/+y+A-p`!qpP@VЍA!  0@6Ѝp@-8P@0SPp`qp @/+0P  P/)%0P  P/)%@-P@p@-@PptP 0S T0 0S @ 00C0XXp@X  B 0/+)%G+0/G+A-`P$@pT'W80@20 "0UP00040000( @0@000S 000 )PPU:WW@   0)%G+P/P // / /00//000////0/0/p@-@4PPP W4Pp4/O-M@ ؃d  0PsPPP0000 0 m)@P*Ѝ000 0 0a)@PT <P0000 0 O)UP@=U@T> ЍO *O-4M(0PX0@ ,0ut @P4Ѝ40SX400 ?Q)(@PPTdp00$0Dp P:J  ` V0/ C:p` P P@ȳȃ00P0v V `V@P,0S4 x3X4 @ P6P)X30pW0  0 `P20S Y Y` P P `V@Y*-P `@T_@ P0S x20S  P0 (0 S =  >&PI 20S @0   1 0R00S8 P Pd p 4ЍO V000 P0m 0PA R TA 0 Pp``y81`@P !X$0l$0@P_ V Vd@Pr P P Pl PX@Put$0O$0@P_{, 0S V V0$0$0S <@P I`0 hk+,H+<+y+k+H+k+k+,l+4l+7@-P@zP ,0 R  000 Ѝ0H+O-`V =R+` =R-`8 s Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =ñPV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` ` P` e0S} 0Ps {LH)%G+9%E(%Gmr"4C$0 RP  /G+0 14/G+$ 0Q/P/,%@-04 ,    00H8+@8+P8+<8+G-P匐剀N@NPT`ppP PT  P   !  O O @`匀G+A-@4pP0`S 0P0aP G+@-@$ 0 @zG+P 0 R   /k+p00S/p@-m\@bPPPpP 0S8@pPp   l+G+ܽ.@-@P00Ph0 0  ;0@-(<+(8)(4'(0%(006G+GXY 0 0R  x00S U d00SX00S D00SX   G+/+k+k+k+$8+(8+ l+<-0 R!  ^ !0G+04/G+0 R 00S P@0~0/0P 0/\!4 0 / B  0/G+k+0 /G+qp/G-p` @PpP 儐u U 0 0 W 00V@00CS7P P 0P@PG+y+PG-P0P`PpЀ@ 0@Dx P nV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSBG+y+G-p@0@`P@0W  S #R0C00C0Ѝ -,P  j H 0 CpGA-0T@Pq1k`EP q 0P 10G+G-1dp`0 @PPP0 rS00TD`0PT@/+/+G+p@-@PPp{ P0S0Jp P,%@-0P ,%80P/ R/0 0S 0 /J+00 0S/$0$ R TJ+l+q|G+A-X@ 0S0dS 0(0,`Pp` pU`r0J+X0QH0H 0.4 00/ 0 0(K+J+([+A-@PU  ^"04Pp4 04 R0PU R4`40 0 P ^PQ p0࠱`  0J+O-1P0sUPP@PP0⸡p`@` V R0 SRA 0 V 0  W0PR 0*9PA `Y0 0 y W`@TP0 00 0` qp +@PPAp ` W0 0O0 0`qp @TPl+J+y+P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 000 r  0@P`P`d@W 00 000 r  0@P`V@J+y+G-`@뀐P@p0Vs 0SP@`-P@tu TUP/+G-V@P吀ጐp0`P80 @p 00  0`P 080qp/J+y+800S/,00/PP//k+k+00CS0 S0 SH0 /O-P0-SP d   8 l?pj?P?@P0S,@ 0R S%|@T I6FJ??F?AX   l 0 ЍO`P @@ D@4 0 AFF^l>|G+IG-@ $P`P,$qpP `~ | z J! R m@yz  0Z Pp@ ;p Tt p@q N*f80  p-^l|G+C-`Gqp pqp@@PP.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P  W (d+j+j+.Pp@-9 $P" 'P= P !srp? p^P 0 &- P& .E06 p+Pxd0`]d0 T0f&@PAP,@m006p/+(d+/+j+G-@tPp`4T#0 5T Ta0'000P0p0 D@6T` P'0(d+@-o0@-MPh@P   srЍ08!P D00 0 &/+(d+@-HP!sr@ 0!0 &(d+@-  sr @@@6P0&6 D0606Ѝ(d+/+G-6@PP`j>T6k.sq 00P6 pD06PU p)`bDP0ЁPP  G.P (d+/+l+@-P ,0 0R B /+l0l 0@- ^ @^TSa04S '005S #/+(d+,00@- @P QA6R 00(d+G-[X@pP PZ`PC`Cp6W @(d+00S/G- M`E@唠唐pqpp6W @ Ѝ 0  PU!P 'P P 0 rEk+T(d+E0@-00mS Ѝ 00 Q >@P 0 S#  PP0P`0 S  Q0 R pV`PPp Cp00/+17@-PU0P( P@ P0 Ѝ000S9@PP UC^PNC Ѝ0@H00S@ Ѝ0@? 0,0 09 D/+t/+?%Snz0 x/+<07@- R ,0,@P?@ 0 Ѝ09%/+@Bl+@-P M# @0.S ^00S Ѝ 00S0 0 00S000 p CưP0@  0R 000@0,09%l+<07@- R ,0,@P?@0 Ѝ09%/+@Bk+@-P M# @0.S 00S Ѝ 0S0 0 00S000z p 6C]P0@  0R 000@0,0;9%k+1M@-@PP  @M Ѝq@-@PZP  @> Ѝ0Sp@- Sp00S p@t, kl0p`P p@qpP@ 0 p@uD/+ k+l+P07@- S SBl0 Ѝ0ܾXPX0@PP A@z Ѝ0@A00 0 9%9%P/L0@-@0S 00(0 $ @dk+/+`k+P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@PA Ѝ04@P,0, 0 10 9%9%y+9%Dl+ˌ0/0l+P/VP @P/5@-@| plT@0TxSPLHD@<8@b9%D%_)^@-V0dSK@S!1 CRJT" R&0CO  R  |  @P3 @.A C#Rꄜ  ̜ 4 L d  k C \0 0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~k+O-`-HMN@00PP*0 S 000C S ?  000C/  0?pEpU:Y U :TЍ D0!R1@0P S 0,ST40, @0D@D1!0C 0 H+0-%4-%C-PM MP 0-@(ݍ ЍC` @VB0Sڐp吀吐 P#0U `ABP0P #D @ݍ Ѝ B0-%H++4-%ˌP@-  0S 0 0ЍP  R lЍX 0L H 0<040800 0000000%%%%5P@-M 0   0t0 @ld P 0S>000D ;0Ѝ,0P qEk+k+?P @P/ 0 /WX/+P/00Sk+0/@-@0Sk+0/@-,@0S0 0q00Ѝk+h0/@-,@0S0 0_00Ѝk+0/400S/(00S/@-(qp@k+/+P@- 00@ ^S00S00 Ѝ0N /9%p@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0S\ 0Ѝp40@00 00( ? @k+k+w4P@-P A7 ЍRS+DSSS 0e C R ( 0 8 @ E C CS -S 1 CR 0CrS dSWS ^S0S^0wS     0  E000 0 FK N R WR Q S-00 0  -k+H800S ,00S 0P//k+k+k+$0P/0 0 0C/l+/+k+@-PU  C@ Ѝp`@%stpPQ 00S0\Q0S 0S@V ҞP 00$Q00[k+@-0 S 0,, *> Ѝ * >k+v{@-@ !:k+wP/0S/P 0  //CoP@- /? 0LP/k+ 0@-L   Ѝk+[@-`MP@៺0-S0p00Cp S T 00ЍU X P PTU $PT00W`O-P$M cLP 00S S03/0L0$ЍeL0 @``Pp 0 R @@-PD &$PP 0@093@!+P0P0U0 P @0+S3P F=⃺A=9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P aK[  00 p @ =RP   R R tq000SPP000p00CS H ` ` ` ` 0U ?o200@S 3/TWU 0 [ 0S00S0000SL@40 S 0 _P&00S k+dk+/+@-@PM @PU@`p0@ mPPU   c,A R  | 000CScd   RzV)00SS# P}U  U Ud0?o2R0P 2/0 RP0 VX 0 |Ѝ 0?o2RP0U U U7W0 0S00S00W 0 0S00S000ES` RU U U , 0 S0R0  b R U2/U}00SS 00S000 S000:S U000 0 ~M\x|G+s@-P`@း000C S0 ` 0 B ^ ST00T00VЍp( `}S 00 000S/P/8l+dk+@-XP@PL0  0S0S  0  03/$@8-%dk+ 80S/S/ 0CS/$8-%O-@LQMp0S [= 0S 00 Ѝ`V/$P  0P! AAQ-P $ SQ@ S0 0 p@@OoB0 R ` 0 0S 0Wpp8-% @- PxP0/9%/-4M@20S4P 2      32 0S 104Ѝ! 0R0< $0"1 S 10S 10S1 `11S(  32 T!2 R (10P!0000 d R  Rd3 0000S P 10S 1e\ 1P j0S~ f0#Sz ,0 0S P 0 !Xl+\l+ z+y+ K+k+9%<+9%k+@-\\l+@- y Ѝ@-P>S<` @@@S 0`p: ЍHq@-@F<P ?hm+G-` @$pP 0ᩧ(S%0  P@@@0^3#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-<0?B3c/ ( 0 0 2ЍMb@B404@-@@T 2P0  9%|m+|G+@-@0@9%0$R/ $吼|m+p@-@8P 00R:0 @0 $p9%{q+|m+p0s@-@@d`D \0 Ѝp偼0U4@PP y+|m+|G+@-@@PC- `?@P!M0`p0PƟ0 0 0 eT-00EPNX;ЍIA-PX 0`p@ @ 0T0 P dU-  D@C<;ЍIO-0M` p! 00@C QaCQW@CACQ7@CT?0! ` ?0 !@PPX [ЍO-PMpP 00@C QaCQW@CACQ7@CT ?0? p ?0 ?@``P[ UЍO-PMpP 00@C QaCQW@CACQ7@CT? 00 p?0 0 @`I`P[ UЍA-0MP@PЍ%P p@0pnP# cP% dP  %PsP xP   1@`0P`D@0 0 M`0P 0A-P@`pߺ<Һ` 0 $|m+@- R$00S20 P00S@o p@-@ 4P0 4哹P~p@ [00SC륺hd0`m`P뙺H0@늹80@0@S(0 p@ |m+k+88+9%<8+/+|G+0@- 0 Ѝ"Z7@-@PP Ѝ0@(0  0~ Ѝ09%ysp@-@P;P %@2P D800S00 QT㕴p /+|G+@-P1@0pS Q*㮴0 0 R 0?o2 `$C@P d7W ^@Q C㏴000 PT @P D7` Ѝ>7l+y+H/+@-@P {1700o/O-|MpP `@; 1 Y0 00  \0ACX 00^YP P0@ 00  `0 W" !Q0S|Ѝ@0/0S00 0 0R P0 l0S0 0AŒ\Q0X0HR?!1P^ A A l+/p p p@0@(0@ 00/0@/+q+@0p@-P`40V0 F@ ӂ!1P@p/+q+T0p@-PH0 A@!Q0a0Ӄ1B0` `Pp/+q+0 0/!$/+q+`0 0 P0H0@-0^@P C0/q+/+<001P/0 R2:/q+ 0A/+0Q@-@q|0A `0L1!0sr 1!0sr  Q q+/+@-`P 0R@T 0  500@~rq 02C Ѝp/+q+ 0P0PP@//+0 :Q Q .Q 0?Q  \QQR/ R//A-`Ꭳ@p0P; R0C @1@C" .70000q+Cp@-@DP0Ts 00CSp@[@qpp/+@- 0 @ Ѝ@- 9 Ѝp@-@0PPS b0C0S| 23 0jS BS bS 00mS tS@p 0lDl+p@-dw`P`00ST;@@nkN g,PVc`p!s q+dk+r 9%C-$MV0`S@p`$Ѝ:S/ %S .S 0 pX@0S0S x?S \S0S 00@ 0X 00|xX@KXBX DXV @LH,X @ @ @ $ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  , @ x T \ \ @ @ @ @ x @ @ @ P @ @ @ @ X PP50S4P40S 40S Yqpz P Pi P`4 iqp @Pav 8P0V{0 Pv3XI 00BH@6X? 0   H \ $  Q0R 0 oqp 0 t2P0h2h"0 \ P B B?ᛡg긷qpG0 PP01P 10111 1v3 P  T10  0R0:P0P Pj 0P \ 0 U 0R0:0P HmSA Pc ^ PHH_ 0Pq+"q+H+/+El+/+k+/+P/+Qh019%H0@-@@00SOoBl(0(01 0 Dl+dk+q+9%/+09% 0@-P P0P0^  @$R \0 P$@R@0^ @R \ 0 @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P 200@p@-P@T `0S`0 0 p`0@0000`S @@@A-PQ@` 1 P 1 PP7`ЍPtp0W"0 S 0 @o0 0PP o200T㢯4 ⥼2P 0Z2Pl+y+A-p`@V0  ` \ Q(P  RPQ(SQ $0RQ? " $ \ (P Q S ^ U 0S P$RQ $2 0SP` 0 00`Q0S P \U 0SP `0 0S0Q  R \  P  RQP0  0 U A U0QPA00  @-boP/y+C-M@@8`0C`F!p/ऀP< A YЍ0 I/o"P R  ? 0 Q   Y0 ? @y+O-$MP`T0pP@0L00SG RD L  R Q R*H)  H00@00000 0 YH  )-  0S0S @ 000 000L000`0C P$Ѝ@y+0    /y+0A-@0S 6PT(`V0(0l00Sdp@ '(`/qp ͲN@00CS(wpG+y+|<+/+$1O-`wvB 1!0РS ЍO00S PА@00CS& ЍOM 0qp   0Z qV Q {랲P@ Ѝ(%|<+ %pG+/+p@-P@T <0@@@ @p ``0^0@y+y+p@-PH@U p@\Qp@F(0?o2(0y+y+p@-P@c p0$ 0P !U@py+O-M,070( @40pap70<0h78D @9L70S 870/S 0Ï0@{t , (0P0s007S(00(00 0,00$0 `00060(0, rs   T000S 0S$Ѝ(0S,0 00000H 0C000L0 " 400 000zy+  0Sqpyqp0S`I00 00S0 @ y50S PIUPe U 0V 1P40S 4L H^04P4U 'V4PR0 QR S P PS P400S0R0S44L0SP`rPHL0 #PPUP: 0 0`0hP0p`PL0 P* G 000 00 L0`$ L0`     h ` D0D0P$ T 0P@TX\P. . P ` @ 80<T0s00040T0PU$00CS$0P20S g000 00 L0`e408 CGPPI h0S8 Z5  `J!` 0C pQ0_00 p`0S0' 0 aP0o 00 N0S0<1YPPYPUp1u. s.0S0$0`P0S 0S < @B X0C  BS pa obZ0Yp0Pp0/+/+l+k+k+y+l+k+y+tk+lk+@l+ l+y+hk+H+|G+p@-P@U < 0P !U0p P$@y+p@-P@= T 0P 0 Up PS @P@y+p@-@`PV0010S0 sr ^U00 s00 ' 0P p 0P tu !R0(P Vp00@00S 0Sp(0(0Sp pk+(% %y+hk+y+p@-P`dU 0S0P@T0 P@|0 pP-@ƪ0 00000@Pp@}-0P00y+|G+@-韴0PPy+O-Pг4M00040c@0P 0 X0S0  P4Ѝ0 $00 $0$0X S38 <|r utE T %2`0 p0@_  0 rs 0Z0 P @0s00P 0S/d2 0  c4 P 0P0@ P(200@_X 02X0QX`pP 0@` p P 048<00 0(00X00 00 0 P|#(sr, R0S0tP 0 'qp@P *F`ut q`pu80<V 0 s00 } V0zHPu 0 3qpm @P`p0X0y+,H+0@-MJP @tu 0 kЍ0@-0 ( 00S@y+hk+p0p@-@嵺IP PP0 P 800S(0Sppp%%y+hk+@-$@$0S000R @y+y+l+O-0,M "0Qp 0S?wyP tC 00#  dPL ,Ѝ4S0S (30S 0S(0S 0(0u0(0P+ X`@PJqp@PNر뮯@PfR00 (PlBlb0 0 0(0a0S 0S D(20SX 2``FS iX1H1X`( 0 @Pᜁut0`V$@PxAut` }810S ,10S $g@PutXZ@P 00000 0 0)@P 0S 00SJ YHSE qp QP 0S 00S1 y+hk+k+Ll+/+l+0@-龙$ 00000S@ y+Xl+0@-魙$ 00000S@\ y+Xl+ @-8㙙0 000K00S@ y+Xl+@-@P ベx0x0S|dyvP@rolif D/+\  1A-@TPP S밭&.KHA%#B \0 @  `Ppn0S0S 0X 0?00]00 ,00SA㉧y+\ |G+/+/+|/+k+G-pl0P` V @ ᵚP 0S 0S Sz+A-` pP刧@4g,0Up0P %sX,p@-HP@T<0   p 0 $*"* *9%z+O-AM(RM+`*V A0 00p P V0S0000AލЍ0!S   7PA>04S S S ᾦ0S  00 [Q嬦0S 0 C Q ? 0   ^R000 Q\ S$R0C 0N00P000\\ 0  C R  C09%Gmz+O-pQpPpMW My@xcPJTpd3dC  \\Ls 6PZ PUA (3T MUۍ ЍpPS@DT2P9@ 63 @@ 0 X ;)| dT@ 5)T@"0S000P ;04P ST@ 5 Pp 0Q 1T TP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S R PN? T00p000,z+9%(%y+؆%pt Gm0@-@PP P pۘP `֘P y!P!9%$E@-@P @P P P,@S *7P1O-M0S" @`0 ЍO^<Pp00 0 Ppxy@`00S 000S  0P Ѝ 70 000 { ' ' 0S @`z+y+al+ l+\0@-PP R^0S @T 0 Bz+9%\0@-PP R^0S @T L0 Bz+9%0/z+0/z+00S /z+@-MP P P7/@-0 z+//@-L@ 0p PS0PЍ z+\ QR0* /QS QQ*/0000/@-@P F'000000/0S 0C0//@- 0#3P Ѝ@-@ 0PSR? P >BQ`  '` PЍpA-`pP@T@  A-P`"pF$@ ኔQP ,00(00 0dPЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@pR   ?PP@PT*?P #SP0s@-P00@a0C`S4   $  T        \    d  l  t  ,  PЍp  000@@0 0 0 0 0 0\/\\A-1!0 f \a[P@1!0 |f[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CQV 0p@]^S @p^404 0 8fp\00H+@+oo p@-0P @R RP D D <f@D@ p@(} @؆%H+@+1C-Qp`Mp묁0@ `P0Y 0 @1PR l1@d1`\0 e\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . C R 8" [T \[R@]S  000TT[T@  \T  \R,0 R Ѝ +@+H++00@-M00 M/SP $S+ +S00+ 0 0 9S#\S @P0 0 Ce0IS@P R00ۍ Ѝ00@00 S00d@H+@+U,O-@T Ѝ0tS bS rS aS @{S000pW G`p 0S 0QU t0t Ppp0 db`0V P0 0$Pz+ؔ+H+@+wO-MDD_.0 0\0.> 0d S \|.t>0 d Q    |  X  ` X l 0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ 孄P  P 0S| @,Sv p0S 00@P  0S  00@[VX=`30S P#Psp5 0y,1S 0W 0S @;SB,1S 0 @KBd0110p\SSL2L"0 N  P2"0 4 @P 0S 00@0  @!p@da1!0 0 $$!p T H1H!0 10S"000 S 0Q 0Sh @;S }S 0 0 Xg$ 0 0$ (0 0坓 ♓@_!p000@ TH 0S  R!p0 U`|+؆%|+H+@+9%?U(+ ˌhz+$9W+!XP~0%$ !p@YP 0 $ 0     囱!1  ! 0f0$$@ (^ 0 0 0$00$0 :00܍<ЍG-`@p娀@jP䘐U@T00S Il0h0BX0 0S0 0   Pz+H+@+ؔ++++p@-P @$000P @p<;%@-@   0@0<;%0p@-P`PUp!@P 00CS0Lp Lp0 L+GmA-pBp` R4 RR R P$0SV0(  R R &t!$0P, _0P00 P0!_ QP!$00P0PT0, TPP (00S(0 #R nR0V ,0020#00$0,0$0/L( T0R #R nR   RpG QT000(0V0(00P R R0   $Q T0S $v (0V0(0 00  T0(0V0(0+GmˌSL+@-@X0  0S 0S00CS0Lp X40 o+O-MDMX0`Sp00S 0S =_3X0X0#\030 `00d0帓XSXP 00CS0Kp XX r*pP0 l_0 X PލЍP2 yKp0S 0P 0P p4S 0p0p4S \PP WKP 00\0Ptp0`0d 0R000d00S 00Sf P00  2 02^00S +Ç+z P0 ^0+ⵇ0+Jⱇ`Ja! 0 P*\PP JDP\e ( p$ \0p ! 0`PS(00PX50[00.t0\`0P l000S SP@ o0 l 9(00(06+(%RK++ˌ+CLukU-Gm@-@P 1^P@-@@P "^p@-@PPp 0 ^@-@P`PP  0+p0 * Ѝ舔+@-M Q qM`0S000@03 0@岐0S  0] 0 0S S ` 0Y~l=@P *0  P*J0 E~00ڍЍ茔+t+x+HqGm@-P@  0S|] \0`p `  90P S w ]ЍЀ茔+G-pA嘁0 0`PU , R:(,=00( &U# \U   0 R`Z &R\R`P , R:(,00(P    "pr P qu PE ,  R:(,00(   Pt  0ꌔ+؆%A-@P p0R`*W0 0 0t 0P P O-0㸿OM00PЍ080?PU 0PH0 \ R0S40P0\0 P R 0SQ0A 0QES0=0C>S|> - - - - - - 1 - - 42 d2 - - - - - 06 - 6 - - - - - - - - - - - - - - - - 0 ; ,1 1 - - 2 P2 2 - - 2 - 5 - `6 47 7 7 ; - - ; < < - ; S S4 0PS0@o0P0  Q Q*S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0j0 P^S0@oPL0 R: L ` 0p卉00)0800400S<';8 00 [4 00e|<0S  H0SSP80S4PU 0`  E}P0800A E4 r0T P 0  004 0 0  0:00z040 0H:HR <00s, H0P 0S ̹0S 0( P2S 0 H` 0S0`V: $D A00@ t9@0S +P 0A[ H0$tP x0 0H$0崍$0 S8`0V:m$ `000 00C 00$0P `80 R:PN`80 { `S Cp X{70 P   R:1 ` 7B7` B'1 01S:` 007 |.0 S0`(78 00 tg4 00K{<0S  _P0800 OP80Sf4 00%{<0S  {80S0p4  H|`P <000F400<0`4 0{<0S  \V 0400<058 00 V4 00z<0S  D`L0 R: L !` 0pP00pY R  Q $5 0/Z4000  ~P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ <0 0 t  PQ8 p0V `XDcH0p0<H<p(0000S s4 00Rz<0S  p PB"000Q 0 0  0p V0`0  `0P  ~ P\   p V0S` 0  PX80S0s ""p0 jY04 040P0 P 0S 00Pn80S0sp!pp 4 040P Po P R00`<pL0p<R80SO4XL  0`Rl0&004 0V@*000@+++|+0+lܔ+%D;%Rht@x+Hqt  H++ ˌ"0%++t+0p(pW10 (W0 P0H !  R 0Bf 0P pW* 0$ (1 0X`pH0`h0<H<h`x0h041 8<0 0R,,0vQ 0{Q  |+"ܔ+p@-@P`Tp0wS {S sS 0p 6P 0 HjX0`@p 'P `ˌG-`3PPU00HX01p R  p@ctPVCGXpp0!S < CQR2|@ @ @ 4A @ 0  X0 0 00 00 00:S 0S0S W00 000 0V 0S`: IxP 000BS /\ +0p@-P@T P ڇP1 0S-A $B A B \B xB @B 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@ +,0@- MMPC@P X W p8W+ + PAۍЍ0ˌ6H0  BR R RJ /(%%@00CS0 S0 / 0(%@-(A{0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@Jb+1@-01\ @T P#Oo\B@T P P P QQ R P\ \ P P Q R  ,+0@-  `Ğ\ @ T\    %R    +,A-pA0 5S$\! R  (P <0S 0 0<堤`p娀P0U00S 000\P [P H ㆤ08 0値PvS,l+C %p+jp@-@0`  *T  vtxh pdPPT p gvP000ST@ @(%%F+[s@-@P zP;@P @0?SP@P` ᵮp Ѝp/ざP@KP 0S S -@ꃈ0S00Uk@-f1 %0@-@<TQ T00 0001S R0Slp@ƾTX` T@0$P@ 4T(8  0@+E%,#-@-1 g%7@-@P  (0S 0@T 00 Ѝ0 0"S p`@-@ P  p !UЍ#p@-<0XPP%0ATp "0R   DS" @D?lApX;%0 0p2#L @ "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L "L /0 0p2#L "L /0S00//00//H0H 0p@-@P@!R0 U0 ,0P01p+P+01//00/00/00/00/00/ 0  /+8 0  /+00/500/00/00/)00/00/@-@X+00/@-@J+ 0  /+5 0  /+ 0  /+/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/E00/00/00/ោ00/&*(O%/g"b @-0  0Ѝ@- @+@-h+s$5 0S04c@- +@-h+ @-0++ @-+((5 0S04c@-+  @-/ @-0++ M@-+ @-+ ((5 0S04c@-z+ < @-q+< @-h+ < C@-_+< @-W+  @-N+  q@-E+ e@-=X+ e@-5&+ e@--+ @-%+  @-+  @-+ @- 0u+x+ @-+ @-+  C@-+ @-v+ $0Qa @-x+ @-@DↂP d 0f" 0@- 0|1+p@- P' dP% <P  SuP 5P 0CP  @@PV 400C`F V$P P P0S t400C`Ual1SS !0C B/?!1G^xP00 S11W?zP`PxP@a@1S4020/C(PZ( @@P{   0@S ${ h ${ ~ ${ T{ ${ { ${ ${ ${ ${ ${  ${ ${ ${ ${ H P3P$0CP?P* <P >P P10!1 NSPN0Q^ B 88C8 P P?@ "0C S񟗉`{ { ~  ~ $|  [vPq P1aG P y>~1S'ʰ1 G P zy/~P 00P1 RE40S 3/i PPP i P,ЍPR0h ` 0Sp0W 0[ 3/pU P `F P 8y i `}i00x00A<0 b02P [00P000Ad}ix+{%IyP,RS؆%L,Ԇ% 001/x+P0 R0//x+O-PP$p`*@ [ ! = 0P@ Ѝ0y00 1\$<0P0 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @x+P/D0 R/0@-A1 P h< @yx+O-0Bp mW k0 00p0o Ѝ`440S 0S KrP  w[000 @  S" S00 50S /rP  [[ X[ 0 0 0! R @ S0 0 rP  <[0S  6[00000 00` S 0PSHP P0SPPq0 00q0S qt ?C S  [PU  Un0X!0C0S;3PP0 PEZꌖ+؆% @VUUUO-$MHZS  R0P 0L`DpB :0Y0 0S 0g Nojs뤳`Pqqq0@@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C0D S0  0.kuqX 2 j0  BhX P0{ P>  PN P P!VUA`E D]@DP`4j j j@`"PD P AP;  JR !   ` D0\0@0!P1 `V0p00@  d`?^|`F`FV0p00@  DPE\@DU`E¨` Y @ ns@T`— R    BY00000S 000 0 0jn$ЍO 0Y S ꌖ+8G؆%%A-`PlPp `p@p@0T `P@ P P0000茖+@-@Pp 020T0* p@Ѝp0 00nt` 0 0 @3\@t 4uP ? R%+h0p@-P@XP0Ps H` R :(P 0S@@Q@pv R%+@-@C0000茖+0nꌖ+0+nꌖ+-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  } ЍЍ/@-@@ˌ@-@ˌ@-pMP@`,0 0( 00 0`Ѝ@- Ѝ"O-M P`@po@oUkT0 0`P0 D0SPZ 0SW L00SSDqPPL00PTP^y@DO@W :p dPRWpV`KЦo`0 S`K0 t@PD0@ >PT0 0Pd00L00D H0T BZ  eu ezeeЍD 00R00S 0S qqL0X#3pztP 0 6u똰IEIgg B 0 EGAt``PzI,I`ggꌖ+P,@-,, ($ *Ѝ"@-`$0P@ 0  00 0`Ѝp@- Ѝ"@-pMP@`,0 0x( 00 0`Ѝ@- Ѝ"-@-00a  2Ѝ Ѝ/"p@-Pn@np茖+@-?7@- .@gB$i[PU % }e/00h@PU %T mdw/00000S$$E Ѝ0+|i+i+%iO-AM@@gPP4q@ & @C @9cPࠟ   IP;/Aߍ`V ap >P`PX Y   =R@8@bl `kGmTT%Yt i1@-pO-0MM 0p@9w`P2 {PP* P OP 0S0 0 L    HPPsrP 0 Q0 01PtۍЍ%0P 0 0  0 i,00S/ 0P F@-@++X@-fP P <Afq"P@|A-@M S@t00{x%P.  ty0S%k}P  X0Sn Y0] )PgB@Pc$[E'aE*B^&@(ЍP@R@P/(P&(20S AP(.Bp0 $!P@U ( X%P 0)AT PPP 3BP p`PP 0q+Q S0p 6&V`T(pA`T-@p0T-:W@Q  R@4Q p0Q  R@AP`003/P 00  h0S  R l 10!84@APT+K++ˌ@-MM+@(j+(]B+(jB+\(@PލЍB@P `0 @@@@@ @@@@+L'B(?nݏC-MM+ iP+ \+ i+0\ @P  ?ۍЍnݏ0@-M 2s1@@@$P @$! P A0$*!PRW)Q`&Ѝ0RN00S 3/P 0$003/0$*AP5CP1[P-W@P)tAP% 0P JW?  0S 0_ Z)(P IAPL#4m0kM&A)*00T++b!n,nP,L,K@-M r0@@@?#P* 6@  P 00*!R00$Q T*@P  k0S 0` 'P&(W*ЍT++O-`M  0 0X#*0S ` 0 SS 0rmp0 S00C `@cm0S :oPP @B pQ %S0S iSc %S, dS 0T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@  T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^0  3/PW Ѝ 0 h؆%7@- @PU ! `g+00 Ѝ0llgP \ j!L  `q( (0[!+i-7nGnRnknQp@-P @0@0S   $0p@9 0@+Hq+7@- @PU .!  `+00 Ѝ0PP !| `d00S VqkL L0[Mqb0 ,+iownn+qn%s@-`4Q@d=m[~x :cgqbgm /cg#9gb9}i 0An@Pxx~E8덃P DC0b3b }ЍpL,ˌ%nO--{MpP`Zb0 !p} ⌕脵00 l-(P _LP _CSp@T Pe rV0B? 0I.P "#/*@P "&*00lmP\mP&< P  8!< ;0S ;P ; 00C}3"0{ߍ3Yw3 ,o0z"!03`̋1,0ˋ 40,0,L0 L  0P,00z?"!!0 P#   PM 6 YP U $ ljT2P ll*=o0S \PU o@ |P0 T 0  SR @(1P ^1 LX 0I2 hz?0YC}0P0SP @ 0V 0R0SQ ^0SS  Pka)|t  PS 2 ++pt+*p oT>ao+onn0o+uTUo:oAoY0@-0,M 000000 00P0 00h0 PPP@P DD崥@0Q ,宥u,Ѝ0@8ꜥ [%%yo+ -O-iMps?!0W^P 00iߍOЍ/lx@PX1P L!L00'@P jZ` PPW0FSV030#Z0S 0W0"{(!` P Pp0W0e(U80P , 00M'P'Gm+v oo-O-0MT@pX   p$p `V\  @M'U` '\PP]iP@P ;H E0᳓ PU 0'SP0U*S/ N|P Ep [ /i0@ 0 0H0 t1P1Z 8 )n4ᾒp`PUQV( 2S022SP0220C2   S``# Iz$00 0( 0 08p|W  @0   (PU f4cf0U M `W 0X0C?o20S _Td$_pdfz@0Uk_._z00CS0000'XV0U \$0S  r9W5jzi 0%S @SJ B B*mmD00 o/00L 0.RP 0 0jPH00Zp@P 0A0 \ 0ɒ3 4Q9i[Wjz00X (ASf@n0U dfWzz  0UX ~c:_cDzngU ?PP9W  3WK0ЍO Ѝ/oo0oht@L,(%lo0@-CMl.PP 0S .QZ@P8 icCߍ0 Pbc ++G-p 夀夐PB`A@T:00Z W ,/Z 000 ZP EQ 0 @o؆%A-`Pp p@ l4 pc 9P@貘+A-Pgo@gt pb0S DQ0Q.SP @$ $U U贖+O+@-M4 0PDP  b 0PDP  b p@ ( *l b PhU*p@ l`lp b @+PPЍ U }U`!i+%iК++8i(++O-M4d0 @bT400f0 ,i40P,   -8 4d0w=C $ CTrR_P, .͟ 0Q(<P 00 0( 0uPPPPPO<@`,0tD02D,"Dq, g`<J /  0>0pa Xva hPP\  hP;PU 1sS 1lS;"000 UP p@ v j! HjlH QpXKX[X{01D+0~0 khP fhP ahP \hP WhP RhP MhP0:4: @p A*0p HA05lp H0St:t*10ll jP 0H0H0A lp 0 APvPH , $U Y FUPPP@;h@P- ,`)0xt)0wogP\8 0\8UXLy0 y]T. 0)0zV ;g@PEPSfPN X0 @\6SE p0 T@P: 5 _\YVxSp O[7S' X HHEDB#4=7(@ P (0AAP\XP@Ps!:4S 0 zP '0APxP 6T'd0b@Pal\8D'08\80WP8 @`8 W'8P00P8 .`8 {W&8P0060S\80\8P8 `80S h&8P8 `8 TWP000S\80\8P0S\80\8P@sT %0}a\8%0|Y5T$A Q0:$R$ Q9ğP \8şWt^H4   Q4SP 0@?S @P _4{ 0Q0:$R##\ğR#$R#W%HR3$$   (Ts0S1 `P 2@T lᙟh HKH#00S "0S @#$X"3S3 TE 8"DC?00N?C0C ,>$P0  0@F0@P{gKP$A?@p@x0a80CP,0@,ᗾP pyQ0S ,c X >0S@0 <xX+4AS< ". 0 0S DmcDW5S !?o0 0S $McXWXz괖+p+4p%WpNopp\%؆% u++ppi+ p>qq'pv +-pt~+++p+oqppppq"q.qIqWqZq_qtqJr9qqq"Wrcr+r>+^ss +К+CbtmtxtĚ+C-ttttuu+"uBuZujuuuuuP 01/v "C-鿏MP@(pGeP3S0 0` 0`:0 00`@00`n0/0 0P 0P/S/00 0 /S 0/0 P0% R $b@ ` @0hߍfuv vC-CMpP@dP`#0R``T  Y00T0 x0 pX@ \,3TCߍ@%3P (3f"v++vt0 +@-@4 0@x+@-0  0 P @0@ 28 0/P  Ѝ+< ++w00@-@XMP0  0@ P x0x t0E2l@P/Q  0 LL 2 /R@0 @0(Ѝ0贖++P x+++w+-MMQPCdP  @] <]0 00SލЍ`0` `9PP0  0@ 00 ~+~+++++3v+fv@-CMRX6S `P \8lPXT20S H2\6S 82424"N(2 r`P\8. ^20 :4S !zw\@10 n:4!SO *00 0 Bct`tt2@P) 1d VXSPP@M0S 0!0F(!(B0S  : 61P4\6S /,V RUCߍ 0 B괖++ov>+tq+|v-+'w3wv+vZqĚ+vovvpp+v+wTw +wJw^wv@- @T^ S C @TR00S0\\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-phM@P 0S'hЍ0 L03/P 0`  Q 1/P P p08℠0:/P 0 083/ 0\ P0//!01000/ 00#0//O-`$MPA@T )` pbP00 S0S 0S0S$ЍP P00 S tbS, R ,0S R : 8 80R:P#3///@-@M MPp! *0 `p Wd5\\ SS=S 8 d3R 40 H$0 Cڍ ЍTTx.x@-`QM p@ P PP PЍbPTP t0@$PU@@T @D $0 @RP1S nFP >8%0>`"@`\Ԡp( ?p=$} y D J$0-BQY 4 |P 3SG 3lt a a00@? Ԁp䐍0P 0S0)#0C?o27 #3RR  0R6p7P 'S0HpA(\ C~ QJ NhP XP L P ,04! @<#Np\2P  @000@"0x0N?P0'SpH0AR 0 B Q  > 00B,04! 㐀@<#!0pJ  Ga CaKR >a00K?(0811$1~0 1p00 @0Eo`YG_FPE]P 0000!9PP 00S 3/pO003/No-P4]P (S("d+"I b\+b{I`[P@``VB!aV>+"kI+bfI3\QQ0QUh $P 00S 3/p $QUY 0` p `` pb.x;8/0  ``px`".;6/0S3   'I 9V0 0mq倁們`PU" b n,`P  TZP"+"Ib+ "`P ]P# \P \P \P \P \P VxT H  H` ,mPyzw ++ix+k1ˌ}pzx00A-p$0p@` PFBP0 >@ p C 01/@P00pЍpP@00003/003/$AmxO-UMMPdh.(@4P^.z^Q_ x IlW`V`$Z^  UݍЍT  n? 00 70 0P0@0Pύxz#Pp40,Z^4S =07h400C27\4=1 V =V?h400C26\4=1 0 000000000 00plp` ( :0440T40s -1yv0 00 0000 0 0z[p` 0440240s -1ଔV4 `v00/ nlE "TX5@[^ =2,XL=1Pp0Nόfp h \ d$v00?00,Z000Ӧ?%N?/&"@LdT`( Z4@0S N?/$"84@pW(4 0}10  A fT "aT ]T4!0p 1$,01( L!!>,H48 Ce7$ 1^(1)04 $,10 (q ,148qHL$!R  p} \ z^x# @p#:0"$1H00 4;$ ,x2P p>{\ {K$100$10H0 0 0:0G80<780Sp= Pr $003/$`ZPM `qQ! >,!  6$H(@GS  GPn<PK <ISG 0.$10B04!8C0(1}1S0}1$1S `4@@T+L,(% ZˌX\%+++X+"+ y_PP$030/0@o//BO- M@MPA E0*!Rp0)Q`U0 $0   P  Pp ,>)+(0$0 |$+)pP d4\,q ܍Ѝ<4p H0Spp0 @0 4p0SW00_ , R\  000;x8,9/PI0  ,x8;;/0  ,x8;9/T0S8S0CS񟗕( h h h h h h h h h h @ Sn "Se S P0~  R{ <pDWv  D'P d0S T"8H8 ⁁8Rd0S ("8\0S  "8`0S !8X0S! S! 80WL0@ \Q\0S ` R !8x8 BlQlh<`Q`\6TQTP0HQHX @1R<&0Q0}P00P0*0YP0 U @w' (pPv 0Q  c+yfyvy yypyyyy-p+Jzyz zy3zy8EzyQzYzyez]yEyyiyT+O-MUM08*aV"e5''@'| tew pW &0\0 T Q 0ލЍ Z )qWd ^!P FPc' `P D @ P @pH圴` XB,T0SYl, d) \& 0S 8$D 0P000P F0`\P14s10#5:$ &&&0S && -J AX0PZ@DP?@ ( p `V T  `80p  P 0 0 ,0ST0 S00 P0p800SS40 0  0 ;x8:/P00400ST0(ll S S        H  Sc  SV  0 <0W<0PPL!@  PP ,0$ 40 ( P R ,1XP$ WP 0005S04+^P 14 5 t0 S r0* i%а 0İ 0+z-z+zz{"Q{S&+|6|P|i||;||||||Zqh{jzfGcszxzzzzzzz{oz{{{{Qz8O-AM@ MTXXp P` ]@P`T $RP```PP@Aލ Ѝԃy̓C̳ @o3(4@$80 gDP@T@@<X !P ` Q430(308 8@4 B2020Y P  )딢娂  8@4p20d2@DDAT P2P"PP崭}$P @2 8p&PI,2,  *20)ATp !0 UP|'!%0 Z@0S #P 0Sx H04@ 0000@;x8 8/P6  &P !%@P 0  x @l%j%0 1p@W:p@w |Qzi|  }}#}5}I} m۶]}w }+z+ˌ"Fmb@-0`M2 pR !,^RЍ04P0 @ PP@4 xp8;7/P  PB++(0@- @"!P(@+@-$@2S 02+O- @P@B`P@   PP@ 3S0Ec#ะ@pPU*@ ЍI 3P  2P BI@    R0S p؆%i@-@00 P Q P 0 CЍ C-JMM bpPW 8W@4PTbH*PhP8b Yo`GFWI  2UP 0000 !K10P < 8<1$P <08 <@XNo<0S0 0< 8`PX 40,0"1 010100 0A000@00 t@@@@n,K@0S8 0S(8JݍЍATNP 08`$!QQ@0RT<0P 0 003/@<08 S 0S(0S 0S8U(0S003/@<08 S@+ 8 ]% 0S/p@-@P`!a(0S  R 0Q003/@Qp@#@-@4M`pP0S4Ѝ0 0L03/P 00@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0A. PPxP;5/P A> Co} 0@o/b 0!!/+10/Tp@-@4P0 ` M1111p+O-P䐟䠟䰟@p`0/ C !  !0  P]V00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 Ѝ+%    0@-MP@/.*V1, 00 0d000 0X0@@@@@10 00@0 ,P`ߍ0P +O-P4M`@p 0SpP pPp 0S00W0#S 4Ѝ0L0 3/pPP0 L03/P+ { 0 Q{ 0S  SL0 0P  P 0 0H  , R  T  X $ \ ( ` p, 4@8Td A- 0R0 DQHa@ 1QRpB   !LAPAP0` A0Q     TTAU @@+}O-p\BMX1SL2^X\1S,25\X1S \QUЍ0C`1`1SsW``P1SP \1 XX1! 0`1V$ 1x C H0C 0[P 0 S 0.S  Kp `Z!XeP 2UX`00 0"A"XT\OP \!T000: SX1x 2 \1` 0 0 X1 ` SX10 2 ( e K>+^% + -  p@-MMP GPAoۍЍpP`@+ P*+> P* P⬪P2 Up@-Mzmi|@d(/PM`P]9 k< 00 O P (1\9(1 k3 FaH @P [ލpab}c+w ʁp@-@l`01SPPP@pP0S0@1S "P 00 ! !@+O-M@PP! c0  0븢p`Y  6pP 0 0P0S<ߍP W%0]PhQP0 a0CS0S p `Vp08Sڠ0S' R$ S\0 0 a00y  p 0h1U0ſ0 0s0ZD+ p `p .0P![h!R( 00@P(O V 00O0 0S*?0 !C 0 5 000t00 00S 0xV<a0 (~ d@edA+3~+SM2 X01SP@/0S0 1S0   +C-d1`\1 R0``DADh90 0 &S Ph9!P h900 ! !PV0<1LPDTPapHNLP NU `1DP1 NU `1TP1 NUP1 `1N808 Up!p@ ЍCy w w +w "}@-M@ cP @oЍ@-| 0S p]P`0 X00T T0PL008 80<, Ѝ Ѝ&+9~++wl+++@-Ml@p9t)0 0 0T00.00 0 6p $0t !Ѝ+x p@-Lqo<54P@\e |p@k^~-?@-@P  w R4 (0@zЍ0@ Ѝ/r~~@-0  0! P L0L D@D @08 ( @0 Ѝ+/ +w++-3M MX <P0  4OP Oo3ݍ ЍS -3M M <P3ݍ Ѝ0@-M0  0 0S@Ѝ0h0h h}@PX0 PPP00L L0PD@00, ,0P,X++~+++~l+++@-0  0 P <0< 0440000 0$Ѝ+~++++( 00!S/ /$+( 00 S/ /$+, 00S0 10 1/%++11<0@ Q !@-0 " !/+0 10 1/+@-MF/.MQ, 0lh6 0X 00000@0 ;,@ߍ^%P +H 0D /Q/QQ Q/+^%@-@0 0 0@RPЍ~@- @0S00+~0@-AMlhP N@ zG  P<04Px9形/>0Aߍ0+d+P@-@ 0P  Ѝ+-@-  Ѝ Ѝ/-@-0XX0F@P rD    Ѝ@Ѝ/o -Zq-@-0XX0'@P SD  s  Ѝ@Ѝ/oIZZqz 8@-P P P@-@{KP@ V+o@-@0MP 0 P B+++@-@0MP 0 P B+++QA-@@1@#PP1P#T|p|` bP (B(Ad##AA):':\A\L,+7@-@(P @BPW 0 Ѝ0%0@-EMe@DAP iF =P0000U (0($x:@Eߍ0d++CC@-MtpA ^ PEFJH10PH P00P0 < Q Q  Q R `b g D O c (P P 8 0O-Mc(0<00PSp@p`00 $ 80s!3 0?h0r@l0S@3 `f 0\@/  H3R0p0000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0002Dp0 0 ~?HL0 48 u?00(,(, 00 0h?P23V 40p0P<0SQP0 N T00SJ0Sj000q p0 0 0 000000  \0 0 00000PX 00808/Q?0 PpQXQ Q(00,0 0p4 80 [`\%p a X0S l^ 0$0p0 0(00,0  04 804p` 80ظ+P+/ܸ+Y"qC-`FlM0pSP^xy >0S p>0S<i>0S$b>0Sk[>0SGT>0SHM>0SIF>0SJ?>0S8>0Sa1>0SL*>0S000$ R(000 "0A W(40S  0$S $SS $S)400 0$4 0N>0E( v>0SP4 PQQ@00Q00S (4Q (4 $lЍC W3W0^ P^ ^ ] 48P Q Q0 L13003 0>0 | lЍX300P3 0=0 0HS(0p`@ 0 ] SH0pP0`@SH0pP0`@SH0\000 SH0`000|S"H0d0S dP`@Y,0 <",L 5P0   R>0  H0L0  H0L0  H0L0  H0L0  H0L0 h H0L0  P H0L0@ 8 H0L0U lЍC !SH000050PpG0  d 9/0 00(00ظ+`b D g 8 +P+"P O (P r r d DžЅׅc C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``0 0pp07/@-M0@0 3/P 0 004000 003/ލ@-`,MHP M8@0 0 0PP@00 RS THP pW -?P00P00P0,Ѝ @T@0/W/0  08H P00P0؆%E0@-$M@D0X h 0P 00 00,0PS1H0Dd$Ѝ0超G-%(MpV@PW \a `XPP`D0,` SS0 Q "S `P  :P !X$U0$U ` 0 幕0 0000 0 0000% 0MPPX2(Ѝ`Q @x x  P 40C-S,MP80S,ЍS S S !S S @P p萟```X 0VSP eM000  00000 0 00 0 0M`Px S de R O-P(AM@0pP U ! `<#*0!(p<#UP <P 600 P P )000PX!@ 0 0 p `@ABA  !@PQ00#C  X!0-  4!0 D` p2;P@!@3@,;T -`@T@D@`0@@< 0 0K-?0 0@`0 P.㨠嬰p 00@p `HAߍ!00PRPN"+M2ظ+@{|5O--0AMDpP$PO @04`PD X,@0D ,`0S40 ,0 ñXT,  0$ p0pC0$ <0@0 0R80D <0 80 0S d42@@00,4 0$4@00 0A000 00@@@iE0SH8RP -0P40 0H03/0S0@, p p0C @@0D @000Ƌ`pH0SPP 1x'x0p(1q@P ! B B2"@A$,0# ,0R B#">, > 0 R80p@n $0 Rp0x1Gx1p#0q0002AߍD0` ⇁0L03/ 00`0:x  Q * Bq Bq BQ B B  0>>Ȱ 0@` X@@p0 0,(00 @@@@@ p@@,`PuUߍ pv'0 `∀pDO Z008*b0A-@0<0SH04 `pP:V09:?V090VP:0 A!r0S/A-@P0\03/0 0    `0V R!  B B" k"10C+Rp0 !"P! 0 `pPP !@` B"H"00080000$0 01P0100Aοd{ qO-OM@P H(s=a1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,TpP5Oߍş[@lşP @T00C0p0NC2 VH0 0$ 0Rܴ V 08L0X T3/P170 00H03/ T 0 0000 3/P#%#t&0 080x 3/0Plp 8X̍ 0 030300 07000F00, @ᕿ 01 SH0 V p .4t`X0 PP00P0003/088q0 X 0L03/l 0 , t T x X h H  0T`X 006/P `0d Q 10  0!s"D  V p0 B!D!2 B" 1ᴡ0C100C0 p7 `V`s`V T00 03/P0 0D 2#4`0Z7 uP0a 0` 0dD   p B0 p B D!2 B B" 10C10 0?o2100C0/ !V +x Hy `b y ([ U A-Pp`a!@,0P  p0Q p~ p ;`P !@ B"h  ;T0 01`0(`10q0000t 0S/ LP0 05/00P 8p<  @  0P4L p P $ Q:  BS:Aߍ L`0 (06/(0Pf 8< b @_0`4 V  V  R U  U  RE ,A0  ( #6( 0P 6 ( p,$ 5( ,0P 0 pP`p0  6 0P@5p`LP` Pp `P@0` EO-0AM@P++O-`4M0@\0P3/0 X ĀX p ppP(W 0Y2 2Z  "00 "  !" 01 " X "  !"0  0" " "  !" 00CCW 2"90E0 0l20h20d2 0J000 0H0P<1,pp@12((4Ѝ嗓)08q P ,07,0PZH D000 0KP P`%0,00+0P8 @ 0S[00S[ ZP 'P00S`(U0,(0u0V,000 0i3/`t +qd{ Hc k uS y l V h rܸ+@-@P0z7P/HP0S0O-pMCO TtUl4{ 00 rs= 8b0  * 0 P  0@0 B )R RPR Q0r Q0CFS0TR000US00Ѝ@0  PT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(4@ PbP 0R 0R [X T00U00} [XxT00U 000/SS<z +W++"T8 T++ 8T+O-0MSأ@pЍ`  W @000PS8 cSG MS  0 mS  sS. gSR  03 0S cS !MS @MSCS GS W+0C?o20S 000 00SSSR mS @ R O-OM M<00(00 P08 @0 (0PP0@D00P P,0 0H03/800<00 0!6 0R 0 , 03/ 0`` S04 H&P408&XqU\a`0$040&00000$0a,`p`0pH0LWX0h05R0p0lh  `Vp Sh `U Th PUh VU 00,0 TP]fd씟a_0`080PS<0dP0O>0=C0H0 8<03$xU 0S T0 P]0 000H0P0 F0PT0S -x5P 0S40Q00`Q0S 0 L0aA3/P 0P P  2/``dF  pBX!ZP0?2UP(0 Z [ Q PD @0    SD0 R8X' a`0"$0$000,000$0%$0t HI 0u2x 0 \?0  0g2` 0$1 F0]2Ȑ 0 '0l01h 0Lt0hpH+ +    Z*pV 0 T\U 00d0 T\08 T\T0P0($00 Q030#Q0S $0A,0"PHbp 0(P &A00P3/` 0``APQ1V㞿P(0 [ J Z C80pW0Ipÿ D0 40 W0WR 0$Q(9$ (0P++"%p0@-@M@0L0 3/P" ! !AQ 0 0 SS@Ѝp@-MMM`P; `@P 4 y+ ᛼-MލЍp{dЀ@-@P Hg2P <b2P ,]2om,p@-08M@ ! 0`P 0 @@hP8Ѝp:2PUJ0 00  0 OP@o\1A-MMPM p C 01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a+[$0pQ@-4 #"T R0//s@-(@T@ЍpH冺0P傺0 00003/@PѺ/@-tM`P Q@0 p@u@!P  10@Tp@tЍT0 @YT0x Pp0p d p吿 `P P 4@兺u+ $+6B+O]/@- @ꄈ'w///@-0@Q TZ@`o?0 \ 0P00P0P//$+@-0M@0 ?1\00S&. 0     000Ѝ. 0$+//G-ሐ`@pWT0S0S .PP$1@00S- 0!X0-0pp@$+0SR00/p@-@P+<0<`P" 6D0# A@$!vpP++A-`8P@b.pP( ^' A(+@-jV@-Kp@-@M @00p ˹0S YPPL00`㋳V 44 0=( 9܍pc+ӈ1G-`1MP@11P!!  xxaxahtq@Pl7TaP0ԿP 0[4Uߍ B"UB?|+ -pP0=SBp+ ?q@B?`>@6P  B4Pt@%t zP \0 D :9 ; ?GmT+ˌ1A-P1@5dp11PT T T`T`  P D ޾o 00c+:9!9Ld@-M00200p00`0P0@P @T 1\ 1T1O/1 P1O/1 ЍBRw;$0 @- P 0 +G-@BM `P @/P @P @ܠܐ܀0p 0pr0S1O/1 Bߍ  Pl ppl0S X LRT N1, 1t++s,ډM;DJp@-P@T1 1  pd+1p@-P`ӷP@Ϸ0  p@p@-P@ P $11P N/ p$V1p@-@P1(1 P1 1 p3V@-@$C-aM@.p.T[B嬂rP`U U.20P$0 JPZ l"0(@80@PW H",PU , )$ 0ᦽ,P@)PK1PL0P P110PU)!,A`pPp0S7 S1  @. 0 0`P@Pd1`&PP aߍ@G(!0㡿@P>!0,㗿ꥻN?ZP0@Z; ER;   & 0F 0 0 p000  S@/឴ f%+P+d+O=9:++s,T+5EP,L,ԭ KA-P$pa@P-@T   匝P( 0 2뛵P 0 v P ~+@.oЍW``dX μ< 0-+!ԋ ??qʋh//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/t,O-4MpZ$ (%t,@P @ PR000f 000V0 0R(  0V @P 0G(@TPT0@P0 0 00000 0 T0$000R0#02S4Ѝ; 0 0 0S  R# S   @ 0  00PV@00V @P 0'@TPT0@P RK RH RE (  , ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 0'@TPT0 0@PT00@PT Q Q0   ,0@-4MP!! 0 P P P@4Ѝ0@/@-@ ;@̹p@-P@/:P `@ H *0P P `Ra BQQ pQQ 0@S:p @-H30RH #@-"0@-@P4M0S*!1PP Q*  P +U 0@S Q 0S4Ѝ0|,p@-0@ ^T00PUPU' \$ST 姴p 2@Q^U@.P@ @$ $ 0 00C 0p0 ~p@-,@P+0P ;pA-@d`dPp㌀0ST 0@P"Rp@P@z X+ 00S@- /X++C-ẋ(pX,P0`@$ 0АYĐY T  T: X0WaU U VP P 0|U Ѝ "V0  NS(~-~@-@P 0  坸@蚸̪z Xp@-@P0S|Tt 00 Tp0"SD0 <00Rp( T4p 0X+t,x,G-Ph`0Sp;@S S 2@1+1:X 嵳p  QBp\T.@T&RQ0000(Q $' Q 0S T v|! 0@1 00 0TRTR"01|,{p@-P@q@op1O-@0pS`P  0PQQQS SK0UȰС0r 0 $^0 0"90(Q $'0, 1QX#  E vQ 0!0  R [ R pR L0L L  R# Ѝ 0W1Q:P X+z Xp@-PL@0St!U 0E p(0"PE0U055403 0(2#pX+t,x,40@-@0SZDP0@0ӕX+@z A-PA`0SH!U 0E p@0SV Ѝ 4 U(0@a`P 0`4p0@00 )` 0PpH p劲 `< P00'p(0,0`X+x,t,s܌1A-P0pS@`  0PQQL SD0 )2  0 r!Rv?000  (0V$0X3,0R 1RP0 0000 1Q\00R00S 0W1S` X+E@- @+00S T ]Ѝ2X0O-SMM2"}\0@S2"`0S2"bd0S2l"h0St2P"pH 0SLჸ80S 84 SRN80S , 70pHPASTPPEP۰ @ș@`P. @ A =\00`0d 6 00h /X p+h;S \$L!L@0}P@j_oRݍЍ0 :S 000a 1 00 0 0 0C0 ;0CS||Pp{ X-Hb؆%k-}Ǎ؍@z Zq lp@-@TP0SV!R+)r00 S @ 0N Dp|,O--BM MX\pa@P 0`^ ;( `MpᅵBލ ЍL0 Py ፮ Q 0  d00 ,0 x$0!`4pX00 pv`$(00C0;S d P㶹PW +RQ 0P \P SD0Rpʨ0S S 00S 00 0`S0S000000000 P 0S  ` 0 R$ ?! 0$ S0S 0$ iedA0O-DMhPl`PDЍ㢳@P >$p6# S0 }" P`;#S0r"p0 d00`0\ h0x00Xo P$`P`t0(08 H2000 00 00p;0{ b@-`X0S0 g{\0@S0 h`0S0| id0St0` jh0S\0D kpP S 0&L Ѝ| X-HO-TM000 0400,00(0 0$ 80 0P! 0`@ @vP$0SUФpp Q 0U U H0!<01PRPp!PUp<0L @P PUDp p0S H0L H00LS40D 0@0Pp0P4p S 0  S PS p0S; S S 21+1:$0S L;$0,  QB\X<X4RQ2ȠP,$0&$0(Q $o#(0 S ! 0S H (v80ƀ1 0$ 0 0 0S0 0S 0$ TЍXRXB"01|,{O-`0M@<TЍаPp@D0S X08  0 0 p`1/Z  S     yQ yR  080Q0 0p`1/P ,0{ A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-㳰@p`P1S 3/P @`VTd0@@ᜰT0P0S@000S4000S(0000A޲0| ,,0{ H p@-@4`4P0Sp@β10S 3/@,,0 @-^ ^P000S000 0#0/0@0/p@-@8Pq8 0X0S3 3/P0 0001S0180sp` ^$ 4R R0 0`40$ Rp `083/< 0 2 `P    000 0S0\000 00//00/00/00/10/Q@-@@L 0A0003/P@(哭$ @^ ˌC-`BEM0SP;0{p 0Sr0S|k 0S d0SH]0S0V0SkO0S00$ R!000 V F 3#&> 0!C> f`B0 010@0`"+P+@ˌO-MP50@10` P(" * `b0  000 op!@䡟o000 a!币Pb0g0p@ @p@ᡭᔰld峲\x@X  H!0 E<  $!`0;ܫ! 0p20 R   P oЍ 0p!快0i ` ` OT 0p-0@0 NR S3#:`@0"+P++St{a+0A-@\0`3/ pW@@P@PP< 0DW  \-W0 U    ! 0  0 1    x  "l , 000SJCT T0T TTPw0B@@ r+qp  uP H| yƎs@-@,`Pȯ01Ѝp+0p@-(M0P,03/`}0@ S:000 00 0 0 0 pp` J0A0ᷨᑯ(Ѝp0$ O-@-MP4,PЍ ᖮpP 0p r@ @< 2" PZ0H03/0S@`H@`A0 0`P |" 0 Q"l2 2h"I0C 0 0 000 0A 0 0 0$ߤN(0S("0P L0 3/P X0P@T`@\0`0 S8ԭP\ 80S ,0 0, S001z40P ∡0L0 3/0 0P0 $% % F   0 0  qd 008p`_@徦0弤8 @,嶦0峦p尦`$0`4 4!0 ` 40000 f0,0 pE0$10劦0$10\儦\0d00h0@ 0l0`p00S<p0  PÁt ,l3 000000 000 0  080p⿣p` 3d,0ᕠl0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV 0heP2Q 0TЍPM00SZ 3/@@OoBS f00&0m 1@0@!Rx!@!x@|@pPpt@"t0S|0X*@DP PQ 0!P@x 0T:x0S@ hBt@OoB@|0xT:6@+b| ƎT++( L R"08l | , u`s ` +>SO-[?UM00D48@< ` D ҨP ͨpP Uߍ¨0P P40,Q3, 080S 0R@ <0S6(1SL 0K ,HLAP4#0B4  H@0#; $F%" @0P@Py @T 2"B 40P 0S 3/P,00,0|2, 0SU@`PD`D@s v0ySM Y0N H@`(HD! @<#P`T@ФP ` P@ M,J,00 0000 @y >   , n 3, eA(00P1:1!p똤 @0 000000 00000 0p` DҞD0U4 Q[T Y   4 v )`,,"P no[s| ƎO-JM M/0`@0PP+?qP) n0S% jt"`0ᓩ`r`!`/)0P T  0CT *0C/Q 00堢P@Ǣm+  P:?0  P+0: S `V>00ꨰ  ᎡPJ>0@0/S 0F+  S aP+  P* P 0/S`0oo`bS LpI0&000 SV|+ P*+ P*\P_@Z[@]UJލ ЍOw@-㋧*@-M @ቢP(0  #@P  P /Ѝ+0S:$c(#"c  8#8S O-M` PPp X㼠弰`pc!PЍ0S @ 3P 0 1@pLP Xp $0 @9˧wnG-Mxz `P`P PP<i+ @P@]  0 @ @P*+J#J.0+JJ.X0T X ٫PP~D4 ЫPPu$+JJ.0PPe+J J?` ᩫPPN+㈁刑PJhp0 0J>P 0. ㊫P UT ލoP@Y+JbJnPPpJ.@0d+N ZP h lJ>SPR }~֏z(h%w+:ʏ/00/00/00/00/0@-4M@0#|0$P 0cP` eP0T0670 P P @ᓦ4Ѝ0P+++O-MA Ad2(000PB(0 0000= 80s#0(0`p[05 0%500%`0$0 0$0S000`5_`@ @`@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0 SW`vp p 0 T$`0$00  0 0 0#T400 0`00P00 0ϡ$0Sr D k3 D0Sa @Z%S[eP*%0C?o2 00;0, 0H03/$0, S`pH0LC +0V   0^ X00;000P0 pX00  00 (00P 0 00 0S r(0 8DQ0v1;0H0$0L01 0,!<10$00H, `, P 0Q00000S p, , P0,0 [wR0,4  4 P Y p00p,0Y08p,B YP P 0,00000;0(\cQ  k,00ZP+8"א+؆%+C-pQ|MW0PSSp` 000 P  "  "℥ 0@T0 S>T2x@X"&(@s@@,0S:0,"(0PgP@  00+0@080s=0 0( T 厤W|Ѝ#!@&(?00\1 0.`!00 XTF@!0(P' R P@@ !0 0 h0 @嶟 0400t0S00XT00P0 垟P@| 0(@h唟 }@8q 3/PP+S$ސgאM20@-)@Mџ0 p\*3 +i@,fP 0ཤ尟*\P 婟-U F 0⪤.K0  0塤Ѝ0!0P8q0 S+P ,0P % l+M2| X+ A- @"(0M( x0PQ2d2 5  L! H! D!, 1 0 8!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FAC(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp0x| (O-p4@`00Y)Z]p !!`PV 0p  0 P 0Q 0S   00,0 84p $0T0 0X05p0 P,[.[ P Q  0_0 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$׽P `ᚡPP $0 Sz22@|x 1 0100 0A00000z@lVlś២x0SS(ṡPPL p0(P嚡!1P审0PA x 0R`( b ",0x  B > : 0 8Ph l;,0( 040x0?o21000Ѝ0+ u O-pᨁ娡,M@0 S000 /00 0S,Ѝ/S  /00P`pU1(5`P p㘁!.PP PP%0(` 1` 0400,00 `T00X08`僣0100& 9P 0_0= &Pӡ`T+WO-p\M@P4 `儰0 SpU 0 Q$0S   $ pkP9\ЍO|*. P: 0pR  ,`VT` V 0 0 9 $`00000Y3(0S` ` 0 RH03/0p``0[   80s pȟ0PP00@0  BR0S0SP 0[p08 r  *   * U0'0U " [P R 0S  0 PP p00 . P 0$ PU$p0p[0 ^[np0 PUp[h0[( !P$: p00 00$0 0 $0 0S 0X qXZ 0 0P pZ$0 0 S)0 0S  0Q 00#0 P.S 0UPpС0Z 3@ D Z0)  Z$ RRp 0S  S0 0Q0000 00000000 \Ѝp  0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P E0 0 , 0R0S00`R  QP` JP 0 Q ``T R T  R X `( 0Sl0( L03/P <00S D0SS000(( rTL0( 3/P 80<00S (0, S004 Q 0( `O20PP0Z0[ U0s P 0$p$ PUp0 80sd0 : 0  U0 W[p㐁! 0 QQ 80s 0  00UPpp0  R 0S  0  @p0  0  .+| +H+h O-@-M`,p0 40PVY ppPT Pp0Z:`PU`J6ERUA 6&uf00#h R 0  80s0`F`pHU p  h0S 00  80spHY pPp  h0 0l0L03/, 00Y:pPpʞp0㐝0P80l5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0: PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr틟8`0[:8`ppWp < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0 `V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/v8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0  -  V00 400Pm۶v ]H+! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe 웟000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$   W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`p 0R04$( $ R( 0  0H3/P* $ %P 0 0X 0T80,3/00T00X \ $ ` ( Sd ,  ,0S} P0 P  R0P0u000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80sb 00_ Q Z 0 SW 0 SL0  3/P@D0 RP RP0{0 80X T,3/00T00X0 0\0$0`0(0d0,0 0Sc 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQCPp`,0 0UB:8  0$ $0S  p p0 R\pᡚ`P p0i"P0R[p Z[ Yl:PpW 00U0#S~ p`Ѝ茀 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0P0000 80sp 8Hp0!8p 40X 00 0S 0P*` p [ 80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPq 00 80sh p 0 Php@-@P(Ml(0S(`,`V000P0 F0 0PP` p P(ؓP,((P(Ѝp000媐,(0,`(PL, RT+O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1S<1@1X\>ACl70(0Sp, H<#0@ 0 '8   '0 0 W &%, ݕ0ٕ80000,  0 ჿ0˕0ƕ80000  0'}X!0巕0H峕H0P00T0(0P X0L W0 000850p0  %  %  P%,  (P 0 %<  5 000000 000 00T0pp В85P,0ᶏ%XpW) 0GSC0.>( CP$ 00S H @3/Wv@DpH L0] YZX03/ 0 05@0 L03/P 00S 0SpW+ WP0pH03/ 0! P7/P%$%$)@0 Q1\YK @1003/Q  01/ 0S 2"`$Є  0;P  0s Hp0  @D@儀 0X80X> &Pnm,0S  pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000k+T+"p408,u`s  Hj@-} 04M@Pp`#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-`Yp@P 0< #80 s#  002 ,   0 S R( 0S%  吁( R Q0 2 T 0  < {+800r"000S   z$ 1 SR8C801/X+0! /X+$1p@-S@ x1SP $003/p@x1P$1 0SO-KMM@040`DpPH(00S >I @  0o- 0<0%"P{ 娻 K@T8p0 00U 0 00000@00 ,@@@@0嗐ppK܍Ѝ(mܐ(0S*o< !8 ;c&@@ u.O-M0M,0p1`h@0pP 0S (0 S> 9 H] 00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000 00>p`ލЍ,ა,0S*< !, 00B"X R00C0C0000S0 0,0A$PX+ u-@-@ 0  !<$10(10,1P001.@-@ 0 0! 0O-,MTPPT`0p Rǽ,Ѝ "P9 @@5/ɕP`K  ` V`G2   "0  00 0(0 00 嬏`ሌі0,ЍO/@[;p@-@Q-DDDE,EDEP 0  P40 Pl<0d p@PP80 P,0 P$00 p蘑)*+-p@-PBMH`@  VEF4F`FxFF,GFGDGlGGGPґ0 Pɑ Bߍp`徑00PS0`峑40Pl`孑80S80P8 8 X0S0!@ 噑0  P呑\0 `0S @`們d0Ph0Sڰ Ӗ@l0Sڈ ɖ@p0SH ⿖@TP`\t0P^:;=>?‘̑ABCEF@-PAMH`@A  6V(dHHH$ILID`qK0 @00S    8`V@# 0 P0 Aߍ(0St  e@d,0SL  [@@00S0  Q@^123̑@-0AMP@0Q*IlJJ K$K C"U0S1 `F` $v됣0p⇞ 0S  `,pYV o$ < v4` ˶00"  `qߍ@ύ 0  0S  u `pV 庍 0  1 PSN0  P娍 0  0S @0S@噍 ߍGc<0040!00@0Fo$ 0DL03/00 Fppqr0S !0͒PD` 0S H Dp8` V,a0 x Q0W 8 < RFO   ᝒ 0 /@-@6 0  e R0Wx 0ℒ  E̒DΓג'ˌݒw/+@-x @p+0 @0p0dk@ u@-@ @]000(0,0000ϘdV@  uꐯp@-`TQJM0@s@!   0<1S:8ZPZZZZ[ Jߍp0@ 00 @@0P(@0 (0 0(0000 0(/P(/8P,@0@_00\h%u567p@-0QPM,0$0`s@|!  ( 0ۉ$1 SI[[[\(\\\\\\1 $ 奆PЍp0 , 㜆,0S$0㚷@!^0 0⚑0 000000 0再0j/P0f/PP@HP@@P@ @_00\h%uX+O-`I1P/S X([0(0 00{O0SvU ( 0S `Pp: "00!15:% p P q Q 0, ($! p h$ P^0 0 8a4Q101T/l,,+w"FmeC0S@0@-S@00 0S/,eaO-0زEM 02@PT PP0 2P |1S$ $P| 003/P `2P X @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 xpPP2@0S- $P* 0 x0D 0SD+ea,l,a,x@+M,A-0M$AT@ Q 0P`p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T @ TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 D+,@+,h,x,\0p@-T00P ODPPp0AS@  1SA@+++0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S",p0\ Q0/\P  ^U Q0000@-,O-GM0M40d2@`TL2 00V 0 0000000@@@@ h0p@c<   G܍Ѝ$1SpA08 L03/P H0Z Z ZT0S p$ 0ST0S8 P P0  KJ,0h 0 x0`@W 47 4$|4 VL0G, <0," B+u X+0@-DMP@S P08 @\0 D@  d  0 0DЍ00SX+0@-@DMP. P0, P\0 P  T  0 R X  n0S0000000 0DЍ000SX+p@-@Q@M`P<㡃@P  T0 0SP@Ѝp@0@00 D04U@ЍpX+17@-@SWꔈ(̉ Ѝ0!p{P4PP<<0 P0<0P0<0P0<04PP<0 S, 0<0P<0 S@  0":{080#4{0,0$.{00000@-@PD 5x , t 0 p 4 l 08 U,0<    0 0x` 6/Ѝp@IЍpE@-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P 0 $)<  <U\ ᯯ0$?P0 |! 㸫|Ѝ0+a80@-S`4M@Pc00 0⬅P 003/00$1U Ut  4ЍS0  000 0xp 7/( (03 (~x}p@-00MPQ0@$ 00x` 6/< `Px1磄x1a1S0C€10Ѝp跕p@-@<P P $ Pp0S@}p P Pp0S 4! B! P  шPp0Sp P R P0 㽈< 㸈PppeaɕaٕMp O-uM M<p Z-H0 cS_ C幪0SSyC0S PB0SyвB0Sry2 P    P 2     P\2 TH   @  P0000 2  @@K @xP@ PHPP< ,h@ ,D@.? 0101010R0 0K000PP0 d|p@  PXy| 0S 10S $1S 10 0Suݍ ЍVP^HOPhHPg1S |!R 2%P \h%X+@+,l,,D+,h,x,,,,|,,8?S?++@-@ܩ00S @P㴇p,#@-@PЍp$QU0 !`P > PP C 01/P ,00 H$L Q>+80S 0 @-J/J m 7O-`ᘐ嘠嘰@PX0r2 S80S00 00 S80S0|1 P S$1S00 0WVQp@-8M`8 @ T P $Q$00S U  0|1 08Ѝp!P P P Q ì ሺ P  H ǬP X+A-Mz8 P`U`ЍDP $A003/0 R   01/`P 003/@P$a0H03/0 `p3XDD2 08 8/PD> 0!! `7# 0 3/P"0#"#0 03/p 0` L03/g3E  Ϭp` 0SWp`?`B414!44I0<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv   0|1 0@ J  7X+G-`RMXr@ GPP` PP` `~VP P7 ( -|p 0S  cߍ<08 H(00,0 0000400!4 04$0D0(0P {WZ  |pTp {p*d Xq 8 `< 8V ,V V V V 0,0V0 V  {p 0`?`a8SPb   00*P*00p  0* d@edA zd@p$w5G[nA-PMPp`;@ Ϻp@P  0P6PzU00 ## ݍ /O-† @-1` QP@1`qdQ@p@-@pP0S0ST 0DSTPS$D  p# @0p|+(,08S^0/(&, /,p@- @ 0( 0vS0PS 00Sh ppC-NMMP<Ѐ@` uM0  ` P`P5n000 ;0@PD gpzfNލЍuf іydG-xM` ✐堠@pPP! !0@P 0S PU 0 R<D1D!DD400S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZL   NYZ( ( m؇ yO-`BMMp@P/0; @否0P0p X@;$  l P) ez BލЍXjP (0  h   l0/SX l0H, l!14"So[ 1 SR 1S  RS1S1Sr`2p?B冯@0Q 30 STS "0SO[@kpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 000 " "mo@ U01U01VMKURXA- 0MHL`Pp t1t!tte3Pj@PP0ЍT00ᮇ 0R`0 !?020 2002p204 pk 0PS" $0Q00 L03/P Q P0Q    R D0QR003/ >(,P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @ P^U0PP 8^ @T ,fP ` ` `b` ` p Sp`" 2 `q`!~``Pa 8k00`U08vRP08}/ ^Q 0S`P82S01111111110 8m2~/P/<`0Xh40S0St  P p2S222?040WP 2SX1O-bM M Q 00P $00/;㊤0P0`bލ Ѝ$ >ep `|y?00@ ~,(Z 2S 1S,2,",, 20@0 Ḁἰ        0S@!? U㪋p㊤ < (njP^bVcT&PRQ 0 p  W p!p'q ?p? @p  W p!p'q?p0?g@P%  0epJ  'j?WU E ,(* pjj?W U `d@J Us@-RU0 u1@`d0T `Š P";0H0`04 oЍp_ s@-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0.80@0 0",<< . 0(,+O-P@pdM04005Q 0} Q Xg QP8B0^  RW* ,50'D0Q   R0RS }υ0^ @^TX 0SQQY WpdЍb004@F@  0@TT0@ 0@4P SI 0`P P\ X 0`VBT@`00T40^21 SR8080<0 0Q"80 0<0$0 0,0q?Ⲡr?020 2S 01 (, (0 PO W2m`!R   R" 2S SP 2qrⰠs?0 Ȍ \ 00 0 0\ 0W>?h "QR 0S2"002#38^0WN dJ,0 (S$ 0 802o0 <04pP6 @0 Ē2Z02H[ 1P[ 0{h <0L0S 1P0S`10T80< q?r0 8Z o0 H^Q  Rl0 ~/O ` 0( R 0C0#80(,zJ TT+ lO-@|MHX0(S S|ЍS S7 ( [8(k/D S0} @(00$0,,QT@0S4000(S$0000Q 00S 0[SX770QP"~, 4š $(( (00) 00P0U00( 000$00 00 U00040 080408 0,000, S 0 08B4X>wu? v?( $R BT@200r/q?`0sh 00(` 0R   T R,0S0u0<0"f<0pP=X50~;\0o_P"0Ha``V PV >g0( 8  z@0o/O @0S U SQ0-  T 000 0/ !o/ S㴲< $ 0 ,0S00@P0PT0S@0 Pe P0ap0@SP0 0HL R   ? x ?u/Z[d0P @10`d ἐ 09/0P@\Ѝ+G-p0@PH8L041\`  S ^ ?Y R  0\ 6X0?Pࠡ࠱000^ 0 G/+>00@-M 410@81u0!_0 P00 0LL_0 H0PU ! 5/ᡸЍ0+ɂ@- I^@ 4]@-5@  0e{c"%@-@@0sf],00p ^e0Coh%DZ,-?$M0 0  ]$Ѝ-4M0 00 000+P4ЍO-p-KMD U#^ " ^|4 0`p0 `V0 R`V"R0*` ğ p$T0S 0s 0SKߍ0S P (e30SP #)RdP#S 07ឧ{0 A (T# A(e{{:?dSd 03d 3 3R - BPP  P BRڒ "B (" e"2dPŸ 0 R#3SPjSt0100(0 \"ec0 PP 0 0SZP=9 =:rk{1 AP09. A k QD 5 P;!%#3\Q0  d 0!(0 eT!c(1@P0& d( SP P*!0"%+0!V6 c@0S(0d c@0 0(p [Y@.AXZ,8Z,hZ,@Z,0m0Z,ˌ(Z,bHZ,Q"p islDZ,PZ,@~0P 0 A D0 A k{I{7{zWᙛ0P x  ;c`G~f@<㊛(0<pP<~ 0&c@   c@-u@rq@SRG-@  g700pP ąH`P:X:00X 0bPꦫ@-Pp@`P0S -S :S S 000`  0 *P00 ЍU0S T   EP؆%p@-@PZp  `Z@[U700@pp@-P 4`Zp@  ZPZ@p@-M@ .\p$ ЍG-`p@T2 P  #P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝp@-P R`@0 @ [0 00S  UPE P3Ѝpp@-Pn@@[pgPppA-@Pp p` j 0W0 |0WxX Uh0X`0 P  0P 0haЍU0 P 0 R"fnvO@-`0tM0FP?o2p @pV[ "[pZL[@UZp h2S [p L0V#4 - 3tЍl[h"6Zp0 p@-@ Y0 S " 0PUPUp@`0S   0 0S ``0S   0 0S ``A-pM@PU `0S@PE7  0P00ZۍXڏ700S @ Q@BPE@C000  pL/s0S o0#S @UX t @-MP @  9Yp8 lۍP   `1p@-0SM@` @@>  <P  0 !   Xp 0 S 09S 0Ѝp0 S   000 00P0 PS l0@  pDL  Ѝp@ pÝ ߝp@-@$`Pm]Pp0 @ `P0 002 0pSp@-PxM@`  j0 0Xp@) Xp'  Xp! Xp  Xp  P P0  < p,4IxЍpE BX‰ Ý0 0 s@->@P`Mp @t0  p``X0 :p <0@  p Ѝp"҉  "p@-@PqP 6 :X01pP`qpJ# 'X0#1pp@-pM0 p @  Xp X@pЍQG-M700ۍ   Y ` @V W@pP`@-`R00 Ѝ@PTp ]@P  Q*@ 0S0S0 S   0 0S0 S*]P ` ^^0ST   00000 0` @@0P ; @-@Q@ L1p@-S@T1S#d1S.RU9lRUppbV:lX^lbp1CS^L10CL1L1PSK^0P11CE^T10CT1T1XS=^0X11C7^d10Cd1d1hS/^0h12,P0C2bV!^bp2,P0Cp27@-@0 PP" H1 0D1=80-@@ CB Ѝ0@d Ѝ0Q@-@    bVP p 00` Ѝ@ Q @40 pЍ@ ЍÝ (Q@-@    VP p 00w Ѝ@ 1S70|]>[P| 01 @40K pЍ@V ЍÝ +t0@-M0@Q0$-+pB Ѝ   081/@-@d'P0S  P 0800L0S S@')p!@-RM@ Qtp0  Ѝfp1S10@-800@@sA P@-@p t10cSt14 Ѝ@R @0d  Ѝ9@+Q7@-@  ,, _ BUp  PV Ѝ0@- P 11P,|1@ R  | 'AQP |`00CS`0X ^@X0 |p 0< Ѝ0@ X0 X Ѝ0Ý+ %(%(p@-PDUpp@00X @zVpP p@U*pM8Op@-P@ `8 0x8 , >U\& 0 0 008 , 81pp@ _NWp@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @C-`P+.H0$:0@0   10 &000 0sH00,PQ 0a(!"4a4# 0 0 >Q & Pp W  g080_P040 Ѝ 0b"!4b4#@- @T0800* HP  : HP%p@-8A > R **X K 0S .@0 S   000x1  @  0SP P0 0'0 S   0Π C-MM0000"@0Qp@00F܁P+ ]PP`pQ vm07S i0 S W l0 0\!`1 1 `Px1 (ލЍ PpP  R쀟쐟PU $Wxx x  0 S   x0 pP 0 Px1p  P  0S 0q0 P+ 'i:|9Q@-@  ll+p07S@Y0 S 0VS0S@Ý? A-`R@M@p PP U70 h0d@ЍA"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *ZP 0S( <0 *-  2 <0# |) 0S h0 !r 0S>0 P 0SV>P  *@ЍA]Q Hqˡ~O-@p$M`(PP  P 00A( $ЍOjPy P000 pp XSP    l0pGpG 00 ZppIV4$pp pp |]#3ps 81 18100x1Z*  NPx1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 P  YY p 000 0SZ81181$Ѝ P  YY p 00`` 00T0 :0G [W0 00x1 Z R& ` @P `[` @H0 0 0`0  WB W W 0S 0`0 7 0S [ xx0P 0S [{0x r "y% 7N@->@T( "44p P`0"@"44 0W ,7L L0 b"!4b4# 0@> *>0@D Ѝ耼p1p@-SMP"!` P%@P T 0p1!V T 0S X\{ORP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   {0 @ WP 0 @  B00.$p ,*l1S ũ٩ˌ XB 0 R/ 1/Z,/A-@P 1 !  SXp0 RqP 0`0S;000S \ \QP0 S   000S00@00P10 paU0 G0P@-p0p ppSq 00P R0   Uы p@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M`@PM (0x`p`FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41V(@p 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@P@P0S 0S0 @@ تʚ;@-@^'00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@P,p0 000"#l ЍMb@Bp@-P(0 CPUPUR PU PTP,PP@PP4PP4\pQ@  P 0 )@-0PT0/ P0 @- 0T0/ //P@-(0( ((@008< D0& @-,MP` E10U@0$00 0@p000 0<0S EKp,Ѝ8010C>Sl00@( ( 03(00@000 0<0S80 xp @N: Y@-XP@P \Lp#R@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0QPU `0 P  S   p0 J00C0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM bȂpT0SY 00C01@0S D3/2"(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* ݝP% HLH R 0|S0       @@U 0 H$Q0SPp>0S} :`Ѝ\ P RUk Yh T0e0S 0S   PE  \P 03/Z,L @-8 0e(@ p@ t@Ѝ%A-M`M4Psp fK0 yQp@ I@ۍЍ4F P ڣ# "P  RP@@#C 4,0 @4   Rh%%-@-  Ѝ Ѝ/@-MMP`@0 p 5QR  0pۍЍHq-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/h% 0p/SRh%p@-MMt Ip P@;00 dSV 00@ۍЍp P0 4Odh%ˌ0/h%@-@ @#R4 @Rh%p@-@`PL;T 4 P P  k RT V00pph%%Q@-@P:c@%@O@-q@ H01p H01@!Jp@-MP@` W  0X Jp 1@ R! (0 p`Ѝpii$0 /L0s P/0 #:60#//A-XM>PUiV0P0XЍU`700p@ `Rғ0 PU B0>00 0<0  ,> }!PP> * @-@T?@Q/(@-@T?@0P/ R R /0G-`P M0(0S @ BP P ;P:ሯ`P 0!00 0  ̳0S80 00 Ѝ080 00S # P`p  P`ᥳ0P 0iS.S  P`ᕳ0S4 040:S؆%0@-@PDM QP@T 00p@DЍ0U  ƾP @0S@-`@MPpTЍ 0S P 0S Q 0  pO>@P @-R000Q/Px1P/$0/@-M@    w0 HpЍ~iO-YM `F/@H9X0KpP pYߍ0pM 0S 0S PP@ Y 5P @T0SL0)P 0@S0@S@@T1S X1 jPAT1S@\1S`1 \P5\1 S S R@L1SP1 KP&L1SPC_oRPU@j P0HS 0s0ٽP 0*81 T48#88 S R p S 0 S T X @@?@0?H0p 0P0H0}>H0 @n0000LPPPX (TiA-p M X`P00 @R  RT T 1 # ᝺0@ @ QPUx!@T00 Ѝ S @F@-@vp !p !p`EȀ %0R% -@  %A  !@   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`Pg@P─@Ѝ ᑘP\ LL0P qP gpP bdd A-PR Mp@ 0S0T00 Ѝ/ᎬP P&`0 00 0  ư0S XT G8PP/00T U8귫ΫO-@Pጹ0"S0Z"SJP Y papP wp700 ЍT WOYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8rhshshsrhsshshshssT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: - U*`XJ:0\S 0}  0 P0N[ SP0Sl  -PTPp@]p؆%P /0 S S /S/P0/S 0 S S/0/O-PTf@P ЍO^=7`Pll a ЍOJd U qWrJ3f@P  P 1 A Ѝ= 0@S- ᣺P'[ f`PHJ `-`)]I P 0 0 2 0 0k ߫p@-@ $J`P 0SJ$`P PP(0S $J0(0$0p,` P,` PO-4M10CXP`p@S(<T0H\؃@Thȅ܅zz\zzzzz|{{zz{$|`|||$}zt}~z~ 0zy,Đؐz(@Lt`Tz̑|DDTh`  ,~ 4lP||pHU-  `Pp$uP@  P7 7  '$ !P`0@T\0S @U0 @7 0H050U- H0?0P 4I0 @PA t01x4ЍFP 0 pp 0S 0lPI01#@%U  ChUH070 0 JpP! .R 0R77@0U h 0/pPL H RU H0@1Sd@H000{U HP00q ,0 00 0 N,0S ` {U ,0!00 0 ᕭ,0S < K Uz <1E8b0w4儒0000 0 PPP00 0 P p@ 0  @P UL <18b0w4儒00p00 0 PP00 0 P0@  H0:0H >P 0<0UH& 0S# /Шp؀P  &P00<0/⾨`P 00 /00P 000H060U ,0 00 0  N,0HS  >h 0A  a/ph  P 4@AK0  U 0 U ,pP 0S U 0 p H0 50dh0 50,0 % 00 0 ᔬ,00,YpT 7$ UkPePUʚ700 5 0 $z 5(@p 0 (  0 p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 UM,0HS 9U H0P SPH0;00H090U `h i`,ḧpP D`P 0$'G C_FH0Q7;0UlQ AP0l1 :P0l1 3P0l1 P pE0P p1tH000|UH10 2v PH0 2n PH 0 2f P PH X H000RH020MU  0pPl] H0 S;70:H0205H0600H0;0+H080&UV <1!8b0w4儒00 0 P000 0 P0P@0PU2 <18∂04gr000 0 P00 0 PP00 0 Pp@0  @U =ὦP d pRPWH0p000S P0<00 7P WH p P  'PWHp   P  P  P l P=WH#  BjP S  ($p 00t ,p 00qpPh $ ( H,8   P< B7d ĵPWH B& $rp= BpP9 ((u (r H$8n  P  Bh%w *p'4 Qw_~ʬԬ J|Eao%sw| ˭ح!*49HUu4GXg1Я+}@/J}AD׸иɸܸvMw km Űް #P 0 PW ,0 00 0D J,0HSu  P /o"Be ($P|/NH P0(0Pl 7$ ! (0'0G ($P^/0H  P0(0PN 7$ ! (0 '0)UY H0#X U@XH020H0 0002,H000 H000H0 00H0 00(07600 2R  *350S00T01=5 =5H00U <1(0@0P@470'P %0S<bU H$D_P$U 81 800 (0 00 0 J(0`S, 4`( "4`4# ,,0ٱH0800 "PP0 0 P 0 0TH010vH010qH000lH050gH050bH000]H,';,WUUH090OAK3O\ 00` U0w ZPhbX@ DP3&7 D000 0000 0P70P7}⮧ G000 0:00 3000%0  Op 8 +8 0 D 0p0 D+ 01 P#Z H0E,y>P0047{ (8P,:|؍<Ѝܔ80$080,CP(/0782p47,204<7囗 SJ8?@p,D7囗 SD@w?H'0l"L'87<7@7D7p"H7L7088 p,20!3 (B(P ((pW 400000(00 0N.@(0S 0 S S0P\S @ p p8000SS ,38 P,,00  C0 ?oP20804P0P$0pB((P f((0S0' & [ PN(PI Z$dh xPP78=0׬0@(0S 0 S S0P\S 00@ P:0  |pPpP80,CP(0)S YL 9ױ00(hQdq{ZPpdq PH P0S (P  P 0S (P PpP| 0)R00S  P W400000(00 0 }0S D:$ D000Xd 8 Z,@ s s /THq]8Z;K0Q//Q *///G-p0@0P `3P` Y 0 0 R:@CS@D"@3X HGU( HG#A-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS  &p@-P l@Ppጦ=@-p@-@Pp PPpT0 p@1@-0@ᚤT 댯@00T0S0 @-  A-@QX2X"XXT0p  Q081800` PPW VpbR0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . p0S p 0S@ᦤhPT0$0x x0Rt D@ t0 p0S ( ;$+RC4A-`PP c_F@T ?T0Sp]@Qp@- M0 zT0S0 PU|0h xPc_`N@P 7H 0  9<  Ѝp ayG-0MPp '$ ! GP &81@0A 81(P  0Ѝ |B ϣ@T{   ȣT0 R0 0800+ P T8p0SS90SSݢPT0c բ| `P7 |0   P @T T0R88tPY0Sx x0R ᠣ ᛣT 00XXSP  P T T0R88BP\>pϭ0VS tc_ A@TG 90SS`-90SS)RaPT00S8 0 H0*: S R   p 0S 0S G@&ዢT 00,6 @P $ - QA-PPQ_@` p 0t0cRa0100FS  !A/P@-404 4;0S >/00H ̵P@-404 4Q0S )/00V ̵P@-L0L L}l0S So/00a ̵P@-H0H HQ0S Sp/00s ̵P@-L0L L70S S,0@o׬/00 ̵ bp@-@Q0 RP0 _0`S0 SQ 0h W:p@p0 p@3W0 p@ {̵j0P@-x0x xxQl0\ i P R !P BR #@(@  ̵p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S O0@0 ЍpH/0h`Q 0000P 0  ̵Z,#'A-0S00@Pd` pW /0000Pp 0 WZ,; n̵P@-808 88JQ,0 v!>000 ̵Up@-@PQp9Ȕ bC-TM@` P `cp) 0 :c ````Fc 1 pW0`pV& 0c붫 0 0 2@ bT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0괋 -3@- P ,Mp@Ѝ0@ Ѝ/@pA-@R4pP`@0S pjA-0Pp@`S:0SS 0   RS* R0 `V1S* ╄P a 0@DpR: Q 곶 pO-A TMP` zyC@PAD@A081 Z  wp 000ȀP *P %P  P P P P  pPpZ p Dp \61@ R L:p 081#?Q0(800 00 & &(p L0S% S% p H p P p $  p E pw P0S t00$Q0p T pe x0SA 8111 0x1[:8p M ΟP> hp@ lᅧPH 00 \d\$k4$P p* 1d p-"p]Dx p 0S P Q ∟[ T  8p  #8p7PO 2PJ -PE (P@ #P P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!8p%P `V%R  p0S0S"0h 1SqP2ᡘYp@0-j  pb 0h!pZp @ pP 0$8!pGPpA 1 RZ  P4 ЍZ p pk )oW Ȕ $շJ5BN\gp 2Ƕzˌȷޏp@-@Ppp p@RRA-P`p@@L0s  S  U@ p@@@dW0S R H R U pQ p@-P0U@Sd` 00p P@Ⴃ@T:ӗp/ڷ%@-`PM1pSAT  p@lLЍ\ ῥPЍ@!R 0$  00 p@ *a@V 0 !}p@`P bpS0S lt00#40 PP D SP ]7( 0() ߷: HqE p@-PP 0S 1 `@0S @@p00p SU   \@ .S0.S0_S-S.00  @R"0T0 0D0p؆% @- @0P PͧT00Q  DP `00CS`0p S00 P0S X0X /X6(%p@-h1@SPPPPE @p Н0.SSPP \ĤP LῤP < ᭤P 0  .PP2Gjp@-@P'Uc 0 h50 tc50 d^50  TY50H/@,8)0& (#@        $50  50  50 50 5 Np@t) IPu|@Dȸϸָ۸+0% 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pPX0p0 0]4QލЍA. !. t l0P4p`0SPE@E p 0S:0@D0̧ O--,MlhpP. ,O|`  I@P_3 0S  㤣 j,P$P@ᚣP@ X^P$0X2@3W00,Ѝ P,P, R ᇣP,PE0S p R* 0 370 89$ R, R eP %9$ R R ,Pp!@P !!!bd! P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 0 d .0@I0 0IU:D Xm0 0 `TT  DSPO-p0 0$09`@P00W*0S T [D700 Ѝ!0 *00K@P  /00T [ 00 P     @ \Jo"  & Z/Z#T [\*00 0000K@P\ZT [T [ KP|؆%S C-RM MPLHp`p; @P>pE  H3p V=p =4 73pTG    |0 Ip P; IbP <I/    VRލ Ѝ   20sV002 0I@ p  p@P0P@T*qp0S4 gp `@T*T 0 2p @ Op    0#$$("( 2pm @  0d#$$(B(   04!c#!$ c$" 2pM @@  ڞ 0b"!4b$#  ͞VH   .0I/XP* I/ f2p$ 0S @00SP%DW2p꾣00ˌ[s  pA-p PMU@ ЍR` R 00P0S 0 -0 0t00#Q0 .V 0 00 0+1P0S 0 ?%O-4MX@p 0S\`d` (0S:0 p20"4ЍO 0  ,   xp0,0 ,0SPCD ,<wVp 00"0,04ЍP V0 00!00  V, p0Bp00X!0h `F,P 0 S(0SVP$ (0S(00 0$ `;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R0, 0 (0S ,  09,Pd Zdjl¹p@-P`@P 0S $`P(0Sp,` P,` P y 0)0@-MMP+ gp P0@ۍЍ0;0 C#@P ,P @- PΠ R[00\L  ^@-QD00P`PV0 V=`V xЍp@@T   0x@ `DPЍp`Vx1@P 0>0S *|P PU@P PP`/0P@-000 00EQ$0 @ Ҝӹ ߹@-` ,Mۡ00<0@SP  '0x Bfp zp0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xFPT ,Ѝ0 8 0@0S 0xPTxA-@`|VPFPPP2Xxp`Er-P x倂|"x20 GV0   |20|2@-Mp@`P!  ( (‗X( 8p(PU@ T/700@Ѝ i///0@-M @ +PPЍ0 3"Qqp 00000)(p00000@ (plp 00  0"'p< Dp O (;p@-QUp@p &-0x1p@-p@-FM>`V P00Fߍp@PF/ a9  0p01 0 `凛0 HF?( 0> *Py0 F?' ii@-@MqP4@ $⹝P P@Ѝ Q@0@ @@@-0SSP`///Y< ߹$0 /Lp/Q @-@p000t0@0Q00@-,M@P(    vT 'p 0 00S p,Ѝ08i(p@-MP@ ǟ ` Ÿ M  (Pn'PЍp:iC-PQSM M3#HT0S3"`V2"@p@"ᕟ0B01801T0t0H0 0C@L0@T3H 0H0L00L0@ P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0p 0`00t0H0T@L0 0$L0E120@ 2qT@D@@@0@L0 X:  @L0  VXH@L0  @L0  XP >UPEPPP@ D$("( %p`Sލ Ѝ C "XH@G ߹a C-`Mp"0` 0$` 0 z-pP @T+Ѝ`+PPA 0 b-p0 S + `@`T*x0V*00+T00V:0 (P|P@ (ⴙ ГY 0@PP @-DM`@ pP@  h   !> U 134  R2$ $@0 DЍUi@i|@-QM@  ?00 p |20 x2"%Ѝp@-]M#PV$p PP -R g000S0S S SS wR0S HipIVPS CQRS@ 0`  x@P -$0 Bp 0S$ H՝ H`hH %p 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 0夝 H/!>50H \0M%p[0S ܝ01S dd0Sc0 0 0 00 00 `TRY>S SM  ]ލpRIxW@P= m@9 a3P0 0- H)%P[%0S" HyM P N000Sii@Z i@- 00 000 0 +Ѝd 2S/2S00/@-@@[V002@-S0@0 @@MV0002S  w/l G-PM`p (PP(@P0 0TT`0#p<00 * #Pp0S p  v$p PU0S p ")@! (:( \$p | PU$p 7/PP J$p l'P Ѝ@qB@lBpBfB@0G-0M@p`0P U "0S1P   ⛗ P崡 00S V 1!X0 P000僗P0 PPP0PU:000000x Ѝ@-  # ЍgB0p@-M2S@P`x (TVP@0  `(#U00ލp@  t B@-P`2$MS@p0  0*00%440 0 0p`!$Ѝ@-@" )@(@-@pp o#p`~B 0`( "4`#/p@-@^P T00p``0@D^ߛ"000œ\p@Tp0,R00 -\ 0 # R 00O-QRM@@001`Q V00ЍP0p Q :8Q@SI w딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 e'P 0 0B : 0 S2XC00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S Ѝ@-@ 000YP  R  Ѝ@-@\0S \0\0@-@`q0` 0`00@-8@$@D0p@-800P@% >Q" &Tⵕ0x1 RpR 0S TT0Q  >0S ,p@ y0800)lTA-p`KPT&P@00<000S@ (0? z@0K0cScO-@IMḠȐ`Ap0 4Iߍ0RS* R? )0000K C&PP d0S  FRV ( Q  R L)Qh 0 0000200> 0BS0* " 0360s RpS00n T) $0K0p C80$Q 0 DPV VdP h  Q 4(/$ 8p HQ@`$Q DQV R <0S @HT60 <0 ˔ @V20HS80 0 t徔@(1S p0 H0S=00(  ⭔(100@ S   F P81#<141816%#8100F0p7spVg 5Sp 0 HS+00 %A C} 5V0@B WeV M 5S8Vp0p 50ST 0HSt300r W 0HSe 700  0 0 "@, 02 S307 ,0 4' Rl Ip0  0HSA20 0 (W@(1SgVp 000DKP*0W(1SW(, 030 PV:0BST  ,,S P R:(, "  PV: ART  ,0 00D0C0W00HS9000 0C!4 1ᵓ@ 4S Y 0 HSM00 $A ⢓ 40@(1SWEVuW08 2Sk  8 "0R PHt  [:0Q 2 000000  @V5 VpWH h 6SD 0HSr^00 &A X 60@4W08 2S'V0081 0 Z00 HRO P0@W00  ^00HS>t00000@0 HS3<0 0 "  2V0@ WV}[Q0000 00@0 0P0"9 0H R 0    @~0, $ cSc252M7@-P\ R&@P\0S x0x08  Ѝ0PP @0@ vp l%f< HqIA-PR1! @ `ᚒ0P pC R0 0R0 06 30 00} P0 0:000s P00;000i P006000JP00ЍP 00000000 0.p00 0"p0 00sI C-@PMU"P, 0P`0P001H0i0P0 0 v븀x0`  ($0(10< cV `!P (@B  ) 0ta!P( ``(1  ( ޑ0(t!pؑ0+"70 (P  0p  `>```g!P( `(1" (> *>Qߍ 0*P  )S Ļ@-0p0i0 MS$MP`. 1 !p p@0S i Rp ۍ$Ѝi@ 0 Pp F8QQ0500 04pP!P(& Qػ(%$Hq] @- 0080PP `V@Ѝp0S  @P  100O-IMPp|HLPL `PR  0@PIߍO#0,0#600 0400 0 P` p00,0S2 V30a2@0 0!,0 Tg:`0 6P Z:>@PIߍO@P:0 P VT` \`00T<:D0 ` 3:Ph &E@"27EO-P`@pQb帠,`P,2S$PU`,@ ,#P)#, Q 0S,9  # P,`0t RZRO-t00! `pP@T:p T  X ⢱00U *V"0 pp Ѝ0R0  . @90  #p   9 @ #pôA-RMM$00@` PRp0F R㼀 00 ApۍЍx p p @ ޏg9 #p 00CSˌ@- 81S Q S0 000 PЍ R ⭏0# DPD30O-S4M@ h@@ `00_0P o0 00 0 pP 3 00 y0 pP3 0 0S0@0`00T0 @P0i 00 0 `P` 0 $ ( ZXXmpP  ,Q$e(b,8_ `P@ [0!P*K"0 0EP 0S $)( ,"p$ 5(2,8/ P@0Sh0` 0h0  0304Ѝ$  0 k  p(,wtp 00 !0 ApPp @ kZj $Ԏ ,Ў,0pS P@,0$S  S St0P !R "R hp( $(,8 $P@b"fO-PM0@040p0`2` ##pRp#ppW9 pW6l0S~,0S0p㄂,0噇 2S0p80,0噇 847S0pl,0噇 p"R000, 20wS4~47S 7p 0 pߍ00 `2$p $  0 p 00 `2($p 7 0 p $7 0 p(7| 0 p#0}0P,04l0<40 zpo#0n@0"04,040 hp`8p`5pg2pn,0 !P ,@ 0,00lS  R, `" pP 00H1,0,0H0 0 p 7Y, 00}R0S 0␍00P 0Ip p 0 ,,0 !P !, `"P ,0 0L00p 0 ,pꊼԼ@(p@-PUp@bn0L0pp@- MP#p 0` 0 0 `@cpF@ Ѝp 0 `Up ` 0)`Mp  0U 0;1009p@-@pP`8!(0-080000&0S  0R  dp`H Ѝ@@00 p Ѝ@ Ѝ茠 LLO-`@p 0帀SP$H` 000 0 0000 ``0 Р0 `  $46! 0Q0003H081v H ЍO<0 $6 70003@0St3H000s$80406 L$S< 300080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!500 *S:G{k{'{*z8 S zTkg{{'{* z$500 H0S0SU h R 0R<0S 0S11H000s8040 P14 P18 P|10 804 d@ 0R00i8 |00.0 ap ̀h`0 ] P0 x10S00H.2 r P 0dh0 ЍO Ѝ?? ,3PW_zٽ701;Ky>EA-P@`T 0S0A hp` |  S 0i0P 0S <0S $4   .p0 p pO ppK000 00p0 pH  <00 0$0 F#5 FAd0h0ꢾO-0R\MpP@` 0$P X0 #3P 0 RT000 p` hPP. dL0S0 0@S@0#/L0}b?H00P X0 "2P 0 Rzgjzzz{T0md0S  $ P $[ <X x' h2 0`208#<410,00000<00@0,0D00 <$P(P Q48`LPPPTPH0p` jpY  YPPP  hኊ&h0 0108#<48#8 10 E00`<a@008#<4 01 P00\ 02`Xv &j04S#1S0810 ^ \ЍO<t  7 0S 0@ 4\Ѝ7S zD ¾߾CDC8E!  R*ffP 0S 07S Ǜ Ǜ Y  S0  !!  Q 0 S:500 0Ep00 0 ,ЍO Y 0 0Cs0'o0S0 S0L0  p    0 0P l0 0SY0A060@ 600 0p0 0  `P  0 S 081ei6@P P0S0 0<S<0P0Ѝ 0    06 0P6SY700S00YV0S9 0Ul00 0P0 RS0t%KSK?3050d0 qY 8 i&0 5 @0S0 R 3 P   = rZ0S Y Y 0  Br.  Br*L0 - $P$0 0 0 Y & 0 W3 @ $ 0 0P  S 0S0@00 D$0Y<0<0818 ?  ; 0 P0lP4 000а 00 0 0P00 S*P *  p @ 0ЍO600 0<P0( 0S * oP   p廄`81 000 0 0000H ``0\0S   T!0YP 0 8 R 1@ЍO3Y Y' Rr   0 P0Pd0 Yk 0 4-  pЍO!z L/ J]tU  R* cP   04@JO-,M@`P Q0 ,ЍO`F ZmVWP0@SS 0SP0#ttx'xVI:PQUE0VB:  ể""448#8S50V2:1 S/ 0 0P!' ࠃ0S 0000<`10a  & ! P -  0Z,Ѝ G 0 B 4 m@-Q` M\@MP  A0p000 p 0S TH ! ۍЍ0 W`V \@TÝ $HqA- p`@PAlPU, A0D0S0 A\0S0 A) A-M0M0 ;`pp@P @ p0ч0<000C$00(00$0C,00@pV004p8 \\ U0`$0 0 p ݍ0Ѝ6 Ý  p@-P@{T  (@x1S0pSq  02p 02022p R Rp07@-PX0D @P 0S6 >0P 7P7;00@0S02700000 0#0 Ѝ0@}xYz  P<gjzz+S$0@ Y Ѝ0zD6p@-@P0 0aUph0Spp@6O-`P@T Q Pd0S  0 0pd0 ЍP0AQ 0S 0P +  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 b0800<0  P`00 00 /0S $0 pWp:#<0 2 0 0 R0H0@S 00ppW\0H0-Ht   p勁00,,0`( "4`4#S /0 @Rp@-00pPQ0`PE `@-@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ SoQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScx1G-`@PMT. 0S pW$ P Hz {PP@0Sh0S d0S4$.zd0 0S {PPPЍ|0d 0|00 00md0 00g090 zP] z PU9$0 00 FPP 00A>d8:dX6M zPP z|0d 0|0Xx#zU" *8PP  |{ yzP<p{?0S P 8 P  IU` GP < 0$Q S "  Q  GzPp h  5< 0   hhpP: t0<0t00 00 80dQYx X zP 3z  U zpP "zȐY $0% h  5< 0   $0<0| C *p@-PP1! p`H01S D0S @0S <0S  0 @T 0Q0 PSP 0U d0S0h0d0p@US  Hqp@-@T PP@0p` G-Pp`P@Ѝ0E @P00 4l@P 00000P00 000A( p, 0 i$00PP/(0 8p0S pc0 CP  0@R 0 0000@@n ôt(G@-@0T PQ8 00*: SR h0S dP H` Ѝ$` dp P (0Q,0Q  п `P  800000( ,0?P60S 0 h dW $0Q 0h0d`0SHrvYz0S/0S/   O-M8PRH0` 0xP00ЍSpP P0 X@ XP R R R0 00Cs z@ЍOP 0S3Y0000000Cs ЍO^4? @PЍOc    p @@0 0 '0$  7 S{ ô0S/G-P@M T 0p `x 00 0@0 0 @_@ЍP/@-@TP@A0S   0:p@-@PPP 1000p} P< 00p0000 S0 @00:S 0S @\S000@:S @Z,؆%0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/l% 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO4E`VK `0P0E@ 9 PP 00pCލ Ѝ@@;04pW 40p(0= yP  0 `R0 :R`00Fd4@0  0(8804 PF0P {0S gO p PP ;000P>p 0S#00 0w8`p@[ + "0P R 050SJ 3@/@ 0P 0S00 `0 SWG @DpW :Sp:SY @\Sp S Spp p00T:C @DP 0SJ G0@P0 0 Y@ S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 @D0J`FP  0S  똀 00, @ ` P D,0d  d,0@PEg P0S v$ D0A00T*y PPR 0PZ,l%z@-0  0 Ѝ@-(@ P 90 0Z,C-MB0M00pS 0S`! \0S)  R&    RA^0C R[ s0Pv Ps @ 9 Q0P ލЍ s0P P 0@P90 PP U PP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  Z,؆%fp@-@PDp@NA-`= @P@ d# PPd f 00@^S0S:S_ p0 R0S@Ad PJ] \Sp0S:SH 0C^ @ 00LT1 0L\0TSpASBC\ oLo nDo4o n n n n n n n,o n n ny0, p`000000PP5p0,0\+0@00`o`Lp A>0t@lTllH0SpW W DkP P 00PpXA C9R񟗈꠆ЇЇЇЇЇЇЇȆЇЇЇЇ0ЇdЇЇЇȇЇЇЇЇЇЇЇЇЇЇЇЇЇІЇЇЇЇЇLЇЇЇ0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0! 0 ;/Qy$0S` K0 R 0  40><LT@C3^A00@C32 \  02` 3 d ! XC2 hhh 00C0'08S 0 0 00mm`| dme,`PPDAލ Ѝ, !Zx/P 0H0Df,l%u\ f,f,0H0S/Df,0Pd /Df,A-PDA@M|0`S*0S'[0S S fS0P 0P@ @Ѝ fĀpW*P 0 000Ym0ppGx@ `0p2!X0X 7/0S 0SP 0 P0@ЍA4mDf,f,l%lG-dqP@0L P12C1b05R0 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0Rm00l0S0PS xm&0S,P N,@GHDf,-!\  0L0#0Df,t0@-M  L0@31 ^AP 0C! 0ЍlLlDf, @-L 0 0@11D ^Q       Df,A-@@bM0u L0 @2# p PW%cP_  Bc p\  Z w$0 HD@,X#10000 2R01   0 0S0" V00 S l ЍA X 1(4/00~X1威0 sSV Q`ЍQ0S  lЍAl`\c  Zv lk@ll%0S  Zv a00@Df, C-`QM0S 00S` L@P: 0s%@Ѝ 3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 003p Ѝ0S/1>3 !/0S 000/f,0S*p@- @PI P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0 0C@-@0 0  (  ( 0 S/! ^R/0 @-@0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!S0`0A-s肟Mp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ0 0 |R 0S |0 3/000Q R R0SQ|P.0 0R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍf,A-PRp `@P 0!Yi000A-@Pp`0 SW' WV00S񟗋`hhhV VjpGPX1` X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0 SHPp  B0s  B`NpG`FPe`AA-@`P0S0<R"*1 21<0S0 0PPR0S*! !x000S(!!!,p (F0P A, (0 ,P0%Ԇ%І%A-Pp0 R*S\ ]\ t`@BX T jP)hP`,m% @-R@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00f,< 08 C800/`Q'Q!//؆%p@-P4`@>j@P@p Tp( Q 010//( $1p@-@0PS0<Q:1,0 R40S `$0V':8p1PS58 0#p(00<^ 00^ 0S8op 0! R R0 0P`0%Ԇ%І%O-@P 0RM i P&  i P 000Ѝ 0@  EPP ЍO 0 PS@ l 0 00<00S*^Q000800R ]R00-R Ԗv0S* ]R -RQ\U0]Si-Rk0 Sz:0S00T6000S8\ 000006 8^C8e SeR ,0Sl40Si$0Sf<0Sc(0x_ j 0(` pc0@`F p@ kUh 00C0c-R [RQ :R =R 0S`:  0Q00pS00p00-S]S0pS00p4 R*000`BV R:0pS00p0 S>*R; :R8 ]R500A  mf0 ``BxP⠳ 0(SB(0<R$  DP    r P `$0  0$ 峠0S00pp0Q00pS00p00-S]S0pS00p= m R:0pS00p0 S*R =R ]R 0S0 -RB Q?]Q< -Z00  V1 0S. V0pS 00p0S ,Z00V0S Z40 PDP   `hFh400!0`Რ40 P0S 00000 P  P (B( [i 0]S S `Q\  (B( 0  EB#ЍO0%f,؆% 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@؆%Ԇ%І%C-@pPP\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  mHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB It i @ 0 D OX &(  RPSxPA4#X  z 0   0`00020$U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP  B   B0   B0V0\S0{SPP0SP<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S Y^0<0S 00$000*Xe .X< 0ef,)>{^ ]؆%0@-``P?Q@ $0A  R Sl0^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )p V 1L  0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   0p00030 0V:0S003000 <Q >Q x`P  &  R  #+S  *Sg 0S9* *B?RP {R2 Q/ 2000( =$,Pu 0S 00h2Q 0   0R  0 S`|* ,Ry  2000< V0 R  !   `0 S*}Q00 0RX}QR  Q +S ( 0  BF  B   B0:  B~?S {Sz   B0(  B 0  B  B  B " A 0000S 00000f,؆%^ ]0S C-`M pQpG bpL@P 6W:( ЍPPP P $PPxP @f0 6P uPP  $ ( , 0P4 8 < @ D t00|0 _000G R:0S005000 S3:  H0A 0Q@P  00Q p0 P>3S! 1St Sq S <0RQ00p< 0o )  sSW S<0RuQp< 000p000Q S S SS8 S S4 +Sg >SQP>3S S' "S 0SU\ S:?  <0Sg 20@0020 0H  @  H0S 7APR, 0E10S*P  B08B0SE0 A1S*, ^ R0C*@ Q U B!U \1L0XR#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/TUUܭ(f,Ee$1p@-@0PS0<Q:1,0 R40S `$0V':8p1PS58 0#p(00<^ 00^ 0S8op 0! R R0 0WP`0%Ԇ%І%0p@-P0@S0<Q*@P80 p<0S P pH0@0@P(00Ppp@0%Ԇ%І%O-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T )P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  Y>P?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M؆%CO-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0( 0 00 002   0 pX = Q  0 R)  R # `ZX !,    R  $  S  R  V  PP$ X$@1`v X PP(@@ xPPP @(r P  @ @$ X1  RvX PYtt vb  (B( _V R  !    _X RG v@(@X 0x  v% YPt P I_Vytu xLt  _`V `R`V t@@ v(  P Px Ptv  O_XO 8@Y (@X bY0txPt- xt v  t v  (B(   _V _XQ ( X ,0 _X @itg v xx ,    R (ZS $X  $ `0 (ZS  P 00004Ѝ0S00 x| @P ؆%O-MP`80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R>sp 0 `800 0@WZR  D>sp 0 I800 0@@ZH  D>3 1> Q p0p-800 0p@$ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T xP0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  9P?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M؆%CO-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  1P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E0 0000S0R0SpG pGPt0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-3S SY S$ SVSc 0 F>s2 R>sp 0 G800 0@>ZR  D>sp 0 0800 0@'ZH  D>3 1> Q p0p800 0p@ ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R>sp 0 G800 0@>ZR  D>sp 0 0800 0@'ZH  D>3 1> Q p0p800 0p@ ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T ,P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  \2P?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M؆%CO--lM%PQ0y @%Qt ppq        Q 0#RS. 0 YT,Q 4^ 80 0S~ <``F`Z01S` 0s vQR\R 0C1!S` `0Q0 Q[ 0000,@4H80<@ y PP  TX0\ L0`V Vd 00 S`FY10`0 0 ,`P XD0S 00D0 ,`PD00D0 0R < 0JS : W1 PZ Z `p6`XD0S[ 40S,0@440S pj, 0@ R0%00D ;0$00D0 ,)P5DQ/*0 F0,0`P& 00D0 ,CP HP 00000D0 ,0H0SPHDgX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XP4P HP PR [S4 0 Y-,Q 4^f 80 0Sb <``F`Z$01S` 0s vQR\R 0C1!S` `0eE0%P0 Q.0000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S8 00D0 ,`PD00D0 Z ` 0R< 0JS: 60 PZ`XD0Sf 40S,0@440S  p4P MHP IlЍ, 0@ R0%00D ;0$00D0 ,P5DQ/*0 F0,0`P& 00D0 ,P HP 00000D0 ,H0SPHD^X 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPpS5 0 Y,Q 40 0Ss 80$0So <``F`Z$0 1S`0s vQBo \R $0C1 !S` `0O0Q000 0,@4H80<@3PP T X 0\ L0`HTV 00S`FY100`0 0 ,` P XD0Sa 00D0 ,`PD00D0 0 S` 0P< JP:$0  / $0PZ`XD0SY 40S,0@440S , 0@ R0%00D ;0$00D0 ,BP5DQ/*0 F0,0`P& 00D0 ,P HP 00000D0 ,H0SPHqDiX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppn plpj-Ѝ///@- // //p@-08P00@S PpaZP pf,7@-@0P0S TP Ѝ0P f,@-@P 0S bN@P/"AP 00 0/ / 00 0 0 0/////0P  P@- /Wg,OP P/ /$P0/ 2#0/tQO-$MH`LpP0`pR0@ *0S  P000b P000T000 R0$ό030#QZ^A2 #%# T P@ PU*00 0T 0C2@TPT  # 3S R0 SX00G0S.T0S 0) QX 0[00 0 Sq 1000H R03S XMX 00 $Ѝ P00#03P 03S 0 S: 00[0T #3SQ R[#  ) 0H0P 0KR?o20S 0SX 00HSX0 YH0 0 X Q 00 0[HCI S 0f 0z0 C R9S> 0 S I0 0CR 0%2 L 60 HY0S100u 0 S 0L@!   PT @0CX 0SY 0 0$Ѝ 0 Q 3R0D]T00S SD @ PTP?: = @   40z0 R03S? $Dg |f Q@-0M(,4`@0  P#USA\ 0 `U-00ĵЍ~ r0\pFW`&SA-M{ {sЍ8K@-Q@M0`(,0  P#USA\ 0 `TU-00ĵЍ~ r0\pFW`&SAJG-0M@p`0W PV P%Y P.X PmZ PNx P4 P :Wf  : }:V+  v: q:Y  j:t e:X5Z! L Z:< U:ЍYXZ-  D: ?:  6: 1:Ѝ (: #:ZVY  PЍGc c c c c c c @c Xc b b b b xb b G-PQ00RM00p0` 0 ᐦ@P @0S nS a0CSsNU2  0oSm MPN ЍMPZ V000U000MP[Z V070U070PMPZ V000U000MPZV000U000MPZU000V000z}MPZO V080U080i0@q@hMPZ: _MP YMP SMP`ZL V080U080?BMPo SHPPP PPP8"`!P`03 pP0  <p, 0 Lp@ -Kp@  )p@@@dVO 0PwLOOPMO 0PFOP`ЍAO00@lŸO-1MM   @PD08 "( p C. `pY@D;8 (@.0Sm pȱȑp  ` ᰱ00 $ %0!`t0p@ !0^ C0S@P 0S RN001ݍЍN0S 0K0S R Pp 08D<4! @ P0 00Z  02'0h,R @1ݍЍ pT\ \ FtH[ D[ L[ 8[ gt0@-M0P  Pp 1p@ P Ѝ00 0yЍ0@Ѝ0A-@@0s. PP0P 0p` ``X00`TNppMX`p JN``A00`=N 00 >5p@-@PCM0 /;P2 ,pPA ` @"N00t2 7{C>@ F0 P4D@ F{@?0S VS00 SCލp@@0S@h0h 0P@0  P@1:M?00@M00@,4XW `W p@-MQMP4@SX TD /e;PA QP0s* KP?QaP` 0pG @ 0@Cqp> D rp7 ۍЍp,0s i/10p +C~@0 P@0 * P@1:~M?00 p 04rM0#S @lM@iM@-p@ aM003x;@3@;3 %@:p2U U @-rP`O-$(X,P0p-S`@/U'W1 ? GZ0 0GP : [#P?5# yq 24x2 zPWi@rUZ0[% 0@-DM@ $P, Pnm~^w_(iTTx oT0dYP`Li0PPA)* 3!R ^!,! RX \`T0R@p 8T 0VP T ` 1<`S> \ Ѝ(00(0000,00,0`@PT01C`/ADP`@T0  T   0`0#[ )[U Pǟ ,!\ \Z ^X S:pU T0`@P0T0701 <` 60PP`@0,^0 <P0  0=R  @%0Dh0`@< D {{APP$0S`@"Dx`@ D  ,\VPfS `@0 S  \Q0s<D 8`0d Y`@0 00000Q0`@00L(0`@0(0,00,0D(00(0?$0S`@"x6`@0002`@P0L dS0 D`0D0Dd D 000#$0`@0$0 0`@0 0 `@(0$ S r <\m=Qh$\NPHL X@0 0D0h`@0 ST<\O{H@^{L@0D h`@P0= 0LS0$%h`@d @$0P x0v> 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#$0S`@P" R"  " R,"2!x"~$0S"x`@s`@00m`@ 2 0 Q00$:($^0<P0( 0=R%0(h00c @DHL0 0$B 0$t!#:6 00 0.$0Ϡ.>L!! 0!!!0C 0"  R Ό ( "!P$?#"0/  "1? A ,  , 00S($  0P 004 `@00wwqvv\utLtxsl""""'.%Q(\)\²( `@R 0S $0S \0S0Y :6l 46 0! 0Ϡ!>! 0# 1110N 0P 00( # 0,$0(0.,, (?"\ , 0\0#0  "$0Ϣ 0, 0<(0,08C.: 6 460!$,$0,΃1,#!1110L0^( .$0"! ( 0." ?"!00 (  "͌0 ( 0, $ 0^ T P00t"000AA0`@00=`@2 0 Q00:P0 0<R$0h00c 0 0$A 0$$##:6 00 0.$0Ϡ.>L#! 0!!!0C 0"  R Ό ( "#P$?#"0/  "1? A ,  , 00S($  P0#`@  0 P09*^3*{ r0s{P T80<`@ 0dR#  \ Q $ Q $ &PT8<`@  \0000 Q00SPT8< `@D !{`@ 0 D!t`@ 0 !m0S(0S `@50 Q00:c 0$ @ 0$8&#:6 00 0.$0Ϡ.>`&! 0!!!0C 0"  R Ό " !( &P$?#"0/  "1? A ,  , 00S$ (  R0#00 `@0D0`@0  0C0n0 @00 0Se 0 h00$%`@ h$ 0$% 0S 000000$0`@2p rp t t `@  P0P06  0# D%`@D000 P 0S  %`@D000 P 0S!D% &`@000 P 0S D%P R  \Q%8< &z 0 R#P dP(  01) :60 0!$Ϡ0! !>*0!!!0C 0P88*! /.P P$ ΁!$?   "AL00 h00H%- 0C00000S P0 0  B 0@0\L$   C00 00Su ^ 0 0  0   N+ R" _ZO-Mp@$DXl`00D0W0 T/ 0 2c1  ?80PP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T (;0d0P] 0TPP dPN$`P0Sʼ Rʨ  Rʰ  R 0 0` 0S0`@dp?O$@T'pET0}Np0`@dp00TD0 @Dv^D PE  0H000Q0SX0 0d0800QpHP 00| 4 JPQhltxPWx@RSY  Y  d@px Ut Zp 0Sl0Xh0[d0 Rwt [%[8P0>C 0C 0p00@t0p` VP x0S Cpt0 0000@4p d00Pg x8( "ό R t0"! R RYv 1 ?)/!! #.ǟ/ B Y? ?.P  Pʉ 00#1?4v.C BAQSx  \tp PpC 0 )qp 0rqpmC0S@T`p VPy 0R?o20S[C00ߍ 0RCd@)0 qp@pK Q#! !pY@#NRp \TPd0 P0,P`000 `0  ZR 0`S 00@ C 0d@  C0S 0V0ZS0 dd` ߲ PTdײ 8<dϲ @DdDz HLd⿲$`X\FZP ?`p@B0SB H2ß̓"bY2+:##c2S% P#q8PP 0d#0dT0>H30@p9B00Pd000@p `P ?/( R ß&0Q| 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,lX10( #ΌQà3\!=30S 0@! B^ A 00 0'qp: @p(pQCB#00B0S@@㴰p d @p괰[0"c01 2c1@T 0A0 Q  s!P AT00A0S10(` #ΌQA00@pvAT00]AT00}lL|)\P(\ ףvɻ %I$@-@5T pwtqTat X00 R 0 R 0Q/  /  p) `)  DQ p@-0l` SPPH 0@#  T\  Q p/d ( ( H  Q j.0 0#  Q/ 00Ɠ\ 0@-o>lP 0@" \ 0 /p A-@P `p@P@0% `P PPA-`X@@P pjNP@0& FP PPpA-`X@@DP pH@P@0& +P PPO-` M wpP8 찟` nGPP P @@ & P P0S  Ѝz P W j; %0p0S|! A-PpQ `@Q P 0@DDB(000S   x_@- Mp``PP( ^@  J00S@ S@0"S" 0`000S0 6/ Ѝ?@0"S1Ds\0`T000S @ Ѝ1Ds$ V kd. 8`. @-@ @O-`P MU PP2SpPK P@N P K <10`0u@P6 0nS# ={-PP00Q Q (P ^  0\  KB" 0 0Q@00oS@d000S p Ѝ4  T (\O-BMM@p?D 0 0FP:%-PP  FPo00S:P C @P@`K*0 PPp 0P0  0PPp `@P" L 0dQ PkPUP p` 0s| >0 ~<P @PP0 PpS *༐Q ,P ? 00BލЍP/U ` P p@?0SQ  C5PBލЍ 950H00 PPRp=  (> P00 05d! 0 {0 0>@ 00 0 5>0 ! bGL00&> 00 04P}>  P00 04q>` 00 04PfX, P, [xh dh zd@+ ) Y) ) p) H) @) ( ( l( - M 0  PЍ- M> 0  PЍ- M? 0  PЍ8-0M  0i?PЍL' --h( 0P    0/ 00p@-PW4U@p >,0,0? `0  6/ph& p@-P)'U@p=,0,0? `0  6/p& @-@P 0003/|& @-b@P 0003/t<& p@-PTU?o20S@ 0 00 3/p$& A-P`^UV00P00S@$0$0p0 7/% p@-PU?o20S@ 0 00 3/pXx% p@-`P5@Ppv=( ( 0 @p@/ @% p@-P@P p 0 00 3/p% -@- M  pbp@(0(003/ Ѝ@ Ѝ/`$ @-]bp@0003/$ O-$Mؤ @00`P /0Sp$Ѝ=<0` (P@6/$Ѝ$ O-$Mؤ @00`P 0Sp$Ѝ<<0` (P@6/$Ѝ# !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////@# ,# $ # # # # # # # t# d# P# 8# $# # " D# " " " " " p" \" H" 8" $" " " ! ! ! h" p[ $0(- C^ 0CQ$ :$0S 537$05 0$0(0, 0 0#  $0 0@-@$ MP05505#0%A0!0%P$00$0Ѝ0 $0R  S 5,3,07$050$0/S 5<37$05 0$00 /0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-DM@YP@f P, p@[; U a@U UP UK ;,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R0#0C R00CT,@DЍF, 0R0537, 5 05 R, S #0C 0S 0C 0S 0C5$0P$ 0@YC @0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S 5>37,050,0@q`@T  p FT")TW*0DSSQPONMLKJIHGFEDCA@>=<;:987bT5?Q10S. 031 a< A0100`w  0 00P, \0Ç0,0,0P ` YfT ?R0@SQ p9 b@S B77r # C  0c1#0p0FT 0, 00 R Q05 705,5 0,0 5RQ05= 3 7,5 0,N{ `f 1$01$0```0VS@TE-0Z0 Q W Q=T, R05@7, 505 ,   R,0 Q ,0 0,0 R :` Zo 0Sl `R` 0Pa $`  ?RX0@SUp9 b B77rb00 `F00b%#jo%#jx%ju-M{00{Ѝp@-MP`@0 0] 4/ЍpG-PRM[  `Tp|PCa@/E'P @1< 000pp. Ѝ80S&  1 00< 0 pp90S0< 000@ ppz90Sx r90S X 0 < @b900^900 P ` 4  p  (@- @MЍ`OO-EM M`X@Pp+`Ez/ AG0P@'T 0 5G@0PT| 0 0EAP B" >"UEލ Ѝ 900900l  @-`@M pP)6P% /F RP$  rR$   0@ P@ rR  Ph 0 @wЍ0 Ѝ@0rS 8 0 d  1 A-` @ᒾp 0P/S /FP @0 Sp 0 S  3p@-IMM@`PP ɿp 0: S X0 0vp IލЍpo8O00@IލЍpg800 p@-IMM@`PP ឿp 0: S X0 0Kp IލЍpD8O00@IލЍp<800K - M 0  PЍ0P 8 Q  8 //p@-@P PP` Q PP u .'P  p@x*PPp-40- M,0   ЍЍ/IHP --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/XIH0-@- M@NP  Ѝ@Ѝ/O-`Pq,Mp;  PR$ Ppp @P$PX P@ 0 @XP N ,Ѝ000:Q!0P00,ЍHXp@-(M @P`Y& (Ѝp0 0 lGHp@-@`PgNpp p@<0< 0p@-(M @`P1& (ЍpGHHp@-P@0 0@`  @Npp p@lFHp@-(M@P2Np `&8 [(Ѝp\@-@T0 0,M`P Np p% B,Ѝ FHC-PP,M/ ``FV` p@R V `@0 @T M ,Ѝ00 0:2 0,ЍEXp@-(M @P`% (Ѝp0 0 DHp@-@`PMpp p@<0< 0p@-(M @`P|% (ЍpF͌(Z ^P>F͌(Y MPtt>C͌ X <Ph0>JB͌8W +P\=̌1S PO=^B͌`x= 0@ S708T 0H0P, `P P  P P P P` P< PP( QP PP (P Ppx PqP'( Q78 x00CS40000C,0DPPh0 0HLpP(T p( a0P^ , `  `Y i V2 q @0T0 @?T, 0Y  p @daZh@0p@ ѼpP'  W  V 0`1A1S ,0 00@!1S 0D 0| 0?piߍ00,,00PL!!\Z, @  B  $ P8<@ Z& 00A 00@S= 00  1  pW  Pp弾W ,PZ00 0 p,0匰0[$0 1p0@ @pIP  X 0@0@S 8<@PP(04 0R(0Lp DPH1H0኿0P@@X$@L僿0P0 001P0|,`0P000FX0Ts0P00m80PHp( `+a( +l( +x ( + (  +( J+( +( ^+,  ,  00P@ap 00P !AH01 `0V0!P0 @`婼V0,@ `8X4$0Q1B/0( `Pp3`P V  P p (` 0,0SU,0 00C 00,p ` W# 0 C 0`S: Q P01! @TQ @JT0,   @0,, Q 0@@1.p`Pp`$׹PP- U  p`$p ` 0SA 04 ,01 Y 0i1 0 S1 1QL ! @0T0p0 @T0 ,00 P @T! 0R1V@`㏹@0P T  0`,0 SY,0 00C00, @ [# 0 0 B0!0@SC 0a0T !1 P Ua P宻U0,000 P0|,0Q0P0P1}`@=`0P T  0 @\4 0 0R080000SyO-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @7Yߍ 000Sk HP0Sv p`0S @0S p0 S 耍 0 S  10S N 4$X0 D@-<@M $( ,Ѝ H0 D@-<@M $( ,Ѝ< H\0\ 0 R/D@Q 0Q(00?H/H$P0P0/ D <  R ,  R$ 00?H/p$0P07 A-D   R'P?UH0@aaS,p10 0D   C(  \@U`@U(  R 00/$0 0 Hl P  `0H?30\ -@@  D\,00D//$O-PL4M  0pS4Ѝ帺PD H0 L ! 0 0|!0^:|@奺P` 0`D0ZP`@P0Z0 T+P V@`|@`v:L ?3Q 4Q< D pH0L  00|"(0:9`P0S R,@PR @0P 8: R0`S4ЍT `@004  0ж`Pu @|`L$0 0 ]H`0` 0p@- PU 0@S PHgppHp@-@P 0PS P1Ppp0P0% H -? \| 0DR0  0R0 S000 0\$( /$0 0 @H 0 0 /8O-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n =1Q0'0 0 0 0 rЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000 l@40(HC-pP☂M@ 㲶`P {p2@0@Z- @022BBB {`@2C{@@ÅCCnPU C7 pP pK 0p R\ @B0 @@@(P9 0 @@@(P. Sp* #p& p0 @z(P  'h000S :3S ЍP [B2T@ T\Z`Ѝh0S,bpPa44 @ A-Z`pPp [Bh2S@ T1++)000 R A! A p@-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0 El00TЍ!f @0l 0 S/lO-`Dt@M[p+5(($ X0CS0S4޷3 P*40H @08p{8 t%p{ġ\T(ÂLLßDDßP<<ß44ßx,,ß ߂ß@ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ d2 0 0#DLr'>ppGl`( @# T (0Ѝ>`@ <Z ^WvT#Qx:N'K#H #EH#Bp-?-<`_9|6o3p0r-y*z'{$@|!h}`a< 0 %+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxz@p@-'^(@@k( @>#T(Pp訣O-Mܶ6 `0&Jҭp6划006 0 000SVF 9 p 5p PP[ _ p?P4S S S|V0SpPn 0@l   $ `00 4S  00 40 s 00bR$ 4S4 0%00PЍp PP 4P40 s 00bR4 44000P ?21 R R0 ; 0, $Q B q 0 ;0 pP.4 S S040S$ 4 0r0  cR0$0`S 404#` pse0 ;0  p PP4P0u0PPcRT T4S{0z$0P s 00bRS4 000V0ScpP 0@  ^ $@ `00 4S 2 0 zS 202#`B pm p 0$ $P0 s 00bR40 ;0 ㉴p@ P< pg 40 s 00bR4 4$RP2$0$ r0 0C aR?o$2&100 ?c p) p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100 ?c0`00$P r  aR$ $ Q0   4 00 40 s 00bR 440`00\0\0! 0[ٲPD 4@0QXdA,( 80p@-P@ 0 P/& TT Tp<O-@Pd4`DM0+ 8 p$Qi w :Q|#R3Z 300S 8 p pP <0S p 0S 2UY R 0CQQ00AQ0S  B.=!ZR 0*"R S 0`"0U( DЍAPAPQ P80:Q !1 0!0:, DЍ!  |P p0 `0 @ 0hZ  6 8s `S2 B#3!0 00S P0 @ D! >PK0@ %0S0:3S `00X00E! *0`00 <00 @A40 0 Hp@-@Pw<ppp@@0@0p@- P@ e<ppp@THA-P ȯP @pT $T`0 @@TPp00<V>P@P@P@X@-@R"P @L"P P-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"(  O-P0,fS`MpvpJP U0 pr(ʍ"(0J"Rp 3S(0$00 0PK ~TP u XRX5$P50 2T P850 0504S0300SL p0SI 4SC 4S 0d$V、匑Tp"2 =PN 4p2Z LQU P P uP %"oL4Ytx2 PY $4x2$4X|2 Pm 3|2gЍH5S4S 4S0?o20 D $l h $ <% p 0$0(0lX ?!P Y 8!P Z 1!Pp2?;~0p220P_0 r("(0 y(Ѝp0@-,M @P2 m,Ѝ0- M0  Ѝl0l 0-M  Q , 0 00  ЍЍH000@- @MP 5p 0T 0 , 0 0 0 PzЍ0$H0@-M@P4p 0T 0 , 0 0 0 P]Ѝ0-0M P 0 ,0 000  HЍЍ000 00:3S /0O-J3\p04P  M2pa`P 0p PDo6τd3 p  "  _ͭ  dlm bF?Yn 㸲 `00s  bP` Ѝ,0 #$ 00 0 ЍTp@-D@D0@Ppp,0 $0l0m pp@-@0@P:#R|  l ^- # 0p {P`pO:ph@lp@-@0@P :QthQp- p #NP`p" :@lp@-@0@P:#R| Ó \ "R-- , p ##P`p:p@p@-0@DPSP @p (0008 <@%8 ppTHL0L 0@-@0:#R#R"#0:d0d 0@-@ :Q Q- :0 0@-@ :QQ σ  #p P :00 0@-@ :QQ σ  #p PZ :0 0p@-@P :QQ  Ãp #WPp+ :ep0 0@-@ :QQ σ  #p .P` :Q,p@-@0@P:#R   Pp @8 “%\8 --  p #P`p:pp8 :@H@-<@<0@00:3S 0 0  @-8@80@00:3S00@ 0 0@-@:#R&#R) -̌@́ $p $" "#P`c:#Rp@-@0@P:#R(#R+ -́ " "  $  $ d p  #RP`p&:#Rplp@-PPP/ 0@` :QQ" “Tƒlp lp  #P`p :Qpp l0 0 (H0 0 H@-@ MZ qQp* c0 y0 `00005 0000508003 Ѝ 0< p503 ЍL L0 0`0` Vj#c¤P`@4 0 000:P/ 0 0@-00僳xX0X 00:3S 0 p @-{ P`/H\0\ 00 :3S 0- p @-dP`/$0$ 000:#Rs/t$0$ 000:#Ru/@000 0  :#Rs30/ (0( 0 :#Ru30/ 0 0 0:/p@-@P0P`M00 p p 0S|000 SC q R0 :#Ѝp R 40,00 3/Ѝp\ht@|4A-MRBP0@Sy R `P 0Sd 1P 00p pQ 10Q61 1`p0V0S  100V0S  034p   03, p /,%ЍP  QÁP 0: 0 x   000 000 0@Z00}|p{ht@4H<@-,@@0SA00y@-$@@0S200py@-MT@@ 0S Ѝ< 000 000 0Ѝ8y@-Md@@ 0SЍ  0R  (00 Ѝ  xx@-$MHBH2@PQ :cVW0r3p p 0Scqp 0SQ1p0SB 0 00 B*1`00|PN 1@ 300 R 8 D 30 0X30G 0 . :3,p 4 P`$Ѝ0`00|P @   0R` 00 `r00T @8 b300 xwplv({pC- M @P {ᒝS X`ም㦝D0`00:3S Q x Ѝp  0 000:3S/<X0X 00:3S 03p @- P`/lD0D 0@-0 03, p P`@0@ 0@-0034p P`0@-PP MP* 0Q0@00xP 000 2000*C_ Ѝ0|P H000 24000*K Ѝ0Tp/ 0 0@-P@ M0:R P% P P Ѝ0P 000 w20 Ѝ0PtP 4000 Pxp0 000:x!0\ S0 0 Q/p@-@Pp80pPU,LQ (0 P0C0S0\@Tp?#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@pTЍA-PPM Q@`Q00?`FV`V` ,p(L 0@ppTЍP/\ , 0 B0/\//A-M`V,P@p(L 0@pDTЍA-M`V,P@p(L 0@p*TЍ@-PP M Q@7`pV00Ӣ?0`FV`V` W,( 0 @LpT Ѝ(1@ RR( RR T 0 p@-`V,@@Da QP(0 ^0C0 S0Vp(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-4 PlMYCTb ,P@QC8 @$^;RC 0000@0pP 0  0k-Pp4S-` 0@PP#@  p) ,ܢ4,  [ 0  0 - lЍB 0 :lЍO0*O-0$M`P2Ut 0# |@Tc 0`P 呢 W*:0S`HJ  0@P$Ѝ@`00S S; S0PV"W*0004S $ЍO=00 @S G0W  B20RP  pGPV 0pG ;WP  P@ G`\O-PQM0 43pS`.0S+R= @00! 0@ @00@ TP/  @ ` TP @ PER  0 p`PЍ` D ዼ P 4F " 2 2Ѝ@ 0 P0  0 /[404 0  R *P /lL0L 0 \ ʌ-P  /(404 0  R *P /̸L0L 0 \ ʌ-P  /ሸ404 0  R *P /,HH0 @-0^ @P 0 @r0 0@-0@T J#0R4 B0pQ 8@.P m @萷808 0  R *P O/D D0 00SP:P4@//Ḷ000 000S :P k/dL0L 000S :P @-Zp @</$0 0A-0`V* Z3 S$P! #Rp@4S@pp3Tw AmB0tQ 8A.ȵ((0 -0 i000 000S :P t/ᴴ00O- M X% p `P 0 #p @P  0 Pp@ 0 .@ U Ѝ@tP  P /p@-JP p3S P`4`630PV0  03s S 0P 2 $R 0X0S H03 20X #$04p03pp`Up@-jP ,3S @P4P30@Sp@A-`PY JSU#X p3 @R S$ S(XڒL0AQ0, X0p ,01B0010χL10|100b\ 0XP3PSSpP4SP|pp3Upp@-@P X0P:"C0T0XppG- ؀\/P@p  `ၟP LTL VW PT WV  T000S;0 l0 0 DO-($Z Ap`P)P@8P ( T2-P* T #P 0  @00 0\ WXP  RX8 @(  ! @0Td @-?C0 @   @ ((    XA-@PQP% pW# 0 0S0弝,庝000 R   R   R  P b奝ᣝ4埝`T `TX *P Q Sp QW02꤭p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S YP00SpX@ '(@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0p _pDH0H 0 R P@0?30Q@ 080//بH(0( 0 Q /|H(0( 0 Q t/DHT0T0p@-PR ` <@78H@?`pp Hl l0 0?o2Q0SX @0*"7 8@08 R (0@0//ᤧH0 0 $H0 0 &Hp@-P`0`0@T X0:20T1S@0?;@0m<000080S@078@0vpԦHP Q@0?30R@080//R^/R/p@-`S 4@HP@?Ipp?o2R0SX @0*"7 8@08 R (0@0//P@/&p@-@Px`P` X0:20T1S@0?;@0U8000080S@078@0p0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/|0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/ḣp@-P @ @0 p@,ꠢHp@-P@ p@ p0p 0p@-@ QP00R ^ p@ p@HHL0L0p@-@ P %pp p@ȡHp@-P@$pp p@p@-P | @ 00`$ppT0 T ^ @ p@x@(Hp@-`@P$ppT T  R @ p@Y@Rp@-P@00S ^ p@A p@}O-`80D0(00 \0P09  ( C P 0 0C00T0 R0, 00)80 0000 S 0CpC00080  K갟O-pPM< @ ,0H1P  0 T 0,pp 0`V! @D0 Pp(`$ T 0 yP0`  ` 0 Ѝ880 -0 M0 00 Ѝ H- M0 ЍC-@P M(p, P00S 0G`SLhPJ0 O@0H"Hb ``8 ᶘ (0 0Q 0 GP0D0 Po \0pq1QH``00CQ000 Ѝ0`00SZ00$0   T 0S00% , W10X0PXp T0RpG WڜP`W 0 ` Pp Ѝ80  080 000 S0CpC5p@-@`PN!pp 0p@- M Ѝ\p@-PT0 0M`@  /!p 0 Ѝp|Hl l0 00S X  8Q Q @ ,@ /&R//HH H0 00S 4  !R@ ,@ //ᘑH`0P0 T 0008!R !R @0<@0/6S//<<0P0 0 0001S@0<@0//̐l0l 000S X *" (Q Q @ ,@ /&R//တH$0$ 000S @ /HP X0:20(!R !R @0<@0/6S//0P @ /A-@Ppp" 80  P P`a  Z D000T $000S0TLL0 - 0?o20QQP T䤎H,0, 0 RP00T00/HHA-@P`` 80  QP p P eV  @00PU z000S00 0 PH?o2?PRPT //PP00T00/,0, 0000P/P/̌,0, 0000P/P/ᐌO-@Pd30Y Q T# PU D#00SH04SPPQP0pGP0HS``HpHW, 0 ^  1  !!BpGPI@Ye0pS a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!pW`YH0pSa>0 S;,0 0D | 0 00P0qpI PX 00C N0HSP 1TX[00CS``[TY0IS`YPY0 0CP$YP0 0 ЈHp@-@Pp`P0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0S 1H`?c`` AD Ap0@!qW#갑@W0 8 0| 0p@ P@ 0@00C Rt0 00@HT0 ?o2R0S P 01  //22-(^0,R0^Q!R@O-M A ! 1@ 0Q3, @ P `p0S! S#A 00 0C ```P  (0R0 (000C0T0 02/p 0PS@(  Ѝ2P141(0A-S$p`4@P(0PS@Q Qa ppQ p 0p(0p(0S/p@-`@0P+ (0@SpP0@-0^ 0 @ Q@R0/O-@ M`P VTppC0S  00C(00@00 T0@ 0 S `%, 0 S@p @ RᴀD`pD~ `|p Ѝ@0 S RR Ѝ,P d,00P `00V  ppG , B,(pqqA0 ` T` 0Dp4ốP ,00 G@p`4 0Tp `0Du@U   PB   0SQ 0 0PC $ 00\R =@U 0 BQ 0C R G-@Ph 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`0X0P`UPW`V``0 @p 0 $p0PEPUP H4@ PQ0 /$ $\/ P/}A-PQða@`؜1Pp0$ TY 10 0 QTD$ 0R U ETpL @10 0 QTD$ 0R U EBp:   0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q|H4A-PQÈ`0`pP0*@$ P rH00@T 0UzP- 0S* 0@- \&@T!\8x ƌ8 t ,0A@0@PU 0P0U00 S0/0?o2?=XA-P$@0S00â?4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 BS0@( p`0,,0 0CA1!0 0`@0S( X0@-J8  PE? 0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 O-RQ M40|`p᭍@Pu 0ሰ(᥍P,m ῎PP0` X4% 0080!0Sa0 ` `8 < X$p@0H0|0L P0T`7 ,!8 \0`0d0h0l0p0 Ѝ㏎P4. hP( :"R! 0 R80SJ 0  V 0P 0PʬR Ѝ ᒏᐏ ᎏጏ@ሏ A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,CPP  D0HRD0000H p0$`!bP@0SЍPЍxt@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED   0  PI ㄏL1D00S*Y p$`(D0@0S0p`0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @r$400@-@PM0 pp  00C  ?o2 0 mPP <Ѝ0PЍ0pHH@- @  0M 0LЍ,p-QPDM00  ( 0@4ЍoP8 /0@-0CM 00 @0C0 0 0D NЍO-QP 80&`V,p0A08C8 , N , B   S @ T"\ *A-U5P` 0M@00%?C5p 00TP 500 5 0@0@0@0  00P P500 @5 0@0@0@0  00P 400 4 0@0@0@0 00LP 400 @08@0400S@0@@0 0 (P !R 0400 0@ 0,@   8P !R 300 0@ 0,@ T!R   P 300  @0;@0  00P L300 v @0:@0  00P 300 e @0:@0  00 P 200 T @09@0  00P 200 C @09@0  00P <200 2 @0;@0 004P 100 ! @00@0 00P 100  @00@0  00P p100  @0 0@0@ 00P ,100  @0@0@0 00P 000  @00@0 00P L1S 000  @08@0Ѝ00@P L000  @00@0001d~p`0@- Md@d0@P006S 0  Ѝ0,0 000  Ѝ0@^pp@-PQpA`@7 Q`1000S 1Sڸ0  @T @TU p0 0 pp!!R& B(B((0 C RC00!0R0ڸ : h2P000S  @T 0 0^-M  0 ЍC-P@ p$P ?`LH/\O NI ^pGPE ࠡPJ@ 0$ @C@-PB2@` M0@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP, - Ѝ 0pP00 00@00@0 0 0T0 @00P@0 l0Pp  PL0 0L 0k @08@0 0pP[p~~`A-@`QRPp,010a, a0 A /? O-dM 0L0 :3St?@0800T$0`$`Q8p@HDHT , Q   0$ 8 @8 @ @ >0S ?@> 0000DL0 0  0S $@80@080@000h0S $0Q$p8PPXEXU 0, a  c  =0<00 R 0 S[  p500SW0AU0 0C0Q $0 0EL \5 0 ;p`dЍ P p0S,0$ 0S$000,0 0S(00 R, 000:3s @  R@   WR0    40 0Rk40 0Rf  B R  HT0  T0BAQX# R0X *1h"0 D 30H 0"80 00, lc Pp `!q@8000S000 @00p 111qWP2"0 YL 0L 0 0Sp P 1 @11RT`T<0e@T 0@@ 0@k0@00kH"!  -(0 00,  (0!!pA (PP@P @`@pH0 !?3 `FVQEP  H0 (P P@L H p XX0}P0@0 R p0 4# X0:h2@80 =V $080  800 L @TX40 00t+L0 !X4$P| D 4`<hpP0F7 /V0P0PF R& 0 R PPUdЍ$00ShL000S380/8 0080@080 u`v 8000W 0 0C B 0d 08 000@ 0CTqP j<0, 0I0y0w0 PC,, 0Qt=$@0 0U80 0  ` `  !V@p PPV@p P<0 `P YD`@ <0[ ,p,@ `P D`@Q  BX,08Y0IpC,00@D Qj @ \p 0@H  TL pD D[ D | pp! RQ("R $R 0 0D (0 (0p   0D 000$R`  4 000!R`A ^4 P  t0 00`<085p0*Wd WP@ m@DT GpGGE@_<000:  00,R800X,@0A0400q0C 0 @P 0  P_` 00p0 PR00Pj Y <0`0 0 B00L y<0,00Q,@ 0P00 0 (000P <  T P$ & |?@ P0   000P.  ?0 0 : 0 p R- W P1 @`0 0#`WP 0 0Lp1S7 W 0 P@0 0pL5S% <0, 00RW t0 @`0 0L`H5S00 0  000 pA-@P`M`3 0p0 R    8VxtP0000 00 0P 0  Ѝw80 D000 0 B/ 0C?0Ѝh70 00p6HC-@PⰐM 048# \` d0hlp`PpjP Ѝ=80 D000 0 B0C 0/? 0ЍЍH6@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT :#| _p @V0 S0( ?3 S 0S1S0 S  `50 00,4H 0R 0R0 0#0  RQ\ R RQ 0P // /p@-PP @0 @T $`U0 VP `'Vp`|0P 0@PUpT` @T @pp ! !@-@P@~T R/0A-p,SP` @T @~T0`SP RQ A0@ R ", "Q//@-pQ.`P@0D R "! "S0 R "! "S ^ 0N R ", "Q^`WP@@-@@@0S g$0P0C$09O-M:z*0p$P( ,pP L*00\` S@@s  aRXAlHQ00) 4 @Y @B@0@T RጰOoB@TP `NNQT0)\ 0  |  bR\ X)` R&H) R! CP' I@, 4R S[80S $ 0P00B$0X@0C, 4R CPg S ^\ h( } 00Q H80, @04(0RK0 H 0@0 ( a $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S  0P$0@P$P70 R(,Ѝ47 0( G$(00 SBGg@` & (00 S5$&P0C (00xP0S F$0P0C$0p& d&@ 0,@(@ R 50(60, 40RofF`@0,0 $P,40 P@0(@Sg 00 CRcڬ%%  pp|% p5@00p(`Y ٘| `nR`F`V,00P0S  $ 0P00B$0X``Q 0[^[ $ q 0$0C ,00(@0 0CS[ pD40,<4!0,01010zd4`000 0P ^$ $@$#@ P(@i0 Rv ,,Uq  P+ x# # l# (@$@ ?#R Ws( , #\ $7 (@  P !0(@$ R @ < P  @ $@lP " 20,  , k40 S [ (H2 0$ ,B@0S $ 0P00B$0$ 00P0 ! 00(`V7ڬA@ 10(`0 V0!0`Fx P(`0S $ 0P00B$0,@'A@0S $ 0P00B$0 ,@T0lT0  (4D@$ L$`O-hsh3pdC@00 M S c400040,c`(,P Zn34@3`0T'#0C S402PL袟 .0@DS(00S0 0l0S R "0 0 204@,P0T0hP XRP0 @P 0( 0CS .P 20 0 P1040 ,( Ѝ00S00h0S00}0T100 / P,P@ <1(`0 R*T$!P00 @T 0 R 0 P$ 00 00l P @T00,P0 0( l0  04@SRCPE@D4@P,K 00SL004P$4 lp |(@0(@- 004 (,t(@- 004 (,@0 0G- *BT ` 0@T0Y XpW,P0PEq SP00 0 Q  PU 0U 0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/<O- MpupP( d5` 80s+ LD  SP̠r ,R!1S5@50  50 `\P 400 0P 400 40 0:p@00@00l%R h%R 0ʀl20 h"T0s# 20T0 $,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q j`S`" Q _SP Q kS` Q[PS ڃ0Y[=20  0S0*Spt ڃ!-=000 0R("(2 RŸ8 =01U4 1aA`PU+ 0S 100S H0 0YH0,N  Z000 0 0 00RYjPU Ѝ0 0 !R 0ʀl20 0 !R 0ʀl2 %R t5S 0ʀl2Sw Su Ss Sq So Sm S[j0pd1P0TX POP# @ QH\F( 00ʃlœ\ 1:t“ @-'@T! tƒ'> 'tƒ /A\  B\  ^tƒ    /H01P0A 00` P;ʀ:l2 S3030 /@P%0000CS 00000000000000000/@-P@M@&\\ Y #3t P P 00 P000 0 zЍp`P -P\P Y # /0 0 |  0S h h0 8=0!H00 R/@- d0t881 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R! AR  00 000:h/Pp@-PA1@`M0*l"R R   P 000 0@ 0 @ &Ѝpx   P `000 L0@ 0 @ 4  @ @ &Ѝp p|02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R. R !`@ '( v@ Ѝ1=00QM0SJ\1`20 L100 70剑Q:20t1=00Q!0S0`20l000 0剑Q:20h000 0`0`:0!Q 00`.0!Q pp0 0 0/|0| 0p@- @00CS0 S 0 S P00mp[xP00p@-0CS@0 S 0 S P00Op=xP0000 0p@-00Pv@;pp@-Pv@1p 0 00S  @-@J Q P\,Q    @/,H0P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Q0p3O-0PP`$MCp@ V yv0P   BR.)*)000T0 S80  2 0@  B@DT p`$ЍIɟ, A A!RA @\e(p WH qH PYW:(PpG TPE0P ?[1 p"`Pp rPP*  U   "0S(@0 TDIPD@ 0(0C\00C Fe$Ѝ }q X@ @  D0|0jp H0001@D T `V `tV ``  @|D 0 0 Hp@-@Pppp@@0@0p@- P@ ppp@PH(6O-0dM@P$0[ Qv pdu`PtR Pq0P 0L W00P  040R0000P0@SD9H-@?`0XPP000PEPUG0000PS0401 000 `Pp @R?+40T R80 # 4000C?00uP`FtHP` t$ D400pP pG0`000 `p00PP Y0 00 0E4,Q,pQpP Qձpp( X4 R!! B qH" RU`pG UH04 S0 0  4 `P,8p04,0@,@0 p<8PU0 4Q0 0C0 Sa 0( 0C0, Q00PSj 0007 Zt1 P  $ 000 0 000K0p00_000C?000P 0@0 0z00 0HP8  #8 S R0 0?P4/ZWЍ0H\8  #8 S R@0刀0ݪpP4/pWTx Q" @-@M  R ! R "R pP^ 0 0 @\Ѝ /@-0QM   S S PpP$8R@ @ 2Ѝ8- M 0 Ѝ䌳D0D0 - 0 $M  ЍH p@-B\\@0O ^\1  @ % a ,\'\ n{ \"LB!!A0 ,"!! L0 }p % !    >{ \PUC 0 ER:d!@`P    P0 B! {c\ "0  \\:\ '  px @ l %L  + {l {e`QO-M  %nPP 0 &  0 S  n u@`\,S 0 @ 0 S -  QS%S+0L GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 So  00PЍ %0i\@0 `f` 00#1.Q0*Q 0S m@0 SP0% p  0  @0d\% 00 @ d @ 0 SP0%  p  0   0 @@%  c  0 SP 0% p    0  G0%  + @  @ c  @0 S}0  q0 @0  00 Sj0 _0 @0  0TY 0@x0 0 I0  @0  0 00 0 <5000D@0 @( 00T0 S\R [# J00 S $0<  p/ 0> 0S0\S 0 S0 000` p $ p@-@P0P`M0S PS   00 0Ph 0 Q00QH  < x0  Ѝp 0l8A-M0PSL!00@0@P0S? `0 6 0Ã!1!1"b2c@AL0L  00210Bq0P pW$P@WP 0fSPЍЍ 0Ѝ(h NgA-M0PSL!00@0@p0S> `+0  0à ‚ @0!0A1 0120BQx0P pW$P@TP 0nSePЍЍ"0Ѝ kL>C-M0S!0 0@0`0S2 P0 py p\1G $@0!b!bpG4p r1c1c@0 0#3c`10BqP pЍ0< qW X $`0sSP p`XWT 0S oPptPPЍ8t -?L*S0 O-TMa뀀lkpPQ ,$  90: 0 @P5 5 e000`P 0: @P} 0S  R 0[ @ #[ =[ =Pb 0000PX  Y[   RRAlpP W,0 0  P5o[ 0o0S` P@ 0 ᤓ  3$ 112cAt3L112c B L00)ɒ! C 0;뉑0P0 P0 0$0 B `@H, p@X 0Sp np= @P0P nXPp00TЍ l  0 ((  9  $ 0ƒ00@ B0! 0)⩑ቒ C뉑PQ 00 @> ` 0 〱   l1$N I$04‚!bƒ1c!b1c N0I 00  ࢐9)1i1c1B 뉑P 0tS0cS0S㴠 0 @00 Z@PV  < 0S pp l TgݵN$t >kL -?L*S, A-p@`0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV`1D !00O-pQ┮qM  PP, 00S0405 `$  l@H 0S1  RS Gs@T l P  4 @@pT %T@%T400 R,:PjP 400P,H=% , 00,P0 0͟0p0 :T T) `DV%?#"< / XT c`D`Vfz t``` 0`D@lQ0-0 >T0p  Tg@W -@@@C?T@^ >Tp A0D =R=S3t 1CYbevV.`^`0^@ C @0! D 02\* R:0Z'TOP͍ ͍R'RT0   R'R'R@@ppI@[BhP 000409hP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 340`0 R,[*P  0jp 40P040`OU:= !1`010@0O1S  0C-11@ST 400 Q,#*P  4 @@8AT @D=AA0@a DQA DR3@D1@ؕ% R ?R ;RK  pR 0%R 0@a0D RA0DS 13 DOS !01000@Sl00l0 0St00t0QU PE@=1QP eOU4=!1010@0@10D R-1!TORP=1=1 @pT!1S 0C110 S@Ra  ?R ;R QeR  pRS 0%R 0 00000 0 B10 OQi͍ 0 0}RR0  R}R}R@@ps!R =1X@ BT! 400 Q!`Q,*P  0ip 40040@N, 40,qߍ! 1K00@QU PE=1@1@QOU=0@-01P @Q %-1 1OS00PgP 400P,V 2gP 400,`V i``&``VP``P``Ì`@oobP``V ፡`{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2 qgPQ 400 ,R@p\00@W 0 oR00 @K00 ' V8`>00;&@D0Q0VT&$#"y p ]K5#0@0D!@D0OoB000@00- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/vA-pQM@P 0S! XB @fP `V! 0v0* V U~ ``ЍnpP0U0f ``U 㔧. 0 0 R U ᆧUlP0S U8 q( ap 0S R 8(C8B((0 000SU00P  J  8C8(0 P I  8C80T4U@.4*p , 4 ht@u \ 0 < 0R@- ME0S@  ЍA-pPP U) @T`V 0PS |V@P0DV  fP ^oO-PRM `Q 00Ѝ@ pPb % BPb <Pc P%60 ES  eP  ]P  W0P P PO0 S  P  `D0 S  `  90Sn  20`S  *0PS  "`V$ `P f$`%dP !dPdP  뼰 0$[PP " [ `$@  (B8BBXnS0 sS fSU0/oS" R0000P0`h&h V 0@:  0S  C("(  ` P0  P W0U PpU 00d P`Vl 챟Q`Fh&hVPb   0 SPW   pP`U= op嫲 g `PEX%X U !   YX p *` M p0 00 C PR0W00Pi0X0  2 0P/W  R000W$e  cP$+ P0(C-@a!`MPp 0e P 000S? PЍ`P  P0 &p  R 0S 0PPP  PP004P`Ѝ  0 P  @``+ P*`PD TO-M M0p0:S&0:SS@ 0PS:S``E[ P!* ;0d@0  jP 0P:S ۍ Ѝ@ۍ ЍC-PŸM Mp@`tpP# 0/SB P/xcP 0 ۍЍCW0P ! p dP+phG0P 0S/S pP 'dX vdY WP ;0 ۍЍC0 PۍЍ  p 0lc XW P0P 0 $ۍЍ404 0 $ ԑ đ d }T }$ G-p`@P  _PcU  VP `P@PP @T P  0@010G ȱ-@- M@00 Ѝ@ Ѝ/. Ѝ@ Ѝ/@-@ccc@cc c0}c@zc 0p@-S@M 0q  Ѝp0`P0 0d 0 0\` U0 Ѝp 0p@-PS@:pS bbP!p`C- M `@V pᬐP0fU@@`V  ' W0 nU sU  `V  @0*00 Ѝ R@@@C- M PU# Ѐp`fRPU @ H0P 0 @nR sR PU 0 Ѝ 0S008#8 ЍPA-P# P 00`p`0,SS00 0\,\@CT`P   `p`@  C-p M@`P(P>qpWX*nUO sUF fUH0D Y)RA @ aPK H0D@ pkH0@0 H0cH0nUp@0 H P4 sUG fU? L00L0 Ѝ@P%  @AP80W D 80400 _ 0S00 80 @H0R# ,0 0H00H0H0@ HH0@ 400 H0@04 H00H04 0H040, R0 0H00H0|z  ܉ 0O-M@0[ ` Z p p(080H0p_P0; P0  `00 ` ἀ[`   ` `pZ `   ` ` 0@ 0@Ѝ0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\脼A-`P0PUM@p"S& U`P !P  ᴀ+0V00  p   00 0ЍPЍ^ p  O-P@ 04M 00P ``Y`4  p` 0P 0 ``|  @P @_0P ` 4Ѝ  0 ` `,0Y (0 0$0,0% P@ `,, `AR   0S00WPv Y  Tr  `" `Lp W@`H @ D L F , `$fV8   0 P+ pW9  `BHDhDnVDH sV  Q"0 S  E ,@  `4` 4Ѝ 0 B `$$`$aB]B@S ́ A-P`0`VM@p(S, '_P$ A`  㶀000 P00 0 0 0 0ЍPЍ]0@-P pW M@`R ^P 0 ` 00P 00 0 ЍP ЍU]O-TMD0 (0D0,$0:080`P ||@P00APP 00vzP|T oPkd:P{PF^P|  P" U $0 T $0(,P `= $010#0`,00 0xGxwP 0s 0PI (,P 0S , .S  ROS1 = @P# PPD @ HDHt 0n P L(BL00S P PJ$0 F0 0S t 0 0E0TS$0 P0S000040'X0\ 0S# ` @0@SR xGxwP00$000 000 f0:PV 0 `@Z 0 Z` 0 Pg  (\Z  RYX%Q^ZQi @T 0&0FS Aw  0P 0 `I0J0 SE0J/SVTSRQPONMLKJIHGFEDCBA@?>=<;:76{3210/k-i+*)tyu0Z@ Z8 50 00@ 00@0t58 0000  0P` P`00M] 64 $ 0P0@f P <P" 0$00 000000 s0lPi ] o TЍ  00P0` 0 0  0  0  0  0 04 $ 02 0?T 0 #t  0 S00|Ps `

$0P00?//X @-M@;0 0C@N $@L0B!b!bN?AA4 1c1cL0P0@$D$C!d!bA@C1{PЍ-?L *S| p@-0MP0`2@P 0Ѝp], 0 0S Q20Ѝp` 1!0G-@a0PP04 0 4pS 0p02,0:PP0  |Qp`  'WPepEȄQ  W| 0 ȇ0H00Xaa@-@P [[[ [$[,[[,00!R  !` 001/H`001P//0` @--@ \@\ @ 00s@ H PJI HH @\tp@-G-(M7@ @`0@PS~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " kU{F{{!00 (ЍpP P # 0U 0 f {Ukkag!00 P ~P T# 0U0  0"{P  0cP0J30{U 0kk iP  0cP0G20U 05{kF{{TPn  0cP0t20U 0x 0"BP;  0cP0x0 0U " 0P;  0cP0|10mU 0 !a1""UJP.  p0cP0%ʘ 0U " R b0cP0$d10U 0T1""P  P0cP0$10U 0 1""P  >0cP0@00U 010""P>  ,0cP0@ʜ00U 0 0"P  G??tl `l 0l k Hk k j G\j j i xi Li i 0cP000{ 0kF{U{# P  0cP0uʠ30{U 0kk Pb  0cP0\30{U 0kk3 mP  0cP0n30U 0_3""[PF  0cP0L20U 0=2""IPO  0cP0ʔ20U 0x2""7P  0cP0EP20U 06`2""%P5  |0cP0 20x{U 0{ P  k0cP010g{U 0{ PD  Z0cP0ʌ10U 0`1""P  H0cP0H10uU 0 P<  70cP0k10U 0\1""P_  %0cP0&00U 00""P  0cP0ʀ00U 0t0""P  h Xh g 8g f df e e f e $f d d c Gd "00 9"00 4"00 /"00 *"00 %"00 I mI |2""2l0 0P2L0 0G 2,0 0>@2 0 05\20 0,820 0#20 010 01l0 0"1L0 0K1,0 02!00 P10 0S,10 0j10 0׳90 @@0 ʳL0l0 0?\R 8R S R Q Q Q R R R P R @Q P P P tQ P P N N N O O O 0O @O N XN M N XN M ,L 0P0 040p0 02X00 0|00 0v`0 @@&0 is0 @@0 \100 0Su,1P0 0J,P1 @@0 =ox!00 10 0/!10 0&10 0G2 @@(0 82 @@X0 l2t0 020 0+@!A*?B0CS Ϡ-6S!R#  S Q0 {+C 7G 01046n kȠȠ+S 0+C{6F{7 +S0+C3S S 0A.B B03200Pp , / /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! ኿V @D8 ,0400G|,0 4 00(@ ( 8/P8,0S0Q 400 @-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?000CS>0S! 06c@<=0 Q,=00 C/(0 S0(0< 03@`<0U 0PEd@T0S`& <0-T0PEd@TU0 C0 0,0 Sp P<`@@C0S 0,S40 PC0000 00 0 0 00[0"1<@0Q3 tR0 p (RR  4,00 PUSYt+H; 0 40 30D <Ѝ D R S R  P;0 PB 0S  0 0C R 10U 0PEd@T 0 B00 00 000R00S2P  0 Sf8&#4<f4#0R :00:0 00 80B4 R,5@0 0000 D 00R1 P! BD A   B\000D0Sp90l9 UR000 0 pP<`@@ d0)pS ʈ0  P<`@@ ;tTUL 0PEd@00 S  Sg S. 8a@D00@T6c0PEd@TULQlP80 R H0A S00 CR*ʈ+R~ 80070LQcD0ʈ;70\0T U 0PEd@00SQqʈ@6c@D \700 $ R40,0000 700XU  PEd@T  E !RB 60U 0PEd@T: H0!ʈ0H0;6a0@D;Ut 0PEd@T:0D 1ʈ0+D0 6a@D+D$60[ U 01[![V 0 0C 00  00D0 PE 0CD0 p0D`l QT U5 0PEd@00Rl @Da0 T ld0h \X ! 0PU 0PEd@0S^6c@D0l0\ 0x R! / R>400 Q 0SU 0PEd@T 0V  $400300 C R=0 U 0PEd@T30F?o20$0S0a #3$&$B0#22cRV0S  l30T0PEd@TU  0t$ R R& D U1![ $Q P LQ0Q 0 B0 !/0  0D PE B pD Rk0h" D 0$ R@" D C$ R$ " 0+06c@D;D10 R 0 B D  0|10$0S  &$   0K` `@U) 0PEd@T$0D`S` 010`+@U G$ 0R $P (D R2D507S U      0c 0S PE p0`x G =?>?N?P?5?E HtM? D Q?H?A?L?A J?@ d? C?l = = B; 9?:?;?0@\,( @Dʈ+6nc2a@D0 D0B $0S`0  03`@03&8#[ (30Q Q6c@D;D  3 +0l3HL0  300@S3D0y `v0aS3@D0P0;T030 0X00\00 C[PEd@[U6c0D@C c P5l01r0ರ^l4a@D0R!B"0$ 8 S0l0S>0p0P00X0?0X00 p0tmP 500 (Cu @m X50`5@0 0`0n 00`P50y5l 0[pPEd@[jUEF0L0Sk 0 0006c0D@Ca|(1 T*U $((UW PEd1岐@^ $(6c 0DQ6k @CD 7L0 $ R&400  0Z87@`0F 0cQ0`+@GP6c@Db 0ಷ@D&a"@`07l00 0 00pP<`@@0 $(C S>0p0P0 0X0 Xtp0(0$$(0P/ \80( &b0R0 S(08@D0 0cSR: 3@ 0@l08@0390ed p T  \  \ h VP H90j0 `C^0Sl90Tp@-@JPP80S $ (2/$0(3/00pPA-@`2PP@p0 QR 408 B4 08@ܷV000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@P`P-@ R2Q <001 00S!B<@0 RE R 0c Pࠓ^ S R6 0 1 R` @ <001 R@ 0 <l0P\p[ G R R 0c P  R S R 00S  0S  pl0Sp0p0Cpp0)x 000 0AP,040p0 p0 0 0 30 Ѝl0S  pl0@@@ ld\S???0ZP 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPZP 0|!(`3/@PW 8pW8 (  0(3/pPH 8 Ꮆ$!኶P S>0R:oRS B P T  B T p W0Bp$ (0 #8l8p@p  BS>00p08 ]` YP S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰P儺X 0C0 0$SQ $C0p`0 sRpW0- p  p0 Ѝ0` R`V40sDJB 0|=J^S3 0b6 08#8^0X 0 0C∀Q\ LX P!P0!01 002T 00(0! T 0SЍ0W0T0S Ѝ 0D?o240%R00S020,0@0000,004@0D?o280 00C$0 (00 00PU?PU@PUAP0UAPR@oPP 0CX2p0;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0l0\000Sn tP LP`,0S P'p00F S#0`0 h0S:l R1#P0 6SL \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 BXl0\000SЍCO-ldl`,M Pt \l@80H00XT 1#D04 @  QH0@ ,0 DA?C0CR`Pƙ Yp0&0D8#( ƙ#<0ƙ3@0 B0(1I>RP30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tP` l H 07#0H0Xl \0P8 B l0\000S,Ѝ80&6&6!Ɖ909t6l L Qtl \e 7t0 S` R S9 Sl@sX 1`o 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 Hl0\0v0P,Ѝ\P80 B0 5l0\0c00S,Ѝ=O- M ,0PK[@!ܔ0 P0pUpX/o" Xp ypHor 04 0 0B % B 0 0B 0 #40BVU2W0>&* Q!L:l`\A `Fp W P!P1UP! U:XUppU0\ 8`1  L\ 0PE0 000C00U00\  W 0 B0 0 PpU` , 8Ru0A6,0l0 &\0PpU`l0&R65V`    R\S#` Ѝ R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`ܟ 0P0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPD/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S|>00000 S *S0SWq00Q 0SD0@S>P0 W0Sr S00V0 00#400 0 30  0#400  0 [0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000) R0f9S ,0 00 t0  R ,00S0Q01Q0$ Q R 12 0 0 0 0#40 0  0 0 S0 S 00R01 0 0  0S 0 0 0#40,0S0 0E000S ! P B R  PE[ P 0 X0 *H ֩0 ,0 SR0 B00 0 0 0 0 0 S0 S 00R01 00 q00? R}0ES IS< [S7 gS7 /0S0CkWi @8 RC0SS@ S   00#  #800#"0  M ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S+  Rg00 0 B00,00g  S  0Qq R0000 #40k0q00Y0SZt 6l8&`6&6!ƅ909&tl0I0Qtl0" Yt0SWd :W㴖K 6SW \0l S8  B0 l0\000SEJ\ R8 C0 l0\000S8 xZt0(l 8`R B  ^C 6ƅ6ƅ6!ƅ909&6Rt0l 0C t0l S+t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [P Ko᫲[@ `P``0P&0@&0!0ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0800S=q#  #800#"0 00^,B 00d*W6F &R= \ R80l0 C<0,0}j 10 0 0010 B 0L0DC0C t0S*l0\06\0l S8  B0 l0\000SD10-\ R80l0 C97531/-A-`pPTqP@G Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0`]p# 0S%t l00\ R6S S L D0 B C}060@! Rpp p@-@0PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV0P0pPO- Mp`80S04< 08Q1S00PP 0 0S{ $0Ss wpVjV`F0HSs0FSRo WmZkYFo᫲[dV @!( `4/@Pi  @ X  P "L  BT  A4 * 0`, ` ( P6/, ` 8(6/L ` @(6/j 0 D(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0` (0} Ѝ8  40 000&-M 0 0 AЍA-P@PUP_8 `堥 0l!(3/@PR T!@啥 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 j, @@ eL DD `&![0 0C006& 0&;> 0$0;/c O-@QM R0 x  0S " !,"pHP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A $ " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4X RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C  0@S 0 " !T," ЍP ""pBW1C1Pu|c g b a a a pa 8a `` C-PRp ` P  01!0\0 0#@B .P@@1R0  C @$'_ C-PRp ` P  01!0\0 0#@B .P@@1R0  C @$'^ @-@P xpxPp`@` 01ē!0Q0 0#B  ^ @-@P xpxPp`@` 01ē!0Q0 0#B  t] 00@-8P^00# @L   0 G-Rx 'xh Q RO SRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#pG7&c20N 1pW|GpG1^NNPV=F10C>@@P  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0@0C 00 pQ80'7b"c2pGNq&R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/U/0S0`0//h 1)46@-S k>@@0 #400k.06S0 k΁ς 1O- p:PTU0!`Q` !ᲠZ* V @: U @0ς!\KU V*  p0Q=0^ Q- Q- [ O-@ 00 0p0 S01 ]Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C00 LQ @00^ P0 00Q00S@\ R 800SC00 R0@\<ЍW@  yQ / !02@X1Z Gೠ6;#6pQ^p N  p=A-P@1T`R`QPEP0+~T S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O- M`V00Rʀ@kf W !.⼐ 5b8Z#8$PB 000#406P0cY 8#8V⼐5a8Z#8P000P%TPVAPeY58#8 B("(Q1P8#8000P#406cR!0C 6V V0T@R p` RPF_oRPU RV0W R+AʲpᰐgZ5P8#8000P#406pGp0cY38#8 WvA7Pp8#8k.00P0p#406VPcQ 0C6B0T@ Ѝpᶐ5i8Z#8PPI0 00#4 06P0cWs8#8 UVZ AU0pX%Xk.PPP0p#406VPcQ 0C6 0h0cQ^`弖0ᾠ9`jY8`J #80 00#4 0编0iQ8 #8 R0἖`3006/02PV , B("(5VPk.0V0p B("(7k V0&0a8p#8<ʀ6O-Skn⼖0M $P  #  # #  #  "!A 9@b8 T#8@p000@p#406 B0c^8#80἖&R @ P$ pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಐpi>X8#8000#406I0cWs8#8 0@弖^| `D B("(9@n8 T#8@@p000@p#406N0cR#8R0἖\ 9b8 Q#8 @Pk`0`00@#4PP06 Bc^ 8#8k0&Ѝ0἖10἖-l] `] T] H] <] 0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&ʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@, R 0p&]P+(+0N  q/ ! RF@P j   Q&Q3 "[r&k R0E 2 8#8000 #40&0bP8 B#8k0&N.V }G.0 0S0 0xS0  0LSI>X&&&&0 Ѝ,  \ P+R +R ,RE R  Q ,^ R3 "&][Pj 0q ЍO R \3 "[k 0("( Z:8#80 00#40缦0jR#8 J#8+ ZB!(:ἦ8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦv8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦU8#8kΆ000#4 0缦0jQ J!lMk>⼦ / ! Z! ! 缦jR! J!^ἦ   u Q3 "[8!8#88#8z8#8W!28 #8T S DP :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  DN 0S A-P 0@ Cp`'VUV `O'P &/@- M`@p*PP Pk  `  &p w, @P  Ѝ腟 0@0 Ѝ~@ Ѝy@^,T  Ѝp@-P*@P @;00pe 0 p@-@*0P 0*00T 00Qp@-MP`v*@P P @ 00&p #,PЍp6P,U 0PЍp0A-S ` 0@ CpiPf&U 0 &0PP%yara0A-S ` 0@ CpEPB&U 0 &0PP%tcid0S A- p@0 CP!`&V `О/0S A- `@0 CpP&UW&(0PP寞/%yara0S A- `@0 CpP%U4&(0PP匞/s%tcid0@- M P@ %p  @P Ѝ0r@ Ѝ0m@ Ѝ00@- M P@ %p @ @P Ѝ0W@ Ѝ0R@ Ѝ0yara0@- M P@ %p @ y@P Ѝ0;@ Ѝ06@ Ѝ0tcid- M Ѝ- M Ѝtcidp@-@P%0PPptcidp@-@P%$0P p00ploobp@-P`@P  0@$p@-@w@ @-@q@. @-@k@F @-@e@b @-@_@~ @-@Y@ @-@S@ @-@M@ @-@G@ @-@A@ @-@;@@-@5@@-@/@!@-@)@6@-@#@K@-@@[@-@@p@-@@~@-@ @@-@@p@-P` @P  U0@Y$pp@-P` @P  C0@G$pp@-P` @P  10@5$pp@-P` @P  0@#$pp@-P`0P @P   0@$pp@-P` @P  0@#pp@-P`v @P  0@#pp@-P`d @P  0@#pp@-P`R @P  0@#pp@-P`0P> @P  0@#pp@-P`D @P  0@#pp@-P`2 @P  0@#pp@-P` @P  y0@}#pp@-P` @P  g0@k#pp@-P`0P @P  S0@W#pp@-P` @P  A0@E#pp@-P` @P  /0@3#pp@-P` @P  0@!#pp@-P` @P   0@#pp@-P`0P @P  0@"pp@-P@#(0P pF0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@"pp@-`PZ@u#<P pP U patadp@-P`@P  0@"pp@-P`@P  0@"pA-P@:#X0P p&`P  P `i(gntsp@-P@#(0P p0P 0pgntsp@-P`C@P  F0@J"pp@-P`7@P  50@9"p@-@R +0@/"p@-@ P"$0P p00ploobp@-P`@P  !0@ "pp@-P@P K!0@!p@-@ @1 @-@ @I @-@ @a @-@ @} @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @- @-@ @< @-@ @Q @-@y @f @-@s @v @-@m @ @-@g @ @-@a @ @-@[ @ p@-P`@P  v 0@t!p0p@-P@P  0@c!pp@-P`@P  S 0@Q!p0p@-P@P  0@@!pp@-P`@P  0 0@.!p0p@-P@P j 0@!pp@-P`@P   0@ !p0p@-P@P G 0@ pp@-P`0Pq@P  0@ pp@-P0P^@P ! 0@ pp@-P`M@P  0@ p0p@-P;@P 0@ pp@-P`*@P  0@ p0p@-P@P 0@ pp@-P`@P  ~0@| p0p@-P@P 0@k pp@-P`@P  [0@Y p0p@-P@P 0@H pp@-P`0P@P  60@4 pp@-P0P@P o0@" pp@-P`@P  0@ p p@-P@P L0@pp@-P`@P  0@p p@-P~@P )0@pp@-P`m@P  0@p p@-P[@P 0@pp@-P`J@P  0@p p@-P8@P 0@pp@-P`0P%@P  0@pp@-P0P@P 0@ppp@-P`@P  `0@^p p@-P@P 0@Mpp@-P`@P  =0@;p p@-P@P w0@*pp@-P`@P  0@p p@-P@P T0@pp@-P`@P  0@p p@-P@P 10@pp@-P`0Ps@P  0@pp@-P0P`@P  0@pp@-P@m(0P p 0P 0pgntsp@-P`@P  0@pp@-P@P 0@pp@-P`y@P  }0@{pp@-Pi@P 0@lpp@-`P:@<P pP U patadp@-P`7@P  D0@Bpp@-P`G@P  20@0pp@-P @P l0@pp@-P $@P [0@pA-P@X0P Np!`P  eP `#gntsp@-P@(0P p;0P 0pgntsp@-P`@P  0@pp@-P@P  0@pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R 0@p@-@0 P x#v#p@PP#0S #pz#0܀@- @@a#舀P 0R @-P Q o//P ና0 0 t@-$$2 D@-P Q @u@ @0@ 0 f( (0( 0 gv1 1 $̔ 0S p@- X@`@@PPpP p@ P 4A-P`p# @P  P` `pp"P` " "" `""Dd@~p@-P @`PpP p@@- < @P $ ~0 0 0 耮A-pP ) @P"  k0 0 0 \P `P  l` P0 000 ,0< `@4. /@-@P 9@ e 0 0X . (}-A-M `V $P0 P"@PpP  0P" ;ЍAЍ/ЍAЍ/ 0 0t {- pܐUꨉ@-@P @  0 0X `X- p}p@-@P x0 0 0R0 P0P Q # p@ppp@-@P `0 0 0R Ph0P Q # p@pXdP/0 0 0R /P/<0 0 0R0/P///ᴪ0P p@-  o QP  QQ #/`dP/ 0 0 0R/ة@-@P \0 0 0R  0P Q l#00꠩P/00 0 0RP///,pA-PPM 00 0/o"P R Ѝ R0 p 0 p`P 0 S  R H  ! pP`   00ܨtA-@PM 0 0 0R ЍQP 0 Ž 0p}`P 0S d  P! pP` 000( (0( $0 !\( t; P H0-0 0/o"^ R  R/P/D0 0 0R /@-P oꌦP/D0 0 0R /@-P ʐo0XP p00 0/o"\ R RP Q  Qऐ /ԥطfP 40 0 0RP /Df(0A-SM`.P@U Ѝ0 PP pP 00 0uP* S'P0S0"Q00 @P X 0 0 0 @Ѝ( ]P {P 00#0 0 P 0S S R/P/ R0/  @- @hWrq0p@-S(M- {@ S  P{ Y ` `vP P (ЍpX  (ЍpD P { : (0( (0 ЇܢdЇ4# x$@-@ap@-$@@^pء@- M`@paP P0P!s*0 00 ЍK0"S@- M@Pp@` `$qp 0 00 Ѝ,0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`ᦆ@P (ypP  ፆ@P ׆W@, ,0, (0 npT LM 00 S 0 P :\03#/S 0 P \0///0@-M @P  @ Ѝ00@-M @P  @ xЍ00@-M @P  @ jЍ00@-M @P  @ \Ѝ0@-@P ,0 0 0R0耝 /P/0 0 0R / 00 !S R!* R0:/ - ^0 : 0P0*  R*/@@/ / 4P $0 0 0R //LP $0 0 0R //P $0 0 0R //ܛP $0 0 0R //ᤛP/d0 0 0R / 0   \*S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RfP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0 8 S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0P P"P \P@ V  P U WP P pR ;R@  uR[R\ BR񏐮qvhg"R /R@S00S@Ѝ!1 0 K    0LPp 0 +("( RB*0 Re \Rb  uR^ 5PY +  PS6I %"". 0)" " <,  0   ,0     SPY$ Y  ͕)  )# < 0,!  Y*-"-  }  )&  u iiG-@p` W W00 GR0S p W W00 GR0SWL 0<0W0PPF <W0@@k`r``p 00 S S   CQ R<S+  rP)   lP#  fP.0@S@S -S 0@@-S0>S @ 0@0S>S0 @>SSS @@ @YP (0SP  R @W' W0S@@a@dPV` /P @P D $P0Spgtgg00T0 mp7`I1Ao/A-PP P`p @@P@@@P p40,p0P4080<0|`K  @-@ 04K@-$@@ }KX|40@-@i@fO-4@T ,p` P @D¤@@`T P礀Qㅑ@0@ @@0 PZ PZ PaH a @-R 0P< P 4Q ,  D D0D 0 ), ,0, (0 ${ a`l Ha`p@-M@4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% L`ЍpS' R=9Ѝp 0 0D Zp p0p l0D \ \0\ 0D cD D0D @0D |H H`_$ `|_y `\_ _4_iA-@`,pPP W 0 !,P0`,P0`C-`0SM@PpF  PP00Ѝ! 03P ,0SU ! 0(P ,0S(0S00 0P 0S>0S0"S0:S 0}S "S000"S P  P d @@ 0P k, ,0, (0\ ] ]x\0p@-S \  Q @PPp 0  0  v \[0S 40 00$ $0$ 0 @-u8 \[ 4 @-R , B04 P @@ @0@ <0 w, ,0, (0 n \ [ D\Z80O-M@ Ѝ@Pp `P @ p @rЍȒ  {`P0 004QY  4 R] ,剱1Qw   P 0YIW  B B!)k,0 ` 04 p<0 04 <0 `,VN<V8V+6Y& 嘡@ u `  D{`P) k 0,S<SS> kdPh @<0, 0`p4<0x<! j,0` k{Y` [{,x x0x t0F/d d0d 0,WL L0L 0 BT(rxAx WW2T YW0 $YWp@-@PP0S L  Q<0  0p@ 0  0K/dp| WVp@-@P 0`0VPP p p0 0  0@S<0  0pPp( (0( $0K/5xp$, LVV0O-S M@PR z`L40SM x `P@> ЍsP pP 00S 0q 200PX 0S. @0R* P# [` 9P 0P 0S >P' X H` ЍOWP 0  03/P  40R 1#PP 0 0U/i 00C 0P `T@zh h0h d0U/T T0T 0]/oou4Dnp @RShm HUdS @UDSd@-@z0,S<SS 0  0 Sh;8 ,TRPG-U `p0VRV@P7 404 S ` c aS` D000,0 100,0$ 100, ,0P  @ ?o2\0S0S P`P : . ,404 SS` " `D D0D @0c/0 000 ,0c/xk SP!p SP7G-PS @- Y`' T 1p 0R Z ] [ 004 00R% NP J 0S 0 GT:d d0d `0i/0,S0 000 ,0F/P/0 00R/LV P H0-00/o"^ R  R\/ VP/@-H@T  ?o2^0SYoU0S A-@(`MV PP !0 jP $0S6Ѝ/ 0P ` pP 00 0P6 0S3$ MP, V8 y @P0 00p `@~ ` Dp` 0$ 0R0"S 0 |0  Ѝ~0"S @ > @Pph>:`T =8</P/<  ?o2\0S /0SP/pSp@-4@4P@P] 00XpX! S0S   0RR@-@<<B T (@@=@@ @ld  @-@P (0 0R*DRP/0 0R/RP/0 0R/Q0P D- ?o2 ^0S 0 S7/Q0S /(0p@-S@ ``P0 ]P0 VP ll `@@ @@pDDD@ @0000 9  9:A-PP  P`p @a@P @@Y@P p<```* 0,p0P4080<0LP@-@- @*  @-R 0P< P 4Q ,  <0< <<0 ,0, ,,0 O8 9Q09 8VPG-9 pP0`W:W@ 404 S P S0 2000,0 10,0$ 1P0P : 404 S P PSPL L0L 0( ( (0( 0( t d57 7|7p@-M@400 S+RP, R7S 1CaV( P` 0 02P 400C40`ЍpR S l  Ѝpd d0d 0< k2L L0L 0< |)4 404 0< l x 6t6T 3P60 6,6A-@`,pnPP W 0 !w,P0` ,P0`400 p@-SP8@S w4 <0,04Q<0pPp 0 0P  d54o@- MpW3 0PS`@$  PW00 Ѝ 0 P ,0S x @0 @P  Ѝ0]S$ $0$ 0` / 43Rp@-@P 0`0VPP p p0 0 0@S<0  0pPp( (0( $0 _J@, 2$3w0G-S@PK Tpw 40SF   P@i P P 00S 0>~P7 0 03/P0  40R 1#P' `P 00C 0aP  @ꀐ + pG \ \0\ 0 8 808 0 IHH Gx +t1H .D140S 0C40/ 0  0 @- 100p@-S \  Q @PPp 0  0 F` 0X0ip@-@P 0`0VP0S R<0  0p@D D0D @0 0 000 ,0 {pF p// L//wG-S p*W`@ V 0P 0R `00 U` yV 0S  Gq@ @0@ <0F/:+0,SE /.A-PP 0 0RI4pP 40S @,0a, 40a@T:8 8 402pD@-P80080p@-@P 80 0R@ pP0@pCp@-@P 80 0R@ pP4@pxCp@-@P \0 0R@ p`P00S@#:p@(Cp@-P@%@pp@-P@80080p@p@-P@8@@@pp@-@P 0 0R`P40S ,0AT p@p@ 0  0O/m$Bd ,(\+aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@k@=@D D0D @0S//0 000 ,0S/&xAl +d*H +@*p@-@P H0 0R@ p`P8@2pP@A-@P1 0R`P#4P%80,0!qW&  P  P 1 ,0P < 0@ 40< AlAD D0D 0W/, ,0, (0W/? *( p%(0P D- ?o2 ^0S 0 Sg/>0S /p@-`P@bP (0S p p@ > > r=0 //@-JP0 0 pi( (O-IMP ; @T p `0 R 2/0 J\ P X @ 8/@0 p\PV @T!1 0 4003/X@ 8/Z JZ Z X" 000 R 2/0 J' P70S+ 03/P. Z :/ iJX 0 0(  0 0 Iߍ 0 0(  0 0( Z :/[ 0 03/X X0X 0(  (' '& && &&t &l&( l& &P0/O-MM(p@ ~T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT00 0=P $ 0R000 Mߍ0 000 ,0H D R000 x$$$# 0/0/@-@@A-PPMp`2 0S/ r@0U  UP 0/P B 0CU/PU  U0 0/Q B T!0C@T@!  r;@04D .00mr 0 S* ~rDp@  QV w0P@wPۍ|w?00@ۍS0cp `Hp p _w0P@X(# p@-R 0@S PR :   PpK0P  , 0`0` `0 9L0L L0 :}808 80 ;up! !!t !!T !p@-@Q PPpQp0@-S MP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPUt p 0QQ Px, ,0, 0 , `X  0S p@-P@ @Pp 0Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ 0 0@ B됶 #0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Q>p@c 0 0` Q뜵 0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P >p@  0 0| < pdcA-PP4 0Q ppXpW`*@P&  P <V`p p0 8/PP`<``Q# PP P 0S #P P PP@ @ P P 0 h -|d-p@-P@PP o Pt0@t@p {z011/A-\@`pP \1S 0 €  P 1DP1 `p P 0808 80 A$0$ $0 B$ <P` @-@^ P ^%QRS  T00_NQRS"  TŒ 00 0 0 Zh  G-@R00Q(MP P 0 ` p Pt p `nT0?o20S00(Ѝp`0 $p@- M`P@00n0 0n0 0n 0     SЍp0@- M0P@n n n000      S Ѝ0 0p@-Pb"!4Mb4# `@0n "44 0n "44 0n 0     QЍp0@- M0P@n 0b" b! n "440 |n0!$$       S Ѝ0p@-@P(MP`/ 0S, R00Cn$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 RM P0V00(Ѝp@ R 0S V00@- @rT00@-@4p00T000(@-@T @-@T000 000S/@-nT6x000 000S/@-n6x000 000S/@-n5x000 000S/@-n5x000 000S/@-nT5x000 000S/@-n5x000 000S/@-pn4x000 000S/@-`n4x000 000S/@-PnT4x000 000S/@-@n4x @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^ \#t001/,001/ 0 01/0S@-@1/00/T0T0p@-@ P`\ Pprpml2x/e000 000S-/@-m-1x@-+000 000S/@-m1xAo//- M0 05 Ѝvt- M( -Pp Ѝwt@Q-0 M Q Q q 0 Ѝ 0 Ѝt ^t ($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@p P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P_k8000 0@0 !0#2 /UUUU3333  ~0: S-x R Sd0 X Sb0?0 r - 0!=w- S W 9SL @Sx00 r - x 0 w -    RD R9 Rx 0 4 r-w- R6 R0 R& R x  00Rs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- - S0S t T A0a0-0O-bA@pP8 cP8  bpP% 00b` 0@T lP0=S AP` AT BX!  koncdb o00)hh"h2C-@`M 0PDH L0PT@g X`P ㈐@@@@@lpk pp lp` n{$P  {j{{Bp[ X0p 0S00R8@<@@@@40040&4&&0&bH1H000D0 00c&X  #Do0S Idp@ ]l Yl  Ѝ`oЍ @ o0 0 ?l 9l 5l(PO-pM`@hP-TPk +T@` 0Z ǿ 0 {i 0 siP !ʎ @00D \a0DSW0DA0DS70DWUX: QP S \ nP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0T W 0 p0@ 0` XR A B0A PR W p<< p`@Wp pꙙ\0BR"\0@-0 M@ 00 Ѝ0@I@PIn0T0P Ѝ0l#p@-BR"^p@5@P5n0T0PpO-pM`@hP-TPk +T@` 0Z ǿ 0 h 0 hP !ʎ @00D \a0DSW0DA0DS70DWUX: QP S \ mP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0T W 0 p0@ 0` XR A B0A PR W p<< p`@Wp pꙙ\0BR"\0@-0 M@ 00 Ѝ0@I@Pum0T0P Ѝ0 p@-BR"^p@5@Pam0T0PpO-MHP@0@Q@0U0B PR"S08h00404 40 ㅼ0hT00@T \ `G-P @p0#03w0q0W`@DT@! b 0 0R ! 0  P   Gg0 @pQP@-p Mp @`P sPP$ -{0 @p{`0 @P V Ѝg00@g0P@gPg0@Pg@|x0 0 XY ,$$0 -0 Xf ,0/o" A0 A/o"; A@-0M 0@4PЍ0 fQp@-@ ڠX00QUPQXp X00QUPX00Q1-R@ !0/A-pR P@a@T T 1 !03/pWG /p@-@PT 0p@/pA-`Qp@P RpP 0D00 00㼀p$`,@(P0Rg00A-P`p@PE 0U0" V W0 p`Pp`PxpP/ 0 0 00㼀@D $P,`(p0W pPpPV W |p|`p`lPP```T`TP`Pf00\\p@-@0`M1PS ,0S a$0S a pЍp0@-S @W0 P @0P g0 0001 1 00Wmf 0 p@-@0`P1S ,0S Da$0S =a@ppp@-@uW00CS00 PsWp P--M  @Ѝ Ѝ/ -- M0 0? ЍЍ/0P0@-$M R P@0S#  S!`0  B0!  0 0$Ѝ00`L0 0 @ P 0S$  @ ,xP 4000S$/00//t@X hA-``!  8MPP 4 . <<  Q S  @2 [|`pU 0 0 40 30.8Ѝ @h`Up  [@@p pW bPX 0 L  @2 G`p(@p@ 4pLl- M> ЍC-!MM0`@!004041 04p0<801 pu@P 0 0 <8 303!ݍЍP d0 00@p-PP@T Cnt` 0 P8TtPWbP @T@ l(C-!MM  !0 Q00 P <( 040 x1@`tP@4p L1pt P4400 $ ( ,  0 0 pp~PP"@T Cnؐ` 0 P8TtPaP @T@0S  ~d L0 0 <8 30 !ݍЍ800~( @мO-@FM $ M4 ĝ嘤0ZTp0d40X (` 0F0d ;0P0S 0F PU 0 P(00F`P N$PvPq$BUh , Ph(9,7FP $/U ,+ 5Y "2 0 d4 30Fލ Ѝp 0P1`PPaP KaP: / qP@ @U  =`W= WI !00 0 `0 R0 IPtt=0$0SP / q@!0 P  n000!10 ` `000 00 ` R0 9l || p 8Xp (p Po 0o o n @-@,,1M0 `Pp 000 cT T( Oc/00@ 0 0 0 30+Ѝ0U000 @r@P00oP "448#800U0Pc0@c@ @ O-GM M & 06 ĝ$,08@0t40X`4(@0p`uP0I@ @P@ᠵ p 5P`0pp00 u@P!  Pfb00S! b0=S0`S"`V`X`V `ሀ\Pb0#S PU w000C00Cb0 @p00000P4ZrPb @8P0p00000 4FrP 3 # X# X0S000C00  040PPg0pt#h`0  ] ]0X045H@PP?bH0 0Pڶ5 (0pC -'Y0q0Se Sc P\  P\ $P\  Po4 R1"1 0 t4 30oGލ Ѝ0@a 0z @ 040040 S  P 0pW 0 00004  `zqP4 P0 PHa0S ,00pl-` 4x,H  lC-PP!`L1 Ƞ0,̠TM4!0L00,8@#8 pptx00000 00  $(G{P!Q ,|W0 p!@"{` P0 0 L0 30 TЍ@{@ ໸ P\@-MЍO-`!p1 Ƞ0,̠\MČ!0T004 8P#8 @ ㈐倀儠0000 0  $(,0zP80Q ,  W4P 0S 0 @z 0 0 T0 30\ЍpR0  @@z@ ,: @@<-M}ЍO-M $4 002000Gog0 0-0P MPh 1 S S   t#@ h# S`  000 S ST S0 R R R R B RQ@  BQRS 0S1 @+S7 -S[QUp @Un0S 0S 0  00_op`R0+S4 -SF B]PPUpwV WPR Pp S 0QUp @U40S\ QO 0 P000+S_opR0S @S0 =PP `_opR0S @S!0 )PP`  G_op`RU8 0 0 2 30ߍ\PPpPp p~ S!@B} y dPRt"O-`l2 0dŸMM080 0y@P6N 0AM.0 ;PY 0SV ܀ +U+wHR 0  0 d 0P @P3H0: S4 d10`! 6   pmvmzܼNSflp'jep`"` ek`(g|d{dL`P)a[`dk0 P%hnPbk*@`nKbk&[l[<`@'i@lKLD.fi`kjK(@nᏴa`ˌjK$n @%g a, dM`bKh &8bh  j jl͠Ꮴiˌf$n .f!e+i "  adhd  d)h hb-Ꮴg+n,n  )g p苠Tf`! `)f `Dg|Ꮴe{n"l )e PfjLdka( a)d @He]Ꮴn[n'b )n 8X叔nMl`Klˉh& h)` h0a a;f$%f!g `0)ah@ h3eib *b` +g+@bˌ`d ,0ln hf,fkg p$Dixe{`!,*e P`Xm]n[dkdKeˌa(,@dJT`KDb h nˌ (h& L, gi*i ibL 4d+ˠaˌ, f+$a "i  b*e h 8n` g (d+, g "!8p P-ef+h{fk(pa{pl{(p'i[pPP%gyd{hk" P,`&h `H`KeZfmn[lk@lˊ0n@$f @,MHiKhgdb') iah ,( g&) d$lʠ陠`ˌbb+Tli <(e` * ꩠa\f( !0<\ ag{h$gd+ " b)e+e;b[h)!f`b aakl   0d `,@i;'0#0j8h;. @nb+lcK nK " @g!$@,ɠiˌ(@a# !` gc;,-j+lˎ0# 0  j 7d P0j;`] `PtЍG-`pQ ?P10@@e T0 U?W@@P@@PW*TP(@T(pG  GfI  bIPe W*0@-@ 1M?0 P @ cR c B T 0E ",  Q"$  D 80 0 0 30` Ѝ0@Mȣ Q0* 00 R;* xB@-d @4  R  *4 8/ᔃ x0 S\ R `0S Р@- d@ 4 *8/,H{xB /, :#( /$&:0/--M  Ѝ Ѝ/0  0c3 <c.A-Mp 0 `P!@ 0pp pP R{0,pp{ pD H{0,pp{ p8 >{0,pp{ p' R /? 0p  ABQ \1!P{̠0+{ p`Ѝ`M0 Ss  @-@!1 M0 MP `080p p ~CP3 * 0 0 8 30!ލ Ѝ">p pPT ]CP* @D0*@"6MLHtHlbp@-+,@@PPpL0PpdC-P8AlM@0SE pP< @I` I 0 ``(xI@@P"@mI`pgI 0``(`I@ @ P @@TIQIlЍlЍ'+hh@B@- M PStqt1p`@PP@@T 0Q P Ѝ$ SP @ Ѝ@ SP"0S- -S?@0 0000 ` O V RP +R@@D!0DSX [SP0S +S!@?@!@܀xld,X ?P L0P00 1 R/@P/!R/0@>S 00 00//x@-M `P @,IppPU0D>S 0!3100 0IЍ>SH 0!3100K00K00(/-p@-MP@U@0 ` ` jPx0x 08 R;0Ѝp@Ѝ/0 a0C( ( LHd|}ccc@-=Q@B 8XA^^14/.-,+*)('&%$#" R"  @  +S@ -S =S  +AR@00RD - ++   @      0RuS/WS^0@-X0CSMF <0 à 0R ^ @@PSPQP@^  0  0 uS0WS+S -S00T0 0 +S -S/0 0 I@O-LM0wSp 8@0 (P(0,00040*( 0 0J @ BJ@Th87 `0p00000  0a0GSX$ $00+W@ 0-S.=W000 0P @X B R d \VS  "=W  R   P:0$`4J@ wB,J R "@$`0   Y 0 S:$`J@ pWB J0S 0"0C$`0 X  X  pW ,WypPZS  Z0$`IP $,BI R "@$`0  4 =Wp Y+0G?o20S Zj 0X0 00X00 Z$`I PAI0Si "2@$` 0T 000 - HR;)I?'I0%0# HR<II @u00S@9~I0"SW  T3* 0 S@*- + x  @ LЍ'pC=W   "00$`XI P$API0S  "2@$` DI00AI0@%!!!0C!0T!"@0$AO#`00(0 0,00?!4! 0P!T! !T$/ !.P !0 AP00010`00Pd00@t0Pd00 $E@  R$@:8 威4(0AP `0A0儀H,0 P0 0P1P1P/ GzG8Q(\)\0f,  DdSQcO-䁟M  0Q:Pl @ T* QT0 T P# 0 ^] S^ЍP@ T XQT T@4T?^  QT0 0@`PV@ @@@@# @V @Pp0VpP@`0V 0QVQp#P W  0`@(V*?[!]-D@-M@0@0M040K00S0 0@ $03/L D0 0 4 30ۍЍ@T|{G-@` ``a V00"5FpPP6 GP@ 0S? 0 R0CÐ@P0 T  00S0 0  0  ! Y*o`@TP Y !CC00|şO-pt MMM㰰TD0`C05T0$0&*0U@@ R R 40B?o2 00⃰0S U0 S0E0 *0Sw0000Sft0+09 0@ 03/0S| 0@(4$ 0000,00F$0(@03/P   0S00*  0.S @T00SV:0S 0S , P8 * R  ]P $0DQ/ 310 D1 0 (0P00 0S  0 P80: S 0" $2 MލЍ0S} 0   000S0z P@T  00S0iC4/P 0 0Df00m0   0C x 0.Su0S` 0.So\ Ru  @% 03/0  00.SI X P D0 ?P8 @-  2/0B 0@ 03/B0Sv 0 dBQB0/ 0 0@ 03/0vBsB0yy*<LwO-`p\" KMM\ؔܤ $ 2 /\@ P@`\/\P  `W!1 0 4 30eKލЍV6/\W/ W0 /\ \@P P`P 0   R  = T/R  * R& R 0 0 0  0& R @  (03/0S0: SW/00ā00āQC0{A/0`0`0 p<P$ 0S %P @ 0SL>0SЍt `p  0@S0 04 0  0Sx t倄倔p 0fS0fS 000#3R0 4$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 &;P 000#3R0 p# 000 ;P 000#3R0 # 000 :P( 000#3R05 " 000 0#S 20@ R@@?+P00Ѝ0 S S\ :P 000#3R0 " 0@00q  :P  :P2 000#3R0) ! 0 00T 000#3R0 ! 000ElP Xz0@S0 @  u:P =Q*  0P00 c:P =Q*  0P0 0 0 0@0 ු6c6665TGXG\GT54444333$E 3DD2p2C$ C1C1h1H B@Cp@-PT,:P h@T$PPP 00pXB0A@-,@@Pn00<0O-@80MpQ000p8Rp0W` 0TPz < &.p005 [V P<U (8 0 0 30Ѝ hs?0t0h 㸨p X C7 3UP 2f11 00'0(00pV' A0( ,0<p PpP<<000S[ F<0'0@'@@<@Z 04 9<00'p PtZpR '0BQ #S X BQ #S Y BQ #S ^ BQ #S [ BQ #Sz Z BQ #S Q BQ #S  P BQ #S  O BQ #S% T BQ #S@ U BQ #S6 V BQ #S, W BQ #S% L BQ #S M BQ #S N BQ #S S:U 0'0S" R! B 0 P 000'0  0'0 D  PS0*'Z +p0S ; 0'0'`;`W 0 X[ v;0'0p'@p;@p, 0; @k  ,# 00  "   2000'0"   2000'00'0tp0840@ 0@08040uH  P;00Sr[t+:o;00k 6n  'h '_0`000`0 0SpC ` pG w0'0E0 :0SpY00B[) 0S0 `  ')p+`00C0Q  r'ppp#[_ V;0;0N]\p\`<P$;@l;7::9-0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFpP P Ѝp'&A-A`@0S)@@Q0,pPpPR )@ P p0 @BA QA3M@  p0 p0 x&d&D&@&p@-p`pP`P@T T0T0 R@@pP00ld%D%@A-`P@P@p0S |@@4 R"@`4@uP0090@$$@-G 0 0 $C-`4MP+@P 0S|0V ! EUpЍ ℩0P;  =R6 0Q*G B&R&>$#"M = -RpY WꘀqꈀvKSБp֐0X{FHʐ 05P 6##44|4tOK6@43445O-BMM00  5 u %0p 0 0 $ 000 0000+0 ቐP 40 4N"P P@\ P 0S l400#S \ P 0S 4d44`0`\ P 0S d4`0`\ P 0S 3 0   \ {0P 0S 'd30\ n0P 0S d`30X3PE0 +.@@3 0`0P\ S@P 0S K3PP[[ 5P200xS0xS0Se "`2 0 4 30BލЍlR@P\ Pq 0S @200#SF \ P 0S 2R0P\ PX 0S 100xS0xS0S# 10 0sS'0wS$0!S |1|Q0P \ 0P 0S cH10\ 0P 0S xc10 ! 10P 0 $0000 0000P 5P3DN!!  $  X  tK, t4  \(L/ (/0/p@-d@@0S P Hp@P@P 49P ౦p-|/ p@- P@P0 $S ᶏpPP4P UPp@`@` P$pP04-. p@- P@P0 $S ቏pPP4P (Pp@`@`P$Xp|,.h p@-0\PP 4P ^p<`<`P@7p,- @-@@P00tO-S,$M0M 60@`PpU 0C   500 0?SN Sl *S 00 *Q @R50*QLU 00  *QA[SU \S0  0 @ Q8 $Ѝ?[ [2 *[  @[[ \[0S @@0S /Sy .Syw 0W r 0W/So.Z^ Q /Q $pP  /P P$ЍQ /QU 300000  ^[![000  00 @ pp /S \S? S -RF P0 U@ ᱠ0]S^0 p Sv tj p, 0Wl  0W/Sfdp @^`2U0/00 /WU0@  0U ᾠ]QQ \Q  @P PӥU@  Q$ @@  0\ @ 8!  p[Q @ P0 @0 C0 0p`@0U0  Z 0 P/ZY  /#Q /Qk 0000EP@0kP@-@ P a5 0 Q 8Q ?o2c 8%$%p@-@lP2P X}2P T00pT 00p.5 0 p$$O-Mp! 0 "  @һp` P 10230Y ߍ萿PT 0 ᳻pI  ㄿP: [ ;` 0 0P P) @@ 0  ᝻p@ 0 ႻP0P S P /"> 0 "C 0 }p@4 -R*>@>O-Mp! 0 "  @Jp` P qo10230Y ߍ PT 0 +pI  P: [ ;` 0 0P gP) @@ 0  p@ 0 P0P S P (/"> 0 "C 0 p@.4 -R<,<O-Mp! 0 "  @ºp` P 10230Y ߍ膾PT 0 ᣺pI  zP: [ ;` 0 0P P) @@ 0  ፺p@ 0 rP0P S P ."> 0 "C 0 mp@3 -R t::p@-`H@P@ ePpPpPP D p@-`H@P@ PpPpPԹP p@-`H@P@ APpPpPP ꌯ 0 00 E\7-H- M0 S0 00 0 0 0 00\100M \0    R8 00 0 0 30KH Ѝ/$76-H- M0 S0 00 0 0 0 00\100M \0    R 8 00 0 0 30KH Ѝ/Y865 -- M0 0'--M  --M  A-`hpQpP @Q ݾPD@(0 0000A%^50P R   0//ǟ7 O- 0S0 a+0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!Tl00p\@@PT B+08@@0/S(@@ @@tH4A-MP@+L0PB @!0C `0 00   ! 0b0C S/:-,+*/('&/$+`00 0z0S@p 0S 0S00"S $7# Ѝ T1r0:/00Ѝ+P ص@-@P1 0S* *@T. 0T)  /Q0C T !@# *0P@/S 0 B@T@!p0 0*  TD@8@0/S @ -0DM 000p 800S DЍp@-`P p' P@ p V U ph:UX Op` +(%VU@@pQ?o 0?oA-@c^?c%^& ^ P@5$&pc`c&0gCh5(5D0c1c  1./ "0;:(0C0 /0 @- /(0  +C0 @ 7+C 0/0E0E0C00 {+C$0 G{6+C{7 Q/0E0E0C /0P!Qo oC-@@`T?`(T) T `P6&`p`3x@y66U`1p1 000? 1?1>4!50;:(@000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J@ @-p A J{@ @-xp JE@ @-Bp J:@ @-7pPP `F@-U.00 7p@-P@` 5Ppp@-P@ 5Ppp@-P@`D 5Ppp@-MPP`V ҹ@T |00)Ѝp 0 : rp@`$ ijm 00 R ܺ; ,@-'.00 0S@迴tA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BPPX `( @4PPY  8@-P@, $1M`00\7 00@|p\ 00#30#^0#02S000R0@ | l0 0 2 30ߍ[pP @@ @(@$f h O-P`~lIHGbE\CBTIC^1\.$876543  -*S$a"MqX(P000@ 000@(P00,= 0 0hWP(P<Ѝ P 0 R R 000   /#b!!"A̟ K/" bP3:bQ#3|,  P\,  !P0 00 00 0 %0H 0?3c112A +K?##+cR 3:+cR # 3 00 0010!00C0 0 0@ l˟v. r00aRaa1B0"B 10#/A!b!b0C 0#/A!b!b0C0l0 @P$`h08P `C  Xh @&  P3P0 @$`PW(PK 00 0/0 @P$`0 `C X? @&  P2P0 @$`PW(P( 00 0  0 P( 00 0UꞵzX(P  0 GS(  +S -S0p000  䂐ಐP:R W (  2c2c2(S \0c$00P 0(0[ 50 ,P(U0X0,0(000@ 000@(W(P000<&0 P w2P 1& P m2PP 0(P 0  R,0W0!0 0 ,0 c0,_0S,0111v>C 0C,0P(  h /"b!!A0,0 W0v 00 000XWn 0  60 SP(5 0 0 0GW] 0%P(0PW%S(PNd6 ,0 X6,,0 v>C 0CW0P(= 00 0!0W045 0 0P( 0, ,0!/A!b!b0C 0P(  0 B0 SmP(PW p 50 ,P(W 08 0 0W  =0 P( WWpn ;0 P 0 0p S 00W((Ph 0 P(]c0 ,0SP( 00$0?2c1, 11,0 02 0 0 000 0 ,, j,0 0C0P(H 00 000 p3 ,, T,0 0CW0P(~ 00 0b c0 ,CP(Z(P000\Wi 0 0 0. 0 +P(0 X 0 Sj 0s< p 0 00|bv 06@p@00dRBnnA1AA@0@10cK@Dnn0C@0c0lN``0C 000C 0  PUS ZSP @  0 0$0H1P0(0v R0Y  R0O P,A00?3c112A  K?#|cQ:t cR # 3 00 001 01 B00,0DSd0,00)\P(\ ף<  X $IQl'dn`, Q0 40N0 S0(0@0PpQ_"pG@Iw  W@p 0 40N Q@(0SP` 0(P0 0V(PP @ ACLC  \^JS S  00#3P0z z H(/o"ZPzX7ETQ(P8 pp@+CP("'0p[10 B0,Pp# (' PH!/"b!C;R, a2ba12MP P(P @ @0C2c2c2P$00( (0k00 @ 0 @,0@0S} 00@y0S 0@r s0p,0 0 0P , P(01(000C.$0'3000c^\0M0c @$`PM @$`Pl  0P , qP(00(000C.$00 0$ p  k0P& $,   P b((0$ 00M 00Ѝx |1A-0QHPP P M@M Q%L10 P1$8,@@ Pp . R! v Pp `劵U  Ѝ0 P0  P La@ p `iU'T 0 ЍH "'00x *gfff`@-0M@ ⬱0P 00Ѝ@-0M@⻱0P x00Ѝ@-阱P@l<p@-P 0 00M@`0,00  P00Q Q Q [' 0 l d0 0 ,0 300ЍpD Ხ4 ᭮$ ᨮlt,t,t,0@P/ P @/G-X# p`!V@P0PES  R  D 0PEV R  SS0@0D@R@- 0BAs @Q 0CR &@O-` M( VP? @P>  pP9 !001Sp Y} Ѝ00P@wP 0 0P `0 0 !=00 !&00Q@-RQM @PЍTT &@㊲Ѝ}& 00O-`!p1- 0M M050d1dPKP @WpB @\;X0 ^00ptB0< O}00 T> /qύˠ@,0  (@P X Px d0 0 5 30 ݍ Ѝ&00@&00<$$0 M000 ЍD--M  Ѝ Ѝ/ -- M0 0t ЍЍ/O-R M @p` R00?o00P @ P 00 P ! !  3d1XP5  YVP W9 V[XP0Ppp`0 0`f0`` 0 00 Ѝ`&pP% Pu0XPC0 P P00 Ѝ pP V pP `\@-@ M(0S2 X0 `(0` 1/qp0Pp)  0 0 PUR <0PUu ЍPPTp 0S  0CP`&%00PpW@-P MG(0S: 0 "p(0p 1/qp0@`/  0 0 @ToR <0@To-1`V ЍP@T` 0S  0C@o$T00$00 0 R/p@- @Tp0 Rp 0R00 ᣱ P 0S P0噱 0c0(唱 0P0 叱0 S,P 4P 8P ~p@{eEp@-P$@@ቱJp@肱괟@- @@{J@u|xp@-,PPn K@gpHD1!0A-M P@00S `  0 XR0` ` S= p6( V80CS70H0 S0QT.*@DT*T( D0 0QV   "Q  T #R.S 0A a 0C "T #R Ѝp0@4  R  *4 8/ 0X\S 040:8 R РS /,QxB@-Pp`P@P@0@D尀 UU  o {<,x@-P`@#0 p@- h` \\\%p \!00p@P\ ckVmmsTICt70000E00pH00 Z00p#T00 00`;T cQƟF @dQ 1^01 0SS100S0dQ U60100 T =Tr T 0@0060000  i 7@DLDL000B@00DS0100C0y T T 00n 50000  J70D0 0]00X%0 0   ? 00D 009 004 00/00*cQPcdQ{B0@DLDL00D00<00D  0W0C3T  l0=A-@R`P 0So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@00@10 03/P(!p0 $@0V0 p00 R (00 0P3/P" Up   R  SVp 0SޫP00 0U XЏPG-@P P`P (rp^u F 00\c<!"#b!0CaqV; Y 0pPY` $00100S p `1003/P00H 0 $0,100S100S& 3/!p 000``0S 000S( 3/000(:P`0003/P 0 p 0000S\AP00}00/>3Tp,(=G-@P PD`P $rp ^t F 00\c<!#b!b0CaqV; Y pPY` $00100S p `1003/P00H 0 $0,100S100S& 3/!p 000``0S 000S( 3/000(㜩P`0003/P 0 p 000$0S㣪P0 $0~00xDD,SR: G-P000pS` 3/0Y @IOP T0 0 0 0 Y @IOP TT0 0 H H0 0p`P   /p@\SR; G-P000pS` 3/00 Y @IP c T0 0 0 0  Y @IP P TT0 0 H H0 0p` P $  /ԇP <O-PPM M Q@ \ /\C  Py P8p/\ @ @. D\m `P /RR.\' B Rm/0 F 0P PE00 bPpE 0: S 9S0/\0Sy@/\` FQ .PQZ 0t/S0W0OʨP ! uPO   RB  (/\p @` @᫪ލ Ѝ.00Z 0/ ލ Ѝ @ Z 0/ ?    0P @X00 @>00 @?00 @00 @0000p@-@P Q \Pp`\Pw0@P MP`V c0"S Fp[00p@p@- PHaM`=  4QP00ا P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0   0 @\(P/:P-0SP S:R S 0@S0S S P:P@P :R0P:P 00/@-0@A R R:\|\00\0S Q0A|R  :RRO-M M '07 pĝ 00D40t4!S SP G@`V 0P0  pP 00S D P R'(' 0 00 PM0F0P000xP ` [0@`0 S ZK :SP\ \S S SP0TD*[0+ P 0`0 SZBUP@0#SS ZP5P00S@0N0SD0AT0:p%5 0 D4 30Cݍ Ѝ:SU @0T:H@DP$ @pP@DU  00 0 Sg00@ cpP  ت4@00@S0 4000040 p$0(,P= Pv 0:RL pR0t4@00 0$< G<4`P pcPX pI 0:R2 PR0 0E`F00S:S:00` F0HZ#0 D 0  ^ 0 @CzPp`Sj 00DcR p CP H @DIpG_P @ p :00`00000 0(S,P p& 0`S `#0 SRD (0@ #@00P  P1@P 040<4`080 p0 7/p P 0S00S\S00 R8AP 0S7\S5 00S1 :S000 0 S4S[ A 00S :S|S@0@ A@>0S'h!<1 0 8 30E ލ Ѝ Z @P 0 0 C1 0 Y P @P Y @@PP P P @0 0   0KP 50 0Pp 4 @m ܵ|Xش̹dxp@-@H`P` 0S 0 0$0 0p@   꼱A-`= b@P dPP 0:SS  pd \S @+ Q0P 0:SS ^S0S:S 0Q0@PP@d;P{ 0P:SSpdQ0@@A0]p0S:S 0C^7B C@2RIFB?5/A)&"! 0@ 0 BT1 0 BR0 0 0 0~0|:0z0xPʤpPᤥ 0n@ @ᙥ@ 00A-`= PP6 d4@P8 0S:S  pd%0:SS   \0@@AdᓤP @pd0 \CPAp@ၤpP[P PRPg 00p@-@# eP 00S 00XS  @<,00A ^aPAU70AAAW0A^RppO- AM M0p|#Sx3 00(0 0I @`/044 PPN 8P0D 8T  000CS3%10/.-x+*)(&%$#"! 㺝 㶝| 㱝0:S 84Sr0S008"$2 0 (0 30| K  P* 0B.KS:S B000$ 8T S%̡ 440<4 0 S BKJ ; $0I4$ /04I<4 $0C 0$CTB>K0CP 04 8 0S:S X< H R0 0  Q!000@M P04@@0e o0:S r 00UOP}K0 S:S008$ 0S:S00ڿ0 <$P0 00 4-H-M0 S0 00 0 0 @0  00^100M ^0@    RL00 @ 00 0 0 30KH Ѝ/ᆿX4@-@$@@00l`O-P"2 @`0,M0$00㷤d20 R\ 00@`pR 0 @P Z p rP p J  0J0PP0 S#: % U10 r 1$4S1$!@00 P;P0S "<100S (!0 0 $0 306 ,Ѝ U r pP Р P 5SX0(, VT00#    PP  P0S=9ƾDih($4? @-;(@M@@00?PЍȤ  { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T P0 0# 00Ѝ 0Ѝ-$M0 00 0oP$Ѝ-$M0 00 0_P$Ѝ-M0 00 0 NЍ s z0r/C- 0 0sM@P010pX0^00pAtAR0O⎢!{0` >PPTA P{ %d 0  $@< 00 0 1 30sߍ追T4$$0 M000 ЍO-PM0?0p00301S01Z P   P0%%Z * 0S0 R $/? 0 3 305 ߍP0 P P0C S !000C 0 `0zSN~|{myxwvus1jh=(c_^\ `ZEU000P0C `0CPE 0SF0 0C0000 000Sv0  IY 񏐐q;$P0 !P 0P0CS0000 @ 0D SA*0r? R(0 ( 0I, $00 40A@Q>Do_] 0 S0 00 Y8 @@0  P @T0C0@0@  0SP 0 0 0@0 @0 0CP2 0S0 000$0$0S0 =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000- 0@C0 89T@!@r?(0@0 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0_000@T@03S XR[    ( 0>  0          00 0@0( 0CP000&   (   S@ @t& YʱY  P sP @0wP"  P 0 S0 0C0  S  P 00CS0@C 0 S0 w @$ 00S  P40SZ 00CS0400V 0YX $ @0 0ESZ  P 00CS0@I 0 S0 < @0ES$ PS{Z{ R0 00CS0@ 0 S0008 @+ D   BR @ X* @ j P 0 0CS0@L000 0XI $ +D AQ@ 0 R0 @ NT6 0TaAQ@> 0 R0 $@ XQ[AQ@  R @0 00K؞0? 0r?(0Y D    00S0P0SY, 00 0'0C@0@00<000jS001,`0 `DH@(0V: A P 0C =>J( ro 0  p P p p =>3PSu $0PS0000`FSVP Z,`XV $0S0 00 00;0l0<00000:0`09000꨾1 D1 , xl\" X  0    0 P P  +P  P0^Z``,40Z`I` 0&@0,(0=>0( #C0,`-QP ]QP @0J Q ,` 000 0  P 0 0C P0 SP 000;000;0000900000000n000090 00c0:0]00YrIT   B R, @ 0 R0 @$P 0 R0h @ X;"  R "  R1 XX B P R @$V$PI 0 SF 0iT nT  B R, @ 0Z0K @ R񏐚D" AR>  BR @ 0X0@ NR-  BR @ 0X0W $@(T  BR @ 0 R0@ )T  BR @ 0 R0 $J$0 S$@5*YY$ 00(0@T 0W020( @' la00 `500S @0S, 00 0<Ze  P 00CS0@| 0Y0  @e0SNP 0Z 0aP 0 S 00 p0 00Y 0+@ =. #RR @R  B   @ 009 @0=>03SS2 0@T0C0000@000& 0S]P @X A 00 000NP[ 0XX 0@+CP5 0 S2 0@@Q?5P' 0Y$ 0@ 3)P4 0 S1 0( 0 N _T?o20S0 0CS0@ 0 S000 ᶜ Pg 0C =>@H0J  r 0gpP P p ᮜP 0Y0CP  00S5000CS0400 0 S @0 _,0p `&  B R, @v 0 R0o 00 ( @<`00 P Z 0@00R,  $ ]R XZ Pp80$0 080P, 4` rO, <`T  P$0 0P(0080<$rZPQ 0 SN 0@POP 0X 0$@4CP: 0X7 0@8PE 0 SA$P P<,P 0 S4$4I2I/P) 0 S& 0 @0 P 0Y$$P P P 0 S 0@P 0 SX,` @ tTT+ @tZ$( S C@ SP 0 S 0 @000B :P $@P @- , $P; ,lP 0 S 0$ @ : 0S@!0@3ZL 0㿛PE 0P0 0Z> 0  0`H0`$0 & PD =>$0 BC  T 0 rٚp/ P ZP@D7 0ST`Z   @DDP0 T0C 0 p0S0P Y` 0@000 @/XZP@D`A-@P`pI0 PJ@-` MHP@p6<P  0 P3 Ѝ02pA-0| !P0@0S5 0`1S010e C000PP! pW@0P@ Ԙ`PQ 0 0 @0 C PC0000   Q  Q*RQ' @<08 0  BP0P00`0 P ; B #A ?#@ 0# B0 P@p@-@P ;rPp0 $<@-M@ 04/@PЍN @Ѝ\0\ 0@-M $̜0@4/@PЍ5 @Ѝ80@-$<M0  $@4/@P Ѝ @ Ѝdd0 @-M00$  $@4/@P Ѝ @ Ѝl0@-$<M0  (@4/@P Ѝ @ Ѝdd0 @-M00$  (@4/@P Ѝ @ Ѝ蘙0@-$<M0  4@4/@P Ѝ @ Ѝdd0 @-M00$  4@4/@P Ѝ @ ЍĘO-M@PD0Xp@ `$ 0SP  $,0  ;/0$  0H@ 4/@PЍd @Ѝ$ (@- @MЍ耗0 $<@-M8@ 04/@PЍ< @Ѝ\0\ 0@-M $̜08@4/@PЍ# @Ѝ@-Pp` t@t0@l@ ᢙU  Ἤ@0 $ ⏙;l,z0㹐O-M`@0 C 0P040 0 0p0ʿP0! B0 b8<B p  UQPE @4B 0L3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b 吗 P 00D0S0S0 S  \000!#300@ 00@00 @0`PUb*Ѝ@\ M00 R P- R@ ^^? 0 `0  OP 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`i강qA- Q@Pp` P=0D! D?o2]R0S h0$"0 !@1= 0 V V 0 P0 A0 A-P@p`xP .T Tl!0D1(0D,TS0 Ae_T (0$"0@ !1% I6| O-`'S7UM 0|0L106@001 0 y Pߔ0P0 rpה0P0 [00 x190 H@ U1 p00PU`p! X U0 1 #hP00? PP P5%0 >]PU`p0pGGq WP1 P! D`⊔pP, 0 000S V D0 G0CSax1  5* 0 0  Rx1  4' 0 0  Rx1 00x1 00x1 00x1 "00x1@\00x100x1 HP UG `xPUB 0 p9/P~00Pa_][#3 0 L1 30Uߍ 0S IP/3#0 \P 1d3d#d0 z\P 00! 0S 0 0S Y 0P0C$PP`O@@@P@T@O (  Zo*03> @8@47p0 Y ,0 2 @0 D0R4 $0pa[P`ZO* 0 $00S$0Pd|dxnfscuniop@-`HPp  @Pp'0@!"@p`@-M @~p 0: S  p  ]Ѝ00ЍO-`-$M$@@P P300;#;S@00V00S00 e00 @ ` @ p0 T0*܉0Gp@P ` 0  p P@D0S^ @Tz0 `I V*@0    T1 [ 0 @ZTg!@Pg V#: 10 001[ 0Z0 0P  0 S0S[ N `Kp0@ @P$0$Ѝ0 9000 00S0i0҇P   0!3pP| `- ` #ap@-P  @T @T0 0p  JO-@Q M0" `pbP [ P5@1 P1 5*P 6/P  00Y[ @D:P PU Ѝ/O-RLM<nQp. @<000@ $0\Pb 0P@0W`p000G<0  00p 0 `8/ PppZh* dℐ 0 `P `RP(0`4`p`,0 PV :/P  W X(,004`V1 011p1*`G0p 3/P00[ < 0G 0[  pW: pW0  [:p  K(08/(0P <0 0K00 p' R `P0S <0P p00[ ` pD000 S C00`` F Q0#03Q0SS (,`0P 48p Pp  8/ P0 0 PR` pp`8/ PY PW  0 S$0 S 0 U 0E 0CU0003  0  Y0 0 SY1:(,`0P 48p R$0S 0R0B 0C00000V  }<0 S8 ᎈLЍ<0 ` < <UM `0F0W 0 [  0  S`V0  0`S`h @p`@pP` W @W  8/ PP @pT `00 501 *p`p  8/ PPT: ` 0P S$0KS] 0U 0E0CU 00030R 0J0 C 0U 0U0PE P30 00@  Y01 ` @0PCUp  08/0 PP000UpIp a% 8/ P`pY0 P00 C 0U0U 0E 03 0@R0 0 0S*$PQ 0A0A0C 0R0 B 000C 0Q 0A000D@ 0PS 0pU0`0 P`FW4PdP `D  RPU @  h00- M0 00 Ѝp@-@ PU 00S  RQ Qpӄ0P{ P { 0pH0H 0 R@-@(*0(@$Rxp@-M @T TPT @TЍp0 Q 0QP ``F0` P 0 RЍpp@-M@P`0S$007000 0#  ܀P( p$ PQ# 0 00CR 0 U S R 0S$0Ѝp00`$0P0P 0 R@-@(嚆0(@ᓆPxA-p`@PP0 00S (}P   _(qr0Sn sP   La0S `(WX0ST`PDPx0@- M0!@ D 0 P墇p @Ѝ0@30 S/P\0P@- D  R4 _  N>h0P@-X  S H@ @B0( ( @oLN44X>3l0R0 @-@X@0 PQ 000^ N/MPT00@-01@UT0P 0 !03D3P00@-01@UT0P 0 !032X0@-@UTQP  0 0!02t2P00@-01@UT0P 0 !0T22000//|000/h00 0/T/@0P /0-@PQ@0/0P /0P /000S |0| 00 9/X0  \\ $0 /0lmNAD  A- `PV'Ep@0 Ï@hC12c` P@ R0d0d 00 1`(@@T0P10 `0_ N@p@-PD@@ Ȅ0S,000P p@ ⼄,G-ppp  P@`嫄 `FR0A0A10 0T;T! 0p000 0 ⊄?TTT&?  0p0@p0 0@]  B0B10< @` \| ld4x|G-@`0耟#䐟P #Qp@ PFR0@pG@A0A10  00 0UPQP H0&&```e8800A @ \p@-$@@ @PpB)O-p`⅁P% Q@0@PpWQ@Jp `X 0Paaǃ0O00pG.wTaX@Z_B 000 D.l@-,@@0@P0S@M-`@P@_}P(p0@aa⁃0O⽃00ZO.TTaXPB, ,0( 0  2,D`,0p@-05S PP0SZ sX@ 0CR\ڃp@T P VP@ȃ(,p,/0$0! 0/p@-@$PP $P p@p@-M$` P@0.'wP rP DDM00S 3/Ѝp003/ 2A-@M$P0Sp 0(`0p 0@0p$p<Pp0(04,00S 3/@Ѝ },0 0(p 3/pP 0S /A-M$P @0P 00 `pP zЍ00pO-pd"yM`\2 0(0108, PP} 1@Po 2 w20 RF p!1 $@  0 400|L0  00 0. $(p,`Z PP 80 03/``P"  ' !0 0 1 302yߍ         AdP P||1d``(d~U"`@,@ EE`>8 / .Ի .P00/ 0@- UM0H`0L10ϝp! 0H1Q|p@{P{0P`p  S 0$< ,0 0 L1 30Uߍ3 "=H=p@-M`PZ@@PЍp \P ZP ZP 00000 P<TO-(p,@PZP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV P``nc@P V@0SZ V@00 +G-`R p@P8/PPV @!1 G-@Q0MP`000Q UI U .00P!1 0 0 30ZЍ0p )P00 S0 0000 zPP 0 zPP z0SPUp!0T  zPp0p pP Pzp 0 P@᧹00 0zP"x:$:/ B/0  Q B  / 0R % B   %3 %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 P 00 0p/0S :p@-0C@0 P 00 0p/0S P@-@b" M0Cb! 0  00 0Ѝ/0S/p@-0C PM @`0 0b"!4Pb4#0 PЍp0 $000  / 00$0@)$)p@-P@hZP 0S S pp@[ZRYP p@LYp@-P@NZPp> ZP @ZP 0S S0YP p@*Yp0p@/p@-P@%ZPp >p@tZ ;Z0@- MP@YP Ѝ0ZP 0S00 Z'00000S /p@-P@XPpYP XP XP p@X0S S  /0S0/ R R   /0 / 0 / CR  0 / 00/ 00/ 00/0 0/ @-/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030< :TPE YPA 0S !1 0 3 30<ߍ(#@- R R  R pP& \ R p  ' 0S  a% 0 0 4 p  0,10  O-IM,M`X$@PPJ L4 p0I $000 0S S  $3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " "  J=00hc +4p# 4I8#8  ~ J- 0S K0S> S" UV J=00 v J=00Xe O<  mSP 0Sx %0SG0S  0S0s S0S J= UV 0  2b"!4b4#"R #< v<0I8 0hJ=000 P tJ- 0S.J=  0S) S LJ͍0 @1 0000:00G0 ,0 OP @(& 00SaLP P P J=00X0  RPjJ͍zPa Øh// 8 O-`$@4 0MQ@pDH 00020P0CS,I6)('&%$#"! E QWX00 R04 0S SYl#3 0 0 30Ѝl`30030H 0 D@pЍOyQWX00VTcWX/ "44 "8#8 e}pPNTL0S R "44!$$("( |"8#8 DL}PTVT008" 0  :} aX: P00Sj!0 $}T@@O 00~!0 }piT 1i #pYp \1\\ P0 pY@D 0   |T00? YK0pPP0 ppW@D 0`   |T00? D |P|Typ`X  |ꑗ*))t8'P$+,'*LO-`!p1 0IM0107 P@p/ <P PW PWD 0@S0h 0&h00a 00  0P 0 0 1 30!Iߍ [: 0VX 0S KP 0 a0 %$A-@ 0P`p0 { 0P qp@-MP` P@@P@T 0S  R0S QPP@PЍpIHPPЍpp@-Pn@tH$Hqp0. AAS0C .S .R Q P-S.S S /Q P_S /0@-S0GSC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ S 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0Sd10@- $M#B 0# A S0 0S  R lQ  hQR 0S0T000$Ѝ0 0S S0S'  R  R R R/S /0S S/@-&/ 0  00S S/ /0S//0S 0@-P M@P 0PoC@0S0S 0S Ѝ0/@-pQM @Q`P Q Ѝ0SS ЍS PP8#<48#8V R R p `000S S<0 W P 0  \# O-@"2M0`C @80:0 0TpP00 03/P 0@&< 00 SS&< 00  4 S R]  pWp@`0`Օ(448X#8E YC: 0,P0 PD0H (0 0C 0S`P00 03/P @MTJT`GTV `t40Se Z  &< 00 Sf&< 00S@v@P0J?o2X  RXJoᩒS@(0S:@p0pY<0$C$80D\8 Z^4 <0 C,0P0 0P,0(00(0"R= @$4 04 0 30xݍ<ЍS00H0Sf&< 00 Sh 0J'ZS@[ TKd:D0(`S,PG Zp 胟XP0 8Dxpp@0 vZ5 { 0 0{% % { $E {0000002P + "P!0P R R 0   `R vZVP 80LE0S. tS00ZP ZZZ4 !Z Z@u@P'JoᩒX00 S0J?o2/8200D00SD~vIS00V$0@00Q @ 180aRC`.@f@0.%pxZ0@@T@$S@@1p@ t100 R@PJ00 03/PA &Y 00 S9 @@p p,80RC.@*r&< 0@  00 %x 8(5$%0 5s (0S @ Dx4 @ R` RR400 0LR@P00  @ P |s`P )D L0R4  4 S Z 4S D00D` RPD0D0S 0R $ RZ $R 0`7O-`SM$04 0P0D105spP 1sP  $0  0MY80p00S0  Pw 000 UPs @@PY 0  DPSuQu@p#h3 0 D1 30Sߍ00Z00 R @TZ 0 .T0@T R@SO d! Sv*0 @ DD@Q0000 0000 AP.0=S} Q0SN SB SC 0S 0 +P0s[0Sb Q00tt @S @Rd! S1*.T 0  Po  HP @@`!1 0 0 30\Ѝ0 SRJ $@PF  0 x`P 000S P`PP@ 9s7sT  P X0 SR @P  0 A`P000S`` ˎPꝎ0 tP001\// p@-@PP@ rrTpO--Mp/0l?  0@P x8 020`  0p X 0S0S  p0 . "2 ߍ0S0SP;0S pW\>37 p p Q P .0 W 0S 0A\?o20 P00S0S  " p P 0P R   L" l1,P0S$d0 RSS 00 0 bpP < 00@(0p$pW97 g2 G520W0 0S   S  R  R Q ^  ^  \Q/o" SS RT0S 0   PxQu x+0 0Sn QRj 0pS\ %y0P,0V 前P , B  0 00PpW ,00 X,@4␯4  'iP1x00x0 n3@ppP @PP `0V 00`nT0`}nO-LM @``Q P@   `P00 PF p0p R R R0 T@0P p R ((0(  [P00 V pW Y 00 YppWV$@LЍTG-XM`@P pP @00   0前P 40S0- XЍ pP m  0lP m8<8 OP 4PPJ 0  O-M0A-.L RO-LMP `0 D@00p840 <0T 8 0  0%00#0(<  .  " xb*. ,\Hǂ@# @!p8Ha@@ 0"00#p0H<@@ ,  " p Gb*@ @!@@$$ @ǟG #!(p ǟa 0"00#,p 0ǟ<  $ 0p " b*!){G OpGp,XG4pǂ@@# !84Ga@@ 0"00#VP0p: mT0hV@Hp` J0S@@:p`F ATp@-P0M0`@ 0 00 !? 7R8 bx b   D 80 0 0 30X Ѝp@꺄  [ 0 \ŸG-T L2MH"0 P00  `p0 0\ @ 0 XS@@ ,B,R0C# T/ .0N ,B,R0.\'^V*00D!41 0 0 30DЍT   Aa B8 LR\P 0FS0 S S X0n(."4n4#0RP0@^*0^0 8< 4^*0 8<   - M\P ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0D꺃<  lW ,W A-p8!41 0rM@010`X0P^00pAtA h0OHh00TA Ό 00 LeP" 0 opP 0@gP d X0 0 1 30 rߍP g00 0P0c B $$0 M000 Ѝ  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/ @-$M@| |P|0p  P  @p @X@`V $Ѝ ,XX1 @- 0M`!000ap P@ *  ap g`@ 0 0 0 30*ЍY`PpW @@T PU 0SP@AT>00@8700굂< i 0p@-P@0 0p0 g(0P g(P,Pg 0\0PP 0P 00,,hP 00p0h 0@-@ 0 0o 0 0 0 厓 0 0 00@-P M @0f 00P 0 >?o2 c0 Ѝ0 2 00 0p@-@P 0U0 0pp@-@Pf0PPf(0Pf(P,PpG-P0Pm `Pf 0@00 S S0 S S tpPU 00  pZ8#<48#808 (@P q0p00S S S@ 0A S  A0 !@P 0S 0000VeP   dP;0@~6@,dO-P Mp@,0(Sz: (T^  0 T0U 00SQ 0 RK@D@T0`F 00SB000 @D@DS `+ T0W  0!0J@0`H 00S#0AS00  0S000   0S& p0@e0ppe(0pe(p,p@ ЍdP  (,@(}0  Ѝ0 00@- M@P  0s P  Ѝ0 0$  0$0 mP Ѝ0:p 0$0$ . Ѝ0O-LM`U@P$`0 @@fPH$bpPD 0 @@fP9$PPW* 0`Q QD QR Q( 0S:00S| bbP  `000 @ p R  R/ RY R 0 @T: pd 0J[0J 0 LЍ   @QA@ 0S`:   (⼐띀0 0  ,00p   04`0W G   ``` @` `@T: 0d00d `^ \LQ  QA@ \W ^ Q\ @ , p0  S QARU  R  PP@T( Q  A X " X. X4 p X@  P@T):<X X X 0` `p  `  Q@` ``  `p`cZhK cE^'QO- Mnp P`ᣱPe<}a00 00@`    $$Z0 X(0,3(``-`P pZ # 3X(00, "(`` -0P p`QK`a!`Q0#03U0S Q:PQ Y7X ЍX103!0# 0 tc@ Ѝ000X; S81`3 `#S41`F2s2`Fs1`FS`FP0h `F`04:0;`0Y S81`3 `#S41`F2s2`Fs1`FS`FP0i `F`00809```E @-pM#\p& @]p) `0v0 0 0 @厺P \u `00 P Ѝ[] \ 00\t / p@-\ ,@\ \ Q :\ :Ap00p00A-@$MPI P0( S 42 p|:pB8@87 N8nj;p$`137<Ǡ  B-0@ NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0 0 0@-S@ 3/@bbO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ 3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr `  P 0 p 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z  Z Z 0 00  0 0 p 0`Z$Z7 Z3 Z5 0 p 0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[Pp`@p`D0|0x0t0l0h0dy70? < < hD1p@- 0@P0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDL ; ʚ; ; @-M@0$!l!L1 !1AL PPU  0R4008 05_`1S   ;`1S0 R0 0 PJ0 0 P7P P P$0 0 P0 0 P0 0 P0 0 |P0 0 qP`1SxYz < Pp0pW  0R  0^pW 0pW  0Rx  0^pWf 0pWa  0R0 ,0^pWGpWD 0 PS00 s^`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 l001p0 a001p0 V001p0 Kxx1p0 A[w^L ^tЍ tЍ 0 &10 0  0 0   00 x0 ꨭ HL ( ԟD< ĜlDȜܜ|\< @-`0 AM0M@p 0 40 0 "8PP0S sD 80 0 4 30AލЍ..jw\  0,@- M@ pp P7`PP 0S@  Ѝ00S.S 0S Ѝ$ip@-Px AM p00 ` $ 0 @P  8 ,0 0 4 30Aލpw  0p@-S@` P0 @S ZPV 00pV00p@-@ M`p PU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp 0@- MP0@0@0@T  0U Ѝ0l00 PU:H@@ Ѝ08800 P@ Ѝ0 hLQp@-`M x00<@P 0PU  0VЍp_40P0 `Ѝp @@4  0@- MPa0@0@=@T  0U Ѝ0p00 PwU:L@@ Ѝ0<00@00 0Pf Ѝ0蔖  <ؔ0@-@ M+ T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P0( @T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPĕ8< d\xԓ̓0@- MP O@P Ѝ0 0( 0P Ѝ0D0@- MPfh0h@0@B>@T  0U Ѝ0O,0@0 P{ Ѝ0訒 0Mp@-@ML ` 0 Q0PP@0<00 00. \T @D  [000T H0 0 <0 30 @Ѝp@Ѝ/.0 T.t묜 ̒< O-PM@PP ;  pb`^0 Q ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'<&( 0'4 0'(0 ` p0R0`a 0 T @ P  S#3@ P 0RQ  S # 3!# 0T4 0 T @ \  S#3@ \ 0RP  S # 3 # 0T0 0N 0L0 000J 00  0;괛 O-Q dM0 R 8 $ Č(Ȍ , 0̌ 0 0    $  WPS ЍpC-`@P@ MPpOP @U _VP@ W @ Ѝ 4@P@p0 0000  P 0S0Y@OoB@#ꀈ  C-`@P@ MPpx@P @U VP@ W @ Ѝ @P@p0 0000 P; 0S0Y@OoB@#l d p@-@P00CS0 S  P 0` PۺpX`0 0CS0S P 0 /X0@-M@Q0 0᧺00 !R !eP᥺Ѝ0p@-  0S0@0Q R  004S Ppl@0QR Q    R AQ 갏 Lp@-@@P@0P`0pp 00,p@X0'괎 L,D D0 p@-@`P0pp0,p@` LHH0 A-@pP0`p0 A LC-P0 M0`pqp@ HD@ <80  "@Ѝ ~2ꬍ LxC-Pp0  M0`pGp@ (0  Y@ Ѝ \2 L0 0 /ᄌ L0 0 /d L 0 0 M ЍD LXA-pP0 M0@P` p 0 pЍ L0 00M0Ѝꬋ LxC-Pp0  M0`pp@ (0  @ Ѝ 1x LC-Px0 M0`pp@ 400  @Ѝ 1 L<@- @  $M0 Ѝh LH0H 0p@-@0pP p@ 1p L,,0 ( M00 0Ѝĉ Lt R) p@-P`@V iP 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M(@,`P p 00PD0 R  P R7@ 0 0 B0 000 0ЍW Q\.Q Q. 0 .Q ^ ^ 0X00p@-P0S@` 10 0C0p< 0 pO-p@M`P@P*W2*00V-:Y `* 00 p pZ+ ᥴ `0 P P0  0P000000Ѝ`<0 PFЍ p `LbXLLaA-RPp`@0ASAA0 0SA0q00C0 <0 eP00`pO-MMP/$0? 8<0-0 00=0==0p>0?͍0,0= 00 0P08  L@ H 0` P+ 0S@ P0⯭40PH0 0@ 0Ps0(0-0 <H 0(@Pd00H= K$0 }0D0l>x0d   00 PD0( 0LP;VV 0FS`AO^/`s,~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!   0P3 R 0S .S 0S 0S00S.S9@0W) 9d 0 @ 0 P 0D 0 ScD0C494.800$400000 0 y 0CSPI(00p`@0 H5Z@$`p @D0  zP(0Ssʔ0 oP0 0`PX8000#80D8, 000.0   .00Q$0 A FP0 0Y0D:0@ H;C'|7 0  0 30 ݍЍ|7VW{l7@0h`7W0@e P' dP0⯭40H000 0P@o0 x0P(0e6000#80P0寭40H0 0 0PO04 0<08 BPD0H[@0EW -@0d D;06 0P 0  P)4 0<8 B cP H[40@ C=0;@+A0W 10"3$ 0;A0000;A0200;A4;+A0W$1 00;A%>A C5;}W 5@0#@  0P34 0<8 BkP(0DK 0T*uPp\| `$PP 0(Vo  R @0 Y$ 0d  0  P@T0P`*0@t&DK106Y 0zP@   t6!?C0 S 0dP4 0<8 BP0Dk 0PCUQnP@p@Te1 W2 j0d  U 0  5PW  7@0r40<8`P@C 0PP 0 Py 0  PqL 0 Pi0D[ 0@CT 80BW 008d 0  0 PO`Vf@DK# 1RP0 `@0000=pH[0 0"- VDKP0G0H[ 0S@  0 P0W` )`0d D;9 0 P 0  P40<8p@C 0 5P4  0 P 0  %PH[WX )@):@@02 D ` 0 cP  0 w@P[ [@P 0 DKPpP 0 bPa @ 0 DK=P 0 QP0P 0D; 0 *P4 0<8 B P>4 p0<8 BpPw  0  Po0lDK`%)PD[0d   0  PY)PD[0d   0  PG(P (` (<@0d ` DK 0  P.H[4 @0<8 B@dP!\  0 PPDK( 0@(H[( h/ǹPW0S W M0@d 0 0 P 0  P0`00d D; 0 0  uP 0 d 0  gP0PD[S  0qPr>@0W ?@0 _(@\(@4@( 0Y00DX?0Q P 0 0P?@G!?C0 S 0  P=W`=HKP 00 3=0d PEP@0HK0? 0  0 P^ 0YD1*PPp`0p@ DPY V 0  P? `0d  @ 0  P1`F@P 0Y 0P$00h>d 0  0 P '0d D> 0 0 PW=-@0 W4 0<8 B'P0D[ 0S-C100 Sh  0mP=p`HK0 P03 ၸ=0D[@`FHK`=p`HK0 P0  0DP<@0$P( 0 PU0D[w:Rt<@0uh 0P5x0 H[=0 0-P(@4@$@G0 K04@0C$4$$@G0 A 0$@C 4 0: 0PLsp30( 0#@C3 0%P @)`PVV spP@ 0 P&0T0 0 EP00d0V0@DV  0P  0Prp 0@C202"0 2@0 0Prp 2@02"@0 prpP@ᘵ 0 nP0T0 0 EeP00d0S0@DV{ 0VPs 0MPqp1!@G0 $@ 0@X0D:W 0|!@Cx1 0{l 0+PPqpWH1H!0 kb dcc${HchbaLVbd$T` `_<`___`_^`__ _]0^4]\x\\ R[PJ8[ZPZY4YXXhXXXWLDW0WKKWKVVKVWVJUUUdJUDJ`UTU@UJ4V8UPIlT\TIHTHSSH QLF+I W0W! ##,0 0 +I W   +I WW" !" +I WW  # +I W"!  +I WW! " +I W 0;I 0PPUD{ p[80 @0 @- R MA L  ,@@0(@;@ Ĝ0 ЍLM- (040 1 2Ѝ/h A-PS`p@@W0 V:0 $"448#80@PU "P(00@V:DG-0pW :0P 4#$4 W0: 04#$$0W : `  SSSČ,$ $  0W*^(00@0S X T0 $( ,0 P @QA-Mp$0PS@` 0(010$,0v(`V}0Sy(0S! 0, $P(0, V31003"Pi,0 \, d0U4#4 00,004#40,(0T0PT(0 S0P$0Q0 ( ,0Ѝ0F 0P6,  (`, Q/:048000ZiQ IQ NQ<4@khP 400(S x  201 0ZnQ q W `lЍ 00XS 40P P00] W4000S @ lЍ z\ 0gkR0E Rk0 PJRg{[{{0S, 0xS0%bP) 0BS@Qf S0 0 {k{'{i@00 0gP 0 S? B P 0,pv@?AH: 6\ h N3?L\ @, $ Xp pQ0QKpGHSE[S0SsWiXGjPPM 8jPH 0 p 0zj 0Sc P |g J @T D 10jS*k&0B: @7W  L1D R@0s {{7{8hhh h7h`P   ! N TLjP8 iPP LTQ00pC0 A0,pAR Q6`v $  z 0BS@Q S0 0T(3 @d [k{{DB' T'{`8j`k{'@P{V@ D$ k@aT T74T@Ka@@@7Dj@{@{ 0Q $0@0"00 P@ P 0SAPK \4  0PA U U440PA U(00040Pj 000Q P 4 0Q `1 AR`400A 00100s_0{S4 0PB1G{kW400 >0PA400A SGQP40PE00A SIYXU:$0SPel4@zfP hPP 8)hP( 8g([88 hP8,p 0S55  Y$\ 8jghgfg dg bgQh`P,p`Th`PP  f RWD ۟4ğ [ 0T0j[0S {۴ {:S03:Wg۸M{M{ Qk6 C A@{{ {*30 ST{@0$&0{0G={۴}Z8,p g g g g gßL! $ 긻O{@{7{d۟WD M{M{ Qkf{G > 0W:0:G{G6 @0$01xŸ0 0T@T0 0480` < )c0@ SW PP@0S46Skm{ r۟]s{M ^o۟MM{^MQzQ!#{`@k`@{'QV{D儁5AD{TdAk{' Q{XFDQ@5́Di A5&B@D {0 { *0S{~0*R:s 0 $0 0~ 0Co0 0UP0{S0 0G{1W 400 '\?A5???ܭ ||N P ` {۴J{۴SR 0,p8$ P `8 LPR 5 e8 f< 0@J0kS30 bA!Fk{1W 40{'05&D [  0A$R 0R@R$ 0 0P 0 0RA@40@0C40d P40040h,pPK 0Co0 0 0S,p0S 0SA [8eee e eT  1V{ *0S 8PT  `PX0T 46$ (@D0[ $ ,pw Q R@0 @'{{7{[@0#S[D 46SV00jS  T R*k&0B:@{8{{5?55?P98*Ȩ @00,pD 46S400kS0S0S{ fPY fPrD0 T8 D kRB7R$eee e ejoT D 10jSQ@Q R# L @{@{7@{8 0$@@R @04T@.p! R  d*'6B#::D00@0!W,p0 8$W AfP |fP"ݯ S |08D@0\jQ pH S80 8$3!knP?0 00M 0ЍV# SA-@PU `40Sp @ ፫P 0S U@Dp@-P@}PyP0 S :pSSp 0R:pp808 80 e|$0$ $0 ft$$ @$P$ܣ $A-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l 0 C1T T0T 0 D(< <0< 0 Eآ h## d#" d#"00 ⎙@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0-w-x000( 00#000S wS -S rS  0S /xS /  @-P@20 0 0 P P//0S/ S S/0S/0S/@-@᫧0@0T S R RT/ ?/PP/ ?PQ/?SQ $0$ $0 p@-/< ( ??SQ $0$ $0 p@-/ P P P`/AQ/Q/Q Q/?0 H0H H0 p@-Q/?S0?/0?/(T @QP00 / /@-Y 0  p@-6P 0P(0@`H PጤA0Sp;0@96@`pp@-@P0 ESM` aЍp  Pd0S   p@-@PpP Q 0S P80PS8p@8A-X Pp@PEX `*@P``O- M` V" p@IV P @P0SV F!)`F0 `1 Ѝ Ѝ 8` -BM MRč dd  X @  PQ1   l0@- @-`@# s M Mp $( PrN TG "  r" @$@p `PѦ0 "l2 0 $8 30ލ Ѝ5TB^T"P @0ᴦp 00 B^P.!0 x:100A@  0 0 P \ AL+\ -L+*)B'&%$#"   \P  h\\\\\6S   ,$x P p@  <X 0 $\  t 010/C. *      RA-P(M`p |@ 0 @0@0 P0 0PT P@ 0 (ЍX  X00 5CS  A/0cS#:'3R31 3:0CS!2# 0@-@P S 0\\0 0NO-PM` p @P-Y] +Y @0I 㧦`Gp"..@0I \ aIQW IAIQ7 IUT^RQ ݩ@ 0T  R Sn 0J00 ЍS T0  Ѝ0Y U P`pPpb0 0XQ AA0@ \QUPpbPpbꙙX0BR"\0@-0 M< 00 Ѝ0@d@P0T0P Ѝ0D p@-BR"^p@Q@Pl0T0PpO-pM`@VP-TP0 +Tn S0T W  p S  00b 0 0?0 0ϣ 0  ȣ p P P=Q PS \4 !Ȏ\ @00D ^a0DSW0DA0DS.70D S+| Y[Q PS \ !Ȏ S@` ݨ"00֨"00 0S \0F00 ЍS@ `?0v0T0k XR A B0A PR W p ^ ppZ `@p SWMppM\0BR"\0@-0 M@ 00 Ѝ0@!@Pᅨ0T0P Ѝ0\ p@-BR"^p@ @Pq0T0Pp r  Q0?0S @-P-- MY ЍЍ/G-`Pz00PE! R !U5  ዗G 0SPPU pWU@@bPp X 00T 0 @CpG 0p00F 0 @0 0;6A-P`PL@L@0 @@p 6U  I A ,,p@-@P 00CS0 S  P 0` Pp6`@-@ 0`00@- M? ' Ѝ00@- M0 P@ 000ぢ H0 0 0 v0 (0 0 0 30 Ѝ0P @ O-M Q P  Q  ߍ ( 1@P 3`000 00 p@ṐP 0 0 0 " PA R R R#Z0 @R 0PU@D:PE[ Z PE l @@@p pZPEW R 30 0 00 R R0 S S < ^PP   IoP /P !Xa*0YU ı 0Pp P` R R R RQ X4* )P  R`}@ pp ᆡ R  PET D ᐡ PEp[  m  U *(2H `P p o3(2H p Pl `0P`p4]3`_`]$H1@-0pQ4`0! LMP D - @.0 P) V) pp0 0 0 RP %3 0  |0 0 D0 30LЍRPLpp  @ 3TN@ @ A-`P@PpWM) X PP00Ѡ  0oRP 2 0  ЍXPP h@2T Ѝ2RP pT0S/ 0S/p@-0P00 00Sp0@` 00000 Rp` F`Q000pO-pp#@l3 0OM`0410Q`1 dh`P0 Q 00咥/00 Z.` P 20 00 [ !!.PQP\.Q Q :0  0PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O 0 P00J ` `0 0C S::  0  ` @:[ 000(0,$@0ڟ0 0  `P$wP00 0 0 41 30Oߍ Z[0000<4 PPS U.R  :gP NM   h O-M M@x0 Sl:0p0D50t50 $0 00<:%0x` \ \ 0 0*9 0 D5 30bݍ Ѝ)0 0(/0P(0 0@ T S#PX (i1|50 0 P0  03/P  T:0 C/o"T S R^  0P$0 XH%t$(0txᤐU'x0 T|@0 0L0 `= `<D804 ,PXP0 C 0M P0  03/P Y  ` ZV `W VpG:(0,0@0(0<Q  0d0D P0ST Q  RM h <p `B PZO[P0 0 00PR ! RȠ LȠQo \ V\pp0XP &0 03W <0S B@Gq 0P!SP" SPSP@Qp$`0S 0 0X@@ @PC0@P0CSX@:@p$` @xt0D0 C0 0CSX: j04 R  Rv Q9 0B'RS] PA `=,H 0`%2J0 SRO40 80 r `PC0 { `Z$8X00 S58  X0P($0b/0P$ R R < R0$0P0P `VX *P D Q* <0X`0<0D0S S ]00H030 0  `P0 9 `ZL @0(1Q:*(P䶝P PXP寝0 CR00 SX@0(0,8t PHp᚝0XP CR00@S<@PX@ 03/P $X (0@(C 0L0.0P ( @00(0(/뜢0 $  0%1{  0p0!40 U8!rRj(彘$0 PXb0.P  0  `PZ0 + 0Z0:<0S$0(P@0(0'`V D`(>H 0%14,I T G-M0p`@P0P0 0   0 p`DPЍ 0 8PP A-M`pP@P ,  ( 0  P"0@Ѝ, 00Ѝ0@-RQ$M8P@'0S9 0S0S9  04 0 0 0@PP 00$Ѝ0R R" / 0 0$Ѝ00S  0 00S000s S 04  0| O-DM @$0<4 @Ph00<00 (*0P tPp`2-0 `!PP ᢉP ,0  0P0ß RR RR 0 Q Q 0 R R < $0|$0@P s p`  0S S S@ 1Y g*@c@P 000S 0 R0 ?0I@B Z 0 6 @DQ  1 ˚  @Dਗ਼ T!:  @Dpບ0 Sr CF P`0  ᬚ@D q [p?`ቚPT* P`,,뮟 0  0h!T1 0 <0 30IDЍ(+I P ` "P@ڣ P2 0 0 0嬟0 J` P`0 0Y,W,  0 K, 0000\00 `G`P   p@-M@P`80 00ɠ tЍp@-M@((  9ЍH`@-M@`p1PP0@0 ) <0< 0  0 p[@0Ѝ0@- MPP@T x 0 P00 000T 9 @ Ѝ04@T00pd1!0@- @ 00M! pP`0P! 0 0 @ RJ0100 @.PQ 0 Ѝ R0XS 00 9P0 P @ A Q QU ( ,$04 c#!$c4" 0]0l O-@p" ,MP $  P \/ 0 "x2 0 $0 30,ЍX"L2 0 $0 30,ЍOgP0:U000 0> U@ 0pp`P @0 ịP01 `V, @ pWVp F P$`U 8#< 400SO U0E S0 sb\ P:U@  ႋP 0:WV 0S  $0R 8#< 40@ P`0S P@P$`@P.Up P$`UP=FU p D e p@-(M00P0 @ `$ C+P* ٓL @0 0 $0 30(Ѝp舝 0 F ` O-lM #03 0P0d00 P m/ 0 #3 0 d0 30lЍd#X3 0 d0 30 lЍO 0 4 $ ( , 0  00h1T@ R@TP 0q0S P q u XP 0SP q, u00 X0S PX$Up#40P@b 0@:0Tp0*PUY 0 SY*  0CR00R:@+{upP40@`b 0\!J0 |*PY9@Tp. U00 S` V,*:0UT0X X- X@P0( R0 J P {P RU @Tpu0 S: 0 ': 00@SP E  O-MXX P@QpK ៍(Z> U U U f 0 ᙍЍ0` R{  ?0Z& + EPP 0:/qp  00P @ P )00 0 00cЍ耥p  #0P  * R + L U[ p  0o#P 00 0SN  00 0:/qp 00 `P¿^ 0? <`V<X0`v R0始0~ъ0 j0P :/qp0` a 00 0`VÿR <0`VÿpX0PYKS 00 0^O <?` 800C`V0 Yᬶ + [DL`0`f? ` :/qp= 00  P  @ P e(00 0`Y 00 lUP&0S#: 0C ᠌;P`T 0S  0C`ÿ00C`V0 0 Y0 0AI 0^ @0^ &(00 0 00 lh- 0 ` @ O-S$M \0@  H`p 00#p =0 0@H`# 0 B0S0 Q6  R00S B0 S0R ` & PP ԕ00[U X000 @PL  RWRY 00S ` R00S R Tu*D00 Sm P^ TP`p^[  C0 P CTs ^a Q `  H`@‹3 QY/ P+ 0S " P 00S U0S S" S' S- PP000S 0 0%T $Ѝ`dP`V=W WS SSQg 'p@-@00PFG p 00p 0@0p0TS00- M0 3/Ѝ/ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ R R R //00/00/ R R R //00/00/ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/Ѝ 0@-RP M@ R R Ѝ0003/P PP Ѝ000P3/P 0@-RP M@ R R Ѝ0003/P PP Ѝ000P3/P @-RM@ R R Ѝ003/P 00S00Ѝ 0R0 02/Ѝ @-RM@ R R Ѝ003/P 00Ѝ0 0 3/ЍR0 p@-@PPeP P0 03/P U 0|  0p@/003/P U 0@ 0p@/@oppp/N tA-PQM@p` Q Q Ѝ0 03/P V*PX $000 0  3/P P P PЍAR X # P` }0SP$LL ܹ ;A-Pp`@P  R 0 R 0\A/W 0A/0A-@MS`pP  SV ` P RPU U U Ѝb$000SP Ѝ VP 0SPUC$ # P`uPJ  (#00@-S M@P S S Ѝ00 03/P 003/P 0  Ѝ0 000 3/P 003/ Ѝ000@-S M@P S S Ѝ00 03/P 003/P 0  Ѝ0 000 3/P 003/ Ѝ0@-M@P0.S00Ѝ@-M@p@Ѝ R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /< L0 0 / P0 4# /0 48 ᝂP @Qa ᒂP @Q` ᇂP @`VT* P ``V{ R\Vt .V DA y XwP Q.Pp  P@] ] Pk  0J`S`P0xSM3000 D P XZ0``/Qi ]QPP 00S1   0 ]R(S  0" P XZnP   R0 F b" R` V` `A ` @R^ .RP @k@ P  0D0C   X0](00$ЍW00P  L`   V 0S000PZ X \0Q PS0 T 4*@DT[@ XZ(@ X000…  Q  T 4*@DT[@Z X `ꔾ |A \> 0G-AQ@<*0pS% R3 @R`P00 0X*  000瘠    P 0 S00NAS 0SPQP!00P0X(00ܹ PRO-P3P# M0RP3U p\` @0I @R: R R& (000 ЍQ*@ ĠS? A @ G0RPR@\ 4 R @4 S0A  Y*@T*0PB0 A\ Rɑ!" 40S0 4 0- M ЍO-pS,M@ [ p 0pS 0S0^Pn @^W \iS0 0P0[0Cpp`p0$PUO P0S @Sm  WE@U `PU00 S 0Y* 0 B>\ A X P00S X(0 Ġ?  0P R XAS"`!0PU`0\0[p 00尒(00,ЍPᩒ(00P0S 0 Q* 0F S 0S 0 `  0AU_0S ! " W@mX0y  ABQ AA\ QE    0B>S( 0A S 0$P R0S  P\0^$p?0,4 B0A000 0RMP600$H p@-P0 0M0 10 `00rp !@p < 40 0 1 30ލp@:뼲 ` A- `0 0M P0 10@0 (qp 0 p0 (0 0 1 30ލ^:  Q:/R/0S/S:00/@-\@3#* 0^ @R R R (000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00C|(00/C/G-`@pTY( V W TtP@TY 0P?S  N00I(00 QSp@-`P@ EP`VP@  0R p/pA-APUQ?UU@A`pP W ځ1AP(0000?00Q A@-?SSRB 0@S A00ݐ(00/-- M  ЍЍ/@-M@ p TЍR/0-S0 \ S ^000O-@ MP ` ᑊP-Yg +Y` Q0Yi T@ @Q :9`pa}VP09`psVP" [)SQ" K0I P0aIQW0IAIQ70IS| V[SQ;+B=0S \0J00 ЍQ `Q0YXP  A@0L ^P @T@@X0BR"\0@-0 M< 00 Ѝ0@^@P0T0P Ѝ0< p@-BR"^p@K@P0T0PpA-p 0 0rM@010PX0`^00pAtA0O0 TAΌ`p`0`L PP m$08 @(0 0 1 30rߍ-8딩  $$0 M000 Ѝꬨ  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/@ O-QPM@ ^ 0S000!R p!3  ~PP E`#3`9P*Q30A 0#1#2#4#8 R P2   (0 A 0U0 pQ*IP 0@pQ 0S  ЍT 0 @00Ѝ 0 0A-@P`p70 P8$0$ 0 M Ѝ T0 0p@-00St@@@pdPddP@Pf@P 0000 0̥ xX8xP p@-P@ p@A-Pp`7t@t@l0@ @U  Z0<0 b|  A, ,$\4@-@pP0S  3/000S@襎Q A-P p@` F  r000 k@P p@-@P嘋Ppp@~!1@- BMM0P@040PPPPP6|10PV l!`D0S \!p0 P P8A0@ P< 10 y!0 0 4 300BލЍ8P 6PP  5/P Q Q 0 0yp0 00P 0 0  PVb6P  Dx0| \O O-MqQpP A@pf a@0` RD 00]8a1PI 0SP p Z [ @@P 0[pP }0PU :Y t`P`PS@P TP 0@U:W ^@0@00嵤GQ|00p@@_ЍPYЍ<00 'yN ܤ8 xM L 0@-0P $M@P P0L0 0 P $Ѝ0 G-RPL 8104!0SA a q`p@ #)/0@S-00儑 000S 0 000 00 x0 00 \0 00 @G (00TtdX|A-p䀟0S@P$0 @S 0`PP0S PU @@P 0U00 q4@ 0@ P O-dM∀`XS0R3Q  0#000SYC@0S00 h000T#T3 0 0  00P Z 3 s003@0pP0VQ QN  QI fP0S_ 3/0 0P U@@|RP00SJ`" 00C0T@dЍ8B@@@, $20\r , 00SO  R1$ 0 @ $(00 L00L{P 0S 0<00@00 0<0kP 0 S@$0<S( @ ( 0P 1S@iPQ 00C0@@0$ 0 @ $(0P< @$0S( @ ( 0$  $(0 xH 0DG @G TG F F E E C-@"`<2 8Ÿ0M000P/"b1?2cQ 11QAQ@PϠl R QE00å?8@O3d11 "@(,p0p P$;t-t#"0l-cR:d-c2SX=  PP 0 0C@aa0C0C Cr  \\-N2?#c!!"N ,  ! bQ4-5:bQ$, !,-#c!!2N0 p\ 0 S 0Y%0 `R 0 S ` 0 `0 S0C0h  B1;Q/0A!b0\P  tY0 `R 0 S 0  B1L;Q/0A!b0\P  TY0 `R 0 Y0 `:Q0 0\P  1Y0 `R 0 Yd0 ` (:Q0 0\P   Y0 `R 0 Sd /09 b !QQ0 0\P  Yl0 `R 0e YEX9Q0 0\P  YT0 `R 0M Y-0  `;@0 {`28 Q0 0\P  Y#0 `R 0 Y(Q / b !Q  (0 \P0  Y0 `R 0 Y'Q0 0\P  hY0 `R 0 S Q T'(0 \P0  NY0 `R 0 SU#P&UP"&Q0 0\P  -Y0 `R 0 S6Q0 0\P  Y0 `R 0 Sp040080 0<00@00D00000 0 P0%\P Yr0 `R 0j YJ 0K0 S0ڜ YZI0`Q0Q R`MYJ0 `R 0A S!004%2?2c  1R11Aãd0Sâd0CS0c04\P0 Y0 `R 0 Y 00   0  00 S0R05`003\P0 mY0 `R 0 Y0 `0\PS00X3 0 JY0 `R 0 YY0 `R 0 Y0 ` 0S0 @ 3qp dqp  @Q2  0S! -Rh Sf! 1QR'0Z0S@)@` ϠϬq^Z R pSHp0W h쨟츟p Xp@@ @@"V堘(q Y.x|X5:xxHP %^ ` 3#`POPRU@0p XEW`` ȧ p w@F@Fp pW%GpG@@lGx@'Q_Y$AdWO@P1:X8G.BHWN <T3#`PPS@X0 pV弦P@D0" ,!,`AXR o``&ao@划Ꮂᮝ !R  ԕ (!܅ Y`3#p W0C@ STD05Hp 00c\0SL \8;Q0 0i`@Qqd(8JPn (0, UTA WVH V07(0P@`,0Pp? 00?0S  S   (,  0 9/P(0, SRS@PV0B!00u TT00ЍWV `Vpb p-ER  80Ŏ;0R00 0;0800S< 8 0S Q{@#Q!Sz RW0ST 0S ``VJFm F|`1 Shp  [:1S@PTJ#M @A$(0, 0/0S/0  0 9/P P0Sj u@Dk 0PES 0N?7c ƒ c l N0?C?d` `aG`0da2@B#&>b`. c 0! 0#‚+a!!!0C0"[oÏ(" ?00 #2>[?G'PE@@GPD2#"P*"Pr D20,W#10 ?015: 2 0 #"".2Q 1 30 #1`0T!2? B4sppp0/SX0 p c 0y!+:60 0($0(>! 0+Qd!_P!!!0C0D![Ï(" ?00 #2>PVXi`v c 0y &: 600*$0 *>!!!0C0V&) !"2 >n:E.€Qk9_u"mnSc$IųQ\(\ףp= ףQ)\(\sc 0 ay8 +:60 0($0T (>+Q!!!0Cl 0[_("Y0%R^PP0 0 cQ@ R0!V BqgqgXpC)1? c 00%y0,!):60 0($0!(>X! 0‚!!!0C0t!YÏ1(" ?00 #2>r?D0C00!/A!b!b  S2 B ("502c2c2A" "b1C @S/  0P08P2X!:#0R ό! UZ: 0"#2>"Q0030#0000T @D 0 S0@ 0 0 @$0ЍDv)1?c 0 0x0x#):60 0($0#(>!!!0C Y38#,"0.s<0P0@<00000@<0P0@}T 0 @-M00@P T 00t0(0Ѝ 00p0D,O-@P`M 0S9  V 04[P? -x PQ%  .  0 ! P  0 %0R R !P  td}00Ѝ0 S, 01P0% V 0VP? w 0.1#0 P PQ P% V0 R0R㨡!Yh&0P l6m&NSp@0GSHl`P [ 0S0ƒ! ⃡10hh "0utY OX1000\11001Y <Y20`S0S >S@1S*S0S -S0 C Rp@0GHN<)`h0hlpt 4t|Ѝ*YY -Y00I S@0IS0  S ,S;SQHAL f ;S,Se SmH^(- Q 019mPhjp@019mo\@ pKph6Pc^p@L 9 bp&k htl&ug> 00 0 0N\hP s00@ @s @  P 1 00A1 01P00P 0,Sd0(0P 0SHL Ʌ ah& `p& u&g.tl60$p ,`0ട`p $  $cR-:$cR 0#031`002c2c# b?0cYZ  [  R`p K  4$L)P 0 S 2J$`p,`0 380܃ 0,p0`4 cP":cP0#031`002c2c3`?0cPpcs V P  P㞋# 03,3(3,p01c000`[048 02,p0D004`<@p@ `08@Z"28#!BcRd:x"cRD 0#031`002c2c3YTX @R  *PŸ Zcc Q,  \Gce Q!Q*R/ ! !c 0p?0  c@`(0X$ $ ( 1 0 Y  YZ,p04`8<@@g>fΌ00t 0HSl0Ű1p,`0 QlQ)\(\ ף{P3A-PQ@E 0S ɀ001N  phh6l6r`n`P 0:S eP `VpFPW N hq0PPT`VLPNLg@P`_pdPpV=`P tJA-`PRPpP qP@@W(tPqpQUX  P>TI QQ 1!0 t0`000V0 m``P v}=E0C0C P S\P0e/PE9  lPE0P0U0S0  1@W@ࣶ MN  hzqT,pPP\ \\ p 0 000#P0 D4I$S 0@-$0$0!@R !X p4 @-\FH0H 0-  @P000^ NX9 PD0@-00@S $000S 3/ p@-TP@Tp 0 3/P Ot{@Tpp0A-0`pP@P UP 5t, 0p `@dG-@R p@@T `ᗆ% :/@DPPA-@p`pPIT P t`L2P @0L€:00#S €^"R'xH0O-`Q MP倱xP2 LB0/p P2T- P R; S P@T" V0S !Q L/`3/L2 S1P2S?T030# T03S 0 p0p@T@@P20CP2P2SW pW ЍS @  L3/L2 S @ꨈtL [A-!p0 0MPQ010/@``0 80xA|A8OU8`@TA ``p`E1`N30@L @0 0 1 30ލqrT 0 4 4 0- 0 M Ѝ3 @ - -M00$  0 0 0 ЍЍ/l3 0--M0 ЍЍ/0 0p@-@PX]c`00CS`0p S  P X0` X PXTcpX0`2 ,\ \0 `00CS`0p S P X0 X /X P2 ,-40- M,0  X ЍЍ/1 ,-8 -M0 00 XЍ Ѝ/1 ,G-p R`@:Q !SIpb0"P U U * l0J0`0+P2P l 0 B 0 0b P0PU` ``P+P I(npC0 00 bxq0T @0 0b Inp--M  Ѝ Ѝ/ -- M0 0' ЍЍ/@- MP *pp`P/ z@P, +0P$ Sʤ00`@$ 0,0 0 ( 0 0Ѝ 0'eЍq0000@ЍH/  < Lp@-P9b@$C@=bpp@-P`@k R T0U:T0T:p@kqRSU@-l00p@-@!PR ! 00 0S 0BPQ`0AP R 0 U00Sp`P0_P `_P 0 p 00A- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ ^110L00 0A pW \00W00S PA0ASP0@# 80p@#1! L0  A 0A衝C-@p0T@1W MP` 8p |h1p0S D!o00@ Ѝ00p chp0S   jp0 @ p@O-4Mp@ P o 0` 00SgSe %S0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK0 V & a0 Q S  T >4ЍPP؀PP؀010 00C0B Q$ROLP00 x8 0S0V `1!(  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p 0V `1! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B Q@ 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S  pD 0V `1!ex) 0S0V `1!X V  x 0S]0V `1!G +  x 0S p (  x 0S px. 0S0V `1!x0 0S0V `1! x 0S0V `1!xs 0S px 0S p 0V `1! py p p xp& qp jp cp"s R 0V0py V@ `1 | x 0S0V `1! | xr 0S 0pT 0V `1!u ; x 0S90V `1!f ; x] 0S  p/ T- 4* p# p$ p7 p#l x 0S0V `1!(P x 0S p[ x 0S0V `1!  xn 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S ppx& 0S dp@ x  0S Vpz 0V `1!  x 0S Ape 0V `1! PZ bX PU ]S PP XN $pG PD LB P? G= P: B8 0B Q@ 0 B  0B Q$Rm x R 00p @0V `1!C P  p P p pJ p P  P  P  P  P  P  P  P  P  P 0s 0 S p 0V `1@! P $Rt@00 P  P  P  P  P ~ P{ y Pv ~t Pq yo Pl tj Pg oe Pb j` P] e[ PX `Vx 0S 'pK 0V `1!l P@ H> P; C9 P6 >4 P1 9/ P, 4*O-oMM\ /H0@? T006000T!R !0s0:0`00  0S   R 0000@0D?\00d00ܐ00 0@(匐D0hXPU @%U0T  ` J 0 R 00S0(U` `P0r$P0 0FZS|98Jw]_ p%nWWN*8`rPYP    RZ00sV P=*X1RRdXOX>TQ.Cj~@QD,TDl(8`G 00<\ T@P@qYP@@0@ 0@00'00F@p`A@00F S$V $@GPU"0T$0S+ @0S @ 0倀0@0S0000XX  +; 0 6 30 oލЍW000P P:00g  r So ! 0R q0- r  R 0  @TP@@R00S= r0y@ , P L 8 4  V  0}a Pr0 , @P0L08040!$R     P R<  儠 `@VS 00S0r0000Q(1S 00S0001G?000Q(Zt ,0@DT 0L,000p0S0^Q@ ZW@@P6 0 ($0 PCUv<0Q0(吰?0400S@@0S 0 1 00040Sx0| 0t0 7| R1|0Pp @x0P0CD0 0P@0  t0S-0r0|080s ` 0`s0X040S)|0SD @008 @CT@Tڐ  Rp@ Q(8`T`FVX8 Pp   Z ` Rm  ` Q%( 0CS@@Tڐ00Sp@0Q/(`T`FV,V uDtp(Pp@`FV 0Sp0Q2`F Vʼ400P`0 0 $0 CZZ5P0 `p@(PJZ R` QJZ@ p5 0\00RQ(LS따吰P T ) (Pd`@DT 0S0Q@D T 60P0@0Q( S따吰P ZwS000P) Q70PP0Q bS000P=<000 S0`Pm` D P Bp Q(0 D`LVfhR . Q "S000P Vt8P0 l@@`(PIY R` QIY l@ `90^`0r0JR따吰P  R000P U `ڀi(p`@ PEUU0S`0Q  R따吰P R000P R000P( |T R`  0_Qy>000(0h 05 / @)P pDQgh>0(000S0(;00000Q|( 0 00 `0000S000Q(|@T0D 00@00P 3R000PD0C(0p0 S R0@D0,0, 00,0@%@00NS `Vr0 x|p @ @ , P@L@8@ Qr0(bQ000Pp  s4 S ph R  mRdp  ! #2 g @ 10  g 0@0R00S000Gp@V*ڜ}p(Pp@ 0 `FV \p Q 0 Q000P Y@W Q 00 0 WC@ ? Q 00P?  P 0b@! Q 00 0 9LPPU\.s` L ,0 4`(` 0PUSp4UPEI0CP QW ,LXX ڐP? X@@@TT80 0ጀ@JZ P@QJZ  80 @L^@( P따吰P Q 80P 80 P 80P P80 Qu s],V /@ P `0(@PIY R@ Q P P P000Pb {8 10R0bB+ S- C S!!/ΟN#cS! C0 `0 `000@F0NQ*pNn0 n]00Ch0h T r0, , @ , /@@p P@L@8@80`P P;80 H000 H000000Q 00P0QH0000 H000@S0r@%SH 0 01H S-0`r0͵00S70 0QH0000 0H0P000Pr0(m0 `, \ ` Q(00, @p/ X P @L 4 s S4 ,p P0 S <my_PXL`P`,8p<P"# . A RJ $\ ,\0\`pEE ,\ R000\00S0 08ʱ [ 44 ?aCoc?`(?yPD?@ tb'0  DЍO R   R8C6h0P0U TZ T0 0 DH@J$Q 0S  0P0@ w0P$0; $0`e0P$02 U ,0W   `R`0@0 0 Rul1 01{HK""0 1 0k0KR k0{' [[( R {[OJ:[k{{+S 5A; 0+C 0S31Kd +{0k{*0  G{5Ck6kʫ+K P'{'k&[;*0  C{7{JG[2[Z SPS0:k{k+S 5A{+CG{5{0Fk{J0H[0 2 0 c01k""k(F[k 10{0[% PF[[ P 0@XCZG(0S[ 0SSp$@ N`Pd  0PP0S0S. XYV Y c`PK $PH0W'  W9RpG   t$`P3F`P-$ @0P$0&?@?$@@TU 0p C 0, 040$@npX 0Pi@P 0Sh(0J  PQP 40S(0YXQQ0 R Y Y S@ `P $P9U@ 1PP$WZ 0SZ O pPpIG0U 00 G08[ $$PP01 00 0 0 0$'0S0P$0 ,0W  aP$0 ! `Q;${0KC[0k*0 F{7@{ k[3{Ck6{4J<0 0R?0S0u0 00\ {'{0; Q {'kkKE{{{7N*N BB*N@{*0   P0y< `  s0R 00P 0mXw,0[P   `P 0Z  0P0 P0P00W0SpG .@4PP   ! KTP P0CSg  s9R  0   00P0 070b@(u$PO 00C  0`P 0S40SD G0 4?0000Q[ 4Q0K: 0[%0Ck{00[{ +S 5@$X0SY 9UP p9 0 :$@?@0P$000  1 0Q Y7 Y {7{E{.+ P0x <PS EX10S 000* Q%ں0S$&R !**R UP0 P 0wPt$0SkPpl0S0r 01 0 00 M0IDF 0P0 40S G044Q p9Uo X1P, 4   9P :#46*0/Q46*0//P@-@00 R@ P@Rp@-@`0P0RP* 0PpP  R 0 R VpP !0@-0O- M@SX@DPqapTVq!`$:0  &^ ^ W0 * 0S  BX:X@D*0S @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ0- UM0,@P.0L10R  0 0  cT 0       TNS LNl@-@-@-Qp@-P` 0E` R @P  IR00pQ`0`p@-`"RP@P  3Rp-M Ѝp@-@ P` !LNT !@Ap- M ЍP/L -2M")2b3c1@2`1  0ЍC0 00/D 4{-0M 00 0{ ^p`Ѝ 0p@-@Q r  P p0 S 1P p PP   ! Q @0O-M`pD=@0D0Q0P95X! @0S S[ @   b 0P15  P T@@  0  "W @TQ 0P02@0  0 W` ЍQf@ 0R AX00@P00  m 0`00R.@0QLW 00000`VBQTQCp0 0"!` b  V0 =T@P@00V"000@000C @~ 0Se0T0 2a PPl"! 0#000 0 ! 0 @ 0~`@P !R/0S 0C0/ 0RA-@P)p`B @1V@ * C BQ   `iU0 pg3701V@ * C BQ   UUb e PPO-p -|M0<80@0 XP0d0p00`l0-P-+*)('&%$ ah000P0 0 00@ S 00(00iP@!T 0PB!T00@l@0 @ R \ $ EQ"    lp l  +RO -R, ,  l  0B ^lp 0Rlul 0R 1B\lX  d$ JR 0 R* /o"0 ZT@gkXpp XFڐ: 5g01[5[X 0S 0}S} %0hSpHpt0 ,0pH ,hH Pp t0h0 pLWt0* t0 0ht0  A R8 , QpCW& pWp hpw0h000(0, St  800Ss,080000 00$ ۟ 0$ S?˟ B @0p$  0HL0H@8 P{  L ! OOp0- @Pp p   !COhPt` E Pa R$0@0P, C0E$@ PP0C PEP`PU00 S 0SPE`FK$0SfEQ<8 0StVl[  P3  PP. 0S0S> ` 00 pSp Pp W 0Sp#a V380, S0d0 p [u0[`q KQ 0Z00SaM<00P00400h 0#Z00St0D0I `\] `P \QRT40pS  !g p Pp 0 S B\K80, Sh 40 B0h  WD0h t00<0CQ?o20S )K{8Ik{ Zɋ%0S    ?@V瞯<?X Nh?0Sp|Ѝ 00XS `l`0P P0 0p Ql000Sd00d0R lpm d|Ѝ 0YiR IR NRl@BP 000l00(S0d0 0p 00nR 0p d0lpP)  ^PJ Tl e 0B Q$ Ql  l  0B Q 0pHpWt0,0*W.  @P z000l0Po `00W'"!2|r0{:#:?C0C0  AQ' r!zGpGp4656:RH (30{0  QH 0R l 0R l 1BQ=l0 B`$QP0Bl 0B Z0l 0N0B ZL\#,Qj{p Pp h00h0<l@qP@ l0X0Cl0h Pl00l0 00000p d0s^ 0pHpt0,0pg  4Hk01{p| W'"4t0{ :#:?C0C0  AQ' Pu!zGpGp4656:RH T 50{0  _000d00H  0BPt0,0pHW 501{',PrR  OV 00p S0lppA800p80 t  t  W p!00[ K Pp p800Ct0h Pp~ !T T  TTQʬ$Z<^t0:Sd2 0:6tt0,0`"0 0 5S!{d 00'  H oP. p840S<00:<0P0相00cP040S p0000 P JXPX0 X \$$dX10 300 $ B1kd00 {0G G P {,AOCpl X4 00  h{  A1{'kd00 {'0G GP Y0t0,050`m A%T0000,P0d0S!00pd04Vp_ 0Sv ph0 |tQ0k,0 00C  t0!0h d0VpU!0Zd0 08 ,R0 PP{ EPt0p 0Ct0 0hd0Ppj0Sr @ 0 00p d0Sb p 0p000,0t0P0d0Z!07 d000# [00Sp 0 VZ F0d000 3S 00d0 #Pp  h`1`f`Ph00h0!0d0p80, pSd 0S!0d00S(00(0t0h 0Ct0t@-00,O-@ 0Q@P MP`PV pL@ 0P  "(%(!( Z"8J@ ZpI3q WG N@ "8!8P0LL#8S 0Y  0  0 ЍU@P   ! lI``3ß0O-M 00@Sp 21`C`0 00 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 Y \ 6 Q0R T0#03\0SuWa* G0V*0F@S3 FQ   M0WN 06S ЍW*@DPD@ Q0; Q0Q l l@@ 4 Q:@00XS Q0n MR)AoᨂX " 0^0 n120 00 QP0Q0l1 c 0R:|00Q )Q 0 O-M<0 XHX8@`00Sp 00Pu0P0P0  EB0SG^E@0= PPb @0 Q ES ZH P 0S S SD `Pb@00@0 00Vp@ !LT 0 PeS5 q00@00S Z 0 @\Pc R  BPPb S@0D0CSڣ0SPX 0Sa G0 0TX 0p 0 Q T @ T TD^ @LT 0CC10BgP0DSy`0 S0 S C U 0S S S LP@"00ЍRq  BPP+\~ -\  L^ ?L NZ P\ #LPNU PPl '@Ѝ \ 0PP0Q 0S00 LS S80S #000 0 b@0ML"00@C |`P D21 `2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf w0 S_ K@"00ЍP@0M@E PL K`"VpK`W  `21 p7  ` PEF@Q@!80Sj80S 000i U U E P 80S800c8080S `T0)  RP!@L#80ST80S P 0 0  B @\ \vj 0`e  BR "@` P3 `2 c"1P 5  /A-@0P R#`pn3 ^P 0 W@00 0p `UPEPU 0 BP @p `W`  0 BP0Up980@-@- M Pe@a 0 B 0C2S6cА* Q*KUZKE A@{ Ѝ0@-@0AC^ 0S R0A  S@-A *@\0L0C00T D B @ ~J0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/ l@ܙA-@T0000Pb1 !0^2, l!p(  ^2,0D10C#10RA! @^ ^@DA0DC1T0R @P@-@M: Q @ 0R Q ~@ЍA-P a 1`pM0S3 U10AT !0S 000 @T0  0S00 0Ѝ@0!0D1S<000S 000ؒ xPl0@ 0p@-@P0p R pPQ`00App@D `0 S,00App@ꘑ xl0  0#10/ P#8 R#4#2#10 0// /A-`P@  1,0@Up00p 0S1pP@P:pP   ! QD`}P081#3S412s2sS/1J //@-@P0@0O-0Z  @SMpPA PaU* F B  H  ^'* 0H0C X000300 ZP@T  ` d` X`Z P` @T@T 06S @ЍG-0܁@pR$A0 QPiV'10SP`P\ 10i1000000S l1 zPP4 @p PU `@00SaPP# 000S 00PU 0C  pPph0{iV0S <0p ,0R0i ꜍ xqlhlG-`P0R@Tᡢڃ0TP$ Zp !pG0  a !  \2)0L0C\0003R @@GpG  \-0P!1^$23\ *G-P@0p@DTD !1PD*32^ ::P  @aP @0 0S 0SQ 0PAPE%Qp Q!! 3 V@ 0 0S3#V0`F `F` 02NS @0@PpP 0 0QQ!P3 p@- @APD0D ` PR @ *\ l1 0DR56 501 P56 +Cp0R `5<5#11<?@-P- M@@;`P  46!z60:S  W  0 C.G B 50c 0 Ѝ  0P c2# R   W C>C0C012`00S/0 R /81@-P0QMP6@m`P3 pP-0S  Q- sp 0: S&PP  8#80 @0 $ x t0, ( 0 0ЍF00Ѝ<0F00FO00 < Lp@-@700CS00 P7pP  BR  /p@-0rSL wS aSOP F 0 pLP0S! e C+S ^R)# P0SPPp0KS0LS0DS0ES@P0p@-S4 @7P00 P! !& 0S 3/PP೼000P @ P $00 00`aai7@0`` 0p"5P"F 0P000@-@!R !P 0C 0 0 S /5p@-@|Q|1P00S3 0  KI 4000S8 0"$0 3/0:0P,p00P @ P 00< R 800p"O0PA~I<4P 005 0 @0 0pE0 @0 0 @-Ѝ/@-@QS S S E00H0@/,0@d0@86@000 0 0000/@P 0p/@-`E/41So O-@ MM Q 5/` t  j*p+4\ ājd% p  0 T  `h, \0`PPt` 4x @ 0 Xpl!$%P 8-,1)p `0(` Tt8 d954 ċ<=  <" # &$ '* +p. x/`2| h3P6l X7:\ ; >, ? ̋ a!*a*b"0*b$*a!4 *$a*8j(*",j"a(!<", a"j(*@",c#j"!$$Da(!c4*"H0i()PVpKM P  0$p pt 0~ Vm 0Sj A/ 1p*$ <)$p++ *<(),<('4 '<.0<.,4,<0!4<!< 0!4<!$0 #<$!<($0!4<!(,!4<!,0!4<!400#<4!<840!4<!8<0#<<!< <08 8 8 4  4  | pp ̀ 4 (  ( $4 |($  p, p0 ,0p4$( ,, 0484 48 x< @ < +4  8| + ̂@ >>0pW p> >@P>P>P0a}> >n XapmTx`O-@(P`P5f10pSp(P6 R ؑZP. ( ,0 [ D`D` S`1005,`5Oeꂡ P ر " J2> cؑ@-@ 13/, (Q0@-@Q +00 2W> 0 O-S␆M `p& 0 Z0 PU E Q[ [ R Y YYY  (>00 Ѝ5% P 0 引 0 @P 0 10$!12P- 0h%S0 2X5@  H%00@5 0 005V00$5005000 S S =00P p  20 2 80Pp` 0 0_UP U\3UX# 2Z 00 20120pESQ  000 EH: w?@ P31S 0:: 0)P0 "  ^*P 1S0S1S *0 29 20 29 20S 28 2CR2S " - @P~P r R < "4 " 8(P0<S 0%4,<%<00.4$`<.,,4<&,| 4& 80<$0480< (0480<,0 4480 <*$,00 4*,80 < 40Q$0SN(PX00 0TXS 00 I;i0$ U"* 0S @0C/[00ϹP0: S 200 R I Rv2?00A@V# 4- Rp!e20S X  \0 RK [ PN200W ᓹp ᒹP <2@oy5 G5 $R Q0P:Q0Q: -@-@-@@ $ @ p@-@PPM#.PG$  p@JX H d0@-0 M @ 0  @KP 0S  ЍpO-lM@d0P X$0, d(,dp Dp,d0  ,0,d` H`,d 0,d 4, d@L@,d 8, d<,d @},  dPPPw,d, 80  4 ` `0@ 0@ 0 `(  pW' Q0: R   z P9 1`0C08#8 0C 0 P0 0RpW 0 10C08#8R p W0 R  p0Q  4P ` C-P@$M`Pp  00 WW 07J  (0pGW`^;\[7X0GS'(00$Ѝ(0W& ,0u110C0 8#8CS  (1 01崀\  P,0p1! B ("(R 0 gp0; P 弁pP 0 00(0 00(0Pr?⸁p (=` 2 \00$Ѝ0S 0S 0 X|弁 0 pm 0S 1  1 [P\ W< W 弁W2 W(0XHWI p  W  8P9 H⨀H( .긁0(0弁{ !(01ḁ0C08#8(XW) p  W  PH(꼁, 1z P 0WSBq X0G i,p⼁ 1a P 1ᴀX0C08(#8X弁 X0H H1崀ሀ!0  1: P pp Q0C 0( J각 0H⨀H(A0!1 p 崀  Pp@-@`PP 0 00(0`00Q(0pO-,0Mp@0 1 _PC a`F`h&hV1 PXh%XV @H$H @ 0F 8`P 00!01@0 @ 0U @EH$H 00@0  Ѝ "  U ! B ("(RQK 00P Q P !@ B  B  i `Pq  qQ0S0   dQ 0Rf `0E 1P @UT @D!H$HV@ `F !Pk P `  ἀ) @P7  1뼁0S0  N a1X0C00C\ b뼁0@SA 0H 1P| " PwQPp { Pb g @1 0P aP[ A1@D@@DH$HV P@`F! G ` @T0:1 01`01 4 P( ("( R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/$ @-@P , @ ($ 0"tO-$M 2p  (@0\0$pp 0 P`0 pP`@  Ÿ%f#"," 0` ! `! %   X! , pd!d!  0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$ЍC-@P MP' $q`{?pW($7 )#0(0 `"2`p` b8"#4b4# 0 V@h # Ѝ 08R(@R )@ b# 8 #)8 b# 0A-1?`@Pp @f(X( P 0刁0 0$0@pG0($0p ?W6@`G?`@`` 0$ <@P U 0$ ?pW ( 0$ q0 0$ ?W@`G?`@`(`@  0$ <@P U 0$ `R @-/ L@-@P 0 @ (G# 0"蠁R @-/ /@-@P 4@ c P*# 0$$, O-LM(6,Bp0`0,$ 4<8 P P(^_8~?00H@040<`p0 `pP , $,p `pP`( 00 400X%'%ɠ0nj) "&&ɠnj .,@0 ˠČ,+$ "$0 !'( ( 0! 0( Ϡ' . $̠Ì @ !  ,  , @( 0$0 [3 `0~?00<`p04P0    @ ,  @ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90# ..YW([T0#P P[T(P  P%0 P P P%P 0!$pP00(p/!~,! rp', /!!,(,#p'\ )S   ( "P p P% p PP%0pP4p p0 0PR4P$(P]8` 000 0 00 00 000 000 00000 00 0$0P(0$P0(0,000,0008 40 0 408 <0 0<0LЍp~p@-@@DQPP` U  0pRPQp b!o Qz!0P0H @ p@HR Q be!>p ^!@0A-1`@Pp fPX; @0D 0 #@0D  H00H0L00L0pGPpP3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW PH@0D q0 #@0D H0L 0 H0L W`G``P` +@0D ;  SP@0D *H0L 0 H0L U`R @-|/G-@PM 6PH8 I `p ` U@  Ѝ@-@P 4@  P 0$$8wR @-D/yG-@PM PH(  `p ` U@  Ѝ 0` a!, a c,/0@-M0<P0AP@;P񏐾>5>  KGC?;7 UQMIqla]YUQMI 3/whYzP;DPoE@5Pz}|ytsrqponmlkjizjRQfeNm^]\[ZYXWVUTSRQPONMLKJIHGFYs 7P 7P 0P:0@ 00 P%0H 偮p Hߍ0?CP 0P 0@! 0`ߍ0= @02S, DP,K00   0  00 0H :p D ?a0/00 0H p h 0 0@!0H  p HP ߍ0 0d 0 F0 G00@ 00qP 0p 0 C0HΦPZ uHȦPT o 0[ 0 0U 0R 0O 0L 0I E0 D0 0 0 0 0 +0 *0 )0 (0 &0( %0 @RPA@  | 0v 00@ 00P 0@ 00P |0@ 00P H0@ 00P  B08 01P 0H <10pH <0 ,00@ 00P6 X0@ 00P $0@ 00P  0 0 0 0 0 00@ 00lP[ t0@ 00^PM r حi<DDD x0{G-8M(pP` {{70J@U@W@V@To 0S@!Q 0S !Q0S{ Q {0 02{" P0 ! ("(R  #|:W UQ VPw (20  ` " Q!W  U0p& V P`P( U 0 0V 10 @dΪ 㴫8ЍV `0Q  V`W U0p V P`000 P0SQ 0Si Y @h0`0  V PBAA x L  ؏ n p@-m0@T 03/@TfdPP b00@T 03/@T\QpSH00@T 03/@T$0p萎 d $ ܍ @-MT@@P Ѝ  0 ⌫pЍ>O-@Rp M ഁУP `B80 S" 0SK: s0  0Z 0!80S7  0Q?0 ] 00 Ѝ 2  Z  0  00 0 P 00  P00 2  ŨP   꾨P  000 0@-P RM@P Q' ! 0 0 Q   0 013/Ѝ0s/ r? ;P100@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP `@( ``0V#pؑI@ T`1 `! @D | T@ p PU Ѝ ЍpP p`O-Mq  PpG  0O PU  @P U`1`!  E[  0PU0 , ЍЍ@- M` @  P 0 q@pG@DP @PPT  Ѝ Ѝ P/0@ 0A0Sw*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:4080pO-@R"2 0|M`P0t00[ 00S80S pd"\2 0 t0 30|Ѝ4P  岤P8 01 0#\ 40`0P 8 0 0o Xp: P8#[> !1ȁ0!` 04 4PU 08  R88P@P`0X A@ æ 1248 Q080!:0 S 808P嬦P8OP 8 ` 0pP 80008P卦P8l00pg,  @ O-M$ ) 09 @,0p020D2(0S PU 0H"4S4S2d90U 400P0h00 P0.0Rd00e0 0h@00S d0P02 0CX 0 (?01HF0 00]p <0S000S1!R00:X Y 0c/d0P0c/K0  00S 0 Yp 0 SRPU 00$ R 00"00't7 0 2 30ߍH2SP708 R4004 4P\ P0R4040P0눐4`0f 0 @ 4p 0`U:` 86(06_V04ࠓࠃ8 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q %P`00S 0 SRPU L00$0Su00s8Qr 4Zx ` Z``q XPF 0SU 0 RP ZaY0MX  R*c/v0 0' Y1 0 SRd@T 00$0S ,0S  !$0(0S (0@TP # a P 0 SR@T 00$0S ?00 ZY0 0c/d0+0 p 8Q 0 SRPU 00$0S00c/dpw@ X P2 `0 R(SYPR`VY`P2 08@04囤tRP>ᖤP0 S (0(X PC_oRPU``  0S0S}\40 0 48 8 \R \P0` P  u` 0 SR@T` h?00[@ @ h M`(0P`2 ` =8@P@,@ bY$0SC00A 0X0 0 SRPU 00$0S.@ l @ e ꠿P ~ X | \{ w w A-P`@M@`@`p000,00(0 00hPЍ@u 0 ! ƒI1p@-S@P  0P ! "0 2pp@p@-@P` VP p0-P@  P 0S RP0/P*0    PP0/0/8!81@- 0MQ020' 0S0. /!PR*/ "RR /@ 1@0BQ R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ Ͼ  /O-,M"10P0 00b 0 0pS PV `0@"P`@ (PP #  ;/ P;/P^W0 0P`PU0c   E BR R  L B@FR !R2 0T0TG SU:P0C0 000 0p0pSpP0@ᐘ( T**pPc`@Y* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  P;/ 0P 0B  `@U, ;/PW W 0 0R0 0 R0T 0f:W 0  00@DY 0ZW  P SW0 00P>  R0P0 S*T W  RW  0 P WE  P  B B@FR !R AI;/P ;/PN `P 0  0;/ P ;/P0F $0;/ P;/Pڅ00DP 0;/ Pe;/P ;/PPWAE S ;/P`  R0 RPE0 C 0R[P9 0  G"!  R  B B@FR !R A"! Rz0 0SW;/PBP ;/P;;/P}$ ;/P$`u ;/P` ;/P X ;/P0 0O$ ;/P`W 0 R0cP- M0 00 ЍpR Q0P:Q0Q:@-隼 4C-S MP@  $3/t`  0 QP `Р4P4S  $3/000 Ѝ00A-pd 4V:@T@T 0P0S  00 S  0n@P0`0dp@ B ! A-`M p@P0: SxJPP ˅P@ P 0 (tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04 0B0   0R 1  00 0p  0% 0@ܷ , 0SL@-   00AS 04O-SM{@Ap⇁0PS`*0S'  TP [ P0 00!Q    0    Ѝ P@ $ 0  QP1嵟$R P0)000000S@p 0 q 0p4 S   $3/Ѝ 0000O000Q 0A00/0@-S@  R   0 r0Smp@-P@T @T 0 `pp@T_P`p  0S S/P/$(0#   @// / ////@-@ RM`P:Q !S@Ѝ0 0pP P G@MЍ0T @0 0O-0S) P& 0S# p@# ,0aT T 1 !3/PT0p0CS@D0 T,0p@2P ?0T` BB \|  i V`!  0 0C 0`@ 0p0CS0 0T `p@QQ   D R !,03/`PIʼ0@00 "R(  0Y `1`!0PVQgRJ,03/`PY M 0p0CS@D0 T@0T p P@0S*V* = 000vP@DS*`A 0`V:H0P 00``F0 ``i  0Y0C00 00KP   0 0C 0Z ` 0005P s 00r 00n0% p@-P`V @@D00T`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 0 Pp 0P0, @: wP4ph R0  R/ S/0 0@-@ R 0  R 0   0 0c 0   0R0J0 P @P X0 0 $0 蠬 @@-@`pM`pP   ẗP0 :CoR  S L D0( 0R Ѝ ; 0 Ѝ;0ꄫ #0@-S lMP@ d  C 00  "2 0 d0 30lЍ 0`0S pᓚ0Pw d"d  0R0p0```p NP0 ```0S!$p @ოPa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 +{ 0 0{'{{y 0SP ` 0d pp p 00 pHmPЪ  x Dp@-@0MPW00TaWV( h0T1S O⨜0T1SZ0`B00 UTX!\!R Ѝp@2\!G00Ѝp@)00UX\! X\!0 000S/꘦ x0 0p@- PUp@000TQ0`U TQUP pX1P0X10T0`X1l xh0h 0 R/@-@00 X10CSX1 @כOT140 @Лȥ x0 000S/gP x0 0 R/p@-@0PⷛU00 \AQ\ X! BRX! p@⧛`徜00OT!00p@✛( x\ \0 -4M0 0,008 00 0 ,0 304Ѝ뀤 T  t,@O-MHP@0@Q@0U0B PR"S08 R>  "   T0"] \h0000000000 0#0 0#0000`0`000T ^pp@eR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@6Q `T ` R\ ! (R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/X!X1p@- @0(MT0$00: 0PS` RT= 0ST@ 0 0 $0 303(Ѝp (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@:L  4 O-pM`@P-TP0 +Tn S0T W  p S  0,0b 0 0?0 0 0   p P P=Q PS \4 !Ȏ\ @00D ^a0DSW0DA0DS.70D S+| Y[Q PS \ !Ȏ S@` )"00""00 0S \0F00 ЍS@ `?0v0T0k XR A B0A PR W p ^ ppZ `@p SWMppM\0BR"\0@-0 M@ 00 Ѝ0@!@P0T0P Ѝ0茉 p@-BR"^p@ @P0T0Pp@- M@P` p UT 0S*嬓P  @p Ѝ{ @@wp Ѝ$S T@p@@-M0 @ ; +6P < 00 0 0 30Ѝد4  00 S$ 0 / L 0 S 0,/ 00\<0 S, 0 /00Ȇ 0 S 0,/ 00<0 S, 0  /00(|< 0 S 0, / 000kD<0 S, 0 /00<Y갅 0 S 0,/ 00DH<0 S, 0 /00P6$ p0 S 0,/ 00X%,<0 S, 0 /00dꘄ 0 S 0,/ 00l<0 S, 0 /00x X0 S 0,/ 00<0 S, 0  /00ꀃ 0 S 0, / 00<0 S, 0 /00 @0 S 0, / 00<0 S, 0 @/00h 0 S 0,@/ 00vp<0 S, 0 /00d܁ (0 S 0,/ 00S<0 S, 0  /00AP 0 S 0, / 000X80 S( 0 /00Ā $0 S 0,/ 00 80 S( 0 /00B@ P 0 S 0,/ 00P  @/ /H-Mj 0ЍH-M 0ЍA-`p@P 0@T0@7#0PP@-/"O R ?#0!PMO$; P!Ѝ  0S RP/0    P/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A -- M0 0: ЍЍ/ @@-00M>R@ 0 000P001 200 P0Ѝ[000@@- 0M@>S   "0!,03,0 dP0Ѝ700@-@ᣋ@裋0@-$MP  0  00@PP  BP< ,0 0 0 30$Ѝ0耬<z z 8z G-Q `P@ S V 2" RpSR Pa 0Cj ?o/o0CS 00c8ÁVS& /o?o BR 0 0b8Ápp?0ϠT\ S?? RpᡏVP0B V0 0T0d0?o c001/o?o0Cs! p R10 0bÁpV Ve0o`1000@bq<àQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /o 0@-@$P  000DuD& /(0(0-M 0 0JЍpu  RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/0///Q R Q/U/Q0 R Q/00/Q- S Q P 0S0 0P 0000@-Q @P' ST0 C0 ^@DP \T^0L Q^ PPP 00QPS@R S Q0 S 00 /U/ S R0Q0 / 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@0@-Q @P TS Q@DP  ST PUPQ P00S @Q RU // Q#/  //s R RS0  0/U/0 00/ R S  Q  R  /SR  Q 0/ 0U0/ 00/0/R  -/P0 000S00/R S 0Q0 0S00/ 00/0 // Q#/Q- S  BP0C S P QP 0U0-Q S Q P 0S 00P 00 @-M0| @000!0000 4 ,0 0 0 30Ѝ֨k k 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/4 40 00S 0M00Ѝ/ j x@-@p@-0@ ,p}pPi0Ppt//////| //O-`ἱ4M PpU t j1 00( 06/4Ѝx0 S@' 8!S㴐0S S7 2S@0SQ00P00^) 00@[0 0 T 00 "R 0SPD @RUl00`0 0 S00000@t`0//O-M+0; 0Q000; 00 $0 0%SSSH 0@p` 0FZSZrXW\UTSRQPNJMTJ7}|{zyxwvu?>=<;:9876s43210/.-,+)('&%u#"> T O V V ,`@ 0,P@X  5 Q ZJ:  Qc ^ Z034S0C\ [0Մ0ʄ R*f @HT@Db [ 00ʄ@T*\00F`00F Sbp   00Ϡ 0Sp0-p 0000t  0ST{00@ P T @Q0N @X Z*  QHQA [0ʄQ*p02,,  t  QT{@ Ph0`p`|0PU t0S  [0 P  BT@d0 DK` p0p0$0x`0t 0ST{00@ P`| F 0 0 000`lV` pp`{0 , 0 `p`@p`+0X`0`p `*VX 00F S@`A@00F SQ` d500< 00 0 p0t{S7 P0 "0 , 0e 0 N D L% Z  04G HP@ 0 [ 00ʄP* 0Q [  [  0[`ʅ P00(: ` d & BP Pßc Գ& `dX0Pc* ` PCN0 D LCP.10e0PQ 0LN0  E DP Lw d 0 000  0 r 0  0 x ; r 0000J< 0 0w0 Z0J0H",2 0 0 30|Ѝ0 0 /    X@`0 @1000   ; 0 >@  90 i  @ 0 0 QPt0d0 D00!@ Ϡ 0@ 0 @ 0000 1@0("(0,Ϡ 00`@O02ӤPT0  0r g Dp] (a`0` 0A-p`P@PU J0SPE 8/`uX@pW[ | 0SS S 0R / 0R0@o/ @-oG-` !p1 0CMM@P0440 @  0 @0 44 30*CލЍ  00p 0Xp P t 0 p\^P+  @  0:/;Z Y Y ,j >G-`0S+ S'QU$ pW!@0 S00#S0S 0S0S0S% ;P" YP@ Q@ 0S1S00#S0S S \ O-0 BMMH!dQd2 hԀ&h Pp0 `V' 0 ]dP@P Udd0 ZPEPH <0 0 4 30BލЍꚣW V O-H!D1 0AM @ MT0402 0Y/:0`x0(SP05 R%S3 #ttx0'x 0@T dd 0 }P pW t 0 cPP D0 0 4 30Aލ Ѝ x (R@TV TU O-M Mp /? t0060K @?T000 1S 6 S`1  0 ?|@X@0 Q0p t ) @0H0 ^0S3 S70PuP`p@ R HP% p ]0 0P R!R㇓ 2P PpU`@P0STu `ppp0S`V@ 9 S  R= @0L0=0T0<0d0p0P0 0 @Tc040v?D0 0<0\4 ` 0S1S < 300S S00X01< 021帑YZ0H0St0(0p080400SrATo <0CPn D0PPPyl 0;X8@( ᥢP @0PP 4 <0 @4 D 0 T<0D \  R H0S @0S <00p0^ S00H00ST *pt`P|@P 0@9/P |T+<; 0 6 30ݍ ЍpW 4@PD0Py !㩀D0P0 w  0 ; X0 D0y4000SJ0X0K<0`S\0c  F`@pV0G  00P`?<0 $ ,   00"0 0,000F000 0~PP0 U0A(  QO `1  0 9L0X0 @0Z@0  (0@0J$0 0 0 SNb0!刐?A9c!@00~P 0S @0P ݇0(@H(H 0Q ,@0@0PD Q  (8 0 P0`1  0 8T0X0 @00 00  101 0@08`(0 0K~P( w 0 Pj `1 q 0 070X0 @0_000 M 006X PY0&0<  X܆NP 00 @q @1W㲐@D0 `Tv?P 0WP G  2‹U 0 0W    ‹v@01粐0u 0 x5H0@X0 0@0$ }P 0D @0P 0$@$ 0d (0d00@0چ0$@`$` 0N0 AQR`1S% 0   0H0@0`Tjʌ |P@ A`!!! Q=   30 @| X0Q  &0H RC AaV v*P|@p t 0@p6/P񏐰b0+S .0CS)[@Y0P TPPU a0 2@X0 0`!02 @\Xͅj S0(\01S< 3`0`00S S000`P1E^`0 N~P0 `0}P10180@PD `hP p08 00 |800Pb00 P 㸠D TP B("(R0D DI |P0d0P0@@d06S0V. `T T fee4P (bC_ _^^]\@\X[[[ZYUlUxUTUTU4TTT,RSSQQQQQPP\P,OP 0L`6Sp[06("(H0 D0 P TP B("(R0D D O|Pi0d0f@d0P u0 @$!$ 0 RV 0R  0`1 d 0 X1x0XP0 &0R E%RI0!@! 0⽄ 0 P 0 1 X@0Z0   %_ TH0Sa =00Z0`"0x"x ⏄3& G("( 0R00 P T B("(R D  R,#{Pʍ0 P @0 0]}P`P 1011S100  0 30X0 l'<0d0d000 3@X@0" \&0R $0 3 X04K0000]0d0|@z0P ዄ0p$@$ 0h0d0e00`0 WY0+S .0CSBR@P0P a0%@4%4 0ՃWt 0|p0|(0d0i10P-0@ (@p05 @Xೃ20%0% ⦃P 0@ 0,&04&4 ␃{/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@{P$Ѝ0 {P0͡"c1010$Ѝ00@-$MP@{P$Ѝ0 {P0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-#3 BM M0Pd0$40@1$p000 S00- 0p  P@QP0| T0^ PN0P0A !< S R0  T40 ; P0 0000 ; PP3 P0. ] x`10$430OBލ ЍS  ] 0S0Q4 Q. Q( q]     & "448#8 $$,  h("(H]D]A]8; $@ @+M9 LLTLPC-PH AMM 04@`p" R3 j 0@ ` P,8ĝ0  0 0 4 30!AލЍR PP 0@ .R` @@L ؀D D 4\꥛7 KL7 'KJO-!1 夡0AMM  0 40PIzpPLpPG `ਁPPB @ t+0JP7 0S4 `  0S+ 00@ pw=P00@S 0S0S 00@ K@ @ = @_ [D ,0 0 4 30AލЍ,l6 P6 xJ04 O-p#3 0CMM`0,40PX\@@I\0S  .S@0SV:T d10S#0 40 000$0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $\000$0D DR @@ 0S+ .S& 0P*0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@ 1( P/d!  0Sx0h 0@$0000\0@P@Tk0!0$  00$0s}0S 0S y[V0 gO0  h[,4 3 O-p0\M2@0`P&T V E 0 D#à  #4:U@   440U 0 \Ѝ!0#A# 0  mVX0 0 F 0ZP0x 'x&[#[0SUPPH   B RX00 0 BcZP [[[Z @ຠ\Ѝ0 `F 0S0   Z Z Z0 Z0S 0  @<0\Ѝ0 HDC-@0 M(p`P)@D T@/)Z0X Z0  Z Z "440(",4@0 Ѝ,  AAG- p崒Ḃ@`P E0S@P0WU! uZ@qZP, }EG gZE@(0`( "4`43Z1S//0O-䡐 MP0S5 DdDtD`p @ S S0  P&  P0 PI  ~P00^ 0  SR 0  SRS Ѝd10P0d10 H.~0P !~  FP  ?P060 0P ~ 'P   P090\ }000<}i0:0  P  P090090| P010r  P020h  0P0Z^ d@?P 1? # ~ 0 2M$ 0P0ZC @o?P 1? # } 0 (32 P+ @ P010  P010@@@!@???p (?H?>H>>> T>= ==\=@-@HMvxv{` |  0 %  { 00 xvxHЍp@-MAT Cv P00 ``00 0~v 0 0Ѝp@@ԇ 0@- Q0|MU0t00& v 0p`0# @00 :e @ 80 0 t0 30|ЍPP>% @% A-@Pt1 0!1n0SuOPpPp tp0Sp@-@QU x3s|p v{01P p{01000ptcuVxxtP // 'P //9G-p`@>W`PW00V0S@ 0PS1S ` 0 , `*: O-M0MP@050W0*  OT: 0x`@(,d!0  d! . 0`1111A05<0yPw  0ʏI @yp d10 d1 P `@ ]|`0SH _D@G S`\  S S00 Q`@0S SP C0SQ0 0CQS000008X|P @0PP 0+ 03EP 1#S;S 0t(S 0h(Sv 0\(S: 0P(S 0D(S 88R0sS2 S S(  7R2 S S0S0 S S SS@@ ` `0{_A`P@Q"0A'A+S? `7R2 S S 00R00S @0 S S00 0S S 50 06Hw0 @70K Pj< Rf0P 0< 0R@o0@PP0d!S 0 0 2d1 Ar| ᅦ1 |EtAp 0τ`0S V `0`SH@DH` .S`0SV Pp.P`FV00W0S  00P $ *0$00p4 0 5 30܍Ѝ4 RB T T Z|40p00$0l4p0004PP(`, T T@ TT  ;T RO@T $0 ` ;T 0000@@T P 0 0P  @0劁$ h1P @@T;T P3P0 0000@@T;T   P @ Zl@(`,0p4Pu 2R2 S S0Sj0 S S SS@@`  ``}z _AP@`0H SD` \R?* S S00 Q`0S00`07<OΔP.eP `z1=C` l DQ XaD@`yQ<0 SQP@* lP  @0劁h1P0- qA`>`Pa0 2 ?U # "  %77( domasearnamesortoptiond6inD"er4H\33 listch,/D//!1 p@-Phl@HMP ^  T 000HЍpp Qx#r crV p 1 xT000000rPT $000HЍply$yxA-p RP@0`P  R P  @R0P\ R 0  0 L4H0O-QM y0P0 ju0P0 ` (0P $` `   [JpPy vPZ @& TO0 @ 0- !H#Z0@0 0@P P vP0S Z @P0 0] R"H`n0 P[) $@ P@ c a Q `U H #Z >[  0 Gw^00pQߍ P$@ ` 0CQ* 0 0`$ @ 0` `Z Y 0p  S` :@CT0:@D`Hⴠ0R  `V@D$` R @D`U+ ( [ 0 @DaU ` 0  v 0  ` `劣 0  v0~ 0 z @0@ 0@-@P @ B 0 0pxd P(0( 0@-@PY00  00/, @-@P @A00Jx @-@P800@-@ P 0  p@-@`0   0M!xPP0 "P IP 0  ЍpЍp 0  ЍpX P!P @- MD108Q0pP SpG0`S `[p4 Ѝ@@^uP 0XuP 0S@ R Ju@P  A0Zx Ѝhh h  0Nx ЍDD D T D0qqX%(%$$ %$0A-0PU" 0U"0PUP!q@@``FtP $tP 0!E`1$(`P 02~Po''oO- Ff@0S` M, 0 4 &V F$0( P@RB 1ȖqYT0i(1<0 BRQ#)16: 5 0(< ܅ 1 c0Aş0 p('(p4< 0P(0 Pz hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 ,00,000S$0 00ğ00( X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LgP0440^# (0p Ѝ! qQ 0Q*# 0$|3!0(08Q(%401Rx$# 30<!^ ^ ഇrp S:p 0(" <!0(0% P^4+|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쁟00(0(1 0( 긁(0(10(0 R 00! 0t1t00`10mZp (4p Ѝ:p N5p 0q^$nqpy2  Z 00K Qvn n|tnnm|mDTm0mml!lt@l0lkk@PkjjjXMP( 01 (0 pqPP$  0P@1@$@P@1@0$P 1@p 0P$1Y,Q$Z  `'10<0Sx1 0^O }σ P +>  P(1(0?:Q@ Q10 p0@`@0fF`b a`\ a`8`$``___t ,_,^^h^ ^]PL]4]@\[$[ZhZTZYYh hȓXWW @-@P00Q  P     $00<0 0@ ($ V4Vp@-l@@`VpPPp;0U1pPE1PSp  (0$ 0pUQA-pA@PT`QV0l@P  0 pPP``p`"@D A-p`@lPP T  0 000P     @-@@0/P 00(/,T000/T004/T00/S00/ 00(/S000/S008/S008/SA-``PU 0AP ppR0APn<0< 0 ,(0tSS( /lmn/< <0 44 -0 M0 p ЍR d @-@0`00@@-@Q 00 2 i 0 G-PtsM@p 0pD T 0S00{000 00 000 0$00-{PP 0` 2) "Z &= " 2> .0 000 0gqp X X 000@ g@PЍ <R 2"00@ϦX 2: 2( ahP0 0Z 2< 21!001 001 0 0100100|1 00P 0 R00   0,T 0 2 13/pTd00-0`PP ` 02 2u00@Z@0S{X} 2: 2p iPv 2 @0 2D001800 8<,C-`@ MpPP  000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH UP (0$( p 2 P;00 ЍP Ѝ#00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p M ЍR @-`@ MpPP  900U,0`V( 2S * 2 P13/PPF `P 0 p 2 P00 Ѝ  Ѝ00P2!O-RPM1: 000 X2*q`I`[ 崘p@ p W  4 0 P tZ 2< 2ЍЍpkP 21O-MrX>*0`0Q̡J0P@wp@ W Ẕ PEHkP0# ̱100ES 0 Y 2< 2Ѝ10PE P 0, Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍjP"! ЍG-Z RbMp'*Q* U@0U @ RD0  P X U 2< 2Ѝ@EЍЍG-邀഑@ 0`P? pp Ip("(R1 B!8. 1!` 0S001 V 0N 0 L Ƞ,Ƞ\ L Ƞ,Ƞ0P8#80\2N0C2pp@- @XP ` PP  pPp@-`P@0S  00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-@P4M0`S  H00 Vv 2+ RJ 13/p* 0 00" "00  0$04 p`0 9/P 9/P zc0  ^ 4Ѝp$  0qp 0 ĖP 2: 24Ѝ?(0p0`,0 09/P  R0 YP  0 0(!S$! 10$1\0 EP 0 㼐ᲀ@p 0p 0 S F10@Rx ἐ$'xP $10 $1(!00O- @1T@0 p0CS0 M@DP`!P a V`P' 0 0 cP 8#8R0  Ѝ0 0S0ؚP 0 0Pv000@- M@ Pp10 Ѝ0O-M 0`p0 DHP@pC ٕ P/  X00   0  P @ Ჰ @ἰ0 `p0`000S XЍ 0  fP   C("(0C 0@0 0[P @G-`l"h2 0(M0$00w?0 @Rl2 S:0JS P Pp2 S 6p %3 P ZPpA Z1C PJ: A  W#: 0C8#p#ȅ@” 20 „ 2 0 0 $0 300(Ѝ00C @ 1px'x op    0  ` 00 p}P202{й L A-p@MPP`  00 2   Q `:1Q堷0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E0 EP VP V$P 2: 2 0Ѝ00Ѝ0PU Q:(0 $P0PU`PM]P  j^P 21 s_@--M0  @  fXhh 0 ST000S 3/R NXIY4h 8 80 $0Q/$$0S/Xe p(V<<0 0R/( 0S/e xUA-@T 0S&xp`/(XP0P@QD D0@`uP0 A/Pl%O-@$M`KW`T hpܴ4$$0Rab    WpV9BP b0@SFSC$<%<%$$<%<%<%<%<%$<%$<%<%<%<%$%%,%4 A33 $$3 $ $3  3 $$3 $3 ($3 $,$,jd3 $zd `D`$Ѝ $  ( ,  C # PU! pP "P6`@P@`  R!PxB `  p  BR MpPG Q]($R0 U tWS UX,$R$ ^wp4 Iwp0 W$RD $pR $R !_&@ $R $wp P$R& U Q R  T$_&@ @ $C@  ` &@ T `   ᭊp Up$R UMwp -wp P  ^wp U@? Pzv^"B%y%Kt,%%(%؆%REGmpˌSNO-pMP@^봳3#`@ @&e#|3pB RP!GP P( hwf@(hPF  H@ P*`)`)`)*`)`)`))`)*`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X D㑝` `Z`r`T စPP   `Pd 0)̱0V!Xq``pyWp @P c% B R+++4,+x,X,++X,+,, 0S U X ˄0S X  R 7/ P  R !?$ _  '$ _  'P0S PX \"$t,y%X 7HqԄ&ˌ@O-PyM$I` ]p000 00 lfp8 PEU( 0Ra S 00 0 ̜vPePRP&GPyf0@S.--.--.---.-.---.H0@ St.---.-.-.-.aP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0S 0ppSppU PE0U4U& p P Q6P/[  00010SXV0Sppp C C0S S/R <OVp0SDUa(0S0S 0 0 .Vp ! 0: S UH/[0% $V0: S0( 0 00J0PU   0P0 $0P 0)0P @/P050CS"121221221$ `] 3& /& `00PP0S \㷛0Sr 00 $  B R0\ L` V, `Q& /0 J 00 P@` 0P` J/R  S/R/   C  R: % ` = 3 0S S/R$ 0RS & U0sX/ HL!R\0X\!R\ %X00: S h C C `LU0: S P1: S ,T : S!  Sn  Sf bu S_ S L0S !vPL,0SK  [F0(尥 0Z i%Z80 S80p1p!pp "Q UP!P1: S 00Z0S 80 0CS!800 tPR X0|S *%0S !v0S !vlY%I"y%V$$8ˌHq@^o6W}8m(%6?O-P@}X[H&dp<868V@,FwP60Pf>x0S0 ` PSP 9ox4P080540HP xP0%.(0@HxP7AP0\ X5X%HPRP8P H08 00$%43/00000P84 "2x4Q 0U0!xP (xP 000 000 z@0D 0 PzP0; S @,0(D 2#!H8 01/0TP0P( S/,2PP P0Ys0 CS 01#SwP0 0( ,S* B<"!0 0 w8PH0U 03/pu0SHfH0803/p,^PP܂ h`0ld 0 GS * X 0 $03/0  0-Q3  Q Le;x0 0 -1/ U;P0 0 0 0 `0d 0 `0d P0$ ,!w 0,ؠܐPYZ0     00h0 l 0 h0l   00 R0.x0 0013/s Sv S=vXP\`0N ( (0, PU`00 XP\`= :W"y%0&R$&K@&ˌ0&-М&  H@&$EO-M Mp4Y@x$$H$ Cbp 0 Q 0  s0(0G@-P񟗙0?>?@@? ?D?T?@`?p???@@?@@?0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S $:PU RnR oRP0<0,㋸`P  VP8!`P,wPPPPst pmYWR8S;T5PtaP<4 1S}H @0R. P`V@0S0H0S 0   {P P 4R㓥'F M P3mY`, 0| ,0Sl 8 RS P0SP,P4PD0S $1V<+0P43X(D`娠pXV 0PUc40S0040D0S [xލ Ѝ> ϴZ P <3 ,HUP(T 0`F40P }QP szPPT0ST90P: SczPPP401!P4L  R p PP T0ST!H R 0 T0S$" !pSzP4T0S1 !YT 8SQ # WpVF  { <# 0+ <# 0+ $ <# 0,(, <# 0,00 40 0 08 <0 0 0@ D0 0 0 H L0 0 3]P# _P$ wP"=H&t,R%y% |hˌ{ 4Rs@-0D9TdP00000Sr0C?o21 `p0 1000C00S8 000-S3 0R2(0pP EP SP *r, (WuUsP xP4 3"3 "3 "3 !00000C0irP=|tz@P4 Pdw`lT$32S D#DWSQ\PBa1S bVRXM=PL2S$ 2"eWQ({h2 0S 000S 0P 0P~PPN000!S 0  0S 000S PV崷:Ua`0:E100S S !0`0001d Pn P E P{r r r&@2SzP@`aƌᶹPW2Sw㯹P0"lV XVL@p㜹P= 2S <0"D\&y%%t,dVPe&&TpMؠ&ˌ%+(%A-P@M`/P@J@P2 xxBp ^p=X2Q0=q E  -P f Ri Rk R3 0!BSQg 4OPb0: S^00  !^p10 ER!MpSwPePLP PPp FP f@PM8MMM8M8M8M8MM8M8M8M8MM8M8MMMp000p0 0p0p0pp pQ |oS N@P0: SpGP Y@Th&y%ˌ"OO-M`{|UMlrlPp@ ^pH20!1S U``$ NPj]6 `[A PmP pPP mAX|P W{@ T` |pl}000 00S MNP"0 0?NP 00 6[` 5NP/  Q  T: (Mp [S0S T* `[`Mp5 `"ky%ˌt, O-JM MPz Trb@ []p1 PEU A0S U  GRiP fP hP ךvP00@000 00 0@E MpP0: S(! ⧼ P` ! ㎓0P 0Y/S J>00/ `$CȰPE@D0p/SP/#P0 S: p  ᕪPPU"$&y%P A-`@MP$D=z 4 0執 cMP  L YMP  {L OMP  qL EMP  gLp޷l30h3PPP P$P( @30P+( P3( P7( P;( P?P(  PP( P P8$@Ѝ(P (PT"(0S (P(0S (P(0S (P(0S (Pq0S OKPb!0S0S p XP`PPa D1R`PU 0E /R OP(#PU  00,0/00b400CSWWWWAP0$0u00S tN붦0s00CZ갤0Q'%$PDQ'@X$@$O%ZJ4%&`&_%A-@Py*Sp` [p 00S VaPLP PP K``PP $ 0@Q"y%%(%KO-MPxRFp` i[p 6@X/ʼ60S ЍfP WP! PP ` pRP dP IvP iP00` prPxP ``0`0`$`a [1ES ˵WBu弅PU K$0P S0Sx{3 @[*0/S /)P0.S0S .S0SZ4  0  R @  0P0S$0PpS 0S@ W`P X`?PP0S <8550C SV]]]X\]L]\]]\0$S P PR 00$ @R 00S $ ?RR00R0SW3 $ R  @0SX  |P 7 0!0 0C0 CJP 0S'  20S 5S 0S 0SJP0 0~ zX CPtI{0SmP h0S n0Sa j0?S] f0STO^0S Z0?S V0SS eR d000: S0S@0S 0: SCIP1 0S! S /o" R P SI 0SWJ ?P 0S 0?S 0S0S F"/(R'y%؎ˌ0Hq@%050G-P@wHQ@ap Yp 1 R1 0C @`P OpP vP0p\IP 1`0S WP /P 0S 0S0`;IP4100S " y%PR'ˌp@-PM  7 $ 0MHHPH@IUITD0 00bHP00եCP[3P (tP 30S S! S 3 Ih3 ! l3 00T30S  R 4#6 R #!SR3B$3 3 /20S (]2 20S 0S'002@T$_)0"P@4B00CS00 {$ 0 D ]$0S60016 R0S 10S<+)0PT<001 10SQ 10SM(x1d1POT10S P10S l1 `1 0S  160S 8$ $@$1 !I01.(  3(0S0F0S 00q0S(0S 00@P`@G ToX'";0$0S'lS'(\'S'8S'4S'|,;<$D$<$_'$l,S';|G-PM }uOb2r@@@0 S X" WpC 0 L1 0宲P|7x HPdN0`x HPLF0H8 HP4>0T; 0DS 00S8 0xL@7Q0D0@0 0Q)@0SZ L zPU+a0@S񟗷ph4g4g4ghxhh@|FP `@@L4 g6P O4P 6P 0@0 00 ?@LOLO0@0 00 0 ޽PL4B9D0S hx HPT/L"y% y%PPPBt @Pht@Qt@Q؆%"Qt,ˌQNgt,Q@-t8FLO-M pttN`ihT@d$`@@@0o0C?o20,4 T$4p 4 00S ST [@ Y`> Z``: rRPGPP! P9H@ Pk$k$k$kdk$k$k$kk$kk`hP dP fPvP$@``j1 0T0 00; R4 : ᐭP @D9A0S #S!9d2 00 0 -`PXL 0Pp#>. P , ở p ᳟p 9  Gp 0S<0 0@0050C SRmnnmnndnnndnnnm[  ӽ@P0S? 0ˌ$ pNp ,0 R qX  Pp P    3/P00 S .$ p~N tpZh000S K"a'Qp$y%Qt,@7L$a'&@HqˌȄO-M MPJ^n Ҁ50 0 55005尀<:00( P 9 pP  pVTP8Q 8A@6P񟗹pqqxqrqrrqrrqqLs@rrrDsrrrrprrrrrrrrrrrrrrrrrrrrrssrrrsr sr,soOJWPE2%R U%RpUQp0%0;㛄P%5S 0OEP80: S0550GSDxxx0y8yxtU%R 2' WUz05;Ur>岯4$04P0VK⹊p`,`vvPP C\$iBC%daE6wTD0000 00VCPP#2 NCCCCCuc0P` 0S #Pp@KS`0#S 'C,De ~o0E?o2? C `V4KPPe,f/;`vV >`PmDh0KL00CS0 vP Pp PNU0 P00CS0v0 U!>0S:00S:0#B2U51>1S)1S 588Pd`d!iB`0U0w4 =P 0PEUiP@P  f/呷0 WT  Kx8P(a'[o\( \[*\H\|\t,w[[[[[$y%b'ZJ\wˌ-Pa'(%\[\5-mGm\%mdg[Yha'PC-*E0 P !`p@X@PdJ PH`00CS`0 hK@T ЍX0 X @kH('(%PO-`脟蔟褟dM@pP0$`(`,`0`4` ` 0R0p$@DTlUU!Z  HtPcPSPPPPd @"nP tP0 aP` rUdU 0A0p# dU4 RU SU" QU040   pUY [/lUT yH  $ @$ -Cp0 dЍ $$ Cp 88 Cp( 8U 8V  HڱT@D"FPPp`t  `TEP8 Bp@L7PJ7,",`!u ! " 0<`QBV!  sP Q !70P0}TH.9 0S@xKItHI$H'BxX8 DB P P% 7PP%H`V08c8 p*P0ZS H  {@ I 0ꀰ倐`DrQt,y%PrM8|s~D\rDir{Dwrr|D(rrrrr}Drrr s6sˌSs%yaratcidO-0-OaMp$22242222322 pp.$ }Qpb>4 $0QPCn2 0000U1dR0 U%L0 PPIp L)EP L0 PPHpd2SPAPX0: S0d2232d2oPPS0 |=Pe0SX GT czPGRP 3P@/PA1@P>Ѓ؃S@'P6DP\hlxԄĄP |8tA@PH00H000k0 ,2q,00SP *;.0d2+042(02%02"0202l[lk@ @GTaߍ02 20202;/`]P 0S 8Hp; 000P00S *Hp- 00/@`P Q Hp 0 0/ .P   R  Hp p0S Gp0 0㰆)0i2000 0B BqP 000S 3 S;3ŝ)di00 0x ZP 000SX"\2R@RX2i/ܦP P@PX0 : S8 q `P F/ƦP t( 0bP[a?`PtA({@p X:x\10D  X40*> X %(>:E!14'S>̂03P7  `703P7`(7 P 0@ tQ S`2S S 2S 2S0 0s  [ >p d2SL @pV X!\1 >\1X! 0 \zF02T7,2P700PU%.>pP h':>P@P%GP H4U QHh P}QXx 3023,2 3(24T\2S(",2QX"\2 !14!8!4P@0+ ^0 \  ` v $!p  ZY0d2S*'0\ P[|PL008 <04DP 40 S8 *"<02#L SXD0 U[#0R,b(H"L2R0;\2QP 00'$$y%H'9,t,;\W`<'}'w@'Mzˌ̀'U CuM/́ց'*P'rdA edAX'''~>jE'$׃1 SR Q  RQ!R!RS !14!8!:)>04P`CQښ. .a0C 2 0L먴't,Xy%edAiˌ8%'"'$+"'1koȴ'zd@x'O-`؁ؑQ@p Jp%W㰑 0S 0S  p10`VA \P hW0S PQH`V.Z ЍyPmPPP fP qRn0@ S\Ht00000000000000p_W 0 aP "RPRP 9XQt,P'Zy%!sO-M4$` :P! 9DP㔔唴9p000PPPt$Jp3W00S 0S 0S 4 Pp(4 a X' 0S00P 㹮0S 㳮㰮PY30S ЍzPOPBP4 FPo vP@*PHl\xġܡ 800 "P2  P20{00 0bvp@o0` 0P00e D P00^ , 0 cvPV O Q000M00J00G 0mv1 P :000001000-00*000&000"p 00000000P0S[PfW00S 0 fP~!:?`I%zHvZ E8@vZt' p't,'y% 4x'w["3p$XksO-@MP8@Gf [`(YPUPE10ŴvPlP,HP8 TP3@ ` I9p@-  mqp@!0 S < Q <0Z@y m@ Pܥ8ȣȣH@Pȣȣ`@" Hp,2 R Q!  R 1,0Q ,0P0S  (  0@P@e00-SF 800$0@ p0;@P?Ѝ$0pw1 4u!?$040P ?000R0Sp c```8㿵pW0Se0S } 00 0@@`p @$@ P@\ m 0 3/p TѲt,y%N$@-,@,@!@-P' $O-@M -,@ϰF8 0ʰf`P8p^ p p <~6 R0 8 l,/0P0T 4PP\80DjpHP88F U1 vXF0G(G0``0 `IPHPU0 Gpp 5pO005S 0(0,00(00 0HP,PPx%x}PzW`WNWU 3AWF CW4eP p  aWe CWe LWf aG Qk Ī̪Ԫܪ$|WWht$  C$ RD -(K L J ~dO {05xN 3Vt V``C `pM nH l$0%c0!0 0  $0S@* xV}I 0 V 0`Pwp 00Jpp kW {m0G S=ꀫببببببببb/b-[m;PH0SI0SO005S* L+PO0S U5S5 ( <p0 (0S 0C !P @P!@p``Gp! P|! Pd! 0S1H!3/ 0L`@ PL,`P ;, ,P1!/ HR #b0 p/ PP 0 / 0K0 pS8$`'($.$Q'$iX$y% $$t,@$$:*k i iui :m@-OP a|@18 '\p@-D@DP @( p@'l$p@-D@DP@( p@$'$H$"A-|@|p `(P,0`8P@@@40A<'`$+$|+G-`MD5PuP5P0 Ap) Px5\y5@P L5HH2<"0@<2P 44Z 6 H⣣p HQ 5P  a@1  p00 @ p0 @ 080<0@0D00 0000P0 0 80$@0P  84 HL@P@T@X@\@HPf Hb745434 0400,0( ,00@@0P<p&PPUPh0PP 0/`ЍA.Yk*4`>p5t$ DBBAA'O-0Mp㬖F(00P6`p0 Dpt6Z0PE `V0SPvPP@`@0V|P 0SЍuPfPFP RPg g@Pd00P0 z0#S /P00 $$00S $ $$00S bpP z0#S (cP $f$0(0Sy  $Z$0(0Sl00i0P ᛪP_;q Z;q U; ;` @fE[w a3C30 @ RI0cS pS< bSBJJPEU ]0P 0U8U U,P 8 80,3/8 RP cW a@}3Zg *3P R00C?o20S^ qXUJ "z0 $0 0R,0$00S XU 0H 'լ0S 0P0 00010S1 0S 00 P 0 0 Q0s  1000,0 0>383P7Z @0 $  32&SR @0 #  3 03  @0 R T 2Pq(00s  2pt0 @0 3Z t,Hy%'ˌ >t؆%aO-P'M$$ M@`p$PP Bp*6춟p0@DT00SfT T!qwl@P XkuP㈦e1p`R 0S* \ AP? a@PP񟗦|5pP50S $'PX y눥!PX%000P00 0CT 0p P P P*P% P p بP P( x}p qkPpq/x00 000#0 00$000  P @(qPPd x (P(Y@X 2 PyP(!|rP( (s@P `Ht0 0P(`p` qkP 00 00$00 0@Ps@P s@Ps@P s@P hDP X?P H:P!Pf@ 2P Z P( (p` P( + /⸸Pm``ᝥ 0V@ ,r0 00p` T!T2P00S4ؠ00 000$00 0 ( 2p00c0Pa0SJ+S'- 29S!S@ 1Z)Y x\r`P'ݍ Ѝ y%'q ~t,1k ˌ )&  O 'zd@X'edAyzp@-P@^p@-P@y^_p@-P@q^@-fp@-P@g^\p@-P@_^p@p@-P@V^p@O-nMM0000`4PSP 0~0 P PPG  >R~p> 0 @p@7x>p?a0SH>D$RT$r R  $t ▩t00<4A @0<4x00 <$0r0p N <4 L!H 76`PEB@D4TG444844444Tt444 44444444444l4LL4444 4D00<@¦Pt< $yṦPt % @< l0< $$r $d8LHᢦP; $0 00  0 _<M0K0(0 0,Q;0@= mv; \;$40t0 0 0 8$;&0<0!0 P 0 *: 00(0  0*:$ 00!0 0 |:(00!0 0 D:,0\0(0 0 :0(:@90S *P8: 000$  Q!00 0 :00!0 0 x:0\0!0 0 940$0c 0 ` 0 : 00!0 , 0 888匈@0S C.0 ehPuVhqᱥP0@4j ᪥P@d 8(u$8@ᜥPD40 tᕥPD40D4LT G 70P 0A (000 1 1 B7C0h7@+P00(7 000  7F:P嬕P/᧕P l>u0S\ 0T40000PEU UZ ⩧ z⥧0pPQ 4S<4Z H4L$0 &/pm?HL4P4SH$L4R0pl& -p\P C (/pD = 4S@00\S $EH?QHHLX00 $?D5XLH gP? tk nPp%;P.nPPT%Tt.p X1: S(%,5 $RV-@P%, mP$  㓤0IPXZs4S04z?080$p!x$ ,p = l$0tP$0 r04 xP  sP$,03}p,p40S0X44S@04S x2S 2"0# PrP 0T40S EP 3T#0S T4S`4P P3 2"Fx2ŸS H$L4P*p t0 L4H/0#! 0_pH2 C  s0, :pĞt  L6 0P0P+ ^!L4HϠ0# 4S 04?X y3뼀04$$ST RQ  X  0C,0p XR001R04Qf ;R040 Q$ Qq8*m'y%`t,w[%+JU2 dI؆%X i$Y  G @'4{Hq'%i'' 4H_#EaK' `,u$%M9X_mHL4 Q} QQ040S[R0[ 4S$kP 44崐S04144 0S @4S 0 z0@4,4S $4R#1ѣ1,400 0Uu +t +0S =@p@) P+ 0!dtR3>0]}NP=. XR04ʃ1$4Q :$4#+-T4S 3 -4"d0t%3+x+v+t+`A,\4$H1H4<$L1x000@ ,pbt➢P Z > ⋢P⒢P  4Wp  T4 w U4.8 0D (O-IM⤹i M0p4, ;pP_h9`4pGs04WZ hȤ  ĤYa) 4S<44S $$4R0(*p  h[,p  4 SP,0S x$0ㄟ $tZ0 0q $0x P$H 1Sh  $$4Pa*`qZUCUʝDPEUpxXtvbPEUU(XP6 (p'8#80( R&0C RI ("(q044s04=0t0 0 0 p6/00!.0u 028PZP ̌p ZPUȌp 刀pp)Pt +@ lUpeA67y%"((E7؆%7(7e77@((48!8(B80($8$ (( 0@ x0@  0PUhPj 0C Sg0400000,00(00$00 0000000000 000000 00x 0p4RE PPH,<PWE ,gp(8; 00 L0%p8; 00|L0 %p 8; 00L0 %p  8; 00L0 %p@ pHR  |0 x; E0 y;z+卙0;0; ; '0cy;0z;(0x;+2(bPtPL0 %PU;"0#10@00 0`K`QH  `   `0 w%P|1K0S PPK0 j%P$ 0  003 ]%Pd B0Ss C,``0 I%P4$`A%$㬙P0d!2 (100`[[[[,Q0Q4QPPPP8㓙k d<;SʜT"%>@ goz䛟{ k A::˟c%@ 3UoVz{ k A9I:`"2RgdD' { @`30S 0 } ' @MHIN2 X0弅#pU00 ی@+0@W0 00D+PT2 ppW O P(2 $PG^AQKW$P, pjc1{CA{7ZA (H{Gz@8HIN T{X({*D#@T7 X0S3 <%0T0xPT00P0p+t##P C0S f bS$t;<000[ Y0 0 |A  ++d2"SS% 0 " $@-C6?8~A@@( (t(8%]7((g88(88%8h($< pI1 @S= 2R`" B8#<48#8Q``0!TR?LTXd%X0 0 0 d20ҋ "  5  `ⵗ`0l0hd?ph{2{7@{{{{{ {  M 䂟 3P ŠU h2Y0Ph2d@ g P   h}hE 0Y 3# |@0H #$$<0(0"(00 2 0BS2 (S:; 4 0;u*U@P4P0đ#1!(0H0C8C8S ! 0H 8(#8L"(V* 0 $1币;    0; A* 0@0 0 U|@0H #$$<0(00"(@06 P0W 0 l0 JD0vD0P#<0[^U  h($99C9n9%((9(3o9:7:X:u:4  QZU|T@0H #$$<0(00"(@0 0 H0D )P崀崐0ZP)0  )0CS00L0X| 0 } Pz Q=LT\dlt|) 0#!)0닟P@0f|x0 2 P/ X0 ) P& Q (08H);)0  P 0#$$0(#"(!')0 P )0 Ph 0 P Q Q 0,q(o0 P s0 P 0 P 0 P 0 P 0 Ph 0 P D0 P  ( 04 p00Sk ES S U|?0H #$$<0(00"(@0P(H:::::;&;6;G;`;z;;;;<<;;<%<Q<l<<<<<<==+=?=Q=f=y===(=(===SIZ0KUI7PY(DDD0J0ZD0 I)0K 9+ 0K2  QJY0KUD03 +Y tP UD0 %(D0J C 4 ḛ U\(PDDD0I0YD0 0J#1 K#+ ' qU'qO-M`PBT0@-S@P.44 @ $t  0p+40SP a`F0pP[PN$ȳPQNpKG4!PN ( fP@`3 pC d0@SD L,4<L@20SK@HGG 0< 0p( (Y \fZ'F_`PP`0b 2 R u( (0 S i( d(U+ 0 z(!(00!0(Xᤔ㡔㞔㛔㘔 㕔p40 p0S X` p0S @P0p@' 0f Vps`l) >y%ˌ>lc>">4>":nV>X>G>e>{>>=>O-PAM M@`᥊xxWP l垊d7P000-S% @)#P e##Pe0@K p0\Z f%`F00S@DDA@D`v +/p .6p0StbLPt63 Q\  %"P -00 R'`@Z-00  D0B5S񟗊\ P P P P P P P P   P P P  P P P P P P P P P P P P P P P  P  P  P   P P P  P P P P  $  h t P    00S &eP}!e0 0w꤄`4P e00i00f`400bd4 ^0S Ld V44  R00Ok&P H ܃ 300S P60$010(0.0,0+ t0C?o2R0S0$0P\P @/v@Da0($!T3@00`FrS; RS iS/ #tS xSr$"똒弢+-&0p 0@00@00S ' 0Y@T+0S cH$z.A$# BR0(0/S j (0S  0@+G  70S (0S p|10l 0TS 4Lv:(0S (l 0@*x! #P+_% 0 P@T[Fk)ZJ}Ay%A@t,@@*@$ Ao2A@AZA:%a$;8?%AAAO8BPMBB:PO-LM)|@pPp/U-p\?,#@DRQ0I < t@@0SR cvP cP SP- TP0(3 LP t,d0@S,,,,,,,,,,,,0D003030800H00 30$30,3C 0C0U U0@0 B "00 00A 1#P10C0 00A00C 1#P 0 00A00C 1#P0 00 B 00C2#044qpy 0P 0PQT)_^JZp3V u`(os`F P% 0SU030#:U %5P|R P l 2} X' P&T6K/r0+03PvTS0 0S0# G@SPE*X: P 0 0<6SR46SR 0&2RRPh2 01 ֊ 6S |*P W0`W  0OP O*Ẋ!EK/r0*,6S m/`P Y0!Q5PVյ 㖊͵<6S:46S: d1Q0@6D&S|1 0 00Rl! H& R\! $&TRP! 8&RD! 0&@R4! Q,!   @ GN @H@n|0P,l4*y%lt, ms)mIm:*E5*5*emcm؆%MmPm(%ymm:nh2 l>lmmmn n#n:*CnenlnnnlncD6nnlA-PHMp`I &p10PEU* T*HP h0@ S S,0,0,0,,,,0,0,0,0,,,HHIIl1[d1T1 P1 `q< P p 1 !  gqPP \ Lp$@@@(@ @s  (hP P0S PxV `P X\0 0000 Jny%t,%iA;*ˌ"Qyt nCt n oG-0HM`p0C,S,C, &p3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 ~*a0@S/ 0$////$/$/$/$/$/$/$/0$/$/0 0$/$/$/$//00 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTqP \V ДY 000 01HЍP oPPp  [0S  40 `PMHPV qh V 4`F xd;*t,y%%%xGmh;*ˌC-Mp`}7ɋPPF! VF :%pSPU 6 `V V 60S aP& tP8p6 R "9h&   %p<6U@,V`F V"@T ᐋP ዋP9PV 0S A@D c9P`Vu  tP9@PA@3P񟗹t4p2p24p2p2p2p2p2p2p2p2p2p2p2p2p2p2p2p24p2p2p2p2p2p2p2p2p2p2p24p244p2445p2p2550585D5P5l5p255zP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03/ $0S=<0S800S3<3P׊P0$0:(U 0S# 0S 0S`V Q PF Z0S 0S 0S`V UUp᥊P `᠊P \ᛊPPEU77<3|8<3<3<37 U3 UUU  U4 @U U00`0  x: UQaUPJ100000  c:P  @8 }8$0S (: 8 |p ,qpG*v@T = 0"600"$0$P @P P`$&^8@*y%t,?~+%H{zˌpz}tG-MbM@Pp g#p10S QđȡPE R ލЍRP fP74p<LPd YWOJ4nP1 JP/0: S2  S)J ;P0 JN@n` 0 4S00`uZ0S ~^p tJ ;PJ ;@PJ0@`@*y%ˌ6!C-GMM \0MI@=P<8 =8X@8DX~|=`{`XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxxP0D80l8"=C0 8}PP   +P:? 0YR{L  }P < <}@P PL< T(X4d@0P$,TX8D } <P  0S;+,Kh8S <PU KhX }P@ OoB;p ||+;8(p |P P[`T`hmPdh@,;p[`L  8"ppT[0 e4+ 0 0C 001T0܌ ||  \8T0>0P XPX0Pl ShQf0 jP4:Ty P: h(q`P9 T(X(g< c0kP9 h(e40GDS4@\D@\D\D\DLD\D\D\D\D D\D@\D\D\D\D\D\DdA\D\D\D\D\DA\DB\DB\DB\DC\D\D\D\D\D\D\D\D\D\D@@\D$A>DATA\DA\D\D\D\DAA,BDBBBCCC\DC8 (VxSl8 X(T(NX8 ,J8 8P 00S= 8 W8, ,, ,07 ,,7 H((z$8p+z7, |7 L(w+ـ P:?@ 0H7 P(74w zp‡P78x7 7<(6 T( X(L7 ^6P 00S 70 6 t(6 Ix6P 00S 6 6@p ሀ68py묖08p0 P 0SL6t pW 8Hp(]j+5 ,00p5 L(5y`P5 `(d(<5 u v$5P @ y5?Q40jGލЍx5|t ,ѣD0\<<{0P 0S by OPy< @PxdD8SQQy@4 1y t DP r{ i{ ti{ ti{ xti{ i\{X$TiP{L$HiD{ 8i4{ ,D(ih;uPmDLmImFmCm 0S0SA  Y@288S2 @P R<S P 0S x xH2 uN @+ P: B?\U 081<Skf+]r P*l0:vP 0vP X@P:|lt ljX:@PHl@ l0@`,rvPP0@P`1p@+30(@0@000,`40 U0(P<P8y,8U0C?o20SP ,R `0 ,0S \x,8S=T Ђ,8S "g*fFf>TZZJj(%%Ǣy%g{zrt, %ip*HqE%/B+Vnp,|Ir $@S^j06i@sK {p  t* T ZG-P`<0ErhR1埅P03傃p2S lE PUUyPH t处 9PB/PE0@ *  pd40pEWQU H4 000`P$ L,[~PE0S#34# 3 P㍃㊃㇃㄃᥄P *UvP303 `pp hZ dy`3P04P/4S @S姇P  ,U{ P 4SqR啇Pl l  PnR8y,`p1<01 1> 11bG01/΅01$1哆gec4#(2R$$jp`g Pd Q18C8S ᎁ|q܁ܑ`HV00l  B/o" R P  \᷆=S` 0 0000l X18C8S+`#RS S=?o20 S Sl =18C8S 0 S y` S S S/xx(+_sy%؆%++,g %%%Ƶ׵)+)+? RFˌІ%"mR@-@`/P6P1  q px10SAQ\1PI D1CDP 4P1 nPbP9P0P 00@0c0@ S lQ|QPQPQPQPQPQPQPQQPQPPVP @ l0 \0  L0  T TT- W0S$/+my%%>7 T%9A-`P <#R+"y%|%t,l%7[|+KO-MpSvPRD,>P4/ᤒ40PP 00 0P0X00@T/`P@@@$ZpB,40HXH[p ީ0S v@P [@ǁ#3P0#  -R R -R eB kR R|# QiR eRX#P#sPPPEP IP -Pd Q@"Px[ZYZZZZZZZZZZZZZ[ZZ[[ZZZ[Z\Z8\YZH\Zp[X\00~l2lyX2\H20P^Up0Sm ?SPPi20`^Vd0Sa ?S``]10@^TX0SU ?S@@Q1100FDꔱ<00 \ (0 `0F !1R, S` \0  0QZs(, ,Az^P D\Y  P0S% G C ?S`0S   Rڰ1\0 1 ,0,+r,؆%Ay%>2\lCCR;%H;%M;%t,,ht@@+%gtO-@LMPp`@ &p1 UV P8p PgP uP GP000`0S@0T <PUP   p !fP,P0P 0S UOPg p U  p T & p V p|:PPU k TtP@P 0P@O 6t,y%=ˌ+OOvS5>5O-0Д@04$@4p1F0[X18X1`屼0  F1|!1hQda0  h@Pw\1j >0[ >00.+ * X18X1=0YSpVPMP 6PR ?PI 4PꨍpN@P񟗯o0m8o0m0m0mPo\ohofP j@PP񟗞oo0m0mTn0m0mo0m0m0m0m0m0m,o=0P1`) <'`F@،p}\1F3\1Kw0000q0\1lH n@ftpclp`0  P0P \1P U0#P\ N0[ ]0 @P 0  P  584'0 000X1 ⓬pxx 哻  ⨼1S 0P n8  } 8:0P \A@ @0 Lp  rp c( \ X1 Q 0P819:\!p*X1 d ]pDT FAP)(< $X11Z LyPPY* 9Y) 9+ ) 0 \1 ⱣPb~ P S y 0 09姸zⷸpHx  W 00S L ں ,PQ :~0S(  xX!\10\1808"/0  X!2sP8"/0 2X!s"/ p= X1`坺  P%DX!\1 0\1 008 ַp 137 | ⬭zPtwht 007 vp}0S $~X0pGW}0ST|}0S }0 S X1\!8 0\!' zp}0S &|Tp}0S &HG /P q  =wEt㻭X1 I 0 SpT9 _p5 P <1\1A>\10L1_ 00L6 pwls0L1N 00L5 p(p _p P \10\1Q|)偷d屹\1 @0\1J/pP @ X1 X40  ❪p` X!\1 $  $$ 43/1 ip   ⟬K0p容 004 㕵p@墹|!RX14X11  ⳻P+p0v!10P!  R!猹00|!R00SR\1 X1 ꐃ吓0 Q01X:   kX1  1PU3X1\!( ; W A? =ĸ ׭ 1R@T 0S 0 @N@ 0S  | 0S ֫ϹPpP P ( RW  R   0010 S   0\PU QR彸\1@0@kQK` \@k\1$ 띢e hzh% 76 y%"ʦt, ! ߝ@ROB ;NMp%2|x(ħӧ,C{0>NmYCC˨8ۨ_92%  Q/0@-0t h P ^0EMb@1 0 0$010Y~@1O-0!bM Mb  [ !1 b0 0 30]bݍ Ѝ"m` t(  Hp \ $G{+ 40;x80G`00 80G( G p x8_S0쀟00 0000 @G P0 xP x8#`@#[*uxP0l8 40G PU P0l8 40G P#\9LXXX8>D8>0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/766p@-``A``1M@0``H! D1 0 0 0!  0 - QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 ЍpXX t ,UddhHT8@-M @wSЍإh  Q/X-M  0 p 0 S 0 0 Ѝ /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/):*/=7*/4*/1*/".*/+*/(*/%*/"*/////^*/*/*/<*/ */ */*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/<*/*/ */*/*/*/W}*/Kz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*//7*/>*/4T*///*/@-@vx@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260207NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:psysinst: screen too small /usr/share/sysinst/catalog11.0_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc /sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packagespkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1181: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt resizedisk %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646tolowertoupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d t#(,D6 =yPFKNN HQ Sx!SҎ,XxYX`aafzyj,j!,jEo'XzUr${-3,0|>|`>G mMZgt~(Lppcy49zllll< < 4t:n!+fL.1a,9f`;^PJPJPPP9RRUX,^`f̧kpushdnepopdneXN:Cp@@?g@C@@I4Ot0P V`\@@)@@b4unblock and -DNO_CONV?؃PE$100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink&3 23 H3Z3d3p3}3p3}390333E3Z334%4#/4 /4_A4^A4FA4<A4>V4?i4|4PATH= G thRfg=d==s Rc==m==l=>r h9p>8n>=v >b    EOF reading here (<<) documentϺEC C CCCCC#C(C-C_A71C6C=CDCKCPCXC`CfCkCrCvCzCCCgBBB\;BBi6`Er;;|;^}-+?= yy@zyEEEEEEEE@0;@<;3;6;9;EEabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'`'0G_'1G_'1G<`'8Hx`'0Hd`'0BHP`'0IH(`'0PH`'0YHH G x6 As GmI z -nڎHH[ `!>Np@                  sFOI4\HhrGt :t n ?\I<I U1@o`>JTIL>aItO,HJIJ Jd̃abJ\J6J6: N:HYND!!J0ҎuTx(JL-d88շ /J`6J0}/N?N?:N(@M@AO>ޏAM@ANBҳ@B׸AHN?*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readS$@YX$'(^$`$@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-YpLIw4Ȅ$h $@     0  HS``````a aaava*$a-a8a[=aAaEa'OaSa[a_aeaiataaaa$@ {b~ȅۅ)   ͆  2ȆGfy؇/K g!#$w&123456899:̈;<=@+A?B{CDΉEFGHJL,M=NDOTPdQvRSTUVΊW\a cdRetfghipqstuvwxҋ)HUjy̌ =Uoҍ3MSlllEa$.FXqdԏ!!!:Ypxڐ/7i}ӑ 4hmݒ!4GSv,$@$@j|$@^$@ ?ة$,$ $@1@t$SFH0eC쬞$SFU0eC쬤EaHah!IdontNeedEFI(s*K>;2|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+-a=rGy=iG}1<;Mt?GRmWC 3KOO]hyD<#*=(s}3Dh&LJ\ M}-@Mjy֬-чH=a-чHeaZIчHIчH(IчHM32IчHSNL6 %?aZ_S'@ )Ѹls*1@ )Ѹa1x )Ѹ%$@$backupstore_gptstore_tbl$@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsCQ`setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusprintallmaindo_setifpreferencedo_setifcaps'zi$yi>J>J>JX$$>J>JX$Hp$@$$$$*X$$3X$=x$Dx$<X$CX$bmx @ 0@ >|  %@init_current_mediasetmediamodesetmediaoptsetmediasetmediainstG  `@ media_statusmedia_constructor6 $6 $66$$6$P$paddr_match \\ p\T\settunnel X$ $print_link_addressessetvlansetvlanif0$E$DEh#"setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrts$1X$$T1X$@$@* X$+[$" $($'0X$p$TA* X$Z $ $>h@@@?X?&invalid major numberinvalid minor numbertoo many fields for formatffs@t    -M  0z z@zzz    u      & H [ D! j @v    @ ez8S  iy  Qz  -|  1k{z l\z     @         bnorripbgensbextattbnojolietbnocasetransbrrcaseins|  1k{z l\z     yy@zy @z@  |  1k{z l\z       yy@zy  z@ 0@ -M|  1k{z l\z     @|  1k{z l\z     yy@zy@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror|  1k{z l\z     @I"Z, 2@;BJPUY i@ _  @gbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacbnowccmsgrecvrpcrpc_getportrpc_callsendrecv|  1k{z l\z     @  G:W~Ck>^%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@)B)C)F)I*L*N'*O+SS*ad*bt*c*e*f*h*i*k+m+n#+o2+rA+sR+uc+@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:H^@@R1@h V1pZ1p ^1pb1p ` f1k1@ p1 $1м|^t0 Non-system disk Press any key to reboot <^ppp@^pppE^pppDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY hh7hdh|hhhhi7iWiiiij%jOj}jUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printxxxxxxxxxx yyyH,yX:yTRyayky~yyHyyyyyyyyyyzz.z:zzGzYzazyzzzzzzzzz{1{9{1{a{1{|{1{{{{{{{{|X|2|=|D|I|bitmask_scan(x/x4x;xhw.disknames4_"ŤɤͤѤ***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]a  : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data"GmI\ lk{` +kk+k"+k"+kkx+mlw+!l)lv+KlVl+sll+lfu+l"+l"+l"+ll+l&+ll+l"X+l+ll+lm+mC+(mC+9ml+Bml+PmXm+sm~m+mf+m"+m"+ml+ml+m"+mm+mf+n"+ n"+collectpwpwffwS``````a aaava*$a-a8a[=aAaEa'OaSa[a_aeaiataaaaNAME=iy8 ezmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsS``````a aaava*$a-a8a[=aAaEa'OaSa[a_aeaiataaaa edit_fs_type_extg D 8 P O (P c d r r 1L@P eP uP edit_and_check_label S``````a aaava*$a-a8a[=aAaEa'OaSa[a_aeaiataaaadisklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz t |  L \ d  d 0 4 X  p @ (  X disklabel_change_geom0{ 0H outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default ,,,,pm_from_pepm_whole_diskgpt_freegpt_create_new D4 е (llܸȦd  $D`\xS22 1=aeaMl -!kYL Se^9>C8FLSv Q iy {@=aU#' Qz  eaZ{ac-gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC쬞$SFU0eC쬤EaHah!IdontNeedEFI(s*K>;2|nQn- q+|nQn- q+|nQn- q+|nQn- q+|nQn- q+-a=rGy=iG}1<;Mt?GRmWC 3KOO]hyD<#*=(s}3Dh&LJ\ M}-@Mjy֬-чH=a-чHeaZIчHIчH(IчHM32IчHSNL6 %?aZ_S'@ )Ѹls*1@ )Ѹa1x )Ѹ fyHh8aA@Аʛڛ mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new0{ ` T Tp 8pP hTd,H  mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************"ŤɤͤѤcontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2J2dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionàbc>|de~fRg+hQiƾjlk^lHmhnMoop5q1rzstʬuJ|vwHxzlyABCSDűEϱFԱGޱHIJKLMNOPQcS-dTU&V0W:XDZ1S4\6eK|t~v}IJ̲Ѳײݲlz-v ",=;DBJWB]ckpTϳ۳default_configread_configrt_compare_protoddrt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt<<rt_buildrt_deleteDDsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init]85<FOZ;Zscript_buftoenvT=RcD-make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_oszif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp*5APdhcp_bound\em7 uP }dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa{{{{{{VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B81^XxLg ؠ.}8 X6xBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~(%, 4 1^Lg .} @6h!f!d!cs_pathX< bc_base_max" bc_dim_max" bc_scale_max" bc_string_max" coll_weights_max" expr_nest_max " line_max"  re_dup_max"  posix2_version "  posix2_c_bind"  posix2_c_dev"  posix2_char_term" posix2_fort_dev" posix2_fort_run" posix2_localedef" posix2_sw_dev" posix2_upe" stream_max" tzname_max" atexit_max"N1^POOhPLgP Q. R}R$S S6?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_popunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %smemstream_seekrshrcmd0123456789abcdef %x:%x:%x:%x:%x:%x %256s 0123456789abcdef0123456789abcdef0123456789abcdefkMGTPEBKMGTPEKMGTPEBkMGTPE_getttyent: TLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~_fts_readkh?marshal_new_auth_authunix_create_xdr_arraygethostby*.getanswer: asked for "%s", got "%s")& @"NBCDB  d'@Bʚ;0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuvABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as5gethostby*.getanswer: asked for "%s", got "%s"0123456789abcdef0123456789ABCDEF_xdr_bytes_xdr_string0123456789  %02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC 0123456789abcdef0123456789ABCDEFQ !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG @Cisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB 0123456789ABCDEF0123456789abcdef/& ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::x",8LP }} (0N<`'4D<LTX ` @L`X`d lt |            č ̍ ԍ ܍                 $ <4 xp  ( , h(   H Xĺ   d  L    \    , l\ 0       <4 x   $( ,h ,0,4 h8h< @D HL PT XXX\ X` X h p t x     L .     \     Ȍ Ќ  Ԍ  ،  ܌       $ 0( 0008 0dpx    Ď Ў؎܎(0؍8@DP    (,0  9  d Ġ< Upp p    XȧاXX@!;!?!>!D!,gnts`4%p#rbmn" 4   tcidI(OT XPHGG@H0H HyekdWNGx<@patadhf`dfloobq$rqH!H!H!H!yaraw}{(v@u\0X̴ 8D\h ص  , D P\ԶX(lpxĽP0ȽнԽܽp|ļ̼ܜԼܼ 0$(P0<LXhDHLPN!48<@N!ܾ  (,4<@HPX`hpt|8Ŀȿ̿пԿؿ (08@HPX`hpxܾ,8DPh|,DXl(<Pdx,@Th|R!T Ȟ x, ȞؠpU!U!U!U!(,Tp$Lh(((DP\dt||`dpt     (, LP dlL 0P<0@HDH\d !$("<D#`h$p%&')*+,-.$/,40<D1LT2|37c8(@Hdl#`$%&'@(),08<,$,<HXdx   XX$,<DLT\dX(8@0045$Cc!c!c!c!c!c!c! P$D$$|$  (08DPXdhlptx|t( XXXXXXXXX$,4Xl  4Hd|$8Xl, @d4Lh0Tx,@Tx8L`t(<X,@Tl|`shsphoxc2,Xc!c!c! XXXXXXXXX̆%H^!$,P,`x%,l,<,(-lP %T%6-0%p%\,Ԋ$`,d,0%, y%szwc",HĊ*-t%Ȋ7-~y%'-h]!,8-5-0H8-4,,, *-,;:!X,І%$dx%(,<,y\,y%L,t<x, Pn,p,d,؊8%tx%T,h8-!,,X,z%`D`,%؆%8,0,H,ȅ%y%t8-X,ؠH(-̆%d,d!,D, ^!$$<%,~ b jj'chf h k* l: mL oX od pu p!p q ru+[t vgw w xxzz B>0C>J O P S T@V{pV X!Z!Z !!"!)!>! J!S! [! h!x!(8uD.vtD.8ytt uv!(||}t|tt G J!>! )!>r!h!/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin ... ... b"w"oqr6 :H66oD)u80( X$dh 0$AabCdhlNsuvW:w:zx$$$$$ $4$ E$g wjg  l |$g  l$T$ K$$ V$$ m$$ wH $ Pac H$ X$dH t$ X$ $L$$$ _X$a'$ f $a'$  $D$@$L$@$X$P$|$$$($$$$ $$X$$$$ X$ <X$ X$ X$ @$a'p$ =X$= <PX$ X$ X$  X$  XX$  HX$ H P $ 6X$6 @X$ X$ X$  X$  $ `$` gX$g   $ h#EX$E "LX$  X$ $  $ *X$ ((X$( 8( X$  'ZX$Z @X$*  TAX$*  T1X$  .X$+[ $ DK,J,JKIlKx,J,JNH $IJ_,JK,J,JK ,J߶>  '@@|  1k{z l\z     yy@@ ...... ...... lost+founddA.##.@n5bwcjackcgb n  g  mbwj]8ggubTܮcO @:c c!c"%c#B$.c%2c&9c'a 6 K  6 pi  6 (]  6 _  6 8/ O 6 b >| 6 @J  6 `M k 6 XP  6 _ G 6 E  6 f  6 f  6 Pf H 6 d_  6 4u  6 hC | 6 6 f 6 8/ g 6 tH  6 8@ @ 6 I  6 `F c 6  Ž 6 4^ } 6 5 ǎ 6 L 9 6 @q ˎ 6 p ю 6 PY  6 XP ֎ 6 hk ݎ 6 M  6 R  6 d@  6 Y  6 R " 6 XP  6 u  6 `6  6 n  6 @q  6 8  6 d@  6 8  6 o ߇ 6 XP  6 c  6 b  6 8/ ̎ 6 @q  6 d  6 XP c 6 XP ! 6 XP ! 6 J  6 H  6 LH ~ 6 `  6 87 Ҏ 6 X  6 d_ ' 6 P\ \ 6 Ti  6 r - 6 8@  6  @ 2 6 Lv : 6 O A 6 | G 6 (j O 6 ^  6 Z U 6 o ] 6 f  6 87 e 6 G ? 6 s n 6 \ f 6 m  6 r h 6 D ot 6 6 s 6 f n5 6 k  6 06 { 6 Ti n@ 6 8F  6 84 6J 6 ] 1@ 6 t  6  @ 6 V  6 G  6 r C 6  @$!>lA? ֎} p|  <<@x{!8p@ <hU >W t$V pٮW |G $M C$N +$N cC4B .TC TC bR }R sLQ ?j #R cX'+JE(FNPcialMsƳhѳ\'+ !"$'(+-.03569:}OKu\yf _-+4-+,-+ -+0-+(-+$-+,+,+-+-+,+,+,+,+-+tip.record  /etc/phonesOwXd$a++d$p<ua}(-+a$-+;Ma0-+JK~a,+u\d-+mavO -+a,+ RcyXa,+a-+yǶz Ѷ>Q%|ֶ(a-+Nڲd,+d,+d,+ ׸Ƴ[Na0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ%%%%%%%%%%%%%%%%""%%%%%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [< is a directory is not a regular file (use -f to see it))%)% ($" >>|Lg% 4;? m7G Q Z h#u28  (!9 c&wf)*45=eF:PN%Xb6k4`w +,-.*?8Eh//'F' X  ʶft ywf`   WmkRkRkYcWbkCkc kG ky wb YMYrWca9%Ll+ ,Jb9%@l+| rBx9%l+cp9%Hl+,,dh9%0l+Snh9%A\m8%Dl+tn8%"l+o8% O8% p8%H P8% Aq8%Tl+!Mr8%" l+as8%!,l+S8%!k+-=t8% MT8%x Su8%@l+_V8% w8%"k+xx8%( EQXp8%Ak+]yh8% l+z`8%l+"X8% ~P8%!k+9?H8%, #@8% Wj88%Ak+v08%k+(8%k+ 8%k+P8%(l 8%k+8%k+d 8%k+ 6W7%k+x7%$k+ 7%$k+ 7%k+67%!k+O_7%!k+D i7%!k+7%( 7%!k+ 7%k+8U7%k+z7% 7%k+7%Pl+*7%|k+Dj7% x7%!k+p7%xk+h7%tk+-^`7%pk+X7%lk+'Miu~w4  *4ET_kq}IcVNQ#58%;BKTamyc<|m+ (press RETURN)s t _t 9%9%9%tags643{}abcdDgGhHilnNpPqrs tw xy !:#=<++-e^H-i^C-k^UKQ%,Q%] P%,p % |P%"\P% N "|o ?o 5P 0P LP LS ,S R \` _ hq q O SPo T S S S ` t_ S Y O TO xO O O 5*J+#x8;>qV)FS{`!Jd`      m% (3 : R b n    S       r Fh\ 64 h/P_{ 9,A ,>JpT!j!!7"" #H##K%2&&&H'e'''(C( )))+*0*T*x*******++ +/+=+S+\+q++++++++++,,&,=,O,i,,,>-|---)...//1~12233333339334 4B4V4r44444445#505B5S5e5u5555556 6U6_65i6s666666666667737G7 <T7c7x777777777g>78 88"818F8R8^8r8y8888888889:;<x=E>q>>>>>Tj? ?;?? ?,?5?J?q????@"@P@t@@@@@@AABABBCC:CCCCD{zDDDcD|DDD8EIESEEE F!FFF[GwG|GGGGGGGGHH8HLH`H8I f IWIeIIIII}IIJ"'J/J3JDJOJeJKBKMM NN{HNMN`NmNsNN OwOO),NO PP!*N0P9P{TPaPmP|PPPPQQ$QEQYQQQll$RERiRRRS^SeSSSSSJTTrUUkVVVV؜WWEWnWWWXXY.YPY`YvYYYYZZZZZZ[[0[=[E[O[T[^[g[x[[[[[[]#]/]5]<]G]N]U]^]h]y]]]]]]]]] ^^%^/^{@^J^_^p^^i6^^^^^^^___#_0_?_S___i_n_s________n_{@^_``(`0`D`\`m`u``_^```````Ca)a8aIaWabaoa{aaaaacc d*d2dWde@ffffffgg"g8gsgh)hhhBiTi wwxx xxxOx}}}M}p/ X up +9J z̄҄؄w0 10 &'()#*>|+(.1/ftp @zi5t| @k ~ 6> #p ? 7@( Q4 A B C D ) E  F ea G y H {@ I "Zا " " x  1u 1e u !/>KYguȐ]T\?]\ Aκ| O"""""""""C7 z W8 E     `  !% )-15ҿ9Xa=AE  I!Z"i#u$%&'()*+,--..//10Y12345T678$9-:);3<B=N>`?n@|[\\]^^__`{{|}+}~?  -dd-ddTdd:dd:dd l x@@`|#####$Ȑ$А$ؐ$ܐ$%%%X%%&&&$'0'<'D(P(\(d)p)|)***+++ȑ,ԑ,,,----..(.0/</H/P6\;l;x00011<<Ē=В=ܒ>>?2223$30389D7P8`:t44455 ! ē" Г# ܓ$ % & '  ( ) $* 0. <+ H, T- \/ h0 x1 2 3 4 5 6 Ĕ7 Д8 ܔ9 : ; <  = > $? 0 @<!@H"@T#@`$@l%@x&@'@)@*@+@&`'`Е,@-@.@/@0@(`,1@82@H3@X)`h4@t5@6@7@8@9@Ė:@Ԗ*`;@<@=@>@$?@4 `D!`T+`d,`t"`#`-`$`.`ė/`ԗ%`CCDDEE(F0F<cDcPdTd`eed#l#x&&0ĘȘ̘Ԙܘ $0<HXdh|șЙx  @@ȏԏ ܏  @@@ @@$@0`8`DHPX`h p@t 33333333XX (8Tl3333Իػܻ`UTC33$$|y{stPztys338-Ċ؊339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž8z%Dz%8z%z% 33UU33UU33UU(%t<,;$<|;z%%t<,;$<|;X|% %t<,;$<|;}%<%(%h,txĝx   @ 333333333333333333333333333333333333 33 33܃% [![! 0000000000000000 P,-3333l3333j33%% % (root)`33 $$Cc!c!c!c!c!c!c! P$D$$|$$d!f!h!j!%@gi\gthdgggPh`h,c^˨ηg5wG ".};73zyV"EL#ޗGG|">">f ͥZ?/^#ȿkF=v jiZZwmǑ_#i䓮~{&u?EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+W.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / BtHxxP$ V$ $b$ g$ tt,$, Xy$ %W!%W!(8-W!pW!-W!nZ!MSGTXTS628 5040 5065 5082 5104 5107 5112 5120 5127 5135 5143 5146 5149 5152 5156 5168 5177 5190 5219 5234 5781 5815 6498 6786 7494 7550 7624 7720 7895 7918 7941 7947 7956 7978 7982 7986 7989 7992 8097 8300 8539 8980 9418 9453 9468 9480 9486 9498 9547 9567 9607 9624 9641 9656 9703 9741 9789 9871 9995 10131 10172 10210 10247 10282 10292 10341 10491 10497 10502 10506 10526 10636 10656 10662 10676 10688 10699 10736 10770 10794 10896 10933 10955 11054 11109 11167 11178 11194 11246 11414 11621 11792 11856 11908 12183 12736 13268 13703 14041 14374 14487 14502 14511 14671 14842 14992 15156 15179 15203 15218 15293 15433 15610 15765 15777 15857 15958 16004 16030 16100 16111 16120 16133 16159 16174 16190 16203 16258 16269 16284 16488 16721 16750 16765 16834 16908 16981 17011 17049 17103 17522 17548 17577 17681 17787 17972 18084 18199 18303 18990 19249 19389 19425 19595 19636 19772 19795 19832 19877 20128 20224 20278 20377 20388 20425 20462 20489 20498 20532 20539 20564 20591 20626 20640 20654 20683 20697 20714 20723 20745 20763 20780 20791 20810 20836 20854 20877 20894 20909 20924 20942 20969 20996 21018 21057 21075 21107 21335 21409 21452 21498 21645 21801 21845 22124 22151 22510 22694 22846 23027 23174 23332 23353 23401 23411 23419 23430 23441 23451 23458 23473 23485 23526 23556 23595 23648 23706 23727 23734 23753 23774 23781 23807 23829 23849 23871 23902 23939 23961 23975 24021 24050 24084 24124 24159 24187 24235 24244 24253 24258 24267 24276 24293 24297 24302 24308 24312 24350 24359 24386 24406 24429 24448 24475 24497 24529 24545 24550 24560 24583 24605 24622 24639 24652 24661 24670 24676 24703 24710 24734 24755 24779 24792 24811 24836 24859 24875 24881 24893 24923 24931 24971 24982 24993 25004 25021 25038 25052 25069 25285 25589 26037 26253 26517 26789 26841 26877 26913 26964 26981 27019 27033 27040 27057 27060 27065 27074 27086 27097 27106 27127 27169 27207 27223 27254 27279 27314 27370 27410 27431 27451 27492 27521 27569 27802 27837 28044 28063 28100 28161 28199 28238 28394 28409 28455 28503 28526 28562 28572 28582 28593 28598 28661 28709 28753 28814 28847 28948 28966 29105 29127 29250 29264 29274 29297 29402 29458 29574 29605 29610 29636 29675 29685 29728 29738 29754 29769 29787 29810 29840 29861 29887 30084 30127 30131 30137 30143 30148 30159 30173 30202 30234 30246 30293 30343 30383 30410 30426 30435 30478 30484 30492 30496 30516 30533 30545 30576 30832 30881 31457 31484 31516 31544 31596 31602 31608 31613 31634 31650 31672 31701 31842 31976 31989 32125 32127 32129 32131 32148 32161 32179 32206 32210 32216 32221 32229 32235 32275 32277 32287 32302 32319 32353 32385 32423 32452 32481 32503 32546 32572 32616 32752 32826 32828 32908 32954 33002 33107 33209 33248 33315 33322 33383 33447 33451 33458 33580 33649 33937 34075 34216 34297 34344 34350 34373 34419 34422 34448 34491 34556 34618 34688 34756 34849 35068 35093 35097 35133 35151 35179 35221 35265 35329 35379 35455 35477 35529 35573 35612 35646 35676 35707 35732 35741 35753 35761 35772 35784 35803 35827 35876 35893 35917 35960 36282 36285 36299 36312 36324 36331 36342 36349 36356 36365 36375 36392 36408 36458 36466 36474 36484 36495 36513 36530 36551 36573 36582 36592 36619 36625 36635 36654 36670 36688 36708 36717 36728 36735 36752 36771 36792 36802 36819 36825 36841 36856 36871 36892 36914 36933 36943 36948 36953 36971 36990 37009 37015 37034 37054 37074 37092 37097 37103 37120 37136 37157 37170 37178 37198 37222 37239 37247 37258 37279 37285 37297 37319 37333 37342 37363 37381 37390 37424 37447 37474 37506 37529 37549 37560 37592 37608 37619 37632 37655 37677 38185 38215 38246 38274 38288 38489 38711 38878 38965 38982 39000 39017 39046 39093 39104 39123 39145 39224 39416 39444 39562 39584 39725 39744 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_STABLE. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_STABLE ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_STABLE ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_STABLE ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_STABLE ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_STABLE InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_STABLE ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden?Die Festplatte ist grer als der GPT angibt, soll das korrigiert werden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS628 5040 5078 5095 5110 5113 5116 5121 5129 5137 5145 5148 5151 5160 5172 5184 5193 5202 5228 5239 5778 5805 6371 6671 7312 7359 7472 7565 7599 7618 7636 7644 7653 7678 7682 7686 7689 7692 7814 7999 8227 8747 9098 9127 9140 9153 9158 9178 9197 9218 9277 9294 9308 9330 9375 9401 9442 9520 9638 9752 9806 9835 9867 9906 9912 9945 10068 10075 10079 10087 10111 10193 10199 10206 10218 10232 10241 10274 10293 10305 10415 10477 10496 10615 10666 10718 10730 10749 10801 11005 11213 11404 11464 11513 11783 12245 12914 13340 13662 14087 14219 14251 14263 14441 14638 14799 14933 14953 14986 15000 15069 15182 15354 15489 15509 15621 15713 15736 15759 15818 15833 15854 15869 15890 15910 15935 15949 15973 15985 16003 16213 16463 16484 16500 16553 16621 16694 16731 16757 16833 17290 17316 17338 17445 17552 17753 17826 17910 18010 18505 18743 18894 18928 19063 19107 19246 19287 19332 19379 19623 19756 19818 19912 19917 19951 19985 20000 20028 20061 20068 20093 20111 20137 20144 20159 20174 20194 20234 20251 20271 20292 20314 20329 20349 20371 20386 20399 20413 20425 20437 20451 20474 20497 20515 20558 20609 20646 20831 20894 20930 20979 21070 21200 21253 21513 21560 21921 22071 22240 22380 22500 22632 22672 22719 22729 22737 22747 22755 22766 22777 22791 22816 22861 22894 22927 22962 23016 23041 23060 23082 23087 23093 23126 23143 23170 23188 23209 23231 23250 23260 23290 23316 23343 23392 23420 23447 23500 23510 23520 23526 23536 23545 23565 23569 23574 23580 23584 23619 23628 23659 23676 23703 23724 23744 23763 23789 23802 23810 23826 23857 23888 23909 23935 23948 23956 23967 23973 23997 24007 24019 24037 24048 24068 24084 24110 24132 24148 24160 24180 24206 24212 24242 24256 24270 24293 24312 24331 24349 24367 24590 24896 25314 25515 25755 25939 26017 26072 26139 26179 26202 26236 26247 26255 26278 26281 26284 26290 26301 26313 26326 26356 26400 26413 26426 26463 26477 26488 26499 26510 26527 26538 26585 26608 26657 26898 26931 27186 27207 27240 27293 27319 27346 27502 27508 27551 27571 27590 27619 27626 27633 27640 27645 27694 27732 27766 27823 27851 27896 27913 28014 28019 28096 28110 28120 28144 28267 28348 28458 28486 28491 28507 28536 28544 28585 28592 28606 28619 28627 28646 28679 28699 28719 28935 28966 28971 28978 28985 28989 29003 29015 29030 29063 29076 29131 29189 29225 29243 29261 29279 29316 29322 29330 29334 29355 29372 29383 29405 29583 29627 30329 30353 30387 30406 30451 30458 30465 30469 30493 30504 30509 30572 30693 30816 30829 30963 30965 30967 30969 30979 30988 31001 31028 31032 31038 31043 31052 31057 31084 31086 31099 31111 31126 31154 31198 31245 31261 31283 31294 31327 31347 31396 31496 31550 31552 31617 31666 31715 31819 31917 31958 32049 32056 32117 32181 32186 32192 32301 32360 32611 32752 32879 32947 32984 32991 33018 33064 33067 33088 33133 33184 33243 33312 33359 33464 33607 33632 33636 33670 33687 33711 33763 33814 33886 33952 34050 34067 34098 34134 34168 34192 34216 34249 34269 34279 34287 34295 34305 34316 34330 34356 34404 34427 34447 34488 34787 34790 34804 34816 34823 34842 34856 34863 34870 34879 34889 34906 34922 34970 34978 34986 34996 35007 35025 35042 35061 35081 35088 35105 35122 35129 35142 35177 35194 35213 35233 35243 35259 35272 35290 35310 35331 35341 35361 35381 35394 35413 35426 35450 35473 35486 35497 35502 35509 35527 35546 35565 35573 35592 35612 35637 35655 35662 35669 35682 35691 35712 35725 35733 35753 35781 35798 35804 35815 35846 35854 35867 35889 35911 35920 35941 35959 35966 35989 36008 36035 36053 36073 36086 36101 36122 36136 36143 36157 36172 36191 36736 36769 36797 36826 36834 36871 37183 37360 37437 37454 37472 37487 37509 37559 37569 37586 37608 37667 37825 37849 37979 38004 38130 38148 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_STABLE. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_STABLE ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_STABLE ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_STABLE completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_STABLE. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_STABLESalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_STABLEEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS628 5040 5076 5093 5108 5112 5116 5121 5132 5138 5144 5147 5150 5153 5157 5169 5181 5191 5221 5233 5666 5693 6269 6629 7314 7375 7453 7548 7588 7610 7628 7634 7643 7669 7673 7677 7680 7683 7805 7990 8218 8747 9165 9194 9207 9220 9227 9247 9266 9289 9332 9352 9371 9394 9438 9467 9508 9574 9686 9800 9854 9883 9915 9954 9960 9993 10071 10077 10081 10086 10127 10264 10274 10282 10301 10315 10324 10356 10397 10410 10535 10593 10612 10731 10787 10839 10850 10866 10905 11155 11327 11499 11554 11589 11842 12249 12551 12822 13183 13363 13682 13702 13715 13904 14048 14244 14378 14398 14431 14450 14551 14706 14894 15081 15101 15180 15278 15316 15339 15429 15450 15473 15492 15516 15546 15590 15623 15646 15658 15676 15944 16263 16294 16329 16393 16468 16538 16569 16599 16691 17182 17212 17229 17369 17510 17707 17826 17973 18140 18698 18994 19175 19220 19383 19437 19572 19608 19668 19718 20009 20118 20175 20272 20277 20312 20347 20362 20386 20419 20424 20449 20465 20488 20495 20512 20527 20546 20578 20582 20602 20620 20632 20645 20663 20687 20705 20724 20751 20778 20790 20811 20841 20871 20896 20929 20964 21002 21255 21324 21379 21440 21558 21717 21771 22032 22083 22459 22614 22758 22898 23006 23191 23221 23264 23274 23282 23292 23304 23325 23334 23340 23372 23416 23452 23490 23527 23575 23599 23611 23625 23633 23641 23672 23689 23718 23739 23762 23771 23790 23802 23846 23884 23911 23955 23983 24010 24063 24074 24085 24092 24102 24111 24145 24149 24154 24160 24164 24199 24209 24239 24262 24291 24313 24335 24357 24384 24396 24408 24427 24461 24494 24515 24539 24552 24564 24577 24583 24609 24619 24630 24654 24664 24684 24704 24721 24747 24771 24784 24804 24838 24845 24874 24897 24920 24936 24951 24966 24981 24995 25183 25488 25919 26110 26345 26533 26575 26625 26679 26727 26749 26790 26801 26809 26833 26837 26841 26850 26861 26872 26887 26918 26964 26977 26990 27020 27034 27046 27058 27070 27088 27111 27156 27179 27239 27491 27518 27780 27798 27825 27874 27904 27935 28067 28074 28123 28146 28170 28199 28207 28217 28225 28230 28283 28332 28372 28438 28471 28515 28538 28639 28644 28721 28735 28745 28769 28892 28973 29083 29111 29116 29132 29161 29169 29210 29218 29232 29245 29253 29272 29305 29325 29345 29561 29592 29612 29618 29625 29629 29644 29663 29689 29698 29710 29764 29822 29857 29876 29893 29905 29940 29946 29954 29958 29979 29996 30007 30032 30210 30264 30955 30974 31009 31039 31085 31091 31098 31102 31126 31142 31148 31223 31373 31492 31505 31573 31575 31577 31579 31589 31602 31619 31646 31650 31656 31661 31670 31675 31702 31704 31717 31729 31744 31772 31816 31863 31879 31901 31912 31945 31965 32014 32114 32168 32170 32246 32301 32351 32450 32545 32593 32683 32690 32751 32815 32820 32826 32929 32981 33227 33388 33543 33614 33667 33674 33701 33751 33754 33775 33821 33876 33935 34004 34051 34156 34299 34324 34328 34362 34379 34417 34470 34510 34586 34651 34745 34766 34804 34844 34880 34904 34927 34966 34996 35003 35012 35020 35028 35042 35058 35086 35138 35155 35176 35220 35562 35566 35581 35592 35600 35619 35631 35638 35645 35654 35664 35681 35697 35751 35759 35767 35777 35788 35806 35823 35839 35857 35864 35882 35899 35906 35916 35947 35966 35985 36005 36015 36034 36047 36067 36087 36108 36118 36137 36156 36166 36183 36197 36220 36244 36257 36267 36272 36276 36294 36313 36332 36337 36356 36376 36401 36416 36420 36427 36437 36446 36467 36481 36489 36509 36535 36552 36560 36571 36602 36607 36620 36642 36657 36666 36687 36705 36714 36758 36782 36809 36824 36841 36855 36886 36910 36941 36948 36962 36977 36996 37541 37574 37602 37631 37639 37676 37988 38165 38242 38259 38277 38292 38314 38364 38374 38391 38413 38472 38630 38654 38784 38809 38935 38953 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_STABLE. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_STABLE est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_STABLE est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_STABLE est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_STABLE Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_STABLEExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction MSGTXTS628 5040 5081 5097 5115 5119 5123 5133 5142 5148 5154 5157 5160 5169 5179 5192 5200 5211 5236 5248 5760 5792 6284 6573 7118 7164 7268 7354 7390 7405 7423 7431 7439 7466 7470 7474 7477 7480 7591 7776 8004 8480 8814 8843 8858 8873 8881 8895 8913 8934 8985 9001 9011 9031 9077 9107 9160 9217 9328 9449 9493 9526 9565 9599 9606 9639 9716 9722 9729 9736 9765 9877 9883 9894 9911 9928 9937 9966 9978 9988 10089 10151 10171 10291 10328 10384 10398 10419 10456 10666 10841 10990 11025 11077 11297 11614 12141 12506 12796 13189 13324 13337 13348 13494 13673 13804 13938 13958 13991 14010 14093 14208 14349 14474 14488 14596 14689 14718 14738 14814 14831 14849 14865 14884 14904 14921 14933 14959 14971 14989 15190 15429 15456 15473 15529 15591 15651 15682 15706 15765 16111 16141 16158 16266 16376 16516 16590 16666 16744 17236 17456 17567 17598 17725 17761 17889 17916 17956 18002 18218 18342 18410 18510 18515 18551 18587 18601 18624 18657 18661 18686 18705 18731 18736 18751 18766 18785 18810 18822 18844 18861 18874 18886 18904 18928 18943 18960 18973 18984 18995 19015 19044 19073 19097 19132 19167 19194 19381 19430 19462 19510 19607 19740 19786 19978 20008 20330 20459 20599 20739 20856 20991 21035 21078 21086 21096 21108 21120 21128 21139 21166 21200 21239 21270 21305 21341 21388 21408 21425 21443 21448 21455 21484 21500 21521 21538 21555 21573 21590 21603 21634 21659 21690 21721 21756 21783 21836 21846 21856 21862 21871 21879 21894 21898 21903 21909 21913 21948 21958 21987 22003 22029 22046 22065 22086 22102 22115 22120 22128 22143 22169 22188 22216 22234 22245 22251 22257 22278 22288 22299 22317 22339 22356 22369 22390 22410 22430 22441 22454 22476 22483 22508 22523 22543 22555 22572 22589 22609 22628 22805 23089 23399 23579 23790 23978 24044 24091 24146 24190 24210 24239 24251 24257 24273 24277 24281 24289 24299 24311 24326 24345 24381 24392 24403 24442 24454 24464 24474 24484 24500 24518 24567 24588 24633 24877 24903 25157 25172 25198 25255 25289 25324 25466 25483 25532 25553 25569 25598 25603 25608 25614 25619 25658 25693 25723 25778 25811 25857 25871 25950 25955 26009 26023 26033 26057 26143 26191 26297 26331 26338 26353 26380 26389 26428 26435 26457 26476 26492 26510 26542 26561 26578 26735 26766 26773 26782 26790 26797 26811 26829 26848 26858 26870 26911 26956 26985 27006 27029 27048 27086 27092 27100 27104 27125 27142 27151 27170 27316 27358 27868 27876 27900 27918 27962 27967 27972 27976 28007 28020 28029 28075 28201 28292 28304 28368 28370 28372 28374 28384 28398 28413 28440 28444 28450 28455 28464 28469 28496 28498 28513 28524 28539 28567 28611 28658 28674 28696 28707 28740 28760 28809 28909 28963 28965 29033 29073 29118 29193 29259 29294 29375 29382 29443 29507 29514 29520 29619 29675 29951 30075 30186 30248 30286 30294 30316 30365 30368 30389 30434 30489 30548 30617 30664 30769 30912 30937 30941 30975 30991 31016 31064 31100 31161 31215 31296 31318 31357 31394 31426 31450 31477 31503 31517 31525 31535 31543 31557 31570 31582 31606 31647 31673 31690 31719 32043 32046 32060 32072 32078 32094 32106 32113 32120 32129 32139 32156 32172 32215 32223 32231 32241 32252 32270 32287 32300 32326 32333 32341 32358 32366 32383 32407 32426 32445 32464 32474 32485 32499 32517 32537 32557 32566 32589 32609 32620 32635 32647 32666 32685 32696 32706 32711 32717 32735 32754 32773 32780 32799 32819 32844 32861 32867 32875 32885 32897 32918 32934 32942 32962 32982 33004 33012 33023 33046 33053 33067 33089 33106 33115 33136 33154 33163 33194 33210 33237 33256 33276 33294 33315 33329 33349 33356 33375 33390 33409 33954 33987 34015 34044 34052 34089 34401 34578 34655 34672 34690 34705 34727 34777 34787 34804 34826 34885 35043 35067 35197 35222 35348 35366 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_STABLE. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_STABLE zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_STABLE zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_STABLE zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_STABLE zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_STABLEWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_STABLEUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The disk size is larger than the GPT shows, fix this? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..