ELF(@4@J4 (@@pp``PM!"\\@0 6QQ O@@@( @0 fH!@P@Q?H3tР -L'/PM]main() returned_   ! X(@@T @@ 0/aaT (/// P-Lxv@-@PL00S @0080 0 0 0 'Ѝv``[^P/00S 000/v5@-@iMpP @iߍ0s ~PP g00 0`wV @ h9%@ K  0R)0R OoBr_edA7[^\ 4S/0!8 00 (   !/Hzhzlz@-몁P|&0 !!X0T0P0H000, !  !a^h[^HzhzlzG-aM0SJpP  G@T  G pP9  :P@1 P P hP5 DP@ P% @  P GPP 00 B4R 0 @a0C0 P 'ЍG v@P|PlPP aP^ 8W$$ 0@ @Ir_8Iy[^[^=>_[^^[^@-<@vPE$pPj@ ]^[^R_[^@-l00: S:T 88S!~E0Yo@友 00 峋]@B@-0@0PS@!@.x 4Sʀ0! 0    !B? SS&R(l0 !! H#D#<#8I0#̀5-Hzhzlz[^ \^,\^@B:\^ P00  /$@$0P  000/dPd<0 P0/S/0CQ/]s@-@0S7`P`@P) ;P' 6P P0000 8PЍp@赃dPX0` P0RЍp@a @P8P0ЍpL\^S\^Z\^p@4a\^]` @ @O-M[$pPt ?WLMڄ!7GR  EP00l'0d'd7!`' \7PX7+RJL7尤ᴴḔἄ e U `P& 6  ::Sf0儆:6P X "01%6PQ P!! *!& 1儆 !&f0|6#6$1  1" @P *L$H&H6HfUTS$1)0C$1>0!10C0PU0S 9#9S  @P :$1I)0C*$1,!1,!p1c001 1 @P :|5*$10C$1  1 @P :$1Du*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1t*0C$10! 10C01 @ P:$1lt*0C$10! 10C01 @ Pl:$1*0C$11! 10C11 @ PZ:$1)0C$1P#Gq㰃 uGW#G#Gx#xGp#pG$p`3`` \3!XT3 0C 0p 0G! 0I 0I G": zG": rGt: kG\: dG0p09 \G 0p0 :RGXp!'H!p0 G<J$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/x[+ 1\H0WHSH010! ,1,! (1(!h$'O! 1"*E Ѝg\^@x\@0 DSBO]5ᆳL\^0`AiPa\^??,/li`?{\^)i` \^@ihaaTaa^^ _ _@4_H_\i@`__ _o @ @`@@- @0 PЍO-`p㨱LM P 1 0LЍ001!4 S6AT1S1S1S* o@ TTW    ,00< @0p08 @P\  0<0 0^*0 00 \S 0  oP0 02PPP I P  x0 P QP0 0<P`  `AP \^]^ ]^G- @5`Pd1.0\\$p0PfGpU' 0SI 00P(0P pW4 pGW=f/ 0<0 06003/儿P000( 0 0# PP  JP8S PP f/$0P`  `Ѝ]^WEV%]^:]^A-` 0pd 0@h 0Pl0`SP ' 0S  0 000`XP" P I/ 0V 048<S Q PU   048<00`U0 0 0` 04 8 <0堻0(RPҺX R  $  (+/O-M`P @@q0X0(08@S<(0<0(<S2<0080< Q0 000000\ 000W@(`,P08PP0P80PPX0 q @0X" 3H"0`0Pci,9VDPUa8 i 80 < P P8 PP 0E?oW20S` X0 a($ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/]` p@-dfPTbU@ $ ``06/Tp0`$ p@//p@-0 P T@``06/0 ``6/`0p@ /p@-P@@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` ]p)@A-0PST@ Sq  uBu 00 `0*b6/`P   0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0   0 7/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@]^^^p@-P0 ` T@003/U U ,  p 003/+^^~@-00 ~ Ѝ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-0`@TP Vp V h00 3/P0T00 T0 `@4/A0T0 `@3K^^|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~Sl^^ 0o/x_/0@-0M P@ 0P 000 Ѝ0T.@p@-0@Tp@tt'z$0dP 5/0 dP5/0~0~ 0p@~~x_T\^^A-(MPN@D1P<H40100: S# 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0P (ЍA05p`WV ||t |bPd O0 0@0 0B(Ѝx_*\^]^^pA1@^^\.@ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@:A-1@TA^0P`dp 7/U ~~ 0dP5/ ~ـ0dP 5/0 4P5/}U} A} }U A}x_^\^^p@-0@TxxPpPP0 4P5/ 0 4P5/P} }}x_l\^^C-1M@TЍp_0` dP5/ 0dP5/P }}}hpPP p d09/0 49/ S0 49/ 0 49/PU c}a}_}0 dP5/0?<#x_^^y\A-1@T  PP0` dp7/ 0dp7/ (}&}.}0dp 7/0 4P5/ 0 4P5/ 0 4P5/P}x_\^^O-,1P@`(!|,|0|4|0p,|(|0|4||| | @P0 | (| (| [P0| | (s| ,p|0m|4j|OO|x_0S@- S S@@W_^00@o/]` @-b@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ G2RS 3C7CR008#8S800 0 &1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011>P008#8S308#8S0x`0 p▴ h(`8p<␴151``5008#8Sy308#8SsSW HdHd*_^y_ D_^@-@`eP@h `0 0X 0P0 P0H00004 4_P$ Ѝp\J\L;@;@^^@-={@-6@o0 0R/  ^]` \lp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/4/-/-/-/-/-/-/A-Pp\`0@ 2/ p 0S0@0 @0000@A-P M@`P0 0 0  p7/0P * * p7/0P  "( p7/ Px 000 00@0L1 R `   P $ Ѝ@0X@p0$0:0d0 00!S   1 0 0S0h006Qd  3|000040J> 0 0000Ȅ 8/0$@0\0` !w,a_^*\^_^_^_^|__^ |^ 0 /|_/$ R/P//C-p0MS @*`  3@P" Pd@ 001Q0000!T0    ә40 00 d6/00P@@Ѝ0S   00C0/$ R xR R  /X R P0R/ ! !  _W@@W@AW@EW$o  R0" //@- o`^@-@(00 S@@]\`^A-QP@ 0S @T`V pl`V @@DT@S 0S T@ G|` 00 p@-@P@M0`000```0P0 `P0| _Pd0X _P<04 _Ppp@u*\^\_F@G`^E@HF@F@@-@A@-@~@-@y u0 0@-0 0@k0 0@e0P/__@-<0@TP T0 0 @L_0P/QC_p@-0@T/ 0S S* S& P 0 0 P PU% Pp 0D0P0000C00 0P  pp_RW SW 0o/_///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2Sdx@P@`xP,@ @T,@ tpG-M`@P2`0p븂FXP塺 0* Rq "Sl ph2h P00 000!h<" p-P'\Pu0[0$UP(0SIP㴑ġ0SKP 1@UwP 1@MwP l1@EwP L1@=wD10S h 0ߌ00h0 01@0`0!dЍ0!p P_ a` P0p 0|wP0qw sw0* R 0 @wP S T0@_*\^](L@` \L@^^P@H@ L@hH@ ~J<\O@@-"//G- s@dVʀ 0! $"0""   !P 0x swzwP0S w zP0p wP ,0S -0S (05#0x  wwP0p ,wP Q 0R(0l0S$00SPXX0S`P\ d$0Y0 0 0?cK 0!D d08 0   !?Hzhzlz_X?gfffA-X0P@0`0\00`P @  2@jЍ P@- R GPGP_0/_p@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !p|;_Hzhzlzp@-HP0PSp P@ `6/h;0  0p@/_p@-p`0SpdPP@0 S 000p0CS0p0 `6/Tp@ue_G-pP`̐P@ P% P# PV `FPEa @P P #P P00Z0S P N P`4H  `@C *\^a^a^^/@-0,\ @T 4/Ѝ_00S/ R//_00S/ R//_p@-@P4`|/ v/0p@80/_ 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/A-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 i@i@ 0  )?)/ 0  )?)/^/@-@q dQ0P0Cq 8 q (q a^a^a^a^a^0@-LP$M@  000 0$Ѝ0*\^j@0@- 0@ ,MPr           0 040$0P 000 ,Ѝ0i@/0/!//A-pQ`.0  P@ x0EP Hpp`@tT:80]+0 'J x>@#\@- a^@- a^///1/8#81/1/ W  R/ R/ d 0s S40@o//0@3S0/o/ a^p@-@0PT3/.p`R0p@8/4! $$#  p@/a^a^` \a^b^Q0 Q Q // ^a^ b^5_O-P`M 0 3/Ѝ03/@zQ [0$  3/0 0Sp "R 3/ 0A0CS000l 3/u0d 0Q 0H 3/, $.!4 3/!0AYS}p@ly@w@ly@ly@@y@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@q@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@ly@w@w@r@ly@8w@ly@ly@Tv@ly@ly@w@ly@4v@ly@w@r@w@w@ly@@v@ly@x@tv@v@v@ly@ly@ly@ly@ly@ly@s@u@v@\r@s@lu@u@u@u@u@v@t@r@r@r@v@r@u@r@v@pr@ x@r@x@x@x@0c0C S+q@q@q@q@q@q@q@q@q@q@q@x   0\3/ 0L3/@ 0<3/W  0$3/ 03/W07 1p 2/0 30 r#03/0A CR@S> 000 0R8L3/4$$(0". (:$ 03/$&0$0$3/0 0 &6z R'zppF0$0x3/p60S `6`&0S T&ZP0H3/083/ jZ0 03/$r0p0pO8OS $03/50S 5Z 2/%5 0|| 3/Zc 0L3/0X3/p0! 'R0,3/0 nK RS 0 3/  BR03/Z  03/R$0Y$0 t$tO0J$80 0C2/ $0!?3?3 2/!;?#00@q 0s0 0$* "0  : 0#$90"? :$#: \0LH#0$"<0,,7S0 S003/ 03/ 03/ 03/0000$3 0$2 p0$0`$40S$HH 2/$03/!t03/0t3/0h3/W_ 0~0$03/$($0p 7/0z0l3/200p\$($0 7/6$8$&$p(0 0[b^p \\b^^+b^*\^&b^g^e_s_n^/b^` \-b^3b^zb^^a^@b^/Fb^^u_c`__Kb^@Sb^]b^cb^mb^ob^eb^qb^\ub^yb^P\`\b^a^n^b^b^^^s_c^^^h^)c^\\b^b^b^3_b^b^b^b^b^b^ \//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ 0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P c!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S p@4 ,00,0/0 R,00,0/p@-(0c%<0@ T!<PUpp@-2@02 P<0#0P20C22S Upp@< p@-\0!C !2 Q02(0$!  (0$!p@R/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/ -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480C-pPM`0SZ 0 S S SQ !SV 0 @0 R =R DeP 0=S@V6ꌙ@@Й@@@@V 0  SR0T=S0(0 P@Ѝ   &P  ⬜ OP 7@- 0@P P0P R S3 @Ꮬ Ѝ0@-@0 }P  oЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 0@PN@ @0 4/@@Tm@P @> 4/@t@G8H1 !0R$04$0/o/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ __p@-A0S! 0S\X l\]0_03/UA 00<000S: #: " ! 3\ #30 00C 300%& %6 " ! \ #30 00C 300000C0[$00pBB_Ai!i &f^1?/ //?0 0!0S 0@o/ //0/////?  22//-P/6  N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N 1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  @(00(0/O- R\bY I* b$\" in_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0H00S/@-@0  "!$0p03/0 !!h`_03 /0@-$@4 < 4 @ 8 L < @ 0 < /p@-P$@4 40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/-1$ 400 001!00<p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0Yp<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@ն0` >1017800s>` !.p>W Gs0000 0 00 `L<`划0@0 0S101ߍ@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X^2=>101101s> 0\! 6 SSO-0p@`0M 46CSЍO-t 4000 0$00 L04`0C0C00/pЍp!```Q 0 Z0cQ w0 J<!PP81\Z 0  [PP  P0` 0  3/ ZPu U  u L0 0C0CL00" 0 0 0P0P20@-0t 0@@$!0   80$ &08@1011@2/L00C 02/ᔬ@ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$!6  P 0@-ZCU0 lPC^ 1 0 L00L06&0 6&0/0pP 0@- @ |M l Q \\ QQSH0t S10  !0 @3o|Ѝ00!R 10/`p@-@P rPp `0 S   a0@-4 0S$ @ ` G-82p&xM &  , ! L   PALPRcF0@!104C T*0FPALPRc0^S t ⺴0  !0 PnxЍH03!0%@ 0 :/P> 0t ▴0 !0 P$@nxЍG~0@ T03:0 H@      "RD$  H0XY ,S@ Y `f^^@L@@|@ @@BO-`P|T&o /@- 00@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00~P 0S#020 0qP 0S"020 0dP 0S"010 0WP 0S|"010 0J Pd 0Sh d0@ Pf 0Sj @06 Ph 0Sl 0, Pj 0SnЍ0!Ppr!000m0 Pn0Phj`!0@00e0Pfh0!000c\0Pdf!0:0a00Pbd 000_0P 0800Pp 0800P@ 0700P 070r^5g^g^g^h^ h^r^^s^gs^h^?^^$h^g^g^g^g^ h^h^h^h^!h^+h^@-H00S<00S0 00000Ѝ^^00/G-Sp@` @ S( S11P0 @D`Fp@03/ L03/X(@`pGP@@0P3/ L0G/RdP@03/L0 D03/ P03/ZPH03/T0``_d`O- 0@4`lTD r0P\qX pX>  R7: R3* P N Y  L\!TWX# D p(p W*Y ) p 0S p    0@[ ЍpWr P@@- ^ 0P \0 B^0i\.h^A-Pp4`@P 0Pp 0<0`@P00 (@0 0,0 r4 G-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 0:P  `FP@VU0,00,0000,000000/O-0p `0 W W WP2d0 ЍO/@08"0 S )4S 04PSz@@t@(@@V @D P T*O0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!)0 0 A3A3C?o20 0c @ `FJ0V @DP T*0Z*IY! 0CY!08 0 0: @ `FJ$$k g Ѝ_#\\Kh^hh^C-@Pp T  Ѝb2"0S@O0j0O-M 0S0>W:W: 0(% "S  R 0 [0!> zJD x>#\h^p@-PN@N@M 0> p@0峆#\x>@-0 PS@0S 0#G-p`@00hTЍ PZe 0 YUP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 ЍrO-p , 0  (0MP @0800T0R0S R(0p,0001000ЍPU @0A#AR ODD P P P;/ \H0H00HP0` B0 0 0 H`P0``>0 BB6*a"*UbY 吩0 0  0 P PE\ 0 H0P0 B$0 00007 rO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T -P%@ P @[H0@@ :S P%0:0PD0@S  Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R ऽ (0+0  PVV0P00 0 Ѝ R  *0PVV0P00  0 | $ R l (0+0 PVV0P0 0 0\h^h^i^//@-M`@ኻPT#T,'H0'<UH/, 2?0Rr pB```@Q```CPPP T@%PP `1l pR 000T0 J @Ѝ@DЍHi^Ui^bi^``$a(a,aaaoi^i^i^A-HCM`PTYЍARI  !pŸ *Q   0"%D3S:0P 0Sl %X!\1- L < m,  WT3W0pW0! 1 G  G R#T3T3@T3  tpl1l!0S `1*B0S P1F@T,,T3   !1@TT 0 0 0 0  |W P01GT PЍK i^ _\^ j^^NX_6j^?j^Lj^Pj^^j^j^ \^j^j^j^j^j^*\^AXVkj^xj^j^j^`A`A4`l`[^j^k^0k^C-p3P.@P03/bTD03/0L30HP30?,7?07@sC2C 00J2  00<d2  004H2  00,,2  00$2  001  001  00 1  001J 001N 00h1R 00L1V 0001Z 001^ 000b 000f 000  000j 0004S ЍC)d` ЍC_^k^kk^xk^k^k^k^k^l^#l^Cl^Wl^kl^l^l^l^l^l^l^l^m^m^ P-`@P p!c pЗ!P  R $LGKpL 4D 4/!`@S`!W , ,`! !oDЍReset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! R!oDЍN  0O   ! "`"Рou^;t^Ft^nt^C- @`p(P  0S 00PAP 00(0Sp(Q 00(0L0 Ѝ@0?  0 L0 00S 0 it %  p$`Ju^s@-@ \ TP`t   00 `$PЍp@-1@``QP R& $ z? 0    !u0t0o$0`0i40(L0c0880L00[Ѝp@` fu^u^u^u^u^O-,D,M0Pc3/03/10100S  !pp0G?o$Ğ  Ďß2$AT 0 4/PW W, L  < @0 q Q* ß\(\ R&BR "  R t c00 0(00,0!0 *R J L ,  W !T"< :  @ P7 L>+ T R2 RLDLOoB@   P 4(S0" [04W  P P P  P A@!T@@@0 (0 sx0P(W ֽW [ 0(0L0Ѝ 0 0rt  0 0 S{ S S 0, (0A`pPzO0@ 0 xR 0(0 8< 0\ '_"\(v^_x>Uv^v^v^O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0 wP/ t q0 [0 0a`Pzo`0 0  0 0 0t Q0 0 0$  00@4@@0  P0 @TL@0* R @)Ѝ_v^O-p1pd0P@3/tXXaWTʀ 0! $ 0    !U U+ U5 r?oT20S00 0!t!0   , ! Ѝ f?oT20S00 j?oT20S00 <_Hzhzlz'#\v^00P (031000Co// !:!P/ 0  P/@0. 04S/Q0 /0  @-鍤C.@-醤G-08M@pl00 00,(p$@ @@ @`Px0,0L0 0D000000(p$@@ @`x8Ѝ9_acx^0S;0;0 / 0 R/<0P/0*4S/0S0 0 /000/_*4S/@-0@03/0BN0_Q(QP0\0 /)Q/R0 S 0@0D0/S/0H0_Q@-@ (4S80BNX03/00)4S0<03/0)4_p@-@0Do A("(RP p$$Ph$! ,$" \%R 8A00CS0p0 p@  bd@-@|0T0S$D 0SX+ 0S@@+<0QD$   D$ @@DD @a0 04Ē Q884/0H4S/ aT H$R @-@@8P 084 $ 00|4a x>@0P/-    B B  P^^ $ B$ ( Q !! B B!! 0S@0P//O-PP4LpQTX4Q9 @䀟䠟fU*%*1QP \ : 0010?0@03/@X0Phi%!1XLP L0뚟@03/@Za_ kx^p@-0PXdT4S N@l $60L0V L0?4`003/03/+Ợpa _p@-D@[P\y_0``003/03/`p\4P_pa_0O-P` @P\Q pQ00؁U00SG R㼑= Ѝ ^^p Q@` WW0p0U0 WU0 `` 0!&Q0 !SL   0-  @T00 ЍO/QᤠT ``  U [  R`` `s!& 1!T0L  @ _aA-P @`pTQ 0 "A9P 0`PR  V`p@V0A3100A-`PT@p)<@)[dP_\[_P`h003/`003/03/`hMd4P\4P__耮a_G-1pS@0!R00R0P  \  \ 1!aV0`0ó?0`PQ 0 ^ ` 0S 0PR! S YY S 0h0hS 1S 0h  PU0S0`0004#\ P/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B   /O-P64M@0$0p o6`H4S 0 n 000 \0(0X0勱Vi( 6T&0P0 '6000 0 01,0 0Z P 0P P 9P0S  0S<`(X00 000(0S X00 000X05`5T4 0 0S0U0S 0 00C)4S ( `00 4H03/(Pd$0ST Z 0 X000404. 0 皯,-0?T 4x4ST$0S  $4,'$ 0020P 10? 0S "( 0 <[(Y(jU h@.''PU LPP P 0 0000Q@  0P 0R  X0  $( @jYU jQ 张eU(06 <  (0  00 ` 0  P0 0000 0000 1T!R110011 0404<Y|''X0 |   @+j4ЍR 0000 00(0$ S000T0R0SX0 0T4U ᚜<`d' P  '` 0 QX0 @0`5 X+ 0 1?  _a0f _dbx^x^O-@4M` g(' TU2T 2x4ST B>0PS0 4pp0V :P'iRW @p&: :6S1!f0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% aP <00&  (T&[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0 4P00? 4Sf0(4S   0t S4Ѝ 0fO-@p@7P`f4[& ( *60Q000  谟 @03/00 3/03/}&  0X4% 0?UW 0<0墻OhừPP <`T00  S  S80d5 ,0T42 S0`5 _a`0@-0@D0PSMPЍ00 0P #40 U0*0$@O-@pmf%T:&003/Oqh$ZZVUP!2`$5ᔠ?`T:0 0C0LP @0  <@0H4 00?@03/003/J` _aA-p@`P'f%$4$*$00S%*h(DF0@00V@U($<01S  2# R% h$60%hX 0S(H$HJ$J@L W000  00 p@- 0$@0P000Sp`H4S d0)$4$H P4h5hE000D40@@DDpa x^O-`MlP@e %0I 0000 T : 0 S:0SM;%ЍOg$jjf V `!ZP@ p$5?pT*. , 0 n ᚯ뚯R0 <$0    )d$0  R!* Jp +4S 0,03/0+4Ѝ耮_O-^PPE@p$댐匠ZT:O$ `fV`!P@ $5?0CV0 GQ!803/@Z_O-@p$M`!di$'<01S 01 0  000Y' ^'v00100PqW X [  G EթP D<$ <P 0 q$Pn$f$Ѝ @00@0 00 0_$0皿  뚿$,$$0 !R3 0?  PXP # <P 0 @00@0 00 0 $0皏   뚏P R0lœ\l% 0S 00 He0 <  0p] 0 Xꀮax^,y^Ty^0 #!R/080/_s@-@P'd# %60`P 8#0 00<T##Ѝp@fꀮO-q3S$100@-4S0,4T封勰U !0 PU ,$$#2$$0 SQ 0T(4 xDTE|D ЍU0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$` 6/03/00  !!000T(4xDT U 0-40-4|0 3/VBn __10 P0  044-4/@- 4@S 0 4;P $0T E0(4 0@0/ _@-(a   @" 0 4$(4"@T 0R0D4 p000 00S 000D40P0D4"$TPp,tq0000'0$4$0!*10,$020 0 Ѝa@_@-@c0 4ep@-@Pp 4S d0 4؏P Pp 1T 0(4pǏ1q*$g$TP" 0S0Q D$,$ ,$ B  B  Q@@TQD$h0 0Tn"X0x$R x$#"p@ 4KDPD$ _@af@g@-@P{@腷O-0P 0UM0 0@p 0 00   P@"P/"!+"q!PUЍ 0    D+600 001000 SZ `B 0&`  1` T4 00#Y0 皟  0뚟! 0 Z 0 Z  0d V! B!! !  B     0 ꀮa p@-P᪖,u!@@@ <a@!p耮p@-Pᙖ,d!@@@ <P@!p耮O-`a|S!Ph!Oc@@@ @Q8pW0S   w!XQ @T0,03/03/XP!P  ^!!Z! !p0 0P! v$ B$ +60$ B$ @ 28!ꀮ _0fp@-@0>00' 7D h@t1q $4!*$010D,$020 0@01 0(1C0 0@@ @@@1 0000 @@0 0000@@ @@@+000@0@0 @@@ <0,ЍO/ ay^y^y^+z^_mz^8a@f_@z^@g(z^0f|@z^dL@z^b@-Q0@ V @G0H4踁aO-$M,S($P 1@`ጇPQPP(PEܐ(Vᖨ(:$Ѝ0 o@P0 0000009  nPpp@W T:`Q 00JpbdH?^x>z^^z^@0!S@0L4 S00P4 S$0;00;010?/ap@-0`S0@TT!* Sp0XT S`0dUP0SHVP,g$EO0?paz^{^@-@ !:0? 00$ 0D O-n0PP04 C`nR@` R Rph1ě{`1dX Ѝ@18!L{T(1 !P{X X[#0$  M /FVH0Q   P  |($"(XR#  UB뚿HXH :/JZHH{^at#\m{^{^ !:!/ " A- p@P` X0 X000 0pmЍ p@-@P`++`%L 0+T$;;L4;PdkXd ;/0SPLdkTd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?p踁a !i8@@G-`@0匀pB00>0>0PT0?0?0000?$:=P(N$5?[J {^O-@ᨐ娀zT:00ЍO/ 06Sx`1`! P$5?PT:0?L0 HS @03/003/ qJ_ 0$4 / 0  ")//0 !Р!/0 ! !/p@-PMXP# @,`y~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍpʈ^P002'0 S#3/^ 0P/^d0qp/@-ةP P8@ 0BS B 00PO-`2`BM<03/ sr DR0S0,,"S  & PЍO@٦`Pp 0Sm ᕩ@tЍO}jP;0Q@1į0 00S|F0p00 I06SP<14AV 0 @1:0 0 0 00\ @X0`@Dp@ f00 lL0000L0|^#\ O-p1MpR00P `PH0 P@  0S1 S9% DF Fd˂0 01/1/ Y 1! IE@TSP S0  003/03/Y 803/`J$JQJd$Ѝ00?#\_|^0/\0/x0/xT0@-@0 @RS ,0 Ѝ0000x\l0P/0 S/@- ^@LS:0 0CS(0 Sxl0P/0 S/@- ^@LS:0 0CS(0 Sx@- @ 200@0p@-`!P /@P$P`00@p@@A-餀`@0PU |"p R0P R 0L  80$A @ }^|^7@-P d000@T (T 0PE0%VE$ @ Ѝ00S 0ES:@@0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/0@-3@PdM *QLdЍ0  00R( 0 H  0F}^#\Y}^p@-P!@0PS ?!60#Q0P(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P1 4 X3P S9@A WT00 00pЍ\p@-L(0H@P#04MX3 @t3$0S$@p@\@-`MtPUp՞@ҞT 10'*"*0*00(00,00 $0$00Ѝ#\A-PP@00$00u0P1G 0P$P 0P1@ 0009SaSh" 0C023 0tGQP0S 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P1c0m' #p  *  P1 00AsaS_S<00SS #l     P1 p `p , * " # -  "$.* P1 `0P1 0\}^"~^11@@p@-l0( h@"6 0TLX300$00p@=sPP p@l\G-@t2PY P1ЍGi D0T`R0L0SqRA RA@RAQARARAHRAQA r 0 00000 R!Y 0S<00L0S,3d00!C=xЍGhq 0 P1 UP *0P P1M qP R  qqpx3 d00xC000 2@0S *"*0S 0S$00P1 p40Cp4MЍGt`o~^[^~^*\^JA}^`~^}^S~^w~^\JAX?~^p@-PT1P @0`3/P P P2pT1 0P3/T1 0P3/P` PpPP10S( L6.m@00;000000 e66P1 ~^~^0@-M@ PP *p0B8#8S 00ߍ0:@ <000l$RP!     8@-M` PpP`-*0B8#8S) ' Q#P17 0,00@400300r2T10P3/P184 P1` ߍ-`0u$\@-@8  t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0t$@虥p@-jT1@0P3/PPX3V P DT1PP03/pX30X3X3;X3~^O-MpPA`@ HQ^ 0pdT10VP1 P1% P1  xccv=vv PE  p`%Ϣh P1   858fP( PF~D00,(P$  `r_0P 0$ЍcH0 p moQ Q P\  PL t<Q7L1S /0T t$4t L1 ^0P!00P16 ?0 X3<X3n?0 X3@0X3X3l "> 1sp3t nP0L1@o 8"1S0!p3`3`?0) R<pt3 , - p( jt# 0s?`9 Si&i `t`Y!<#ĠhlÄ t❬X3@W?<0 0?: !t3,t 000W?000*W tV  0t#p^0   " ""   00H00D000h0$\p@-2RP0@`2 R0 RL00P0L00P0<0, 6#p@ /0 (^R^p@-P@`Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@pDMT(h0P00 `<0 $0z [H 0 \0p 0+ t0S 3/0 $ _02\ 0:/ 2@ a`8@7寐P 52@ @P7塐P80!0d R2  R00p + 2\ h0<(,0040 000$0$ 6哂" 010000S 2< 2p`(`X002 p  2( t x@0'x 00 S0!< 80 S( 2@ ŠĠt0S $3/,0( 4_0 $2\ 0  0S      R<02*QA    Q!P X PP <082*P 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    IP X 0Rt| R\ ` $ @` $\^a⡺yp@-@P`, 0B 04@0 0嶿p@#0`0S 3/ 0 pp@ yp@-@P  0<X00X 0@0 00S` p@!00X0S0X  0@ 0 0 04⑾ 0 0 00 R0S 0=@Sp@A-`P@0pS m^mP 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <8AA-@p`p0<00P P h0 03/<0P0 A-@`帀0,! ,1Q 0 @FX?Mb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  AẺG-`@uPP@  ,p}0S S8 @@ D1. 尓 ,/ 408p<003/3 3@ ݑ0#S0RR00R0S @ 00R80KS 40\ $$\ 0& $$ S ,@ "44Q0y NEFXPi'TDG-p`P@PP 0,00202?Sb40003/S3 PP;yO-P0M M @0NpP00SV000S/=,⨗Po E000B0岧bS00x2Z4 2  R+00\ [^d R  POW bd R  Q@000 0# = R8*X0 @00R X@000S0S00ąp 0p0p00S ۍ ЍOQYp[*Wۍ ЍS?`S'pW*p 1W W| Wt W h$0#  8 `@Wzꝳ^a^W^*\^O^|^^^^^Ņ^O-|@4MPpE80S<0:l=S808(QD`V< #" R=嘌D`08 R){80 S-d0S 3/ `80SOhp 0pR00 ҹD >|x< #"0^0<` `00SQ  00  `0{0 00 00{< `V 7<0 0` <0 0Q Q<0` 0 x҅^^ytA^p@-P@`a PUp0S \P0 P/ 0 /p@-@PH@pp@-@`P;0 @Tup0S \@ Pp@-P1 P#UDP30 P0 0 00(005@$ ,009$643<0p#^)^.^5^@-@(&4$<"@Dx@-@ ,Af0S<^p@-@P 00P`fzfAp@A- a@TpUʀ 0! $ 0    !f 0  @ 0! T0t l   ! 00 0h0 03/@T \p P Hzhzlz~/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-@ZU0` P ^pp Cz=,>z0帢,<zpsL!DH1003/b#-  Ѝ_?0Q R 0h100100100 0׿-/@@@B^p^G-@p`Nze1 0 : 0h0 0$3/UP0V/R $0Sh0 03/P@ h0  03/0V0 ЍG@-MP`-@@*8`0000 0 00000000 $ 0S882     㮸 P Ѝ@P04P800@PD00P0t2 X0l2t0G\@`PdPP  H  p(L0ᵉ"p0  ᫉!0  ᢉ!0 F וᙉ!0 N Εᐉ!0 V ŕᇉt!0 ^ ἕ~T!0 f ᳕u4!0 n ᪕l!0 v ᡕc 0 ~ ᘕZ 0  ⏕$0 P6d0 Ed0 Pp% 00 0tTЍ@)u*\^^AdA܆^^^^^^ ^^!^,^7^F^X?A^^|AO-`00@0Q0z P_ PppJ R/U? T2L SARD 420r,, pWp Sp0SpU  QD pW?  Q!C0S ۼټU Ӽ PR  PʼU p2T SR@PR( 4崼Q ЍPR 奼0Q 0W  囼嘼P咼0|`tpJO PRS \冼St<值 PR @x0T @@&b^n^^^_Q^U^x^ F_^i^^^@- o@-Pᄈd0`@W P0@@d0<0 000`^P Ѝp@,Ѝph]^`A^p@-@PH` 0S 000 P0D0L0@@D@匵p@A-@pH`Pq 0S Q D 0 0 00@U LT0S UPuP @AG-`PHp@80L0@<0S7nvzP,$0 Ḷᠶ$0 Pbb t X5p~oP PU @-LJ 0X@[A-@pp0 03/` PYV 0AbX?0   Q @-0 03/P0S/A-P(Msk@PF@(Ѝ0`P0$0(0 `0 03/ 0 $0 0008q/   0P: p 0 `p*08/0P*0=0 888/P< 8!P r? 8 ߵP (<03/ 403/ҵ$Ӈ^p@-P@ 0 $0 ӵ(<03/400 43/寵p@K"-d}P0.X X%,à1 0")!0 <"#1o\Q 2"H>MbX?C̀^@-XM@X  #v 010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X u701H0T@9C>H0 @H0P  0$ 0 0 XЍp@-XM@X  u< H0XЍ0@-P$@\M h娻\Ѝ0X u 0 010408020H0P 020^2p@-$0PXM 僻`XЍp,0@S Q S 0R,@`X u010 H0nTP`  H^X  {u0108020P,@6^`^@-$@00 3/ 40S 3/00 3/00 2/p@- 0@ `4P4P0480(0p P 3u `PU 09 0PA-@p`0 03/ 0PY4 9 0:U 09 00<0S 3/ P0p03/7/PP 0 4pW  7/PP Pk$0 0bc9 0U} ЍA03/$0 >PP$0 0 <4PU96PP$0 0 0 $ 0  dP  0 P  PU4P0S ppU 0 9 0c 0 9 0ЍA0 0S $0p p00 00 Plt PЍ}^^^Ɉ^^^^^AA-@`)Hp1Lp@PU  0R0D0 0 TP_03/T(0S9 0P  IP? $8G5ϊ^^^n^*\^^^$ X0R/0p@-)00+P@*0,,UTJoNOPăVPp(!%\C-pP@d`㈐刀\MX  }r0 1PH\P ?o 2? `V<?oT20S 00\ЍC'C-Q @lMP0@4p+N+ 0BX `@Gr50270X00,@LP U01PPTT0@P@lЍH00 0<P,0X0@P 0f^1^r3_A-`MpP`]@P*U@x 0PN0X TBPq402|0PSd020P0$P@P(00 <T 8 U400`0 0 彷`Ѝ2@f^3_[^@- 00 00 00  0@Py 7P 00 0PЍp P 00 0%>0S(0 0TP P0 3/ `PP, PP  ꠆~^^A-@00PP 0000P80P0800 03/pP` H`0p`0808(0S^֋^@-000 00<Ѝ@-1 0 /ЍA-@00pP0 3/$`Q\@    0 03/P t唸"`P X匸0001k  1\1\1 R004`V 6/P` f 嬸@T :-0  啸03/t卸yPp`P^ ^P^5^MbC^Q^A-00P0S@S 0# YPP`Pp0S 00B0P30PU*< 8X?r_0S/p@-0@0P) 0# p@.@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝ耂@P@@@0 P0`HC-Pp`"Q P 1  0 ЍZ@P@@@0 P0`HC-@P`pQ P 3  0 Ѝ4@P@0 }P0 P ` GC-@P`#pQ P !3  0b Ѝ @P@0 UP0 P ` G@-0000  0Ѝp@-0@0P< 0# p@Ap@-0@0P- 0# p@2G-p00(0S P @P ᣀP`@ᕀ `QP 70S00(0 3/0000@00dp@-P0(0Sp@` 0R000 Q0 (03/0Fp@@-0(0St@gp@-@`PU.0 p@,0/0 3/Pp@-0@Q0Pp ` 2/P D$ @p 0`( "4`#/ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0$ MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00@P8p0 X (n0 Xd000p0$00(h`X0l`射\@P$0 00 0 ՂP@P $0 ͭ <03/ 403/Ѝ rZp@- P@@@4X`TQpC-@$0\MPp`x( X  (n< YD00010<@1`1d`H0$0 00p0 0 P 2"0 2"QP \Ѝ@ 0b0?o0cS2   $ $0` 1011SX m 010 80t0H0P X  m 01$0 080H`P 0  rr2 6$G-@$0XMPp`x+ 0/X  m X00,10D <11@`H0$0d`0 0p0 0 jP% 2"0 2"P XЍ?0 SX  ᣤ*km0hm0141 H0WP @ 0b0?o0cS2   $ $0` 1011SX 8m 01|0 H0P X  *m 01$0 080H`P 0  2222 6$21BP31 a1/G-0M01S`P`1  V~$0] p00 pp0@0*@4/@P PUЍ00p8@@0 4/@PQp1@ 0@0.@PCp@0 =X (l0od0@0h0l0041(0D00p0$00X0@P$0 00 @0`@  V $0J@(PG@$0 @ <03/ 403/T,@ rG-`0$ M@p0c   0P*5/PP@008P< 5/PPB,1P 0<㩫PP4< ḫX (1S\1 R0 Q0Sj 04PUX  5/PPZ %`1  00PP VU  0o 0$0  p  00lPP 0 8YPP  08 0$0        ppp Go57#0娂\1FX0 3/P t5堀7# 000$ 0T p  pp0P*@5/PP/00p8P@0 5/PP14P 0@0tPP#p@0 ყX ph00@000t40 08$0p 00PP{ P $0 b@ <03/ 403/U  @pP0 0 n0 pc0 0 0 R0WPX# شґXpX XL W014六0/{  *Z %Y  0S W  U 2U  PP+ $0 00 @0p@ 0{W $0vW018(W㴁.$1S  p0P p Y#t帱ZW W:1S 1S !p0pPt1<1p!A?pP0  < 0Np00p  0 !020'> !RR p0,  p{0 S01"90 1!(pp00p  0 !0rǬ000V^^ r^4^k^O^%\^^ӎ^^^^^^^^^^*\^^ˎ^5^e^V^p@-P`@v  0 DS P: PJ0 0(0L  rPH TXX `[1ap P0!?A1c L\1q`0P!2 SOp 6e `'``` HLaX߭pP  rK 6HF `'A`` HLa9P5 T0XX, `['<0ap P0( ?A1c\1L!4L1%\gfff|^^p@- `P`@0  p `l XpPtHu@v8w`0xya | pH!R0BS2l]p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yzazˏ^C-lM@d p$X e02X`P*00 0`40 ` 0 0 `h0&hS `Pby$0P 4Ŭ$0 p4P0`UlЍ00S00P080P$0P8PX0 0 3/$X )er08,00X0P  NP 000P0 M bP C^@-0000000倩Ѝ^C-@`Pdpܐ܀\MX  d$0H010 0 )0 1P$  U   `\Ѝ0 1?o2?opW<UG'p@-XMP`@X dL0 H001`?oT20S $0$0 00XЍp2W@- 0@8 0 0$0dM 0 03/$0P$ P 0 R0 0a PPPE_oR_0]dЍ$0 X Xd:020U0?$0;P03P,000 03/ `KP0`$0 0Q pO zP0SQ0 03/T +P 00 X d20P0 02PP 08 00@-\M@PX c010 PH0\Ѝ02p@-$0P@ ,Pp 0 5P000p&P pO-@`pMP0 0$0 p0  0 wP`\Y Ѝ2 0 P00SF$00C 08 S"00 Zf 281 000 0ߢP00 00 6P ’+0آ֢ 00 0Ϣʢd P00 0¢0  P00  0ᴢ00 0嬢0 P00  0ᝢ wO-P0M@ 0p` 0 0 03/P ƪ #Ѝ$0 P0 ?0 7Ppl W 2 0 >P00SF$00C 08 S"00 Zf 281 000 0P00 0+0 P ’+0 00 0 t `00 00 P00  0 v00 00 P00 0ء8^C-P@$\M@>R`>:p,X  Hb 0@ #0 01020D@H0@P X 3b 0` $0!01020d`H0 @P X b&0160 H0@4\Ѝ@A-@M@! `Pp 0 1pA?!0@P !0@P 1 4ȧߍ0 ~@I^!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-cr O-P\r@q9P)m_01naV!n1SKp9U~o p\`MV ᎞`v[~~Y~W~Arڌ$paMP  MpPW $009=[ ILMPM1 P NC-MPpqpQ@101Uo0|1 0p!]?lB 0t 0p1l!嗌q!0 v}q|!0 ~}q\!0 } m4n010ȁ1ԁ @fL01$ F40 00\` V10㨁 t10 4P5/0 4P 5/YP 0 4 ;/U ^ 0 !0  8/` PE(_CSel(/C#b?0E,匠lPቢ1  P !  0P00 P(00 000 000[P 000 P (00 000p000[P  [0 0l0 0W4Ѝ@#\@-۠Ȕ^@-נ^p@-@P^PpH0. `@@@DT$0E p@03#\x>00! $0 /Hz 0(0S 0@o/Hz@0 !!/@-0 !@@-0 !@p@-Px@x(Pǡ $0dP$0 ,0KO R0(Z,04S00!pHz^B@-@Dw0DS 0 ! 0$ 040-^Hz0$/HzG-`0p$0PUGU !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pk10, TP2/Hz @- 0 ! 0^ Q    D $ 10@X@@@HzQ@-0DPTp@-$0D0P !@8pA-@@TTϟ@pP!@@aQ00, ,$041 0,A^Hz` @-,00@10CS@嬟0@!,1!,0,@Hze^B $0 0!0 00 /Hzhzlz,0P 0 Qp00//{@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S K{^P0@-  d@/  R 03{^@-P`qi@`00@k00  p 07/PP70q 2/U/,X 0 4 8 < @ D H L P0 L P< Ѝ@,P P@ Ѝ@&ӕ^^{%B^ ^0@- !3 0 !0@- !& 0 !O-rP`Q@U@Tp  q[0p@ 01@U0 0000TX Ѝ  0 @[T ≐<0  Pڸ 2/p[ >^p@-P @@@p0/{A-`0@P0c  p   021   0 0Q000S$ S"A{a^^A-p0p` R0P0Q0C 0@ E@s @{G-x1TP@Php LX 0HS4,0S ݝʂ 0 p0@,0T`0,0 BX!0q10 X X@ T0 t  @AL ]@AB S @D{ǖ^^%^O^!B!BG-0@pPp0  R( & 0 b ` a.`%RP  Q! 0`@&F @{@-(0@0@{ 0#0{ 0#0 {A-P@0B@`Ap0S  A{ 0#0{G-0Pp0XI@0RPQC E` Z +B+B+B+B+B+B+B @ G  @ ߜ{^p@-@@0SpP:0 PpA-`Pg8` `p00p 81@ Y0P   8/P 壝Ѝ0t M x0Q  6CQ@ 6AoV0,  0Ao4^p@~C`A@-@ 0@!S &BS &S; `Ѝp !S0SP 0SP0SP`p' 0P0  X0P` ` 6/P@0 \` 6/ M0` 3/0S8P 0P  p@`A4/!/!`!//` `! /!!!! !1/c 8!0/c#c4 4#1/!!!"!+!3@-`P,f@)P0@00 p0 7/0P ePЛ d`6/0d` 6/ Ѝ@*\^͗^^@-~ho 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-1p@ 0dP5/0 2N ` P0d8/0 48/V *V``U`3V  PVV010!SV0`4P 5/ P0d 8/X?A-0p@ 0dP5/`P Pd08/0 48/V *V``U`3V PhV010!SVk0`4P 5/ P0d 8/Ap@-D00@ !0 4P5/0 , !pp@-T0 @M04P 5/0 00dp@/@-@ (1(a(q <@Q0  wM sMP0 00P 0 00P0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/ Ѝ@4/@6X?D6^1B2B7@-PBf *x0Àp0F0FS0 iPg0@T :PE@d0 0S B @DT Ѝ0'YA-0P@`0!0 4p7/9dp 7/0 dp7/0 !!@B-0 4 0/-0d /40P 0S/0S<0//|0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LpT P\LX` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPpLpITP,Z`N `Y  \ X B`\  ::0:0 & SA-@Pqbp`::S!QL2ML8PpD01 .O-P P4 pჟ0  A ` !@T  `pW㊠   Ѝ0' 0R S 2/< RJSQ LMLrD q @00P `RA \ R> SJ @  f r > R"4AQ43 Q!, 8\, ,0@8 @8   ** * 0P0 z @  f rS 2/ma0S8080001@bq"^C-M`pb@p0000嘙 00 P0 5/PP `ЍCIpL2傟@   p@W ("(000 00 $(0,0 0S?3 Q0Un0" nU]]PLRPLP*00 PPp008/P  1 000:88/P )>0:! ÐP!: P<: R? p@ P 0j=0:* 00 ЍS^^|e^^^^:B0A-SPp @ሀW@0000W0Sbv000S00 0@H 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzh-|h-|A-1P 0(0C*s`Ѝ0 d0@ L`P pWQ bQ ,Xs`P,XQ bQ0<00D00 87 H0R0 R1 WH01H0XH01H0 0ps8 4\001  @ 08 0@@0 0s S#4  4 Z2H02,00@008000@@0 0S%40040|A-@P2PXD`q@pWA60@008SQp 0sK 80SQ88   x븁DjXD儖< :R!D01 "0D20LML q @T0@0 0s S#4AQ48 ** * S#4 BR4 0R", W S#,@ 0S#,8Q, 0 ,0000001  @ 08 08 @@0 0R", W|^/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/s@->0`@ P  B` 0ŒQΌ Q @͕0T00 P05/P  0 ЍpJ^p@-0P L嵕00T0@4`X 6/TX0d` 6/p@f^O-,M_x0@ d0SS0 p(а d0S ,ЍS CS 0C$0P]K(0``03/P_ 0PP0  (0`P  bpꉙ^KB^p@-@$0 03/$003/0$00) 3/ $003/$0 03/ x$0 03/\XP$003/Pp}PUp3/$0 0 N'p@-0P`@ N0 0T @ ` BT0 0p@/0@-@ zN T A-0@KDqDDa`PU P Pw0  R00 C1$003/P00P$003/P0` 00p(d0 U T0X 4P5/T0 dPX5/P굙^X?^/O-@,M d1!Q є嘒d0S TX00 P0H 5/pP X,ЍOpd0T 0C?odP2X5/x0d0SS0pd0S bJ,ЍS CS 0C0(P` 0pPP3/0 0 0 $Ma h p@0 p# h00ꝳ^^ə^֙^^xIB^GBGBp@- R 0@P5/00 ]p Xp@-@9dP8 5/0dP 5/{p@ B@-@@s@-@00 P0 5/PP \Ք00Ѝp000(` 6/ 0000^O-p0 bԂ009 d;/d0";/0 d;/)`0 d;/d0\";/ 403/ 0d;/ 403/ 0d;/ 403/d0 ;/б 403/@C @0 d;/ 403/ 0d;/ 403/ 0d;/ 403/d0 ;/ 403/ 0d` 6/40 3/=d` 6/ Ѝ[ [ Yf9d`T 6/d`0D 6/0d`( 6/=d` 6/'O-0 c0 09 dp7/ dp07/@0 dp7/g`0 dp7/dp0"7/ 403/ 0dp7/ 403/ 0dp7/ 403/dp0 7/r 403/@Q 403/T@0 dp7/ 403/ 0dp7/ 403/ 0dp7/dp0L!7/ 403/dp0 7/q 403/@ 403/p@0d` 6/=d` 6/ ЍpW pW ZX9d`T 6/d`0@ 6/@0d`, 6/=d` 6/'O-0  q009 d`6/ d`06/@0 d`6/`0 d`6/d`0x!6/ 403/ 0d`6/ 403/ 0d`6/ 403/a 403/@ 403/`@0dp 7/=dp 7/ Ѝ`V NY9d`T 6/d`0@ 6/@0d`, 6/=d` 6/'O-0 0@d@t0"409 d8/d0$8/@0 d8/ `0 d8/d0#8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/8 403/@  403/@0 d8/d0"8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/H 403/@a  403/d@0 d8/d!0 8/ 403/ 0d8/ 403/ 0d8/ 403/d0 8/X 403/@*  403/(@0d`!6/40 3/0d` 6/=d` 6/ ЍX ;ZX 6X 1[ 9d`T 6/d`0D 6/@0d`( 6/=d` 6/'p@-@9dP 5/0dPl 5/\0\ dP5/08 4P5/90d p@/G-P@ep|0 4`6/`pW 0;@@ 0<@@0dp 7/@-0d@ 04/d@-0d@ 04/dQp@-@P00d`@ 6/0d`( 06/ p@@/A-@P0  00 `0dpH 07/ PP0 4p7/p@-@P0d`D 6/ 000d` 06/ p@`bO-00pS&Z)d`0\#6/40L#3/d`B?4#6/`$0HSC 403/CBPi XASZ` ` Ѝ0d`"6/d`="6/ `㈲ 403/P `V <d`D"6/400"3/`I  40"3/C0@S Z=d!8/00d!`:/Xd0|!:/ 403/ B?d:/@0d@!8/`,,40 3/0S: XZV40 3/0d 8/3/?d :/ᔠ唰40 3/0S vZ4H 0:/d`00 6/ `d 8/'G-P400!3/o>`d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < <像000( 0"(y&\^*^p@-@ 04P5/0 0p@-0 d@4/s@-`PX@`00协00 ` 0 6/P XXЍp@1$ G@0`<SIXHn8008080(040,0Ѝp@d5 0 00$0F^Y^u^4iBPhBeB fB@-@ZP0S00 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-P 0 3&*?=0 `p?x0@xpz@ x0@J4 F@".PpP0d 8/0 dP5/A-@`0p4P 5/0P4 8/`{?0 0%3?0 00 02000%VP4 P0d/// QX0S/X0@0/-0d$ /Uꛚ^ Q/0N͚^D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/P\`\p0 48/  U 0PE;U AX?^^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P@`U 0p U ό0S X婍@x0tdP 5/0dP 5/@p^p@-@PT@h@@pp@-@P0d` 6/0d` 6/( d`\06/T00T0spp@-@P`\00\0dP( 5/p@`@-@$X H00H00X0@ep@-@`gP\00\0d`( 6/p@AQ G-@PQ10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPZDpPp6Q  0L0GP0 d:/ 0dp 7/1 dp7/P0<0#!H 00`@00  00004040P  <彌0L0H00H00X0( $00040(0(@ P T0`^T0XP0T0@`0dp 7/ d`x06/0d` 6/@``p`X0V0C?o20SX0S<0 0 `F>^_^n^X?^O-0@4P, 5/0P( 4`6/P ( PX0S   P0_ X0@0S X0<0X0H0@(x X0L U l X` H04p+ <0p 0< 4:/04< ;/ 0 'W0L00 4p7/H0  <0! 0L0+ < 8/04< 9/04< :/H2$p 4 < (p,pLpL0S@0SP0<0aP [PX0S  `  X0L P0 X0<0X0H0@(S?V\n \8PhV C/P` XpP X` `0HP0H0@% V P0S+9`P I YE0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@C-4MPT@P冋 0P 0 P05/`P 3 `4Ѝ0p"GP `0P P5/N02p0ltNPlP@R1W 1W 0W$ @d1W# 1C7CW2 03/P0 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0000000 @\A @A A(@^|Q @-崇/^0( o( /|p@-@8M埇2("( Rd Re  R C$ R R  R C$ R0 C/o "`PQL$ ,`z(`w$0S2 03/203/2 0 3/P 20S 3/`P lvd`g0eh"P0  00l0-P 20S 3/H8Ѝp   *\^R_|^^^tB.^p@-@PPP " " " #p@m@-Rop@-PB@P{pG-0M`pOK?0S-0APT) 娠 0S 0s S$Q0 0$1 0(1@0(?0 00$Ѝ#?$@T0Ѝ$uSBp@-@`OPL$D忆@00000 81"Ppp@o*\^^^p@-P@O01S{O8 p@_ R $ R $ p0ꗞ^@-,0D ,@ 04/01/@-,D@0\ 0@/C-pwOP0A嘐T <1S 0,03/`P 1O$.O 0  $@껞^@-JO0AT0S $P B@S/O-Pp<p!@C`RT0唰唠B  &PPpW@D  0RTT >000DXQ01 01  Ѝ蝳^&b^n^^p@- 0PQ@ `M ` 8U < 0 ܍p^ ^G-`@ pX@ 0sP<WP@ @H S0s  SPW/QP CQP P Q :QPP Q 1QPP Q (QP W U QPP 7/P@-@N0@00/X0 @-=(/^@-}N<1 S  x [V [ [C Y fY @Y 0$000000[   ,03/   ,03/   ,03/0    ,03/P   ,03/P   ,03/   ,03/PY   ,03/   ,03/   ,03/0    ,03/Pi   ,03/P\   ,03/   ,03/PC0 01P000P:00 0 00,p7/ 0p 00,8/0P000} 0Sz 0 00,p7/ 0,, +  P1+ _ 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/Pꠂ  10 01>  0P 00 R0So  ,0   \73/0PP1>  X  X,0   L3/P0S  ,0   \c3/0P 0,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( F8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0 P%6R0P0$0(P3/0P 04 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P0T CR(BBBBBBBBBBܱBBBBB\04@\p0\08 043/UP 0 S000 ;@p9/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0QP/0C?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0h(|`X d,0B"3/PXp\ @F@Q` ,0d3/ 0 T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P0[[n <1QU! !,@p!;!  9/U\0 0\00 00^@-@M. 4 010K/0  $!(! 111 1014!, p1>  ލ^^n^^\^^W^l^h^BR_w^^^^^^^ߡ^^^^.^c^~^^^^|_ʢ^ڢ^^^^^ ^^^)^4^>^^^^O-p@Pa崱$!0r0C?o20S (!0r0C?o20SP@ Q= EP:P7 Q4 EP1X0S BvQ)voX hPh F0041P041CpC/F0pBpp Y ` ЍLv0 R 80v$v00S'\Tl^*\^^n^ 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q 1E`P 1S P&EP(㕀 0S|5\p@-@ 0P` P@HTppA-`PBX4S @Tt'Pp@-0@@ TCPPP T5PP PT\0P4p@C@-@TPTP0P4C-@Q4MT4P 0p`  8/P x4ЍT4  0   p  09/@PE |xPT4 0  2/0 , 9/@ TT4 0  2/꺣^٣^A-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-MpA@hAxp \T P HЍOx 0(0  RC> 0800P 5/P |x @ 8$D0<4>`P2帢42 4HVgxG 0 P Q CPP`P$0- PP ,2 ,4$2<0424242$42(484,;/P00@4$0 0S( R !0R "0R 00  1, 04|1<4t14p1$4l1(484,;/P00@4U@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4$0Pv 函Pw0 }Pw0X4Ѝ*\^ B^^̾BPC(B0^`CxCCChCwL0P0P P奼P@v0H102p@B^ BB^`C̑CC^^ 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-P`?|4S @'a8Pptp@- 0 R\0S 0 000P00 Ѝ@\p@-P?00S PpU@t 0  tOPP xQ tt0x4< 0IPxxQ tcxTP\CO-M`p]?@u` tpP  k P ЍO v 0A(P0000h0 00S0404РE>L00 8/P ЍOY04 04 0S E> L00 8/PB4X 00 Z1S @jPp$Q gpO-@M`P *0 SP*0 SP*0 S K? E?PU*0SY @00 0 0Y2Ѝ0`pX d0`\h0Pl0UtT=S3: 8t #8;/T=X \S< x 0`;/X=p`T=S00> 0| \6/P p `$ (, d  0hl 0W*0p4W Q0CpT=X \S3: 8t `#8;/T=X \S< x `0;/X=opT=``S> 0| \8/~0@-01 0P ЍXB\p@-@T=X PS0@  ``\6/0  T-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 ~T=X \S`PA0@  5/p@0  nĨ^G-BMPpk=U@a 0h#8P$  +PP $R0$=1S 0 # PP t PԢԒb0 /T-X=\R ( 08/ PX͔\T=' S  ` 08/T=X \S  `08/T=X \S  `(28/T=X \S ( `98/PUS  `P05/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/PUT=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=\@PT=S0> | 005/0 SW0l l 0.POBߍ$Q $]t1C@]˨^Ĩ^#EF\G-`@w<Phr@ X P G@)s 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}<p 0\ R`0P xr G^ ᗸP 01r*\^pB^BLj^^^^G-p@ `APCQR  U010! A-P@` 0$ pE\:o X0 A\ ^G- P$`(p,00 N\:o AY Y@0 G V @ AT/C-@P@@0$M,(c 0`#Ѝ\P p@-PH0 & @4( P t1  0p@_p\@-@xPt`$0M\p(P t1 0040 000p`00yЍ\G-p0P 6 0`0(x0@U  Z40 0 0Ѝ0 00:/p \vd@-@( $0$$"6 0U(@腉\@-@`Pp<<0$M(A((0 00ᦈЍ\@-@dP`p$0MH`((P t1 (0 00]Ѝ\0@-P$0M 0 0 eЍ0BB@-(0 0600VЍBB@-@: 1R0@-80( 4@"6 0 '$p@_\A-pP`@:^ T 0pA/@-:@Gs@-P@:aV 0@ (6/@P@ЍpovdN^@-o/@-p@-`:@R_ᇱt1`>p@-P@RoQTpt! @-0@( ?P/Bt1/G-R@`PST1S  7eP l%,=0;;`8P1QY 0 >2`0 82VP7??( dG賯X?ժ^R]R]p@-@R_o᭯T1!0CST1Sep@㋆p@ܯ0S$00 0S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000,00(0\0 0T0@00P0<$  0A<0 P kDЍ0^c^S]^A-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 tn9<l=D=S3  70 ,k9l=hml]衆7^T^O-@0P `phPh=Sl=SX=pT=\S6 0l ;/l=0l=d=   P Ѝ T=X \S6 l ` 0;/T=X \S6 l `0;/l-k9T-l=X=R6 l 0\;/ P D;nT-X=\R6 l 0;/ 0P4xVt^@- PU `h=@Sl=SX=PP@pT=P\Sl 06 7/l=0l=*P ЍG-@`pPT-X=\R0 ` 09/D=S+yXT-X=\R0P  5/x0PX0 `m<T=X \S4 h `08/ 0 m蠆^^000 ͓0\Sңp@-Ph@X1 01  hp@YG-@}`J1吀011S #S3P11011S %cPP 10CS1c!Pp@-@mP֭ 10CS11cp@ =  -0=X T=\`S4 0h /D A-@P`}X= 0\8/  D=S1pW3m<T=X \S8  `p#87/T=X \S  ``06/T=X \S  ``06/X 8 ``\#86/^p@-]p@1-P Xl= S-<<j=0=0>03p ^&S]^ 0!< 04 0 (   !/HzhzlzO-P@`0ȐpW # ▹ Li` V 3%0000@@ T Ѝ,^\ P/0 !8 00 (  , !/Hzhzlzp@-@P T9S 9S 404 0@a 0 (}p@BX?gfffBD=S/p@-@=P0C==0CS=>3;3p@hBA-=PS`p @PVD=S@ 0 &=@S蠆A-@p !P`P  0P Q- 0T  \lЍ0A S  ,k 0  a^^@-@00PPЍ7@-P@@=S 0 7 00009Sd=000 PH=SQ  OZ09SB B BB B B(B B0BQ Q   Ѝ0  DG-0Q@pPxh0MQ w0ЍQ o 4=3/|7S (h70?0?h70?|7S 0 0@a 0 (3|7S H/ox""0 \  R # 70~Yq 7B^X?gfffBAp@-PMM@x#cP00C0S0ۍЍp S;0#0Q0e  Q  QH @=SA a"Q{  Q: @-RX"QN ["Q[  Q* BQ@-\ RE"Q 2Q*2Q-0S00?600 {@2QQ 0CQ0Q 5>8#8So \|T` |70SS`  /  ("(  'd@=S d= 0 CP6M0000@=S d= NR d= 6M0@=S d=N0@=S d= N09S >S$Q:0SKL  S* 0C#1L 00 7@=SH0QN0 N P%F*+:iA-όp` 0P@aP 0 `YP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S( S S@@n R 3 0ttf h@Ѝp@S@ S S@ S@@S@@Ѝp5S]Ԭ^O-@lM@=S D=Sd?`< ,0"=0>0$0=S >S3;3lЍ9S9 YU 0S990090C9Z0 06 p 0 P 4 0 03/039Sb.030@]  \P303TbW ?9S咩PϩU 勩PU 0S000000C0彩_ Z0q(P 0 S30 03/IpPG2 0 Ѡ+t %PP!\"(0傿)R d- 03\ʔ#G   0 宦D9Sㆍ P0S ` P 0!:> *00! 420a08/ᠾ(0"0D100 0$00KC195 S) 10170< :0#(0 501=0,0P(  0\!Xeh.d=  P 0 H0 0YXZ Z!0  b 0   0 P\D10=   =0C== S-0>0>pꨏES]^A-0=@S 3/`pD]U  PP `V|gPT=X \Sd 2 0``6/T=X \S4 h `` 06/  N^A-S@\`M 3` <3 R `0 `ЍP) bVpP :0E?o2P0S PU   4W00`pPVPE3<30A-MM@p$%`PPq`l$A0Vn  V7* V  V @-R ,zx $VG ? V Vr  V@=S0 S0N0D Sg*$AS0N0; S06M05 AS0N0/|#VP+  V* BV X RVd=B @#V  ;0#VV  BVd= 1A 40 d0 ۍЍ \ R\P@-R 6  -3 P Pd= 4S0N0 S0N0 VAS06M00 PrP 0C. P 0SP@-:R .0?T0:@=S >P@=S 9S H=S S S!Y0>0P30 00PPz0 00@=S2Po 9S#Pk 07P Pd P9S9  09Z gPP S9i*F%-? S/@-@pP`,M  @C3"0 @,ЍC-3@@DM > H=S  CR)N <G a3@ > d=;d=9)"" 2PP 3@. >DЍC> P@ [0 l U C2@PV0@0 TP3@ > U DЍSP- 1R >  =H=  S9S `P^ PP0 S 30| Q ;S3 #d`P{0 PP` V@p * !(#{]$ 0d- /p7/@=S/D=S/=G-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> P=0 .:^^XW3XR=3 ,=3/@]G`O-@P@MY,=3/`P0@= C.=b*H=S989d=0d=9SC|CCCCCCCC`P  ?< ?989H-R9  ;S ږo #}> p ;gQ("( ;px0} 010 @9  )%$ ~  d=   d=  d=6   d=  :S0?ӥ=t /9S H=S)> L <H=S $> CN0\ ; ~9S 3   s9 : 00 x0======H=Sp3iYh3f 0>>0.>0R 3;@030)9R3S2T=X \S2 d `P05/Y 9S HQ  9S9tR:k@+R0 0m`Ѝ  H=S ?  00C0S0020ӕ fڮ۾=-  P  c `cT-X \R0 ` 003/ AT1XHc<`T-X \R" D 003/T=X \S4 0h `8/= [0=S0- 00@Q PH=S 0 yZ^  -%3S]2D 1x]8 ^=^+^p@-P`S4P@@MT @:1p0p@-@2@=Sp>PS 0CS>02lJ`p@>S 0CS>H=S >S02p@Ou^C-PpM>,P@ n`h@P $Ѝ1Y0CYD1Ye 1Y 9 - 09 nx94P@4 =#@=S M\1Y7 1Y. 5@P#@= S7 9S    @N S 6 b4P@3@ @uS0 @0 0RU@P4P@3@ WH=S@2iii9iO-@=@SdM  +P #X=\@T͔ \4 h ` <dЍO/0 000T-X=\R0 ` 0P5/P  . T-X=\R @ 0`6/<00p  0P 0t+tCb2 9S2"ἴ'804;[:9S { T-X=`R" D 0p\7/=-0C==0=1  .& nT-X R$ H 00\3/00` (0P㖯! 0@*4a= 0.#3 ;3& ET-X R$ H 00\3/<0 0` 0 P▯4 0)a= 0.3 ;3 T-X=\R  0P5/` 0p`1)S q S  BS T=X \S=4 8h `P#85/= /3  d=0S P 0=00 S0( H0=T=X \S`02 d `P#  .[.0< 01(320@@00` P! (ǟ:|"!(.$΃$ *00! " ( (.@70 p07/0)0RSЪ h4P 3 5*8S00C8u6 ᥇*݅0 0 0iX"tt^: (`P [ 30_ 8P 0/3)` V0%.F'K+~Qp  ⦟0H(མ=[)0@%\`= -JZ %,`=0= 0F&>=~)0 S$bᕼP `X ] ] ] TtZ ]Vt]p] )pXG&n` K+Q 0 /w0H(མ=[)0#M`= -JZx#@`=0= z0G'>=np S0 0 02_0CS񟗃 #C#CD#C|#Cl#C#Cd=0d=9S9Stv `43/+jd=0d=fH=S >Sl"PZ 0>W9STd=0S9`S 4Q`PEUP#D뎄 U >^pP>P,K 0$ 0 0$ p7K-00 02` S02́"0000H-Q0R RJ RD2G  0> heP``:g>  (L0>YP 1>#F&U   0e1  ?& ,22?2 ?"LP0C.>2>2?5?# R #.i,tm_oDcS]^S]S]̨nS]^^^ۭ^48|^^^9^M^s^*\^^O- @ $MP( W\ $Ѝ] ✟O(TT=`X S2 d `P0\5/T=X \S4 h `Pp85/0D= P0D=U_}0 4"P  R2PXB  +\0p 00 pp(\H}0wQ R*[0H=H=S10S"t[0H=0 000X0 0d1!42# 0L= [( 0(=v p[0H=0dp0 0 1!ᬆ2# 0H-P=R0&SS+ 000 j P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P='H=S% S% t[H=帥帕S L}dd:9"a0@gt^[Pd :9ȏ"a@h 00L[M' *+ )+5),|04p@04\r0404043099!= 0 &P Y^:0㠠 0I10S S2 ԊJ베YH0D PG0  SBQQ Q"< 1=0:H=S0 d=  0 P0 d0מ0d= d-H-R' R R;P d-Qb?)d= lQژ0d=\3Q8<9 9<9< !S:S]/d-P-R2R9;998<9 9<9<  : (0 P0S909 0 0x 0 RPl 0SiڴyX b*>02 t=$2(x=6=⾀ᰀ^ᥡK'ܙ44=4!8=141:1:141=1=1=1 =vM@p1X 0>9/  >pp1a  8>p0T8<;Kj>0d=$1R| xH0P-d= 1R9 <9 p@-@%P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002Ṙ`p1#: c0@0005C4CxEC4C@5C@7CHC@C^@-@4S@/G-3PA@,p0 <300Y SHPbVH剚3<3X> - 2X>00`V  -P 3<300 UHGfO-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S !껲^ JCKC|LCKC@9CӲ^ȒCCC Cp@-Y@P&pp@-L@4P PDp$0 0!0 00 /Hzhzlz-0 ,0/-0\ /@-00l@ 4/Ѝ@-0 4@4/-0d /A-Pp@`T d08/< S   S Co    / 0 /8$@- ? \p@-d0@#0?HnP0 0110  00p@\hp@- T?P@H1`S P 0 p@0/p\hp@- T?P@H1`S jP 0 p@ 0/p\hp@- T?P@H1`S LP 0 p@40/p\G-,0P#0?}H1S@.P0#`WPhnW0tp000!1-1-10-1-!03/0 P1UP!؀0!8/10C1101Gn\@-~M@& P` ^880U VA0NЍ蝳^^^@-<0DT 0 !0  !0@- ! 0 !G-L1@pT`,A- (\0@ R'3/# \03/\0P$3/00S "YZ x0| 00++R4Sx00x00 1 PxPh\0@3/ PU`0 83/00 (P 05/ЍG̀H|8_I0 0 0L \00P00T0[C\CT]0\Cp@-@P 0X %S  05 0pp@-@`P 0X &S  0U6 0pU 0\00`00d0p N\\C\C\C ^ B/o P" RA-P`P@& p@" p@OP@ 0 ??00??CS0cS@@-@`08 3/ `0$3/\083/P\0$3/8-lM 0 f lЍp@-81@S@00tP-1-!03/03/81SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p0-181S-1P0 0CS-10-1-!03/*10*1*!0p@/A-P`J0p9@@ 4D1S H!R 3/0H10@ 0 0 0`P 0'0 P嗙 5pH|_HU] *08'1Q0@   D-1/p@-@x`tP03/ `V81 0CSp03/ 0 3/p@d03/Pp@-@tP81S@  03/81S 03/0 03/1!03/81SS/10!tx4``8 #86/,!03/*! 0+!3/0.!3/81S t#0\` 6/t \`616/81S*!0@ 3/ 03// 03/*!03/0`1 S 03/-!0p@/,!0 3//!03/0!03/,1Q@00,1&10/!!R !10!&1/d21S/*!Q00*1&10/!!R !10!&1/O0| 00Q  Q  BQ*!0 &10/!!R !10!&1/*! *!*!0*1,ltG-@ p?p(,"`PP H1SPЍP  0$P 05/pP 0  pP1T 0@@PP00"ލ1TJ t1T0CT 1 P 1?A3c0\\t]t@{t K1@Xt@jt@mt1(@1(Mb31S/ !t       000 `0/p@-@^`W 10 1@1  ``0d 0 `0d 08!@0 0-10BRS-10-1R-1@0-10-!t3/iD1Sp3/0H1pp@- ?`#P0@ @003/DH1S P 0@0Sp\G-P0`#0?H1S@P 8!(pR' pP⨏YȀ6$0( S S00@ 0990`1S @1S bpP,@ ᥌,0B 00351 p"  4!  *!?   *! +m R*!4 1!4!0)1(0S`1kS*12!0k8!0GtpR/1v00q R0 00 (0KS0ږ S~0A0R.1.10.1(0\1`10@1&10!!RF !10!&108A00 1 10 10%1 1 10 1p81S'000003/08m#!Rj #1fR*!1!4 *!*!*!  }S*12!0*1 0 0 0\8O-t0 vpTM`? @PpTЍ0  1S P P0 pxP 0&>P0@0S`̐@1S 3/P ,NKpⴋ0H1`0d 0h0S 8܂0` dQShP0 h00&0-1@1 -10-181S-1P0 0CS-10-1t-!03/03/'(v>  !嬋 ᪋0$@=L0K<1h t0L L ,0H 9,0,08,0,06,00`1V1810<1t1D1  A 111@1 01 10 1 o 6 0 HpP0  03/pP3 0@00S-*aSt Rh00SZ=9 R =?A3c2#d S 0"#!0 "#1R 0 34,J\Y^MbKH|+8X?^p@-0 `"6 0?H1Sp@P 31S ^ʊV 1  10 p 10 10%1 1 10 1<\O-H!R gP %!PR %! A(0q 01pBR0  R<" 0" , @W`0@S @DWc ANq!  BR!V: !K !  !-! -!8!R:-! -!90@`FS AV    R<1! 0 03/p !  !  !0@`S @D` BR-!`t6/ ! !  !Q$!R ~$ 'a(A(D5!@ 0 2/4!  #! #! , 2/"!R "! $  h0AΦ0,0 ЍO/ Ѝ8X?`CO-H1S~ @Py  tPĉ03/81` SP4f03/\,!03/03/`81 S 0S @0P 3/10u03/ 5 R $ Q Px |  Q $R0x0 x 8!R0 !e `V03/03/`h0Sd`VH ᎉ Ѝ3/0>  3/,!0 3//!03/0!03/,!03/ 03/t03/ pW03/0p3/ 0H0 3/0k,! 3//!03/0!03/,!03/W0 03/  &1S 0!&11!aV 0V`!p0!7/10C110103/`1 %1$"!0 o 2/<20S  $0 R Q x0| 00 P04S x00IS 0x003/ Y 10%1 10 S 10 1 Y 10 181S3 0CS-100-1-!03/03/'at!`&`'  Y又)! (! (!)! 0110$1-1-1 -10-1-!03/!1S0!10"1^j'H|_(^^^K@-@M<4@A-p@ `0S @S0C0\0@3/\03/\0P$3/l00S "SRH x0|00Q4Sx00x08H|_ H|A-`0@P0 p0 7/pP pzVB `0H3/ cpPKP 8 `8/ `0<3/V `0(  (3/V`0MC <3/ `043// `0,3/ `0<3/ U `0H3/ `0 3 %pP V8 `#88/0FS `083/ `003/`08 3/`0 3/E$`0 3/V@  3/ЍC-`ph@(h 0 `PP 404 x <(Dlpph`t ЍH|_H^C-@0`pMtP0 0``FF  -  ) %4p  081@0f-10-!3/tN>P0 | Q S*  S  h LaH60S t0h,0P nC81 0CSt,0Sت 0S0@00000810C S񟗽 CCĊCpCTCCC،CCCC000|e00 㸪0K  XfF0  0D0iF454eAl1,5Pp1$5t1 0| 0 1᳐ *10*1@ 6d#::d`0l$  $001Ft `@1S0H1T0< 0Q0 Ѝ000d00@000d00000c00000 0003/c000 0003/ct Pt0 4`x6/  `R006/(cZ0 006/ cR0 003/d03/Pb03/Pb`0`0081 S= b81 Sx03/0` 3/ 03/03/ 03/,,0 3/ 03/03/ 03/ > < @000;0a>03/ 03/ 03/03/P0,, 03/03/0P 0     0 03/0S` S`0 3/0@S` 03/E*\^^^^CH|_^'^ش^^T_C8lqCyCHU]|^zC^"^,^9^D^д^e^Q^ڳ^ų^^^^^^^0@-@PtM0 0 00tЍ0p@-HP0S p`@n<P 0ST00pH|@- 0 0 t3/p@- @tP 03/03/pp@- @^؄p@-A-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l"?0 \` Q- ( "(R0#6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0*D03 \P05/2 ,P5/2P,` 6/ `@ 0@S! @ P03\` &N6/0 `xp0 `!VA@H@$P@ 4@0P,@#P^+^<^2C2CU]B^K^#X^O-P \h ( ` ,@,4/ R@ Wd0 0 ,P5/0D(0@0O-P\h@RpC$Mx102c000`0 00Y PP 00$10 0S[Ѝt0S 3/0 \$8/ 㪧 ,0,3/[ t0S 3/0 \`$6/ 㒧 ,0,3/ 0`S  d0 }}0X?a^\0O-@M0Q05php  P@/ Pt0S  3/0 \P$5/ T0 ,P,5/t0PS  3/0 $\:/ > ,0,3/I YʠUUPPPPPePS UXt0S  3/0\ $9/0\ 9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/0P ,P9/PPZU00ЍPt0S  3/0\ $9/0\ 9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/P0\ P9/0 ,9/0P ,P9/PPRU |0 3/}s0 ,9/p +40\89/  {0 00 l0P U0 $0\P 5/0 ,P,5/rPt 0S54 t0S  3/_0 2 \$0:/ . ,03/ ,03/ ,03/ ,0 3/<0S ZP 2"0   X?$0$P 0#! !0 1/X?MbG-P\ `@0h0p@$S T @@p@0 4/Ѝ  \`8V@0\t$1D 00:/P@\' S"PT0E 0 0`` 0 6/@D @ d 0D9/`FVH0P@`S"PT0E 0 0`` 0 6/@D @ d 0D9/`FVH0P@`G-P\ `@0h0p@OST 00@0 9/0P@T 0 ,@ 4/Ѝ  Q`4VIX0P@PT`E0 0 8/ 40@DQ T$1@00DD9/0P@T@$10 0DQ& S `VI0P@PT`E0 0 8/ 40@D@0 4D:/ ` `FS `@0 4D:/ O `F@-@pPl}`Pc 0 , Ѝ@:@[ 0P 3@ Ѝh^s^R0 R R#+ H@-A=@%?#+## #/#+## #1wꁵ^^O-\0@@hpWwP3P p@K O 㐤  / P |0 ,,;/,0 ,;/*0 ,;/0 ,;/$ 0 ,;/"$ <"0 , ;/"( 8"0 ,$;/3- R p  34 8\ 0 08/0 ,8/2 420,8/", 4"0 ,8/$0 0$00 ,`6/$04$0p  34 8\`  0 06/-00-03 03 v3 p0  Ou 0 0 0@40 \`86/ TG-@`hpB}|03/<08 PPUPR40S0P U` T l.? Xr? Dl?@j?p +\0x!40\8G/õ^^^*\^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@`h 0p@{P:vP\v 0T L0D; 0 0 0 00 0h0 03/^$^^^3^O-\0`pQh@P t0S 3/ 0\$;/ p +40\8;/}0 ,8/p +4 0\88/ Wx0S 3/ OT(0,0000/@-@0\thA-`pF"PB"@{X0VP`|`hp6|\`2|{."+"بC0 RD   R8  | R, |  R  X R X `sCCبC$\ЭC@-@[0Q !@\0@00A-`JP@0S P 0q@P PMsPp@-P@tp@p@-0`@hPP 0 \00 ,@,4/pzP 0 0 0 0h0 03/P 00 0pp@-@P{p@0,uO-Pp@004{Y 0 S0 0 ЍO0  `P` Ѝr@P`  T0 P  0@@X^O-@MphPU{l$s`P ߍON{rP! \0W%p  P@<0 R80S@p<0$Rt.{ˡ80SOʅߍr80S<0Qt0S 3/0 \p$7/ 㮡 ,0,3/p<00St0S 3/0 \$9/ 㔡 ,0,3/<0 R@ 8 R4S@0 xw0|r0Sz<00  z<0S( 0 wP z0"Swz < wP z<00 Rp    z`mt0S 3/_02 \$0:/ (X0\ :/0 \:/ ,03/XP<00 ,03/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 0a3<3$Ѝ 4à@  P ^8pP pP#8 㷞MbX? CA-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`w 00 0wPP 0S  0  0` wt08 mtU P 0,q p@pqo^\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \#90/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@(@Đ0A\ py ЍU]@-P`p@(@Đ0A\ pfy ЍU]p@-@P0 \`6/ 0 \`6/ڝU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&x 0!d!0    !0G5HzhzlzX?7@-@ &^b0202020 DR2|0U@4S0000 v2S " [" Ѝ0@{ꐾCpCCC2C2C@-@ &@,w@-&wPp@-@P&w2020p@-@4@SS&w 0@X?@-@&@w/@-00 x ЍU]@-@8Đ<0\ @/@-84< ,@4/@-00 x ЍU]G-p@d尐PV㬀ʀ 0! $ 0    !&Nw 0!d!0    !0GtHzhzlzX?7@-@&^ 0202x02p0p DR2h0唏0000 u2S " ៏" Ѝ0@迏CpCCC2C2C@-@D &@pv@-&vPp@-@P&w2020p@-@&v 0@X?@-@!&@wP/ 0\R/@-@ 0^   \R@-@0U. V? 5 Ѝ@`4v^^A-PQ+ t@pT'}P xP `0d 4\0 C@P 0t000 4Ѝ@ڶ^޶^^^^ 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0V]@- < Ѝ@- 4 ЍO-M@p0 (P $   `0 S p  .(, (ߍ      0 (p @0p@-@MP `y  @ @@ @@ K }zw t.   ܍p@-  Ѝ@-@ ЍO-MHR@`L @, B?<00p (008 <040,0$01 @L +!0$ 00,0 0400<0 0 (00 000 8 @0 $ 0 "$ , ", 4  "4 <  "< 0 0T p (08 L @ `  @L $, 4<\.@! ߍO-MHR@` L@ 0(0 0008 00!p000 (S08  } zw.@ ߍ_00! X ( S 0 N 0 p$008,0040< H @L B8$`!;00,!4 *4!. $<! (@p@-@MP `  @ @@ @@  x  . [  W܍pO-M`@l `hh2 00h2$p00h2(P 00,L  @ H P 0 X@\0T0L0D0@ `lx @@!H!P!X !,0( $ OZ`@ h$(,.` @ߍP$0 (040,08 40<00<008%d @`0 H[ P W0 XR00 D 0L40 L0F8 TA

$;(8,5.` @ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

*P0&4#000#0PeU1! 0< <0  P `F@0HV@0 00o`V 0  @02 4p i0<0 Ѝb+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0 `pPU 0  %$- @00 

0  >2  >2  >2     ލ0 0 000 00pG0  |0000000 00@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:[OTPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/L00 0/LG-@`pP0@M 0a800,($@ @@ @008 <0a,($@ @@ @ԷT00L0000P % 0  0 |t`P ()P l$0088( 00 ( `Uߍa]۹^S^TW^^K^x^^^O-Mhßg?00P0P L0l 00S`P00(0,0 !"00 0 0 3/0@ 0 4/ 0 3/ 03/@@00p0 l 03/ 0(9/ P #0 廼0 嶼@P 0((8/ PP <#0 囼0 c] ^S^TW^,K^G-@`pP0@M 0a800,($@ @@ @,008 <0a,($@ @@ @T00L00000S !&.LPP &> 0S !&> ∵&>ş 0S " &> yP0p0 58/5 0S !%tP p5 0S !P5<< R$ş45 0S " 5 CP0p04 8/؄0 X " $SP P0 PU " 0\\ 0@ğ 0S " (  P0p04 :/0 Z "  P P0 P U " 0xx 0\ß 0S " D< ҴP0p0 $3?:/ 0 ?R !P 0 0?S ! 嫴"0?X0#00tl ➴P0`B0&.088/&.P &>0 ∴&>/⃴P&.00!08/!P 1 j1!eP&.00l!0p8/T!8zP <1@$ L(1 ! GP&.00 08/ \P 0 .0 )P&.00? 0@4/? H>P ?0P4 ?0 $ P'ލd]g]^TW^d]_^d] 0@-ALM0 P0`5/(@ @P @0 @ 0P00 (p7/@ 8P @0 г@0xP0 (P0 p7/8 PP 0@, ⻳PLЍti]Td]Լ^Ti]^Dj]^p@-`@pMPߺ  ݻ`a R ջ@T h pЍp07@-7P|@~ Q@00#47 b0 P Q0t Ѝ0r00#4p@-@P`\08M 00 00 P ( Q8Ѝp@-t @I0p0p@-0M 0@0 $0D0 (0H0@,00070P` P `@0p`0Ѝp@-@P7`ptM000 (, 8 40PЍP$` 80 p0 P@`pPtЍC-pp0MMPSrX@`P `'0 (`(0'7 `# ``m N 7 (pWIKp 7 (Q  7 (h `0 `07 ``1p 0b"!4b4# 0(0 7  (p0h 0p0` Mߍⷹ7 (⹺ ( pG 0O-MP$0?0AP (0p00l  07 00010D \n D0Q`l7D\` R 婰@hR 0T ``Z0  ( l7 ? 0 , l)0l P0Y R ``Z0   l7 v0 , l Y  07\S0lpS WPUZO*ЍIk]u]p@-l@P G  ?,ap0@-,M@P#4\0    000Z?,Ѝ0<^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pP`4Ae#T , LaT@! =PU,QP N  20 0  0(< 00M  ,QЍG\@-$M-#`||p0 rc@P D0!4a000ld  $Ѝ<\0@- $N@ f4D\,7D@- Ѝ@- { Ѝ@- Q@^@-0 ,0S s<00,X?@-pO- Ppp`0DM$  0<00,(Pp`@ጡ <0400,0<0 0400(P0$p P`wDЍp^^p@-P<@L0,`P@00സ 00V$  p@z%X?p^w^^h}P/P0/h}@- 0,X?@-0 @  00 %P NP `PP |C$Ѝp0 P 004P0 PP$$h}^HPD^׿^4/0|'RI032W 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-P(0@Tp0S @p@-@P 0T 00Q 1S 0<1g2$L2:1S!!1! lfT(0003/p@`^}^ 0P 0CP@@d #/  N @@<0P 0CP,0P @#// ̇?0S@- c. QAAL0QD80Q Q 0  )2$2x] ^B^ P P/  N /P PP0// p@-`(P80@Tp lP @p@-W@U" (R  BR(13/4WU PEU4WiD73/4W(8S 0CS(8 88 3/(8P8P 0"pC-wn0@S!p !R 0h"0d ЍQPLLR厏10! R W  0 S1S 0! e E0! R W%!V V0 S|QV& K  R 1V6S1 !/ |(|Q=|$ V| X Q VXXW} WyNxP qG VpMNv V|Xx]Z^^x]^^O-p@0_2 0iP>05/cw^ 0do00`0S PX 0p  0벰p W` 0S2001n8^0 Sd0001c00fN8XR0S00d0Q00@Sg/1!t1153J`!01\A  1ES  0310@0/1S01 ЍO16&!6&0- R    R    R   "-" R   .R 0  S0@008Sh0 S,01 ꨏ^x]}RD^0.R  "-" R   wP/P/////RP^D ^DH^Dl^Dd^D ^Dl^D0X 4\ !8/P x7S0S/x]O-`@0u_0Pw>0S4 0!0pK눐到0S|D@TP Ѝ P @  0 0W   ,p_^^ ^*\^^p@-`@PPp@0!0/00007wnS000q 20|7S S S0< 00CS`D`D`D`D`D`D|7Sx8D!0 0<00;080p0808070B;0;z](^O-@`p0TM^ 0=0 g $ qw>pWzp{ 3 a0 hp7  0 gp7  0 gp7  0 gp7 0 gZK0   0P> 0p gp7  0 gp7  0 gp7  0 gp7 0 g0 0RP 70A \ 0Y0 SZpp0S (DgY 0 0PT TЍ `P( 0 S0 `` cgp7  0 [gp7  0 Sgp7  0 Kgp7 0 Cgpz]@B00 S   P 01@/x]A-P@P"y.\8 8S+ S! S w~ⴀXa` 0 SD200S020R  ?PbS S    00P Qu?0XP `V0P/ P^P2q?0^ P! PQ000 P` X#0SP`h78h7JK400   ` ``0S 'P48S|74XS 00|g6 h78z](^J0000 000/s@-X 0@^! S R 0 0S0A:1D!0CR< 0 D10D1! 0!0 0 0 00 0n\ SЍp D!R 0S00 000 R 0D10CD1! 0!,0 0  00 ^^^΀\Q: / AA!  ////p@-@8 MQs 1P 00#!" 0 0000 `0V :3/P 1 0l t 10 18003/@ D08003/0<000 Ѝp^z]^^{]G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::{]}4iDiDiDiD0S 00 , QQ  /z]$^}R^0S 88 4!RR    !/z]$^}R^P0P//}QG-@p ڐ1 0" $10$1Ѝd`PX$1Q2S(10(1("Sh 0O }-X 1 0! Б p7岠`71 0! `W p71 P!l `80S0S `03/P 1 0  베,10,18003/ 0`R ᤚ0 9/P 120!S 0! 0X x W㲠`0`4!S 4!n 0 Hi h0000{]^}z]^^y[^^)^_^^^p@-@P:3/P:3/p@-@:3/~:@/G-8p(MW 1@P` ᴐᲠY0 0#!"!0  03/P1 000 0000 101(Ѝ \0R 1 8 @ 101 :(ЍG/^^D{]^H^C-`@ 1RP~P1US^1 nY0 0p1p 000P Ѝ08 R<<r  0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*w@P  # 0 3/P fw@{]\{]n^s{]^C-Pp(0`S!R# S 0@ xs0 0R@@@N@80S*WwPU 00 0@ Ѝ (0 S*!R $ $ $03/P{]^{]/A-`P@HM p&40%V   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`Ms 04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p +P`Ѝ{]^@-0<S !  4 0 \ Ѝ0 ^{]<@-@ P0@00{]/O-P0 r;r(@,2^Y^///< 000/< 000/p@-<@1 P UW0 #3000p^p@-<@1 P@W  %3000p^, 40 !44# /|]G-@p0#800`400400 40P 0縀P 008#80  008#80  008#80  008#80  pW㸀O-@P@ᲰpᶰᴠḠᶀẀ` (`"(   @H$H@ +ᶰ *Ḡ z(Ẁ s`h&h` l ("( 00#0@H$H@0@$70 +8078 *8᪨ყ 0(8ᨈჇ`h0&8hg 0()400"( 0 00 "  Ѝ0 $ / 04 8 /0 P@-88j0QSh7/~]^C-CM@000 S0P `P \P00B_PqUpaE0PP C00aQ 1A U@TQ + BpWBXGHqWBp^..#4.P 0@0P B?1^BaQaN1A^00B?01S0#^UCߍ|]^O-AM P0(a00 S0@ p@ \@00L@TqD0pp C41Q 1A WPUQ  @(@AB,$LAY ZIAJY @@L@AT(p ,40,8,̠0 F`<1Q̀ A\AA1LQ00<01SV0#0Aߍ|]^G-@$N$aA$P 0[ CpG   pGW ` | v0 G$@$N$aA$0PK 0Z  KS%P%G$P$@!@d!@!@0!>#`1# $ ( #$0  #(#< 0$Ѝp0R@-P@0  <0`101(0 0C`  &ЍpG-R@P<M0 % `1 01(ppG0G  0m gP 80R %Ѝm$"P//O-<`@ P1IM 01p 0  0 0 000 S0 0>1Q X 0 0>0SC Dd(0HL@@00C pTS0!@D0\pW)T* `1  R0 :Y  ZIJY ^ ..!.0@P^ ΂ a\aNL^Q !^UIߍ脂]^A-0@`1Q X 0 0>0SC0 (@ B@D0R !@D ^P+T, P1  Q0 &IߍP(PQ !%^QY00 ZIQJY PP^PQU(   PU@T00q^qENQUQ!$^]p@-.0( 4?L00L0S 40040Ѝ, Tz0d0252 5n$YX0Zp0S1 <>4.Fb0|>!\D00D00J S*1 =-Fb0(>!GL00L00S SpDDDDDxDtDD2St *Sp 0S ! 0D=D-HP00P0S0Pk xl00phQ1 <,Fb0 =!L00L0yx7S 0450!0P0C2X00Z0Q1 <<<,Fb0<!L00L0Wx7S0X0Q1 ;+Fb0(<!L00L0@0`0H5Q0[0 1 ;+H00H0Q  04 8 <0,S0S P |0S! *0Fb:!H00H0l0S1 :*Fb0:!wD00D0 R1 T*Fbd:!eH00H0X VY1  )Fb:!OT00T0YQ xQ 1  )Fb9!:X00X0A=P:1  `)Fbx9!'d10d1xW !/ A&V101<00<0101|7hwSpm2Sj W   Pd dc7![0R 1  @%M[ 71pw. h7R7!66h7[071?%0#  1  @M ?qw>0S㺟)  ;5?|Q 2  Pq<`0S ;!0:1h7 0 000T0 )08W l7 U#l78l70 000T0(5   8P! T $P 0P`00 0&P  x8Xh'* 13/?S pT0D$ d|g V 7S 40040 0 RY-1 6\%05 'D00D0BP*1 5 %0X5 L00L0P 2P P00S ! $0L5 H00H0pZ1 5X$04 D00D0_0 S ! $04 H00H0NS x RP 1 3  6`00`07h7 1 3p#03 `00`0%x8W` V , #`pW 1  TK, ;0 00 00E 1 2"02 yV )% ,P   I#p0P Q5/1 HR  2"0, T2SL00L0㸑aἡ  @K 0 `:S  0 3/P1  101"-000|7S0 Q85/h7 1A T10T1!l00l0|7S0 Q5/Y 1 000! 0 C c ! 00 000 0|Qy`h0` UE^^^^"^ ^^^^3^L^\^t^^^^^8^^^s^^^^^#^5^^B^m^^^z^^^^^^^^^^W^D^N^@@q^^I^^^^^ ^(^^^^^ ^^^^P^P^^)^^.^^Y^0S20HQ! 00C000  10000FP Q1 d10h18!Q S ! 010FS|7S괬DDěDDěDěDܬDěDD! 01!7S !P 0$28V V㐁C  $2$"`0000 0>  C  !``$VH,> X> `0N 4P 8P < Sጾ0 0C?o20^3baE0`0>_ >!0>U i V1.N ?`/`0 4S !$0L00000h 0 0[ XDDDXDDDXD 㠅  EP 1 4C$> >000c $(P$Z 1 =  0 =  0SG Q1Sx=X 00 0 0S8x 0 $0P 0 P 1 $ 4iC0P HcC< <P0[0Z0S  P   PPj 0000I|7S0C00S0S !R 0;0X909!5# ȫ" ##Z#\Q ^ Rʐ 0  0 Ph;h+j000101%0S S S;`4pl!0 l! 1*  :*00 0~4p00p 00(00`P WaP 000 04 00|7S.DDDDDDDY 1 :*l000 03  0   P1 909R0000pY0@ h71 \909L);$00$0101Yx8U1 90@9(%000 00 0 2S1 808|( 0 a6/ 2" p0 S!-0002021 H$B!= 0S!-00C02021  HB!= 0{PQ1S} 3/z1  HAP1 `f HQ 0SH1L1 P10CP1S0 900S000000 0P0101B 000 @  0c0p0  |00q0궱0 $000SG X`0I50倀05X 0! [  ,0P,0  P _$0S 101_000\\(](0Y0 0(00嶱 pY ;p|W0p 0S 0080 R ,03/P1 40$4101000t0p0S*_pP0pz  Hd0SX0SU0SR0SO0SLXIF[I0 0S`B SE SLX@ R<00 4(40$0[46e_ pY (  B8#<40W0p2 2z08#S ! (  0"3F000101F[L XX `Z80[`P'_000(00@S. 1 l20,"|200000101Q[0 KfR0 , [0, H0\00Z000CC@0 Z`P^ 0 KfR00S 0 [0$0$``n0h'?o2< 41R (00(0101 h10p!0h1(10/1!|7`S h7 0d aP8Wi 2S30601_꤭^b^x^^^W_^^^^^#^^4^^^C^O^[^^^^^ ^^3^E^b^|^^^^^@^^^/^^\^@p0<0(3*R5d^0 0 0 3W^@hy004 p0/004 h u0P " x(S OW@lЍ  ! !B000Sp0p0p03 R S 1! 00 0. @X Xh'0@)4t0 0 0040a6/4]|'R42 H(p? 0  l0@ X 1 2"02(!.40040h7 1 202"$00$0{04 \Pq 40 0@00p10p180080|7SA00S<2S1# 30#3D10D10 a6/% S   03#H10H1HaV1 H?, q L10L11S 3/0SL1H100PHPX1  H> M1S 3/   H>0 ;09000000 0S``0` 0001S 0 0x5q -0@-@PM0 0 P> 0Ѝ0@Ѝ/p^0000S0004 R 0 000u/@-0@|7S2S 000ЍA-`|7@S2Sg 0!1Rc 0pS\:P020100010020 0083/ ? 071 0o!GR # gD1"022222221 " 8,X" ZNT292S988-#87 0C2c70r0Q   <0   04Q   10PP0C0Ѝ3254x]A-P L0R8pL `@㩩|'R"(R# #0 83/G?G/ @0?@D00Q0000L00 00 R  001H0G-PpaFđMT> 0 Xi (  _00 4S! Q0 000Q0 S0#+   "0 000083/? 0? 071 0壽!GR # 国0S/S10C1ߍ (⌽0( 0" R 0Q   0   0" R 4Q   q )P0p`F@x]p@-1BMS@BߍpP` @P  `P 0,ۨ0Q  R ,A!0 R1Ł!@p@-2@SP 0aS 0 6/p@03A0AS@-@e /C-@p Ax8TMBRUhDDDDDDDDDDDD0DDDDDdDD0#8S >!0R1ā!!@RPPa|4V@  PP` 8. 0000000Q<<0 0 0000 P'""#"0 0S00 000U T@ PFVQxc n 0 ""0 ㆧxW %_o`/R χ166S1 000P U0!01S 1P% TЍC`TЍC1S  ^PP  `P 1ZS01ā! BeP2괁X ?PP  `P 2 01 SP0} p l01 R0PUQ $ `,0PE("(!p7 0/A0S 0(( %=>000QDDLDTD\DlD00000r"N90r":9?o2|N8z?xh728s"}0p:S| (0TЍC/]DDA- MPpE$%@`P0%`Sb BS` BSJ? S#* S~  S< `02010?0x8D!0100"]00 k"]0h78h75^0x8?00h7#2^0n^0`P V C Vѹ@`U0"0u"]0h7=$`C000i;0X 0  ൹L 000Y*-O|JDG- M@h`"\(P;`P  0<R&!S ((Sp1>: S  Sp&"`'S p, BSp'S?;C0CSLDDD4DpB!Sps HS:Sf S p'SW0S p7 h70h7? S* S}  S|7S pG  Ϥx'W/o"  6R| PX?;CS񟗧DpD`DD`DpDDDpDDpDpD0DpDXDdS[ *,AS\S#R @0SC00P0S Q>⪎0pⲐWC嶠C ㇤ @0Xp8%S BS6 BS  S / BSZ|7SQ cP> 13/8L%S r SE`=0W SQ`4#=0 K  (崸03A0ASW)0S&!V&R! 1?0|8|7S3A0AS13/4P` W 3   R< ! ЍR <3W0SDDpDDpDpDDp'  |'S|7 x'Rp' p' W0S08 w~0S 㴀u?0X  R0\ Y "q?0Q  \ W "= s W "= m W0S p7  h78h7|7S7S03A0AS7S|7S4`xh7u  8h7q  h7 A ^RD0Sx( 0•>h75 0oR70S.0‘J1W/ W?B0CS)"= >W1n00S0 ‘V1PP6P 00 S C  RP0-% EOO-?@Q`|M? p3C>6CQ m3>6Q  ?QK 70Q4  |ЍO 9h?Q'0 00 0p0PPFx0@FSD0D0D0DpD0D0D0D0D D8DxD0DDDDDE0EEE0DE,E@ExEEEE$EDEEEE(E4E0D0DPE0D0D E0DPEPEPEPEPEPEX E EEE E0D0D0D0D0D0D0D0D0D0D0D0D0D0D0D E E=Q  =Q F0Q0 0CSP24PP=Q7S|'R h7   eh=Q \ Qa T=P=QL=|ЍOWa0.|ЍOA=0SVSS8 E EDDDDDDDDDDTETEDDEE1S S Sh740 03A0AS]7SZ4Ph740h7h740@S+"P( 10CS DDDDDh70h701!x8 h750h7h750h75!0B8#8S"= Ñ PO1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P.!h7R00h7!h7R44!@R8PP<0 SP:XM=0S|7Sxx >VP J1P|Ѝ > _ pP[ :3/ 0= 8 PP < `R # $"0 # p< XڵW >  PP 3S>ñ:3/W Xop᚞!Rh8\PP8Q|7SxH☾ 9Ppo 9  @PPQD}`!*R<80PPi80SS*1|7S.9 iR B0<yPP# P?0CS|7S < @P 80S$ < |'R R0<墻0 S < @P 81#3/ 88  |7S PYpP P, !PP kx!> 4U !h7R 331Sh75h7!R R R5p|4z5x1S p7h7:ph7:l!h7R33f!h7R22p'P 502 10h7EP!0B8#8S ȕzpt1S7 Wp7 WP pP W [ pUPY1SU$ "0pN!0B8#8S ȕhF!18p7b1019q W8 +PPd 8x7 ?o2x`QQ 6P  x@Q @A0 S |Q80 Q_P|X x0@`P|V` e 8J03A0AS7SP U x01@0S S2|7S cPP  13/P!zR8PPW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U PP 03/P Z0U 03/!R8yPP 8 5 0P> "'wp7t  d1/@0SX1X  &%-  P8 E` E E, ED E.  PP Ex E E, ED E B"P9 919"d B"0i9790 9100000 910000iiii9ii:ii87ii8i(o?) D]]F^* *]x]ɀy^hzlziHz0 9100000 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201:!h7R 0 0h7w>0S108p'10!S"-08H#8,C("(R! 8PP 8` V#=0 ᔞ h9o! 8⋞7S (#8 9! 8Px 8  0BS !R r39S0S0 p Q ARQs0W@ 8S8 R>Wp:3/Pᚾ0S 0H pH0P,PpW@:3/U0S {@ X0 0CR00h'4PS4400Rh7{ PP u0 0H80p-HxP h7~N#2000@000S@@W`"( 0PPK0T0 TPP B > 0S p7  h7 ;h7h7 ; h7N50000> 0 " $oh7P:: x1T%SX58 S!V&R! 1?08|87Sq|'R8%S x(0!Sf|8R8a x(0!R7S|7S|q|ЍO0 00 0p0PP |ЍO$tx"u#P   03/P}#|ЍO_Yʀ 0! $&0    ! @aRa/#R07PPWa/ 0!`'0 !    !y0C-DM,00 `p\(00 00a00$  P<0@=qP0(0`0$  0T00<0 a ,+qP<  cDЍ^_^^^]@- ,@0xQ S,@0AZn Xx( Ri x(Ri. Q - Q UTX P$0倛$0 3?>4L D01"S o`% 0CC1%50 V00XW0̯71G y027=02c|000彯D1 9?9ᵯ3 :5<:M?0:610<10bPb00000C0zJ0 R@40c@,04@T \FP,0I iRF9 RxH5 V' \P,0 0! 0     ! 0S 0ЍP4@ ,00 1S\,40G  P4@,00 p0QpHzhzlzx]0S/EO-@TMP8 <1#b0p`0c_80$   ,p(`nP0$02 0200,p0(` @408 nP'> 0H2$,p(`0/0,2  0408 nPv 0 00졟!18 $ 0,p(`40nP`0 00!18 $ 0,p(`40nPL 0!X18 $ 0,p(` 40ynP9> 0 00!18 $ 0,p(`40dnP$w> 00$ 0,p(`408 QnP0N@$ 0,p(` @408 ?nP  <<xTЍ^E^_^E^"^.^9^D^P^^L]cp@-@:P,p@-@`PUp0S00`00C0 v `bL-@-0 0? GЍ Ѝ/Z^p@-PP UlU`IH@P I0000 ( I@P@p_^~^'A-1P@`p x(0Qᔀ- 0!x8 S ڭVed0 [B$Ѝ ˭V0 lg|[ꝳ^^^@-1@P` x(0Q|pp- 0lx8S 0 f][ Ѝ@$ ᜭ0 hO[ Ѝ蝳^^^@-1@  0@ i<[^^O-1020`003/0900*= 20T1Y00 0!` 0@0 00aS0@`PpЍA]^x]{] ) @0) 8408008,08089!= 01/&E%EKE8$E@$E2 029 0/202/@-8 040#Q0l78l7 0.  ( ( #- x Ѝ1@-@ h70 0 ,00( h7=h7l78l7^^^]p@-@P83/p@@-PP @Q]UYxw w> G" !`  Br 0 0# Ѝ B7SD10 1  Ӆ`0< <`eGG?0L Q^^^-]^A-`P8p3/@P\00\0  s@-`8 P3/@P\00\0- 1 (0 . x 00x822x80!L0003/090020T100`Ѝp@]@^{]A-P`8p3/@P\00\0  x8 0 0x822x822x⨨x80!x8 99p@-@P`X@@pp@-P@P xG G
1S 3/pA-P@p`000 h d `0?0?x80101 M? 061071 N? (Q 4s$Q 0n 0 1SA/@-P ` pk@P 00 0s ЍA-|7PSS` h7M @ iN@p0 R0S P@xHA-|7`SSp@ h7] P i^P]0S TAT10 R0S P@xH⻰0S i V1Sp1 '0D D0 0P⠰AeЍ☰S]K^A-@y}`|7 pS 0 xXℰJU |7SS@P uPLP1 f'0 000q]s^C-P@@@`pAT ݐ  ᱭP01SDP1 <'0, , 0 Ѝ@ꇈ]^G-`X  pR 0S R@OoB@PU@ nP 0R01 S  R 0S RZP0 P0T@`C-p`@Pi CP@T Ѝ0S 2Pȯ1 &0t t 0    AT  P0S P @ꨈ]]^A-P@U+ p!bP ЍAW0S0S i V1S1 z&0D @ 0!:P ЍAЍ̈]^@-@xP 0x8i  <P 0<8HP0H8p@-|7@SP yn<089,8xxXP 0 022220000990w>018|7 S13/p^A-1@` !^y~|7]S11 P8889,8PPp (# x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGtQ ⡮AR]^^^@-@xQ `P P P 1  <10<1Ѝpx*P 1 l%h\ \0   D@  ,h70SU? #~Q A1 "0 `l0Sp7  |7S 1 $!$\2+~Q A1 !0 E0S1  ;h76h7p7  1 l |.h767h7vV @TAA!@^^^^e]%^K^j^^^O-P`|7MSS00 03pppn1 p0"#0W  ЍOXU @T N00Ѝ0W p|7S2  0S *4"|0 0P?00x8S| 0 0C8C80Q Rn P1S: 00! 0L!0 00HP 0SH1L100P10CP1?H1S 0 R B0 Y 1 )! 0 |1P 0Q113/0Sʐ1  0 J 2S 0 ᬑ9/000a)Sʐ1\  T0T , NS@]~]^^X?^^H^(^^C-2@SPpM !Ⰰ8#8X 0 a6/ЍCa< ` 92<2<! !000w>0SB !T20S` ` 42hǔ00 㲒 Ÿ  @1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? n0001 Z 0 0GP+n0001 C 0 7S 1  h76h7?!  )  }h776h7v202r1 ``V  ` 00r@^^0^^^^x^^]^^^A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3ٝ@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 0, ,P@00:p@y걉]M^p@-PiN@ @P`xh✨VxHp 0^ 022220000990?p@_^s@-!]1 @R0Ł<>HP1 00|!|1| yG 07D180$881m`Ug,884X P10X 00 0in  F  0(' 0' 8' j^6D'@7<7Vtx8 p  p'    L ( @ ) x8 Ѝp̉]^^DPE^h'E A-pʀjP{Q` 0ES  B2U U U ,U UPPH$H@㲃Wpx@'x@@@p*0000>0h'0S0000@/p@-P@ ˞s000 0t u"    @v w 0  " @x 0S @@p]A-0 0SP@0p `.|'R]E(]E`]E]E`]E`]E]E0 0⏞  ⋞ ⇞003213030 0x  t  0l  h t0/C-@`M8PP000L Ѝp0 `ݐ0=0 H02 |7S0000(001011 `ώ X0P   D b00L7SPP7HWLW0P7^_^@-205 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R!  R  (R  B/o"S0|'Rt@ R R  R R  1 0S "N)R]O-0LM SP@` 8⫝h7 |7S 808 8Rp>0pS s39S~p$H8R.p㲢 $$8Rh7 4@W80 & #RH L0S0P !0 >0'S s3)7R1 8A>0 0\7\0000H  0C IRO~7@P000S Yڸ 94,80W 000040  B    04@ 014@T7 7U 0      $D"$  (0 0' #RH L0S0P " 9;@P$000 W 0 04;P 4;@;@q 0H   CX0C00000(00(00000|'ReEdEdEeEdEdEeEdEcE0 0ⷜ > Ⳝ 8⯜0 0 00ZT 060S  S  S#:9S00w0 00#"!# #"0( R:W $4RN 0@0080 Rm1 !0110/1!LЍ 08h > dx 0 08Z  V >32130300W7? o#嫲Qh' |'R8"Q S* h7 |7S8 2 R 0@0080 R (03/P1 8h P81081%[ 80S 000徠S (Z !%*0$@00 00 0J(0(0 0C 00 0J00 00  Y ! Y: $pY  7PpPG6 I60 0徛 0 010 1 00 00 I0, 06, 00(0080$0p0 C0000 000 000((0C@60 8000000C00 Pp9^{]]n^^ ^-^C^T^O-0S h7 #  000   0  8H(#8CQ,[SSSx Jo᪢R  0 0PP 0< [㰠岀  T%0 @, 90S 1 4 l0:0(101R(101 |7S  #RH L0S0P  E6PP 0 T;PP 0ᰀ00(0101@8S>HHPP |7h'S000 (  0/  p' ; W00  . x ⻗000G h7  40S  Q 圗0 00 00C0(0x3rPP h'00  0  ;X00  岀0  " 101Gs~h7  40S0 0C0(0o 1010H   CRB0C00000 `(0 0(00000=000  , R :01 1 e0@001 PW|'R  0Grpq瞶 0 %1 0100L7SPP7HWX0P7080LW2@$Ѝ褭^]^^^3m^^] ^%^A-`p1@P 00(0K0P 000p͖  ɖp@-`P0@P 0; 0(0 `  ⲖpG-!=⼐p7# 50`Gp@- PP 1S 0(#(000Ѝ 0/ |'hR    0  + h  c000 fw0S 00000   0ܵ0  00|'RI00 0 ! h7   Vh72h7h7 M0S5 ) 00@10 @( #RH LQP  ;4PP    N  0 00H   CR0C00(0 0(00㲐0ҕ  Ε ʕ붑9Ҋ]A^^^O-@fMP/ |7h'S000 0 0  ;0h7  9)* S09h7  h72h7|7Sxhgpe\ !PUP00!  ! 90 9O9S!  d!h 90 9?PSH(Q PU$`Q0CS*e!0 R` `!  0 ``` 0 Ⱑ PH!>h75h71 0l xr08 S0R 0C00 S 0S00Ѝ0`]z^^^^@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@61 0 6Ѝ@!3. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 0 4`V1Ѝ@/Ѝ ^:^-0 /2S/p@-@Pa0 6/p@/ 06 08880 8077090(10101/* * E4DqE@-:@0S 3/ D:S@0/p@-`@0SP0P    00T ,P1S 01Bpp}]P0/}P 0!/}@-@ j0@f^0 R  ]^p@-<@P0S,@T P@p^ QA-0@P PS t<`lp0FUAT4 B^R D.`0d!!p740!h  i j9k9 0 g901!\0)|7S!=0S* 9'w>0 01 9i9 00\0 |7S 93/1  |7X `S499Ѝ@x829009h72h7Ѝ]]^^,^p7/p@-@f_qp@Lp7/G-P`q夁夑Mw>@VAM VQ V!I|10@|'RJ 5) 6) 7) 8)099!  089 079 069 059000N9 O)PQ R   0 0`VPpx8S   19ЍGd 0: 0@P 0590690790890Ѝ<]S^8]"]^X]Ȍ]@-h7"1 @ S|Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@^^O-pM`0`  Pߏ0@0 00P 000 0_o`@KRPPU!R:"R :"R:0ЍC-MP 0`p` @壏0 0 00  00P 0 0@iK?o2P0S R0 Ѝ0G-@M,00 p@P(0|10A0p$  <0`FOPJ<1$ 0<0  A,p(5OP91$ 0<0  A,p(%OP)0'00弐$00 00A,p( < OP0$00 0l0 0`0A00,p0(0< NP  ,,4@Ѝ詃_^E^E^̗EN^^Í]G-SP Lo `0@4p8à St# 00000SW 0` 01`P1 0k`0 d`Ѝ@0@T@AJ0^0P0᳐0Y:0X^@-  0 @!  Q3  4匌000 P1#9P00T0GkX耖C@BC-P`尀p0@ A0 m0S HP `h0` 00哾 Ѝ}^O-P@0TM00p1W:[I (kPC C1 0CЍOo0S`0 S00qp0少  A$0 [! CP p0PQ`1P  0 jPP0p 0 05Ѝ}^^O-@0P00MP@pP 0S S S 0  RG*101aQ> P P 0 ⊠001*  0tj 0  d000! PA0 0S2 P 0``Ľ0S# P ` ` G岽㤰@J ᪽Go`!0R p⠽ X@Ѝp0 p 0j 0 (፽}^ ^7^N^*\^V^@-@@]@- ,4 4 8 #8ᚽ Ѝo^p@-@0M SЍp@P` 00 0⁽Ѝpx^-$M840, (  0 r!$Ѝİ@-`plMW'@P@ !0 0  ( 0  P0000C0 p0!0G0 0C0000 0d@S2 001 00@0 (<H0L 0 H0L GlЍ舁,İO-0@!DM 0 0 (哯P@`p\ 0  a0,@($  PL 0  a 40@,@($  tL 4 l 0 d    a 80@,@($ P^L 0DЍ^İ^^Ex_O-`F,MPp ɪ0 0 0 Ԫ0#ddh&hV *巪0 0 0 ª,ЍO*0 0S 0S**PP 囪0 0 0 ,ЍO褪00C0FFP 優0 0 0 00C00007`P' 0S S SBi 0$ 0 0$ t350ZT$S U(0, 0 (0, `%#*%@ P!$BP 0 01`S0300 000 c P@k  s1,Ѝ0V 0S0S 04S գ2㈉ @ + 0Sʠ= 3 @ T 0S 4S 0 SR00CS`ElElEElE0 S奣 X"@ @00Ω004 0 004 ٩30 R S 庩80< 0 80< c 0S a/P`0 0} Pu 00囩@0D 0 @0D 妩0S 0CSc00`0 0S05倩004 0 004 勩3 JI0 R S i80< 0 80< t 6 0SP`0 0 * >P" 00H@0D 0 @0D S0SS Sİ0p@-00@4S 3P1 00'R0 0S0StP 000 01S0H00``Ǣ2z@ap p耯  BR/ $R/ #/0 0S/c@-P@1S `p 0 @1 @T # Ѝ0S 0CS0@q 0S0 0S:00 @ꀯ@- 801S@ R  R 0ꀯ@-@ D0Q  0TS   ,@ ꀯ03!"/03" /0M0P@Ѝ/0M0P@Ѝ/L@o/!4! #4! B#4!0 P/60S/p@-@P |u!>000pp@-@`P@P = pP/=p@-@PP 3%p@-@P )%@-@ 0 Dp@-@Pm%%p@QeO-$M`@Pu pP u0$ЍT@ @ ` X0@00S @T  [00S 000S00 0T 00A0P` ` @Z 0 [0 TA0P0T A0P ` 0z 0`0/G-pP@/`P $T 4 06 S H0S 4 R30 dPP;@P8 0x00PPH0l$ `Zv 05 06 06Z$`SH0Y 0S 0C @\  " 嵹꼰E^!>00000 0/6 0@-MP@ 0lЍ0/,0/@- 0MP3p0pp`hP@м 03  !*,0 , @ 0  Ѝ@}+ 0#000W2 0,0-Ppᦼ 03  !d*,00,0 03  Y*P,00,0,0 0 0+z-Ѝ8}\E0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@|`pP1hSl l0p AD0P1p00`0101S0@@hq}@-@Td$,d,lH,l $. O-@pHRH2DM p00 @@孪0A10bA ᮔ庻>  ᦔ E1F? ᜔`pP#1 00a0,P($@ @@ @G000D1 0<1 00a4,P($@ @ @qG1  00a40@,P($@ @@ @`G0'40张0  00a80@,P($@@ @PJG040p0 00a80@,P($@ @ @P5GDЍ}^^E^Ŕ^^^@-@W0 0S (P@\0X0S@hP d0`0S }p@-P@+0 0DS P@ 00S \0X0S@8pDP 00Sd0`0S D0S 00P0#///0  S /0C\ B /p@-ۺ @dPPRL0$!p@ 0S  Q@D0R0 1}p@-P@ :r0!S <S21pp@-@P fp@D p@-@ PJ:00p @-@ 9@)E0@s3p@-3@ PzD Od@Pᕺp00S0S 0S h0S 0S d0S `0S X0SxpD//80S/@-3`A0ASM=p=DPP@YЍ@00S%L0 00P0 R0030 0003/ PcDЍp@-M@`DPP@Ѝp@00S;0S 3/0000X3ԹP-D@-@$1@ Qvp@-@P 4元001Pp0S 0Sp}B# p@- @P8 @P@O!p@P@A-`@Q pP000ԩ@P2!Ѝ0 000 ` .P !YPp (1S0 d 1@0Hp A0, (10(1 }1i0@-@M 00CS0 pЍ0@  J L 0@PS   (10C(1 Ѝ02i}C-0@SM 3/C 0`# P 2$]P 00ЍCp PPXU%3V'2 0 \  PS U R X ݸU U /' }p@-@,0P `0,0ETt x0Rx0t 1x0 0S  0 00 0000Gp@} O-@,MR||`SpPp踰 0S YP R R0 00R0P0 008Y PK80SC00004Zʀ !  , ! wp !|3x3 t3l300  !ḠW㸠 00踰,ЍY 30S00ø0Ŭ 0SP0 0 00Y00帰X `P帠3 00 0S|24d\0Q\d00\00X0d00`0H04038 $d0S00 0` 00\0X 00h0` 0# 0 51P0PP P,ɷ 03 6 %pPR,00,0,P0S  ` 0S{0S  S % 000 0U$ ",0 Ꮇp3S0S00lYL 0I PE 03/A)WHzhzlzd} O-<>PQtM 7 .0S@ >Q Y= @Q==X"26XG0SW`T 0.p ׀=0P@8&Vp=X @`\=Q 3C5CQYK RC4 YE U -Q60S=`V:7p4@ T1<X0 0CX#0X 1CX0`0 0iA  00R 0`㹶DpP@8ն1`Q -`0 @ T` P n 0⊂ @ↂ[  P !>d6 00 H`;X 0 00 RV  00 S DK m@:S00S P0 @m 0C| @?3 P 8P 4e 0`0 Y 0  tЍO0 0000 6@P 6060X`\00` G```nY @ 09@X9X&Tp 90S񟗛EEEE,EEE90 S񟗤ElEElElElElE ElElEElElEE0S`9X6C 0CX0S T80Spi8X0S 0 S0Z T`0`V``Y T` YY P8((XX T8800L h0 0 0CpP T"@P7`9 0| 000?8p93 p!>8H0000000`7Xn /1CX @70 S`^*47`00 0 `0pPJT1`$p` SEETEEEEEEEEPEEEE60S1| W `93! \ 3 D 00  03  P  W`P p'TppWp`,0,Wp  <ER0t01ؠx0@pt01Wؐp pW0 ؐ 0avV w " "3 PW`W0  &`WZ V[ 44 qPP0Wd00 P`00S 000d00  !QR ` `R` `W00 0 `3 !0S P 0SM  k000T2 (W+ ` @0p0S 0S000S 0 `ܠ>pspYp/` p`p`0"X00p003 P R00DV 1X0S00}0S`V|00S1X"0SY$Tr0|`Xk| S   0QN R0`10`гtЍi iii i}'i i^ii@i%iߖo?oi@oi!i#i"i Ki ^P08 P R/ !  /} !  } O-MP@Dp `0@0@@PWR'P@%n1003f 0 `P H037HD P@RL0S( D 03 0  =110@0 cЍ080S 3/@P WS 0Z00C?o20S 0S "P @P}0Q(@- 0@R0S 0 R S ̲ `P 03 0Qݲ/}p@-`㏕P n0@0L0`0D00@0 0<0(080,040D00040,000~@p4EEdEdEdEEE`E@-@@e0O-,00pS@(,M@P 0 0 0"d1d00hS&h@P  00 ")a! 1 00 $a$" 1040  0PP  0 !H 0 (",0 $  2 .(,(  P! ! 0"8S00 000080Ѝ8?@- <0b",4b4#  #$  #(  #< Ѝ*^p@-@0M SЍp@P` "448 #800Ѝp6^R=dd!Q 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # B|PpEp@-40 R@  000 T k 2Ѝ@-40@ R  000 = T ЍX0 0&-$M840, (  0b $Ѝ0C-M 0P`` @(vxp0 P 00 00 0 0@1?o2P0S B~Q Ѝ`C-PMp@p 0` u`0 P  00 000 0@1?o2P0SP @TP@P T@P0ЍT c`O-@`Pp3DM ,@0P 0 0p(`$  53ᄃ 0P,@0P 0 4p(`$  r5 0 0 0'!,3 4P0P,@0@ 0 8p(`$ [50 400!2 02 0P,@0@ 0 8p(`$ D50 0 0!2 0P,@0@ 0 8p4`(`$ .50400 0 0!(2 0P,@0@ 0 8p(`$ 50 0 0!1 0140P ,@0@ 0 8p(`$ 40 400!1 0x1 000P,@0 08p(`$ 40400 0 0! 1 0P,@0@ 0 8p(`$ 4 0400 0 0!00PP ,@0 0  8p(`$ 4 @Fn1T@T3DЍ^F^`K^ET^d^p^`E|^XEx_^^0` F$ap@-P 㛋@lh 0S Q 0P @@@040p@HPCp@ か0`0 30O-PMdv0@0100C0#21 2 P  0S # 2!12Ѝ 0䥟0h`/r01 0 [аK ဨO XA 0$0$0S аC[  R R  H0,0,0SJ DC[F[ P PM !>800( p<0@D\_0 0p08pX 0 0qq01000[аK+ P V H$ 0S V[ 04040S аC[V H`308080S ذC[_ # 0p0p0 \"S Y\  Z  Z RTDSS  S R 0  rr0 00 IY <>0s0 cR0 R0001 ᷧ \ ᱧ|H  \0S`3a `P  `P 0 "00 0S0  "44 0C(",400 000 0 B0  B(00C(00 r0P,0,00  !B P0#$$("(B-0 0C00 000PP;# V2!12  \h5  \gH/oP" R` 3 2(0([DK ~},@- f904 4^,0?A`"b8"#b ЍQMbO-p`PLM @ M^ *p`G^0(p)`#ttx'xpGW V 0$ 0 0$ $W$0S 0 3SH0L0S@P xE 0$ 0 0$ LЍ00C0-P Uʐ(0, 0 (0, 00000C00(Sqd巐090! !忐00CS]FDFFFFFFFF4FFFFFFP@4Ѐ 呐0 0 0 圐?P#W 00S00 R0S v004 0 004 pPP0Sd@P`   0Q ,DD(00830#0S  $3/ h20S 0  :H0L 0 H0L 00/80< 0 80< 00! !1>@W004 0 004 ,20S 0  P0T 0 P0T t00 1 0S W0 Cr 00堥pឥP  ṥZᵥ Ქ   R # 0 0៥P10S #W  R1  0S R 0$,00 00(000(000P 0S  lT`P  8Z0H8 4P . $}<0]`0]E^p@-0P@w1 01  p@耏0C-ᶐ`,M @P 400   0 P  Ѝ PP XXp[  @Z1 pW ЍC )T TX%XU d"44` 8#8R** 1S0!PU:pWPX0\p JU:H @D P *0X0\T  0 @TЍCQS0RH0@0`0d 0S S :\@0D 0 @0D `Pdp03/@EЏ]`00 h\ 0SQ HP/P %/QS  1 //Џ]]@- 4^o`8O-QpP00P B囎0 0 0 妎02"0`0S 0XA0C?o20S  0R:!R\2S2 HBu0 0 0 倎 ЍOD  `P "44!8 #80CS@@0SV:V`!P U[èa+ PU@9 0 P(P2(X2 h 0`P(Q-1 01  60 XP00 0 X0 XZ[ 8#< 410  0 000!"440000 0 0 000PP   v0`^-$M840, (  0)$ЍDC-MP@p 0` ao`0 00  00P 0 0@ '+?o2P@@TPQPP! ЍG-M 0P` @p-o`0 00  P 0 0 p@*?o2P0S  0000 0ƔP00Ѝ0O-,M@S ,0 WX0\ 0 X0\ b ,ЍO& P 0SA(1,!0 (1,!L0  ,Ѝ!>00 $02(0 00q pP2/0 0 0 %0 p0#$$ (0"(DRD +`P  `0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00p ! 0S0!0 pp P ČX0\ 0 X0\ όV+ 1ʌ@ @ ꮌH0L 0 [H0L  `0d 0 `0d 屌V 0 妌V j (Y 7Y@  0P H0@ |0 0 0 册@D@@-!>@tPM `0@@bp0  0PkЍL000V a@O-=Mm[ @P=ЍOXP 5 1$!0 1$!@ X=8@0<0<0S S  1$!0 1$!*8  0 0 0 80 <   ! 88P0 0 0 0S P@0@S 0 0 0 @ATڋ 0$ 0 0$ 0T PP8 0Sċ0 0 0 ;`( "$`$"",R a(!"4a4##<S3 81, @000@S S堋0 0 0 3 ;0S 'P "448#8T克(0, 0 (0, d8(Sx0 0 0 W Q0(0 C8 80;00 ,000P 08P 080T1!0 1!30SM P8G 80 0001S0_0 R; P08 0T 00000S 80 @p0(P0$400010C00STy 90S@r 0lPPl  l080Z Z[ 0S@100 0SRQDZ Z 0 0C0PZ Z nX0l00m080Sz $0S @E0S [@@D 0p0q$lA0P0$0Z.@0 lG0媊0 0 0 嵊w 0R* +Z 40P $01l$0J* 0$0@K@ p lZ+l0P0  l Dp00000@@@T@ 8pDP Dk @ nW0l00m0(0Sz0SL Z| 0R: pkl0PJ0   k 0000(0? pDP@k D kYH00C $RYHY0 #"  02R0= 0IS  S< SU@ @@fj000 nW0l00m00 0S40p0叟፟0P ᪟0S ᥟlo0 hk ᙟ000 nV0l00m00 0S  pQk^l.0P0 {@E@MS@T 30S@CA@$@ 0pi201H0H0S 0CS # 2 P0P0SD0CS/ I 00SI pPkfX0\ 0 X0\ E W T  X     L #I0L0L0Q  R W7 hW4 `W1 XW. Q+ H0T0T0S D0C@p#@10S 08S 0 0iX0\ 0 X0\ X,00 S Ӟ 000S 8 P80S 0 00010p0t 0 p0t , 0 @0<01# 083/꼁D}~0]O- LM ]@P`pp8 nh8 (p000`,P$@ @@ @(*' 8 (p0@04`0@,P$@ @@ @*4 0 07(p008`0@,P$@@ @P* 0 07 (p008`4P0@,P$@@ @P)0 0@7 4(p008`0@,P$@@ @P)0 064 06(p008`0@,P$@ @P)0400 06 (p008`0@,P$@@ @P)0400 0L6 (p008`0@,P$@@ @P) 040 0 05 (p008`0@,P$@@ @P) 0405 05(p008`0@,P$@ @Pm) 040h5\ 0\5(p008`0@,P$@ @PW) 0405 05(p008`0@,P$@ @PB)44 04 (p008`0@,P$@ @P,)040|4X 0p4(p008`0@,P$@ @P)040 0 04(p008`0@,P$@@ @P)0@ 040$0 03 (p008`0@,P$@@ @P(040p3 0h3(p008`0@,P$@@ @P(040$303 0<(p008`0@,P$@ @ @(0402 02(p008`0@,P$@@ @P( (p||24  0pD08`0@,P$@ @@ @(,2($0 200pD ,` @ @z(p1$01D 00,`(p @ @f(1010D 0,`(p$@ @ @U( \!\\0@S50@ T08!0@TB . 1zd@R㒇&0LЍ RPP CB! ,0FD^Ŕ^^^^F ^^(^3^OG;^G^FS^b^m^x^^^pFx_d^^G^|G^G^0].H@@-@) @꼁 A-p@PP0S PP 0 0100a10 `0 0 0f 0V *0HHQ0C00 00A@-@0S 00H 0 /H@-P(0dp`LM @ P@ 0 *!P@  0  !P@PP"   0 (02,0(0 !P@ `"0  ````( 0 (( LЍp@-0P@΅1 01  p@ׅD03!"/03" /p@-@`aP/@P |pl00S @-e P3D8#8 ("(P "00 /HP/0P7@- Ѝ0P @R R00P0S0!> 000R@-`Q00pPg8'#TgT%%< =@P@ ЍVPldh00100S 0CS W @#RP 000~A-@M`p  X@PP"0 RP00S)T@$ ( CR)@P@P 00@ЍHP PPꛚTPᵚ1PP P00᧚A-p0PS@0S0 P0S 0\ Q Wf0 0!0;0\`Pz1#P 00pQ 0!A-PS@`  pPl0 A/4@|8!< 8!<凄MDhP/A-p`0PPQPEU `f @ T T@ @T@  e0PEpO-,0,M00@010 44PQ : 01 $000pBpWS(0 0 0 3(,Ѝ0000 000000#![ 0CZ 0 (08#<400 00000@U``Pb0 0 0 U7`PT70`0000x20 00 0$() 000S O000 0-0"> 00$ 000K1 08#80!$$ ("(Q:0ɱ pB "4400  8#< 400P 0( 000@ $a{0 0 0 冃000], ,0@ 0,0 00800,0@0,0eq*0C SV ql`N0 0 0 Y0 0 0 VF Z`P@UDO-QM00ذ(0 p@ `G"448#80SZ:0P0(P(00000NC10@00 x0| 0 x0| X( 1P눀,Y 0S 0R &$@Pu@Pp,`P,j ]ׂ0 0 0 (0X$Ѝ0S003 3SH0L RP0.PP E0 0C00 0000 =@0=d(0@ 0(05d 00"440(",40mH0 00@V0g0 0 0bP0010m0r `pP$\d0 0 0 o(5]0X 3`h 0LPPkF0 0 0 3`P(P``@0000\`0TP 0 @0 R s(0, 0S80S 0S `80,3/pP `0 00 0 00S<Z0 0 0 0 sR 0 M [K PH LPP @0`000p sR `P3 `SPT@P H0S iÁ0 0 0 ΁(A`P{@0D P0@040 D 0`g0 0X000 0zT@PX嚁0 0 0 奁(k0XA``0HP4`S0@0D Lp0@00 0@000D g 0 0` 00,(0 [   U X3`Z0 0 0 e(+v0  #R  3 0S#t`P xW9014!0 014!D1`80S t80,3/`P t*0 0t P* [ 0S% (+`P 00S `P ,0 k,00,000=0, 0S 3\ V`0 0 0 ( 0S0X0S LV6 3 U往@1D!0 @1D!0  XU `尀@1D!0 @1D!廀T @"44D 8#8Q ( %0%<#*T嗀@1D!0 @1D!墀(`:( 0<00 (0(DQ ,   40#0 @0A_W 0S0 0 0 ,("50 @000`P( RSpT1 !0 1 !_r`0< 0  00` <pP 0`  R 01P/0 03 $30S ( ,0@0,0(!!448,`#8S9 7i04z 0R0  0 0 0 hP|" R  t`23X"X1`00t0o$0 0 0 Uu(00,0` @ ( ,0@0,0 3  10S 10S ($( ,00,0(0 , 0  `3  10S 10S ( ,00,0 (B`P(3(Q VP~0 0 0 V J(0  0, `(=1`%(91`DH`\]^ C-Pp@p0M00S0TЍ0S  S` BS0S 0 00000 000B00SQ QR `0 >P R 000*A-PpU@(M \6wPP7@4 000,30P0 0CSTUFVF4VF@VFPWF N@P0S@ `x0P #R᧔1@0S  2R`V\4w`(Ѝ20ᑔ0S0@0 .@ 0 00S"00 0 tP@* Q& 3S#`0VV;@ aP 0007@00 0  ^ R `1@ G0@ 0S 0 0P@`0  V1@ 1 0 `aR0C000 0⣝S S Q ` -@Vs@-0@ SP& S) S- T 0S000 Ѝp0S`P 0P0@000ГP00P 0  0,0O-,M00P`Sd@ p&S d6Rh *5P Pa00CSZFYF`[F`[F`[F`[F`[FYFh]Fh]Fh]Fh]Fh]FYFYFYFYF]F]F`[FYFYF`[F`[F\F`[F`[FhP 0h0[8 <jpP7,Ѝ`  J[`#0Z)[# `V [ZZV0 %_ `F` ,R 0 _`hpd@(V` _pP00CS[F[F \F4\FH\F$[F$[F$[F$[F$[F$[F$[F$[F$[F$[F$[F$[F\\F$[F$[Fp\F\F$[F\F\F00000 CR0ŕ0S@@0S@@0S@@0S@@0SKKꑂ0 00+0 0p0lPk0SJJ~P0SJJ  gPV$0S 00 `$PÒ1GlP 00幒npP9hPP30SSe @\S @Y _@P#P0 CRd^FYF^F^F^F^F^Fd^F_F_F_F_F_FYFYFYFYF_F_F^F^FYF^F^Ft_F^F^FhP, 0 P )0CS_F _F8_FL_FT_F_F_F_F_F_F_F_F_F_F_F_F_F\_F0_F_Fd_F(_F_F@_Fl_F0020000D600D1356 R R D0$00  0np$j  0$ p@-@PP`p0Sp@\tPp@-@0x`S   !00C000C0PUp@ R0 0  NPO- P=I`pG@T`@V <00CS @p S0Sĕ0C0S0 {@0D 0 @0D { @1!  \PDP 0O-@pDMP!0l 0 00,@(p$  - 0!0 0 040,@(p$  0 400!X0_ 0'> 0 080,@(p$ P @DЍP^Ŕ^^p@-@`M0P0@@ @0 ֆdP s <@@T 0200 R00C1 2"Ѝp@^0?P,?@- P98@XA-@T.0"0R S  B! "2 2R2S0p`P"0#Q00S qPP@UP#00C?o2PAbP,?XO-Mp "44 8"#8!`ǟ C\4LGz0 0 0 6CS 0C:W 0  0!"  "? !AT,fT< 0pR4 z0 0 0 z Q :lFz0 0 0 z; 0C S   !R  Q \  \ @ Q 0z0 4崥 0 4z 匇pP 0wz0 0 0 z\ Ѝ   1T! 0 !A  Y"RR$0@P       !<  0 00! 0 0 !000 11S0@0AH4000S0p0 pp0 pWa   R^  !Rb z0 0 0 zU0p101X 0 !1R!AQ ڴ! Q Ƞ,Ƞ B!0 R00 Q    ! B!  B XY 0R p pp! R p0 0!p DR  B   B  ` : pφW+ p 1(",400 000j 0 10 0 1C00S,00V(p`o ky0 0 0 vyd0  0嚆 ~ p 0p00Y !!AQڴ!Q !! !! B! Rn10C100C0*y80< 0 80< 5y(v [ fDPXP-//-/-/@-@-@-p00d0@ ` P Kd0 (00  0 ( 0P(% Ѝ1M  @-t^@-p%^!p@-@P10S 0S 0Pp0Pp*P pd!>C-@pPM0 0@@ 0 !44 1C 0"440X1`V T, 0p Ѝ0S0S S0S  S0S ST@`P 0 ^, 0  02# |0R0@l@ Oxh0l 0 h0p0l t 0Sp0 t Txd0]8nFD-/ 0!< 04 0 (   !/HzhzlzT0M000S ~S 0S/0S001Ѝ/\ P/0 !8 0 0 (  , !/Hzhzlz0@-S@ @p0`000S ~S 0S/@PT0P d0  0S ᜍ1@ Ѝ0ᑍ0@0A-@pP`@PoA-@P@`@pY輁dp@-P`@Kpp@-P`v@?pp@-@`jP0001p,p@-P\@&pO-@`p\!DM 0 ( a0,$  @P0 00( 0 a4,$  @P 4 p 0 h (d  00 0 a8,$ P DЍO*^r_G0^dG-`pP$@T0S0S S 0S0S 9/P@@-0S0SP`0!0@PS R \ 808 0  Ѝ0 ]0 <<0f0`0SP%0%* h0P h0 QP%*p PU kq1!0 1!vqCߍ  {PP0P 0#2S S1 00S) 3qP"0#dd0h&h`F0L00,0000 0#21V$000$ R0S& 'q1!0 1!2q0S 0S0S0S 0S 0(``Fr 0L00,0(0$ R`F 00 RP0 $ 0'P 0$  QwPPUx $00C<0040<0 S  0SX :P  0@0X0N\K4@` 0 T0$00,0`0P(0(@,0 SȰ0 00 P&0Kyp1!0 1!p $ P07h ff 0h00voP  R0Q]:@(pT@400pp1!0 1!{p 0 H$qP0V 0 0@0 @DT 0 0  @D0V R/H009p! ! !$ !$=p@000 `FV GpX1\!0 X1\!'p0# 000 0  p1!0 1!p60S T00SZhp"   p"44!$$8(<"( #8 bG6 P   00000000 0nP00Uuo1!0 1!o 0  HepP0@o1!0 1!o50S T00SZhp . q .q p"44!$$8("( #8 . e. aR  0Rpt`o(!, (!0!,4 0!4eo'-0 p0pGW/0DEoH1L!0 H1L!Po;oLo0 0 0CS0S& 0R"(o`1d!`g0 `1d!1oo0 000  0R-7Y 0000 0000092 P000`00;S T0d1R0 d 420S h0  h0 0ᭀ0 00 S.+0P20  h; ;,0SG!>6 l 9&0009T0 Re _  h nBoP 00000 0 3SH L0SP0\ 0 R<  0CS00S0 0000Plp0060^ ^B^^^X?H?ą Rb ` 0 hpPX w6 @TR  d130p00D1;Sڤ0`1&40SI0  0$ T 70L00SE S0701mP2T"0P2 1 T"nT0@ 0!0CS103/XP  `0S 0 1 000Cp!0C 0 1R ^T00SP h!\00CS 18008 0S0Q0S 1 S01\P t AQ\l\hVLQy0LSv41 Sr:;So 0SC H!R L10LS2A0``F{m1x!0| x!!| 1!zm1!0CS0X1#10C10    BR901!Va0 BR1011 01R&0S ,0S@P40S0#ނP T0  000 0 =]P 0 @  0R* $4RkX00<0 04000hP] [ 0R 0@oP XEl1!0 1!lD ToEl1!0 1!lX0000< 04P$lX2\"0 X2\"8%Pll60q%c0 Q 0zQwSu* Qq0B AS0Vk80 !$!01l1!0 10! 00 0 00/ l%\0S `0S ! 1 2 90 /@mT00T080;(0S0  ]; S1 ,0S1100S 0S ,1 0 0;U01- 01! h0hh P>00000`0VsąX?@-0  0'S(-P L@#g1!0 1!.g$0 ?Mq 0`( "4`#/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0:0@p@-P!T1PB1AP \ezX1+8T@1D01@ xSx0 S 0|; S0Ҳ;p ^ܐ]X?O-0pMS@(0I S/`;W= P `( 1H`S= `0d ]  S `3`#Q``VO^hPPC ;0S0S0S i PEU ڼ; 0CS0!0; 0CS0!Z@0 0 0R0100 Xʰ\U 4E00P4%4158E00P8%8150<01D00H00S P0S -(`0&T00S 0 0C1!4!R4!480P00L00T00 :04P+  10S0$0|! 0B$00  00!0CS0a-041V`!;p0\00  ;S0J0P 000S V!`0 Spǃ0SH0P @ ;S=1S PC0 PE p3U;8<0S00 08PS]*QU0BAS0U0 $0U.1  D0HS 0 0S *0S\1U*000C?0S2e; 0S1,1 0C?SQ\&0A@SR 0S(0 S<00<0t`0 R P   W :(P30& R0嚿P0S0S0S0s `F1S `僿P`30 R@P1S\PE80P H0Q8SP80P H08( D0H S9D!00C S:P9P0 RFP ,9P0SCUP)0!0S01 P4!UP!S414Q0\0P 0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP18}0;!410\ 0C 0C?UPp70Sn$0SX$P gUP!D$0PEU0p080V PF0p3 PE UVD7p0 H0k80PW0S=0800P000S 0  000CspC 0RUP 0010CS B 010CS>PQP98MP5|60S`P0  0 !!R: !B\: \~*  B Rx X0S1 P0;0l0800000S P8 P ! 1`P0H&  0z$ &!$$&  @ f1hd40S?0bd 0P `(VA00 00t4p1Hh@1SI  [) 1(00` RA(  `(VA0|   ,0wt,0K |ሁ[%( 6 )X/5`0S 0 00C00 0#Ѝ1 @0 40K, =,  5 4000:g<0U0402 3c00S0U0S- 0 0 0 T26c`P 4 00S< 07bc024"0 024"c `)X00/0CS202000000 000000 0 Z00400 1S 1! Z!0 01 01 Pfv0S0A101QQ0" 3SH L0SP0\ 004]@G^0^]@^ąX?p]<  0CU4 00 0000Zp 0 ST S,(S0( ,0(N0 PPcb0 0 0 0 0jb4`P@ 4 00S$>0  P1 0 0 0 1 0CS0 0 0 0 0 0 0 004000, (0Qu <0Ru< C+R 8" R   !BRpĠ! U 0 BRU RZ aX"\ X"\a (  p@p 0% 0 0   X  `fC  !  p @0 "!R 0,S0e!@QP00S"0("(R"" "! BR ! R !!$! 0SO SX 0Smp000Sp00!0 CR001H1S4刄L0H1ia004 0 004 tayPk 0RVUe0Sb 8lP^[Z%p !Je   0r8VP0 000 S$0 40< ,0 000 S $040<, (",$("( R,B B!8-P 00!0 CR01"P 01R 8P 0;d6040p0(pS S: /`x8( #<40(p0S&0000 00!0Sh R0 05P P`3 7P 2PAP @PM;SJ>`S]f(00, 00S^f,0 ,0, 000 0S0P 0⭄1 XSq5`0 0 0 0 @0D 0 @0D `0 S,!0 CR,10t00 00=80S: !8RP L00SL0L1`(`@-1D @0C100C0 0R100  gA-@0p0!R蔀0 0RP`|-fP 1T010`00 0 R 01 @ @! 1@-0 00   00qdЍL^0 /|10|1/O-4M I F SPPQPU>Q: Q6 @ Q1J0 A\-Pap iA eA0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ Q A0 B^0"Ap10GS1qS BPP q*0 GR IQ PUIPGQP0p CR00 0AS0 PP 10CSQ0 CR 00 P 0CS0BS0P 0 BQ000 CR 00p@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R i1M  0MX @p@-PUp@`60P 4 G*0Pp` d H Q1Q44!.010p@p@-PUp@`\0P 4 A]Y\0Pp` d H Q1Q44!(]010p@@-0 ;5< 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-@0  :0p@-T0@00SDP@q sT$3Sp0p@`ZꈁW^tF@- @FA-0pS@ S P0S S0S0S0s0S0S0sT( PU  0R m00mPP 00(0 * 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S > ` 0p0;000 00D10S 8100Vc0 0000`000(S-00S 8 80000000 R R )0) ,    0("(#8S00SR  RO-,M0P0PP` 0T0p0X0P0 00  ( Q!R A0BQ00WV 00#2S S( /z@P 07j40 6>`Z0`p(p0 00 00 0#21Ue1 R30 4R0(",40 00P0 00 Z(  岱  )Ạᰱ3ᲀ0 U 00 0S S 8 1P0S05TPP,ЍO@ ,Ѝ0 ""R R2 v` ,    ""!R!3 Q@0Q @@Z0 ; 0p0 0 0 0 j`( @P 1  Q  180 00 0 0`0(p갱( \RUq崠 0S_a000 R)0Q8  Q8 U P0X0TPP0,ЍO0000000S U P 0S8  S8  =U0 00ꈁp@-A3???H2S L2P"0S0R201T2!211C1S03S0#00!0P0S$2$p00S(2(`0`\0P0`1PP1P!UP3,b0R:P!<0824pX?0@-0PMX"@00 0`0 80@0@}_ 0&[(& Ѝ0`^G-pP<`@P1 /(<0 0  1! `p1!1尠 (`Z`|W W 8`hab@`0@00T0P01H0,1@0Cp1a`@0PЄ8]0p@-P@T @p R00 0R010 `G-`0! 1(pP0C 82BJ@x{[0:0>YV;P 000B:000(QZ(0, a0 (0, ([Z@p+(@W@"|a8@P 00S X@ 0<1P0 PY 0 00T0 PY 0 8P 0 0x0| 0?P0 0y* o9P03 ( 00j 0 0? 0 bꘄЄ =zA-0(pW% ;@SP`0;(Y0 0 0 (Y<U>0SPTA/(Y 0$ 0 0$ 蘄 00!/ᘄA-p`屮PUA@T P P (Y0 0 0 (Ym0:0PP꼁@-@01S001蘄0SrC-0`S,M(P@%0@P S FFFFFFFFFFFFFF\10S UL 0 SpH ( 0R*T ,Ѝ j& 0AT0!  00XP@ 00TP00S h00@ C3SR L0Lp 00 S00/֖]F;Hx]0S,4! x!/@-@0M &<01,0 00 0S0Ѝ`Fx]@-( (0 僾*OЍF0P \P 80P1/Q Q \P0 @\2S 0@\2S (00S@0Q,00P1Q00P1G-@0SP`(`+qP`2Sa 0!QQd2S01q1S10S(`V`P`2SP ̐ PI@P>d2S01pp1S10;` U pt00{W *0G70 W1Gh"R l2S0qPp2S<0h2S l2S0jHPp2S<0X?]p@-@PPpP1S" R X0o@ 8fS0S03X1CffPa 0 08 $X!F1T1S01S00p@Cz@-@tM0t2p S% `0PS OTw   { w 8s2tЍfQF@-0S6& ЍS6&&kh^0b? S /A-P(p1X`8@@ TL3K@D0S@D0S`@DV$ '0 R0@1:D60 P1X3VL0S*@L0   @T8A%8150S<1*A0S0 S(00 b/ R /0SA-0`S0MYPW2PqS 0@S0@?oR20S@^ P0@S WB <2 PaQ^M [M0000 0 P 0 0 0UP! Q 0`0@S010@Sʲ0T#TT1X%XS !0P90DN0Ѝ  10CSa0Tw00000090P W R0( @Q 0p0Q0 0 P|00S @0G3WS "#!>20 2 0 $0(0 //]F@$00#.0#A0@.H>@$00#|s3 0 00 PU `0S l;P  ;PPЅ%@-0@ 0@00 00@@ t00#.0#8.> p00#`3 p\V 1  xQ6S1!0 1!S 6 T00;c1S 0 0A0 0g!P00@0@00=0=ZS1!0 1!eS ЍO-0R:HS1 01RS 0SH 0 A SS0!\ 0 Ѕ%A-P`ATAAp@O-Q<OP0T 0 P0T OPT1X! 1C1S01S01S0# 0_1S ;S O0 0 0 O01;S唵P!T11T10P1000110H1;S0;0103/^꼁Fܐ]X?p@-@Qk0  p@襤8^P +PT1 RX` D B R*1C1S014cR :3Ox0| 0 x0| >O<T%OX0\ 0 X0\ 0OO00q00꼁ą@-@aM 0  Ѝ@Y`pP HQN`0d 0 `0d O;S6S00 ( 1( 1S D  B0R#*Nh0l 0 h0l N00  B !  x01T01Np0t 0 p0t N<꼁ąX?p@-@P帣0  p@`P 01; S !R D0D00CR:001N꼁ąX?@-T@劣;HH 04004 000彣@0/꼁|ąX?x0 R   R-  R   R   R-  R/  / b /X?gfff@- @@0 ꈔ Gp@-@TP<0==09#9S p@r+P 000m꼁@-@8`@0S-//A-`@Q_w-1`pP!P+0B8#8S1; SQ0A?0R  0?!0X?C-MP00`0p0 0` @V/ P  0`  00 000 0@?o2P0S R0 ЍO-M04@3`rXVP 0 S0DS0 0000p20@4兢@`T0V2|p3幢5@DT00`0 S0 00(0 0000TP -(z0[@D0 [e 0 S030#X0S -([P 3傢 ߍ(0 @ D  H d L 1P0 0T00S0+0X \00U  (@,0#( #(0 0&(  t& T0 p Qq0y1x!&^? 0|10 (B0 0 00$P(0 8 00$P(0 @ D  H d L 1P0 0T00S0+0X \00U,  (@,0#( #(0dx0 `0(0lq0h00p0670t00T0S_0yx1&^? 0|10Q0 (BT0 0 00$PL(0 8 00$PD0 =00 =C00Hs }@=-$M840, (  0LG$Ѝ7@-PQ@ PP P R #ZP Ѝ000@-MBc0 80P (P W PU 00 00!0 0wS@P5BЍ Ѝ@@ꨄO-GM`!XP@D1LqR @Gߍ RP@ S @  R!HoQ 婒Z X 00 0@Y ,`(p 008P40$@@ @z 0!>4 ,`(p 008P0$@@ @dd> 00!T> 0L>4p,`(p008P0$@ @N> 00!> ,`(p008P40$@@ @8"040= 00!= ,`(p008P0$@@ @"x= 00!d= 4,`(p008P0$@@ @ (= 00!= ,`(p008P40$@@ @040< 00!< ,`(p008P0$@ @ 040< 00!t< ,`(p008P0$@@ @ 0!0< 0<4 ,`(p0@08P0$@ @@ @ 0!;0< ,`(p0L08P40$@ @@ @; 00!x;0<0L 0,P($@@ @ 0 !(;B0 ;L$ 00,P( @ @q 040: 00l!: ,`(p008P0$@ @Z: 00 !:4 ,`(p008P0$@ @C040@: 00!0: ,`(p008P0$@@ @-0409 00!9 ,`(p008P0$@@ @0409 00!9 ,`(p008P0$@@ @040P9 00D!@9 ,`(p008P0$@ @0409 00!8 ,`(p008P0$@ @0408 00!8 ,`(p008P0$@ @0 400!L8 0 <,`(p008P0$@ @@ @0408 00!7 ,`(p008P0$@@ @0407 00!7 ,`(p008P0$@@ @y040`7 00!P7 ,`(p008P0$@@ @c0407 00x!6 ,`(p008P0$@ @L0 40D0!6 ,`(p$p008P0 @ @4040`6 00!P6 ,`(p008P0$@@ @6 00!606 0<,`(p008P40$@ @5 00\!5 ,`(p008P40$@ @p5 00!`5 ,`(p008P40$@@ @$5 00!5 ,`(p008P40$@@ @4 00!4 ,`(p008P40$@@ @4 00!|4 ,`(p008P40$@@ @@4 00!04 ,`(p008P40$@@ @3 00!3 ,`(p008P40$@@ @q 0!300T 0a,P($@ @(4 0400`S0S=pp0S p@-P%@5p/A-0`SPig@p0S^\9@@+0S ;2XR* 0R 001000@0:757@A-`@pPd000S S/@X>1De>4,W 卨@列輁G-p0M0@`0S6@ЍZP V V @{  @  aY`v YHX IGPIGIGLGIG0JG|JGh@P 0R000\@P0S@+S; @@P@T 23TA *@P@T 2TA @P@T <2 TA @P@T 1TAHXmJGKGpLGLGxLGLGLGLGKG00 0S;   ; 0= S00 000`0`S0e00d10200q0 000ID1P!@@2T!#3=P022|=T0814X0 \ 1 l0 1pp|00t00 p x02000020201111*@X?T?@-;@SS8#8S TS0 T @0;x@0;;S0(P ; S Q 00?0 S0P 0PD00 K P $00 B P X?p@-0(P;Sp@60@ Qp@3@P p0S p@-P#@p/0S/p@-P@p@p@-0S@ `@Ph@P @pO-QMp 0S SG Ѝ1`11@1P 0` !0 0 00  00P 00 0 00?o2P0S0S* BRPGPGPOGPOGPOGPOGPGPGPOGPOGPOGPOGPOGPOGPOGPOGPOGPOGPGPGPGPG0`00@0 S  S R| V`S0 0SPP/CjRP#US@@Ӗ/CjR@#Txltp@- @ ꠜ_^i^n^p@-@\41P!YP301108480pp@-@\41P!C00P300x104Q88Q0pp@-@04Q8!0 S 0U0C:x!0S30C x15x1%d!d02S414pL R 0!QP!U:0;S/0p@-HPH`0D0@Tpw U0S w N@갔_A-p@`{P00Hq < \  41+ !  41,812#4100FS`p@-@PUp@  BR +/A-;@S0;)`! AR80;p4Q0H 0 CPPP 00!0C,2#41000PЍA04H04Q0GS0pP0PE<P4Q0!81 BR<10041,000x10   10BS!;S0;/814!R41,000x10 / 10BS!/O-4!81PR$Mu;SrP1200m |0!aq?A3c 2#!0C01' At14X6' $A$A! T@T(#3#  p0p [(1!20  0^  Z@ @0`FB`d1 #<S01R4!41$Ѝ 0;  0  4 0 0$ЍOMb̫gfff0@-M@ 0 \?A3c 2#!114S10!p 101010UQ%151S0!1 P301108480Ѝ0Mb@-@<41000x1080p@-0!@0CSPp@}0;pA-`p@᐀PUT Vt0x0S 0S R00 婈D'P@`PO-pP10?o@2`@1PU8 V W6 P@X3 娒T 00C 001 00 0ݒ@ P 1R W P `0 @PW P @T PP< xPP`Pp@ P,A-`pPU@ 5P00@@0TPPp@-D@DP <.4( p@dp]t^,w^|^(00S/!Q  B /( 0P/ R/0 S%7!3C" 3/0Q0@@/-P, , " " " " "    /@-@Q  088700 @0000C0%0 / P/%0$0 0Q: QA@/ 0Q: QA0//ᣋ. -%0  0$0s,P^ Q 0S3 X#Q R!0$  @XR5/p@-@`P@  VU2 %0%00( c&$00$0D0403$ 238P<`2%0 00$0%0$ 0 00$0%0$ 0 00$0 0400,0000(0(0$pA-l@Pp`$ K $0S 0 p0V00$0000 0 @0p@-P@@ - UT0* % %  (R%$   $ 8 $ 4  #"#8@  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOL   @P]ĖO-,MBP $X 0 C0 0qW `2`P1!0 1!N0000$0VZ0 S: p0*b 0`& 0 0$0  d1d ! 0!!WPPL ,PB  R;#0R7#0R3 D P- 4 P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍO@   @P]dO-$M@ZPP $ЍO!10 R0 01"0 p Wy 0 b0880000 R V R  Qd:^"p 0&O 6"0VIt 0 0 00 H1 !0!!PP4 vP3 = R$#0R  `  b0 C P 1 90C P 190 Q 35 5Uzw   `    4 P000@`]PO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D}0 P:v qPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880S000%0 0%00S0 0C00000 00 Ѝ0 P:@]\< C-M@pP `؀0S  S*Ѝ% %0 0R q\UP RQ 0RW0 0 0 P0 /@p@-PP@p`0@`TV@@Q> @%0% P 0 0%0P!0%0C0000}>U0`0"#0 0 /01#`00S 0S@@hV=9C =C00 0 0 Mb@BA-P` %`@|pG L @H(PU@T D0D 0?8c冋Ѝ 0@0$@꼁ĖX?gfffO- S @Pp0$DM0aV[: R7 0K 00p`00! 0  "  p 0pW:S' '078!800$0#1S<0P%1P%PDЍ00a]p@-@Pt `0D0034 0 0 %0 0%0p@p@-@Pt `080034 W0 n0 f%0 0%0p@p@-@`VPPpP 0V 0 10 V& [p0% 8 4 &#&#( #  % ( %    % (0 @10(0D`04`06% 36 3(00300%0(0% 0 000%0d0% 5 00%0(0@10(0QO-@PlM8 $05 8p%P %!  !  ( 尃Დ P& 4`8p FPP 8<% 0 !0 ! % 0 8p4`岓ᰃ(0:$00$0lЍX }%`p&bPP` 8<DT0 4D0%0 01 0102%00岓ᰃ(0C-MP 0`p` @E0 0 00  00P 0 0@ ?o2P0S 00P PSS00 ЍSP @-@ o101H00H0101p00p0101000 20 2000@0040@][P @wG40!( ( "P @@ /-//-/-/@-$0$@ 7H4(ԗ-$M840, (  0( $Ѝԗ@-G^@-G^@-@ϳͳ-G1M/ A-P0p`0@P& d0 0  0 ⲭ! 0PP@垳圳(3004 0 004 (3Ѝԗ@-@(0((0M @X@-@ 0S 0S <śP0 0  0 P ԗ-/ 0!< 04 0 (   !/HzhzlzQA A-@,pP`J10 00S S S ,00S PP(0",$( "(0P x@(=30 0 0 (H33 40 0S 0 6P/ԗ\ P/0 !8 0 0 (  , !/HzhzlzA-@P@`@pIEl輁ԗA-@pP` လ@P.WA-@`pP B@Hp@-P@a>pp@-P`@'2pp@-P`@ &pp@-@`P1013 0003p,1S//`G 0O-@P`DM!2 0 0 0`,@(P$   0p!t2 0 0 4`0p,@(P$  40 0 00'!2 0 08`0p,@(P$ @0 0 0!1 0 08`4@0p,@(P$ @0400 0 0!l1 0 08`0p,@(P$ @ 0!$1  0 08`4P0p,@(P$ @}0400 00!0 00 0 08`0p,@(P$ d 0!x0 0p0 0 08`40p,@(P$ NDЍO9^^^^^^ԗG0^Gx_\ 0 \ /IzC-DlM (`10 0 0 (1 0Sp * 00˳P  00 Qp%p *T1EW (10 0 0 (1lЍ  嗱P p 0S$ "44 8"TT#8X%XU (a10 0 0 (l1 S A७0  PP #!> 12! P0 P $00S "(P,PHpWh P 0Xp  L0ZP L0 Qp%p :W 00USx 2F8 Ⰳt'0 N3<T⼄j'04` 0L 0&yp 0(P\j 0(0, 0 (0, Չ$P2!0$0PP4(080< 0 80< (0"$T'PP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX 0 0$ 0 0$ (0 0 Pϡ P,ԗ^@-0S0SP0!0@SP R \\0 00 00ҕЍ 0 0]4GԗW7 d8<8400 004@L0P 0L0` `"44R8#8 0 ( i0 S     0 V |1 000努됇9G*0 0 0 *V |1 x0|0x0| !44,8#(#Ga*h0l 0 h0l l*V |1 000 0  OTЍY6 6RQ*@@0000l6T$00 X00T0 H0 ST (|V |1 000E* 0$ 0 0$ $* 0R  P (P 8@5 0RS*0L0X"@P L5<0@080<@@@ @@00x000(00@00D00H0Z$ @0S0 0 00S%$-"P 0[00000000P#40 000000B 0T(0I@0 S0  0S~ 00 0(0$0T  @00 0S0$000 0 0 0!0 0$00 0C  R0T Q   R$!5T   R 0 0  "000D00D00T 0 0Sp 0PP 0 0TP$!0 E RE": P R (|~ 0 0 0 0 00Sg6$! P8#<400(00UI  l 00000C00 SE ( ; 0R0% * 00PP 00 Q:P @(h0l 0 h0l (V |1 000h徨h ~0p 0h 8PP{ K0 ^؁hفp؁x؁@-) @0PЍA-`P}}@@Tp!p@ 0RD0S}A}00C08@<00S e((0, 0 (0, p(<LTV(004 0 004 a(D=꼁p؁hف 0 /p؁p@-`}PpT@TP`@0Sp@4}1( 0$ 0 0$ <(@ꀱp؁hفp@-,@,P4}0S 00p@k}꼁p؁ 0`( "4`#/P/p@-@P=@P=p@-40 R@  000 x Ꮵ VЍ@-40@ R  000 a x ?ЍX0 0&C-PMp@| 0` _ `0 P 00 000 0@%?o2P0SP QPX@P QP,|ЍQ ʦ8-$M840, (  0 d$Ѝ؁1M/ zG-PQp`{&PW@O0 0U0 p` P!@0P 3SH L0SP0\ 00< 0CVh!` V UD0V SA  .QP VPpX.XBppSI>X p AL\ AL\0A QPV .RP AL\0A-Q \AA\  S^0 B |J@-`P@M 8p.( .h`( .( `p08Ѝ^0@-ASS0CS8G`GGSh &B -QꄶGG̶GGG&A 0 0 0 B&A 0 0 0"&A 0 0 0 0~&A 0$ 0 0u&A (0, 0 (0, l&A 004 00 00 Q Q^&B 0 0 0 U&B 0 0 0 @^&Q Q QD&B A&B >&B ;&B ؁P/ <O-PM'U@|50S p50h5h%h0(0008(Uv p0( '(Ef0/S0@Po ( p((0K0:00`P\(p)j 2PW 0c`00:0p0PP|1d4p000( :0,PR0 <040 P0#1 PIP0 S$ |!  S |!  W SW pG|!W^ G@G`G0/S0㡥@PЍH3xtp0B;p|P* `;340,0( HD  PH0,(PH≥ U 20 SM .pu'p"Pp07B0` /;k G  RpG|1W2꠼GGGG G@G`GGG  [ |1 000 000 000 000 000x 000p 000h1!0 1!`0!  ! X 000P 000H 000@ 0008 0000 ^]^89^O-M P0(`@Px~pPP 060S $60S 0F00V <ԦP 1  Q98YE$ 8$(0 8$($Puߍ0`0@@0 vi PqiP 0S!00S 50S  .m&$060S 40S  .\&00$06DP5A$C 0$ 0 0$ K$`40ѡP2 0 R 0S 40S 0  G#06 ạ  P! 30S  .&0  *t#06T30S 0  4#0D Ꭱ@0S  30S 0  "0| @0 00S P 20S 0  "0fP 100S0 ((CTTP820S 0  "04+6P< R 50 00Sၡ  10SH  .%0  5J!0650+000 0VPd[=dqdx"T10SS8x; f   0086lBύ00d0 P ٠xxH0Bύ1@0^؁ ]k^^^C^^^^V^{^8GO-(PWM@PE|P |1 00U0" 8$(0 8$(#|1 0 00  0'S(@P" 8$(0 8$("|1 0 00 @0000 0 0S0% %` * D0P D0 Q`%` *S6@V   â@P 0 0`0: C0P,0 8>0S 0P. `$,00.0P 5"(8,(0 (8,(v"0尝B?! !}"X:0HS,l=0S 0p. f$0J. `$200- 40SW0H S񟗖GGGPG$GDGGG|GGGG|1H X1GGG800S 000 R0  0LP 0 Q`:Y 0<0fPPn 000[ 20GpG0GGG/Up! 8$(0 8$(!ỡ|1 000 0040004 0$0[ 0$C [C !8(0 8(!(0,0[(0, |1 80<0[80<㹤PPP @ 0 R 0 3SH0L0S 0 ᵣ`P`@P[0 R0  H0⪣P H 0Q:00S U  d!88<(0 88 4<($$0 4 $$i!T(|1 @0D0@0D[ U%|1X0p t p tRP Mdx | x |M|1 000U!084(0 084(ZD80S U9 U%P 0P0 S0%0 * L00P L0 QD: 000S 70P6`fwP+0S00S$ 6`~0S[ ᬜPP 0  3S H0L RPp\0p0pG4pGW600$0$ #44 8#80(00C(0C0S0CS"`p0<000SX SX  0⛜ {`P  eP( B00S S5PP `V0S0`J?y =;6$0 SXp\5```P BPpt$0 S 00CS50i 0S񟗞GGGGG 0Rp% p *  P0aP P0 QtppW 0 X0  PI YXé(00C 00R0 RQ0I400 \ ?^R# \' R0\4P< 80P{< 80 00 CR H4 Rk(00CS \eIYb᤟|^0H40Spep}p8`ᘛPPN OX(( P (K0S0  R R)02)024 808s0 (0kb88<(0 88x4<(|$0x4 |$(GR0嶐 <(0?o2R0S (P`&p5100T0T`Vk 009 ~oF40V015`P2X00PX$0XDHX$0S8 J{0508 Xp00S(0`S 8&P$008$0fcP P P  0 40S PH0\0\X DH  0001`0``V ~oF؁^ ˒]^^xJ|Jlفt]Hhف`p<`508)0 280p0xPw 0S(0 0q(0B8 )0 (  00E0 #R HL R\0P  0800B00V0080(00 Y f48100d0dY~I0 $0)8 Y "h hpWDpG00N4000S 0$0 S0S 00H0l0lpW DpGWV0`1p0p0S~?C0S`040bP P P0  0 80S 0S2<2024J3w,0800z0 0 0 400 < 40< P004040CP10! ((0 0`c(00(000C0,00,0$  "S  R  0$ ppEpW3( 0Wp ( 05 4Y04pp(p2a|1 H0L0H0L0S|1 P0T0[P0T0US P 0,[*[|1 X0\0[X0\U٠P dXbX|1 `0d0[`0dUP SSs|1 h0l0[h0l'Ur᩠P\[Ub00`0S0% % *0 t0⤟P t 00Q:00Sb 8$(0 8$(m IWߍPp00,W0{ AWC +W_ p0V`0 0 0sP 00 Q:``V %PK H帰 00   !bP 0  bP W (3W <W R00  x02P x 0QF:00S  3W Q  Qp R00  |0Px | 0Q(:00So  [00  0Pa 0Q:00SX ,R P ,00l{0@`:0000 00000PpS00,9  92#0Sl  3/g9`V!U d 90S(00  0 `.̘( 0ⅴP(gGE0S80:S50S0S0S0S  GP#0S0S0S0S  5P R 0!0# U LpPP`d D;0S(00  0 .n( 0'P(U00KݛP0T 0S P0T [ 2 0O-@P`DM!$7 ,@0 0 0`(P$  Z 0:p!6 ,@0 04`0p(P$  F 0!6 06 004,@0 0 8`0p(P$ /H6 00'!06 ,@0 08`40p(P$ 0405 00!5 05 ,@0 08`0p(P$ 0405 00!5 ,@0 08`0p(P$ 0 4008!45 ,@ 0 08`0p(P$ Ѽ 0400 0 0!4 ,@0 08`0p(P$ 庼 0400 0 0!4 ,@0 08`0p(P$ 壼0400 0 0!(4 ,@0 08`0p(P$ 匼3 4@,@ 0 08`0p(P$ v 0403 00!3 ,@0 08`0p(P$ _ 040<3 00!,3 ,@0 08`0p(P$ H0402 00!2 ,@0 08`0p(P$ 10㘢40 0 00!2 ,@0 08`0p(P$ 040 0 0 0!(2 ,@0 08`0p(P$ 0401 00!1 ,@0 08`0p(P$ 0400 0 0!|1 00 ,@0 08`0p(P$ ӻ0400 0 0! 1,@A00 0 08`0p(P$ 庻&F BoHo0oT0k~o@傺DЍn^ ^زGx_p^ȱG|^ ^ ^#^1^?^N^ Z^j^d^8s^^ ^^^؁Gp@-P @l oh 0S Q0P@@@040p@9oP4op@ r08PG-S@`p0 0 0  0  0 0 0 ᎙X 'R 3SH0L0S(㨙@PG  0  RV WV R R R R 0S 00) 0,P,0:S) 0R% * 0⥛P 0 Q% *D -Q a 8$(0 8$(lЍ0 #0C?o231 P (MQMa▕  #RH L0S0P  0@.0 0 0 o0H   C/R00C00000T 10S q?!+0( 0 (  /R 3SH0L0S0@P  L^ J^(`)p0, 0`1 01  ({؁^Tف ؒ]^O-0p'S(,`(ǘ@P  P ] P ]P  0 ЍO@ЍOЍ@-0  勹؁C-0@p4M|d2`PP Q7P1HmD2DR:420( m2V 0SS*4ЍCmm 1`1 V@P  \]P  4Ѝ@Ph 400   0 ˛P  Rm@T> mpP XX@ѕ@?m ߗpxmWT 40 Xpp` dU0030# 0S H0$U0*`B 004 0 004 `Pdp03/@8TG؁O-pqpP X 366(06pPV M]AW0A/!,0Op1S A?SB?11SB/1 A"g1صS 0 qWgşhp`Lp dxDH\VP D⌏P  P ႏ4 D00X0005`  1QP pW 2H0U  HP _0 ?Pl40S  .0000h$h0@f14S 0 fZ \ (4$ D0$ P 0 ?PC30S  .0000#0# N0L00 M0[0dVPDP  JP" 4 D00X0002`  1ƒP sQf1S 0 fH0U  QHP ͎0 M?Pm <5f10S 0 lfYEP 2(0,0<,0"pP dp p0 81  ` ?V P ?1`U FkpMY  @e<P $0S(P,f8ApWqNJef3S P81 0 020 >pPX00S . 0` `0000%#[ QI ]^L^^فY|"I0]]^X?xJ|Jف@-p@`]0P p@3 Ѝ@-@e @ep@-dP@ze0SA?C p@@e!R1S A?CSP فف@-@D P0QQ  00S 0R  4Q DA-@p`%P@P #e%A-Pp%A``P@  `P Urd%p0S Aفp@-`DP@Tp0S  PUP $4RPD@A-@p`%P@P d%D@-`P0 R R 00SDXp@-@`]%P@P dy%pp@-0PS0S0S 0S, 0S00S% <%A &P@X%p`00#d00#h00# l 00#<%pAفp@-P %A`h@PT(%p `?P0 %pA@ف 0 S 0#/00P/Qp@-@p@ L!P T0 SRp00k01p^]SRG-M"p4QP@ $Q !BQ -Pg  `VP_ R R RRQQ`V\$U9  BUU 84U 09  ` $f$0 0$0 (0$0(0 ,00,0 000 00P\$DFP`o1Pw$.0P9` $ kP(1PЍ`0@V$( R, R $2p H 8H X0  SX \  d 0t0 0x0 $S d 00 00008 900 P!U   $0S DZ  S0 $00 000 000 00 0P1XU p H; 8 X H/ d d 00#08 0 X RPP?#0  ~RP P2 900' d^iiikii G-9PQ@`Ma V9Q] ; 6C0CQX 5CjuPio iJi( i i Vi?Pi ߖ>Ni0iKiǯ> ~$ni i ixji >Ki Ii %i Qi >!i O-pSODP@`UT D P5TX@@0S0 00SDP%O PT v ` Z` `$4R@@00S0 800S DgT@ 4Q@80S/A-3`A0ASHM:pZ DPD@$Tu 4HЍ00S1_h 0 000S)iP% 00000S .`   00 007d0 G Ps_D @0㎙ X]%^X?@-@9@A-HM`pDP@T  |1S  00 0HЍ00S!3_ nG00S .` + P P00000FP_D@ g]>^@-@|1@rQCp@-@P P oppp@-`TPTT:N Ir0@0L0`0D00@0 0<0(080,040D00040,000Yr@pGGGGLGG G00000pp@-@P 00000000p@-@ M Ѝp@-@(TP@TPp@-@0Q$MG 'R`l P'RX("($( 0t0  0 \ *P- R00S"!10!0!0!0!0 0$Ѝ@\@P R000CS1V^^A-`pP@200SD0CSX 40GS* S( #S_ KS% Ѝ o\Q\ X ^ QPQ `P H000S D0CV`#0F0 P  P V ;00#S0  o`%S000 00 00 00 00 00000V0S  0000X`QRI p@-`@M 0 C.^^ P?R1 K 000 C0PU'X wX X XX* f`0 0<000 #MP`ЍpA ER PPC/C-40@SOM S $ R0#*50S %0OߍC R |1 0 0 0|1 00 0Oߍ@D  Q :S S #3R t40S h$l0|1 0 0; HT, `P2 p ⻵4Bύa`a`001411 0``1P t30S 0t#t|10 0(0 ST#2q12L [PP ` v2P<2034P09}P 20S 0"XT lPOX20S 0h"l,20S 0008"@000000 00000000 1LP1B110 0141P /P d10S 0!3"p'qr\10$0$PU ~_EUX `-`1` `<<0@ 0000 0S 0 |T P0 L00S P0\ PRy1(0(PL[ ]^^]]] ^']J^x^^]0]?^~^xJ|J^^@-@ cZ4X @b8H0O-,00( S@(M ᒆ@P 0<Sኆ@P 0b 0 0bx"#2't1040bt' 0PP 0 K0( 0",$ h((Q"dhd& @ Q         R/ R !! ,P 2 0!&Ȍ 00 #8S r;Q R r[ Q R Y  R% ZA[ RY Z R Q R R R R rd   PR R R rd    PR R [m ;/000$ R  2/P [Y P"0R R; R8 R5 ppWp Q0Q-Q*Q'R R R R p W Y  "Z  R W  pR R r $  P R RG-(@Pp,`PM00pxxp'p0S.0S0く RF 0S 0S 0s 0hP' (00 0 P" (00%0PЍ#  ! Q#3 P 0 P 40 X 40 X 0S2 P0S   &"44 8#8 !R   0 1 &"44 8#80 A&"44 8#80 1 06i0SA-6PS0M0S  0Ѝ0S0Ss0SQ@p) 0S0S/1:FPp0S@ 0S=0s  RE`0 P1(0@00Ld-0S  !> 0,00S XPd0R10S d0WP 0 S0S< / ]0SE0@-@8P<$MP 0S$ 0R dQPHP0S0S0s!.0  TP $Ѝ0 PS0S ,0 @@/8O-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! * ! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  P0  {R 0  0sRd   @0O-M000S `Ѝ0PS0S/`0S. 0@Sp(00S% 4DP`0SK 0SH0sEd0 0S0S0S0S090sP3#21208S, 00P0<0 P 0 PPQXD XEP X*0S0S0s0S0sPU n3!>6d0刐 p0(0l 0008bP0S100 0 8,P0PS3 T,PQ <X |0,%S 0S0S0S0 0XPm0j0S0S 0sS0SQP 56l0S (0l00L0t0 l6P5g 00000S ;0`( "4`4# :000QX  :X 0S100`P6Uy ~ aP `1`0` O-hp&h &TT$M 0X ' "%X " A  TpzWpp) PAQTI$Ѝ R R d  &R&R Rzd   0P 0C @ '018E 0AT 0S0S d0 6S 6Sd0  P @0S0S d0 6S 6S W d0  P @0S 0S   0S0@@H]0S/ 0@-S0S   Q Q> (0# ,0# 0#.$$ ("(0  !R   0 1(0# ,0# 0#.$$("(0 0 (0# ,0# 0#.$$("(0 0 10)0# F0# ,0#.$$$("(. 0  " " "0  !R   0 1)0# F0# ,0#.$$$("(. 0  " " "0 0 )0# F0# ,0#.$$$("(. 0  " " "A-0@SPM0S0s  0 0h!0ЍP0:taUP1\ Q: 0 CT0C2T* S 5 A%CPU^\Q:ࠃÅ0S:3P50\Q0ࠃÅQ:0CPRQp Å0P0RS5W0P0R^#05W0P0RS5W0^P05^]p@-@08M S8Ѝp@vP`.q "448 #800C8Ѝp^ 0 /@@- O@(aLFף3EDM>A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00فG-@Q MPp@`I YF 0S A`0d 0 `0d /@ Ѝ  07}P 4@@ V | |pA0 0 0 A@ H.PH0S |1 X0\0X0\0S/ 0S,0s)  0 |P T @T  R H0C@Q S``V |1 X0\0X0\|00@hفO-x8M#2尀崰1(20[H`00p00DlpSX00Z 0S P V@PA [@pPUXHT0\00C?o20S, U@P' [@ZXp00 -ApP00$0,7 0@00000@P0 0UA_E0UY 1p@ @l0D pP [BZWX* @0S0S0S 0S pplPHvH0U40@p 3pApD{[(ZXTTL0 T OPTL0 @uXZ@pX5(#2!12ЍZ@aXTzPU @X0S0S0S 0SM  n4t`T6 ?lRP ]1p @pP [pp`[@D `< Hh@PA<0$ R=`0l3t 00x0S/ 8 lP@P)4 lJ@P#8 40R030S `0 H,0*P` 0s m0@0P1D0DPU A_EY `S?`X0H` 0 00SHC?`@? 0`S  SVX`4?` 0P0P 0  0S0s 0s &0@0P S0@0P0s 0@0P0s 0@0P 0R)T0Ss0<0s0 Xk 0<< R<RZ | r%! !Q$ RnTR  V` 0>` 0SX>0 Rg0 `T R QRM  #  RC H`,0&0P,0;R ف| P P/Q|1 00/p@-@PL0@ 8PFz P H@P ,$8P @ 0PP ,$)P @T-/0U0L0 ꔊmuHف0-C-@q`^M@P@0D 0 T@0D 1 1 KXp!Gxf?!0Hp . U. PPT 0@@00p@p i ^ߍCЍ/0 0 0 |1 80<080<hف^^0O-,00\Mp `0S 0S  0S0S0S5 0S0 5 ~xxx\Ѝ50C0( 0MRM.zh5P0S H5@D<00 ,0<Tx@P+es0 0 0 ~U0@;kx@Pbx@PDZ0 0 0 eU 0 u0,(000 H( $==P H= (00$0 4 U0  $ %=P$ (0R< $ ($=P Hb=(0 0$0 h3 H( =P$ (0HR0@( D0\0* c<,0 <,H0S |1 000U H0@04`#000Q 20S5 00``'H`3`= =80H iP r <,0 <,Ua (Y 7Y 0 W)P 0  R <,0 <,_w=@0HP H0S |1 X0\0X0\o@0D 0 @0D f80< 0 80< qH0S |1 H0L0H0LZ OH0L 0 H0L ZU HwX 00PUG^^^hف^/^lځ-$M840, (  0g m$Ѝhف@-(0@ R+`p 0sP3T( PPQQ0SrPU@r0 000 3SH L0SP0\ 0 t@ ЍP< 0CU* 0rPO-LM  dj 0@P`p㬌!< 000P,`(p$@ @@ @0 0)!X<  0@04P0,`(p$@ @@ @< 004'!< 008P0,`(p$@@ @; 00!; 008P40,`(p$@@ @t; 00!`; 4008P0,`(p$@@ @ח 040; 00!; 008P0,`(p$@@ @*0@ k 040: 00!: 008P0,`(p$@@ @夗040\: 00!L: 008P0,`(p$@@ @南040: 00!9 008P0,`(p$@@ @v9 00!94 008P0,`(p$@@ @_040`9 00!P9 008P0,`(p$@@ @H040 9 00!8 008P0,`(p$@@ @10408 00!80< 008P0,`(p$@@ @040\8 00!L8 008P0,`(p$@@ @8 00!8 008P4`0,`(p$@@ @0407 00㬇!7 008P0,`(p$@ @Ӗ040d7 00!T7 008P0,`(p$@ @弖0407 00!7 008P0,`(p$@ @奖0406 00!6 008P0,`(p$@ @厖#040h6 00!X6 008P0,`(p$@@ @w&0 400!606 0<008P0,`(p$@ @ @^5 00!5 008P40,`(p$@@ @Gl5 00!\5 008P40,`(p$@@ @10 400!505 0<008P0,`(p$@ @ @'0404 00!4 008P0,`(p$@@ @l4 00!\4 008P40,`(p$@@ @ 0!40<D 008P40,`(p$@ @@ @ӕ 0!3030 9)0 9)|1 0000 0 0  0N >(   q RJ0 0 0 |1 0 00 0J9)0 9)R @ =02F?! !2S28(0 8(8(0 8(0'S(~q0`Q q0 0 0 ||1 0 00 KQ6 Q! Q Q^ `00  cP PdA<,0 <,LP0 Q $Q Q" Qq9$0 0 0 /|1 0$0 0$ p_\( \ q Q$Q Qq Q P q Q q Q q 0'S(pP  0 p00! !0(  pP <,0 <, 0` 6P 0 0 0 5 P 5 P50P090 00S1|1 000fPT9pWP pr0 0 0 @0D 0 @0D w|1 80<080< _p88LD00H00 \0 $0Dp$0pSB Bp00@@@ Ѝ8 #8pW  0 x0 G@pWpc3`Oh\3 p 2ipځPtہ8]O-0`lSPM ,x Rd0CS񟗏꬯HhHtHԱHHH̱HH||@P>0S00:S{|0S*@37pWG DA+k,gWuڠh7h'W0S0A@ЍOV L|@P ?Xc0SP@Ѝ@PP N@@# 6VR  3@03430xAPN0 30P""##4 R00Ǒ3S86@|0,6 | @?G@ T -@ |.|@P@\ |$|@P 0倅0# 0# 0# 0# 0# 0# 0#01Q5 %0 5 %U5%0 5%0``&0`&0`&0`&0`&0`&0`&`1q\ oP $iP0S  P ^PD $XP>0S;  U+ . LPc. _00; $ 0P0|;<3 0&&'0 x000C0吠Z PᐠpWUe 0q`W1P:7@"Q  <f 1 P" $P|;<3x0S00C0xPp |PP;@H0 R|Ѝ0 T0# 0# 0# 0# 0# 0#$ 0#01q5 %0 5 %W5%d0 50%$%0 0$%d0P h`Py0 7 {P $uP0S p0'S 0 3SH0L0S(oe`P 00# 0# 0# 0# 0# 0#$ 0# 1q0000W 0P30"e 6P $0P0Sp0( YgP0e p2PLpH00X2`p dR lR5 0d / F  0010p8#8Wp WpdW  lW0 H Psh5l%0 h5l%, 0 @000Q5%0 % 5 0@$0 x00 Q000310吀00 0`0  R 00D%0 00D%/d p0S p   |ЍOhف^^pځ߁ P ^O-B0`0}0 0 0 (pPpGW m0 0 0 x>d!/W0 0RP 0fP 0 RPPH0 0 0 S ЍU 0  R 50 0 0 0S00 gP "0 0 0  [@ 0$ 0 0$  0R*`-/W0 0 0 (0, 0 (0, 00`S 0S 00 f@P| 3`0<< 0N@  #pځ^ P]03" /A-`pP_@P7U_0`VP  K@A-0@(S`pz_PPqc7-`(A`( 0(0C00(00@ '@@A-0@0t0Pt00`0x0x0|0|00S 7.PO 000S (.PA  80S ppq.P82  8<0S ppq .P<#  <p0S ppq-Pp  p@0Sppq-P@  @P -P -8P -<P -pP -@P7--l 0/G- @XPp ^g`P @<,0 <,b|10 0 b2`3 0  Ghف7@-0@ Q)R*SP S (wP 0sS :R  Ѝ0 :RS 000:SNv@- @⿯00t0x0|0qp@-``.Q00S@P5 P ^-0u0A 1U00S 8P Q-080#U00S <P F-0<03U00S @P ;-0H@0eb2U`VppP /-0p0p/Q00 =Q 0U00S MbP -00P0t0A-p(@P` ЍS0GS#0G *R#0G% S1SHHHHHHH4HHHHHH(HHH$HHHHHHHHHH HXHHSHHHHHHH4HHHHHH(HHH$HHHHHHHHHH HXHHU0S 0S0S 0S 0S 0S.2\  R 0S0S0S 0S0S QP:Poul0S  2V,P7dUa0  R0[U0Xt0UT0  RO0 000 0 00PEU0 U?0S< R/9S60S 0S0S0S* 0S' 1%P"0 ,P  0 000 0 00P U1p U 00U1+P 80 000 0 00kPUQ U 00UჁ#W @pЍt@P9W+0 @@0 0@P d0R55-pGW\H\H$H\H\H\H\H\H\HpHH HHHH\H 50S+W$,# GR@zğ \ Rv19@ 488`40ⰰ@0P 0 Y`60S .d P63`&`1`00>hl`0d 0 `0d wW |1 X0\0X0\V1@SN0D0SMx1S500F00< D06@PPPD0H02D0PS<UY@P /`0d 0 `0d :000BU@ |1 P0T0P0T6@ DL P@ D0 p,P D`0d 0 `0d 0@050= D0 SC 4@ R<000000> @ 0<01 SP<0SD 3Jύ$ 1T0 P08YP U`H00XD@v  Xl*Q XJύt02/P% `$<0R00@ U0<<0 |1 0003SB0 0 0 U |1 X0\0X0\3@3 ^P x1S 0S  @h0S! 30S00S20SX  @ :P $R*X&Q GX X0<V x0S  R SU@0S 0S L0(0@ 1P>LP@0 @HJ@P@0S `<,0 <,}F (,0V <7 4 [ l@0 0 0 (@M^ ]^ lځ hفS@D0/ Q0*$ PP0<10.P[R0S0Z0S[ f0@0P @ $(  $z@1,@@0 3  10S 10S @ ,000,0 $00 @D<W<0PWP00S J00UߍvS Ac0 0 0 n@ X*AT0 0 0 _Ud |1 h0l0h0l[00S 0(000",4c8<0X00[@00(00S0 0  , @,00 #  # R 30S @ ,000,0@8#8 0 0C40 XU, |1 `0d0`0d#0S ,0R  0    0RP@ C`0d 0 `0d 7@`0 `@0V@PTECS0 -0P00%U?0T000 P)10@T ~ODT꼁X? I @-4 R0R 0 09 Ѝ I0S"p@-PX0\ @06S ⼸P `M6S006"?N00C0p/@-0@0,M`S6S 6Q0C?o20S ?,Ѝ@M@0 P pt0\ 00 00P p$p3`MMM|19p@-0PM@\`P ^(0(S00 6P 000 |0 00@X0<8@400 `4 L@_PЍp0  @`eH]C-1威娑1!$M07%#2a12p1P00@TAOD.3"`&ab`%$Ѝ10p WAG%0s ?w0@0P P%#P  $=%P@T$0s w0@0P 00  P$0 00^ X? IفG-|1P`p M0I Sa200S D0CS@|T/  p&  0  0 0d  3 Cɿ@PV a p Ѝ  R   ` Ra R H0 0 0SJ 00 03 @S ؐ#212 00 020@T D@DT (3"(00S L$  000 G$H00@ ^0@-M? 1LЇ͇00000 0|0c00@P  ``XP0P $LJ0@ Ѝ0@ h],I^]^X? I Ip@-P@0@0d000?00:<0?00 0400S 40S3 !0 0p0uh0p@-P P@U0 @@@D@H @Pp@0Sw A-@`pQ@ DR HQ0PP ۛDX=QC 0 0 0 P ț01 0S@0@Hp0C Q6IILIIIIIIIIIIIIQ! D R   0L S H0`S@]A 0 0 0 gD0S H LD R $ ,H0S / ؁]^[^"^Q|Q/P/7p@-@P !p@H0@-@PP0$M @"K|1 03/PpK$Ѝ0p@-0 M @`KPK|1 0@4/@QKU KT06 Ѝpp@-0@SP M 00SsP  P0@o Ѝpm`$P 0U P KFK0P 4   H R>K;K0P/@- Hk@->@-|1@PL2`PM 0CPj 0Pp 7C0CPVP 0P00PЍ1PD (7C 0CPC 0P p0 \PP 3`PP 6(06 06$0Xp\00p tp,pJ<1P 0P,0S0pW 0W p0'u?0040 0S0$f8 T0-00,0000 0 0$0000000 000S0`V 0V `0&e?00400S0si WiHliHC-@P0,M 00px0嬀P`0PPTPx0P$P?JVIx00Cx0,Ѝ PP 0 `O-@!P0T 0S P0T ,g`pP |1@ (0,0(0,0 )@Dhف0SGC-0`SM3PP00@PS/P@ 00S% T, 0p 0S0U0S   0ⶽP Q Ao' `0 0 0H 帹Ѝ@0(p0p/֖]H;Hx]O-M0(000406#@21,20pSP  0 P  =PPP00 X>PS>P16 `PP`00$000:S0` 00S _>@P7P@00`0 0 h0H   C'Rj(0C00(00T 0(0(0(080(00 0<0040000 80PPS4$0Q00SG000`00040<404000:S8P0S^0CS[:0(P3 80>@P ( 0嘴 80=@P#RH L0S0P  (=@ PP =JPu08 80 p  ( 0P0:S80S& |!  V V F|!Q2t[I[I[IP F|1RS[I\I4\IT\It\I\I\I\I\I F RB`劽1 01  唽0S4<V02,#2!12Ѝ  R|1 000 000 000 000 000 000 0001!0 1!0!  !  000 000 000w 000o 000g,@004 0 004 h ؁Dp@-`1@P M \8@0 0 ,P@\9@ 0S/@0S@ < Ѝp7@-Q@T0 QP   FP Ѝ0P QP0S)T   Ѝ0@g@iTdTT Ѝ0@k@DT\ Ѝ0@\ Ѝ0@3 A-PpW00 00000@P& dVʀ0! 0     !0 0\V@Phi$@P wЍs0Pp0 㿴 [HzhzlzHs@-@P` 0R0%0 * 0B>P  0Q0%0 *S @0 0 0 x R ! Ѝp@`0 0 0  0^hف@ p@-@@" " @-0@S00S SS000C0S@  0圣P0S]]0S0S0S R @-01/pp@-P@UQ PP 0S  00S%`\P CpS 000CSp78#<4000p@-0@S8M  .]00 00S 00S0#TTX%XU `"P  S 8Ѝp 000CS0P0]^@-@X3P P @0S00S 8#<S000CS/@-|1`SPD PP 10SЍU8 0 Sp* ( 0R*T᫟ 0N4T 1!00 Pᕟ100!L'<{PppazL0 XSL  7/P ^[^IIyara!^Z^l^IR_I^p@-P"@P pO-`|M@Pkp@p8d@0 000 PpW00 TP qӆpP `$`~0V|ЍȍPP  rP | qPu d( qP 0"L qP Z$c00⸅T0 0lP`0(0p00t0偏唆PE P 0 R  P  P"QQU1[P#* E 0   Pᒓ 0P01hd  R:hP U  0 S{hP `r0S<0@0D0080$0H000L040` TP080~ R\8X*\^^^^^^_z_0v_^^^>^^4I]^P@- P H0S <#0@0S  I@-@ C-(M@ 0P`|0PP2 !VP.  Ru*  Pr  Ro0S `V!0# ! PP_ QQ0  ש `僾PP V  ͩЍRD ``;pW 彩0p  fPP  0p0 00 0P  UP  Q 0 ]PW 叩R   S` P|I@- T~PZPZ  u~p@-@ `PP <P 0S Pppdp(00S0000S01/̀̀0   (0S"" /P/@-@, } @p@-@`P *P@ 0S 3/@P@p@- @R 2/@O-LMp0P| 0@tpx`d 0SQ [q 00V 0! V V<'# ` $` p"`0 Q$%``$000 @`0 0 ;/ LЍ $00#i e$p$00 ]WH00$C`[V4@@ 03/P) [ 0p0 0|@x`tp LЍO/0S 0 3/P0 03/ $03/P Y@p[ [ Y[ 03/PX  0G3/PpZ@YV @0S[  $0W3/ 03/P @-0 0  00 0 00Ѝ-$M1(0  00000000$Ѝ@-  0Ѝ@-   0  0Ѝ@- 00  0Ѝ@- 000000 0 Ѝ@-0 0 00Ѝ@-0 0 00Ѝ@-00 $ 00   Ѝ@-00 $ 00   ЍP/Q @-/^P/p@-@P03/03/(  03/pp@-P@`03/0 V p(`V pp@-@`03/ 03/'03/PPP'03/pG-@0Pp3/`0 3/' 03/`P` 03/ 0`'pW0 3/ p03/03/'03/P'03/03/0 S \`G-@0Pp3/တ ` `03/s'03/TP `d'03/pW⩐03/W' 03/7P03/ 0``C'0 3/03/03/  QA-p@` x0xS  &0 A Q*PP Z%Z@0 !P0 0  /0]p@-@P`ᘋP $0 p@0/pO-LMPpt0 000000 0 I@u(P40080\Ϸ400400000040  000C00娸LЍOk 廷0 ;40 B0 [P40;40呸LЍ8pW  H0q 0,01 0 ??<n3Q#3?P [@P # [P0  R= 080#80C?o2S>^0 7/,0@ 3 #R(0\\Lp݇0 0,00 <0bX?u^IA-@( 0  R    RA| ` p  叽P ,]@[  [Li0 8/,0@ (0LP呇0 5/(0LP則0 A/@]|^7@-@(0HPz 05/0<0(0LPo0 5/040 Ѝ07@-(0$  Ѝ0 @ Q 040HPK 05/(0HPC0 5/04 0R40 8 Sps@-,0@!;90(0LP# 05/}_(0H`0 6/0S"PU 0S , P(0L`0 ;6/Ѝpp@-,0@0 07/(0Hp5 07/(0Lp-0 07/t0 (0Hp! 07/(0Lp0 07/#:0`VS (0L` 06/(0H` 06/(0L`0 006/(0L`0 6/x0@ 7S (0L` 06/(0L`ـ7 6/(0LPр0 5/?Rd(0L`ƀ <6/(0H`往 06/(0L`嶀0 006/t0 (0LP婀 15/(0HP塀 05/(0LP噀0 05/(0LP吀 x15/(0HP刀 05/(0LP倀0 05/(0LPw 15/(0LPo: 5/(0LPg0 S (0LP\ 05/(0HPT 05/0<0(0LPI 05/,0 w]Ԝ]] ]@  WW Pp Ws@-@(0LP#9 5/@P(0H`0 6/0 PUЍp:A- 0pP(@@pD0(0 `H 08/(0H 08/0@00@0(0Hp 0 7/0  D00D00@0Ѝ D #D  I 0 D00; (0H` 06/ D0, R0  R1  R6  R6, 0D00@0 R  R6  R6060D0(0H`0 6/0 D0< D0 -D00D060D0600A- 0`@(P@`D0(0 pH 08/(0Hw 08/0@00@0(0H`j 0 6/  D03D0 ' D0 0 0D0(0H`T 06/(0H`L 06/0 0 D066D0 D00D0Ѝ0A- 0pP(@@pD0(0 `H) 08/(0H! 08/0@00@0(0Hp0 7/0  D00D00@0Ѝ D #D  A 0 D006 (0L`~ 06/(0H`~ 06/(0L`~ 06/D0?, R R  R0 0D00@0 R0D0D066D0 [D00D0 0 00 0A-@40$003/, , R^`P(0L`~0 6/(0LP~ <5/(0LP~IIIIS8  0"S4 ЍpS  0"S (0HP | 05/(0LP|0 ;5/$03 (0H`{ 06/0V>00(0L`{ 06/S  0"Slp@-IP 8]G-P{p@`9@  ز<0

p<0 00(`00$00,0< R Atp0,0S$003/(00Hw0 8/3 03A+'_q_(]_p@-@(0LPw1`[$003/(00Hu0 8/3 03A3Ğ]'_:_]] _7@-P B@ 0RIItI4I 0"S 0"S (0HPt 05/(0LPt0 ;5/ Ѝ0$03  0"SOps@-@ 0S ,0 (0HPt 05/hP0 Ѝp (0L`t0 ;6/(0H`t 06/금@-P  ]G-Ptp@`  ⍫<0`p 00$pp0(`0,0$003/(00HRt0 8/3 03G ]'_:_A- 0pP(@@pD0(0 `H6t 08/(0H.t 08/0@00@0(0Hp!t0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`t 06/0 SD06  60D0 D00D0 6 0 6007@-P B@ 0RHIIIhI 0"S 0"S (0HPs 05/(0LPs0 ;5/ Ѝ0$03  0"SBp@-Px]A- 0`@(P@`D0(0 pHs 08/(0Hs 08/0@00@0(0H`zs0 6/0  D00D00@0Ѝ D03D00D0G-Psp@`  x<0p 00$pp0(`0<,0$003/(00HP0s|7040000U R00000 0 $000 Ar _ _ _ _l 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-@0 A`!(GZ00QU0X<000hp 0`0h   8/ `P 00h  P 5/0P00P 0<00QGX?QA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 /$0Pp y0 R   8/0 400@ 0 03/ 妢Ѝ_A-Pml`@P p0S`Vⴘ P @-@0   00@A-pQ0@`P VP0QnP `O-Q4M`0I@PT`C P= 0   @ o0@000,  ( @$0 4/`P# 00$0 0,0(0@ 0 pS0 @ {P 0  03/`4Ѝ0@00 ;/pi> 0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp8g40ST   @@B,A- @!PFT`%g0S87 S 0AT 0S 0S p`003/i0S 03/0 Q   2/8000S 0  2/ 00 0p@-8P@0S0T0p]P000 0$/p#0 0 0$0/p#p@-PfPC]`Pp`P@0P` p@#p_ 0     R [$X(\,Y0]4Z< @ 8D 0/0 0 /  $ p@-p0`P@ P p@hP000PU P@T hP#,0 0S/ R  B /0#@-@#0, @0 0 S0  0 0#$X0 0S/ R P  R   00/0/#8- 0000 0p@-@PH P` 0H0 00P0000000pC-0`pP 0@5/pV 0 0 ЍC/0 CR3p1J|1J1Jd2J2J1J1JE0S0C 0 P0PEPE0cUP!009/000P 05/0S0C0 P 5/0 0S0:00 0 0CR 2 5: P 5/0  P0A5/ P/n; S 0 0//Q/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q" 0Q0 .0 /<AQ(5J4J85J4J4J5J5J0 .0!0 .00 .00 .0/5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /A-3A@Q6J6J6J6J6J7Jd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0V:P 0Up%p%*`Pp@-0@000\P 40\0`P .0`0P (00P "00P 00P 00P 000T@4\Q@- /6Q@-/%QJ 4A0&S2&Q/9J9J9J9J9J9J9J9J9J|9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J9J @-0 .0!/  /9Q/Q$Q !0AS h00 S 0h0@-$&Q>0AS h00 S 0;Qh0h0 S/1 l 0A!lTX 0 AQ  R 5` R  R  d    BQ / d /G-<0@@`p  d0P3 5/0pW<0@  d03 ЍG/P`]PEU4d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00 O D0R P5/`P  O0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M:?SF@0C4SBNJNJ$OJpOJOJLJLJOJOJLJ@MJTMJPJPJLJLJQJLJLJQJQJLJLJLJQJLJRJLJLJLJLJLJLJLJLJtRJRJLJOJRJMJLJLJLJLJRJVJLJLJLJ8WJLJpVJ+SS ʘ+S ʌ+SU  SW $Ѝp+S h8$ЍCT+S ! BS;  SPh`h0S! AP+S7 l$ЍC7Ph`h0S, .PPh`h0S, ]PPh`h0S! RPl$ЍCl$ЍC37 l$ЍCAl0S 8L 0jzQ \PQ R00 P ⩒  81 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/\0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRB0@0d0=X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0ld 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍCDlQ3$ЍC{ld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0r Qn\0Cl0S <djl0 S0C BR 0Zl0S SU \$ЍCL\ 0K0HPLPphP@0 0` ` 09/P5 `` 0` `  0` 00 ``009/P0@0 0Kl 1R41R; UJPUJUJUJXUJ`UJUJhUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJpUJUJxUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJUJhVJaRYRPRBdBQP\pB0w @PR40@0D0HPLPpPPPPPPPPPB R p\$P @ Rt 0$P(pB R p\ P @ RtppR \0 @R00ѫ pl0Sg0@!0 0 ‐  8[l0S S SS< 0T 0C 0 S S I A E B ?l0 p S03S0!R 0CQccP)< T0X00XJ?u&p$c>_l?p$?_z_^_____!_8__*_1_p@-PUpU- @\nK0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0岑 A_A-@P` 0!0`3/V0p4`e%n 0!0p3/ W]p@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@]]; S 20/ <8#8SA3=8#8SA@A210/</t2>08#8S P2AAP00/<0 /<0 >8#8 S 1A0A`0111Q 0CQ 0CQ 0Q1 A+AQ[J[J[J[J[J1111|1 p1Q 0CQAA Q񟗼\J\J\J\J\J\J\J\JZJ\J\J110/>08#8 SAA Q\J\J\J\J\J\J\J\J \JZJ\J\J0000000000x0t0H]f___/______l________r__v__z__~___p 0S -S"0A(0,D R!#(,0/0A-@M(00 00p@P A<00,p$  `< +0PL  D    p A ,(p$00 0< @Ѝ~_ $_<0S/@-@0[@ӀSA-@ S  pplP`pP   03/@NT@9 @AX꘤]_ˀ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-@p`PEp@@0S/p@-P @ 00 R PD  t@  0P+ 4p $^J@0S/@-@@t0@04@\ O-D0Z S(@3?:pPa0 S.  S lc`Bv @ Q[V`@ 0  >0@0000@X Q@ T`` 0 @)`@X J#@0 800@P <_A-@PpMA@` 0 R@'A-PU 80p`h0@4p谤] @-@80S 080<0S4@ A-P0 @R <"p0CS3 : `6#pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/P //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@XT00@-X003p@- MP@l T`sP 0 R V ,Td ЍpRV RW SW lp@- \`PE0S@0 00P00CS0p$pܪ@p@- 0@PEPP  p@pܪ8@- (@EPP @ܪ0 000/G-P`^XP0@x000000!X0Sp 0pWF0S1h0$h00h뜐 2 \M3h0  @0l0 0p000000t0h0KP ֍h0|0000(00,000000S 0$@i!TP W\Wcz P h孎0\ UPL ?P8G蝎$_L |J_($_M_*\^_0eJ^^_A-`MpP0WD4@V >44V (4V 4V@ 4V l00 03V 3VU 3V|@0000 0 000g3V P< S0< S< 0ShPQX3V] 0L3V $@3V X 0P pƆ`P  h [h WX2Vn 0V`P2VA 2Vp 2V |@000000000 0 0 000`1t l00| 0pЍA/g 0     0 0 000l000Af0 0000 0|`PdA Ѝ? @000000000A00000H0 0000 0W`P@ 0 R 00ЍAA0-h0 00P0`P5 PЍA ``W W @W@W @W W@W @W@WWW W W W WW($8$@-@p`V0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0  ЍP R 0 0q`@ @T@@~fvtA-@aP( nC0 pAܪ40( R/$ R R/  /L-4( \0^/LT0Sp@- @RP 01l0p0p@//@- @ P@A- P8C@PP 0SPPUPX0S PpWP0`P`pPP PpܪD@- 4 CP@T  P ܪ 0!< 04 0 (   !/Hzhzlz RP RP {//C-QP `M 0q<0 0V@p, 䀖XW Ѝ0 8/P 0S 00p W0 0CW) T ,6W 0WT )h0 0 : STP 5W'= W: =GTTh Tp 0: 0: 0h T 0:: 0h T 099>08#8 S=;G"0C S tJtJtJtJuJuJuJ0uJ0uJ0uJ4W00G?o  24W00G?o  2|4W00G?o  2 0T00 0Y  00 e @DoQa Q^ > Q[ QXe @z 0T0 0 0T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T p{' pTP {-t0WppS l00p3/tpT TP 4 @@a0D8#8S @DH$H0S;K; S< S {:< Sx@k1Tp0+ 0k0S0+ 0Ab c0C S@0}p@ 0; 0; S 0 8T .T T!  0@H$H 01AU/0D SyJxJxJyJ|yJ|yJ|yJ|yJ|yJXyJ@@0D8#8:S@@DH$H@@01 $'* @-@(0S2 $0S 0S, P`p40 CS4 ,0 0, !; S  Ѝ0 0 3/Q Q 0 0 04,0 L$A-PwSU@x0S( P$ST`T0V S0 PVPRTpT0 0I.l00p3/PPT`TpV@ &S 8yT0SP `S __\ P/0 !8 00 (  , !/Hzhzlzp@-@0Sp@P0PS 0p Sd :!-T0S` 0Sh0T0`!X?Mb@-MPRX0@S `--x0S 0$ PP`V% 00S" 0p0CS00 00P k< p00` P RHj<U@R0 BLЍLX?._5_Ĥ]Q @-囉/U_p@-`P0@ $  `P0(0pLoJ|oJyJp@-P@PPP(PpL@-Mp`PqR0@S 00V-C0S$  hPP:TP0S4 S P0 0!! !1Ѝ@,-h0U h0TPP @ R 00`SPU0P00 P Q 㿆ЍX?Mba_p@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ 彆A<_p@-0@SP S` `̽ < Rp؜0000 0O-,M @p P@DQa|뼑t',Ѝ0PU TkPU0 T 0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `*0Co[ 0 SQڰ  02"__p@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pPPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p)@-  001P)@-  001PE)40 60 0 1PH/)/@-P`x㋼@fㇼp0lpp000 P$⛃0@@0 P0tp0 Ѝ_)p@-PP@0S `ጼ`0Pp0p)_s@-PP 0XP\0p0@`0\0p0T0S 00SPQЍp3/ t0S 0 d `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ Wp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HO3PV '>C 0CV 0CVP x300 l3V P0ST0S g lpWX` ,3V0t03VV 3V! 6C0CVP 0VlPUQ 0 0RnN0Pi2V`lPpU``PP trttRdpVʀ 0! $ 0   , !0 00 0W 0!d!0   , !$Ѝ0S S S $ЍOPR X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00,N\PP $ЍO4P R 00S0<0_P 0 0q`V PP0S 00100  0;/P\p3vt`WW~fdWcWHzhzlz$ 0)p@-`P f`t@P   pPU X0S P0S 0PpppG-PQT@TP `M `lpWX`UM@ M 800S 3/`P\p__@-@MTT0 TQ S S @Q @-嚄/_p@-@PX=Pp\MP :P X0SP0Sp@p$_ 0`( "4`#/R/`0  B"11P/  R  ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P#!- \ X:#:^:\:0Qࠃࠓ\^/<]A-Pp`@@0@Dp@0@L$<#@`W O0pG`@A-PlL0pLALA$ `@`W N0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0!`pW:X  QY Q  O 0P<]S/G-` p P#"Y@PX lN0S  O00H@PR/G-PQ0Fh pY@p`V8h oO0S h hO@pG-Pl @R`T  Vp P匀`#801U 0S  DO0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  O00pGPp@-@P}0P $R@P SC@ 0 S 0  S@C R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  eP p A e Q0000000P)QO-P`p@@DT 0 >p0 SX Ѝ0 )p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/HzhzlzO-px)@4`S0ʀ0!H)0@)8)   !@V`WPpP 400 $d0@04 00$00 , 0 4 00CS寀P ЍTd4,0P S@0 00 P  [  H ^  L X0STX0 000Wp V `0`p00S`0`p V `d``Pp5K o l/Kp1qhpPL|00 10000000 P 0 Tp`  0hVÑiɐ JId 00C0ᑓ) 0R 0 0C )010嘐 0RS0C2x05A45t4545454545440Vʄ%04$V pDhTp% RFDHN\A \ \ 0 A0a00 Q3 0BP R X:  \0 c)0C2#8#<4(",$!8Q(L #8"(!PE  ᾐḐ ḐP0 \0 [꾐 ᾐḐ ḐԒ01 `@3 90  BQ RZ    0S b@W~t( y7o@`pIlh!0V$4?T!0V$4 `FV04 T`    ̈́I 000404040404`T`  ̈́I 00|04x04`04\04d0Hzhzlzd]+_HJHJJJJJJ(Jq_M_JԞJJhJJԔJJJJO-@p`( ,M60S:0$0 T0$WpVP` tTP Z Y00PP PP P$$$C~00,ЍT0     $h$+ P$0D0PP0 .0P000CSܬJJ@J4J@J@J@JTJ4<008S88000X[0QaPA3Y3Qa\PA<Z<Qa]AP  YvY`ʠ"0I0q" x'0`p'020ZX0a0cP]Ws[0Y00cVc\00Sb MSW 0CSJT0SE0 @ SZ0 S001000Mx!x1@PPUET0 wT!T1@PPU:0 000YX0\`[0cZZ3 Z0]0cZ30X00X00X0 S 0P00 YU8#<4 T088 < T0 t]____| t]98UUUU ̠S /0QT0   R: ,0 3 0#1, #2 R0/ R,#@-I/t]O-@P L0`!P!U1 P Q02 !`V800#0Q00P0qpP b C22   `V8 0x  "  Sw  " 0S  I0P0   ꀪ]]]S/O-p4MP@XA` P^!1 00 V `P0ĉ c02Aq4Ѝ \ DH  ! D H!@$$DL1!DH!@@   1@!!!!P` Px  ` j P D  PR@TāV 0 PN0@`000@T0 @BHBS 1(0 100c 0 0d$000Cs0s 0S0 "<<"$0,04#$(#$,0  R!,,!  $2!""$,0 0#00#00E^a 0 0SP 00S@0#̠$̌(#4 < 0#"̠4̌8"$,00 R ̠$̌(  `2 "̠̌"$,0##4<0 48,0))4 , L<\ 0>00#00#0A0S ( MH0`0P^ <T"48"$0,04#$(#4 <  !48!00$31##4<  q  0j3 #  $ (#4 <0 $ !0 $ !00A1@00V@`@P0S 1 0 1000 C00Cs0z 0S M "<<"$,00 2#̠$̌(#4< 0 R0#  #4<0 a31#  #4<,<  <,Ġ 0Y.4<.̠̌0Z 00#€` 00#0R B000 0b$00 S\0S3 0 48 0 02##4<00 S0 b##4<032#$(#4 < X!0!  0S  OG0`0@PY   j! 4 8!00 0 00R! 4 8!002#  #4< 48 0 0$30##4<uꀪ]]]O-P`pV101!00 `#8010 S(1@BpW* Ѝ 0"00#0 R00`00Y b DBB Z Y ? !1pW:Y  ! !QZ ! !Q  F `Aꀪ]]]O-p4S@,M@0S[60 G[2* `101!P0P P#8",V0!`1 W㜠0P  Rpsʜ%YJ*P0 0t 0c PRx `RQ,Ѝ S $p RÑ{'U$2 0 2 $0Y:0!448#8400p0P!##48 0S0`0P !  " Q  ` P꡿( ;00 B0c 0! 00#0Qa0 !  R hNP"    "\!  qc2 02 $00 p 1bR0YW:0 $"44 8#8$04  p r  (00!Q" "$,    Q\{ u r  "! RH{  ! R  0tE 0` PY*P0 0t xp0c PR`0W 0PE0s00 #  "0  SM{  !  " 0S 0`F =EpG0  (0>  P""$,(00!Q"<< 0"$0,000S  E0`0P8ꀪ]]]00 04040404/pJ JJJO-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  D0 `0P[:00!448#804pQ 0S  yD0 `0Pό\00PE0 S 0S 0 `F^DpGO-4S@P,M@0S ^0L^*0`%!P0PV#80! p` P P \",)0 $0* ((000 0 000) 0 0000XQ:0 E$0<R0S  C0`0PX;:0 ^0# ^0  n 0##C$X0 0cR# 0[垳#CY00c[3\;:  "BZ  bP"]000$0Q0S  C0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `FCH|t]T00  ,0X00500\04/JJO-@PM@P\d C\`*PP!"UP8 S0"( !i8 剈`",$`!)l&p (ተ0pW0: 0 `S0S  CC0P00 $"44 8#8$04  ` R0S  %C0P0pW*80 0t xp0c `RPWЍP00`F0 S 0S 0 PEBpGO-4S@P,M@0S ^0L^*0`%!P0Pp#80!)V` P P", \(几. $0*   000 0 0 000 0000YR:0 E$0=R0S  B0`0PY<:0 ^0$ ^0!  n 0# CX0 0cP0[垳#CY00c[3\;:  @$Z`R ]08#80$0Q0S  [B0`0PP0 0t x0c PpR`Y,Ѝ0PE0 R 0S 0 `F6BI|t]X0S  0R   Y  Z0X0[ 50 0\04/JpJ,00S/  R 0|A-`P(V0@P0# (( A0`0p $A0$p>P`> *0`000  @@|"/p@-P$0@Tp5/@|\0P/ L  \/-  , "  |)A-p`^@ PP@@@ @S PU$R : ^V WQ C@P@^T0 N^@D@D\'LD@D BR@D@D\ @!N N'O-`pP`08@T U00400 Ѝ 0 VP`@|p@-P` 0@Tp 5/@|@-P0P0P`@P , 0< 0 00 20Ѝp|O-dcpT\\CUXc@-0 00@998090R (  8[?08000 P HЍ R 00!  b? 0S 00 R (,( @(@ ( ( ( ( ( ( ( @( ( S    @-@ v> 0S0 + <@D Pr!QbU00PC10c4#P Be" "1Ct p R 00 0C##< #"02#0 dR0 <#/00 0oQ98|7@-P@"l@  0 0 Ѝ00C-M 00Rpx@XPh` (   P  Ѝ R 00 b?( 0S 00S=P   PPX7@- @P*< 000 # 3 @ `,3 Ѝ00( x00/0 <#<0@00( x0 0/ /@- < Ѝp@-P@` ` ` pp@-`@P X0 &U  0 060P000p4 06000p@-@P0`` 0 000pp@-@P 00   00000CS p $p@-0P@ `0%R @h @ 0X  @ 0x0 000p 'h0R@h @ 0X  @ 0x  &h0h0p@-0@SS+J(JJ0JHJ`P `PPE S`0P( 008#80"$R*0( 0000C@0$0p`X-kR`P`P ;$0V0$0000pn^xJ|J_p@-@Pk p@_O-0pM0 0! @@0P 1S 0l0`@ 0Y":0S0  H j0` Rp00 R SPSP2/`0S0S-  R*  8?\0"0,@0/O^@00 C)@C)0c"<3?P 00@0@ 0S@P  0SЍ 3/0@-0MP0@ 00P!0000(0$ P$0S S Ѝ0.00(0P(0"0 B (0 n^O-@( $Pp0`ȡ [ :(0$Pp0`0S3000/V"R/ p R+R*J\J`JJdJJJJJJJJJJJJJ` pW0( 00$00C$0 Ѝ`  R j"  `PE  p 9 P   PEp`V6 ,0, ``` n^_xJ|J0Sp@-P` U U@ T?P  @ 8?P0 <0p/p___0-T# ;T@ p&  Ѝ QCM? @ R P? &? H$H`pG@00C Q4#0@CV` pU@D 0 p0P6&0`FS A CR T a DR @DH$H@DX W@;@T@;]O-8P@Up=0`P00a040,($@@ @<Ѝ_;_@- 7 Ѝ@-0 R  b@ @`@ 7ЍЀp@-P@,000 080/0 0 !""##$$n00/0 pG-@ MP 7`Ё[@ !#P $(` 00 c2s~ C1|8Q y]gFp Ѝ4, RXi]X! 0C#000 ? pP Y]sg0, 0 0 0S J]r 0 _gdH `L0 0P0001@00Msh0SA 0;  R8 0p 0A a320! r0  P 638 #61S0SS$ 0S 0;`0H @R000@0@v00 NSX000L000)}0L ;_5_X_p_]^P P //Q;!)p@- P$@P`0S ~DQ 5]@L000:0pp@-` MR@@P60  `$!1/@P 08SLF@ Ѝp7@-P 0 .N@PQ@P L00 Ѝ0s@-P@<`,` 0ЍpC-0000`00CSʺ0 V0  =# C!1 Rc7P 0S = C!P0S c> Pc>O-P 0X&  ( , P B R   ,0),0 $ Bn 0 h0 S0 2 20S09(  0C  ?o 2  !0  20 -4S S 200h0SP 0_S [ U.0-400 , <S00SP}`& A 0hn^P0P 00\/@-01"\A@P <]@-@Q0ST RN^ 0A@D^ \0SQLSQ \03=?00S00Q0S0SࠓࠃQ^\ ?6?000-A\\^CQ Ӂ0ѳ 0ҁQ/0G-@0P00pU5` w 0R (: {>C 0C"4W0  !1 /@+b! T l0<# \0r#-u-ppЍ0T00W0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @  w@Pod,0PЍ耖@-0S00R0100 P @P R0S*@? T .@@D@0 Q RP00x]G- @P0A S0 00.SR0 .QR 0L0SZ00UЍ P.P Bp0`^;ZSU Q CB \A R^:^0C `4 pC SRQ G\b*R^ 0S00`p Ub 0 B Q  GcR0b~  0V`: X .XQQ0p`bW PV ` B` R00 0S B Q.Q  W ^` Q.  ^ P^ B`_0R_0 0S00P U]c +(0f V1P UO  Px]C-@PM0Q s.R R 0E $2S KA p R0 0 2`P 0P 庁-  -  -Y@PPĥߍC-`M@@r PS Pߍ 0?``FW - @ T0@ @D T - - 0- 0`W@F`0! ᲀP XPP zpwWV\ !PV RPPx]C-P@?00CSLM`LЍ@0 `p0R 8- 4- 0- 0 0S*h0 pS 0 A\0S/Q  '0\ \Q^ AB 0  ("(R ! @ B+ ,\ Q?,? Q, ? )  3000Q/@-0Qs.\ \ R 0 #@aAON/0S/S 000/0M000Ѝ/ 0P @/0P0 @-@tPt`t0 0x0 @`@NOP0 00 @`@DO(' Ѝp@֟__x]/@-@;S9S@˟@-Q|L  DЍC-@$M` G,0pS rXL SUxP@x  !08p 00$0$0 0040X< 0L00!s0X0P0"L0(X0\00M0400X0St  0Pqd 02\0 ^BXe001@0 @0` h< 00@0P@ 00$  0 PP 0Q$ЍP @+0 H0 0I0 0J0 0L0 0M0X+0\0800sX L000 00X0S A A000[!!] _ 0Q0A-` @ P80 rGLppF\P:p]pd@ E 02p `0S7:0 00P 0 \-Ѝ\` 0\P-00 00H0 C2 000\0 >0>00C000\ /ЍA*_O-@L8`p0,MP 0s H$ .[,Ѝ0 /\0S* ppd0Ep7s0GU 0X0XP 000Z\P0c 0GPh  ZpG $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B Y0$ % \P0G 0 -P= r 00 0Pd0;0hl0 QM AH0 C2 000 0\P0 0000#SnC_p@-@PS P @0 0`f` jPp@-P`ԝ%@P N@ǝ0 000 001 0!%00Ѝp@-P孝L%@P4Ѝ K&ޝ(Ppp@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0z@0 0C?o20p@@-D@f<8%P$埝FЍ0 0嘝pA-0Px0 0Ll3%@\`FT 0S <Ѝ %p%O@pG-P|@xp'D0"HC \ ! `.V xy'x 0 -   11 1`00C`0`0  0`0 11 1/@- ~) Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0ts4M(00P000X 8@ERk X0S04 p000 0 0 0JS 0\0 00h00000p XR:0#S(P HY l0d G BT02000Vp`dp2L0.L00 VX0S0 R d0\QV l 0CP 230Y l0CL3000V00R d\01CpS04Ѝq000 0SNW\0S*(P  &$00,0 0[ (P 0(l ,0 B$"\P$0, (S:P ꄰ0{0 00^ H0[ (VP Hhlj h00\ %S/G-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0Ppp`0 00z=(0 {07(0 080:>r0"\!o0C00D0l `$0 B"0$0$ 00(0 0P   Xp.0Sp(( P XЍ]__O-R4MXP0r\0@Sm: % 00$0 0(l $p0 B$"y`P3( 0 z-3 0 0 1Q+ q1 :CQ0 ( !4 0 (+0(00t0(P 4Ѝ| Z  R 0 0%RP0 0RP ,,Pm'`@-M`pP0 0 0u@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51:  P0#03Q0#S 1S c0?oAQ1O-P`pR H0p00?0Ce\ 9Q$ P 0[* 0R3:U& H0Z 0 0p Aq  o B X0 H0p00$ЍUP11 Aq  o B  X0H0 0p0UP1 1 mNA0C-P@`q嬁,M00T\0S*Q[,Ѝ #00 0 8Y Q  0l 000 0 B"0$0P `K0S s S00 Q0 @0:02#400@00 >0@020000 * 2@$ $0% 80C-@$M0\ S :0P(a`0\0pS*W?5 0 c#xY#WQ 0p0w#PW p 0 p l0  0Cp  $#0 P $ЍW sO-X0M@Sp@8` 1hh q h l  l 0 PP ЍL0P!h00h0h0p0l0t0WP X0 Ql00vPP0[pG00X RX0 00l PP h  0C h  00Cl0 L0 0 CS  dT00l0$ BL,p 0C#0P$ 0ZXPsM!Ѝ/O-0lM P00L0 `圠  8@0 YK@P)0$     CRv     P 0@OoB@lЍ NP@M@0  4 0.S1R R-0.S*p0Dps 0S7$0S] @0LpS.$0S0bX S B/o" RL :0000 0\P+ P2 P0,0 0$`00 C/oQ" 0R pp4 0`(` 0\0<`SLH00 0D0P P PA @  D0,0  ;0l0TP C)CL@H)0c"$<3P<0 L`H0S0000000    QQ Wp(`Q@40SH 40SE  }J@P?Wp(` W( 0KK2(0(0@,0010 Wp 0S0 00 0 0 00 8P ,0S  \)P 0 00 d)P08 ,`SRpp pK0p 0B    0C tr  B   C $xL R [ D   pD R`[ W`DppbL0{ 0Wr LpR$ R v  I@PX0[0C?o20S( 90@0b$  R Q R   @v0  I@PX 0 B/oS" R@ 0D$p 0D@P tO-8@LM00`\0pQd :,pA0001 0P 0 \ LЍd \002\0d800000@ pP00lSh0 A)A )0aD@48"03$gP4 h0@0P 0 P"H0 0I0 0J0 0L0 0M0 0L0< 0\0<0"800s@0 00S00p0 0$0p00(000,00 C00 , 0R$:04S 0Sz L0 X0r00L S000 S<0 0P0<0 00]h m04S4 d8000@ 9PP,l@ A)A)0aD48"03$PP4 h00P 0P80 0($ 00 0 I00P 00PP pd80@ 7P^l@4 A)A)0aD8"03$PJh0 pG 4000 0 Q 04S= z7 PEPPi h/04S& jd0@ 7XPl@ A)A)0aD8"03$UP 40h 00 0 pG  P  0CxO-`8$M000 $@P @DOoB$Ѝl A)A)0a"03$P0P Y Q ppQ y@ 8'P $'P  h P__A-@Pld Qpp0 BT A(`P15"^h05L<0 L)L)lp1<"$PV 0h 00P00Ѝ@- 0$ 8 ЍO-8@5V V:@P J5P @0\0S,5PP_O-LMtPp x`倐40儀s Z000X/| X@P0 @0$00 |0 00@P $@X0 XZ 000LЍ @P T 0 40p 040@PZ8 0 0 $ 4 ( 8 < $ @ (0 D0d@<00&P<0 @ < @Rh  @  00 70<  @ $ D ( 00 00 0H7W 00X0STPP L000L0000|0s 0 0 V,0@>P| L00 0L0000ЍG0 r| rSh fC-0@p0S M  RP- 00P S 80 \p`HL@X!V0 P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`@,M0pS8@,Ѝ 0S@\ Q00S) 衟 PU \  0 R0U0 R H0C200 00 0PP 000 0 = SP @P 0d hpP R b0S"$   PESQUP!\ P R0R0P0 |@Pl A)A)0a$"03$z@P p00 0CS0! 0=PU 0RSU@pO-p P0` S8$M S@ `I  \000 0 P0S@$Ѝ00S\0S0000 @00\0/0S00-p0d P l0  \RQ B01@ 0 @PZ 0 \ .\ >0>00S H0A00 00 0H0  C200000 A@P0S> 0S0\ T000 =0000 y000@ 0 0 >0 .0 0@0@P001 0 -  0  H0S 0 dd@Pl _ 0* I(C8RP Bt000 #8 *(80( 0@P @0 S=$ЍO5@7@50_M!Ѝ/A-0 @p0`SP , PW,,G-` P@U,@P pp, @P 0 -0N0@ ,B@s@-@0P000CSbH#SR`88 d0l 0C S c10PQ0`P 0##sr$ 000#sr  Ѝp@?8l A)A0<)a21 #ЍpO_@-0P@"X8F0@8 4#, #$0,F*FЍf__*\^00\ <K00C SKKKKKKKKKKK 0 ! /+ 0 0 0UTG-0 SS   ЍS P 8pL  PS  P;0S2  I00 > `! R 0;mO-0tM0$0L0P 0<00S40@ P$08p40!0~0`0S0000 0#200~ 0022 0$0X0S rtL Sq@T0x0ᤂ0X@0h0sL0ld0S A A! a,3 1T 0 0 #0X 0000xx0,, 0`00SD: PPD0 @S  @   0 R50d Q a30RQh 0D0808 p00CS0!@0$0\0HXL00$P0X PP3l\X0 A)A T L)a"31$PPJT L00CS0@08 S  8 T8 000X :0PD 0T UQ.(0< 0,0 0004 0C0$0\ 0@T0T0 00 00S U   00}0 00  0}tЍQ 0S0  0 0J02p40 @  O 0d00e0|0  0S 0d00e068L00S ldA A! a,3 1T 0 0 #0 0m P$  d>0 dl0 0m0 0n0  :0X400S*Tc?002 0 00 P T: PL 0(00,00S ( ,     0 R T"P40t0000?(@,D000@0(@,0@0(@,0PDn^n^A-@pM0@P`00 R@@00V T0ML0 0L08 0 ! VT@`00R 50 W@T@M00N0P #000Ѝ@-0`P pMX0S, \0R@#0*x P @P&00h@l@!0 0\0!" 0080H00 0 0p 0, a@P  0 000 Ѝ80 000 m7@-@P岆&'P ʄ Ѝ080 000 V0C-0@P8`rr eL  h X0S ld0S A A! a,3 T1 2# $0L0!10P  000 00HpX0000(0""p 0 8080F  0M  00|0L0 8|0080xp000h \0000000 Ѝ 000  0SL ld0S A A! a,3 1T 2#$0mA-`0M0P@ N80 000p L040S cP3 @fPH0 0I0 0J0 0L0 0M0 0L0\ppA800s  #Ѝ@- `P@ P 0   0L 0 0<031009 0P ЍpvdG-0p` M8P0X0S, \0R@#* 0]@P~x 0PP(0(wl0dT A@! 0C#p00$?@ p 0e@ 0 00! e XpLP:!0.e2-8640q."@* ?X @P&0d00t@p0!# 0, $00{@P 0 Ѝ 000 |P@P ] 0`( "4`#/p@-@(0Sp0PS㨯P 0 R@TpO- DMhR/@lp0.`p0P00`$,`@P!$ @P#W$k`Fhp &h$ 0@o V㨂X@P $AP<,:$EDЍ @P P0`/< 0P0 8 {\$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PP@H@0 @P M0@SI@H@ R BJ(0W0 ,000,0_<(KC-M8P Qo<0, @`pᠪ000o, 0 < 00 0 0 )P 0S000ᐮЍ㵮P7꠆A-PPP Up`dU@ ㎪0ū@P0 ,A-0Sp@ヮ@P 0`PP`P0 P〪⿪00`p@-@&004P0 pp@-0`S@J@P P0S00  }zႪpG-0`@ `Pp@lT Ѝ 4 P0 00@0`@`@X?O-M@p[p0`@P %s= 1PP倁008  80850p0 0zPp [?00 0PmpP܂X8808W808808 080P?@X p, Lp , _,00X 08@@ᬨ,0S 0"@H00X|ЍT㜐L L Q! Q QAt&0800?@PH R $000CNH@@ &408040 =%u<00<0%$3!00 8J0VP 0@80 3!8G@T$%t<>0 SC&X02+@ 05:o#0P0 @ 00 000 000,0000ѧ0@pC 0 SQ, 0$R00S 0{ 彧@㌄ 0Sj  @$!X$$(08L0(0+00, 0?@P,p00ʿW 0!"Т3" R 0P03Px 30p 0d@P 0b" 0"@0 t U@ 0(D , P\b 0 ,  @ 00 00@,0  0@0 0[^T@D$p 0 C$0/0 0 !P"$0/0 0 !P (p$,0pW @ 2$ 30p 0d@P& 0$S !@ SaH@0 RV@ X0R 0" 0p! 3AP1T 8@@808 0  &!1T+Z &+0S !Ʀ 0SG0p ~!! ~᯦0\ R 0  8@@808_41uO-DM,0h08 <00Sy 00P08地3$00S 0SpDЍ00  01 $0, '%Q  0 0\:Q`@(0 0? Q  , DЍO<0 $ ,pP Q1' 80080000070 `P 00 ` E`8S0RP '000pQ QM Q&Ж000800400S 0 Q:p0S0 0 pQ Q QVWc0 SR0S S 1H0C200 0040tpP  0 P0*% 00000$0 0;00t@Pp1`l 060pP _$0 ;cS0!00p 0`$0 0:0 Q@P 060 %pP  89W M00 $0, `$0Y (R   Q\ G0p$ I QX#Q X *Q Pڸ  Q\   00 $0, p H I 0 I R031005 000(0<0040(0X*0( 0R{*  0 $00CY\0X(00 00(0)!00 (0 00 0 0 0(0 % 0`0 %(SR0 (0 0 p0000G010S0|0S8Sz$0p 0 qP 0 ; %0600P 1 Up H   X  R   l40S )!0 0 A000  0 . 0p  \)`9q(0 000S} V 00w9rpL=_O-` V4D`Y2!>3`04\@ 0$p 4/@P 87 (00 0p_i@_X?_Kp@- P0@@`<04 @ 04/@P ?7 e_i7_@- 0 0000 0Ѝ @-0 000 00 0ֺЍ@-!>000!44 0ṶЍO-@Pp`LM$@Wph6X SP0 7 |8/P $ LЍ ``  4:/P 6 $ $`88000`8 `` 0( $;/#PZ@T<P|p0 3/Pt0 SƤx0S $0x 00$0M_c_ 0tꤶKp@-@P% Cp@ 0`( "4`#/G-@P`P000 CZ4(10S@0  dU. X(G4嘡@@0 0U>00;4000 8Aᜠ4/P#P  p000@PK R> 0R  CU700000008A ᜰ4/@X#0D?oU20S 0 #T T0S0S0#3T0 P0C0b @0 0C00g te )0 T0S$Y @ 1p6儀00008A ᜠ0 4/#P@H  @P #T 0 T0C007S @30 00 S00  P  mx5 0R ,%(10(1P v5@T DvP~$$10$1忠M 0S0Y @0 0000040S: 8, p44\:# 80   <0L\0C1 01008 T 0`000d0嘚*0<00L 0  !  0003 000 s 00bR0d`0Y   P:dd0 00 0`0 @<,0< @8R, 9981!p`00h0 !0ž+@ 0`( "4`#/O-p845,8p /? <*Xy([X0sd0HSa82 00?FFY;00 0S  $0  0 48<8<@|@0(, 0>0P03.: R Q# Q3#8#(, PU0 :8;崚0 0 0) ;0S<Ѝ8< -8    08 08  0`H,]8L]^<0@-@ P0 M0   0CD T ,P  0 rЍ00@-PM8  @:88;R0 00 ( Ѝ0@3;Ѝ0S| O-@$MTVP`L Hp RQ4PP0UPPӈ U0@/S  0Q PT`0QSR$1 1@!pW?W0Ar1 U.181Dr0P0PPS P q1 1 W?Q00 00U0P00H0 00000`00X0.181qr$Ѝ\0P/Q_h_t_n_C-DMP` p ng <  0$ 00 0@ "400 00 0 &0|0 0 P0 S  hg P dgDЍL\ 0 \0? 0 0 90G0 0 0ZAg 0@-8@ wh0l P 0EP3<P<#/G-@0 qd `00000`PV`0d P Z000Pp"SR \ R3#. 9 Y: 8   088  H@ 0`( "4`#/O-$y@ p&0q00p0a@S 0F  `!qF` p0 S  0 `@qpPU- 00 qHpo?0尡Z | Q ! |! BR!&p p0S 1S10C1p0S p pp0S hp 0XS  0 pp%p$]%_<@-@ hp000p@-<@Pfp0@Spp 0R@C-@M4SpT@#(a(Qq@ 0R@ p 0 \@9pT0 0spЍ00 0R圐 0R@T0 U0S   0 p00&Lp00C0@0,00002@q刐! !  *P![& e! ,++:10 0 Ꭿ4 NP !*! 0 0 }4 =( 40  ++!X? __G- MPp  @` ?@T Ѝ Z @0(01ʟZ R00 00@@eTP0R00PP' $ P0Q\(0 S @0 000O-@,MP0p T0P`X D0 T0 0C S 00   @P ҙY? 0  P0SR0K|0C!0 SH080m@< E  004005000@@$?40 S0 ?+0 ?#@ ?-Q P@ 0P 00T 0,Ѝ@0S   0R00   R  @P ~0( 0(T (@ T 0@0 0 @0 0 DR2320   (T7T0S  $k(0  e(m__O-PMp`HP宑H4P@0S#㺑  \* P$IV  $  # $  L0Y@2P #101#0 00 #P  #   B d#  P@    tX  L R @ R  P " #   0 3SH L0SP0\ 0  P <  0C S00S       PHFQ4(K0KpK|K Kk  #RHL RP \ ϐ0P0, BR    PBVL0Y@PЍ  #RHL RP \ 㘐0P0, BR V   2 % ꌁ@-8@P(0, 0(00 , @o7@-@ HiB d \P\00P0 D00(0 ,00p0z Ѝ0XL1_^__@-4@V+H|iPw(up@r0/p@-PH@oi00p@i@-Q0   0P0"3 e 0ЍA0C-P4 $0# @ 0e@P y{0  000000) 0b@P 2"1F@P 00' T9@  {1 4W?o20S 4 j@P 1011 Q 0@4Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ Ჭ@P1@010@00 @1:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S '  000000t Ϩ0 R00¨tp@ሀ@M@X?o_O-P`1 @npᐑ吱!@P4|qdVʀ 0! $X!0 P!H!   !,h0S2Th 0! d0    !tT# 000 +@P?8</P  R (@- 0@X?oHzhzlz_G-0@@p` ,!4#Q !PPL}_A-0MP0`0 0p` @>0 P 00 0000@?o2P0S@ЍC2 |2 0<0:t0p0x00008|0l 0 0X 00Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 04PK0 TP K!`0  0Sp   0 oK P0S00000 \0 Pp0p  BA  P { }U/  - o+ v) z(<____X?<_G-PR M 0GSd2p`0 V Q 40p "@P!00(0 0,00000  t p $ x ( 8 , < 0  4 | <08 l D0H0@ 0@ Ѝ0SK@0 J@ VS  7<$(, 0 00@SD@HJ  @P6Z>JY `0 @P)Z `Z.JY 0D@PZ `000邡@P 000 s@ *J(J&J@@A-1Ms1P@W<P0< !0 0?BP@P BЍ0( ,(0$!    z@P  0p0X0 0(0"@P ((  (l`p0@``!(>@ T 4pNz_1_<__>_5J_ 0`( "4`#/@-0 $0S\ 0 B @B24 b1> 0S& p@-`0 CSR!0@P P 3 0 P ) 0 0# Pp 0&p pG-p0M0`0@8 ;8"PPd h"\D00D0D  0oU@ (W 8$ #R Q!0P0000|000A A1(LHL RP \  BQ,L (/PP00$ 0 0 0 0013PP Q 00 0,,PP. }0Ѝ #RH L0SP0\ 0 y(0000(0 <  0CS00S( 0 00 0 0,00S00  R,0 O-00\(lMP0@0|0\✀0|0 D 0 p,0 U`<Z 8 F #R6 QC0,@000,0000A A1(L&< 8 Pu Q0,@000,00A A00010(LuHL RP \  BQ,L ,<`@P #}Pb0 3SH L0SP0\ 0 x<0000<,0 <  0CS00S< ,0 00L 0 ,0< 0M 3SHL0SP0\0Dx<0000<,0BHLPP\@  @Q}@ L ,<@PY3P|?@ X808 00U0@00S0T0S@lЍ<  0CS00S< ,0 00 0,0 0P<0 U #RE [R ,@  0,00 0K1 1C!  ;@004000080 0 P@P <AU 080 X0000CS000% (  APP(  4D|@PHL RP \  B[, 0 ,<e@P P 0 0 XPPX0 080 P000CS (  `P(  4|@000"8 0\0$300CS000 (   `P(J`X\` E`BHL`='S R00$00PS;#S R7800C?o2080 Dp000CS000 (  `P( PP" 0 0DV`PDp[`$0S0S P00`X0 `?o2X HwP 4{P0%'O-0dM`00,00 0p0S|PdЍ|WH$%圀t00t0 $0   W@ 8G 82 #R" Q/0$P000$0000A A1(L0SQ?P,{ 8080)HL RP \  BQ,L $8IPP  { 808 #RH L0SP0\ 0 v800008$0 <  0CS00S8 $0 00 0 $08 C PHLPP\ : $8PP,00(004 00 0P33PP QųW 4( p000CS0(0*  P ! 0z P808i  @Q0$P000$0000A A1 BD"4 0\(@100CS0(0   VP @P T@X@D@'SR0000HS#SR8@@DOoB4( <`000CS0(0  P pP 0 0<P}<`X㜐 0S&T P00X0?o 2P @P 0y W808 0,00S0U0SPP0%'0 /7@-QP@0 P0 4 8 RP 0H0000 V Ѝ0O- 0 `M00000090 00 00CS@0S@ R0.S@ @P0 0C?oR20SP@0<0000вP0 @ @P P 00 @P 004 Q\80 R] X n00 0e <08 : < L  L H $ 0 $0[p8 < 8v #Rf Qs0$@000$00A A1<0(LXy?@0 00C?oR20T00S 00@@X@0  @T 008@ @s@P0 x|0RP(000Ѝ 0ڴHL RP \  BQ,L $8@P xu0 3SH L0SP0\ 0 t800008$0 <  0CS00S8 $0 00 0$0<0 Lf80 Z #RJ YW $@  0$0 I1 1C! /0(0400 00 073<C@PU AR 4( 0@P00CS0(0, ,  6pP, # 09x@T!0S3  K.HL RP \  BY,0 $8S@P e}P 0 0@pP@P0xT0S  4 [0(  00CS0(0 ,  @P,  04K0@?Sp0wH@ p4 (@0 0 0C R (  , @P,@0<0C?oQ20S( W  LP0w@00 <0@P 0w<0[Tp@pg 4( 000CS0(0 ,  @P,  0wT0S  We U`P 0 0@ @P@p4@P( 000CS0(0 ,  M@P, P 0 0@@P@Pp0Bwp唀X @@P 4b0@ @@P@p W  L=P0 wH@L0:e 00 <0$@)Tg<0[Tp@pY 4( 000CS0(0 ,  @P, jXP 0 0@@P@p]4@P( 000CS0(0 ,  @P, G5P 0 0@z@P@P:0 ?o2R0St  o0 <0@P0@ @\@P@p U @-0S00, Ѝs@-P0S`@P K   0Ѝp@-@<0 K 00CS 0@K\@-@08 <6h0@ 001/ ^@@-@08<7U0@ 001/ ^@@-@08 <6B0@ 001/ ^4@-@08<7/0@ 001/ ^4p@-@PIK0 !p@K@-`p PM@P @ 0@P 0  P030000 A@P0 ЍO-@P 0Qf`冋ᨋ`Vc p`0 0S00 0UPNP & @00S(!``0000S 0  0 Ѝ0S- 0 00R0S @ P 0S 0  0  00p R W:0L 000@000p0 0 000#\j_@-@8 0 , @\P_G- P0 Bp`8M0< R{L4L4L{L4L{L{L{L4L{L~L, 0 @8Ѝ 0S@ T#000D (0W8 `@@$@Q #RA TN0(000(0f000DA AD1(L 2, 3   !  @P A , 4000CS0,0$ 0  `P0  t@HL RP \  BT,L ($@P tP 0 04Y`PT  , 000CS0,0 0  `P0 00CSh~L}L}L|~L}L}L~L~L 0  0 0C?o20 0S 1 0 c># C,0!0 0 0-803!@@P& 0 8ЍG0 XR7@-P@0LP! "0S, ,00 13/  Ѝ0_ ^4*\^@-@0S @C-`M @P- 00 0SS S p0 S2 I00>00 P 0   0@ЍO-p0PDM,sr`lE0V0 $P00P0H $08 `8\ #RL QY0$@000$0000A A1(Ll80 L #RHL RP \ C|o800008$0>0 P@ QX@ @ T@0T Q@DЍR 0HL RP \  BQ,L $8@P SsI,000BS8 $0000 $00R# @06 R S 0(0400 0 0 0423@P A4( <000CS0(0 ,  `P,  0 s@ T0RSfP 0 0<`P<T04( 000CS0(0 ,  `P, A000 r @r00S% ,sr! 0S 0T00K 0 @GDЍO000 0SS @8S @ 10@0*p@-`P@M8  ;8?P00   08 H@   0 013/Ѝpt ^@@-p`@M8 & Ps   P00  0H X@  0 013/Ѝt ^4p@-@ `(MP0k 0 0$00 000 P@P A r(ЍpO-dM000t/H0p0H0 <D ` $0=X@ 4R 8A #R1 Q>0$P000$0J000A A1(L40^ p Qp #RHL RP \ gm400004$0eHL RP \  BQ,L $4PP q( #RH L0SP0\ 0 }m400004$0 <  0CS00S4 $0 00L 0 $0@4 0 3SHL0SP0\0Pm400004$0,000BS00S4 $0000$0<0040  pu Q? #RHL RP \ 6m400004$04Q #RHL RP \ m400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0;00 Q40 pw Q? #RHL RP \ 6l400004$04Q #RHL RP \ l400004$0 ,000BS00S4$ 0000$000,000BS00S4 $0000$0900(,40p|  Q? #RHL RP \ 6\l400004$04Q #RHL RP \ El400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0800,(80<0zs o0ZS40 ~ ? #RHL RP \ 6k400004$04Q #RHL RP \ k400004$0 ,000BS00S4$ 0000$000,000B S00S4 $0 00 0$0408)@&H0L0zs 0ZS40 k #RHL RP \ bk400004$0` #RHL RP \ tk400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 Gk400004$0 <  0CS00S4$ 0000$00,000B S00S4 $0 00 0$040HP4 0k 3SHL0SP0\0bk400004$0` #RHL RP \ j400004$0 ,000BS00S4$ 0000$0404 0 3SHL0SP0\0 j400004$0 <  0CS00S4$ 0000$00<  0CS00S4$ 0000$0000(00,00 0 PP QX 0( 圀000CS0(0] 8  w@P8 T ,znPdЍ<  0CS00S4 $0 00 0$0p0 0R01 p0 p0 ( 8@p X0B`HP0s0 $ ?@c^Mb 0 0\(p000CS0(0 8   @P8ppPTp kXh@@Dpc'SR0SH#SR8ppGor0( <`000CS0(0 8  @P8 W:P 0 0 0<~@PJ<0X` [W P00`X00P @P , P0%'0 0 0PP`Y@P $G-@|0s-P pr`0s 8<0sqHL0sq0s 00~(,圠p|^ 0>0 ^0P3l:0S#S$Pe PPe~ "؀(0, 00h1 3 |PP!  0p E0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s 80 Q3/PPЍPO-00#`pT0DM|0T0D  $0/WP 8d 8$ #R Q!0$@000$0<000A A1(LHL RP \  BQ,L $8@P000002(4  3@PIWK4( 000CS0(0 ,  @P, ` P 0lH@F #RH L0SP0\ 0 ]h800008$0 <  0CS00S8 $0 00 0 $0WA, 4( <000CS0(0 ,  9PP,  0 #R. Q;0TP000T0 0A Ay0001 0(Ld0  #RHL RP \ }ed0000dT0xHL RP \  BQ, TdL PP i0 4B80SO?.@0( U Ѝ0 3SH L0SP0\ 0 ed0000dT0 <  0CS00Sd T0 00 0T0 0 L_d 0 3SHL0SP0\0oed0000dT0,000BS{d T000 0T0@0PP 80S PCe HL PP   T\`$ A# d XP`0 0C0000 00C00 0 0n>000>  d B00X0 0`00\00 0 006 3PP <Q,0S `X p000CS0X0> h X `P5 \h P<  0CS00Sdd T0000T0LH | T0d,PP h08 4?>.@0( $00h X%`X 0PE0 0CS0X0 h X `Ph <ptx |x\R00 D0<0R0 4\R8Hoᨂh lP RpIoᩒ0<0D<`X l000CS0X0 h X `VP`h P 0X 0`0lPR<0lSp D0S+X P00pX0 ?o2 p(P U`V` X0 00CS0X0 h X `pP \hPBP0%'h{P\hP5V0`F 00000C0 0000 0S/0 ^(0pS SPpp&=0 a圐@ 0`a`W=(p[ P0hH0\gU$00 V0C$040040~ 0 L`0(00 ?oV20Sr $0 F000$0C0000000 0S 0 S   P   b0ia` Z0X 0`,0†=`P \gPꀠ,`<00C00Sʐ<__vLO-dM000%圐080p0p0p0H $ p P $0X` 4F 81 #R! Q.0$@000$0000A A1(LZQ?@)g 8080)HL RP \  BQ,L $4F@P  g 808 #RH L0SP0\ 0 b400004$0 <  0CS00S4 $0 00 0 $040p V #RF WS $   0$00000Gq qG 1800,000(00  0 @P AijX 0( 圀000CS0(0'  `P  ,f @808eHL RP \  BW, 0 $4@P h("0 0\( p000CS0(0   R`P pP TpX`d'SR0000HS#SR8ppGor0( -@lЍHL RP \  BQ,L 0@j@P -[ #RH L0SP0\ 0 W@0000@00 <  0CS00S@ 00 00 0 00@ + PHLPP\ " 0@&@P@0Z  Q- #RHL RP \ $V@0000@00"  @Q00@00000(0A A1 值,000BS00S@ 0K0000 00;0s@0 F  #RHL RP \ uV@0000@00 ,000BS00S@ 0000000;00@ 0? 3SHL0SP0\06EV@0000@004 #RHL RP \ .V@0000@00 ,000BS00S@0 00000000<  0CS00S@0 00000000@ 0 3SHL0SP0\0 U@0000@00 <  0CS00S@0 00000000@ 0 3SHL0SP0\0 U@0000@00 <  0CS00S@0 000000008<@ty TY@0 Q  #RHL RP \ U@0000@00 ,000B S00S@ 00 00 000408@HL@ty ̀TY@0 k #RHL RP \ bRU@0000@00` #RHL RP \ ;U@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 U@0000@00 <  0CS00S@0 0000000,000B S00S@ 00 00 00040H\PY00CS@ 0k 3SHL0SP0\0bT@0000@00` #RHL RP \ T@0000@00 ,000BS00S@0 00000040@ 0 3SHL0SP0\0 T@0000@00 <  0CS00S@0 0000000<  0CS00S@ 00000002 0#0<00480 00 02 3<@PW T 808Q #RHL RP \ "T@0000@00 ,000BS00S@ 00 00 0001R011 0008w@p p1B`nHkP0s0 800C?o200 08, D000CS0,0 0  ,pP0 PP) 0 0DܮpPz 0DSp$0S0S P00pX00 00$00p 0?o2X HP 4LP0%'@T V 00@`O- 0tMp00,0<00/0圠 `0 l< 00d00d00H $  00  VPHG 8 9 #R Q)H 0@000000000A A1(Lp0SP`K?@P`HL RP \  BRL 0Hž@P K`, BQ0 3SH L0SP0\ 0 XGH0000H00 <  0CS00SH 00 00 0 00H0 D #R4 XA 0  000000H H10 H0V ~ Lp^ Q, #RHL RP \ #GH0000H00!HL RP \  BX, 00 H:@P s,000BS00SH 0000000;00PH 0? 3SHL0SP0\06FH0000H004Q #RHL RP \ FH0000H00 ,000BS00SH0 00000000<  0CS00SH0 00000000H 0 3SHL0SP0\0 iFH0000H00 <  0CS00SH0 00000000H 0 3SHL0SP0\0 =FH0000H00 <  0CS00SH0 000000008<@tx qTXH0 Q  #RHL RP \ FH0000H00 ,000B S00SH 00 00 000408i@fHL@tx HqTXH0 h #RHL RP \ _EH0000H00] #RHL RP \ EH0000H00 ,000BS00SH0 00000040H0  #RHL RP \ EH0000H00,000BSH0 0000000,000B S00SH 00 00 00040HP<00@0004D 0 05 3J@P AD V04  00CS040 8  <@P8  @?IP` V8080<00S0T0S0U #,0043 00 0@P ,0TP0S@WW@tЍ #RHL RP \ DH0000H00 ,000BS00SH0 00000040oH 0 3SHL0SP0\0 DH0000H00 <  0CS00SH0 0000000Q #RHL RP \ DH0000H00 ,000BS00SH 00 008" 0000 2000 08@p 1B`HP0s0 !?@cD4 P000CY S040 8  G@P8  @JH 0@?SP@@HH@ P D 40 0 0C R 4  8  @P800 P01@PP0VTPT D4 000CS040 8  @P8  @H P^Mb^[.P D4 000CSST 4 T  ᤺@P@V D4 `000CS040 8  ùP8  @G @Z 0 0``Pp@P`P P !D 0\4 $100CS040 8  D 㒹P8`d hTPX'S R00$00S#S R8HoD4 Lp000CS040 8 4 D[P8 `P 04 0DL PLpZ㜐 $0SX P00X0?o 2` P0P @;GP0%'T  L 00@P*U U !3O-p M0`&0 00S$ƿ@,hA/3 1 H`PŨ 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0:VPP PU 003 00 q 0H@Ѝ000zS0Pƾ~$k__]G-P `MpQPLg0S@ GP 0᠂003 存P@( 0U&2ЍH0S0 RP@UP @ P0SH0S300 0 CS 8:8H_G-P@0 pS kT! S TfF`.W޻Pڜ0H0S0S 0 P@41 3 00000 00 0 ,` VV!0S 00   T 0S  0T0 TT Ѝ`ʽǽO-0pdMA@4dЍ0%`000D $08 P@@8@< #R, T90$000$0000DA AD1(LT80 , #RHL RP \ #dA800008$0HL RP \  BT,L $8☸@P [E,000B S8 $ 0( 00 0$0 04000 00 00!@P wA4( 地000CS0(0 ,  PP,  0E@\"4 0\( `100CS0(0 ,   PP,_`P T`ZXWP@D`R'SR0000HS#SR8``Foob4( P0%'4 (P0 00CS0(0 ,  }@P,Pap  ᑬ@P (@ i9a1u0@-MP@A0 00 8808Ѝ0@- Q@80 h0 3    808 0&8808Ѝ Q@-0S 00 3 ЍO-M<0@8pD40)l":  00C 040S4L3,0A`0 : S 0003#0 #L#3202y4P u0u0<Ѝ޻ 00 00au0P t4P tTU T]__@-003!z?` 0q Ѝ_0@-qPM:Ѝ0@@B80@ 3P@z?00`0 SЍ0_C-M8`0@XP:@DŔ  8TAVp pϬQ @$ @P@ `I8Ĕ< Rd`XЍ_4_R_O-p400P@ S` 08`M ?  0z 0QP_ p(80 00w`(`p Vw &0 &00C030S3 L32  B \%<1R.=S+T @0P SXprpppZ ڨ |0  0 v00C00 ST0T00! B!00 0`f `` V"%P80 0SЍU TO-,M 0%!@ 0PP``h\%1R=Sh \1R\0 嵟 Ѝp1>0S100! 0 $=$Sd 01000W 00p50 00Tp4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOTU \_&]_O-`0, 0 00T3pS !!!j[ Y 00 I T [  , ˿ 0 0 z,Qq4Ѝ0 0ł." 04 ST0`Y p80 S6D0S `0, 0 00C p?ϊ 80S#$ 0C $ $  $ L#$  14  4 T3S! FQ p0S031 0p X,$0 0C$04 $ 0S/4 $L3$ W0 B 0!0400C40 pGa400400u/ᕂ(T3 pʏS !!! 0S  031,P #pipSTU T0 O-ML0@ ؃00@p S;  TH!NuЍ``0 Cc ca5bS4D $P<0`@$!c 0 P`U`8$<4X000 0S  ?0 0000H0P 0 0 0D0000 0P0 0 Rh  h    Ϭ D 0 000L0D0 _%_VMO-`LM4000p@ T0$004$0 00: S(0B(0@,0[ 00㣉0 Eញ?0 ᗉ0 00D0R W,P 0 U*Q6P ,0T0@#P!0nH#0( PS0 3 00000$0 40LЍL P* [Y LR ^*[PX P+K(H%Q!4,Z3<8  Y3R 080 !<SD00S0055 1!08Q< 0*0 0 0S ရX!0X 30 R0P!0 R/0P L#" [0L,"\ Z YH# XJ0L,"\ Z YH# X0L#" [0SB 0C0?$ @DCMM_[_O-,0`@p(00P  ` L 0l7p0t ̠\ yQ 1K\Nt0 0/W  0i 2Ϡ!8 [ K P0 W @?Z,`Қ@0A P0V 0SǚL#" R: Ϡ!800L#" R*080G-p$0P` (0@  ` L 0l6p0t ̠\ TyQ 2I!0Rt0 0/V  0 2Ϡ!8 Y I100 ܇ P?߇,`WP0A Շ0V 0S ?ᾇL#" R: Ϡ!800L#" R*080O-@pP4M ů 0᠇`\Ŕ5#!\X    0 T0 L)L,)l"3PgX 0P@,ЍO Z GTR ケpP `@0S7 0S00 T0T3?R\0 0SP `0 S ,ЍO  @ 0 00 V0 0 Y @ 000  ,ЍO>,ЍZ]O-TM|00@ 00sc000P40`0x Cs cq6rc4D $`<0p@$!c 0 t`pVp0 00000㊿P T (we 00 00 0 000"T0,0 0SD  ??p,P 00`2@0(0C$0L3T 2 0$PS98$0<4Q4 0000400Sb S<0SD@$! 0 $ 4P |70S l 00`^H00000 00NnP TЍ08SL 0 <0 ?D0 0  0/0S 0/< S T0(0- \%6R0ǂ0## 0 /T0 CL    )pC)0c <3.nPL0<00 S 3 S^\%6R=S^ ?᠄800p ST 0`S"80 ϣYc8<0D80N,00 ,Qg A!40Y0C40 A40040( 0T S"80YbT3S   , ( Lj$000Sv h00h0 0 0000S TH A)A)@a #;̠S Rd X8 00 ǂ !! ^?001>00^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ yLP i(  00$0 ikH000$ H0 H0 ,  H0 00S  <0D@$0C!d 0 ః$ 40`R0 10S  )00p1` 000 0p40UP0`W0080S 00S" 0 0 0U $0 0Rh  h    $  0 0000S! T0H C)C) c1<62 8<0jH00( C0H0_ H0 , H0 00S@~@4X", 0S Hh_%_f]_P=_TU T_" _VMO _O-p`0P4M 0 ?0@00 !0\%0$01R 00@ ``&!! X0 00*P@? j4*!, ZS QS::lP ,l 00\ Ó\ h4Ѝ $0 R  X   !A,iTt]U O-P0@Ḡ $M⫂0\ `#,^ 00 0T ? A)A<)a>21,, X:@ 0@P-kP l 00Q Q Ah $ЍH  0 0 PihT] _U O-PḰ@ 0$MI0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X:@ 0@P ykP l 00Q Q g $ЍH  0 0 PXhT] _U C-`PḀ@p 0M 0\Žß0.S\! 00 Q    ` a 00TU 40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PP0s40\pdT80< L31)l< QR>QR!<`0d 0001 F g40P 1`dP<040 pL `l\0<726, @ P0Hd,:0000@ (0 008jP0~d0(T0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Ep0$0101 0 "p `@ H0P ЍP0805@U50P%P0L05P000Td40 `001 0 0p00101 0 0PPd001Pp 0 0T0 C)C)ct00<21 ( 0P0 c0S C\1^1 U  U `  Rd ` < #.36,P Z*85@%00L 0404 00R  Q RI 00T)\5 S0  11@0p@00 p001P0 0p0$01 0101000040 0@0 0-PhP <0 B2 b061")(! ''0001S 12 :f X0P 0 PL< l52>p, ᇱa Q0:1S 000000 0(hP%1,P 1Ferc8U@e8 L0PP`P`U1Se 00P000Tu\5& S0 @qq p0@01 0 0#p0$01 01 01 0` 0Pp@P''000jQ0805@U50P%P0L05P000T<0 p001 0 0p00101 0 0PP'Q P T A)A0<)a21 ( 0l0000 0(@+Pl00Cl00 01 0g00T1 P  0 p001 P@000 0 0 HzPPx0gd000 000g0T0 C)C) c1062 *(?PPd>ePP0 0ap0T000400`0  0 F Ϭ 0f2fcd000 00 00  0Pd0- cpG<0S00W0S <0S&0 T 000`p<0嘐l0Xd  0 ` 2( bPdbb< 0(bd0000000%FfP ]H0p`d10 `@c040" 000 |00S)1S0!0Y8P0 c0S C\1^1 U  U `  Rg ` 4 #.36,P ]*85@%00L p00W00W0SO 00T~\5$%S0c 1<00@00 (001 0P 0p0$01 01010000<0 0@0p0 0PP 40 P B2 b061b 0`` 00( ~0p !0001S P 1! b X0P 0 PB2 b50>" pPH Q0 :1S1s 1<00_8U@e8 L0PP`P`U00T\5' S0 @qq(0@01 0 07p0$01 01 01 0` 0Pp@,Pg0p Q0@558 50P%P0L05P000T0 (001 0 0 p00101 0 0PPP?'Q P T A)A0<)a21 ( 0l0000 0('Pl00Cl00 01Sb00T1 P  0 p001 P<000 0 0 @ PPx0d000 000p`0T0x` C)C)ct02160" *(PPdaPP0 0a0T00|0400`8PL0d000000(0!|dPPrd00H0H 0ql0L R 0P00 `x0PT40<@㴠P d`R00T1P Pl0R 0 H0P 00 0 0K<@<0@ 00 (0 0><@p001 P 000 0<00@00 0PPp4ph0400 0000T0 C)C)ct0201<" ("BPP4 d|`4p80slpx`40V>:[ h04Ch0h4,aPP480L s0H 8001d a4pP0`Z`1P0O,`Pw00TH0 010l02H0 0 0p001 01 0000 0PP W4 ppt0p!R  !  0  T B)B1) b072  0(PP 40040l0 2H0H qd1`i_1S) !00h  0 0(xcPP m 0T0() C C")0c7#10 0 d 000"00  ( PHd0s ἐ?00T0 `C0)0c VQQ? Qy/" \5 DS 0?!>0  0 F Ϭ 0f2fU`d000 00 00  0EPd0, A`pG80S00W0S 80S%T08 000`p80嘐l0Xd  0 ` 2( PdT_P_8 0(bd0000000%FbPd0H 00d_|040 000?600O-@PὊp(,`PT: [0 S0S 1PZ@V 0000000@@000@ @O-pTM`@ 0S TЍ@T@Y@T  r"! ( 0  (04 0D \ 0S,0@0H*0 0:00@0圠<0 08000  RȰ%d*}P# P `2@S8NSLQ0 P@UP!PŸI͠ӈ$ P 1/PD$0   0 U$ 0 x$080\< 0/P\00 T0 P@ \0 A!. a4,AS ?0$0 00AQP0 ⱇ$_?o2Y0S000@Q9  @ PQ;Ã9ʁ0ˁY @0 R 0@@DT@B@@@Q88%@5L0orAO-p|M00-P `0븰[ 0004P|Ѝ0800 00\@000S/ : P0X00 \00&2T00PT@p00h@l00<0 h0@S < `\P/0 d U 4 Q4 @P0080\0000P n9Π ^RQR.L N @n 18E \H$@@NU0@@$0@$ ((0, IY! ? Z40 0 Zů 00:@   aPU@5 ]K$@@@ @L @ Q  N. n*< 0Π U , D   L @   D  H   @Ha$ LP@% 0@D TT{ 0(0 X PP@9][6]n@PL^)Pr@-0 ^ R*@p5 R@9 _000S -/0   R Q   -//@-P`00S-@! < 巭@P@P 0@0 0 P]@ 0S R )@ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 i@P 0ST 0S@Pu@PL $0pI@p p G ppt H뼰0@0 0  @p 00 @W  A K1@K0P L" l1. Q*e  P0 S 0 S00@$Ѝ 0p@ 0 ͇ pɇ  Ç  v  v@P 1  z  nv弰帀  @-@@A-P@00S= 00CS9< 庬PP0Sk@p?oV20#S 00W: 0R R 0000@0` R @@-A-P`00SE 00SC 00A0 n@P 0S 0S@Ѝx@Pp \뼀 0@0 0 Tp ]@ @ A HCHp ЍAm-@@@O-lM@0P800(00 0080<0000Q.80S(005 0 8(pu@Pd0`0p00 00 p 0 P6d0 45#T20T20$ ;60 0Rt ?0:# 80@0(0P0)#00<dKY`Pdښ`P dZlЍd0000S0 0(0 0?`L0<0S``V$` 0墠d00 $0嫉@00t R[d[0$ `0S$0 00 04T0?X0t0pC  0@DpH@ 0S00040t 01,0@0D SP0H 06L0 R00S 00Sp 0 1p0 0 800(0C0 0t T0 C)Crq)0c9s400 p@i  R !00 R,  ) 080S06 S600S @" 00 00T00S01 0, A0T 0 0X 0 00 pG00040 040D00SD0H00H0,00C,0{Sڤ0 00\0C00 T0 C)C) c0<;2 0 40@P\ 0T0V0S$0 S<0S dZS @0$弟Oo(0BO<0S@dZV !_A-`P!0[ @p%0 Wp0 P  $0 Q D 0! 0V`0 P ( ,0 Q @ @0D 0 @0D 0  UP0 P 0 40 Q$ H 0< 000000:00Ѝ    O-`0Mpp@P$ w  R  p0@ 00@pp\%1R,5S0 0 0 os0 o."\哞p1`Z 0 ?  Ϡ ,2 0 `x 0Ps`0 C c00T0 ` C)Cba0)0c03"\0P   \Ŕ P\x 0@%s ̇W Y0Ѝ0  ~s,hY0 TTO-`0@[M80  ,00  C0CSR [ߍZ 1 0P  ;10Rh  $  $  ( \%R\ R @uD%p/L/pt{W  Ð!&4$00S$0(0?(01  0 So 0?R0:$0( 0QSc00S(pr 0)QQ 0000  L  R 0 \0B\&/ 0:\ &/0 00 0Pt  PP8ŕ0 @L ,Q-Y!0ZS 0ᙋ 0)R 0X:0 0 0001 000$0 0S0 0hP0  c2# S,P!Q RQG S1ZQZ3PR> 08u< p0 H0pß 0YW0  0ᇋ$0 010 0 W00 0 P 10 0X !#H0 p ~p. ?H 0 V0 S$0 0100k P w08%Sw 0圠000S0  0 000/SP0 0 c SRQR3,00Y$0,0, 000 0Yt H0L 0SP0 0SX04800T\` p BW, W pq0S*0xp(p$ Q0 ^!((AP (( 0 ( C 0[00 0 0pQy1(( R@ 0pPn1XXϠ R 0 00p0 0R       0 00,0z0P0[0 S0&t ( 00Sh00Sl0Sp0t\%0R  H ! H04  1/ 040@  p 0T0< C)C)c208<" `0 (0P(040<S" 00 0000S0( @08D 0/@0D pW* p040$04 S000$00 rs \%L5R$00 0!! 0 $0 S000 P,0 A pa1^8970':00圠000S0 00$0 S000 P0, C pc3^09:00SX"66 00Q00Sy 0\P 0 b32 R0Z1Q SZ ☐ pBᜰ b<  YS:0 B z'z b~3p2z0W p11 0 PS0  0H0 p55C20000 0G0 0=0 p ~p0Y$0 0(X%0'00 $0MP 0 S$0 0100qP 8@ŕ L 0  !pt(APn i1ptpt1p 0140S(0#Sz0[ # 00p\%X0R !0 !09 4P L8 l0 ^85@50%00L508Q Q0(010 0S 0 01@0D 0/@0D 40pW08@5L085@00L0T$!_K!_A^T΄8P* P' @0D 0 @0D 0 圠0 0@R    0D Rh  Bh    R  000S1 ?@0D 0p@0DpO 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"@P 000 >9S&U@ЍRG-p0 `$PS@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000yRPVC-0P0`jpd@T 0 Vp P ЍT80< @31)` Q0R 0008<Ĕ?iP0 C c00 0 ~P  d僮 0# 0 h 0S400 0`,``000內0r008 1 010I> 0008<ĔB?iP0 C c0 , 0;P `AV0L" 0 0$ 40h00Ў000R!_!_!_!_"_MG-p0`@s PU 000W Ghώ R 00 0h Rh+9S000%KMO-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPw p$`W0@: ,0W0:F,Ѝ\0Q.0b 08T @)@)`"30 LPd 00\ Ó\ qHxmH0哸+0[0: 0 GTU p0Sp/0@-@0M 0@0@ @@@|P|0 0@0@ @@@ؠL0 00@@ @@@ ˠ Ѝ0@7T=k$_Dr$_{$_8 p00CSp0/@- @D IG@DT=D-M }PuoЍ$_@-0 R  @ @0b ` 0vЍЀO-0,M G P000 kpW PP姨@?n /h+p+ 0 $+4IKP ဍ  0v % ! % G4\%R0004\5 P  g ,Ѝtl4RR  Yh0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3Ev  6000S0P0,(5 0S0 @0@00T`0#S> ) %> 1S 0DD@30V⹥0P4T$0X4S E>0X4(40`AZL V$5S0P=$ct $c`P P3P/ '800pH0S40LpHT0 C)C)0c"03zJPO  0u  F80`$%!0, R0 j0PPl \`ἠ_<#| YP  0 ?<#Ή p 0Px 0``0 C c00T0P C)CRQ 0)0c03"JPP ᙋP$Ac"   Fቋei]$_8 TT$_$_^$_0O- ) %> 1S0T$0P40X4S E>0X4PPh04 SE4P0P0040000,8T0<P C)C4)0c"03P$IPP440$ R:0E0400 5 0 0C?o200004PAY$%,0RQ0 05L0Zg$5S0Pŏ, H_4dS944S@040T3$0`1c1,10 1(5 0S0@0@00P :>0 $  * RPPz$0p0,0 0t0D0t 0b0?o0cH0T0 0CL0804P8PP0Y0SH 0 <Ѝ0(($20V|0703PJ80 00S0 C40HL T0 C)C4)0c"03qHPP*40 0 s4D80 4Pj$%0 , Rk\4S  5  0 !000V0 20P LT0PP4P DV PPP:0hdP ^(Y00Pt]8 TT 8T#_$_$_^$_@-0S0boP@ ib@P 勉 Ѝ 070@P `f`070d`0u/Pp^0Y VAC^B`lN_#_5A-P00`SP p*a@P "a@PHJ0  Κ`$@ЍDC-@p3$M/P++  h0$+4`P6T90h 0rr0 51 50@0\%R=S04, 030304040 50r0" " 200(0\5WD`$ЍAT8 O-,M@40AFWp PL30U/o[" R ,Ѝ800`H0S40L`GT0 C)C$ `)0c"03=P$ 0Lr0$000S1D8 PAG-$MR Rp`P/oAQ" R@   hP V {0*L)4 ^@P0 R@k0npP V 0S 0 0R\>PP0M90 @P0&00 0^@T:040 0 00 0j@P,V,`T`` 9@T0l f0@kTp`|  +ԚKp`=S0 @P=04=S:0 0SX0SO@(0 ^@PP 0 0S 50ó 5v=S  0  @P Ѝ0 5< 0P!P000V<1 ڠ@000C?o20000\4S Tu/V~= 5 0 5=S# U4T@=S 0 6C>00x0SUT010@U@S^$_$_^$_/%_A-@`L1pPP 00' pPB=TSAP 0 9<=u0S " = S<$%0,RL1h嗇P 㒇 I዇000:0O-@P`=MS =S  •F^U㐱P j^pP$N^U 00T R8d R5Tp=SB 005CnPЍU ᙋ P ፆ㒋P 0   0PbU\ppv PO]k%_`Mp@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0P 9 ;909  000&00P֕P 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0dMP00 0 $0) 0\&(0 0 00 )( S RT 0S0,0, (0 0 0 ^0y:,0S,A 00(p地0$0 P =<00004000@0D0000^P࠱8<œH lU?P(8, PP PH L^EpP n7~ ^y[xQ[ W9 n0 ^U QU^YW0  Pp WU(  0s40 00000 U 0 0 P40S ^ #0 H0 .P^pP ? ౘ$0:T0$09X00S T0S X m 00080P<œ0 pPEUP!U$<0S ( #0( H08<Ŝ  ß   . ?pt8PLY"Hࠣ࠳Yࠣ^  pR0@P} 0csxi Z pR0 0Os40  0000 hP9H0 C2 0000$0 0n'"R0 0rZD0Sj0)C( 0C8RP_  <100 #8 )(80(0PM ,000$ 00 )dЍ *Q@pR0PT00 0 4  @  1/QZ 0\r\!p@- @P Pp0p@0@-@Pp 9S ʰ;S  0"`PQ 0 SL0L0Tܩ'0P0b 0 F ЍLPHO-pLMP4  P3r:Po R00`5L:dP @`> $ PS!QS0 @ @`98E R@(@@D@\ @@P:0@(,,0N X !$[0$ [ $ C:8@BP80& @DXT $@0,0 $gP 8m>080[ 0 0 0 \$  0 $ R0 8P S> 4LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@,0 0/\*0 ,\0 0 ) p,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` f@P 4@=" 0 @P<Ѝ8e@5``L0`(04S =oobT`V 00 0SJ;=@-P`Dd@P0 0@P   0 00P嬏0 AЍpvdG-0`P0 XM00 0S  XЍG ?W p p 0 00000.0>000 g@P: W000 08@P-$ 0S)2 0 @@T0S3& 00S00@P  0  0@3 100ʒXЍ2 :pP 0   00:@ۓGvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-7&_T譀ۋ_l- P0 SQO- P4 R 4#0  /" RH @R` pA aw0y T= T @` pA aw0y T/ Tp @` A paY0WqTPp R  PP`@P P\RUP 40S40p ЍHpAD a4Q[ QVYQ@_ AQ[ a0YPPRP   O-Mpᜠ0W@ᨰP尐`00 p 0000e0@ 0 T 0p*Y   Q L B Pb<" P VU \P*PP\& 0 00 W  R@+ @ CP R ' '1/P 0000 P$8#L A1< a20! 0000P C R 01!01/P 0R0*@0 @!0L A1< a20!  U@PY<0 0P0~0 <00Q0000 0P0<00CS$0<0&U 780Y 000 &R00S P0Y00aL0 C# c 9!300 X0 6SQy00(00 0,0, (0XT 006 UF0 000000( 00,0:PP 0 =(07L0 C c#3800 9!600< 02#T20T2%60P0 (7Ѝ,0( 54O40SU 0 700 Q0+  $ RYW 0@ÏD0T00 S 00!1 001/P000K0@00  $ R  WR0@ď D0T00 S0 1 A1/P 0@00 0G@-0S    P (000 00 0 CЍ5N p@-0@00P`06/ 000`06/P K|00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$0|PEP0W(0,0ů _t1 000040 0 0XpP $|LЍ0x 0 | P ( 01/P0@ 0 p 01/H4QP5pUp(6*C/Q @ ?QD   00ã 0Q ONO\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-`p@P M9S$ 9S000S0(0)9+ 00000 0000 8/9 ?o209S# 0 R h0 "V_@0 V_"@ @@@P$(ʖQ Ѝ0 ]`&_U$_@-0,@00V@"4/ЍTT&_0@-@0@000@@PD @DPPP0 0 P: 08S00P0000&_&_&_'_'_p@-@`P(0P0  ld P bO000@09#60pO-P@p0KMP0`@`0/U0:Kߍ0 0 P 0 ~0!"R Q0:V&0'0S(.\S(,0S\ PQ)0.SP PO-P10DMp @0! 0z 01 0z 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 8@P0 h 40R 0 h`F ` l 0z zDЍ@>O- p0M`,00P, $00@000000L000$ t0:@P#L0980 00 00CS@,00|00000 m:P |0S080,0@OoB@ЍPM@`00`0|0S0800 0X0000C\0X0S?80SF 0000X40@0 H0X0  @00@0C 0?d00 ?`0 0`0xN0P00<00000008#8D00Ch0X0P tS-40S0X0T0 P00400ST[ ?[ :\ X =040  t   @P X\0X 40X t00?@PlY Y 00<000t0T0000ഀXT X& R  (0 P(0I Z( " Ra H HQU BRX R0Z< <  r  < R  A0 ( R* H R8 R# l0hPl0H RY  R+ 4 \RX0=X0@U%X(0h0D0C(0(X @@  X 0S  7 BR  X0\00080P00tP ^3X0S^ 0S 08 88C?oR20S 9ST0,00 :4 \RX0<X0@@@@@)R0*#D0@圀0S0@ @000T380S 0S`0X 0c0T0(0(儠0" SR?xx`,0x000 :80S> 9S; L0$  僈P@`Y 0d `0 M0000 L@X0 0@Q>@DP@@EW0S 0@0@ @C0 00@0 R000Sk@)0S:X 0(0@00BL0(0儠0" SRwx`$ xp%@P9  0 $0᠟ 0$`puP @w x0y@Px0, 0@0SbL0$  P@(0(儠0" SR@  x0x@Px0, 0݇ x0x@PD@>&_'_@A-M`@ p0- 0?PP$ 0 T 9 0C8C8900000TP00 0 9S00003/Ѝ0 B?PP0Q   A-Mp`0@8PP$0  @@  9 0C8C890000҆0H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?Z@Pm@00$0@T  R@@@@@`ᴰK [00S S% fP[ᴀǑ"$$G @ `@ T@ 0P@@@@@B .`0[ᴀǑ@Ƒ`0S "440 ` ;0@P00 R ?R *  1/,Ѝ]'_$'_O- 4MPRX0U0 `0删00Jp ((0 T @?4/@P7 0 00\ 00000)td@ "4400 00C0 0    _х@ (Y0 00P05/T@4Ѝ 4ЍO]0'_-DMLH ,  0eDЍ]@-0"!P Ѝ@-0 \ 0 00\幙ЍA- MP8@<`P^0yᨀPPP)0P p@`孙 Ѝ 0 @-)@0ޙ Ѝ@- @ 0  0)0 Ѝs@-`@0 0NKPPPP FL0 00 ЍpO-Q'_t/ 00CS0/0H>tP@- P O-M000@`00 ptPPwPP rЍ00@0 0009 R0  09P  d11 00*!00)0 PjP 00 0 00Qd0X0 000P05/PP  垇  0  P`+P 弇U000 40 90000Br^t7@- 0@ 00L iPP02 Ѝ07@- 0" 00L X@P000 000 Ѝ00  0/ @o/p@-@oPڈ000P0 5/pC-$!0PM R`p0 R R  @ ЍR , 0&:U@P ቁ0S2 9@I00>`9@:#:0*0  菁@@P@$A-`@0P00p0 7/"!""9:#:0900 000""00S00C=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'Ñ(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SZ0sW!srS"srO00sL(srH0sEx0sB|p q`0$E @10000! DLQ# 0 K#ؘ0 0 p忀@PX0|0#880'00 Rd0X00,$00|0 *P\P3Ѝ {G 00圀z㬠* Z00*0 p|@P0嬠0S0t0娰0S0p000*P\P3"sr# AQ񟗪nNnNoNoN8qN8qNoNz 00娰@[@P#sr` $sr&srxG@x00w0F= 0 @@ 0 p @Pc#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P 20010 P *z00)0 p@P 9  :(090*P\P3-@@@@A-`p0S t 0d0 0 0P0 LS@P90VoЍ@oO-`p M✐t@PPd1)R:ᆂ@.:<1 0G0 0U@P<9 08C890 000000@04/@P 各  0 @L@ 宄TFЍ9 0C8C89000063@tC-p @`0圀T0L T* T20S-@ Ѝ贐 JP@00@ X  baD 00 0` @\ 070 @嶊tX'_O-34M`)R@#*p0 Pሐ0p 0p@P 0s@P0 n0p4ЍpP0 000900 0 00Qd0X09 08C890 000000@04/@Pd 0I2(0 0(0$00S0Ӻ20Ӿ1ш000      01/@PA/ᘐ 0Q  000)\ 00)XI~@P&0 0009/@P 倃 0 0L 0 @ 坃T5m9 0C8C8900000 90000nY]tC-p P`UO 0SP9S B@ n Ѝ00"nP 0!@0 @@ 0L@P  019 0C8C8900009 0C8C8900000 00 -  01/ 01m@mO-`0 P\MS0000 00cp_[? 00 A 0#3*pGp W00On@000880DP4p<@@HpQ0L 0800P 05/PP 5n\ЍHP0PG0 0(n  0[$0 2 #R0P @0 00 0U *Y0 SiIPS,@ 0 DQP000 00S U0 F0 0 0 mm0 0 0\00#0300S00 0 0  000,0$0 S:00( V ( ,0A  WB 0000000S  1!  0@0PPkꫪ@- 0 RR@ @Th R( Q@ @p  R0  0@/@-0`0CSxv8<)Q\8PP P'Ѝp#sr$ 0AP<0S'P`PP0V0 ": 0S`ᤝ`V <P 4003/P $ 40 <#1/P %PP$ 40 P0<#5/PP 0:0q'_G@-`0P@ "6000 "40")`) P*0S< <00 13/(Ѝp'_'_'_ ^4*\^0   000 0 01/ ^@0   0:0 0 01/ ^@p@-P@iPڈ000`0 6/ 0p@0 1/t ^@0 0000 001/ ^40 0:00 001/ ^4p@-P@oiPڈ000`0 6/ 0p@0 1/t ^400CS&NdNdNNLN(NXNXNdNXN@NLNXNdNdN4N 0X / 0, 0 0* 0+ 0 0/0)H7@-@`P9#61S0 S 00S0( '0ЛS (0, 0C0000P0 @00D0@Ѝp^O-M@P D`pI R?PoUЍɯ U  @@H 0L @ 1/P  0 0P*)P !@UP `0S/0SS 000/A-(M @  0P$HpLP`!ЍtNT T h姆000@0 4/0V0/oS" R(Ѝ000@'_C- 0 M0p0L P)P ?Q@`0 R"0 S (pkT0 `0 R ` 0`0) Y0   00}Ѝ 0 0 0<000 0 @u}T j@QA   /@-@0(0$S, , ,0( @@@-@ P 0800{,0$ @R(( ,,0@S/S  !!0/G-``pP  S@P= P sP M {j000 Qpq0$0 PjP jP jP jj (IX 014@@H/@-! @P  !(?- $MD0< 0 4 40 , 00 0@ |$Ѝ@ІNN'_p@-@ PQejbj _j$0@sYjp@ ~A- HP0D`p0C ##R@`V( 01S P ȥ`0D1X  Q R 1P ᵥ`0Sp@-@PDA@ p@0! 000CS00S% @0T:00p@G-HPsp0SЍG0 0 0S8 0S4 `` B<T@P 00 P ``0t=`P T 0000C0TA >00C0 0 Ay<H<< 0D0 0p(_ (_p@-P@ iP$0$0p 00 $0Cp@A-@P`"v$0S000000AOG-0P@Sp`P0p0S(W! !R 0 VR:0S(!0PE  1  BS !!  100C000CS0*O-`@$PMpT T0@0 0 TЍ 0 0S  F0 ' 0K# 0@ 0 0S  `G0  0K `0`  `R` V  0 0 V  ^ @G-H`傊p  V@ P B5^:4\P`R  \ #RP  aV 0S*0S  s  0 D@PH00000  o#P0S .v PPL 0<0I880S000000I00C0GD  !! !R   1   0 S  B!<00CS0000$00Cs0 D0HPD0@A-P$0@S`p000$00Cs0 A000O-P`H@,MD00Pp 0pG'60&6`'v00 `0 B`F$0s w  BrU R$00Cs0 ,ЍXC0I0D$00Cs0  0[f[ g 10$00Cs`g`gg g 0SZ000_ PpVS g g g^ 0[0$0 qF0@s  iO0 $ 0$  ZO `F!<  OO0S 000D$00Cs R0 B $0Kjo 101P Pg Mg eV FgZ  Ag 0S0S 0U  00pCA  !4P  ! -P0PC0Q ;0 0 !P 0V$0JY0$00 P 0Q ff f0Is f 010 0C1P0S 1$00 1 00 QO u;0 0$0 0O 0V$0!Y0$00 0GD0 !O T; $`R0 Bl 0K$0 O 0 PC0$`0 0KC-P`dMp 1āȑ@0%T00S?dЍ,0(@0P,0Ѓ(0,0(0SX , X00(P\0xP0 (0SX@ @S , , , P0X0S\ , \ 0P0SP0! 0 R00R0S"000P0000S (0X@S, , , 0X0S\ , \ 0UP@(_ 0 !6/ ! !Op@-PS`@!V 01P 0 メ 0ap0 1 Q000 !  !AR !  B /A-p@P`C0 00A0p@-@P`20S00p@S000 p@0j /-@ $M0 4  *( 0 0 00w$Ѝ䰜N (_ @-yP00 A-P@T* 0S' 0p 0S |`P*@50 L 0S 0 ; 000C0'(_ p@-@K P p pP MPhI PP `!Q0 0:777V p0(_@-@ PQ0 0p@-@PT+ 0S Q 0`00C000 000nBp@ Ly} 0 0 0p@7 0S. #p@-P@ 0 0 0^=7Pp@z 0s/ V0( $ A\ @-4 00A A"1S@ ^\10,0//O-(0p7p"AR0PF4`0AAbATW& q@Pp 1PQS0@ @A 9`p YZ PQW`p V000p@V00C00S0S $  \s,0!qpꀳO-tMp0圀P@`@, ` M90 S6 ?9P F90 `oᩒ tЍ(P,0PU0%VZZ=9 00`0 < 09 V90J0 0\9P "SR 0 !P6d90S \9 0J0 00p8 `$6:00@ 000R  0  0 0_7P;Y% 8  O!Y PyO{6jV 7 !188h0S9 0Jp@0 00`v@(_H(_1G-p VZ`'v' dA0$pp P(00@0?o2X0S0( )0Y  0Q տ@1@AS8 80< <@@ X 0@p@0 $ AP0 pB"   40Y0X d(00(0H&c$p@p P(c,V "4]#@/0@-`0ML@T LPL   @Ay0 0,0 0X0@@nЍ0"T(_ @-MP@NO-`$ lM@ ^0@pP 1@N@pP0 * 0t{$p @v$zF  lЍP@p 7 I0 008Px7(, Q   47 7(P, ZY Zll} Y @5 5 L5 R ( ,"&~ M5](_(_P](_ A-?P@ M     6  %:&p@`V `0 ЍO444 5 0D0 07O-$MH L $P!AYpZ `4!C20(2>B"  YV] xf$ЍOF,0 AT   SPP QPUR QP  RQ  R R  0Rp0@P 0 M000 A`P X0P`@ď T0,0 PM`@$Ѝ# 0s/@-@dM+ SP2+@!804`S< (q< # W 6 0`6PP60  OP $0AQ0%4 0W.HsadЍ6 0  3}6(0,#6f54,Taꀴ(_G-q ɽ@QU|x|@8PU q"AR0C4 Ry᧽U001S B YXP Q00P VU,0!Y00X0S `"V0P `7ꀳO-@M ` @VsC f %  ! . R  c5  60SIV!F5~$    BR - 00> $!*&`  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO?0 @ =P $3 2 03X    0 ,  4 @, ##\G- P@ U `D`(00@0$V0:Pp$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p51`P(0p(_(_#O-4MX傉 Dd娉0:hR 0Pt?)v%t(0$ 0AT,0@T3 0B![0U QY (@ 0`0DC3f0S   $0?P#0* 0 Q$0(0S, , " 80S< < # 0P 02($ Q( ((,(A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$0A`09 0 *"*0 # 30 #6: ,00$0 0! 0 0*⠔h0 d!3l!0 \    ,  d . 01/pP6 Ș4Ѝ 0`0DC3fd0 R  R Z ḕ ᪘,d{3x(7d0$0 6 000 p,0W ᎘ 0h 0 0,00#X?(_#\O- 00S #6:(00*  $ (01/#P1 0B!P0S@(060`Z``0T:0P<Ѝ0@s 0,  S1J0S$ 0,$0g3P0, 00$0   0 ,1,0,0,!1, Y 00 0 V ,P,,20җ $S60#X?(_0@-(A(Q0 M[+$^P ) ^0,0,  P0 S0$$ ( 0R*0 000|`0&P `y ,#004 ,0  ,,Ѝ0@ T#L>X](_8##x>)_ N(_/O-pP@; Ѝ&9;820*0]/G)_O-PM8@0pH/ `0 0e, 0V 0 9`P Y `-S--j- G5P ` 2`Ѝ0S G---S- 0  /(0, #60 !7P *-,6-R)_O-p00@`0PH ,0 2 00 0`P  -,- 4P ` T2` Ѝ0S ,,,/ ồ 7P ,,,^)_p@-@ 0S 0 0P`fP   0f:p 0`:pO-P` 0MU:0pS43#L2H200L2H2V =0@T kY 0V  000 00Po-@P:  y 0&(:@4P 10SG 00  0: Q [ 0(",#PP @(T9!  >0 9 Ep [: W POE0 0   XЍ A,X +  X tp ,++, D  .X[ V  0DAU  0 9BpMp p|)_j)_s)_p@-P0`Q@ P0! X   PPp  00CS050000 V$P s P< Pj O-`pAM$ P@\-0h0i0j00$0XpD>0S 8.882<082$1<0S$10$1 :X 0x>A-@p@`@P3 ΄0 [@x>@- .    Ѝ0.   Rp@-P@ 000Sp@00@- 80000  0 ;  Jg0ЍP>)_D# 0 hD# 0 hD# 0 iD# / /A-D0Dp0Pc00S@_ԍ0000PgAr @-,0@ ,0,0t ,0 1,*,*&& 00S:&0@ 6, P0T8v0v@-`0`PCv0h0L0aၠ2,@I,0 X?h])_0 2@-m$@4@-@0SnP O(+0  $4`aKב"닖) 8K1'B7 : lyЍH#)_/?*_O-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! 7`PE000 pP  Vx>4 0S/(0(0 S;3S8#0/t>,/A-pb@MPA  p101U00 001 000! P )n 0 0P$P(0P 0P0<1 000  P  0 ! )1BPPp_000P P0:PP00 }P00PƎ~0 00x(0x0)0:00 T P|p@Ѝt>p%?h%#\'"*_x%W*_h&*_&/,T\Tu_)RA-, N0RǠȠ̌' @N@  0 `p0PP ||m000URP(0 c00 0 P mЍ]*_*_O-p`1P10@@@A0 媇pT0%WgO 0$P $N % @ `X $$FJjPp6h%t>#\#*_G-@ሠ@MT:@Ѝ!IPpZW``U`#VEਈ W@Pp4$`#\@-. .   Ѝp@-N@N@`P@ s p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 04$`0S ,P )0  0%0P 0S  $0`,Ѝ zI .#@0 Ꮗjh%t>#\*_O-N@N$M@0`zPP$p`AfX0000  $0PV la)`0 P  6{$Ѝ H "@0 Iz#\*_t>p@-P`N40@N@ 0届 p@{t>#\p@-8PPp|@|0P3#pt>@-@ 0a1 v  0R ? 0S1G-p`䐟V@0c 0SP%PU! 0B0 0S0S 0  B;  0ይ0S 0S0S#U `FPP0 i*_A-P`pWX  %A0S0S%T#000 #]#pX $0 0@Qp@-0PBp0 "@+#0S "4##Rp@-@P *U & p@O-dM,$00[ @dЍ,0L\D0$0H0,0P0PHPX PDPz@0 S 0 0CA4H0XPP(0( 00C\ S\05$0 000 [ 0P00T0\000D040H0S {0`(00 R0F0H0S DP97SX a 4IpP[ 0@ P 0  Q 0S X0D$ Ho@]000p<X0 HD P r #R4 0/p oZo $0 K 6$0d@0S X0HDE0 S@y0S*Y"000%"b"@ 0S \` X0R $@Hp0Q D@FX0 ( I @,0< <0@ 1/PV DX0@ (,0 I @< 01/P #P2 |0/ ~D0WX <0 @< 0 'X XH 0DAP' D < !<!<!< Y 00 0 0 0<PP  PY< 0  !9< 0 <00X0 B H@1V 0a!pP0 pp0p 0o"pP 0D00 0!V!9!!00@;000vl0\0 DID&DP T  H!X?*_)_,+_O-4M$0X0 P\!-#@hX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X$ T \o4Ѝ,X  X , !"!  "0 / @X?+_/=p@-,P,@0 Up@lꀵ,]@-`@ 0 ````!PP " 0@0 0哉 00 0 q 0S  "ЍpC-`M 0 ````p!@P 4 P"cH# W' 0`0C0@ 0; 0R S" 0WD0 0tW1 0S1  T 000Ѝ 0; 0? pk 0S:0P//0 R:P3#//Op@- P@00`p@3 b-0 @0 -p@- ` H0@SP`B   DD00 $p@L?p(0, 0 (0, $0Sp0Spp@/0C-00p0(`$@ @`<Ѝx1OM_>N+_G-M 0p` @` 6P0 P 00 0 0 `@?o2P0S0S 00S00Ѝ R 0000 0b[P >0A /R0Ca 000/P @-4aP010-p@-@P` 0P ,6,P R0C P 0C0060@* 0 0T 0P3#pP 0Q ppH# 0R  S01 R  S0100S/0/- 00#R0 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B 00Sp@A-Pp`d@P 050H10@0P 0A!&0DB$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```10X   B YWW 0 R 00W K XFVV 0 R 00VA7A-@lp`*0S #S P(v0S I]^000p@-P@P 0S [p000p030/@-P @-@ $M0 * , 000 00P ]$Ѝ++_0?-A-P`pP @_40 1000000 @ 0@AA-P`puP @A4010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-M00@P`U@PT 0@`[ P

P R*0S*VPP0S0S:00P0 PSP 0O--p@-@PTpHP 0 D B0U0"&00 $00S 3/ `5@A-P`@p<0V`!@0 T@1T@!tP  0S*0S + 0S*0S ?Q 0S0S$0SH0S00 @ 0 000$p"[:1Ѝ@SA-P@`pS&S<0V`!@0 T!1Q! @P @ 0S*0S 0T 0VЍ0V* 

 ;@00CS@0I pA-P@UPP0` 0p00 @0S . PU000eЍPP00`V  D#&RS 4 R @ R  00B X $6SV T1308PPV40S @0S00 80$0S0 0 0m@00@0 P@0S P080 HP }04 R@  B@  0VP`U40S @00CS@0  `H#O-P@4M0U<0UP!@0, T@1T@!0Sp,` 0 Upp2300 000C0Uf0  p4ЍQ @ R p U 0 R H$Z 0  0 U01 C050 0C00[ C$ U1Y ( ,p  0Qp   D @J0@@ 1/p @ `D $ u0P P  $R  0S0S 0S  1  =0 S K\P 0u 0  BR A@-` Pp-P@0P  Ѝ\ 0S400@ T:p@-@P0*70000p%7O-H0S@10 p0`$0 PpCL \ SN P00U  R* HQ Q0 Q11!$Q44P88P<<P22P@@PX  ( R,Q RV  R0 R SW H0S 0S00 S10!$0S4 40R8 80R< <0R2 20R@ @0RX3 (0, 0 RSV200S5000 S000S0000C0 00 {V D0D0H0H000000[H0SV  @P M 9P F3/V2HQOV  (P' U   U    B    5V D D H H 0  0  PN Ѝ2/LA-@lpP`a(00LP0PP@O-M Q@ 0|ЍOQ 0QScp0GSP#*XM 0P UP<'W P3 00 0PP04`PP4 X  2@0P`h@00(0(0V 4t0s 00ݜ` W1 !@XZX 0p0S   @ Xg 0 0CRb00x"hD$000l $\" 0000H00SU@ JD08 !O, 'R ,0P S""D00<00+!D%"D%!D$0 00 0dh00\`0"%D@0L D0<0<,020@0400808004000>/L 00C100L0 @  0L0 ! 0L0000FN `@l r0 S0 S00P0$00 0 0H000s 00:vЍ 0FR 00SP3Z 0 ! PP`@GPh]|]4]@-@pP`M  0p P Ѝ@|ЍG-0@P0`Sp0S 00S R 3/000"y <@  < 0 00x0SX@`@@O-0\MpPT00,00`@L0#@0L05 0 L !6   PL00 @, 00L000 0 P 0P$0> P@ I  Y0 S b00P0(4000000@00080PP 0S*80U0S  XT00(00 0PPX _@ P0 0P00<00 S?00 0 0 000 @$=0S 0Z  I 0 BD @P 0D 00  0 00C0 QS00$P0$ 00S 3/(,00(,000 00080408 400408080<0 <00@0H 0PHD D B"&*@0DG20 20<0S10010(00(000C0S @@ 0  R*8Q RP0@H\PPR$4T00(0 00@T*@np 40 00R0 R0%400P0P@ 0S* TX@@TwT/ $W Y  TP-@\ЍW 0 @P0  r 0P000C0 00 $\W Y  U $N@TP ,0S @H#O-P`@Mp@0 0<0V`!@0 T@1T@!8P 00 0S*0T* @00Z R:㈱Q0 Z8Y $ Q\  M 00S  04S0 08pY40 K004 000 qtO00 $0 S40 @0 @0 W v00 0 KP  @Z 0VyvЍ ]@-0f ЍA-` <@"# p0 %0P@00T@Pv 20S R 3/Ѝ<0S @O AO@O@OAO 00 0C0 @00 0 0 b ]00P 000H0S 0@0S 0 0@ H0R S nS 080 40 0s00000 &00P 000HP 0 D B"&00D0H000 $00S 3/0 $00"00000>O-2*M00P`0T  0pP 08/pЍ@4 R @ RH0  8 $ RS B0㴁0 0 013刁0H0S! [ DJ0P$H0[00 80 P[ H  H0S 6 DJ0P  0  b0j000&j` 0H0v8/H0p000p $0 03/ 0, `F(00 0 pO@NHNp@-@P0S@ S dV003/p@ `00CS0S6S+_- 0 ^: 0R:   0\ P00O-+_+_+_+_P@+_T@+_pO-M$(04P, /J ?00/0 0 D/00 m/0 0 /000 0/40$ (0/0, 00/04 80/(0< H0/,0L /T P0<0DX0/@0\ p/`0d 0 Ht&xL|TX\      0/1!" # A# 0/1!  @ A)  F A* *! A/ "< A/ # @ A   A @ %- A, &- A. '. A0./p21t"/|"x212/ 1"2/1"2/1"2/1"2/1"2/ 1"2/$1"2/(1"/2" $ /$ 0/281"/3#J? 32= C A@D5 $ÍH! L(#,PT04Xa\8c<`! d1@# 0 0D3hqlHsL( ) 08@ 0  00 2 R"` 8"0h0?Ux0 0S?#x03@$ 03030300ߍH#hMC-MP@P`` p"0  P}H1 R*Q, ! 0L CT04 ,  0000<0@0D0H008  00000000Ѝ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221ӀрH#>0a/Q/0S //C-Mp0@`00 0` P!0 P 00 000 0P\?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0S^ 0 B 10^ 1300,0堰0#3[ * :#:SX  ^80@.4 620 0 0 fP Y 0 03/^X&  0!  0D %6SP0S 0P 46S0 00 0Pu0 o#\H#0ʠ,ʠ 0C00S >0 0>000@< 0#03P03 Q03S/O-@M:#:S0>0>0 T*!p#600 0  6`P W  P$ ` 0 01Ѝ R* P R: R ! 0 $P  <R 0T :0 0000Q R:[JpH[ U  0T:U a[ ][U 0 (,0 D 0 P  DDaP 0S #Jp`|]O- 0LM\$  ,040LЍT  j&j R@ DN@@N@ 0C*,0"*R0 @< # 3 S:P03:RT0P0 008040  @QpP 0 0(0S 00 0<00800400 0 @00P@0vC-0$M@؄SP`p0 0Lp@07/p `+P ,0 `00000 p00j$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 0F$ЍO-$MPT0`@LpP$f R R C< i S X:<0SYPZ 0H00_ 0 ! 0L @0 ."    !P@@ 0 ATQQ@H   vlH#$0?/$+_@-X0S:0 0B00 (~JR0\ H#,_A-`Ppu@Pp@{PUPD0S T\J nP } Pt$:,_A-$aP0AS k0!>00000000 81Pn 6810`U 0CS* J뤀p0WjW000N@N@W\0hЍP< 0 eJ>/H#e,_/,_#\,_O- B 2p A`Pu LD PKU@@pIP@P%(0崁!S00@0D 00P@061A@0U0C@@@ r0 ᄠ0S 0HP@0   S0P  "  @5P 0>0000000x (0D0 , PPE4 뛥*@,_H#$B}0?/>/p@-`P@A.0`P @ p/0@$p@-PU@^Ip@x0@QX00 1Ġ  S0 Rp@?I -_H#,-_  @-0pt0ShMs@-P@ ` `"""&*C6z 00#  0+0 0Ѝp@A-@ PP` ""&*C6b U 0pC P(,`0x S 0: h S 0; 0o`P`%`]4]@-@`P0p0:0a0 p Ѝ0 /@-@i0:00M0 Ѝ/"&*C680S/ 0S/ 00CS0/@-@f`#@-@ P@ @-0@SG000`#0S/@-@ P@ 0⽉Pp@-0P0@*ᶉp@賉᱉@-0@ R0 @00@ A-@ P ""&*C60S7 0␉ P * 0; 00  0:0 08$0 00S) 0SA0S 0 00C0 \ 0 ; 0(0C 0 00 0S0SPU 0OP `V' 0S 0x0U 0  :0V081` 0 >>⣂R1 P A0S 0 `(0` 0p 0s1Q 9 0 6 &! R  010@ 0"61@ 0"601008 00000%`#$H#O-M 0pDP@Hز2 a 00'603S P0 PZZ@H OGZ  PQ d"($($( @0  S  G "0` "zᔈ 0(p @,0@00 + Ȉ  |40L PZ 0 P0 PM4 ЍP  04PZ:T  0(p,0 @@ ]0`E 0(p @,0@00 R * s P , g (R +H#l-_]4]G-Pp`ᔐVUGA0Ds 0 0 0 0Pu 0  0 0U`0 000@-@t0tM@@@0 @OLP @n @4P00S 3/@TЍ0>x>0/]O-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P Z7 0S 0 .0 0i0 6$0$pU04c$,Ѝ d0X 00L A0 _PEz$H#D0/-_-_@-PfM`0@c0 06S 0 0MЍ@#pp 0 P؅ 0S  p80 P Ѝ#\0/H#O-`0M  R0 Q @K Vp@P Y$[ TЍ PpᎭ PU@ p ( ,"&EPp@0T@ 10 R0PPn0 0200 0Z00S 2V0 @7TA  0 Q00S; 6V 0S 0 0 0. V  00 0;O T0 P  (,,Ơ 0 @ @  fYr @qg V$qV cl$#@-0 _ Ѝ#\O-DM `@fp PEVW0 0  V0 ܄*DЍpC-@P`؀ȄY$7p97P P0@@,p᱄D<@U@DOoPB@p,p܄T 0 >G@@/H#-_p@-P 0?A3c S 0 S<` , R0L <0`ODS0@ @@@?CD0pH#QP$#l$@-@P P0 `AX!h1@@400@D @ P PЍhMH#0  48 h0Q8 D 8 4P  BP 00 4000L 8 4 L T  T 0$000/း0  48 l0Q8 D 8 4P  BP 0400/ 48 $0Q8 L 8 4T  BT ꀸ@-04040@D 8 4 D P  P 00 00耸@-000CS LOXOLO`Op@-X`PP@ P `U@ 0J,0@U D@_Tpܸ踀 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzO-,M3CPHqT!LpD@!  patQ`1 0 A0 0S000%0l 囒x )#40 .#40 $,#4 00  圠`pS 00,"$,#4$00  3#S$0 0,Ġ̌030#"$\3#  *[ :pY<:^d:0H pP *pY+:^Z*\ `:U0Yp * X$ : ^:*\ >:05p^0#*\ 0!03 ^P0#PP 0900H < R80L0|0@H@H0,ЍO萀\ :0WP0 000hMP/ȸX/@-8@100(< R@@ 8L @ <00@dꀸP/O-$ R <@T 10`0 1P M< @0R!80L0@0< 40!S<018 L 0!4 @0 pW, 0 S(mP 0S I%P!0000 SWP0S 3 0$0 0$[ 0R0S  @0D0@0DlpXW @0 101}p耸P/H#/X/]>4]O-\MP P9A0a@0<|S8<00@0@0FD@`0XT0<`JZUCV= 0 hP < @0R8D@ 4 R8<  D40@ {pJW U   PPEZ ] 7R s(10(1~@ `D @ V8  @ `a\Ѝ耸H#@-@]00000000/000/0000//0M0 PЍ/00M0Ѝ/P0P00Q0T00/းp@-@ ~P0@PD00|`HP !L0 \  h  t P 2 p@ꀸpO@-@ 1"00 0/0TX0P/း@-@@~% 1( #4<@ X0S X @~ꀸH#A-`JPp A0S  0C0aA$x|~ A R 0PA 000j~000~~A- 0@R1$1$0@00P~P`ᔀ0 S  Q0p~P  0Rd1$A<p~000000f~3S X?@-p@ l\E `hA Tt= H9 <5 01 @,ꀸ._._#._+._3._;._C._/////// 01>.2h !0S000C0< 0S0 00 00000/$@-@P R00 O-\MP0 `S`S@#@2T@U U0!:3 U`0A0C 0000@0 0Y`V0#0#60 ((0, 0P0ÇʯU0S '(0, 0P0$@#v0#6(00#6C0#60c400,0P 0P00 ,0S $0S@i\Ѝ0K,0Px+(0Sq0Wm*"@?P@!@1#(0S`1`!@D @@0S80*PJW@1@!@D @P`10@0S 400C $ 00C 0@0D < B Q < R80CY 0D0@ @D0 Y A@0@000I00$0Y k0S pP0T00Pp#6$000c0000c(0|0I640 6,0P @x@X 0 ppppPC 08 0P0S0P0T0P0 @S00R0SL  00`g 60C04 0PD PEP PUP1UP10S> (00UP1X(0@0@0T@!T@!, 0DS0%#`F :0U*080  $ 80 R:0`F$0 S,00T: Y@PY@PP({|0FS@1$0  0l  0@R0T0 0P8 00000 R0T0 08 0i: @00@0P00S Vj0P p`T0S*[&*PP U P10S!1E pX*P Z PHEY p`W [P1 P!P1oE 0  pW PPP@`A I@TH#}._/v._ z{/08 Q/P @- :0@._/0@/@/0 \/у0P1@p@-@`PH1ƒQL"^!^D*Q p`V`F`P9 E@V P^@o#PpA@AQ`V`F` V P L@p@._p@-P@x2 Q*    0R p`VHt9`F`V @ LPp@._O-1M0SX9`Pp U@i70 @b7`7W00Ѝ-  Uڌ2Sᅢ \ J 2PW@` P @ KH#._@._-/_`/_0@-@X0S0/"R\:@\*QL0@0C?0@@- pP 02 0  Ѝ@p <0 P 0 D R 2 P///@$@-P@-PA@-P 0@@-P 0@@-P 0@@-P 0@02P 00 /@02/@02 /@@-@P02 @O-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 070 0000y)p@H#@-@PL0"D0S 03>4000,02Ѝ000$z/_/@/_0@-d@M 0R0`Sr]00 00@0P0@0  Ѝ@s@-P0@D0S 800Sx TlP: X8`A P<74`P@Ѝp$$]/_H#._/_/_0_@0O-M`  00P0ll500ЍpW8< 044Q0D0BS0S W7*7P .0P W`V70`F`@V @ DD0S@pp h @p 0p0C 0P 06# 08 P 00C 06]30_\0_$@0_._DH#O-,MP`@` V.P 0pP@00㜠N@T ,ЍX PPE%&$ $    01/媠 00P@0/@- #P00 QP@- P@? Q0 .S 0!  U06P`0!R0P`!R AQ:R 00P`0S6#P `0 S 8P`P`P `0 Ѝ U000S0QRA- p$@P`30vw6 00JЍp0 P/0S  4\Q 8< Q < < 8H  BH /802H# P00S/P 0 (Q, Q/820P  /?p@-0@` PU` S R   P00 `800h <0@8@@H00H0pQ 0 P0S  0082H#@-T0@T00  )0 @ST0@@2G-@0Q00P00CP0wູP'rP""R,40Xq0S)4QD140P !*owL00CL0$ T00CT048P5 `]w000P00P0w`0``FV`uG`pw, (D0H,P` ` %H#25L]0_? 0 G20@-P$0M 0 0 wxЍ0|QhO@-(0 0600hxЍ|QhO00@-  r,0 0000 0-%@P0 S 0l h VP$P6pP @0S % $0P000CSoOODODOODO0Oh%`P0S %h< 0$0T T0,0h0X 004#\,`P h@h@p0S@0P4 d4Vss`+PrxPr @ r%P 04p00`S 00 0$ `|rLP rH%@ zr$ 0$ 0P0 0 !h340XY Y% `0P ,30X !W%!A%`P 4r|nrH%@qp ?4; fj0S0F0YyN 00@2(2P0X,20 0 4C#"#04>0CYC 0[  I. .!(0>P|0S' P!0S!   p 0h!BP XXM0!h%`Pm0 0 @0S00D0(0,`(0q0000|0L L P P `KxqcP\q@0@q @@H#4?I52_1_2_1_T1_1_2_82_2 R2__2_O~]g2_(1 0S/O-qH0S@ `.PUq찟PU-q ЍO藙@T P 0! 4 ( 0q R `-8 <0R<00# H00CH0k8@ Ѝ?H#2_42E}_2_G-0H0SG0P SQ@ 00qpW R00S0 00@T p 0# 0 0S0Np` #R<00# 0800X<0@800 00 0T0 0T0 q(08@ qH#2@-T@L0S@ DpdX40 0P@T@@pH#?p@-@8`Pp@eR$00$0p@pꀽ#p/p@-`LPpz@( 0F 0 0C 0T00CT0p@pꀽH#001 7@-@HPt@ ,0 6@P Ѝ0##@-@aM }0PKp@  N@@ ,0D $\030#R0#02S tp `Ѝ. & R fp`*t 0 D`P Up 0 D"60 B+ 0 B"6C00S("06BS-XN, !004 0 #6:S"& :///R/>0 0 @-@oH0 0m@p &O-$MPH0TQ@`LpP0#0@ 00S 0S圗0S R0 0`P60 0 H00\XTPLp$ЍO%[rO-Mp8000 0 0RЍTd ` 04 ` BPP0PPP Q /+DD?C-`|M@Px Dqh0Sh             ($  ( 0 040 080(2<0}>@00   1DH0 0LP00 0TX0\0/S G0h``0d0@ !P 0000S l0`0G0`p`h0l0d`@ !P@p`@ |Ѝ`s@-@P`pBP Ѝp@sЍp@- L@:P 0S 1(S3 SP 3_O-0M3S P@P1S S  2S T$$P $Ѝ22$0 00$00 0$pP $F$ 0`00,080402S300l0`0V L0L00 06/PL0?Y00` 0` SE V!3P Q*I ?I`F`00A $0Sz "R'0&b00CS$ 9 0000 0$DP $pf00CP $f` "R"V`10 ` " 0VL000`8` `2$S0A0S,0 40s0n`n`4`800XpSD 00t`D00V P t`0t070S1   0 l0 0  ALp<040S07/D040 p 0 0'Z (? ~ 0, Rbc^pPS01 P([)D0<s0D0D P0a B 0 D0H0 0 4D0P-d 0HR:0R050B0005D00D00 p0 . Q 0 0A B40 00C Y (   0,`1!00 000L000H0 V 08 S00 02 02000p0h`|0l0$03/P$ 0@H0  0`0POA-PpU@` U RP  Q 0P ֿ R@T P t<]0O-x02 CMR@#2` 0R 00 00 0$]@P C  p2 S Oo; BA 6 Ѝ0S%P U"0P0 0$8P PEPPE0PPEw@ U @-P@`pP  0 00%PX0@0X0 ЍG-X0 P `Ѝ0@S `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ Pp  Z`    `{p 0咿00X $p0 $0X  0 0X=`PX0 X 0 <` X0V X  !X0`P 0X0 0\0j 00dX0"Up]W L ! <pP 53_P P P?7@//?@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 0 (03100 >0#60ЍЀA-`@V pp 00000 PP 00P?A- $0p0 $0 0@R`P:    U@` P 00 00$00?x @0D0@0D0S/p@-@P`0S000p P P?A-0S@Ѝ` -0) Pp!?@P0t 0000 q 0  0 0^@P 003/@@-$Ma01@00 0000 RPP0p  @W 0 00 .  00P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000P$P,ЍA-X0!P 0S00@0#,$04@ R1D@C(2Dp<@`C0B` R 0 00000D0Hs 0 0000 000H0@ 000 0 @@Ѝ?P$0 0!0 00 /Hzhzlz@-0`iM0 0 &EP 0 iߍ@P p0 tpPd  U00> !0(I@I0I8IedAO-Az 4M◻(b$sS0S b 3 D PDv202 000*0PP !Q0  ,)00 倲倢 0  pAT \XDP`<DP#~P\DP D0/S]0`00FD@-0` 0`Q s0!00  "0PU ` P0 T | 0 00PqP;0 0C4/,P000ƻ P0@P@ 8 8P<`YP#$ ,C00   P0T0P0S PvAT00hw ЍP4_Ӏ5^D3_ 3_Q3_k3_p]3_3_R_ h^^3_4_4_3_3_*4_@-<0DT 0 !0  !0@- ! 0 !@- @0S 0@b@I8Ip@-T0PO`d !0vUF Ϡd 0!mT@!p,/0@-0dM0@ 0 Q00 P00J  @`T#ʸ@Q   4/0 0 &#: 4/?&6 :  \ 4/dЍ0@D5TY^4_[^_[^^X@^TY^$X^&b^,/4_4_0O-P`p'DM,00> 0 00P(`$ pp0,0> 0> 0 00P(`$ p]'0 !d> ,0  00P(`$  pH 0 ,00!> 0 > 0>00P 0(`$ p2 0 ,00!=0= 00 0 00P(`$  0,!t t= 0 00P(`$ `0,0 ,= 0  00P(`$  p0,0< 0 00P(`$  pެ0,0< 0 00P(`$  pʬ0 ,00!D< 0 00P(`$  p嶬0,0< 00!;0<$ 0 00P(` p埬S0,0 0$!; 0; 00P 0(` 刬0 ,00!P; 0 00P(`$  pt0 ,00!ʟ: 0 0 0P(`$ ^0,0: 00!: 0: 0 00P(`$ pH0 ,00!`:0X: 0 00P(`$ 3 0,0: 0 00P(`$  p 0R!9 ,0 00P(`$  ` R`: 00,!t9 $0 04P0p(` pR, 0 00!90 $0 04P(` p۫R00$,0 0 00!8 0 04P(` pë%0,0p8 0 00P(`$  p寫&0+,00! 8 0 00P(`$  p囫(0,07 0 00P(`$  p凫)0,07 0 00P(`$  ps*0,0@7 0 00P(`$  p_+0,06 0 00P(`$  pK,0 ,00!6 0 00P(`$  p7-0,0;$0\6 00!H60@6 0 00P(` .0,06 00!6 0 00P(`$ p 10+,00!5 0 00P(`$  p20,0|5 00!l5 0 00P(`$ p30 ,00! 5 05 00P 0(`$ ̪60 ,00!4$ 04 00P 0(` 嵪70 ,00!4 0x4 0 00P(`$ p堪90(,00!44 0 00P(`$  p匪<0,0$3 0  00P(`$  px>0,03 0 00P(`$  pd?0 ,00!P3 0 00P(`$  pP0,03 0 00P(`$  p<@0 ,00!2 02 0 00P(`$ `'A0 ,00!l2 0d2 0 00P(`$ pB0,0<$2 0  00P(`$  pC0,01 0  00P(`$  pD0,01 0  00P(`$  p֩E0,0L@1 0  00P(`$  `GP4_:P4_@?5_ 5_9P5_pW|_R5_$5_25_:5_F5_5P5_GPZ5_c5_q5_L?EPw5_@IP_ƃ_5_5_5_5_5_5_5_5_5_5_5_Xw>P5_v6_6_]6_@P6_D 0 00P,(`$  p74 00!4 0 00P,(`$ #5 00!(5 0 00P,(`$  0!h5 0p5 0 00P,(`$ pDЍO- 10 P 00 000 0@?o2P0S  H0R0RS*00Ѝ"3xoX? NMb@-1P3@l `q0VN P0 ! 0p:01 00$00 $00$0PD$00$0T0(00,0 0S00@000H8p0900S  @/0VH00L0H0 H00P00T0< 000\X00`00d0`0h0$Ql Ѝ0 `ԧ 0 H0ͧ l Ѝ@]H]@BA-`MPp@q 0` 0 P 00 0000@U?o2P0Sq0PЍG-@Q0Mp000` @`^0 ` 00 0 0 `@(?o2P0S, 000 0000 P 0R ⹪<0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 cЍL?ɚ;6eA-M@P`pὪ(0`  0 000000X00ӟЍC-`0M@0 0p` P0 P 00 000 0P峟?o2P0S@0S@T0Y&K  5PR000d@PPqЍD?|>G-`RMAxp oP` ($1 0 1 010P 0@Hpq?o2P0S"ЍC-鄐|M@P`` pHC0X 00 000000E|ЍNs@-P`"00@0S 0 㑑ЍpIO-PM@`Ȱ0kU0s 0ȰĠp@ЍO薢X0UT@@ p(wXV2U`010# 0YC L R?0P PVV|pWV,V~Z[$bFrFV  P  ~ &cV| RV~# W!`JKq@hVXQ 0`FV`G: EVbpP(V  幠 ;?0~`rVV .VU010#`| 0YdVr~Z[ F FUV 4 P V|0S Y1`JK@| Ѝ0 M@ Ӏ@ӀO-PR`@$MB @plU0 RVY@D @$Ѝ Z X       㢯DV  (UZ0 H @p NO-t"00a,$@ @@ @Pw 0(00 00a,$@ @@ @Pf 0(0l0 00a,$@ @@ @PU4Ѝ7_)_7__^h^9_?_8_M_8__ 8_P ƒ #60 P *R  P 0 / 0CA-@0@`P 7P(0p, UP1p1:PUp0S S0 0!d 0 yP*0d0L0 0!d 0 dP:00 5l8_(8_@-L@P 0S  00P 00005A-Qz@p `PUpPz?00ST~z<0 80r/z>8_55lR8_X?i8_0000 z50@-M 0000P 0`(@PP8 P@P 0 @@0@ 0 @P Ѝ0S  @!y!I@P @0Dp?  @Sp!@@DpA@Pp y_0S 0000@P O0S 80p 0 0z>@P@z5p8_[P5O-䒟M0S@ X y0Su,0 a,0zXrQ08 0( tQ0(@8(0H> C'L(@H(!,QL H L 0P BRP =)Q -HP PH8( , <@H 0L pP Q H =)A -BLP H!HP 8! ($ ,!@0<Q}x|$Q[0* 100S% ,(XQ?0 00000000 00 @0X P Dq,0a0Iy ЍЏ 05@BX?T?Ӏz8_5O-MQ@L @pP `VTP%@ЍH0 0D00@00 01/PP P@ `p@-P,0@TpP @l@-@&@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00-@-P0S  Po` ЍX/\/RA-PR`@\p 0!SPPP@  d!rX@@-X^ :S\!@  s@-D0`P :@P`00Ѝp6@-@0X6 0 60 6@ @ R D0\ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W +P0S ` 0 D  P  X R # \!800@00H00L0 0T0000/03/A-pP `V@P  P~wP wV @000V 0 `@ 0S 0 00 P000 @  w6l0@-@PMFw0@0@ @@@0 7     t d T  D $4(Ѝ068_0?8_8_G#_8_8_9_9_19_P/D0 R\0 R\lp@-@`pPlv(@PT6wep0`0 00$P 00000@#w@6@-@Pv 0S 0 0S0   L00C0 w@8 0S 0S 00  6@-$ P P 1PЍ@-  Ѝ60@- 0 Ѝs@-@PzN``N0 0Ѝp7@-@ջPPлPP8P 0  Ѝ0@~ Ѝ06s@-h` FP0@0@PDPHPLPPPTPXP 0PPЍp67@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ6B6=6@-p@`M[1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  [Ѝ 6 6$6@- $Ѝ6@-0 0 0$Ѝ6@-0 00 0 0$0Ѝ6`` @0Q S  QS/S//PH 4/@-  @((bP @ tP@Ѝ6@-@ 7M00006p@-000@S0S00 /M0P0p0600CS0/0aM06@- MP06/@-p0M`0 P 000\@$0x0,` 0000(0 ` 00 000000QЍT?@6P?X?@-000S ,0 R@Ѝ@VЍ0M00Ѝ/@60G-aA8Mp 0pPU <1P1?0P0QS0S  R00RC20@%  0,00$0,1P0$1`|00 (`000 P PpP0,00$00(``00 000 `P PpИ8 ; |80S X~; P8ЍGz8ЍX?@6@BT?P?lH9_pPU9_\6_9_H6pPo9_y9_T0 / 0T0$0! R!/ R  /@6T0 / 0T0$0! BR!/ R  /@6P0/̶G-b0S  (|B 0x R x0t0SosP0 00SHPQ呟 K00S*T0  1SL t00CSt0ڑ,0 001 S P0T 0 P0T 0Ut0DH0L 0 H0L U 1ST0  $0L t00CSt0 GKt00CSt0 4S$3 2@h0l t0 h0l 4S32@ 0 0 0 `0d 0 `0d t`0d 0 `0d 0t00 0 0 X0\ 0 X0\ @6@-`@P@sAoV0SB0SD00CSD040D0p00CSp0(刵00000נ Ѝ@e@6A-l0p@P`ㆼ?P0 1#A$'@P@Q@ X?iA-@pT0 Q]P`K ᅂPp0 勂CKЍՀ]@0p@- AM@PJQp@0K #Հp@-P40 AM@JQ  p@KՀ /@-, 0#@0 ፂ@J]p@-4 0#P0 }@Jp]p@-@4 0#P0 j@Jp]p@-@4 0#P~0 W@Jp]G-@0 `0p0 0#`= CPPP `0 @pP ?L0 RS W* p^3  0S 0 0 0S 0 Up 0 X?G-@0 `0p0 0#`= PPP\ `U0 @pP ?0 RS W* p^3  0S 0 0 0S 0 Up 0 X?0S/0S/P/0PP/]/Pp@- P& p  1 0G1 0G1 0G0 0G0 0G0 0G0 0Gp@PG @PG @PG @dPG @HPG @,PG @PG @0PPP}P@$OO@,NNA-p@P0 MW  00 0 0 p`P 0W!T0``Dz/ 08   Ѝ0 0 0 ?_m^9_O-M` 0pQ(0@8I6I 0,06:/S *wL0  30S c,@а IV`@Y RI/Ṣ`Pe$0000S 0 C BID@I@9%Y. n BR)ꈁPPPPPPPāP#z?0J@`Z``0"10"J000(0> CJ " IIXI?@X> R;H4H`P @ 0 0=02  b@P1 úHH!FQ. 1  @P0S 0  cHTH@W ЍRꑺ0S @4 T@ 8P@0SD@T8j0 &L0  00S 00D000H000<0 8/0(000 00 $00#1 03/@Ӏ5@^b^9_d_^DDD 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-P@0`0@0Vp @0ppG0Ā崐@THG70S2 7 AP V @0 7<G@00@0GP 7Ӏр@@-@@00@0@{A-8a8q0Q:$$@1Qyps 0H!L1P!h1 T0S0 An1PP0T313FᰪA 0 0!4104 00000<4?9_<<9_</00S/<7@-PQ@@0 0S0 @zU h000\ 04@ 0 00R Ѝ0@0 000CꬆPP<@-P@$`G1UP 1CUW 3C7CU( X1 03/?@1U( P$10S&P" @000@000800<000 0D3$0P0 000@0 0PP00P:PdFЍppP QrP@0S RS 000<clc,4?<@0/@``@o/@ /@ @0@ @P/Q-//0 60 2/@-`|0@T L0S p]eF0!PF@P P$`0 Ѝ@Ӏp@-@Pn@PoU p@>F@-@ ]@_9_p@-@/R  &F011>101?1?11` P@V@@pp@-@HPF@080C@00S  0 GFp@E΀@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PEE @0 PUFtt`p0@00\PS 0  P@E403EEp<΀@?9_1_΀2p@-P@a"p@-@@Tp@-!2 A!R!!r`!U!,!P!,!001Sp!AA2S^ 20Q 0 SQ Q 1p0C0C00 Q2-  a>Q 0 "Rq0 o`/O-M AQ( <0@@|eЍO Q_(0pS<0(000 00?o 2?P0ISM0 $00I?oR20SC0I?or20S<YD`xW01x0#L0D4`P(000U  L0S:Z0S7 $0S`0$ S0D0@0 P 0@ ET`?D0Rm`P E `=,0D1 @4008040 0S`,DDDlP80[80m 0T0T@Th YT3$ 0Ra 0 S030#R0S 0H0D`0H0433X`x `⟼V`@d0X `X@\`) 0lVh0(0p000t040x00儀0X00X \`V 0$ 0唀 )0夀0(0SJ嬀0020 S030#R0S0 0000Cs  00 0zX00X \`ߓ )0X X00\`Փ(0SX 0\`X00ɓ"+0V0000000X00X \`嶓H00 00 0000|05D,3DL00 `@`,CV800Y00000C000$0Yx x@00S0`000HD< DH(0S 0 '" <0 Ѝ`lIӀ@ӀlO-3M3+XX`3@03?P0ЍV0@%T3 044004@PP 0Fd0C\CX3Xp`V L0S4Z0S1 }C0 0000` 0PCU?0kP C @= 0_C1P$00,0$0 0S CtQCkU)`, 0S,  0808@T  >C00S $ 0R uC0000?S0G0 jC hC&Ctk PA00S0000WCpG|TCp~d13W@ () $(0S1 0H0 0L00P00T00X0 0`0$0d0(0h0,0l000p040t080x0(0S<0|00< |◒ C@0 P0@p@0C00$00 Hₒ0 <}<0 PL00v0 TqPcP΀lIӀ@ӀlO-@HQJPH >@p>pT 0d3JPpvtӀ1MR  !Ѝ/1MR  !Ѝ/G-p@l3a PP    UI@-M@`Pp0P @" W#!!  0@@ @ 0  @S  0  @PЍO-%upWpMH@Pl3졓1 0 00S?9`s = 210030 10 .11 R`` =%+ Z- TaX 0\P0 03 BV Ѝ3 =0P x n= }-:_0Q`/wt@A-@PxM␀ Pp`x sdp` PN=T  IP  o,=xЍdIP 0 7oӀA-P`h0hp@0 0"+ - 0(00  03 b3Q-//-//-/-/-/-/-/$0 0!0 00 /Hzhzlz0M0 000  c P0 000 cP000Ѝ/0M00 P000Ѝ/ M0 00#0 $0  00#$0Ѝ/Qs@-`P@0S00000S! 0U@" H<0S@ Ѝp<0S 0S @΀lp@-XP`@ PD03 1pV T( P p#p΀π0 100S/I}΀̀p@-P@i<x5p@<΀@-000S ᲎ 0#  Ѝ̀@-@0S0 R000000S 0s0000S0St00ddWPX00SL3$A@250 0 0 Ѝl΀2:_B:_]7̀ππ7@-@P & h04t 0Q00l00p0000 Ѝ0̱Pp@-@P,  00 00 0X0$00(0tp@/P@-@ 厩@ J`@F7@-@`P>;0 0 00h1S\0\PZ_00 @00 0 $00@0 Ѝ0<_X:_]:_n:_@-QaAM0 0$0 0S$0 S*;01S< `10X00q01;W  ⋳0 y * c;!(0,0(0,劍 R   0R1!0CQS B0 00 VP t.S1! B0C 0l;0  4_{πxP΀X?πpPl΀5]7:_:_A-P~`P p吀H0L,A0 U P#H0LTp0    0S7;|03/0S:@l΀̀@-<0DT 0 !0  !p@-00P@00.pπ0@- ! 0 !A-p@xP `W0 S S R00S0C0CT0J$ h0l0h0lA΀l@-00@0π@-"0 @0 0$Ѝp@-PHM` P @ (aP Ph@Y:(  (  $   :HЍp΀0@-A4MP000S 5:\0S)  BR/* $ t΍00 000X!h0l0h0l810000S=0P=P4Ѝ0 Rn4Ѝ0@<: ,aR !080(,p01I"SR@ i@P l8΀lπA-M 0P`p` @ 0  00P 00 00@p?o2P0SP Ѝp@-$P7 @48p΀A-M 0P`p` @s 0  00P 00 00@:?o2P0SP ЍO-hM000PS` p8@T ((Q QNT #@m7p R@ @ R R rRP 7, ,  偋!TQ U P#Q`\ a\ 0000S4 Ѝ A@PQ Q 0S R#z/ `d@  P#P@ P  { zl7̀΀X?]8:_΀l:_A@-` P@000S00000SE` \ 70S 0S E`8C7Ѝp0 0 0S 0/΀lπ@-0@S S 06,0,h0/70h0΀]πx]| /@-@M`Ppi0V \ ᡐ( ݮ( @ٮ0h00l`pP0S 8wtJ`0S6 ,10S@0,ASK@65  |03/-0 ?o 2  ?Ѝπ̀΀π@-$@1!R:011΀Tb_Ѐp@-0@0S 00S0S   pX\6PP 1S 0<S   6t8p@Qr̀π΀π@-0 0 0 Ѝ@-  000wЍ@-@MP`pT0 \  0 U  ѣЍ0 T@-O Ѝ0@-@@ 85,0 ,00 01@26΀(PA-06PPPMb `,{7C0CPN 3 1C7CP7+?0 00000%@TG5V* 37V 7C0CV+E50N0!#4# 11 | p+h003/PP@GpP |,0 0P+X00X0+09 P+X0@00X0X0 R)0X008 0@@0@@0@0$$0 R 0R @TT0i ~ 0P+X0@C +P v+Q 0#$# AT S Q Q @ ? 11 0R!rVP|+0@K+X0@0X07300+ SZ @0X06300x0S(  m+h+ &+ PtoSW Z U0@,0@`S 0 0C 000|E+| +000h0 0S 0040*h P 5/P40)+U %+ #+ 0\00`0 PP3S0W L5310 0P3S5 H@Xp 3 C pPpӀ h٢0`0xP*00@015w  8@P@0!S&3S XHpP@st@ #T *@ 0S 03# @04/3 0C( P0@0p00h t0 p00*萍0h*f*0@hTX x" S 8j*8}*@  S 8[*Z*l Q   h T8F3 Sp*~X  X " X @  B@ ^*|00* 0S**X0 0Z!0X0@00C@00h0 0S[  0 @0 0X0N @ X ! 0@0#X00 @00C@0* )) 0S@08 * * 0#03 @04/@))0萍000 0[  T RI 'R 00'@ 8)) 3/  $!0X0@00C@0 !00 00X0 0 0@@@(8]@-,0 00000 00Ѝ]p@-P@Tp`OP w@G-`p3aMY)1 PUG)P G)p@-P@``>) 0@I @p@w)p@-@PP1) 09 0p@k)00/A-@P@pET|`)h0000h0W)@]00/0 S  0S o/p@-@PP(X0d`)P2)kX00X0F()p@%)0 @-@LMPP@U@-@X0 0dX0h$`03$!$H@G 9pP tP @88 0'4z88 0Ez88O-p`@嘰  HQ:/PDPWe \   0P ?P Ѝ0S 40A3/0`@00@`IO-dMZ@$ ` +㼚0T L0P $0(`T U`P8p$p* dЍ P`P$0p$p2 1 00ᐓ`P /ՁP0Sx@!_PPs!(oPPm00h( 0;0!PP^P1 00 0000 0 PPM0$ 0C0:P01T01 R ! ` !l  2/`PH0T S*P S:00S18 ,0 0Rn pP ptP tX ZxP Pi`Sn88G-M@` 8pYP+0P@@0/S WᨙЍ0 0 S?@# ,* bѲ0 C /  C1$@ `O00<`00 ` OV@ k`F ᰲ0W@C0`F`O-`4Md@qȔ 0L0 ?0-OX) 嚰P匙|4LP0 0/0 0,0p p00 000+P f㉏,0/pt0Q0*#P,00 0`PP_,0L v0P0oP000 PhP|P00(0L0 C5<0X0pPtPlPxP N >_PP X0H(``QdX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S l20` \(0,PPUd1, 0d1d1`l H(0000C01\1 $  BX! 0D 0TRk:D04Ѝ(PH! E'b$ N$ R!0 R $0&a$0P(P`10`1Q\`X00X0 P\`X00X0X0 0dX0A$!$L$ H P pP tP \oN<kNX0 0R0U0S  88z_=_ЀXRXRIhr00S/ P 3/>A-P0 `p00l 0 0010 (@0/P Ѝ 'P'0SP 0@00 0 0CS 0P`V pZPp P'0,P 00@0G-PM" @@M a0 @@9 evQ1 010;0 @00d!PpL(@T `X-W0AU2@P 000` S'Ѝ 00S S S 00@0P0p 01@ 01p@ 00P!0 R Ѐ8?x>88n=_=_n]^C-@PM> (0S; $ X7 `V6 e0Ԑp03/ @0^P00^P 00` 0 ሇ`P 003/Ѝ y D@0 (0p`003/x>>_rP/(0S/P/ R  00/G-Q @DL08( Q!P( U Mp PU PU ^Lp R(0  @` jpP  PU *\L(0P(@S0`(`(@0S   0 ЀnoG-PQ p]L@(`T `(耟VLR$t! 0S$@0S LPPp~$dLv"(@T 0Q S   0 T`@ЀӀn]A-@`PpU 0S A  0S SP@-@ib~Pd]_#hP lP 0m@iA-@5`K00Sʬ_#Ѝ0 0 0PPA0 0,0pp00 00 0P ,0/pt0Q0!*'рH?O-_#_1>_)QӀ@ӀЀO-`,MpQ #`>@Pw@T ,0〠X2 PF@PP  P< P` X !P P`~@#0SKIlxV 0oU> :$@`$  @PN V`0V):P `V 0H0 ` @P0 00# $ 00`00@PQ  $@0@,Ѝ 0S S +$0@P$$ `X  g}@?рQ|0S/@-@h3/0|0h0O-a0#6040080>0#60D0>0#6000<00@00x80S @OO-!0/1000L09L0b!5@ 0 0  p0Pep`W'dp_WL0<L0U0P . .`1Sp pP0  J0  J6p5W p,7q,7!0R  p!R;T0    [0 l 000[  [ 0H6p30pGor$ 3HqP n$$0 1 p0Y0#03W0S]$a!$$>WpW /zz NzDC DD0ĐN  I~`1H!<1d1D1l0 $p $07/pP[T!@X0A  81((0<1,0@100D140 pPGa l0 0,03/l00S 3/El0 0$J(0Sp Zn Yk 00Lp @07/(0 03/3 0000 ( 0 0凂pP(01J 0 03/@H0Sh;HX L#]H<k ]pP tP 0S ?#p"W  00 0003/p0xxr8Hd51S m "l0q 00S p0S0$@G$0p  $@G0tp0P \ 1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/@10S 'ZG0S,GZ%0"# " pQ RKP0. pl 000p@(p(p ,pJM"0 0Z000C0/mXk0 &-`(0S L<p<ЍWIӀЀ88=_z_Ԁ0@-_MP P@P0 _ߍ0@-(000000 0ЍQ@- $0000000ЍQO-dlQPKp.GP _0] 1FsUpah3Z`s 0 P2X _ov0]Q1~k50S  Q<ЍO ` 0R  *P V 0lZ0  B [ FtX __C0]‱1K|88 +0 0 =7Pu0 m6P0  0 (M[0 `0Y0A" !0# 0 AQP 0JP R! 00 0 qP [ P }000[P `0V3*0 P0S-Q.Q<.Q.Q.Q 0: U E`ӀЀP/L0S/p@-@Px ᬕ5@ ? H R  R002 P    0(0`0 0$(00,0(0000pC-,p`0P@Rxd1Q/Q1Q1QT1Qt1Q1Q1Q1Q`0S )P@ Z0S l0 S 0`0 Ѝ?`(0 Z0SM U 0000P0 ? R002   00`00t(000(00 0W PX (៩0 P?X (X0Ph ?=10S`10$0AP (`=p@-Pa|@T 0Sp 0P T  P06P0G 0S P0 P08P0a_A0C0  l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/5H-xvA0`SM X P0P:P00Sړ00P0 *   {JPb`0l 0000Z? 00C0 N 5 0 GN]C0 1111KJ0Z0W0S I81S 뒏"Dz 7$媃0$0W4Hj?` 180S 3/??5kT0  oCl[0 00[ 0 [ 01`0S! 0S0  0Vఙࠉ䠉 [  M d(0 0 0Y "(᧷*5 x `V 1S!! !1 0S   $3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Y`H0S l  RM0(0 >!t1S 'd R 01501 a 0Z0C000000Cl bV [Z0 0 BI\l\|  Yi <u& v +\1 P 0P^ 0S 0S5p@ 5 =5Jl0Q QM00pO `<C?;x0S `\5@>_ԀӀ}Ӏw>_@Ӏ_>_p@-a@PP0   DO-M00SP؀  X ڒ`\63q80S0r ZYY1 `x0  $ S,0O 0 0 0P,*pD P $0S,02 H0S5 `[,0Z R3 RW ,@/0SRP0O 1P00000C0X000_T-0S00S% `P (%@H0S PS0,0,@T V5  Y4M &P0 Z0S 0W 0 P0P0l0 `0 0ЍB ,@Z0S0S5@ 0000C0X ?005@000`PV``0,0 ,0p0WZ0S000VP0830NP0 Z0S000W 0 P0mP p0W 0  0`P cVa `5lP@ 0U 5 =5P@UH2PH0@S 0  0tK {j|p(<(X<((X<0S X (X (00020Z00S   00C0p0St t ' `%D% a P؁,[=(e?P ,D) LH rp>A|%0 S Q R0 400``0 o0ZQ"04P B+ 0 0` aӀ@ӀӀ5р0@-q@M QaT0P0` ,0 2TP X ≥Ѝ00@-P0dM 0 0@S0 0S0 Q  +?o 2Q0S X !dЍ00@-@P0 SMS0R  0 0 0000Q P Q P  ?o2Q0S Sߍ0p@-5lP@0U5Pp@0`P * P5<50 Spp@@-X0C50S[0  K 00S @*SIO-`$10|0L048<0L0 !80 !!L0?! 0  ?  0 0 ?002P DP  aD <0<0 !,0S;,0[0000[` P055 l`0<10x080C4P P0$(, 0P0=T0T0(k= ( Vfd 4R =0c?0h0d  0400h0$  0`00,00?. 40!! 140S  3/B10 0S [0[00[0x0Sp p0t (0x@tH05A ARX B0BSl|505 V@ V ipg~$j:mB0BS  R`0@1d0Sd d0h 0d@h02 R @0@w[ 1\D03/2022! X! ! ! X! !20C22S X 20S QP1211S T0  qp(Ji?p4P0) 0 0Z 00400 [`00005A ARX B0BS5(A0AS hJIx 04pZ0YB0BS  Rp@0S5D0DS Y Y %IL4IрH?ho89}>_M_>_>_#_1>_5HCQӀ@ӀI@-0  000Ѝ@-0  000Ѝ@-0  000Ѝ@- ! <  S 3     1S 1S 0 0000 Ѝp@-QC 1嘸@Dh@00@00 00 !!0400000, !  !^==P 0 V@0Fe=PB{=P3S _hMQ>_oA-`|p0PS d$ @P U `= p0S0@U@` =|o`PQp@-P`@0`S LɼT A=PUTpp@=0 3/|o`PQ@-@*=(=H9p@-PP@ #=0S   Upp@m= 0o@-0@0S R 2/|o 0o@-(@ P0S   |o$0 0S/ R0/0|o 0_oЀЀ zo 0OoH9H9 jH9o 0>L9oL9p@-X@P0`S @'8<@Tp@ <03/@|o`PQL9 0o_@-0@T0 3/@|oA-Pp `4 @P  p `Vn00 (R $@ @0@0|o>_o R 0$0 1 |oPA-@`!PP0q$0开0PU(0(0SAS 0 0 3/00PTp PDU(0 S 0 0 3/P|o ]>_?_^p@-`P㘷@  `  m0000p@-@P&@z0S   rG-@`X %0p013 0PUPU'1Y P 9/0SYP  0  10PSU0P&P PPA-Pp`@ ``p0S0@@PA-P`@p~0S 0S   A00 00SD0 3R W@ pAp@-@PP@Tp@-@ <@fP9R?_O-`0Sp,M@PTXHbP ` x` 000000 00P0 00<00 @@0`P 7b,ЍZ  勶$ \0 $$0w[?p`p  cU 0S $  0P 212 2<22@022 02{UY 00@qr@-0C0P $p!Qdj2  TLP1S  < ,$=[?_c?_P9T9?_0@-@H0018,@0S ЍP9T9p@-40CpP0[;P0U?Mpp@-@00S^P00#;#P0mTpp@,M-0 0/?_ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz00S/A-@`7ăPq3PX`00S P P P4 0,,( $ \̀?_8]?__z^<_0 0 0/@р\9O-`PC1(S 01O000O~㌐0I0SOa岀p;@n0S p0I0SOa岀a (O%|L@рG-餀PopWUpP@@ t@]!8R#8 @L A@ 0B072S S B! 0B0+@р0@o/@р 0P/,р0@- 0D0R@00,$00P v C-p0MP0 0`` @0 P 00 000 0@Y?o2P0S  R Ѝ脽@-@08M@@d0 00@ 00@@0@8*v*0|0 0000,00 (00!P0 0H0$@ @000'> @00n]8ЍрH_Qd_Q?_р_Q?_@-p p@p@0@@SC 1X01t@ Ht@@ <<80,@ рopрR?_(q@_prA- 0b@SPpb1~b0@X4100S C0 !!04L0H0@000, !  !Hzhzlz@-@Q't T 03100|P0BPЍvx 00SP 00S t T0 #!R`0SӀ@-P 00Sp@-P@PpTUp7@-P@}00 Ѝ07@-P@}00 Ѝ0@k7@-@00PP 000U [ Ѝ000/0@-P0M0@ 000TЍ0C0 0 @=P 0 P QRp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@yR?0S P00 0000@-@ 0  R0Q@R  R 0CSfQlfQfQfQXfQXfQfQfQ0S@$d0  6p R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3S|@Xp@-PP@W j PpP0 b  BRDhQgQhQ0hQDhQgQgQgQ8P08P0P0 Q8P0>Pp@-@`Q6 P08P0Z0S P0S 0 000C0 p@]Q41041/41!0CS41/p@-@Q p@Dp@-01Q@101`41Sp PP/@P/|0S/@-P1SO-餓MsQ[0`J`V  00 0C0`>8AT>@ 0`` 081S.8AZ/ Nh`0 !0L @0;/2 00  00q`P XPЍz8APU 0R `0SNPXPܡ  2/0@ ! * 0 0p`P X̱  2/ `0*j`P { 0*]rXᵱ 0000@ :0<`0D0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10<2020 20C22S) O&#x>#1[  00/p@-@8aP 0PE 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A-,2Q@Up` 0S %v20{0u1 00$_V;0 0 `!`0  0 0 0 004 00 0(0001S ! !! 1 00C000C00100C0 p]  P g P-;0S :Zrp0S YP 00$P 㹰Iq\W,0 UЍGrӀрO-PM`pDT 3RU e@u,0 \ *00 0 0P 0P wu6 #@T  ᠰ5/L h Q4p 3 2 @,@ l p PWp t x | " ဲ"/ⰰ0S00P0 010S  L0P0<P0w8p pZ20H0S@1 1[X@00#}[ ̻@p50100qcτ00P0P Q469390P0 0 ! !01P00 1!1111|0SG/1 !0|@ 10000000S 0P 00=P 00S t |2 x p@0@@SC 1\0100e 1<0SЍ3/rрR?_@_] Ӏрр A-0p3a 8Q@T0S 00(#p y081 0*pXm@x>03hl2/@-@1 0S@_A-Q 2@s 0  BR 800 1@0S 3/ᖧDYo 5P0PS P0   1hS!!1 !   P01 P  !V> @P0#f0$ 0P+t00C00S   zyWM0 _ fLX(1S,1S |`V ;e:La嵔Ӏ@_ @_G-@QdqMP00`P  衔2 ~P03P0(f ᶼF7S  r>PY j@ ᙴ 00C0 F 0 L $  0 000P00P0Ѝ O-`pA000,P0   P   W| Ps 01P90\+ W !W V$ 0QU  0OW(!0 R (R3 \!Q, QB V:  R \S; Y.  ϿPW P (1 S0(100C00,1 R0,1(10X 0C010Zu \  0R P剿PPu PPA- Pp`3@2::P@1@!<`J`PP   R0@D@P0Q @@p@-@P0p@S@p``FSPP  ᗖ@  B PR / t0Q   0RL     / Q `r`9p@-P00@Tp0 %P @`rp@- P0Sp8 P`@>0 QV 5 Pp!!0p@-P@)@0$P0p`9@-@000P @@`9C-MP00`0p0 0` @ 0 P 00 000 0@Q?o2P0S R0 Ѝ7@-D 0PP0PP0@EU Ѝ05G&@_0/`9-@-,00 ЍЍ/6@_*\^O-P`С,M @TpPP VPp xP @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #b0S 0 PP 0x P Q0 000!R00! 0V0C0@`rN@_`9@_@_O-0p@!T?Tr *P `1 !R  !1 `Vp〱Y `10 V$PQ0T0< `  Q      YG@10Q@Dp0 弓P* `0   `P 0 0 Y0V `P `T@Ἣ Ѝ`L]`r`9`]@_7@-P p 0@P X Ѝ0Q000 $!@ !A_2A_cA_A_-@-<00S 0,0 ЍЍ/рA_*\^G-`2Q " @PpX  p$0S00SpQp @W 003/pP  X 03/p80S 8V$0S I0 0C0!R 00! 0S% P $`X!P  Y0000000@0@@000000!00C0A_A_B_3B_IB_dB_`9B_`rB_G-4Q4q `#,@T /W 垼@$0S- 0* |<0P000@03/ P R00S $ 70S (0, 0 :Y"P<000 @ 0"  `9`rH#9X?рB_B_0 /$/@-@RP` Ѝp@C\0 0 00 0P Ѝp@-Q`M IP0 ( 000@P @P Ѝ藹Xp PU@ 0  !@P0P S  !  00C0`r`9O-DMB,0RbS20,0ѻ 0"0@ 0 R"0 0 0000|"l tt圷pBT:0(00p<`@PD"0  < 0A (0p,`$  9t99 $C_0}QG#__VC_9рI_]C_?^3_tr QoC_t]@- @0 400`$0 P gЍh]xC_Q]C_@-铸$0 0S@螸   0`r@0P`P/'@-P`0 H 000㽷@Pp@|Ѝp@-@e000@q@-@]00C0@iG-`PAqT:pW @P P  0 ePP  + 0S  ŐPP0 幐Ph p)PP A 80p0@@@ꘞ_4_L]`rC_C_C_D_0   /`9p@-(@ P40$00@p@l`9X?O-M00p00h04 Q⨐ @ 8 00(0<8 T@7   eP @00S 00 0Ѝ0 NP0 S  ! 0000@00`  rPK PB@TP 6YZ  0P0 0@Pu 0 P0 0(00$P0 5/PP  D 00 0P00@00lPP  N 倨Y 0BS  50S0cS ڼ5 90KP 30S Q *PZ PÏP  P$0S0 PPP$ 0  YPPPU$P'0S P$Y `#^  1PPe  `(P k0(0!R00! ,4 \T 0 vP 0 PP@]@0S E @bP 0P00 @PPP 0 @ [!$ 0S ,S0PU,UPP J R 8(0[S PP 圄< Pᨗ  GP ᜗P᜗$0rS @  `0, ⟧P $0S)( Q03/P( P-U .  0I80S 8R$0S &`P,8PP[ 03/ `0, kP`P,PP[ $Ꟗ0(0 PP$ h03/P!R00! T0Y@S㤀 0S \U00(00,00 0 0 0+`V6 03/`PP" 0 P#`riD_;E__D_UD_D_D_D_E_[E_Uo'A|E_E_E_E_"F_F_G_GF_F_F_mF_G_`97G_MG_&@_xG_G_D_@-pM0Pp0徵Da @T U 0S @T%@0S U  R 0S"000 !R00! 0p0@@@  P00@   Q     0000S~Ѝ`rA-P`pd@P  dd@kЍ @@@@ 0㙴@P@0 V@_D_D_@-P1M`3A:z?0` c00S /᠌P U@5Ѝ@ᓌP.ᎌ@Pp㲲 @@ 0Y@P L90 @ ,G_рH_!H_AH_dH_ 0 0`90\`9 0 0`90 0`9p@-`P㒥` P@Ӵ00@0  @@0000PUִp6/0`9`rp@-@ẴL0PU  R8 00 忴p@g 03/P`r`9@-@:0 R00Ҁp@-@@`P00 D -p@GҀs@-@`W0P000@ <qЍp 6Ҁ@-$@ ƶ ҀH_O-M 0Y0`0p XP)/‹P$ 0 $Vr 0  vP@ P 0 `Ѝ0$0 @/ᘋP@t3t#``)HE 0  I@P ɤ,3X0$0Y@X@  㶤p+[ᄊP`'@ 倌P 吊OsPឤ  @ 0 ᓤ`2V㌤ <(uZ` (00,0  ```婫@P sn T~(0f@P*0!R00`@" U1, 3 01(00 0000 0a0@P`,0S$ @ 8`(x( 0 r*TX P P P̓@} `P @$ 0Y0R0S`ḓYD^H_^H_9H_^H_H_H_I_I_&I_0  ?r؞Q9II_$0 0!0 00 /Hzhzlz-  0  /^I_/20C22S/JB@- $0 C0 ЍrI_']@-<0DT 0 !0  !p@-P @4xU00p00000P0p-0000/G-`@#202P̠ X4 CX$S\U  PLmU P0 Sd pt:mU d 0 dGy]@-0  \X40SX4 0 !H0  !Ѝp|0@`V  m00\dPPPm00Ѝp@dd `l 000 Ѝp@d̀P/0 00@o//@-D@ @X4 CX$S\#@loA-P`@p@0 80000]ȣZA-P`@pl@P 0 $0000]ȣZ⮔@-@lⳔPl(@ㅢ/ 0  0 x0S0 0l0 h0S0 0\0}?r0}?}r00<0 R / /9@Bx 0/9 0 w9@-0000(0( (0$10c004Ѝh]QI_9G-P 0$` T@`FH0 00 pMY <804 0R 0s00 000000  B 00C$0䬴XG^O-4M$0h4, 3\`1`p@00S 8XX06000 P ! ` h$00味 $\0P0D0V ^0 ^p 000S00(000 0S0@f0僡000S00 :@T 0R@0T nV@[@000 0TP(0$0,00H000000070|2 00 4;80 0$< Sg0;;00S8#$0000\03/$0" 000 0 (00L0P  0PH 00 00L0 000SY  0S0 0S  00S 00TT ^X 0;V 0`5000700 0廳4Ѝ ˲m0S1೛0 00 00,03/0 0C00 000  000  0C0?0@ 売rQI_GQ$0S8$0/$0 0!0 00 /Hzhzlz@-M xP@x`xpT  xU \ЍvP UP w@^I_*\^G-`plllPB<@0S 0SUЍ˅0 \  徹9I_I_QwQ 0O-p`PDM!2 (P0P<00p,`$  @<]I 0!1PQ0<0 ,p(`$  II 0 0 0'!p1< 0  0,p(`$ 3I0 0 0!$1< 0  0,p(`$ I 0!0< P 0 0,p(`$ I 0 0 0!0< 0  0,p(`$ H 0!X0P 0 0,p(`$ P < HDЍJ_^9ٝ^L_J__J_p@-PT0@Tp@@ 0R0P 0S 03/@r: 1S/00`9X?@-<0DT 0 !0  !s@-@P0@`Q Q10S8 ׄ0 R    ʸ,T Q S`0 S#0@0S 0 Rt    X00S  0S800 00坸@Ѝp R9)J_I_J_XJ_0@- !r 0 !p@-u@P3 p@0303/P 媻t03/J_p@-fu@dP03/pp@-Tu@R @0Q  !1PST_p@ 9;s@-@P@`0S S 0SQTP00S 0@ \($@00Ѝp9I_J_p@-0P.@@Pp0(.Pp0 p@J_^__@-PM iv`@pT hvЍsP PP Ѓҹt@P ˹` u@K_^*\^K_00S/A-P庹u@`p刀T᫃᭹sP` sP᡹,u@tP \K_(;2K_WK_OK_FK_p@-4`@0PSyPp p@fr@-00P Ѝ neP r@-@ss@-@tUt@sp@-`00@0PS 0 v0P0p]`K_A-pa@0PS @T:IsPPsP p0.DP Ps0S "0.1P 0 *P 0S  tP 0Sd sP 0S4sP9hK_J_K_^__{K_K_K_A-M`PPPЍ%P00S 00SŶ5RPĸ ;u@p刀T :ux常ƂP ᬂ᮸]P᧸ t@\\K_o _F}_K_^K_7\^@-Pp0`Ap00<@00S V Ѝ 6P0@-MP tP@! tT 0S S S P  P  r(Ѝ00S KtrP A-l@0pS >P8GrPPr`P !.GP Pr0S .5P /PP0S rP 0Sd$rP 0S4sP9K_J_7L_^__L_L_%L_@-M`PPPЍط Ot@pT OtͷU ׁPفP ềP ᵁ᷷h@P0尷P꾁P s@HL_^7\^K_p@-`0 MP0tP@@ ᐁU s @PtT 3 Ѝp0000/7@-@PᆁP 00kP Ѝ0 Pp@-M`P sP@@ RV Ks<@P sЍpp@-M`P sP@@ 3V ,sP@ sЍpP7@-@P 0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0(r ЍhQQp@-`@P'P 0S Tt ܀ `մp XP@0SpT  ǀ 9ZL_fL_L_,0 0S @-岴@9L_A-Pp`@z00$0p ` P@ r0@-l@P0^P UPU  PU0^00 0@Rr7@-4Pq@P $000 q Ѝ0QQ@-` 6@etPp1S`00a[1S0@<0 AA0,000 {q Ѝ9X?:Q@-0@`P 00 0@0@ަΫ|ޫ0t tt@`P0P``X XX0@P H@Z 80Ѝp@O[L_:tQL_H;L_QL_L;L_;Q@-`0@0 0@0 0000 0@00C@0Ӏ@Ҁ|P/0D  \0\0P/|] t000 S \/0`0 S/Q/PQ//Ӏ@-PZ00C0 -@- oFO-XbM L"0H@0S 0\* Q00S  0 0Ѝ 0@PgP@  ;p0U  2 0倐 00000P0 0^ 00    0# 0 0 00000U00 @PE B P‐cpc0@@DT00@@00@d @0\0ڶP P P@~@ҀrӀӀ0uP; g;G-MP 0`` @pĂ 0P 0  00 0 0 p@>?o2P0S 0000 0&P0S0 0Ѝ@-p0 0  ^8 0@0000@00C@0Ӏ@Ҁ@-@TZ0S[00[0''d@ p@-81M@T-  DQ I 0  P@@  `  t!00P 5 땷0 x0@Q 0l0300@ @@ DDЍp@葦]ӀP;Ӏ0u@Ҁr$M_0?QHM_Q8_0O- a 000p(P$@ @A0찟,00 000p(P$@ @ @PA/0,00 000p(P$@ @ @PA00,0`0 0X0000p(P$@ @ @PA<Ѝ@u4QOM_\;tQM_^M_QdM_000/00CS0 HKp@-@$P,DU ၘTpp@({Ӏ A-0 0 2#@T 0PSpW Ax$`p0S RpP$ 0RA~@TAIӀӀ}@-M`p[@P00%b 0 0  00@00T0S@1 0 0S b@Ѝ] 0S 1S Ӏ@-@P0`0a 0 0  0 0 @00T0S@e 0Su@Ѝp1S1S Ӏp@-P`d  0 0@0T 0R0S 0S @P4Pp@QG 0SӀӀ @>D 0  !"P/ R0S//ӀQp@-@ @PXTd0P1@0P !0@@T@IpӀp@-P(@p`:pӀp@-`P^a\ T `@00  RAP @ppӀӀ `0S  0  /Ӏ 0 P;p@-@Td0QDSh h h0d 010Sp@p@}ӀA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR O-S0@` (`ܖp0Y,#0 0+Z  R` R8 LP P`Q l TV7Q R pP Z RL  \d PW ᠖ ЍQ@ZSP0QS  Rz Pv QV >P(|oYQcVZ U Z RY Z&PU V000 ` @ $   1 00001Z [00[0`0`p `p  d Rhhh d!QPP Rdd h@hu PVu $V (PpPIӀӀ}@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0Ӏp@-L0@3P1S P0 00SڜP000ppp@-P0PSA,00S 7aPpp@XwG-0PPpa|@P @T P03P0ATAU [YL0<L0FWᔣTG菣 0 P;0(P;0@;P;s@-xR   @ 8 | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/Z  0 R0d1`0S00#0H1``0S/00 /0 f/6& *P 1:f@ 0Vi0`0/0? ?,0l`00000@垱t0*|`P4  IЍp@Yr#_1>_oP;0@勳P;@-H0 '0@Z07 pY@P; 0 @哳P;0 @姳P;s@-@P_`\VX`YVW`XV 00N \P0SЍpBp@-P: R@*B B00CSQQ8QQ0Q0Q0Q0Q0Q0Q0Q0Q0QQtQ B # p`V@Tpd02S SL0 <000CPPprH?p@-L0@P P`Pp@H+ p@0x 03/@pÀO-TM@  0 000N  PwT T r(, $Zp`H f0 02/P0pUV @ *  0  :0#::c4 <@@00D@8Pv 0?@P ?0 QF S  QR03@0B  x0p00p0P >p00p0>p00p0[>p00p0T>p00p0`0t0<1x0JEJE@Co(0B(-R #办- . A. 001Vq1`00` Fd`y>1 1mRL{ qVH{00 0 Z &h!Z|2x1[k1"04P B+ 000 0zG 1 ~G0/h2p0l"/`2 Z0Sz pCSWppp'pr00 $! ! ! ! r"&" 0r &0B28V0V/p2t"0 0p0`00` d` > 0,h1P=p00p0T0000 0S00@00ip0j10S  b G0V100`00` d`=00  % |0 S)W 0@DHLPTX0\ (!@0@J0@0,!D00D00!H00H04!L00 L0z PNz10S7 $0 |01f0010 0Sh00h0100Sh00h01F1 0=[0 100S R  V 0X00\0`00` Xd`r=Z 0BRS000#0s-( (!!( 0!!0 *00X 080`00101 01(01("z` @"D !HL  $ (,8"04<(X0h\ l00  ` p  R00=9B =C00P20T2Ѝ0`` d`< 0` `00d`<$0` (`00d`<(0` 0`00d`<,0` 8`00d`<00` @`00d`<40` H`00d`<1` P0d``00< 0%(0` ``00d`<q qqqqqqq  ppppppppp1p00]] ](]<]H]@B@-`P@v1S0 PЍpwP`L0 00000 00㴞PP v 0ӀO-Q4MX@dp|4ЍOs8QT@@Z`PF J[o@QZ6 @PG >0 0O0$@ 0[;00 V@ T VJ 0 Z 01m1@P0Z@@y 0}Ἇ6  l@P DATy j@64ЍwuV 0X01 <1@P0X@@y M6l P% [00 @@0 0 P@ 3 VJ0700Z0 CSRL0 @꒟ gP@0J0 2@P Z$0,0 0000@0 00 0p`5@Ӏ$QC-M p @P0S !PU  A` 0 *s@P`P  Ѝ@@-@0 000 0@0㌝oЍO-LM00|0 P<00<@3ppU#`v <0 p|000xtpLЍO:70 00S 0S# SV000$0`0S0000$00S 0U `V U00=0 V$`U@ 00?05 㗎P 㒎1L0:p@ 0@A400(0080T(0Ss |:ATo 0(0L0SZ0S 0 000<0@ 0P ! @VPhQQQ Q0QQQQ Q` PP110$[0y0S 10 R 0S(0S5 0S0p0p@,0$0Z,0 0S0R0S$  0SX ! 0 000 b00 b bX 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@bH0XH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0 d0d0h0h0l0l0p0p0t0t0x0x0|0|0000X0000000000000 0000000X0000000 00000--....////1X1 1111 1 111111111 1 1$1$1JυJ?X$ 8181<1<1@1@1D1D1 RRwv1 1ovX 11222/X22!2? !. (2(2,2,20, t0Z 014 <.L[ ,0SDS 10 Ry ?R Q Y 3( P(00 '9 a0 90  90 90 90  90$ $90( (80, ,800 0804 4808 880d d80l l80p p80x x80| |80 80 80 80 80 80 80A/A80B/B80C/C80.80E/@8@0F/F1080G/G80.80N/N8<1Q/Q<1@1@10w80/q82@0@ 0 Di80e8(2/(20^80, U00C040 040$0 0C$080 080,0S @T00 V0S  400C0 08 S * @800 U=0 2 LЍ0S   @ҀӀ1`00/1`<10/1<10/p@-@$PaE100pӀp@-PP`@7V11 P@ 10$00@gpӀp@-PL`@V11 P@ 100@OpӀ@-@[p@-P@SRp@-@K@-@Hp@-P@@?p@-@8p@-@`P` PpR0p@xpp@-@Q0` R`00p R0Q`R D/O-MP`8Sp^u@;vux lM  Puv\P Qu ՖP іOO널IȖiO O̖x ˖vc _  ᴖP @ ᰖP  0 cP[  ЍᗖPvxᏖP ᇖUv ზPx  xP  tPkPx|uvr cPn Ԙuxc c  OPf   KP_u @Pv O-MP`8単pu@'vex :  &PuvL"P ዘu  x vg c  P @ P  0 尘P^ i ЍPvxP O3וUIv ӕPx  ȕP  ĕPổPxuv ᳕P~ ux᳕ s  ៕Pv   ᛕPou ᐕPv o@- 0  x Ѝ"0@-00 n Ѝ@-0t`qf@ucP^$0P 000S Ѝ7@- 0   Ѝ"0@-00  Ѝ@-0t`q=@u:P5$0P 000 Ѝ71L0#400/s@-@`r00 0PO@PЍp@ЗGЍp@-@PT@#D`qM1  0r ЍӀ0A-a(M 000` 0P᠗@P p0 @P ?T@(Ѝ{1P0 ` $0R  aP 0p0z/`00 Ӣ0 00A>ӀnM_(0310S/00S/㔷<@-d03" " R @" B"2S @'@T*P p@-P@Tp 㠈000000@p@-\03Q0S m @T 00@ ㅈT?pG-@`PT1 TG TGUE h1*FRA:0CU= ep81P3  1 0SP|% P$ V* W%003A } @T@ 0V00CS  @G@@ #@00E @(vA- P@`N70 0S\Z0S=Ɍ ͌pWX 0 S RQ   ЍS@-M p@`P 70 0S ^0S PQ S 00U0Us00Ѝ@-pP`#֤@P∀ 0 |0| 0 00 h0 R\0Q WK|0 M$3SH^̀5̀\K0@-M 0000 0@ 0P     WP ЍBA-@ `$P B  p2P/UV#3#P"U V VX031S ( ,02 0P03#P qp@-`Q3 OoBBP @H]PP0@p OoBBӀ@-QM`@ؒP0T  R 0@ 00 0@`兕PP PᾒP ἒp幒W ᳒p岒WP ЍMO-QM@p帰Q @PH0P @@0P 0M@P:00CS@5 aL0` 000 0o0 00P 00 0 0 p}+0@?o2P0S` 00 0@P 0SP000P0<J Ѝ\]O-QM⨠崀:p0PS5` 8@P0 @@0 0@P⒟ % Ѝ 0` [o0"00  P 0 0 #+?oZ20S@ @@O- DMPP嶓 0!@/ Pq B,$o 0   0,p(P$  .0 000@!. 0 .  4,p(P$ @.+0$ !00/>t.  l.00 0 4,p(P . 0!0. 0   40@,p(P$  . 0!- 0 4  80@,p(P$  . 0!/>͟ 84 0 0<0@,p(P$ . 0!/>4, D40  0<8@0@,p(P$ u. 0 !, 0   84@0@,p(P$  _. 0!/>x̟x 80  0<4@0@,p(P$ H. 0!/>$ D0  0<8@4@0@,p(P$ 1.0 400 !+ 0   80@,p(P$  .0 400!/>\˟\ 80  0<0@,p(P$ .0 400!/> D0  0<8@0@,p(P$ - 0 !* 0 4  80@,p(P$  - 0!/>LʟL 840  0<0@,p(P$ - 0!/> D40  0<8@0@,p(P$ - 04 !) 0   80@,p(P$  - 0!/>4ɟ4 840  0<0@,p(P$ w- 0!/> D40  0<8@0@,p(P$ _- 04  !( 0   80@,p(P$  H- 04 !/>ȟ 80  0<0@,p(P$ 0- 04 !/> D0  0<8@0@,p(P$ - 04  !t' 0   80@,p(P$  - 04 !/>Ɵ 80  0<0@,p(P$ , 04 !/> D0  0<8@0@,p(P$ , 04  !\& 0   80@,p(P$  , 04 !/>ş 80  0<0@,p(P$ , 04 !/>| D0  0<8@0@,p(P$ , 04  !D% 0   80@,p(P$  s, 04 !/>ğ 80  0<0@,p(P$ [, 04 !/>h` D0  0<8@0@,p(P$ C, 0 !4$ 0   84P0@,p(P$  -, 0!/>ß 80  0<4P0@,p(P$ , 0!/>\T D0  0<8@4P0@,p(P$ + 04  ! # 0   80@,p(P$  + 04 !/>Ÿ 80  0<0@,p(P$ + 04 !/><4 D0  0<8@0@,p(P$ + 04  !" 0   80@,p(P$  +8 40/xx! 0  <0@,p(P$ + 0,$4F! 0 <8@0@,p(P$ s+ 0!/> 00  0  4,p(P$  @\+ 00/! 0   4,p(P$  @G+ R8_M_HlRM_:R5_M_M_M_8RM_M_M_M_M_N_M_4_M_N_N_?_RN_#N_,N_0! 0 0  4,p(P$  @+DЍA-AP,p`0S S% S=V W@TAV NP )@0S)T @D@!d0T@Vƍ`)@\0PU L0S f幍P1T@PӀ@ӀA-`Qp@N0S S0 STT PUQ > @w,uT P= PU@.$ @]T"dPTi0PU L0S ]0P CP r@:T ,5X0@,@Ӏ@Ӏ@-` V@Q,  hj Ѝp@-@P80< 00 #3  0 0 0 004 00  23 48<0@S- 0KHL 0 P030 0 0S 0 @0 D R0 0``#`0  00000 0 Ѝp@yO-`ᑿ0|0@0C0000   0 S po0?C-@`Pᰐ1qS21 0! 28. h R R R ' 宗KX0@00P0#*1S0Ap@0 0@00002S000000SP ЍCD000@tN_@<@-@e0( R (   B "R    B \!R A 4. R Ѝ!R b /o" Q AG-0@Sp00SW GSP0` 00Q2@F` T`W p ,W 3U  G`lP 0S<@vp@-@P p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0Bp@-TPC{%0C0\0(@T@ 0S 0ACCjXp@- 0!0@@0  /N_0/000S/@- 0 00| Ѝ\I_bDvl]00/00//O-H`Q@S 0p0202  㓘X0WE3" B"2S1 ЍOp `00S<<0 jX <0 40<V 00S 0 Ѝ|]G-0P@s ppE EY BUPY<`P WVV `XD 0G<D0 XD0 QA-Ppp `D0@c`  TD@A-PD`@ @V`<pX0# ߗ@ < S" ԗV@0 A<;p@-P @H0c   㽗0S@Dp0 S pP/0# S/P/ 00@o/P/P/ /p@-@Pz@0000p]Ӆp@-@Pz@P 0000p]ӅDl@-@4DIlP/D@z/O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @O-1p {P{W%ȀN@ \[`R03/@ Ѝ @PR  03/@ 0 @/00/0@-003/ ЍC-0`M00p@PUЍ 0R P 0` b0 P 00 000 0@?o2P0SH00S 0 00,,嵒03/P 哔HPv]N_N_@-勔 O_@-P P d``嚒PTL啒 Ѝ (,勒冒H!O_]2O_DO_@-ez]UO_@-@ xxqt4Qڀ  !P H@, ! U]oO_HzhzlzO_A-@M0s' p`P@T#0@400000 ,00(00!0$@ @ @00 000'>0<0!@P h@@Ѝ`P p@<0W(0 00PSPPvH$LRHA- @M,L(1 000p<`@P0<0A0,p(`$  !0P  @Ѝ<     '.A 0 ,p(`$00 0! P P\đPT@<`PppP  帑PU@HO_]O_PvO_O_XvP_s@-`P 0@T4T0@T  S  0D 0 0 "P $Ѝp HHPv]LP_h0#(1< /@ ρP PQ00@0!!#/ 0S(0, 0 (0, (0, 0/ B@- @ 凄P 0S,031!10Pp@-P`|@Tpg 0SP0 `00C0qA@- Lp@-Q@Z0S P0S00C0D0 0U<0 Np@T \/ Ip@-@dP@F,p@zp@-@803Q 0dP 0 0/Fjpp@-@00C"0!300 P p !A\  Q` `000PUR0(00@@@#p$0P @- /I0S co `/P0`o@`/0@-@0M 000@0@@@!0xP 0l00@0@ @@xDPO7 07 ((Ѝ0@跄SR-Q_Ԁ5Q_ӀdjRRR8_p@-4` Q[ ipT0咋@  0P8+``Ԁp@-@[@iPp@u0p@ 國Ԁp@-4`8SpP0P a@  Y+_084@p@Ԁ0O-4`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@Ӏ$]p@-@T 0 R X0 ӊPP T x `_0000@pt J0Ԁ0 0S/0 ԀG-PPp@U3P @T( 0`S 0V00 U00 t  _V  0W` S `0W P x J0p0p@-@0PQp R00  ㋊Ԁ@-@P`P" RS . 0 000 00 000 00 0 VPP  E2 1"  yP0E"0A 30Ѝp0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@Mh04`pP(0 000"!       P0?S$P(P,P0P4  L0QQ 8QQL02 SR|0p!!!!!!!!0S Ѝ$]@-Pa@> i?,10!(1T00!41  1 00000110010 0 p@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0o )A(10101A-0P`q Y( 䢒@T  0"@P 010 10010-A!  !!! 1P $P dA-@ 0S Pp`P0 8P0@0D"0!!#  0SW00S@ p0>S? 00CS'bRcRbR,cR,cRbRbRT P@G  0 S 0 0000@S P@@ -@@O-Z0M0C21@S FP4 q<00Jp"@03 [P`+ q`P -PPP  !QP PЍ! 1 0S P 1PS01ą`$ 0 00 0  (  0S @1S Z RP Rp Q+  峿0P pQ   BV 'V  `P [0  ᘿ@P7 gPPQ= 0 B "Vx1Sp` 0[\ 0p!x!ZR|||!x΅uZ0S*P0SU "=|@T@P`?o22PP V Z  R ; 1UP0/1P0X Z  R  ZS 0Z0P0U1P0Q 0Sl 00C00 0P?o20SA Z1UP0 $]@ԀԀG-P葐tp@RU" PX1@T, L0S` ZR`@ 0  ``MPX Po@T PdЍ@T\U `0SL`` 0  ``P X Z0 CSRxP:d@Ӏ@Ӏp@-xM@?x ` P G0U0000`0 07~(0$(P lP, 000P0 KxЍp@-P0@1P00Z00l 0000l@ ɄA-`pP@T L0SP0S@0SPUAC2Ӏ@ӀӀG-1`pAZ0PS&\W Pqo0SP0SP;0S|PP0S G0 fQU 1ӀӀ0@-|M@t PYF00P4 o|Ѝ07@-P0@60#R00SP  0$100\ P P P $  Ѝ0@CA-P`p@TW [0  d@p@-xM@`Pt F0 0 0`xЍp01 10/O-1M`p0ApPpXP0  @4MSO54c@㇒) l 0R[0"? R (`pap0` 1R#Z  PZ 1 ` ^0% ЍO/0G" 0# ?o\20S d20 d2ЍOYP k` 0 Q 0 0  2|wЍOsЍӀ>Q_O-p1唑|MSA僿P0  `l^XO FX娋%@S8|ЍOO R (alS E t E0! Rp 40堀尐1!` p$vY0  [Wphp`0STP 1`@T 0c/ 4/|ЍyӀIQ_p@-@HP`50S p@@!p@{ӀO-`PA$MZ0S P R 3Z 0 1SW [i?Z!00!00000!00000!00 0000pPWJ?Zn @3         0000  00000 000 000YP',P04P0< ` ta$ЍfP @ p `3 `X2         000긕@  5@0goG 0J"0!!#V p Q; p0` 1RX J2  p  RT Z [ [  l P V1    ? ᰠOP. `0 !402S S1 pX 㨑C0HL1`0S" W[0  lP 0 E?ⰠP0  1P0!\Z Ӏ$]A-`@Q` 4R{pC2! !! ! ! !! !0 0F"0Q!V31 $0110102A$]p@-@P0` $È` 啇p@ \Q_UQ_@-APP0  +P08P0廻9wÉ  oY!p' :P0|`V0S 0 00) >00C0VP08P0a7P0傻፻/000X C 1XHqL1# .+P"  03/`400S$ P .zz?V` 0 `AP0 :P0;`L1P02P0V sQ_}Q_$]v$]j]C-@1PC|MT!atR 40T!md2cX0d201S" H1Sx  B` RW1嬁p0P  1 ` X 0 8/wY* gP  0  ~|Ѝp@-@ 314020SS`@P`Pp 03/p@S p@h@Q_p@-@P@`iPN@  03/@qp@p@-@P@`UPN@  03/@]pp@-@P@`APN@  03/@Ipp@-@P@`-PN@  03/@5p耾0A-PpZ0P01P0?`0Sl 00C0|@Tᶹ 0SP0 ù Rb AV  Z ` p000G-`1SxMpA 1 0t A001Wpp00 0 0$00(00,0@ 0A0( S :P0  ᦽ0 R (! xЍ%@ S_`40` 㠐p0`1RU WP 1 `@T 0c/ 4/Q_A-Pp@ ᬹ0`V S R @0᛹Xڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/HzhzlzA-D`DpP@O0S 00U@`00ՀH00/p@-0@00S00P00R -  P 0Q 0 p@$hb 0 {&0C0d03-P Q(30 0`Lp@]p@-P@lU EOp@-TC\  P 0 P  &{`@U3p@-@P R` P0==Q`PP0  p@P0=P0/C-1Qpc0S@ XP0E 4< <> P0P<7 P0P000# #$ "X  q {P 01 QP 1402010S   Ѝ<WP0 @0P0+00l00 W+P0@ #I$]A-P@`pQ 0嬀S @TAp@-@P Tpp@@-@፷0S ,0R@蘷P0@0P0@yX]p@- @dPVʀ0!` 0X P   !wuTU pHzhzlzpQx0tS|0|I 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzG-pc~ࡖ 101APU0 0 0 0 XP0 0 0 0S@00:#003/G-@`pPԠ ,1{?R 偃@P @ zO |fP`P\00S 0x,!##)" !qaZIQ_R0>00 R_h]_IR_^@_@-L0!C !!R@ (3 %3}P@}A-l0,q@0 PN `  0*  @X @R X A  Q ,1eP ,1! / x/ / /@-MR_////p@-@ PN  NpӀ///N/-////@-   Xo Ѝ@-  Xo ЍQ@-@ @zAP  ,P ]R_dR_@-@YNP @ʥ@@C-@QMPЍP`pP PP M P@PPq D0a0CQ R P bQ0@pDPP oMP kMP 0 dMpPt#MPMP\M0y0 cRY0 0@ÑQM뉙! &ခ"** 0 BM@?M&"** jR_r_#^A-QMP@`0p!POP" 0 z@P$ ?@QaT ?듥W ЍQOPLP,MP'MPLp WLPL@ >@LPLՀ h^tR_^r_R_R_^#^R_A-83@M` TV 0  n30S& bOP B0 rs #[OPP  <0"0 !& 0! "忀 @PPLPC`LP>PLP9D2,b0`}L@zL7:!#:  : 000@0QmP1gL匃XLPLP LP?awxuЍ>@DT>Tz >L aO`Ps5LP2L0 40 0000LP!OLP HVPP p0y0 pbw`Ak wvfV`NP =@5IR_R_r_#^R_^*\^zd@R_O-@0pSM800880S NP8 830:PP>@RHPP t8lfNP0ST KP//00 000 `@ hT KKP KPKPa 0s?oT20S yK 00LQگ0 0RA*S 0 0B00 0+PP 0 00 0"PP & $00FKPC 0"EY DK><0r`P;Y H&0 *t6 006 #:: 0( ,0 `586000S ~?CS .Z/00%000b#a 1006KP1KPV0MPG   (00`P l", `500Y7L H~0`rP8 $MP50J@PcJJPJP JPP4?a݁4PD`D R RMP hPP0IMPP00@MP 0"G0P D R~30S ~P0(MPD R 0q~0h000.g~p30S ЍPTUET5 \J MPP.KJbPdR)|JP$wJPBJ0w0  cRW 4J 106!#: : 0000P"JJ 6#::0J (0jPPa& " J@PWJ,IP,JP x'JP41h?aP1 LP p}PUv^ 0P0000i p0 02220l0Ю@0#0$@01S3x0 02P22 0S P @pSeTTp0 0 0SP 2S(@LQ222@0#0 0@0"xW282vDI@-0C6@ @-(0C+282@G-pȁȡCRU 0S O+Q t!@0D0@0DW+2@ 8+dVʀ 0! $!0!!   !0S0S B 000FP10 0 0 {282202+20C2Hzhzlz20C22S/|@-$02020CT@-P@[0p@- @0BQS$HRRHRRRRRlR5@ ?0S Y000 R 0 0p@P08P0000?s|{2R 0 0p@!M0 ج`'0 0Pp@KHT_A- 1aq@T. L0SL00 7@Z R  BRl  00Z0|PU 3S ˬP0 P R {QӬ8@,`T  @AeӀ@ӀO-$3$#$c[3$M10100S0#0嬼2@T L0S壼0p|P0U0"W50a 0S0z/` 06yʼ@P0In40\ 0S؃0$! 0Pz/ 22 y40T000T00S P0  0S 0CS S0!Q500 ) Fd00500pQ0S,0 P: ^:pz_Pp0` y`0 GxW   M0S LrP$ЍOBdd 0@c5T50D6vX?Ӏ@ӀT_^_iT_"U_T_]/P000@-0ll@lP R P00Q# R" 0RR 00oRRP00G- @`p PĀP㰀尐P᤻PU߻U@  `R0s#0"s#R Q0Vs# oRRӀр/0$ R @- 4/I 00S/(Is@-80`SP 0 00,U`@P  Ѝp @P ,e3P` `30`0P40P0 R8@0`m VU_^8^6U_@-0 =s<0`0S 0 ЍpЍp@suIRSA-Ѝ@P0p P`U`dV0 P`s@-@\P  t<0`0S 0 ЍpЍp@8uI@-Q @  0R_ST`00`0P O-M@0P0 4S'Q Ѝ0s0S0 P0S0  0 P0S0p P80p 0 R $w0 000 00 0xlP0pU 000 0(]P`V40000 ?8000C S 70S@R 0P8pXb ppy4 [<X R 0P0S(0R (0R0S x0S60S60  ; Sv 00;07 00C03 0SjY_f AA0C \Q_S-S] RY0  0S 8EEP0 0 00(0 0B`Spp00C S3RRؾR RR(R `[0`0&`0S#h`d0V0+0`80SLP{ Vr 0 0SIx0SEY0Sx0SR`P B   ?`P `QE 1`0S  .P% `* ,0vP ?Y > ` 8JR*5"`0J,0-Z!  `0 0 0 Y0Sx0S  ` 0 #P  x0S084s 2`   0 X D00XѮPZ ` 8$ E$ 01 0㈀00 Q8:8ۮ8`4 RG40 04080@04$ V0 4 W0X0So 0Si S`000N S`000Jꑒ" R000 0p8 P@R `0`8 , P00R: V Ꭾ `0 B` D` 00P@4 W8 R p`0`8  P00Q 4;0`0x0H00800P@T( 0 S0 00(0 0&#`0T[T00P( P0nU_vU_bO-M Qp0a4S  uЍQ0sVz@0P@T0p 20p} X 00 1$AP` (W084匐0尰Zh T `0 P \Q4QB  0P 0  XP X `  (D4 BT * B8` B [C4080CSE+`  0P4@@DT4@8徭0@8@0PPU(00ZAp00$0( {0 000 00 0iPo0pujYS 0CP0[ [ @`00S @8! P08004Q (0PU_vO-$MXp0 H$RLPT  3t@$ЍUQ RQ X Y%  X0 00`0`S@@0S'X.@0 0 0gi@P 0  0p  R@ 00000 0Pi@P 0Z 01  Z@P 0@00CS񟗣RRRRR U0  @P00 U0  0@  UpP @~ 0  @P Ҭt00SS UɬjU J/U  sC0 ᰀ U*@]U_s@-@PP 0 5t<0`0S 0 ЍpЍp@KIO-M00㸐0p0娀`$R Ys Ѝ0SQ0s UPP  0X8@00m 00 0P x0Sa V `40$ [ SQ0 0 0hP ^ `0K$H0S ( S2   0P0S0p p 0 V X0S Pk 00 ;xbP[  00 XP x0 X00'0040 S6r  $0RZ0V0 "4I+3.XPQ000W0(00000C0 00  S Py 00B000C0 0p00s) o0sQ0a _ 哫P᭫ W bB 07 0x墫0 00000 0gP`@?.0 EP +-1V_vp@-D+<0<@000404  R4  000@>1t A 0st@@@ 05 P 0?P8D. !  11W000PPP Ѐ 0 ( W# W W 000P`1PP0@p400 80<8`PP  8oYߍЀ԰10804 P00D0p<0,VP@BS>P H1R0!sR u oPP1 00 400@ 808`cP8` `404SR40 8✦$@TR4`Sjo` `0Yp8p @T2c@P @^Pw0Sp1S X@T01X0| ;E@Pt  ?X@070l@ *00 0@0QS P0S p0 0R  R 0$0S !0(0, 0P$0 , w*$0 ! >$$0Y 0(0 0 0S[ X Q B & 0 0C 0! 01PB(     P0SQ 0 P0S@nsP 0 0V_V_GW_W_V_-C-M0000P Uy 0  0 !0s  0PE( 000  0o@P iT@ЍCЍ/X X` p )4X001 ``\    p @`$0$@VBPP804 \@\CRQ f%PU Q@R0 0P,@@`  R XP T0@:$E@P 0$ X> 0 X@' ?@A-`t1V`04S nAPp`8@T 00S8@P 44p0p8pPPUV  0P &0p0 XP Xp`@4 802#T*0 R0 R P8@hIvvW_G-P0 m0 p堀堐堠 RGm sA S shmT  m@m@0p`C m@W_]__b^W_W_O-`PM PU (` ) Sἦ004Ѝ    p @$G 1( P,00 00R P 0 10P0 00`0 0@$0$ K 00 0hIC-` $MPS0@@ 0Yp00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`&m00 T @ 00$R01 @00-W_Q|J-//0 R/ 06S/`WvR@- 0 W ЍHI@-@0 00 #3  0 0 0 0 00   0 À/ʚ; 0 À/@B 0/Kp@-P@03/0@0pp@-dP@0S03/03/@p Q \ *@$0X{@-@ X0` ;@0 00 000 0 P嘰0`orPpW +`P U p0S2PU`000 p0p 02a`P Ѝs:`P$P03/03/P0S LX{̀KO-pLM`T@P0Pp0iP ;0PS 03/p0 0 0 %(,0 00#0( , 0$ 0 0$ 0S 3/8P 04800 CX0 0X"0@0 R8 00p0 ?;#;0 #5; B%!0!&!<0 80r0Q P P8<0 Q HZ0PX304pP0p D0$W0Z0@000@00P00SP00P0LЍ0 0 D $0$00((0@0,,000p00D04400X{@KO-M0 SQ-@0pP?oU20S]@ ЍWp@! ! 0 0000pj [`0P0B Hg00S,p@I$PKKX{^ X__@-TPD00@tI@00`ED0 0 0TЍp@@-TP00@t000`,0 0 0TЍp@p@-@PTp0M00Ѝ/@O-0尐@crW 0200PP 0С*0  00#0  0 0 0 X P0Sr ЍX{@-@  HЍ@-@  GЍ@-@=@-@a0,($@ @ @<08 ZDЍ"Y_R-Y_C-Mp 0@P`` 堐l6t0 00  00P 0 02?oY20S 0S0ńЍ80< 0S 800< /_p@-@ᱩ@0`0@0_,PU 80< 0 ^p@虩_P^@-@PP@ M@-P@ᆩp0S 444a 0S@0 Z( 0R0000 ᪩^0 a㔖^ 0S 00"#! "#1^P63 $103$!Cၩ0 3/<0 00000@000MbX?@-g5Y_0p@-`Q@P0 u20`, eupl20` p@er_3_0H-@`,M0P0S@ XX$PU? ,ZU80< 0 80< 4 `P @ ^H D?Rp pӷ1 000P1D H喕pҨW  ` !0  t]@0 ]p00 0P00000p^p>埨0Sᚨ 0R 0(0 0 ,P0$  R 0(00$P 0Ĩ>P^弨zv Q 0   P~^]Y_eY_RX?rY_C-@,MP` V0 $0(  ,0p@0000 HPD` @p]?U  t000000 T0 PP Z],,Ѝ+008^e{Y_Y_Sp@-@`PPK PpPK00p@-@X0M 0@0@ @@@ T^  00@@Ѝ@Y_K0SA-@p`@T!`_K Ps@P `WKH0V P@̧@0T@SP P0PT TPX0\ P0 X0\ U `3K@@H V P@K@-@l壧X0\ 0S X00\  @@اP04ST T % ЧT@` K0SA-"<p8`}PU 帧J0@!`R R0S hRJ Ѝ0V PVP0UPS 0 |0@ 0@0 T0 0 偧T ARJP V PKRSRK@-@p'0 0S 00  @D\08S   TTR@Jp@-@QPRpp@-@PKR@p0-@- p@ 0P` 0c0`00 \PЍ@Ѝ/s@-P@٦00`V `[ 0  0Ѝp@[SY_p@-@8P姖 3 $!嶖6<\00p0S/p@-P@<ᤦ,0S  (0 0@0(0\p@Ԧ0 0R0000 000 @0S  Sp@-0P@0{ 0R 0(0 0 屦;P|\pp/p@-@PPp0Sp[@-@X0HSi@ `ip0S/ R/h l00hKD @-(* 0   >0@K SD0 ,P100S//@N@A-xM p@T@xЍ&Rl00& `吀0S p Rt00CJQ0S\00\0x t0000x0(0\0\P0 ӀK0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0U0 0000 0@0WP H0L 0P0S 0003/(@ʚ;K0@-@,Mh0003/80< 0 @0S P00$,Ѝ0@YX0SP 08jH \00\0`0SA,Ѝ0&p@-PH 0@   S+0S@)p&H@@- 婥P@X@-@ hP g^Ѝ \QC/ɚ;0@-@MP 9]P0 Ѝ0P@-@ P P0 L0S003: 0 Pʚ;ʚ;@-@ PQ  ^ЍO-`DM00  0hpiPP <UW 0 00 PDЍ 0S0 0W@0@C@0 #PP ?o2W0SuPP 1hPP 0$  0P0 ( BR %0Sk) ,0 0SHUFiP ʸPQ( ^0S (0 AQ 0S00  00S000 PQ ^0Q 0 AQ0S000  00Q00Y_ʚ;0@-@,MP O\P0S00 0EPQ 0 T]P,Ѝ0p@-@(MP` -\0P 0S000$ PQ 00 00(Ѝp +]0P @- R R S12S1`01 0] Ѝ@-0@SM 0Q  00]   \P Ѝ0@-R@P$M 1` laT U  [P  @04 S#*/00$Ѝ0Y_@B@-0 ЍA-@QP  m0!T`Ap0 MR pW=) -` p`喣URP0 S00 10\00 1 p 00 00\ @@S0P S0."? Aj9K@BZ{c /K?B0p@-0M 00000` 0P!U@PP  ;[0P@0S!Q Q  A\@0ЍppC-P `0EQ@P XP\ ` x HUp0Sp0 0@S((0,0,0p0 pDSKK0`0X00CS/@-@8X0S000S(0S, , " @@-@X00CS@N0@-@00S &R, l00& 00@FKA-X0@0CS8UPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0@ʚ;ɚ;6ep@-P^H0L A 0S PH0L P$0NSQP8@<`0@0SP0 HP80P00SP0UZ, @T` P H@L` 1ppʚ;@-P8@X0 CR3   R* S w0 RS ^0S 0 AQ0S00  00 1S0 00!Ѝp 0S 0ll RR H0L`00P` Q00 ʚ;ɚ;6eA-@T`P9V`8  0((bS \J S HL PH LP Q H !L P R 0@ 0aS \/ S9`p1S d`$V0SF 0SC0S@0S=0AvDHLp P Q 0HLp P Q 0HL PH TLP Q H < L P  R  0 Aɚ;6eQG-PЍP(0p`V W`#DX@ p 5/PP Dp0SSt00C>S Ds $\RmC#P0SRX Wp W xt 0xt00  0xt00W W @ _ 0 00⌠A9 YPP]@-0 Ѝ @A-1`P F?o2!R0S0!RX00CS 0S 0SxxS 0kHHL@LpH@L@PPp^P@HL@P0ɚ;6eG-0M`P0p @?o2!R0SPdP dP뤡P`AT 0ЍW 8H0L 0P0S@ X0 CRV:S H L0 H0P L0 RP (0L00H0P0 KV nH0L 0SH0 PL AQP0SH0`0 L 0P0$ P0S p fS0 $0ɚ;6eʚ;p@-@HM` WP P1U(P0 0`PU (XHЍpA-p`?o @2!R@@TPP,P+&@-@ M P rX ЍA-1@p0Do!S``V@P1S0 S 00Q)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M   P X$Ѝ0O-QM ЍP`cPc@Pp0 0[W 01S 100[%T B@WBpU0 @ U 0  0t pxP 00匀P@@Ϡ0H0L0P #0 RQ @ U U' p IT A)H}cP H L H PL  QP H LPɚ;6eP]C-`PV@p,M0S,Ѝ MVP0S K p00PV10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@T?p@-@`Pҝ0Sp G-1C0(qŝ@@XP`X R00G 00 CQ;Q Q 0d 010d0 0 01 C40dC?10d8 0C?Q C80d?10d0 0?#<d?10d8 0? 0000 0 00 夝 8/` @R 0@UA-0p @P  0 0S0 0 \00X00\0@\@Au (aU0 000000尝P ` 000000\00X00\0@\@TO-@`pP0T! 3R V"0< 00800 80<  l 0 `r 0t ` $W  ЍOޜ0p 0 ` 000 ЍX]Y_@-d<0 XX \   ` R`d00(@-(APT2 *@@E0-XX0\0 `0000Sm p0  eY ,`p0pr10 \ YY L0`8g1:xP(A Ѝ (($0PZY_Y_Z_.SY_ 00(1 (  S !$00/00/A-@p`Ptp ` Ap@-P@i p@p@-@a0 0  P00p%pp@-@PP0 0  0000 T  ,03R pPpp@-@`P/` Pp@D@-@(@?$A@@-@0@@3@-@@,@@@-@ @#A@@-@000@p@-t1(Aқ 0XP0 0!` \ \\dPd\`dP:C$ `ȑC\ \\dȑPdȑ\`dR&C!*`\ \\dPd\`dQ#ỉK<LG-P `p@P8H 0S0 010SH 10SD FVCBH=bI01,XJ!}0 03/DtL\?0寉1 kP`娉V<0H;SH H IW 7/pP 0R  P0 4S 0S p__K̀__L8__H L__`_A- Mp` P @P 0 P@ ЍU H00S <00S EF5/01,HK̀]^@-$M@P8 `p0 #$Ѝp@-PM ` @P 0S0 0,0 03/8岈00\0> nЍpKLH L0)-KG-@pᕈbP0S`PU23`0Ɉt先0 0 \忈L}P`P>8师P0=PP 寈Ѝb 00 0夈50S0S<0K 0SH 3/PPD0e0<00<0Jx!L0,h儈>4P 0(0S 3/,Y.0S   H+0`08>e 0U0C 0   S($0S%p-P  FP  0R SP 0S0 4S  +00K<LL^ `_p@-@Pp@>@-@P 4@-@P +Ѝs@- P`@P 0 0@Ѝp?G9`_@-@P @-@qP@@-000 Ѝ]S@-000 Ѝ]S@-000 Ѝ[@-000 Ѝ[ 0Q/P /@-00 0P Ѝ]S@-00 0P Ѝ]S@-00 0P Ѝ[@-00 0P Ѝ[0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0<0`0<00Sʸ0Sp@(< <@-@0P|0S@/|/A-`@ІpȀ<0P 0S#Q003P0 000;00C0<p@-@Pᨆ00CS00<p@ކ//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0h@S qe)0`S0Z 3 #pG Shl`T  P) P0!!00A-P@l`hpT1S S@ R Th@l@A!)1GQ @p@-P @P0P $    $  PU  U p@p居Q P  80R 0 Q P 80R 0 <p@-PO0 0S S, S@@偅p@P`F``V80S@@P``` 0V80S@DЍp R 0 R H0 QS0  (PPPP h`_p@-MP` P@ Ѝp U @P C-Mp `@T ЍTPP< 88@T V pY P0 W 0 Rp@T Vp@V + + $ c}0 ST  `ۍЍXT 040 0 G#P@03/a_Lhr`b_ b_0/0/0/0/p@-@P0Pp$ P p@-@4P 03/  00C 0p@#L0/p@-P@Ppp@-@P$  r40 0p!b_@-@j@4p@-0 P@e0000@0@00p@p@-@PU`0S0S00 R00 00C0p@g4A-@`p8000sV P-00CS075dP U P0 3/0PP0`$0 0!0 00 /HzhzlzA-`@MP3 `0Hp @00;tp" k"<07 V!P <m=8 h1 S(0Z?00ЍQ_*b_Eb_X:_@-@1!P Q= @"t@<"Yb_@-<0DT 0 !0  !0@- ! 0 !@-PDMp@`) 7Fs)0 000007 !P =7 *0`DЍpb_p@-P`!0@`  )pS0SO-Td"0P 101S@0T<@0 @0<) 0 @  P011 R@0 0@0<@000Q@  S  R@ 0  R S0S 0S09T 0S@0@0@0T @0 00000 0 0SЍT 0S 0R;`P嬰  0:p6Z:@Y q Wh`:V HPZ/ЍO:@:<b__b_c_b_b_^c_h^*\^c_7c_-PÑx|0x|120C22S@-82cM0S-$$cߍbpTUʀ 0! $!0!!   ! /W@ 120A0Tcߍ@-|!202VE 0^/B` ` ``  $`$ ($,(,`0(04`,4088<`4<80P<@ @0<`-B(xz HU 0==A-`x0pPpy5@$V@@T L!z0S0z$ W%Ha z==p@-80@`0Py50Sp@zp==p@-00@P(y50Sp@yB==0000/rP/0S/-0\0000C00S\ 1 !L0 @0C000P0 p@- R 0@ Rʠ8PQ BP P0 h00R Pp00000C00 0C000 0 p@c_[c_#\ S# @-0@(M0T (Ѝ@3h03100P (Ѝ@^10 00 !0 0 0  (Ѝ/#\r S% @-0@(M0T (Ѝ@3p03100P (Ѝ@J20  8 0 0  (Ѝ/#\rG-p@ࠟW `PU0``0C00S 0UP!R g0S0 P0pG0000C00 0C000 0  e#\ 0S\* A //O-ZQ& @`PU P` 0T p1p!Q  0R `P 0PE0J0@DTZ Ѝ   #\@-P`p@P0 @& Ѝ@-P`p@P0 +@ ЍA-@`p8xPPdrx@Ѝ,x̅@fx,dxT0 @Ӏ\ 2A0\ 2R1G-`p0S0 0@P202Q8@P0 Sj8@20C22S 1 0/8"8/*8/2898/@8/M0P PЍ/  /M0PЍ/@- @ P P R:H0R 0R  0RЍTVRPA- `pP@T X@0 8/P Ѝ00/@- 0  00 Ѝ//// /$/4/Q Q Q  <0@o/<9@o/</<!@o/D0/P@/@/H/P/P/@-soP/P/@-goM0 Ѝ/   /@-M Pp`0 o@PV 04/Ѝ@-0 0 0  00 ЍЍwc_A-pP@ `81 410RTQ`P1 10R0#Q0` TIPp 0  04 0 + 0! Q0P HWTL@0 00   0!Ԟ؞ N@-@ tv@+Nc_O-M @ 8PRP@: u`ev0ZTQ P 000V 0S000S000Q0 SQS-@ /o"/P$ !R @4ovЍ($ 1S0S 4 33R* 0 S42 @# 1SV0S 3 3l3RL 0 SVhh2 @1SS   R 0좟 0S YP @ в 0R MP 2 !S/2,<0p 01S 7 0  a1SS   R 0衟0S P ܱ 0R P 1 !1<0p 0Y@   010 0 0!0 S @- P%  S! "+0 0Pn8 K㄰0 P 00 P 0 0 0 0  N؞&^Ԟ]c_&^ &]c_p@-@P`u0p@JuNqp/<0M 40000P0000Ѝ/Ԟ؞qp/<0M 40000P0000Ѝ/ @-T0@00<@ 0   PЍ  Q Ԟ؞@-T0@00"@ 0   PЍ  Q  @-@tT00Sڰ001S 000 \^  R @Pt@ 0DP8AT @tNԞ؞  @-@P@P`tL0H0 0P@\@t 0N @-@P@PCtL0H0 0P@\@tt 0N O-PP' `@p$t0S000Z. i pP% 0 R 0 B RPUlAtPh00S\001S V  0@0D+t ЍpN Ԟ؞O-PP' `@ps0S000Z.  %P% 0 R 0 B RPUlsPh00S\001S V  0@0Ds ЍpN  p@-P@ Ts00S001S 00 0P\ 0S @P@lsPp 0\ RP !R P< J4L @sN  Ԟ؞p@-P@ TJs00S001S 00 0P\ 0S @P@lmsPp 0\ RP !R P< J4L @TsNԞ؞  qpO-M Ta dP3<1@0V ,100`0V3PЍ00 0 010pW 0 000S aV b3 @T 4/p PV x R3`$@P @00 0;/ 0PS  &^Ԟ؞NA-pP`P ^ 0pA/A-pP`P p0A/@- w@P00$0 0000/dA-pP`eP p0A/A-pP`SP p0A/@-EP(@-?P(@-@90P 0S @/A-aP*P a0A/p@-P@Pp 0Sp3/pp$Ppp@^qpO-M Ta dP2<1@0V ,100l0V2PЍ00 0 010pW 0000S aV n20@T 4/p PV x ^2`4@P @00 0;/00PS &^ NA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`~P p0A/@- @ mP@0/@-@c0P 0S @/p@-P`UP 0p@/pA-pP`FP p$0A/p@-P80P p@(0/pA-aP+P a,0A/@-P8@-P8p@-P@Pp00Sp3/pp4Ppp@;/ 0 6/O-@M(0嘱p#09ᡱ ⃡P@Dlqa` dE.`q0\!PT100 0@7/$08`kge_f_P P @-%//9f_-pcPP @ @P@PW<@-@p" ``P`= @` @`@PT=IDP MD /0@BG-M0S` QPPRp`100Ѝ  \U1#H1@ U00T0S `4  ƻH000P040h080p0<00@00D0#""$(, X\ 0$0 0 #%@D `d 80<0(00 , h00 l00p00 t00x00|000`P0pJ00@$P(PO-@Pp$M刊0`VP؊@$ЍZ0SW@@`  U   T@  R PP0p@I 0  0<(P 0SP// 0SP//G- 8M(0@`p\,00 0000a0($@ @ @P儮0,00 0000a 0($@ @ @r 0,0\0 0T0000a00($@ @ @P^8Ѝ(PTf_4Tf_Tf_p@-P<މ80@T$/p2P @(PA-p`PN@\P a᧻`H⇴ẉ0000 @  000$Pp@-dP0SX9 @➉ 0<R8 00, 00C0p@$Pf_(Pp@-@P$`ႉ ep@҉(P0@-@,MP>x0 |  R0 0CS 0 R=9 =  0 0R0 00?!0  0 0  8 R00=9B =C0x@,Ѝ0@BA-@(M`Px p0 | U0GS  0 R=9 =  0 R 0B000?0  0 0   R00=9B =C0xh0l PUp0P0GS 0PU=9 =P 0 0R0 00?0  0 0  8 R00=9B =C0h@(Ѝ@B@-@,MP`pᅳX h0l R0p 0CS 0 R=9 =  0 0B000?h0  0 0  R00=9B =C0hV W? 8 < 0# 0$ 0 0$ ,Ѝ@ D 0$(0, 0 (0, @BP/004 0 004 /@-@pT0T 0PS10`V q03/@T Ѝ>s@-`RP1`0@0Ѝp@Ѝp@- <"`80,E $01000 Ѝ,P=#T^f_p@-@H`PS0S(0p "@<>p@-@PT`_L0!RQ41`/`p@ T(`@,P=f_s@-d000S B`@>8P0d0?oT0cЍp!C13/=A-@`TPp WPhd圀PVpʀ 0! $ 0    ! 0!d!0    !Hzhzlz 0 <0G-P0p@|0|`cP@  P  Z0 0 0 ZUPG >>p@-`<0@@P@Up0p@/p@-P(0@00C0Up0p@/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz G-0 M P   @p X@`lP X 0000 ЍG@1  @P>0PA-X`PpW0S8 Aq P@m@0Pf_p@-@P0 p@>p@-@0PD@Tp>@p@-@PDPpUp@00@p00S:h/>00S:y/>00 R !>0 ?>0 :>0 >"111/"111/ 211/ -L0!0\Q S0>,0 0R/Q0 />@-0 o>D0 0R/- 0R> <0Q/1S co `/ > -@0^1 0 co ` >40@0\/- 0\ >40@0\/- 0\  >40@0\/- 0\ >A-@`P$0pW@P> 2 2A-P`@$p0SQ @>A-P`@$p0SQ @>A-P`@(p0SQ @>O-`pPа$M @T$Ѝ0S:?T@eQ; P 0 ?0@4'V`1  L     9 T: 0I37@-@0@T t0Ѝ@\P0 1 8*b0 ĮPЍ@>,p@-P@P  p-0t  B^\  ŠP0 !.0 . ֮@>,p@-8`8P0+[$@ 0*Tp>@]@/-s@-`0 0@P0 0Ѝp@Ѝ/A-pP`@k0P U @0p@-@`PX@P  00p@-@Px@|PB /R/rN/@-]h_N/@-]h_@-]h_@-]h_N/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`P@0 0/0 p@p@-@`[PP 0 000 p@[0@-@0as@-@0 PЀ `[0 <-L-[0 000Ѝp`6Tzp@-@`P0S i[0 0S 00 o[p@/pPG-`MpP@ᰐP!0 3 0000X0P3/H3 00P00 ЍpPih_qh_T*\^h_p@-DPt` 0 Q@ [0 Q Q 00B0C0/T(0@,  ;[pxP|Pp@-@$P`Z@ @@,[pxPp@-TP`Z @T@ 0 001`00 0R@@[pxPa0|P@-$0P 0 0d ЍxPp@-@ `PZSp@ZxPp@-A@ <`PZ0 0RS@ ZpxP|Pp@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \PvZ0P$PBU 0PZPp p@$0 p@|f~fxP|PPA-pMP`UZ| 0R) p@T1 00S 0E0C@S@1T( T@# 00S0 SoZ @@(ZT W 4aZ#@ЍS@P VZxP|PPp@-@T P,0,h0 Z SDZpp ]|PPG-頁@0MS㠠P# px1 R0S! 5S-@Z@W 00@ dY ` P@U`1ZV @L0@0Ѝ 0`` Q0  00  00P 0 0@PEUP!U @ 0@S 0 _T0p`FP@xPa0IQ/p@-P0 @AlP Q PP  @ 00H0pxPa0O-@ ALjUDP dU<0 3/UPA@APA@-@ᤕ 0<0p@-@P 5/p@褗|AK}AA-0@SP T`@pL0S50S  0 $U 0S ^p`W 0< a0<   03/ ~B80 4"A9 @AAXAPAS @T`臁 13/ pXYG-p0 @0 0 P  (`,q(0, 0/X(0, 0Q ?000C00Ѝ 0$ 0 0$ P@  13/P lV 0 &Pp]#\A-@Px`K@pPEP*E-804P"8%< 40R:AKlp@-@Px`KH0,PU< 40R*p@Kp@-@Px`K0Pp@KA-`@xPpK? 00+0`@`PPPEP0pE8AK//\00S /@-X <!t  L  R0S p@-PPK@KpPO-PP@4M?p4ЍO/lR` pR cR sR SR0 RS 0S# 0,0,pW4/X0Z0l $ $00 0000000L0 0H00<0 0 4/4Ѝ0`t(X4/X L4/<0D0804 ,4/P0,0@$4/4/0 0-4/X 0S 4/ 0S 4/ 0S 4/{0SH4/V4/W P` 0FNQ  0 `$0P ZP4/ 0@4/4/Y 4/̀QȐȠU{  4/`p0W:P4/ r 0 4/p` 4/Pk_ok_yk_~k_k_k_k_1l_el_l_l_l_l_l_*\^m_8m_\m_ym_m_m_m_ m_p@-P` 0@Tp @A-Pxp;J`V  `V`V@oJ ,@P` $@P` @P`A-8p C  1@0@/Q Qq QaUB  JU # 3Q R.Zp W 0S8U: 0 S00R0S0&W8 p0 @CT20S(U* 0 @DS00R0ST `x4Yw7   P0 JZ 00,    Q  [ p B[ RU  KR  Q R|[X} U 'p0@  00`w0%G P0JD*0J&``  00``0@ "8`; `7 0`01@ ,G000 0i0SQ000IB 0Y0  J R(0S0P103/LЍ  pQ   j[puX  R%U  /o"QQ 0P RP P E  ,0,0KG  0 00 ,0  ,0W0  0 0pGZp0  0 0J W  Tp  @D]m_]-0@-M P0$@ @ @800S @ @Ѝ0@Ѝ/P-@-T031[  1 0S 00 00 ЍЍ/-@-T031[  1 0S 00 00 ЍЍ/-@-0 000Ѝ Ѝ/s@-P@`J0 `{Ѝp@I-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@\@-@P`00 `*TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <u!1 @P >h`Ѝ c00 U00S`C 0S. z,@T@p T @@⛕ 0R#T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG ?@1c  p U 0 b^gfffm_@-m@ @@ 0 4 00"  |@c\ ] s@-@Q@U-?@-@PH0 @ @ @u800S @ @k;NЍ0@ Ѝ/P0Q   m_m_@-`@P 0 PK000S   A$ЍpP-?@-@P@P 0  000+Ѝ0@ Ѝ/ 0S  HP P@@-0`Mp@  P0 Ѝ0-@-0 000 ЍЍ/-@-@M0 4 0 000 Ѝ@ Ѝ/Z^@-P`|10S A3S k lxPT e#T212@00@00A0S<$10SA0 00S 0 0Q00o0 Z#p0 Pa 0 pp0 [0S `0` 0Q01J]P.0 `to\\PxPa0#n_\^*\^m_-@-`00/s@-@P` T 0 ,@J0 `IЍp@5Z^-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 ` $00S Ѝ@ Ѝ5Z^\-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`T 0 ,@0 `Ѝp@5Z^-@-  ЍЍ/-@-00d Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppPW0T00 0 \@~0 Hy0 xH0SЍAVЍ5\Z^+n_-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p.$00S Ѝ@ Ѝ5Z^\-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_?:@@(p?01 010101/A-a(P!R Ap@1!#880Ro@$1 q0$12020A?@-`Rq' _@?T (0  !R@D!!!R Ѝ@?A@? P ?p? Ѝ0 00P ?Bp00S/@-`0`@0S@0D 0 @0D o?@0D 0 @0D @?\<B|0P-  !T LD.!      /Hzhzlzl 0CS@-T0 !< 04 ,   !/En_Hzhzlz@-P 0Pp@-(3 0P@$3OoPBp$0 0!0 00 /Hzhzlz@-<0DT 0 !0  !0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`.@s >Pp@-@> @00/A-@Pp` l00$0@p#0 uAA-P@`wp U0S00  0S00 [x0SAgA-@PpY` 700@000#0 ?A[A-0P@`xpx00Q ` 0 ? 0S0Ѝ#> j]>[PTp@-@P=0S` p@=0U* `V 0a@-@@ =p@-`P=@Tp00=`0S   0S=p@  p`p@-@`P~=@T 0S@A @=pP/0S /O-p`Pa=0S R 1 ЍO==P=@X:= 10@?=@T R Au=s=  ЍO R !  R   V=T=T  Ѝn_@- M@ ܏ 0 R0 00CS0 R=9 = 0 Ѝ@- M@ ẏ0 0S 0  AQ0S00  00 Ѝʚ;@- M@ q0 0S 0  AQ0S00  00 Ѝʚ;p@-P@P@Op@-M pP@F0 `\0`^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  007ʚ;A-qP M3 BX<T t13AT \<@ Ѝ H@E<000 ^|<z<0 000@0 0D@P! /00B! 0㨀!!3Ba<T +PQ<p@9^Jp@-P`GT0ST X0S   0 T00CT0puP 8 0 upn_A-pP`@P PP 0p`1010p`0d00@d@0S0d@"101A- 1@0C 10P0C00S   0 01Q 1S 0S   0 0 00 00Q 1S0S   0  0000000pP0S 1S0`V10C1@ P0\A/A@ @-00p04 R0* 40 \@ @ 0 0S00 10 1ЍO-P`41,@TtAB4  ЍOO000P3P#00PS\0P0$Aa0Xpv40 S 00CR %05萔耄[H쀄4 10C 100C00S   0 QY40[ H_ @^A-pP@`74 XVAp4!X0`FS0 X@ T0@0T0@-@04$1$S(!(!(1$! U4@H_/O-P2TP Ѝ000 @ 00@- X( b0A*(P Ѝ @- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-P@2 X0P4 R0* 40 Q Ѝ0@W0U -,^ :!!<  12X0 0( X 0 p@-@Pe2`Qp@21S$A-@pP`P20 00@2ЍO-c,M@0pPW`$ 0)p B+2 '2  "2400#C8."<`Yw#?NW4 `Ï2`8<000Td0a@PZ `'h 1d0H0> T`X` 0ӋP0PP0C1p@W U P!T0L0X0$ P0\0 \0q``a a,Q1011410Q&3*`5WpF&8!U. P0`Pd PR0 ک 0 PSD d0 $UP= =@,Ѝp\I  B(pz`1QES 0 @APc h00<  W0O< @@ Q]? P q`F pఃd0 cLg1( @,0,@SI$1((0(11 @^en_(TTn_H_L@-@`z0$MP00 00 0`0@pN0 00  0|0|`0@0p `0` (X00P0 `0@00 0z$Ѝ @^,T\Tn_NNn_ 0?n_-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-cn_00@-M00|0|@| 0x00c00PP  TTLP <委80 0 Ѝ0@eh]@^Tn_$]o_TX?,,00 C#' ,00/<0?00 Q0000$  B',#  /0?A-@PM` pm00 0 0! 0?P W 0  \ \0P  PP O0yЍ$ 0  0 PQ_T^p@-P@=0 PKx0iA-@P20t0 3R 0SP` pK!VU A[0S?0G-0P3x0@ |0p `V 00 080`03/V/0 0 0  @-@G@Qs@-0PQ0 7 0@S /000`ЃЄ 0S // @Ѝp@.-  _x-xЍpӀO-M` 0100 R$ 1S 0S 8PU00Ѝp-@0p 0T/ Z H0 SI0X D- 0X?LP0QP0 0P0L 0LP0@L0 0v0D0C0TQ 00CS0TZpL@TW000S  X H0 S00-PW㼀H@T U0S0 L@L P0RP0 0L P0 0@ H80<$P PUTpW O- *p|x|@-@!@M8 R@Ѝ0@ P00S 400180S/DЍ00@-@DMP @ P40$S 00S804000@ 80@-,M@(P M,x u`0` 0[{pP#`,Ѝ0 =0c?0h0 ``0$000`00 `P G{$,80S _,$F $8P$?$$nN,xo_o_TO-828`3 DMQ$200S#pDЍ@  #pP 0?S0S 0S 0SX 0S S= S p8@TX +0S2 ,V5 $0@  8P80 P p@@ C000HT`+0P 0R:)++H RL0+80S/P L 0VP0@0L@ @00000+~V{p| e aO-LlM3q0@0D08P80<0^+(08 q'+00S+@TN @L P0RP0 0P0L ʘ00C0+3`0\ 0SP0   H  $X0L ` < & 0@ 80H<^+00T` $VcH+7P :+\  H 09/` X[ B @  \   0 P    0  0 - 1 [  b   x& 0  X7I*JYE#p|{o_x|O-X$"0X2 P00S# Ѝ80S 8`a0Z@0 Z  P  ~  P0$ P0?S0S10!puPP0 ?*00CS0+ w*  0!0PP0X#*UZ P0S00[0S [ GK*T ꠂ{x|C-M 0`p` @P0 P 00 00 0 0@Er?o2P0S RR! %*Ѝ蠂C-M 0`p` @OP0 P  00 00 0 0@r?o2P0S RR Ѝ蠂O-!\'m@P =mk,A)U(P m@Ѝp8]Ӏ@Ӏ{o_o_lTG-@1@M8X6 T`p P1?L9cϠ1#8S:,^$CT S:!$C(FZ  PP (@ЍR  Q R#P@ R 0S H0R 0S(@ PP00S (HR L0CX?MbC-pMW(ڤ00W$PP `@P  @P Ѝ0 S 0 n@#@ꠂ@-`PP @ 0 0)@ 00ЍpA-p`PP @! @8(@00000r(d031,0(V0*H00V *W  N@0` @@?0@- Q 0 Ѝ@- 0 ЍC-`pPP @- 00Y 0X3A X% X, @@!R" R R 0 @ L0'L00L0(0 9/@> ЍP 0@00010CS@0 00O-p쑐 WMC @`30GSJ =PP4 Ws 0 @g \GXNY`P0X0>[  ᥟ 0 03/@PF0X0>B  @< W10 PP@ @ЍZ P@P b @P  OWP@ @Y X` `  i@P Y  `WU U U U$ U8 U\ U8 U8 U8 U8 U8 UX U U U U U$ UD UL U 0,Q *Q : w@  0  @001 001 000       @#000 S U0j 00C 2 0 0 00 3/@P 0  "  00 0 0 3/@P 00 3/q @ @00 0 0t 3/@P 0 0 0 0< 0 3/ ,10 0 0 0 03/ 0@0 0 0 03/@= (0pS10 0ὑP@0+@# 0 03/0 0 0 0 00 @@?~f}f3{f@|f@-@P 9p p@-@P0P @ 003/@p@-@M P ZЍp@-`@0P @ 040S-@  3/@pp@-$M@P @, 00`V-@% 0 10 !0S! S S@ 1_ 000 00p ql 0 006/@9$Ѝ0A-@PUP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  pP0000Ѝ7@-@P pP P Ѝ0@-"0`p SB@ pP P`0 @  G-@`p W T0#03V0SP (0S0P p(0SV @ 1!H  @@ PU @P-dM"h0 (00@#0 00 ,8^dЍ`UA-0P`p@0 TЍ@- #ၱ0@-zG-P1p SB@>(21X`1U @ T 1P Ѝ@-050 ЍO-`0x#MPܰ" 0$0DP @Ѝ(0S7P (0S00SS @@S V X_ @T    Ap0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  &@P 0 00000 00 u-P@|  @u0  @P @k0  @PP (x[1 01  010r 0PPQ`e0 @ @[ XT`UEp@-0PS@`M  P0 Ѝp0000 O-14M`P@X0`0CS*qAP  (0SX\00X0 00 ` X 4Ѝ#  0#[ y#0 #]O-0p IR@4M, [P  @P!@T  @P @  @0` @P "@ 4Ѝ?@-@1#p0t 0 0x0: 8@d#p@-d0@P &r"0@3@#p#&r"0@3@#L#p@-d0@P h0l (00@@, p"h0l (0, 0@@1#p@-l0@QP 1CQ 1CQ p"h0l 00010#p00f@p@-d0@P0S S p80`h0pP""p0@`]]p@-@d0P"@p@"p@-@d0P"p@"p@-P@P @" pp@-@P` ᡚ"&'00F= 00'`P000@0 "pp@-P@Y"A` h0l 0H0E`P &r0`1:0@9"pG-0SP'@  pHPP srF +"h0l Y^:0 h0l t($A'Q"ЍX#x0S `F"P000p0t 0 p0t 1p0t `0Sp0x0 t S PP #`PA-0SP-@ `!phl 0 y0S 0Q h0lt $@!  ШPX!x0S P!Ѝp0t 0 p0t p0t P0Sp0x0 t S PP #PG-50S`5 Pw`P-00p 0 0(00 0@ l!x X@V00y0hl`:t%+  @ (0300Ѝ]o_o_0 0R0,00 0 0/[s@-P`00@t  PЍpp@-P@H`%!U88P@P PP@ @V!pCCCs@-@`00P EPЍpQ@-@ @ @-@%P@oЍ0P :0Q:///0/P$ Qp@-$PP $@* p@  0/P$ Qp@-$Pp@ P $@*  C-@`00PUH@ $P ( ЍC 0S 0S=00 T5 0` 840S$p  (PU z * P e c ^@ ЍCǍ EP ЍCCCA-P0`!Qp# `!0   ᏇPP   PP0S ,Ѝ@@P! P0 0$pP  0 8804P(Px,0 0Sdd$T0`0 pP4`; 0S G3 Pp_CCCG-SPM@gM PP#@D V x0St@P:0  00 0 , R0 0300`  f@P (,H4@L@$ P  #@P ,(PЍ(,0( 4<08@ 80,0 (@P$H0Sx 40Su UVw PP0  RS< QQ: 2  d+& &bR0@p 0S4#,S  @P @PP `10࣋#h0S00 0 ^@Pa Y 1t1U0UP1UX1Ud1U $0D@PR$ 0RUp 00 0p[7 *k"*A 0 BQ1U1U1U1U1U 0  ! 0C?o2S 0S0S000  p S00S00S  pP BpN@Ap_0@- 0@SP$M  P 0 P     $Ѝ0 0 R  //p@-`Q0Q@0 > Pp00p 0@-@ 0P  P ЍC-@$MP P 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V hPPP^X V  !p_@Bap_@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P R tT00#T0S@D0PE0S 0 @VP0P`4ЍI@-P@`{P 0N Ѝp0 ` O-R@|M aPP 0 4 @|ЍY 0,Q@! 0000 1/@P0qlX X@` @P V  8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @Vо (( R LP0VP Ṿ ç@I0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0S tT00#T0S@  T  0h3 LP. 0PED00S 0 @UX0PS4ЍӀI@-P@`mP 0@ Ѝp0 ` O-R|M@ SPP 0& @|ЍY 0,Q@ 0000 1/@P0qlX X@`  @P V 8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  0I3 L (0X0B 0 R  @T᳽ (( R LP0TP ᜽ ᦦ@IӀ0@-0 0I ЍO-1M@`0P 0o @Pf#΅"^0@@A-QPp Q! Q`+Vp`@j2` R`   Q`02@Q20C-Pp`D2 ~ Ѝ S @ R0P0@A\0 00\(0  #i 0R P A-`Pp S@"@Q  0" R0Q@D0 00\ 0@  "i'ЍG-`VP:Pp W @ V9 0 +PP$!i2 02PP 0 ( h @  &ap y a00ЍnX ,]4]G-` R P0S0R@9@ 0+@P)V  U @$P0p @PᾗP`@ P0 Z@ ᑩpW عչO-0TM00S4LUhLUPU|PULU 0q@P#@TЍ0 0@P0t 0Z@P003 @@3 1P00.`@$PSpW$0X3X$p^sቹᅹPYZ43Y4P0U0,0) U 1 #$, 5,0@PU00P00S W 1 !, #,0@ U00P00S V 1, @GDTpp 04p|0$00P ``p0p$pP ``  }o R<  <  Fto P T R , (u( $ , 0 0@P00 0$0000u  Po R<  <  FGo P T R , (H( $ , 0 0@P00 0$00NlP@hP 0 03/@NT@O@N@`rlrĀp_ B @-{00S/A-@P`p 500P0000 0n?@r?v_`RU 7A-@PpA` $0SH0( `@ $ 0R`0P p@-P80@T ,+PpAD0O-"LM@!2Pp`0 < 00p0,`(P$@ @@ @<D@a10< 0D0<0p,`(P$@ @@ @P`D0SU '`Q`1 P0D 0<,p(`$@@ @`0 010D 0<,p(`$@@ @`0 000D 0<,p(`$@@ @` 0 000D 0<,p(`$@@ @`d0P00<,p(`$@ P@ @D `LЍ p_p_p_ q_q_&q_4q_ Q 0 NDDp@-@PBoPPUP 㗷(P75p@z㉷ R00 A-d0@3`q00CS0 .<rPR&U A-@p Z0` 8PP QЍ@PP0 PP 0PP  P1S!!1! pW020 ( P Wm@Dp@-@PM TP0WPP+@@@`V& WP0@0@ @@@0  tP|0 @[T@zW PPPcL0Ѝp80@L04t]DBq_0?DDPUG#_l}p@-@P`0P ( R  pU  @.@p@-pPPM @P Ѝ I@P0S00C>S@0`S 0S@ x⏟10=p0@-@M P P z*] .Ѝ0@-PM  @P p@P0`S  X00006Q  @ЍO-@$M 0Hp,0`  PP #PP<@3 P@P  ^ (  , ^ !$ R W  RR R0R Pz@ \@80j/ 0S(A P? 0W`0" ؞1 00 0 100嬡@8`pP= @r  mP $GD1 00? 0@0 4<00000 P L Py0 00E pL0 T# $Ѝ0S@1P^vod`rτn0X@Sk/1!p@@PFV0ꨂ]Jq_Sq_o D@D0p@-P @`M P  PAЍp/O-M p8`bPP @nyd 0 S/ (PЍ"V   0PP  `0 200P"  P#PP(P ` 0S:$ 0RCYk00 40i!  @ 1@1191$0 PSh@T bx0S @ x ⹈|0 00$0080匐$00$0 A( T 8 MB $[ 0PP U   PP0 #U TQ  @@Ѝp@-p|M?WP$x AP` 00`0p 030$Xp0p~PP W G>P  |ЍӀp@-@aP1S @T 0S 0QU00001501 0S pPPO-03pP*@`ᄠTH P 0 S E @ 0SqPP02P0k,^C-p`$MRP0P P0CCP0 4P0Q%@ RP0 0  0@P $Ѝx0x E0 ` Ep@ #P U<@ H@U  *,^_q_@-`PV  D@P  ` 0S  @QЍp i@P 0 A\C-T;M0 0H S@#* paVP_P  @P U UЍ6@A-p@WqC0P !@P ?T0003a Y@P  *@%$q$Q W@@-0P@3UQa .PP Ѝpg$Q  Ugs  0R # @-0S@P ЍG-pW@ PP F0`0Sk  ]@P0S  p@/p@-@1P 0c⸙ iⴙ$ Q$@180pfp@-`R" 0P1S 0@S  PB pP0  ; 00p4 p////// B 0@Ps //Q 0S P 40 P0@1S///p}A-@ t03@`P |0S 0 R0`h d0P0U TpH 0AD0Q00C0 R0 Q<Ӏрp}G-0@`p @M(0 0 <0a0,$@ @@ @P<@X<0S% 0 00< 00a000'>,0(0$@ @XX00P000a0,0($@ @ @< X@Ѝfq_p}HuUkq_LtU0_C-M@pV 㶯0 P/ `㬀嬐0 V:f xT` V 1e@`嘯VЍ0`1S 0 + euq_0BRUbPEQᆢBDU"XOW[YgP @Pa X g 0Pe Z  00XWYPELD  0P P 0  ~0P P  r0P P   f0PT P   X0PrT P   J0PdT P  ,W < 60PY 7  -0P0 01 0 100/oX" R0  .0/oW" R  #0/oY" R_  ᕰ 0X   T^p@-P@U`0M  PPP  ޿P P 000Ѝp@-@PP4M  ȿP0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V PP ᒿ@P81 00HA@P @ U ̪Eߍ^@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  OPP P  FP0(ЍpE/08!PR/p@-SP@HahtP@10D1@A `0p 0 pO-0@SP q0S 0`Q X280SP81X0S >`0@ 0 B0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!%&00   0 >VU@ ЍXU  0 L0Z#  P21p ppp pp \ 0R 081<10<1    (PB(    ЍO P `~HD\^A-`唀p?`@T|@0C0୩P@PEPV= 0 F0 f021@& 0@@AHD0?@-@( .~@p@-@0Sp 0P R @1S@  0S00p@.@-0M?SV1``0@SP T;8pP @ S @Ѝ$p!W00SZ@@D@ @ @@0p 00Ʒ@P@T %5@Tt T T0 d0 Ѝ@860@Ӏp@-@xMP` x }` ⳽P0 xЍpp@-P@xM`x }001`0 0徴0$ txЍp@-n@PqeM  w}U 4 喾eߍ0p@-MaP. r@P 0@ 9 4@sT@ލpO-p0A$M>SHL0&0R00`A 0 0S9 S7 ZZ 1SL0  3 [( L0  3Z P[0w30S x3 [0t0[0(뽷Z Z[1S W4P0S 31@0r | " S 0     X P   P L  `Q((L Q`Q''L pHp Hᢲ"!    Q QpR RGE 00000 0 0 00 y2XP1 01 1007[0b ZZ[Y 10SuTQW4P  j|2 020ϐ0V000aPx0S 1$ЍP101 1R 0  02P P0 4P0 PZ[|}q_@Ӏ$]Ԁ0@-P@P0 0001 00PP 1Ѝph10IS HWV@-@ 0 P  PQ  Ѝ0G-M P 0`P'qW`$ 冢P 00S,@0)0S( A @P|`lP $P Ѝ@p@cL0 `AW0@ 000 0b`P|P Z 1 S* 0S :QUuY P ޡX סᤀ\ᤀ<ӀA-0MS90PS5 h@Po`P@p @@@1 00P 1@6ᤡЍQ ϡ1$ 嫡@깡@p@-P@`u 0SP S00C00 xP|PU x0sP 0C0Pp?U p0PS ʀ000h0S x0UP@-A0O-@`P |+1Q>C/1C  Pp@BX1QE 1CQ [?0Q Pp@3u0S1::8C81Ppf0 S10011000000S0S: R :SP0C BS000;LMP s@s@~f s@-@9X0 0 0h0V@2Xp@-d0dP@ 0\@,0(@@T@p X\@,`(@@T@Xp@-0PQpl0@Q `0Q X\0S0010X R0*W0\0pp~fTf@p@-PU @d0`(0p`h0Wp Wpp^p@-@d0PWpp@Wp@-P@PW[0[hp[pA-@Pp uW\00tp00@`0W00F= 00'`PP @-0 @0 hⴳp$@A\  \ R/ C-0SP)@ `wW耟 hp\ 0R$S$Y#P0S0 0 0 ᬲ0 P0S00 S PPTW ЍP S KWWP\0 -PDW  fP@p@-A@ P5W\0S`V0p@4,WpO-50S8QpP Q1 @P)00夰 0 0(0 坠`h>pOVWKK0 ZV%+  `Ⱦ,03弼00 Ѝ@^q_0p@-@PቻP D0R [p`V&[VQp p^@- M0@ P  ЍO-P4M`UXpPP LP  81R  4Ѝ@VW Z8H0L 0P0S XX0 S']OH0 L0 H0P L RP 0 H0LP Yp 0\0X0SPP0P:OQVպ O^ɚ;6e@-@LM`p ₴P P0U(P~?oU20S  凵LЍ B 0  @o/p@-dPp@d)| 00C/(0, | 1R@0@@1B @@VRp}QQ 00 Q10C2q0Cq0CQ0C0C3+C? R0//p@-@ Pp`p@'}p@-@ Pp`p@}O-M0(0P`p` @Z\$ X $  Oo0%DBP@T$ЍOЍ-@-0 000埴Ѝ Ѝ/^ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzj}}@- P}p@-@,PZ080f(dp@}⹐s@-Pn10@T HCÐP4N(Ѝp@y DػPЍp}}A-<1P@4"000000D1h1P[PYP UD!  _0`a00h W!F0000Ϭ00000UL!000000D12 !_0 ? R2UUUUȺUUԺU U D P 0!00 hP  U  _?0ShPS0C°0,`0(@$ <08 @DЍ}r_UXU9_r_r_P_r_r__Us_- B 1011 S!1 0 !q 0$.}p@-@PX0U00 00@1B  HpDP}@-@$0  (@p@-@P LQ 8Q  _? = 0>;0p0<0l|Q hک$p@p@-@P ` 6c/0000`0001S 0V (pƨ}_Ӏ}A-P`p0| @@ @@1B  lAT 4/0 #P@P }p@-@0P#PP@ bm pX?}@- @$S^}G-Da@ Q8# 0 4 0 T 4 T ( ,8q X( ,:T% U' . 8 < 8 $ < $  @ !    0P @14 0 LS0000 ?X#!D1  L0S81  UP hP000@1 t1S 3/P0000  P   +) 9R0\0[S < SEK1 C/oS" R 0Sw rX <0SP@4ePR? V1 C/oS" R   ^KH090KW1 S S R D15 q0L s `D15D1G!S3  U@n P; P1 C/oS" RQ1 S S R VBP1 S S  b0 :  8T!U1R3R1 C/oS" R Vv  & U1 C/oS" R 0<0嗀T1PSPSPUT1 C/oS" R D15D10<0 U  P,M1 S S R# _ 0 R P /  *Q 000S0>;9 H L1 C/oS" RP N1CoSQ/ q P P ph p0a P P lyp0Q P P V  "@ Z1 S S R :L 00 S   | 1R0&,`( dP"YE U_ H1S I1S J1S+ ) U' 0 08L*0  :/0H1PC_oSRPU  P PEUP#U PE0 S = }<^p@-@AK `P @2p}@-D1 M2D10@9000 00B P090 Ѝ@-D1@ D1L 0X1SY1SG-@LAP` p VW 0 Q(P6@QBYP1PVW) ``&@1B  U!!|0R W PP Q yV t| 1RWP 0@1B  $PW 0}p@-@pP ?P,00(@@p0R?P(,00@@}O-0DM S @0 P`#48@3 @(00.D 91 Q/[ , S) \4P[01 0S,OpDЍI "A3Kp8W`<0}Yq00WX03QHp=0K Pp # d/ bQ8!  TP h P  @! t!R 2/P   "Q8 SQY0B@0T 0R2 @A0.@!B +@) Dp Q gB("008  R(00C?2cO 0@CdB$@GSYL0S800ڄ0)T0S 0  |#pR 0]pTX!R#W W#W[ BfSQQP 0 S W] 0pPXw?0H SQ00Q00SHh upt!W>Q; 0S  R5 HQ IQ JQ  R(`!`}ӀX?gfffQMbO-M|>@QP`q P\>Q 4P>0S%D>Q 8>U9 ,>U1, Nh{.23i 3!1P =U Y-23=QЍOG=0S=Q%>C0CQ X=Udl=U0 GL=Q Kk0CQ=0CQ(=0S =U& =U2<U<0 S| P 0 :/zh| P 0  9/TX<Q P<U 000<Qw $<Qs <U4 <UQ Y_@ P]  z T;0SV[ ] SZ 1 0SV [0S PN X\  " D P 8;ZP5 F Ѝo ;Uq0CU::U< LQ0CU' ? 0CU %40cSr\:*0#Vl:Ut 0CUPuG p 1 0Rd[0a PP? SUUUUUULUUUPU:0SUUU\UUUUU9U908p 0;9U 0CU 0U %40cS KS V0CSt9U l90SX9UG 0CU1 @9 I0CU00 C0U %40cScU 8U  0U0{0p8UEPP[ 0Sq l00 3/ 03/P\  8/ =@8U 7UL@ 0原P  ! R[   Q!0(03/G7UD >0UR >C0CU, %40cS vS<70Sl70S PP7U ;p0p p1S 3/P HX0S00004 |000| 0C0;PUPP8v80 0R01 ST 0H0HS^PP' 0D 80< 0P@dP ^!$ҟ$Q^Z @Y 00\T 0< sx0S ! S f[0 0S00c0a1 0R[0 0S00LR1 0S[  $0F@19@1e|00@1$0\1(0S`1 x03U D1"    2D1 0R810<1D1  0;; 0D!"0D1 xNi0 8P # D12D1o Pk\0D!  %<D!0 0<0ozD10S 0RS P100100@[00[0NP xPP0S ! S,[0) UUXeWPP 1 0RPFPQv{0 r [Pb 0S ЍO7&ЍO& Retrtht@|ft,@}0^t tBt @utt€s_Ȁs_tCt gtӀX?f@t nt ot st@jt@wt@HtH~ft,_}D3_p@-P@&U0  @  @1B  !0Qp00GP}H/H!/81 , p@-U1@ S S R 0\ <0 uP 03/pT1 S S R 0<0l1S (l13/#/#p}/p@-P,0@TpvP @؂/@-@PD0@PP  80P  R 00 0}܂p@-PPL0@T 0S 408 CTT 00 0p@}؂@-@P({$08 TT 00C 0@}܂A-@sP/gpPP` uPa00|0p @R 0PQ 00400S  R  0?}^؂@-$PP 帨܂s_6s_@-@X T08 CTT 0S 0V0S   L}/܂ 8080 1l1S 0 0//L 8080 1l1S 040//L 0 601/Lp@-PX X0X` 601@0003/000lQpL}A-pt`P@@@ @L0 @  ARSD1 WH@@@S@P0/@(0, P00C}0 /@-P0 @"6 0<  $0000P0@{Lp@-0 PQ"6 0 A X0 0 X0p 0` X0 0$_0Zp$Wp@QLO-0lMS 2P"0 & q`+될@@, 0 XY 0X0] o@P@  ,Q,#N%plЍ YY 0PY0D lЍOo| R  @ X>  ,@P / * jo@T0@@ @phdRd #e@P o@T 0@ ?o 2R0S@@#@@L}O-@`2P"0|M & tr< 000 0 @  c L Rh00+  0Su 0X#00l ,TdRd #AQ@!@1 oPip @``Q` @P R LP8p UXf<`D!L"$ L\ "P R (R~ ( 2/7@T R R TdR`1d`#f 7oP@h @0``DT  IMYn 000 |ЍL}G-`!1  60QpA@0 @ |Q   XP YQ Y.S  Y SQ@@@@ @S @ Q YQ 0@L  Q S 0 T @\QD  @L}p@-@p p0 601 R R p@ Ph p04y p 0PL^}^p@-@ Pp`d0sp@}p@-@ Pp`Wfp@}A-p`tPH @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @׽@WX}@-p0Q0A T 0SlAOoB@ 8T 0SlAOoB@ 8L}A-q`0S3@Thhz0VT@ PQ]00TS@P R P!Ss0@@ <01S`4@0Pl01S TX`0ALws_k_}A-@0` F@PP x0x0q@{l1S XPH0@`l1̀0003/D1;D1PUL}4UQp@-4Pp@$U0S@@ՏpL}@-@ $=T@ 0}L,sr/p@-Pl0@"6 0\ \ a* $83 0$00+p@WL}A-\A0` F@pPP840101@0@$l 1810<10D1K<@1=`1\1l1S000( %0 03/P @ 0)P \PЍ00   0PP0C0 }L+p@-PP0 601P003/@@epLO-졟p3`!1 ر 60P@ @` 1 Q[  S%L0S> xq8L0SI@T @k@gT L0S8L` VXP1 0S [ @ @P |< tw#@ X2@PnT @l1S 0 03/@LX?}G-`$$ 4 6 0Q 4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;oP `3R X3Vl 9>C1CV %83Vm 0 $p 07/pp{ 0 ppr0o 2 Rk0S Y`w2V, 1\0CVh||t2V" 0CV 0LR 0 00($2V0CV 20S0S00 0R 0 py00u 0R 0 0P0E>Sp`D1Sh0 000P|00D1  0 1V '1V 0CV X0@0X000S80 @  UQTQR+ X @0 X 0!p0V T00SRX @0  X L`t Vft_t u wt@}pt tttut 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlzp@-`@P@U VB7P0P0 0`p@-@P &P 0SB000p@-@0SP  \P 00BS0Q3\000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP o0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 PSpS 0S~  P0000`P  BR1 " 0010 0000S000ps_O-`QM@p0 SB S0S5 000 0R4P 0PPC PE0UP o R A00N \ᡡ:50C010 `F000p0S000Vl  P \ Ѝ@ ࡡ0030c00 [ s_0PPQ/@P - Q^00@S0\3} X0P/-0^  0CS0\3 }p@-@ RP 0 BS 0 \0C0P 0CS0Q3\R  pp@-@PDpp4031[  10 P /-[  \ Ε@- @ [0  P p Q  Q\1P!  S[ @ [ @@茕@@at Ӏp@-`d0@31[  10 PU 8X0 @5p@p@-`d0@31[  10 PU 890 @p@p@-0@1[  10 PU 0 A@p@O-@DM p`\0@ <00  <0,(p$@ @@ @`P{-*0 L 0  `<4,(p$@ @@ @i-DЍ}^s_7@-@00P000U  Ѝ0@' Ѝ0@-@H$0S 4+ 0 S   0 }G-Pp堠堐 M@T |`  (j  : 50SlP$ v Ѝ@}Xs_hr0S/X VA-tp@hP`V U0PD 0 p@kP`X} h000@-@AM,P XLA iQ i, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01v"PLaPU 0S 3/P 㩃 㦃0$L1M/@-PAM@zU 0SAߍ@, _`P  Aߍ ``0pP` v0PS 0S k Ui0 L1S0Sp0LQ:03/PU`P J G$IMO-MRQB 0$P|ߍO+Q0S 0 S0  pL\000 0 *Ɵ`P* pߍ3@00T 00PS+ (0S(pW% 0 S!0 00S0 000$0p 0少P [030#Z0Ss ^00S@0000S 0 0`023 -0P_W0 H 0L000P0@0T00XH 0P40@pD01 X00& 'QI x k0S QD   k ) @X ? 0"0 2" 2" 2" -0IpќXPU000 W A0 K =00Js 0( 0(P,.0( @(p,.0x0H0y001H010( ( ,~.0( (00,v.0( *(00,n.0( (00,f.p$0S02")΀΀p@-D@(P2B/B0 ?Bp@0 9B}+V+Vp@-` P00P0T0@Tp@D0D3BP0SX@$0S 3/,P}dX?~p@-h T00T0\0@Tp@L0L 0?0cBP0SX@ 0S 3/,P}dX?gfff0p@-X00@ X  $R|01X0S 3/P0ST0 R D 0 08 04 0c0p0S 3/,Pd}O-LMD@p`\" 0  t 0p,@(`$  @Pg*H" 0  0 4p0@,@(`$  @PU*" 0   4p0,@(`$  @PC*0! 00 0 4p,@(`$  @P0* 0!hh1 0  0<8p40@,@(`$  * 0!1 0  08p40,@(`$  * 0!00 0  0 8p4,@(`$  )D0 S @tPt`tpU:T /LЍOP 0"S %@LЍ^~^s_s_<&V0^__~$P00 !XP/ P/ R/X}d@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P0ӗ/^Qp@-@!@3PPP@p0S @-` [i ^s_p@-P@eP`  H0S p@/p@G-`0P @NP D0S G/PpU 1 !|oPGPp@U 1 !T Y B BR !  goP @U1!W``@- @0P @Fp@-PP@p@ J60`S% S S  p@0S S460\ FS! S S Ԛ|xS S p@讉0P L\ 1 p@ p@ p@dm_t_"t_ t_=t_s_t_t_^A-`p@0@TP0SX@0S 3/,PdA-PQpT0@T0 R X@`0S0S  3/,`d,0(0 0#1P! P #/t>,/0@ S /@-$0 @PЍ#\G-MⰠ P`p ` @Eh0P00SS-ЍS000 000000@#?o2P0SQ $0S S S h 0QQP<0H p80(0g$00,?X.^(?$?C-釟M|@P` p|Sp0p $  ᪆0` g2 020202HX00#ߍX5Vp@-1@SHPÙL0S0L0 HHLpP UpH@0100p@ EHUH  L00L0H0P @0` 3T^ p@X0\ /Mt_X 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz@-$M`0@TPp#2Q12000@T ~ODT3"P%QR 00 0$ЍP0SX@(0S 3/,P ,0S 3/ M10@dX 0O-DM!3Pp'`0< C (PP00p 0,`$  &3 0P(P?0l380  04p,`$  &03 (P?03<0  04p0,`$  &0 000'Ȳ!2 (P 0  04p,`$ &0 000x!t2 (P 0  04p,`$ r& 0'!$$2 (P 0 0 4p0,`$ [&0 000!1 01 0<(P04p 0,`$ D&0 000!|1 0< (P04p 0,`$  .&<1 041 08 0 1 0@ 0<  哑 发0P &R+3'! P<0 僑 UH0$z<0DЍOtR_X]ct_ ]it_46V,?rt_(?~t_$?t_7Vx_t_6Vt_t_0:V,/.^A-@`(pP$N!$\A`XP 0 0S/p@-X0PP LA@P 0 H@Q000 0pX@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` PP0L00H@40 400;\00T0X0XG-0MZ北0 S 0pWЍ@L\ T 0E0 0 uP@T 0H0 0E0 0 D pb` `FV`!  WepG@0t_t_t_P/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ/\/0 ASQ/p@-@TPPpP@p$00$/$0 S$ /0S /@-@p@-$PUp@Qp@@-@0 ( 00@Pp@-@s0 0P0 p!R ]100 Mt_X RA-@P;bS`:pe@P PU0P SA-@P;bS`:pa@P PUn0(PPp@-P IP@ X0@p p@-@PPlTp00 00FS0c 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 c0@DJ0000CS0000`VTT`pXO-pPUK `V#:S`F#V@`B @P< 0< 0 !000 000HL=lH0H0`0000%PH0 }@P 2V2(0 0C(000(( 0 > P(@- c0O-rMP`@0 ``(`0 0`S`F 80000U V0  ( R(PE0Sv80 0pfW &R Y < Q<&0G 3SL <P 0F 3SH0L RP \0 = >R 3SH L0S P0\ 0  0CS fW< < 0CSSp10U 1 !#N0 P H00 < 0CSH L0S,00 BW 1U  1N@rPp@ppWt 0q 3SH0L0SjU 0< pP7Ѝ<ppP U(0% =0S0%8000T   #RH L R!Y B/o" RY0@ 0C0pfV00 `g000 ; Y 1S  0 t 00IAQ00@0Wp!S  a000P`V PU @P@-P   Ѝ@-0000 ЍP/@-PPQp@-pp当`P@Pp0 0` U Pm^.u_@-@P@Ѝ@-  sP  Ѝ0bSG-@9p`PP2 0 i0 0  I,b0W`!V`! V `!0 \a0pGI0000CS0000@TWW@yPXO-PR``Ap0PPPM 0j@P 2 (`200V [ ?@P Q Ѝ00pJWp!fW\  W 1+#  ` @PZP`F R[ 000R000 pXA-0@S" `;(0 S8ʸS C< 0CPHP_P (00 A2(0000PP 0 06@ `.pP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP ``pA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` 0l hQPp000D vVQ@%U 0SPpGW0pUv    0  P@ 0ЍS* v(`  B'(00C(0  B 0E 0S000 0 00HLhH0H00v p`F0Sp0P v B R ! 0 3SH L0SP0\ 00<0Cv S0!0  BR ! _>u_w^Qu_gu_@-L Ѝ@-F ЍO-Pj RP@  Ѝ0S@PETUT 0S     @ QHLQYUP`C !ZP 00YPZ0 P 0 0SP_pJ^  \ RU [ #RHL RP \  $ #RH L0S0P 0 , B!R \  0 I0000H  0CS  B00Q 0    ^  B PPZ0 1AP? ` ^00C0 00 000<00q^^G-0P 倐p@P: 3  0 0  000HLPgH0H0`夀V[^xPP P  0  0 00HL/gH0H0`>^r@^u_/-/-/-//-/-/-/@-@ZX-@-A-PUp1p!0@W`DS W c cVdPW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  *IXP  ]W`P  ]`G-4pPPP8 `@P 00 00 `Ph@ЍG-$P0 Sp`M 3Q0S Ѝ@50TZ @ 00040"0P 0  0SD20@T D@DT ^D2W? @02W+ WS M0P{H1W0To 0Tl  o  *H00@`0p @TP100C?o270 T:0 n;xT^@P# )0 ZL 0 0S0"7  %? 3@ 0S L IDiiip@-@PPPU@` \`Pp Bp@- P`8@C<0P p@@0PppPp@- p0Pd00S P0pDP<@80 @ui0^EFp@-P`0` 0@ 0AT 0S`0S@ 00 0pFEA-@Pp G, 80R) 0 R) *`00<00@0 0$0t`|`p00S0x0 00P0:0"`P@@A-P@p^0`,PVU  AgVG-41p!,10RC*Q`= X PP<*P00 /R0S /kYPPr@ )`Dr@ |A0PP 0,`8$0 Paf~<i~@<7$d@P?Eu_@-@P wr00@-@<r7lp< 0S \0LS   ,,P 0Yr@DQrEFp@- 0@0CS 0P upp@340,0Sp@-@P 0S 80 31R00 pp@-P40@AT ,YPp@E@-0 00 0叀P Ѝ0A-0SPp` xj@dTPP (0S Ԍ@[ 00 0@PF0@- P,0@S uЍ@Gpt ᯌЍ@-@ P$0 0\  pЍs@-` @P$@P,0PS E@U 僌(0SU 7Ѝp@ X #!Q *@Ѝp0勌@07@- e@PP$0sT@ 0$0(0S  Ѝ0O-@PDM TP\DЍOlQ @A@AH1  g @00~,ap0 !@(0 0 <00,p$@ @@ @0 00< 000'>,0(p0$@@ @0\00 P0< 0,(p$@@ @@PP DЍEFleVG#_u_u_2\_^p@-@P8p0 ᵊ@P pp0s@-`PP ?@=TvPЍpPP` jhh0\S   @00C@0[ 0SV"40040@FEA-p MaP 3/@P@P 0 (00 0<1R 0@ Ѝ0 @P  屌  P0Q" #Ȁ!0 q@BP 0 @0@ 0QPQT 00 803/@P  Pa^DRSPFFE@-00 0 Ѝp@ @O-pP0$M 0*@Pt@P $Ѝ0 (00 01R 0 B@ L P03/@Pe `Q`` ^VZ: UPH000 PP H   } >P  @PP m 0 0 0g  `ދ #P *|0!0R:T P@1P `0S1@01@C00 P^EF@- 0000 00[Ѝp@A-M` pgP&# Ѝ(0 ( W  R  0@P  V #@(0  (0@P0C(0P$P @@$0 0@-@MP ڃP 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0p@j꜁p@-@(P$ 0 @ +p@[꜁B B 00@-S ^  ^ ^ 0^PQ P0L\ 2,@o@C-p0MP0 0`` @jW0 P 00 000 0@3?o2P0S0k P0Ѝ蜁A-0MP0`0 0p` @=W0 P 00 0000@?o2P0S/ Ѝ褄C-p0MP0 0`` @W0 P 00@00 0 0?o2P@@T 0S(j0 0wЍ萄7@-@00PW000U  Ѝ0@g Ѝ0p@-d0Q@`P0,`(00@@@@ 0,`(00@@@@pp@-d0Q@P$?R"0@@p$?R"0@@Qp@-@PmP pPpp@-Pd0@X P0<0p@p@-Pd0@P1<1p@A-d0QPp` yXEA በ4$0@W 4S@00\0`@@P@3@#p@-d0Q@`P M0,(0!  ]4$0@V bpH R\  ` !S@3@# 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/HzhzlzO-LM0D;3P$00000008000,0000Q  000p0S0p 0t0S. ``+ @00 <03/X0 Q!1P30@S ?oP20SLЍt`0S0 00 0400 \0P0 ` ATr  0R*R:@ S80 0#R00S H0S1   $0S`2$ 0`20p0  0S 0 0@0000  1S 0S 0 0@00T 1S0DD0X} p0S 0 p0p@T 1S X pH0S1 %  R  B   0  P  I4S4H J ``0Q| y R1 0C 0S @0 1 A 040wF@  0S @0 1 A 040w0@  0 1@ A0p0000p0S,0o 0 0S0R0S c,0&# 0$ 3/pp0p00SL0D0DZ qTp@ 1S0`00(0T 00S0X0S 1SC0SD 0 0T  R S` Z 00 0S 0080$ 3/ 0 C/oQ" R  1  %p00 0S0R0S K,0 03/ B RS 1@01T0 S0 (0CS0!HX!0S B &0 mNZ 004  T 0 0CX00`0@- p0S @@@ AT WpAT0SV 80CST091@010 0\2@ W qqq 0000S 0 P  0   000000C000C0(  S( &0  <0T00 S @T Oo0B0@1<1HpW(1 &<0S /pP 00 0S 0080$ 3/ 0  > M P A1Tpp 0p@STW qq 0Sqt0S? 0t 00:904#02A-pP}`@0 0S@0d00T T0T H0'&@P*${P @꜁H#x>@-@ 0@x>O-Dܐܠ`̰PUV J|_{0 0q0HP0\@P `N@@ p @@DA\02 $`k0 ,0:~U ꜁#\\O-LMP0D0p0D 00RZ(Y`t    ""20x0x \20\2p0S@t0p@3080X00t004086 P x4S @t  $V .DpLЍ00 ?o2Y0S 9@00SL 40 S R08TC0PI@ZD Nt00001`7 DR   Y;4 10R0 D0p 3/0@S000Y1;ò10PD0Y[pYY T0P t0   ~ PayP00 R0S D0(0D0S 0c 0`(0 0003 R80 R00S3Q. `# ,  , R& S 0!Spx 00 N@H0P$0  H0 `0 +@P(6<00 $@ 0S@@ [fYu0o Ti h2 0{b W p00 KK@C0`H01`:0 @a$06@0<0S,ӡ0$ 0H`\p:XP#:0 P000L !4040T 00 0C0000 00C00 R0000C0 0SK (0p`D(00(0p'TY(`t0000 Y p{ [ p p0WpS@@T 0[00Sx  @@0 p04/'@(@#@ @p0ꐄ#\xVI0O-@`'~0s@! !@-@~s|s@ys P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,0'5d0 0!!T0    !/Hzhzlzā@-0 @Q# ЍhQ:!<P, i` @%P 00@H 0TD@D0<0RH0āG-RpP`0<  ( 07`{ 0R<8 P0D @R, @ BPS@P P ㌲PP 0L00H@40B300\00T0X00 W 00 ?IX0ST0S@L@T@P(v_G-@R`1 0)"{XPP2  IT@(0 0(0PQpXT0S@L@Tp0pWP0@ppQPt@T75v_A-@R0 zp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@PGv_A-`@PpTXUd 0000 0R'X 0S UQ 1QT0S0T0@1Q U? 0 @P@?0P00@pU. 0#! RQ  3SHL0SP0\00<0CR1Q0GH 00080 080L@AUxWv_@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@hQ/T RT 0 0SXp@-@QL0LPpS  Q QP0 R00S0T@@0Q 0 00000 p@.p@-PL@Q``UQV 80y`0S0C0000800C80Q 0S L`L0SP0  RpT0pPE4{.L`ov_@-@@0S87@-@P1 < @#0D0 Ѝ0A-0Xp@P` U[<S !P  P71S010SP0 R0蘄p@-4$P 4`0?RL1S(@pP ,!80R 0,1010:01 010 `2@P 00000111010044P0P041418181@1@1D1D1H1H1O00 P -00111100!1.01 0.000003/P %V 101~hp@-L@Q0L00P0T0aPL0SO-(ppP U [  v@`(@P U U ֯PP  H@L BÌ\PTX0&( 000P 2 G2^v_@-P `@P   vFЍp7@-P@000T Ѝ000@Թ0s@-X,`0 ( P@\  o0@00U Ѝpo@-/P0P@-&P/ R/@- @@e@蛹꼁@-X0@P0X0 ЍQ#P,p@` n000S X0 n0P00V U X0, 0X0wos@-P`Q n0@00V pЍpn 00S/I剹7@-@00PB000U  Ѝ0@R Ѝ00BSp@-P@`]qPP  $0S0$S0ĕ`pv_p@- 0PS`(M  Bq@P- (Ѝp0  w@P0rV" 0;;0@P R 0  R ! 3r@P  -r@ 0 S@ R  q@P SEwp@-M0000`P @P xx00Ѝp@-Pp`w@P @w Ѝ0@-AMP@ fP Aߍ0s@-P`zw@P @vЍpO-`M؃pP wP (0S v&@Ѝ ]x@P v 00PX 00 x 0 !4* S  #@m,x@Pf!401  504DT04W0S 0 Plv0I(0=0@0  04 0 1 ::8C81@PZgPTP 0000=u3 wivX ޴|).  y /y3 w-@Pv40 3w@@ @[Ꙓ_^@-Pp`v@P5v1%@* m0`P!300$@F @1P pP% 0110 $R 0V SD1d Bv Ѝ0 `S1 @01@ !t@ 0@-AMP@ ;P Aߍ0G-L1p30Ma0$000P 0 t@P/$0 (00000 0 f@P*$0r,0 WP@ @T (xp@P , v( v0Ѝ, v ( vG-Pp|UUpW @0 S0S``F``T@PuP t@O-`RZPP Ѝpİ@0 T    R R @ 0pP0p pUXp 0pGp@@JZpP v_O-tM  ᜀJ 0X  aW RD R(@O Zp R<@P  A0$ (\?<" REP 0 0 0$ 008A 4/ 0@0BPS 0^ pP  7U ! RdY@0p vn@P 00W YtЍ0p  FJ VP Y PB#P U RYP00XP PU@ hQ @U H R   @pYT @@v_IA-PM`pt@P 400000 0(@BtЍ7@-Pt@P w@o.t Ѝ0p@-`PV M  V00 R0S@"  yt@P0V 0@0  -#  m@P s Ѝp #]Z@-%50S@,M]32121P0 a p 0y@PF0 000$000l@P& (00(0 (00(0 1:11:1010 S;305<0@T $ t t $ t t 00$00,Ѝs@-`Ps@P19@ 00003/@lsЍps@-`Ps@P 00403/@UsЍp@-pP) cP@  mPT@ 0 S05 \s nPV  n Ѝ0T@000v_0p@-M00000P0` @P #0@P P/sP rލp@-p PP`IM  l@P0 0000 0@P # 0@P PsP mrIߍ@-pP/ cP@"  lP0S ЍT@  lR   mPV  m0S0T@00v_p@-0M@P` C, 000 00 00 0 0`4,0000*PP #0PP 0Ѝp@-P4M`p )l@P043,0$0 S0 0@P $0S  @P P 4Ѝ 0o@ P T u  m@v_O-PPlM%  (k@PmB00S@h8(8xP- ( 80,00< (0 @, Q00(0D2 , 000 yr@PF0DT?0` S;# p0 @ts0S@' 10@" Hk@P↲ :`0P @X0 S$0 00  H0P #0@?oV20S@ P gTV0`D@ qlЍX0S- 0HL@P H0 Hd0wl@P`0`0S 8(,08< SP00@ S00S p $ H@P P000ɚ;6eIJv_@-@0M 0P 0#܍@-@0M 0P 0#܍G- `VpP(  R0U@ᅨPP 0L00 H@$ B# \PT0X0Y P jpP 0BS:?V@ V p O0 R $R ÕPpx0311  U`XpV 0 0F0ER/000  R`v_v_O-MP 0 4qM Q6 Q(@AU` R. 4  0$0 8^4?o2Q0S7Q=@20SF WP? U P>8@` Pj@P @0V UЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* R tT00#T0S  T 0 0$; |ı hU T00S 0@ 0v1U0K@@v_IӀA-`MpP pp@P 0 X0 SЍ000! @o0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` iP3`$00 (ЍpO-DM`  p@P0P S;# p0 ts0S 0 P0o0U@DЍ [i0Pⅲ! 8p0P ,0 <0]j0PPv_-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0ppЁO-P0㄰U`!R `VP R@ R R ppG'qZY08/07@-@00Pᠰ000U  Ѝ0@ Ѝ00R0 0S  0Q =^ @- @-p@-@0`PVp@0 `6mp@觰Ёp@-@P0S 1`0D0_H_@0L0@0pp@-@P  P @PS@-@-p@-@TpP0P R  RpPp@ R   R4n Q  101pv_@-C-@MP_` 0` P 1 p`00F_E_F_ E_s_0S PЍg_`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @A0(00M  XЍp6nw_v_p@-P@e Pp00Fp@-@ 000S0S P A-@pP`V wp崯JRp0S 0`V`x` 0S G 0S 0SDT@_eA0可6P AЁ΀䁂@-@5p@-0@SP 0S%Qʯ0S 0S PRP0*@Pp0S@`ׯ00d m P p訄Ё w_@-@P,80 S 08  @< @/΀Ёp@-@PpP 0  p@!(0 S 000\Ёp@-@PЮ400C40 Op@l܁p@-@`Pሯᆯ 0 ` ~!Ap@=1M/ @- ^  0S 0S00"m)w_A-@`pPP 00S0pO-n@PmtSc0S 0S 3 cpWp倓pW[^P~c<0880厮XJqH &n[p0 Rq  o4Rl 8 Ri ( RcpW`  2Q[ X  R  @ 0  0 PNd 0 5 Y k [ 0SXpБWQ{(帑X 0娑X  8   8  0 0Э    h  B 0 R d0S 0 0@000000}k᦭p0Wp. 00 噭(0S 00S 8 R4 S 0 0S ǭ p!w_΀ЁX?䁂΀V0S p@-0S pP@1` 0 e 0S 噭/O-PM0S@i@0%@e@`0@0  p 90e`PR 0,0X000`]4,%@P B@T ,bPOO20@j@00@0(O@10@0$0 00D0, @0_@P O\ TK0 0$pbO@00@0Ѝ @O-pDM@0%@(@0@0P'⃢ W90`P @ T0,00`]4$@P  ᇢ @00@0DЍ0S&@!_@P圬`V׬=@ 0R Ϭ)@OO Ŭ001 0P @`0S $$$ 8$0$0@0@01`0D0[H[@0L0@0@0 DD8@00@0 `@P 00S p@0@ 0 v 0Sln/ 0O-DM!2P`p0'>`B` 0`,` 0 08p4($ Px0 00!'> 0`,`0 08p4($ Pa0 00!'> ,`0  0 8p40P($ PJ 0!'>X ,` 0 08p40P($ P3 0!1 ,` 0 04p0($ P0 00!0 ,`0 04p0($ P :``$@` @0`@MP (jDЍ^Ё^,w_5w_>w_TVDw_0@-00PSUP`- P!0 C  SJ,10SF @P0S S S  @0R00 @0R 0 0@0@ Ѝ @0R00p0S S S *@@0@ D@@00S @*@ꨄO-pM00CS@z#0a0N P$@01 Rr $Q[ ! Pi@P 0& [T^/j(@T R 0P 0 P Y0 00- ;j X)+ ⩝   0?  xl  l ij  ᩪ4  B4 wh0[$@N 0  B"Ѝ@(@܁P/ HVO-@S4MP` 53100S 1/ 4Ѝ x5Rp0WWpG'10 000@5854 0 SpP 6  \" 0pp01Q+ 00? 0S*# 0p1qp00S0[7 phP (0Sh$ $  (3( 0,,'0044/$ 0 00\h[ i   @0 L00T X 40000 H@ 0C00P\0 00SP 0S0S @ p  X@ @ @0 0@0 P d" 03/@ T  ?P @0 ,00!0C00!, 0 (00  C@0 ( T 5 1R0 S8X P 0S ==S 0S=9pP0!@0Wp  09@0@0 {P  03/@ ყ0 )P7 10 10S h0S Sk{x(g9@?܁]w_^Qw_P P// R0@-@d  !0  000R  0 /0@-cMPa/`@Pcߍ0R@-@ `0S R0a/@-@ 0  R 0  /0@-R@cMPa/ cߍ0P0P0S ap@-@`P4VPu 1^P1^ps@-P` !@P @1KЍp00^00^s@-P`g@P0 @fЍp@-KP00KA-@`p PZ@P <O 1^@]@-P` pR!@P0 @J Ѝ0@-00 Ѝ^0@-00 Ѝ^s@-P`f@P @KfЍpA-@`p\PO 1/^@]T @@-P` p @P0 @xJ Ѝ0@-00 Ѝ^0@-00 Ѝ^s@-P`Cf@P @eЍpA-@p`7 P@Pi 1^@/@-P` p @P0 @$J Ѝ0@-00 Ѝ^0@-00 Ѝ^s@-P`e@P @eЍp0@4SQ@-e0/dw_ 0((00`O-QM0 | @ЍЍOQe0R 0 0p hW01h0#0@T_WPUY b^P^PPE0PbQ|ɦP@T d2`SPL90 @ [030#Z0S@x 23&Ph  0 U0 0 00$00(0(0,0 0/00$04 /< 800/@000D H00L000 HP6#%$%U  0&H & 'L ')(ᮦ  _PgU0S' 00S 0/ 圦m0  `PH0 h00P0 p00PL0 x00P0K000|@000Jsg#Pl@GGG0P R0z/G- P@ U `D`00@0$V0:Pp 01S :0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`Pl0pzw_w_G0P @-P 8P/ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/Hzhzlz/P 0%%#3/| `0R 2"-D | 1# H LH RH P LR P Gp@-P`@TQb00_Qh b_000S<@@ @DD  S d C F0SpP!pw_w_x>@-P3 0O-3#CDM  * &QZ0S00   8 < 8P`cP$PP3 00@3 YPP PP00#3W[003 PP PP00I[ pRԢ(lHg V""0&5a V00 S"0  0 ,2T"Yp1YW0P<"[x 02`  2">L0 ,00! ! (0 0 00`$  @p'1少 01 00` 0,p(@$ @l 0lQ!h1 00` 0,p(@$ P @y 0E 0 0!1 00` 0,p(@$ @y0E 0 0!0 0 00`,p(@$ @yDЍO>0  ddWGGw_x>w_,/w_w_(w_w_Ȅ@G4 Ww_Ą!Wx_ x_x_"x_ Wzw_  @-50PbW1x_000V-P @P\^\ lp@-@P0  0pYp@-``BBp ,ʠ,V P\ 0$000 0T00pɣT00T0p@p&W@-@P`XHX 0"00000 00 t00 0Zx_bx_!CeGG-p`DRDX($0 S*֣ [@P8 000冣p S R /H0$ 0C#2 BS*p@TX@( 0`00yY2003 D垣B?,X U00 0?P0` |@TX 0#0L0R    X@~X 00 000$0l0 PSp  p p0l U %NG$p@-40P (aZ@P <UP00p@-@X`@Xp@-@000pX05000  ߢ00;00)000 Q :00`P =>09#900S? ) 0R9ڜ  I S `P 40083/壢0` =V0 %c%բX 0S 1pp@|Q t  | x x |000900000 0S"ʂXw0p@ ZxS0000 |  @|    , 0C1p@ZXGpG@Gp@-@P`AMp@{Gp@-@60  `<00 08H PU 0 0_0p@/0 Vp@!Xp@Mjx_p@-S  P8 Jl0Sp p p0l O  @P  0!P ?x E4 PllpA d0ic1p0a!UP00G@-pM(pp@,`PP+ 0  0V060000T0#T20T20SrP V0 0 0 V0S PЍ0S P 0 0 0 rPrP@- (pP @ P@P $0 ><`P Ѝ`U0@0O-0Dp`8 P @ P刞븀4@<0Y@P@0 <`P Ѝ [P ᫞ 10 Vc@`0@0GA-P`pQ 09@P 0 p 0 0(90{AEAsG0/202/@o/ 0R:****0//p@-@|P0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@2H@-P`pAT 0S *0P A030#A(0000S  ЍA- P$`@ZV Z Q+ a 0R010 ` ]&ᰝ0 S(0 1D 0 (00a@00C@0ޝU *AA 0R010 0A UHH@-@0Md傝`2S D!0,0D2N0, N 40  N 84N8< $N$ @<(,N,(D@04N40DH<  8N<8 HL$$@DND@$LP((HLNLH(PT,,PTNPTTT X 4)0 00000Ѝ@)HX?Hp@-]@L `%Pp@# PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0HD?H20C22S/0@-PR@X0\M0 0S\Ѝ0 0 XSX0# t0 0 P4/0O-p048 X001 0A S *0D!000@ Ѝ  0 0i "!W]0> 0NP D!00000  `~D!000$YX)00`V`W`V D!@000t @^D!@000g ?`PV D! 00 0D!@000Q80H@-900pЍO-0$ML0  82p 0S *("D!000,$Ѝ@ FH0]`V HP z@ 1s z6 1sP` @'N0S2  1 I00>0000@001 :#:0 1!yd 0(N P U  MD!(00(0P` 0~P@ U 8D!000$pW.D!000V UH0PpD!000HO-d2P 0$MS ao@p1H0S< 1s@2K@M0S2  1 I00>00ġL001:#:0 1!c 0M P SD! @(00(0\$ЍA81T B !D!$00$0K2 @ *0.SY Y+0.S (0000S X 0 0CX:00"@ *Q' b>@ T X0 0000$ D! 00 0 HO-Mp80 0 0S:RP0b00T @ 0 Sኚ`0cV`V``FHZS弚Ws pR` $@ 0 80)0  *& [}"V v"|V P0(  0P0D00`0D0yD刚T a_;W 0 W9 .R6 .R3  ! `1~ ЍOz 0=0P0 Q L  L 00 L0`V*N ;Y*=!R 01a@ЍHHD?G-`0 S@Pap ZPp` Qq a+G(0S 0 0 /1M0Ѝ//0S/9@- 00 Ѝ^@-0)  0?Ѝ^@- 0  Ѝ^@-@1;P :;p@;$00S/p@-@P$$Pp@-@$0P@!;,0 R P/20O-@Q1DM0 00 @@@GX1pTa 0 0 @@@}G z{L0A@(0000p0<8 00 40p,@$@ @@ @f0 0<08 <0,(p$@@ @T\00'>0,(p$@ `@ @<08 CDЍ@x_x_섀x_x_x_A-@P0S`Pp0S  ! JJQPW\PQ 0L 0000 0C00S  ! ,J8섀p@-@TpP`Pz⒗ 04R00 0 ȗJ00p@(Hp@-@`T eH@ 0 StPzm0S 0R00 0 0 8000R 0P0@啗@pH@(p@-@PJ00C0p@脗(O-`40@SPp0I  0SBQ  0RPCS 4 ! I$0 0S1z1000 0PS+JGp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 00 0R0008섀@(A-@p`PUddG0Pp `P00S 0 000$ 000 00P8섀A-@ `PY00pQ+U0S0 R\S  ! 0< 0C0 00C 00 0C0 0pAx_섀p@-@0PS`#00\ p0S0S 0S0 0S0/P: P/O-EM0@1 `Q1P$ @1100(0,0`V4`!990S00,0V@,0S  C, /  C@ UK0@TK@0(S,0 0P 8U 88Eߍ880 =P@@p@@0, (p@W=0S K@T P`= I@Pp@11 00S  pI@P K0(0 :@0 0D02< (H00L0<}H@kK T (0(Si p0 W| 00$09 p=@P d8 0!40PP04!8p%T`pd00P 0J0TS 0!@00S 0 0(K80@KS`00GS@ڸ RRPH P;  $@T ^4 ,00CP1* !, J8,0S C, /  C881(P0CVS(@@81ڀp<1p@B |<T"  TH@P J0C J8"@0W JT Tn^@-0 ,0  oЍ$0 1P$0o/Q /O-P@ UMU"@&ZK8`F0F01p$@ Ṽ00U3@00 n@ T F M@*8ЍC-P`M0F000Fp00 0L@P t@Ѝ0 C /  C07s0 0p5@R7T8 1 !S X p P000`F 00 P0@-@,S(0 R @0@劔0@-@TBP00S@ S @R 00q00p@-P8'40@Tp@`0S 3/@0A-@`TpH0PU4J 0S  3/@PP0 B@-  Q &Q  /GP-/p@-@@P0S0 0S!0Sp00Q!I7`  00`00Q \R HH [P@?R C0\S\^ny_2y_%y_Ry_p@-P@@0Sp0700P 0S!!//O-1@P P 0+KPP@ pQ@-@@P 0}@-0@S 1000p@-PPEUPp@1PpO-M<00`$008, 0000 $0 @0C@0000P@ <0$@S x?0S 00@0B00 ?00000@T 0S 0   f?C0 P 00P 00001$@@Y 0 >00@ /Q 0S  @/0 b P 0S  @ 0 0T 0 P /0P /0圝00.0S 0p- 0PP 0 pQ  01 P 1PRx 0 pRn zj0 D@00 00 R000 0: 00 00 0 /R RH@D  0Dp@T0P 0 0000`0"P0     -: 0 000C0+  Q  000T0 `0P `PO0 00  ' RR T垴$/ D ` H [aH0S R 0S 00 C0H DPMH00D000S 0S0*000 0S C0S ..00000050SM /P 0`0` R   W~ UeTG`P .0`0 0 000` PH ` -[^ DP C Rf .      $0 R   000 000000$000$0 10 0K0S `00S`0SP0`  N/P`  R Q0  `P=/P 0P 04/T޳Yb.DP` -[H <C00DH0D 3TP ȳN.SO009   R C R C0&.0D00H0C0S 0C0A 000 00C 080S0S 000(07S0$0 S$ 3000 (0@ p>P @DP -- .L0 `00K&0Lp`t0P@dp@g(0` r@@[ .px.,0S50S 1 40o.,0/@ 0 P@R 0  {R P0X@}T }@' 0/T 0X k@/Th H'P`40  [ */T P P 0 CX0S 0X0SM 0X0Sa 0X0S 0X0S 0X0S 0X0S 0X0S 0X0S' 0X0SC 0X0S] 0Xu0Sr Pl:96/T0X @/T P  [:*/T lPP/@/T0X2 5@/T2 0P* 3 0 S* 0/T P P200/@0XO0S    -0 0 S%:-?/@/Tj 0X @/T TcP DS  [ */T( P P=/@/TT0X @/T GP40 13  [ */TPP/@/T: 0X @/T p'P `  [ */TD P P/@/T$ 0X @/T  P0 0 S* 0/T P P+0l/@/T 0X 4@/T1 P)  [ l*/TlPP/@Tz_I@7_:z_7_!z_{7_xJ|Jf7_[^_(z_Y^7_tIxI_7_[^v_5z_{^_?z_/T0X @/T DP980\  TF  [ .*/TP PT/@/T0X @/T P980  TE  [ */TP/@/T0X @/T  @qPp9h8/@/T0X @ 0/@ /@/@@ 0}T {  R00Ǘ0 w00 0 o`,0( 0 00/S+00S0 00 .R  .R0/S0 0 00+(0 0 /RC 0D0+0H00 00S D0H 0 090H@DT{ 0TP C0S8 \+0C00D0k+ H+0D0SY P) H  Q   4 RK 0CSHC0SC 9+( 0 00 00C0>><:=+L:+8+   R& 0CS#H++000000sC0S +H+00000000S: 0CS_F + +00 RH R=0C00D0@P *D@D00H00 0S $0 Ѝ H R /&@-(0M00    0 00  i@ Ѝ0@-0M(0000 000000000  M@ ЍA-0@P0MP?PX/PPPR`(p,0P0,004P 0`,0P:48 (P@p`$0e:PP2804 Q0C00 0,0ɀ,.Q .R: :9,0p*0 0PS 9=00U P `0P000@0Ѝ9*0S P 1*P ,0 \1/ R0S ,0 0 -`P *VA- 00S : E0pP`900@   0S P )@00WP@.@P )Pz_dz_0@- DMP ^@, 0^ 0^ ^P  LE 00 0O7U4PP00DЍ0@ ^z_A-P`p@P P 0 P0 A-P`p@P0 @Ѝ0 G-P`ሀ#pᤆ@0T00/ 0P0T׆哆8)P ͆@ ,PV  6/P 00S0P00P0岆)*P07@- 0PO @P  V C Ѝ0z_p@-P```@ P@J @FBH  @ < 0!pI8@-@Pȟ<0(H0P @I"8p@-Pe"@@ i"@pp@-PZ"P@@@ X"@p|@-@O"@A-P`P 00묀p@T+00 0S0PPP@ 0S@PV P@DžI8p@-@Q `P @ P00S Pp, ` @V opp,p@-P`'@堅0 R000@00P0Ӆ@pp@-@&P 0Pህ 0R 00/ 0P0弅p@'0A-`@VPQpk0000@@@墅VA pZ 0R 00/ 吅UPO-`M@'$Pرء$00h8P)d8@!OCAd@ 0|P p?oU20SR XPUPrN0 S   '* pW ,PÚ g9pP : 'WP#( !C8p :WX R0 R (P O%P ڔ  BR*&('W ЍX?gfff@-@jA0 !!|0x0t0l000, !  ! 40 @PAAz_Hzhzlz\ _F}_ 0 F80F80(F8p@-P`6 '0P0P0P@0 PP0`f ]0 0@0D咄pI8A-PpH0`V傄@ @P h`00 N/ V?U 0WI=.Pd0$0d0_PP @@I0(iF8 0 (F80 (F80@-0MS@PW@P@ 0  nWP W@P@ B&Ѝ00@-@P0VP0S# S  Ѝ0`@P 4qp  0'P 8`&VUP0P (`@0@ R/"A-P` ⢃1@S0101p F@ 01$@ᎃ 0ShȃAqAXAƒ Q PQ1@0108IDp@-P&000@ 00`,0$ R @@0@喃@pI8@-@P H4J 0$R 0 偃@&I8;s@-P`@P !0R!0RЍpA-`pP@PЍU$R0*PP*R0*C-cMP P P8 P/d3qpTzAH3 sr* <"( "hAS P* 5@8T n?Ѝl f?@2@ PP( PPR D0Sd00Cd0L 3/d0@P0Cd0G4Pb@H0 4R90d00d0 @Pd Ar凂@T80SK庂U ?sQ@TA孂? ? P(1x ?d?O@ PQ3* i58#%D0S d0 0d0傂D03/ =d0X0Cd0 Bsh@h0P>h@0 P $ 00$0 %0$0@威SNz_F{_{_5q{_{_{_譀^8u|_@I|_9|_^*\^Q|_g|_{_u5p@-Pw%`@P,P ` 0`  @@p@&I8O-0dM`删匐0@ p0 3@P dЍ0S @  @<PP @ 13 00 00@PM80 gpPp 0嚁 @PT0P00L@$@(01T$@T8P E$@P  @0S 8$@@@0!@P 8+$0 8000a0A8P$!P^  PBG2 RB L0S=$Y: V V4@r( V  V w #a $ V g V # # Y [ # @=0V# # 00 #00WbB3@P #0 0  hP0400W |_Ӏ|_@Ӏ8p@-P`彀\0@T Q   4 p@/$ R R @I8G-@\pP3 P000喀`@00  0'00& PP( 0@`000`A`0嶀W 0P440PP !PP 0嘀0`0V0PWfpW <4>zV #|_|_7@-`0P @P  P N?U.00,V? ? Ѝ08|_|_O-pP0$M`! 90@P $  ] P N?U.0  V? >p V  V<V X<X L<s@Pr$Ѝ8}_^|_;}_L}_@-@t< @z}_@-$0C00S@\d0P0S R 0 R 0S 0S/008@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ@-0 0Ѝ @- 0 0$00Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝ@- 0 0Ѝp@-@H0  9PH0 0\10H00A PA=00Q00@@@pX"0O-DM 00(00!1@p`0< 0800p,`$@ @@ @J 0'Q!18 P0<0,p(`$@@ @40 00!018 0<0,p(`$@@ @!0 00!08 0<0,p(`$@@ @ 0!0P8 0<0,p(`$@ P@ @  "0 T @{~%DЍO7 0@0X_^}_}_}_`O-phQ`PM@8^P 04PP$W Y~d@T`@T!~ 2P P 0 < tP { y~ PЍA @0 < tP03 0<300_~0~% @ G O-`P0M@ B2 b061(" pN 0 00@ 0 O4pP}ؠd@T`@T%~)R0t0 D 70P s t0~0pЍ  @)R0t 0 D 0P  @G p@-P@ P00CS 00 Ñ"`0St t0x 0`@x000p7@-@000 0Qo Ѝ0O-P`㸀M v 0UЍ'J0J@V@ V d< G  0PP Pz \ 15 }_p@-@P`T}*p@}`H0 /p@-@DPE}H09H00 Q1  . p@u}X`p@-l t0@SP Sxxtx0t H0; Sd0S0000p@ !CeGp@- t0PS@ Sxxtx0t H0; S `@0St t0x Px@pd0S 0\`S S PP  0S 0@ d@z!Ce@-0@  R  R / R      + 8 R QX0;0/O-,MP0S`0Q@`,` p|0PU W@@hP V   \0'0` V`p|@,Ѝd d| 5` Y|d V Bd 0p@I@IG-Q-PBM:p(1SP5R`<1@0zN@P@)@ O?P@D | P Ġ Z P @D@Bߍ  M5PP G5PP  eq @J@- @ 000 0000p0`0P0@0x0|0p@-M`P@0(@0 0`P Ѝp,p@-M`P@0(@0 0`P Ѝp,P0/^}_@-@aM %|q0U d40 H0`0L 0/0 4 $$80$S-! !Q p 8\0 0X08T00" "8= 70 00dt7`P`0FSX7 4L7aߍ7^|^*^~_}_^+b^}_~_A~_j~_}~_*\^~_@-@P (70S7@1Z^+b^C-`00VM@YP 0 Pa1pzdPU:{V0t  |9 00({ 0&R0S YP ЍPz@PT0SdP{U /G_~_p@-PHzD0@T0zp Ph@d00d0@I0P/p@-P@ p-1Fx01000.%/&.%/&  N+VU + # + 1|0pO-`$ML@PpH NP0JVN 1U㬁$10SI  @?0P 0L<\00 ᕢY  $Ѝ P1 ! V0[ V I08/P 0V+c9W p 0V8/P  H0UNR@4PP0 05/P +`ؚ@t[T0@-p0MPU U@ UPЍ0Ѝ0@ /00Ѝ0@I0    4 6::0070/0/0/X00/^-/0 0/00/00/00/00/0 0/O-QMp)a@P;y0` |a0S@l@@T&WXH!D1 @孹4y0  0S80 S 00BQ0B03!P 0S T( y '!P0   - 8y0S T  +yXX?`4_-0/0040/0H0/-L/0P0/T0S000/p@-P $0D@$@@T@px$@ @T@3y|p@-P@xOp@&y|p@-@,Px 0 0 0Oyp|Q3RO-M  @ (R00@PBU1# (pU< ` P``0 V@P 01@P( 01@P  ,1@P@  1@`0V 0U ߍ`PC-$M@`100 00(00@ 0 ( 0P1 0  !00 p0p1.p 0z.pP  # 8$ЍT    9p 9 ^p@-P@`M$ 1 !|`}+Ѝpp@-@P`M< !! j+@-Ѝp@-DMp `P7@P 0P,@@00PR(4@P DЍ .@C-p`M!)+PP*0@S+   0P0`'0e*PK0  000`0&0W*PK0S@! @+Ph-ЍyKxA-Pp@Pdu` 0/S E6@P0 Ѝ0 ldu@ 0/S 5@-pPdw`d@ Ѝ0/S 6@P000P0@/S 5A-pMpP`}@PE?`00\@4@80'4d@P IpЍHPC0S@0!0000 00!0$0100! `(0 `r,@P E*@P 0`F0`@-Mq` P2@P 0,00000@0L'4x@P 0S ,L,0P@Ѝ@0@0$0, 00:#:D0@0)@Pz@-P !M`#q @P 0,00@0000'4/@P @T ,,T ec@ЍG@0@0$0 0 00+8+D 00, @0l+@PE. G-M⨀`P p@P @P0@0&@@P($pY ,H0SD00 SD0 .R0.S 0t00Sp280x00L0 0P0&L|@P0d``PSx08x0V +0tS00.S @cS0 .R0.Sm 0W@V0T03/@PP0 `@P@U `PUX @5 0R'S)XD X 0S#YH 0RD@P 0 8 *0@X03/  ЍS@@UV r+p+0X03/ +zU v8 + qo@@@8 @-DMPp @P`P @DЍ0,00000@0%4@PP0!0S U@0SU  @ , e*@h @, )@,*UC-1@3p MaYP9+ 02@P,^@P'L10S 8 Bٯ0<00@00000n%D@P (0S" ,<q*,(0P(@uЍB  wP @P0P0$0,( <0P0T0< P0*@P(,I_@-@K@ t|O-LM05@`pP$ P.A8. $00pY[XX |0S0oS  %(p0|0|0H S4*| ` ,PA 0S s$P6Y( LЍV0 (1P Tx4Q (J`(Pf0((0pP 00 ((q(pP$P `! `G |0S 5$P @ 00P00D&P0  P0*t0 M850|0j 0M( [tZ[| 0  Y-|0 P0Bt0S J?ts $0  @2 0   0S 0p0 0%PT PO0s M8M( 0% 000010! 0 000 |0PV  p Z ( M(  A +#R0sZTU 0 xP V30040z   R Un 0 \Pf V000|00 `0$}PS `-^ ^$_|w]Ѐ__@- 0 0 0000 ЍA-pPMq@P 0@00<@@0#D(@P >PЍ(`8P(0 @@0P 0%@P 0 0@ R@T(Pr0S wI&s|s@-`r@PЍp0rP @00!*0@P000sC-P@ЀАpM0 0M |`P aQ! T@ W/0 /!bR0 ڲ0SPU 0@ ЍWh^QX?_@-@-3\M` @P 0P0 SWW0WdWWW WPWxWWW(WTWW, `@P,  1\Ѝ Pq @P +@$ P` @P$ ( PS `*@P  @P(  pQ*@P( K*@P  @*@P@ `$@P@ @ **@Pp@ `*@P @P@ 0000 p@ `*@Pv @Pp  +`@ )@Pd~ @p7+`)@P /P q@tZ@D^@-@M )P ЍG-@!MS$ ` p! WP0O80-PP%W$! P?@0Sp 0W<P0@0  P ᡙU Ѝ P@ Ȑ  P00/S S 80SP +4@+  Tz_@-PX0M`p d@P 0 0 0{@ Ѝ^p@-@`L 0P@P >*@rp @-PM p`/@P  04 00#0G@K/Ѝp@-@`LM 0P@P  *@>p O-1MP`@0D.`@ p70 0dP*[0$0P 00 00PU@ @0 3/0P@UT@H0@00'x0ЍUT*0 0 0P@0 3/0P P P@ z_@-0 000Ѝ p@G-p`/@P.0 . 0S@ !u#PPY %$@@!0S&   )P  PjP @.Ѝ @ T  Z@ TG-0Pq$@!@`P  PPP)}!$J! G}0@-Mp 00000` 0!@Pw.@P 0lP0S r%@.Ѝ@!"@e%Tp@-@MP `@P U?000,@@04@P @Ѝp000S@@!"@P4%/0s@- Q@P $P@`V300姗Ѝp0 0p@-M 00000P 0`Q!@P0 @P?ЍpG-5(M@L` CP@ q$$/P 0 00000 0H  0 00 0@P $ .(Ѝ $0R  .$0  0P$00PzP$$  . C-p0MR`P0'mP 0 3/@mNT T+ )du40000 000@S *-r@ @P0/S d-@P0  Ѝ€@-p0@ @`PP @ (0 Q@ Ѝ@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR0`00BS 400S03P R30Ѝpc! ! C- pሐP@``V`31P01 0@PP  ЍB0p@-0P@0P 000S 0 p@Fp-p0ASG-Pp@x `$&PP00S!3 T` TSb @P\0p@-`M 0000 0P@P@P T0P00L@$@(0 T$@P `Ѝp8`p@nT  %@P`0 0S030&@P 0S@3:&@O-P0!M0#q` 0000 0@PcUPd  b]-@PX  a@PF@T0SG  m@P  S @P  -P 0S-@*# G 0$  @P  0'm0X  X am 0 P@P" 0  ,Ѝ-@@@- x Ѝ@-M pP 0`@P @P`@Td@Ѝ@-M@ 0P &ЍA-M P` 0p@P @Pp@T 00 00@dЍs@-P@P 0`00@P %@  Ѝp O-P0M 0000p0 `@P   @PpP @Ѝ0@00@<0D@PN(`V@P]$0 0АԀ0:#:T0: S"  S-  S0 @,<!,P6 V, ) S  S0xy,P0 P0< ( 0,-(P0< P@P ( 0 ,<C"@P ,<v!,r@-@# Ѝ@@iЍ@- c Ѝ@-!  Ѝ0 cT cp@-HMP\0  1 1 0+@P+X@P$0`800 @4`0 <F@P 0$S@0S 0R@4 k @$d!$uqHЍp@4!$ 0Pf PL^^@-; 000c0 Ѝ@- 0;0 00Ѝ0 c1 0c+0(00@-DM @P$P0@,P00004P@P f0S00, 0P P Q@DЍ0  ,f!@P ,  0c 00 c@-0S@`@P)0P @ 0,Q@ 0P000 1/@p)ЍpC-pM`)PP 0_) @Ѝ 0,Q !!1/@P N@@B)00@-MA0 0@NЍ0C-pM`T)PP 0') @Ѝ 0,Q !!1/@P rO@@ )00@-MA0 0@OЍ0C-SDM@`p- ` U_E_@P"00P,@@0|Q4 TP 4P@P sWDЍiX@ cl`@`  @P N@0@-0 c Ѝ@- 00 Ѝp@-@M` P^@P0P,@@00Py4@P *@ЍpP@ @-0 c Ѝ0@-MPP @@0cP 7#Ѝ00@-MPP @0cP &#Ѝ00@- 0MP 00P@3P #Ѝ0@00@- 00 cn Ѝ@- 00f Ѝs@-P@0` @P u@_ Ѝp^@-P`P(@P 0 p`@L' Ѝs@-P@0` @P J@4 Ѝp^s@-P0` D0D0 0@P B@0 Ѝp^^0@-0 c Ѝs@-P`(@P0 %@'Ѝp@- 00 Ѝs@-P@0` v@P  @ Ѝp^@-P$0` L0L0 0t@P@0 )@ Ѝp^^0@-000 c Ѝ@-PH0` ;@P00 0@ Ѝp^@-P` '@P @0@C'Ѝp@-00 00 Ѝ@-P` z'@P 0 00@%'Ѝp@-PD0` @P@0 @ s Ѝp^@-PH0` @P00 0@ \ Ѝp^G-M0`@S11\p @T~0s_v 0s0Sp 0PPp?X0!(PP 0 SP? P0UPP(L0 s` 0 s pUZ0!(00PW  0S  F PP Ѝ 0sP0PP^^p@-PM`&@P @0 @0c0 f@Y&Ѝp@-  00 0 0030 SЍ@-0 cHЍC-LM@hPP$ l0S (P(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` =&@P @0  00@%Ѝp0@-0  Ѝp@- 0MS@$P0` @Px20S@ b@P!@PS #!@ Ѝp^p@-P@%0P @ 0<Q-@ 1/@%pp@-PM%@P0L` 0 0 v@z%ЍpG-PM%@P2 0 @+ 000  0- @`@0! 0 J R@@`pXP0  7@;%Ѝ@p@-PMu%@P0L` 0 0 @i%Ѝp0@-c 000, Ѝ0@-00$ Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp%@P 0 @ 0 @@P0 04@0@0S 0 00$ЍI@-,0@31!$ p@-P`Mt y@Tp0@&0S00P0@PSЍp07@-<P M@P@ Ѝ0^O- ` 0M&J0 S1 0C 0 p $@P 0  @ PT 0S@  0 @=$@Ѝ@G- `@ 0p%J0!S B   o$@P 0  @ PP 0S@  0@_ $Ѝ@@-@(e$0S( ( (0$ @eI@-@, 0{e,0$ @R$$ ((0eI0S ( #P QS//A-@YexPx` 0S0hP 0X` %p0S Q R$0gcI0@-@ 0 %?@keꄌI00CS0/@-@P $ 600C0@ ꄌ0M, 0S00Ѝ/p@-Pp0 0AT 0S P 0SP@p0S000 @ꄌA-p䀟3AT d`Pe0S @000ePU PPhdX0 $3`U3@103 P000 @I@031SQ  R R0/0A-`@P 0pS00%P P 00 1%.%V LidDPD`P 0$0 dI@-@M @Ed@ @dk|h$0l 0 ` `0 X 00  , $0 ЍI9_@_X8X0?G_1S/p@-P`tdAT`Rd\@Q p0S `` ```@` $%IA-p` qP0@p@pPP0PPPc 0 0! AdIp@-P@`c0P 0 1S 01  0S 0 0000p@cI * ' $G-PP0S0C00q0S ;$0SB \$c00Gc`c3}?@T cV @ $` R   R  R R R @ 0S  B 00 0003``}?00G$ꄌI@-P0S003@oѠ@-P003@oO-`P@& PpW@! ̀$c `#뼐崠@TW030V@ @00 |G@P WdPEc0U 0S  3R  P $@ꄌI@-K0@-E@cJp@-00S-@ `P4@P V\ WcP#@b@P (cp@@ @,JA-@t`pb0@00Lb%Pp `B0S0P0P0`Ip@-@P`b@b)PXIp0S0 R S   B3pIG-0 PP;0`0SF6P ,10S00@S00" 0S) "0 000143[00/[ Ei[g[@JO-0M<P0p`PnP 0  8 @ ,` 06/`P [Ѝ0S pZ TP"0 0p! A$[i0 000TZZ 4[ [@Z [} Z@J@-M @ [00`040 @0SP 0@00000xZ pP ;ЍL0 0 P! A000000Z@J@-M @ "00`040 @0PuZ @ pkZZ 0V000000 `!R  R  A P1 S! 0S Ѝ@@J7@-@P4Z0  1S01  0S00P00000]ZP ( Pl p0ZT000000=Z Ѝ0@J,p ^́_m_@0S/T  BRT @- /@ ^݁_@-@P@oC-PYPZ Ѝ@Yx0S 0`Y0Px00 ` 0qW PY*HY R01; 010qD?J@Jp@-P@`PZ00p@MZ00/0S S\/ //G-S `@K@ VEQA?`IQpQY 2@X@X@X(@XD@X @X`PLY,Y`V `$GlQ\n` N@PT0'0 (00 `$G6 @-@P` p{ 0  Ѝ0S0S@-l0  C0 $ , 0 P *0X峊3Y/Ӏ H /p@-@0 P P0h0@ P Pp p@ 0P0<ppOppH0 /@-@嫀XH0  .?H0 T0 0C04Ѝ@-4M@L p  P  `H0 0 $ 0p  p0T @4Ѝ(+ p0G @ A-`Pp\0 ' -P@0 00+ @VЍ0 001/4p@-@`CPP `!PP p0S X00X00@ A-p᠀PR R @  0@* @R@AR V  p `0 @R W`G-P8M`@\`pgU+ 000 00@T"P0!(@,00 0 ! X  ? Y 00 (0 D00 !8Ѝ@ 0_@- @dP HP ,P  P_ ___(00S/@-@}@ I"_O-4Md`pXP\[ 1 00000YS@) P)@&0 00U@! P1$ P00(00 T媌1 00 0@ E`0  4Ѝ-_A-`PpX 1-P1 00@ЍO-PGߍ^@-PGM`p0  @PL0 @P 0 0 0@Gߍ^p@-PBM`0  @P @P0 T@Bߍpp@-PBM`0  @P@0 a@P0 7@Bߍp^p@-PBM`0 a @P@0 C@P0 @Bߍp^@-PM`p@P 00E@IЍ@-PP0M`p @P00-@Ѝ^@-PP0M`p @P00@{Ѝ^@-PGMp`0  @P0 @P60p 000 0 00[@ST0 -T0V@0Gߍ^@-PGMp`0  @P0 @P0p 000 0 00,@$T0 -T0V@0Gߍ^@-PGMp`0  @P @P0@0p 000 000 @ T0 -T0V@0Gߍ@-PGM`p0 m @P\0 O@P 000 >@-TV@Gߍ^@-PGM`p0 G @P\0 )@P 000 @-TV@Gߍ^@-PGM`p0 ! @Pv @P0@^ 000 @ -TV@GߍA-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00I Ѝ@C-TV@^A-`0 Mp @P$`00 0@PppU0PV0 `F000pP Pp!00 Ѝ@-TV@^G-P M @P&0 000 @PV0`W0 pG00 0sP P!00p  Ѝ@j -TV@p@-PBM`0 M @PP0 /@P 0 @-TV@Bߍp^p@-PBM`0 + @PP0  @P h0 @-TV@Bߍp^p@-PBM`0  @P^ @P 0@F0 @ -TV@Bߍpp@-`0@#2000FSPVPp0PpV00p@-@PeM0 #p@Mp@-@PWM00PPMp0@-P0M 0 0P@P0 03/@Ѝ0 ^@-000 03/Ѝ ^@-000 03/Ѝ ^@-M0<00  3/@PЍ ^@-M@000  3/@PЍ< ^@-4000 03/@P~ЍX ^0@-0M00 03/@{TP PL<0 0R 0T#MЍ0t ^0@-000 03/Ѝ ^@-000 $03/Ѝ ^@-000 (03/Ѝ ^C-0M p08@P% 0"sr`@ P`L $L0 ,03/VP T 0"Y0 3:UЍ` ^@-M@0000  3/@PЍ ^G-M ` 0@P P 0 p@L $|LP0403/ 0` Zp@@T Y0P3ЍPp ^@-( "!0 803/Ѝ8 ^@-( "!0 <03/ЍT ^@- 000 @03/Ѝp ^@- 000 D03/Ѝ ^0@-P0M 0 0PO@P0 H03/@#Ѝ0 ^0@-P0M 0 0P7@P0 L03/@ Ѝ0 ^@- 0 00P03/Ѝ ^0@-T0M0 0 P @P0T03/@Ѝ0 ^-00$M0"!#!0 X03/$Ѝ ^0@-,M\!#!@0 00P @P0\03/@,Ѝ04 ^0@-P0M ( @P Z000`03/PP T 0LK T 0KЍ0T 0n0`S` 0`V,0&f j1 Sd080P0 P?!;00(0S50(0XC1PJCU\400 # (0(*40803/PPN 0S0h0 j" R 0 0S  0R dc 0S40S   X0?o2P00 W,0"&0:808 01@0P0 000@0000 0$0P 0S $@jP 0R d&<@ p0& 0S P@` 0P0 0刻0S8 00<08 `PS$0Pp @4\  0P 0SW 00, `YWpp$0VpW @d z00P0 0000000,000P 0S, j0pL00LPS 000 $0 T0h731|0X0S  »0P\0| L06D00D pW,0P0UpPR0pD0 0\0$pp00X0&PS&60DL 00Sl`,`000W 0 V,0"&0:H00H 1 0@l 0 0c60 RZQZ3l0000000 l0PPh 000 X0S 00S PL\庻`0U00S 40S 0| D0  D / ,01/PPiL0SiP ӡ 0Sv iU  %6`1f 0@ \0 0jF P00|`00 W`001:# `  H pW H {Pl 0 0/, A a3!<0S W 0# . RP HH L P! @=*V"*PU SP0t00x0*sr2\0 C >00040St 2n`0x >0 `S 0&fji0H 40V Pi0`0t`xpGP0 0, RS00W00S0 ڝ 00  F 00)0 C cl00182T TVT0 b8 QSQT S10 8<00P 00 0婹P 0S P 0S hP h 0X p0 ?o2"@  8 VPWY" 0@ ĸ 0  ٶ`0ShP $0@!꫶ា]ᵶ 0D0 0 SP QW&_\OO-CM@001< @041 0810,09309L0081 0D000H00p$0ᷱ0`S H000 )@H0  d0S_@W $0S 408 03/c bhPCߍW5812 0 SpKPP) Nh Kh`>눀X `A$00 g0p$08P 81 40/03/PP )00[0 (0l 81 0SD7  01 V 0d 81 0S0 0 80K0<`@400 0 0ᏸPP "R 0[P;?X H0  0S0000 0S 3/H0   P d0S1 g(0, 0#R00SjH`?i`V`fmWY $0S 408 03/5010 8S0 080D0S ,0S  L0jP0ցP (`,g>ڷ 5g 0`! 0  <1S<1P P0  S ,0(`,S Xj·(g $(0 L0,0P0崷000 X `<P @ p 0(`,0 00h 0 `  01/9v0 )V. `0dS00V#6:X0\030 000p0*V0\000\ R Xp0A!!\X00CP1  pp0Զ\B?l1Ph0 aX  0S 0S#6:RNƠ 0X00 000p0*X000t\ X0 0X00(0`0 T0X0S5X2 \ (`,0C6` ïf0X p0P 05/P cfUX (04 ``X 0S00`f04``L0pPX0\p0X 0P 0  <0P@0 R T0S  R q < }`00S  4  80 0 S W 5 q0 S\ 101T0S@` T0S ) e$&_K_H#@-0 000! Ѝ 0  /A-@0MPb r,0F00 00YЍ\OA-@0MPb Y,0F00 00@Ѝ\OO-X2$@LM3@P1`00 p     0 x 0AOoBBLЍ06 ?\0e@@e0 0 0 PPpTe 0S@bVeQ (T =1 0@  @& (  6, ?(#<@$8 0(@P8 R  RT 0@ P 0R 0],iPG-@0(MP3 聓0bᤶFa @T 000 0  .p0 P(0 S00 ,40P1~pp p,00 00pG<010801 1!&ʍXK:81|1 0(0` 000 :#: 000 *80 咍 ,XF00000C00 000 0C03DH8 40P*qp& D8 40 ?y#p{00H < 04 Hb#\&_x>H#8Xp@-@P;0 ?p@;G-P`$0@p3/@PZ@00@800 4/@P 40T00SOp0Vz S P$03/@P P 0Sg P H @0SI00S@0SP 00L0D 8/PP H0U00S @@ 0W5 V5 P 0S  0P P  0S 0R PP 0S P P <0 P0 ЍP PPSSA-`Pp@ TW AO-P @`TU   T0 0 06/@ ЍA-P0P`0C?o20S@  UAp W U XUO-DM,00000l h 0  @DЍQpPሐ$0 3/@P`V@@800@  ,04/@P680U <00@ p0l 4/P@<` P#<0Uu L8680 R R<SP )<0S 80R PU8<P @88`< V0S@; x0S@7U l0 0Rl0 @P*   03/@P0 @t 4/ 0tP`@P 000,0` 0@ 0 t4/@900S3 0 `P @@400 @ 0 t4/@PN40S80 0,0B 0<0 0p0@000l0P00 @T4 P1 /<0 0p0 000l0@080 0,0008`<P  0 4P qPd mbZ 0RES@@0 t4/PB@ @0  4/@Pt0 @ 4/ 0Pt`+0t@Pr000p0@0l0 0,0 0@ 0t4/@P`00 0 0XS@TA-P `@0p0S 0W 0T0S A0-   Q  O-pM0<0P0H00P0 8`@DL 0:@P& W0V04 P0Y04  0 ЍO  P0S P @Ѝ /A-@` PpP W $0 Ax<@- 00 00! 0!""##$$ @-88Qp@-@ Q  88PRPpp@LJpR_^p@-Q@pP @Q+\0@$0@0$0ph8$@8Tp\0$00$0$@p@-Q@pP @Q  pN8 0"8 0"p@-Q@pP @Q@p68d 0$ 0S (0, 0@@h8d 0$ 0S (00, @@pY 0S/S 0 / E/0S//0S-/@-g_//@- _G-p@0S 00s  r M`p 0 r 0 PU S SZ` VȀ- //@-!0  @-   P`  |`o    $`_/@- _@- 0   ,`  X`o    `i_@- _@-@M_`PR`P/@-0_p@-@PC_@pA_  ? Ra0 ? /0S S S00 /$0@-h0pW0$^8^L^___d_ `A-`p@ P^P @A=: <900   tP1 @0<03<O-@`MЍ0S S S+ 0 / 0 ///0@-P M 0*@P 00Ѝ0P/00@-DM000,00(0H0 00@0P<0A$  <0< %DЍ0茅_/p@-0P@T `@pp@-P`~@P @ᕮpA-pP@k`P$ `ႮV000000 0 0!!!!""""####$$$$|0|0役 /@-p@ P`] 0000 0CS 0 rp` 0@Ppo  0` ЍC-MPp`04@P  0 $ 01/@T 00Ѝ   @P  @P A-`pPԭ@P  0 ̺@T 00Ѝ @P @P 0岺-/9 0T0/ 0X0/O-`DM@ 00 0 刀匠00  ``\ pP 01s$ 0 0p0 13/P 00s0?o`2v0S  PP 0a 0 DЍU P \ PU˰p [ P 0 8p Wʠ ^_G- P0` 00 00CS @0 00 013/ 0p@p Y 00 00S@X0`W  1@P  |q qq 8<q|HLq|q (,0sq 0S S 00 000/0CS///p@-P@0003/Pp 0! p0 0SS 0 /S 00/p@-0` P 00CS0@003/@P 0 2X00X02pp@-0@` 0P2X00CX020p@00/ 0@-0@00CS0@000/<P /0 0000/p@-@PS0003/@P 000/pp@-@PT` 0R@80003/TP P 000pp@-@P"0003/@P 000pp@-@`0P 0003/@pA-@P0圀p`0S002X X00CX0>2P|P 0  01/@-0 蔅_A-$0@@@P0`00Zp#ZY0S 04 0 13/@ Z@^0     0 1/@-Y^ R0R0#3/ 0 / 0 /0S  0S 0@-@@0S  00S  /O-`z1@PpW  z{   Pu  Pp1 Ѝ@@@-7@- 0 R R A@ Ѝ0A@ 븅_p@-P0S0@0 0S p@0\03/-Ppp@-@04400 # #$0ЍՅ_00C SXXxXxXXXlXXXxXX 00 /, 0 0 00 00⽟s@-000S @D0 SJ0311p0S0 0S-00 0Q 0 00;nz000C0 00C 0 R  S \0pH000S<(00000 3pPz  Ѝ<10# 3R0 0 Pk 3R0 0 p^LA00L0N4{0Z0~ꐾӀ}N__8s@-P`00@T H0P4*(Ѝp@U0 DTЍpN8p@-`MP  @P t0R R3000 0 } 0@Ѝp3000 0 nq_@- Y@Pኽ0ЍO-84PTM3p؀ 00`S 0Q Q @PD/Q Q8崳0S 00 0000 @Px p/) 0S#0S 0S00 0P0/0S xP000C @P U/@TЍ0"弲S(4001 00 0 0 :DP@ `V/ b@H/T @!4( F/0S1 T/ @ԺP ,0 S00 0 0 :P@$/ @^/TкP ,0 ST#080K/0S3 ,aPp13 0 !p006/P&@ 8<(1#,0"){ 0S R 0C 000C00S00>l/ d ᅼd`P]003 0D p(06/PR@ON8&_hrpShd pSd@O-`|M[ 3#0S S@ h X TP 0 T0k r |Ѝ 0S0 0"X0 PKl@ TLTH̟H2@X1100140PĤ0j80?<00 0S 4;j0$D0?H0? @080t{p<0 @030D$00U, (0KD0 SH0 ?%X1!U3T0000 0  00 0@ 0L匏LP[T0( p0,0pDWp!$ Wp! 'TƋ[0SW04 n0!#?0 0APT000 0 0@0PEwhd D_O-2`P#0DMS Sz@ OP 0 F0 DЍ0S\ 0S0 0l! 0;PK4@ TLTHĔi?0?00 ᠄0偋ᆥ0DpQ1! T 0 00 0@0 0D X !ᔴP 2000 0 0@崎P pW N0Z0SX꜋ hd S_0@-PM@ P@ 0S 00 30@Ѝ00@-`P @P 0S-@ @0Ѝp@-0P 0@P` V $0@0  " V@Ѝp@P D D0 4S 40 60CpS//&^0S@-0P/@- @  X9_c_8G-pA`=P,"? !@T0@@0 @@@AP0p0 0`0l0,TG0 R\ \ @0@0   N8O-`Pq(2?0q v,@ T, 0R SRd,P [|,,0@V 000S ,00@E,,P,0@8Np@-`P6,0 @T 0?ST Thi,pP@T P @,T,P@pN@00/0@-M@ P PT0@ D0D 30000}P+(̅Ѝ0zd@A-P@`+  Q 00C0 0 , |+tPtp0S`0 2?0!0S 0 0 A+ 0N8p@-0@HP+0`0@,0D0+Tp@N P  800P////p@-d 0@P[ .0T p/pO-P2S 0}*` @PP X@@}>w0K*}.01Pd 0*΂+"[! |*!/#1S%P @ LP WZ 0* (!P 000P@  P 000@P QZp 㰠夰m@_pW0: 00C@_2 < 2 ,2! Q Ѝ:;,mnO-Q`0p"Ợ@ pP 0㲢 <2 S\02@P? ᤢ ":#@TP0!嘢p!9#@TP0!匢!dƒ1#. @TP2,! 0)"0|| pP 0 0 T  (0TPp@0T@PpP 0 0 TpȠȐTP0I 0@P ?T @.0 @.0< ' Ѝ:QO::mnP/O-$0(P`Т@p(0傴Q< 0R00$00S ?⃁X *;#$+4P Uc): 0$0@0D Ѝ( P U8`<:$ 0ˡ (001r00 A&! ;6!@-0@00$00ƇPp@-@P`R/ѡPP`Y ሃPp@-@ )0!( :@ @-0@0!80@)A-P?@ `!tpR|) W\00\0  WX00X0%0S`00S 3/050)A-@`PP pX)Iᙩ)p@-0@pPG)吩@)Tp@-0PS@p ݱ0x 0000A\`()0 $A&_)0@ Ѝ@}^*\^0/G-P`t@ )U 1P0F0SG:)0S0p 0SڬP嬐U3PP ۸$)03/( Z#Z P &˸Ÿ00C0Z $00)(p@-@PPpp@p@-@P(00P 00$00宆p@(O-M00pQ  (@`TB  0 w : 0p 3t 0U0Ѝ0 @00D0 0(X 0S<0:2<.`DpP/0 p80Pp ЍP@-p@-`Pp0S0X0S C\ c0RC ~PTP1#pR_O-M`8 HUH$ⰫP 0PY+ἰ$,0( 噫P( ,0H9 x00Cx00S  . n ( 冠 H00\ ! ᭬x lH gHY H@`H7P+ ($G 0 4MHx00Cx00S  . 0 H G 000 0RPpP{UWv  00& G<Ѝ2_TYy[^ʇ_Dą_A-@`@GPp吀0T:GU0QU P NP 0P奕GA@DA-0MP00p 00!t0  00 q|@T`x00Ѝ0SP*  (;y 8000 0y*, 'yU (T`<嘖V 00 0@G-Pp&G@ᤐ夠0SuGT 0aV X mP T ἧ幧 0 P@D_G-@pPF@ T:tAG@aV X 0=P,/G@T@@3Dp@-TF@HPH`0Sp@0G0Q 0S f@D+_A-AQF FP ⇐PP 5 F`P帀PpU:AFQ  R 00 00 0\ S Dą5_X_P_{_D_PT41L0S/0@-@ QM ZF } P7 ⚢ P0/ P  FЍ0 I P R PU 03/P   P ,PąD_܈_ _P:_a_O-M00Puh`pl0S6 0l0p0 0>0  0z&  8 0 <0$0 00  <0(,p8 y@ ~0Sl00Cl0  UЍ  0*@T0O-@p04PE܀0SFT   Ѝ0aV! R L P 0WS8ZY T 85  .P@ᏓD_p@-@l堨Pd巨`0$4SS @pDD$@yP 9P 0@弔^^ą 0`( "4`#/O-M i}90000 0 -PPr00 +4 40#400$"44 8##<004 8 40 80 < 0 0`$"440#4 0 0$"44 0#4 0 04 8 4 0 8 00 $"448#8=Sp1=p#'40p0("(W$3[L X0!<30C(r*0 0r;p0C0Cs V `^lP0@[2 zЍA 0P$( c 0 $ (   0 $$ "$   $$ "$ pR0Cs WPp00 00$}PP !440"440-* ' P$PT!TXX\\``ddhhllp pt 1tQ00 0.uP t0)uPIP`1 QPب!"44!1"44!1"441 $0$Q 0RP (F0 v u  8  u(PP0T8 5P 0 ,00ER_PM__H^R_ _M_O-X`@fuM| X0`p#00 0?PP*0P X嵮0P P! R R00wX8&  Ⲅ,T P00S =Pfyuߍ XX / ,4L HZp$PFS Jy3 0PE{pX P NΠ0 n :1 .fPP  0#v P 0`☲cᝄ ?P X ⏄& 0F& XB  k0 0#P070㚳#, u u $(0, 0 0S 1!3S$ ?6.~`0S S*Q #?0000.V A00 Z00 Xt P 6XPP.}  Q#?0000Q 00 t Xt z PpX0 [oR 000X00 0@PdPb X^_____K_d^^ _l__T0Tp@- 60@巐@PP `PUPTpA-@Pf/pᲒ<(00`S3 #01 1@ ##:!#0<,8  cs00 ]s0 H0<0 0008|0X``00``n8 (0 0<0`0,0$0@000(040,0AO꼪j_WEVG- 1( @"6 0KPP 0S00G@|PeX0S0SP3B尙Nxp@-P`@ `P4_ |ޡRܡ`T ¨ۨ0S 0 aPpp@ _2_^^^@-@hPd0$T`P 0S 40 0,0`aЍp|Q@-0@ (P$3P@꼪l<_0!L0 0/R-/00R>0/P}ft,@|f{f@~fp@-@L P & 0 pIP$ pO-@2 600o RQF 0Q0000C00 S񟗇`FYEY\GYGYGYGYGYGYGYGYGYtGYGY`p 0 V0":P ZeUP!0S   fP   ۞o RQ 0Qd 0pS  Ѝ0~pS PP Z%ZjeV`! 0 /0p ࣞ R Z R 0 R0S000S 0S00i 00 Q #{bDK@K#\p@-l` dM0 h@H0P*0,,PY  0@hpx>@K#\DK0 60S#3//0 R@#0 Q /R*0h0//x]0( #&0  R /E/00S /კO-M`Y0 00000P>@P= 0 @@@@4p `PĀĐ@TT ,ፄQZ ЍO T1# ؝@PW01 TYP0 )EP @Ѝp4!  \ / v: _p$0 0!0 00 /Hzhzlz0S  0 00/p@-0pPd3@1`00l0/(0, 6Q 0/(0, "R0@@Vp@-@P0 00R 0(0,000@p@-P`㾹@P @ `T`60S $0CS@ R(08 8@@dpp@-PU @`00p`h0P#Qpp^p@-@pPPp@AA-APp0S$0C@PoobT  R*  R )Pg$ R8@ (@T $0DS R @TP8 R8 0 RP`Vp@-40@SP 4 -\0(,0S S 00 008@Tp`0 6/@p@-@P` ᮍ̠ 0P6 #::0t $00000@0`0: 0p^A-Pp@\3A`1`00 SQ0S60S50S 0S E`L~P/ Q 50S0 xx050PY@-@B6D0S OP$@/@-@50S0500S @JA- pPPFへ9@0(0@P<1``00gxxP MPPPPPPPPyulPlB 00 0`S 0 0, ` 0@PЍ<[Y&_$^@-(@,000S S 0 AP 0S Ѝ@OЍ-\M0000Q 0S 3/\Ѝ G-`1@p31`00Lg 0RPZn50Sx:x0550aB R  00 0S#P> 0 0 0  ^PF0 0000( H/o6"Q R  R   0 0 pPP #P 0SPU  P P UO-1DM00P`p0 <0 a0,(P$  @(P0$ 0 G`<0400 ,00 0000a0(P 0$ 1`<0400 ,0X0 0P000a0(P 0$ `DЍ&_htYY*_XYx_VY5_O-QdM@0 | PdЍdЍO}_Q0 00000`0 PPPV0/op"/8A v @T@DHX01H0#0T0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@ J RH  H !m X } P `J@ GrpT @DPO-造Mx@P` p<0` ᦟ0l0l ۾,1 0(10$10 1H00Xe[ 1?o2P0SЍh]YC-M 0P`` @v|p0 P 00 00 0 0@<[?o2P0S  BP Ѝhp@-@P@T $@DT`\\ D0S(@0 80 0KP p@ 0d^Z_\Y;_A-0pP@TU,`T`1 @DP0u_D0S/0@-0 H ЍA-@`p`Po0(@S$0CS8 R (0S $0C `PA~_p@-@P T-p\P D@<0@ @ $Y x p&_LKl@-<0DT 0 !0  !0@- ! 0 !A-@`XpPUA00`0S 00  03/<ꨏp@-@P0 0 0 0 00 0 00  p@O-pp34M1`00#212@T  0"0#!"4Ѝ00 030 &d`NP0S @D R 9 R9(`Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y PP  C\0 : L80 @0S ( <X0000< 3SH L0SP0\ 0304 sR k "Pt"P\"PH"P4PPE_o$"RQ 807;?<  0C S0! 0>P00 R 7 7  zP( U 0S40S ╝41  00000C0( @D0P0*;(  z+ y80S 40S 0 @PU 0 =PP220:00lpX 7/U P @p03/LKA-P4,a @T @DT@T $@DTA0S 0S@0S&$00F8P0(00S GpP TI<08000,;(@LKO-@,M,00@T `88@DT,ЍT <0RUSL (⻥+0 0 0 6 P0PP9 V>c000pppG0 0 Y ``0 0V` F/ 0 PPP# 0SE,{0 0 0 `00@T @DSP0P P060S500C?o2 0 0 Laq 3/ 0``S MbA-@p `PBM 2SJ@ @(@0 0@S  Ƈ02 100 0 0P`5BߍZY@-0  Q:0 0(0 0QS Q   Ѝ[ZY00@-AM@0 0 0 0P00! ! 0@ :Aߍ0A-P@ `%0H   CR'0C0 0000S  (  ( 0Sp p佛 Ae6#RH L0S0P  9-CM       rCߍG-P<p~@|` PPl00P(P$P,P^0$008P$S( (0 O| 0 pGLKp@-@,00,0PS09|0,P@8PUp`0 6/Ps@-D0@40P0`#|0S  Ѝp@/Ѝph080/h@-@P "P @ A-Pl@`qTH1x`31`0050SPr050x0S 00000P P ޱ P ٱP 00P 0000qP9G BeἱO-(@4M3p1P`00+50Sxq050a`V :W 729 `600 )90p9W 1C7CW 0SY 00#212D 900pWr `$pGWAZ#2!128W M8W4 0CW8W 8W0CW  0W `4Ѝp80 SvYXoYXoYXoYXoYvYtYXoYXoYvYXoYXoYXoYwY(8W 0W\ 0S 00.`7W ~;C?>CW_ >0W >C 0CW H4ЍO7W  ;CW0CWx7W0 0S  ⶙`@7W H4ЍO6WJ 57W >C0CW`즟 W 6W`VlX 〰0 W@0}Pd0  `]zDVg* ( V  0S 08 000 0S0(Dhp@jߌ_X?G-@e@! <1@P"10ZU U`@1U@L`H@00S00 000 @7GJUS@删D 01+pW 80S  3/XpQ >$pW 80S  3/XpKdA-@P(p`*R/0 0 0 7@000|SP0P00Ph勯004 0 W004  @0D 0 @0D h厯3  @A-@`pjPUxA R    B kp03/@-JL d0 Y8_YA-` E@0 @0= P0p0pg x 0t0p@0P P~ D0 ЍA갏K_K_h]Y_Y _܆0-DM000,00(0P0 0H0000<0$ <0< _PDЍHY_nm@-0   Ѝ_O-|0 S4|00^@S4p0`4DM00p,`($  <0'PP` <a840S I=0S/ 8)` p7g g0@a0(03 0p0`00p,`$  <0OP X%x0P#PPcSSH3~x0q0000@P00U ~_U01~?1<@ppDЍO 0!<0$   ,p(`OP 0!2$ 0<0  ,p(`OP{0 00!<2< $ 0,p(`80OPf0 00!1< 0'>$ 0,p(`80xOPP0 00!10 ,p(`$ 80< eOP@ <0< $  00,p(`SOPg 1000<0 ,p(`$  AO0PU     '. ,p(`$0 @ 0< -OPD @01Q[P1S ~?S?11S1O@pqMYDY__dYI_pYKY7_^<_C_u_,Y~_O-DM@c `d` P@; N l׭ |D1n00,($  p<0NP@  DЍ 0!<0$   ,(@NP 0!0$ 0<0  ,(NP 0!P00H00,($ P 80< NP YY___YC_@-@Pu; n @ 㔥ꄋYp@-@PM` Q    ,p@K   RP PP  M<0 <0x 8RR00R0S 0S/ 28<YpYA-`pS JPTP@ p :0V`` BlYԎYp@-@P\p0p@/A-Mq`A~Px{@ppT\ЍAi Q&)P ~g@K@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@$Y,Y0YpY4YaMCaaq o %a abbbXT! 0$ $18!0 㰸  0R200 `p00S0p SV P`p02P0Q:0"PS_p`W !0t`"0 AЍA0܆KKՍ_ݍ_@-@k@0A- P @0L ^U 0S ~`pJ@hpT + 0S0@A7l0S ⳆP ~8@$Yp@-@`P!@P 0 ⸼pK@-Q@MP@`pPP@ \ V0 0@Ѝ 0 <R0%0 6@@0A- P` @0L ^U 0S ~p@ကT l0S IPX0 ^᩻ 0S0@A~@$YKO-`0M#08@Qr 6^0Qp XXP  03/ NZXP   03/NZoWP  03/0S  P `@P@tWP  0# 3/0@WS8'S?Vp (]0 00000 0婬X ("Z ~X PUP Pjr~pl`dV  X0PCP Ѝ< <0塻 PS_0SCDP `;rXP Uڐ P\P0PE⩺DPp  ź럺p <≻~`XP `  ᱺUڐ P4PPE⁺D?< f44)454P$SN $#(u (PPL\0S$PP4 <P <qL0$3/PP 0S- <@P 3|`|0<N03/P |` f@S"0<#S 80#S %'B BS #S #S#V6 0 0 0P 0噫P* (q"S  S "S "S's |"Sx"p"S l$'a S `M BS[ BS30" P0S- SP[ `0 ` 6/ YNZ0 0(`06/  "  4`eD# Z  R @a$P/  03/-[  c 0^{ S#B%B}e Sb O!"'S s[ SX *.ls3p3&iȀǀɀ@zixiKxi 4Yiiiii{iFi@ui niii@ɀIii7iiiG-Pp'~`a@|T l0 S 50S0 0TP80 .~J@$YK0  ѹK0 @KA-p`Pi$@P 00S0L ⵵  PP # @  ⤵__0 口괍YċY+ x܍Yp@-P@]40x@XPx0D#0Uw0D"0Uv0D 0t0!E'D!E&D E&Dp@-4@QPM `?1h0Q o0CQ 0Q 3QN `Ѝ3Q 3Q31 1}0QE0 00P0 0!`P0@S?` SRp @N? p`P @E2Q 0CQ 0Q2 0CQ00l2Q 0Q X}J`0!  Q SS  @#!@  ! ! !1 ! ! ! ! ! ! !! !! !!,!1<13" 4`q1#  `1 3 1#>0880R 3q0`N`H0@0< !N D!0/H0L 0/QP @0D P @㚚qP 0?S@ Ѝ@US``iui vi iiiG-x Qp`PM \1Q-@UVDD~O0 00 00+@P ލ@,3T @P  0R gDPP1@ Ⴗ 0Q D@P W14 (0W-@ 41i i^X_C-qM@`P)  03/PNU# 0S    Pp@0S   n  0SЍ$1PpP  ɀx0/p@-`Q@P R 0 0 0 !7p000SP0PP00p0*R  0 0 0 c`0SP0P0P0Wp@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P0#3 R`M3  mR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP $Ppp@-@PPp0@-@0M0S0,@P  RЍ0ϖoo_p@-Ph@t1 01  hp@}@-p0$M03`A0AS P R R R0 /@ ( MRY R @ 000 S""44 0 #RH L0S0P   0 001   01^000000000 0 00000 006@P #T@$Ѝ3  #0P0C@0@ 001 0 S 0 ₁< 0"448#80CS=10 001   `1100000000<1000 00@P @j0 | 0H   C Rw0C0000 0S(  (  ( 0   00T0 0 %0 @P{ Qw 6@t2@7@ꖎ_33@-3A0@S AS S 7<2@S 3/4P@*O-Q,M0 #21 2@P0 40S `0` " !",Ѝ0Sbb20帗pH42V Ho宗bVRUH_0 0X0\690PPU:0勗0 00 ዀ P0p@-P`@Tp ņP ࿆P @A-0PXMP- 00 0XЍA/`@p U1#`101"4410 0CH00UL 800(080@`, 0 0 0 03/XЍ訏\00@-:PL@0 R 00 C0.APAAꫪ] ؏0@-PQ@M 0 040060000 $0T l00p0 200P000 %U 0 00#080PR,R02t0HLR0h00 P(05/L 0  DЍ0ဖ_DYhYY^_p@-@0|0D9D!x0003/H RUH[HHRQp0S  0 厖20C24R40SDd/Q/Du00S/   ! """ ^00@-0PS0 O T  RQ40S47/aC^-9S 0C570C03>C<A \0 S?0aN^ >9QC< A(.S,S :S 0S70/00@-0C QAC^9S000@N TAPNU>9^C<7A@-@ 0R R% RB 0 ~ R ~   ^           R R  R  R P~ D3          /^^ ^_@-`P㨕@H%  `P*0& 0# " !P 00 0 ~ ~0 024`S 0 0B02H028Ѝp`H2T o@-@HP  a`P "@P 00CS 004`S  0 2H0C2 HЍp`H</@/l2p@-Q@`P *P2Qt D2Qg <2QT  p@ 2Qi M0Q 2Ÿ2 0\00-\0Sp4Pp3" p@I1Q 2?5Q1 20$201Q( &0V4"R= 0p@00Sp3A AR00S7703P pGPpp@APpL2!4<010 " $"S $2p@p@F8"Rp0S 0 0 8Pvpi1iii2i(#iX8i(i^ 2 @-$2@0$2 P$20$2/(2S@-$2@ 0$2 P$20$2/G-@\pP(ᰀH(20(2p02P0H02 (Z p@2S,`Yp`V v H(20C(2,2S0S,2?02HW  p 3/`P  0S0S0 0"p@-@Hj,2&jPUHp R&U R?,"02(2H0C(2@2S(2Sbbݓp 0S0S0 0"P 3/A-@` Pp0H   CR0C0000T7@@#RH L0S0P  @0(00(00S@P  m{0'  $ ! "$& $ "$ (?Q0@ a060^@-0S 0 P P Ѝ0 $"$# &  $ "$  $"$# & {0C-M 03P 0 SP0ht`0开cS0 g00044@X 0@ DC5(00X 0  R:0 3  00KP  E0P<<00   0:00h(;(0, O 0@,@(0hE0#:0#X00S(DD KP `0#DDH$H#  3  0 0P0 0 = P0S `0#DDH$H  3:#:SZ2T Tr & 1T (0Sp0 00C SF0 ^  ( 0:01T7?T+ @P  d{81@ R  P0-hp'  H/o"!20T  T n 0T00S 0@000x0@000 04ЍR L؏G^ Ld5݆P1O-0Q@00`pDM(00 0<0a0,$@ @@ @<@:000< 0a0 ,($@ @ @: 0$0\00T0000'>a0,0( P @< :DЍ$^؏_Y^ Z _A-@`pP0S 0Q  6/P Pp@-@P0S| |0 @Pp@-@ @6@/p@-@P,03/ 0&@P@ D&!R @A000p6@/0S   6@ H0600C0/p@-@00`P 6/P 0S| |0 P@pC-@4 `lMPe540"p  8PPpC 0__ PHzhzlz00S/*ȏ@-@P T0 S/,P/0p@-PP@` ) @0S@@+` `p+2@ 00S 0h 0C0 0/@-@ \ 0 0 0@- Ѝp@- 0@SP 0SP 3/P 0S pA-P`pj@0 p`000@@AA-pP`@V@D`p@-@`P lP)` `e aP1P SP` 00PPP DP8& p@ Upp@ b__RPG-@  Q Rx"pS`F #B'BS 0PS & P  0S 3P_0 S` 1 VP  0S P P6 0PP `S r 0S 0S=  0S000000000S 3/p0S* 0S*  PU UP ላ0S> $D?o W20SP P pq p0p%X U !08i(p@-@P` {Pps@-`@P@ 0S u  "U R `Q  `  000PЍp0  @0T0  @-@ 0S R0 00h0 S@- P 2S@#@ T 00^"^G-HbHHBTDrUʀ 0 ! $ 0  .!0Sa $ $  (0,0 (0, 0040 004 80<0 80< $@0D0 @0D (,H0L0 H0L 04P0T0 P0T 8S࠳ࠣo\p^ 0$0\@X`b8pP@X@\`Z80T`!C`<0@0o$0@(0$$奤@`xX? ZMbQ$^_O-,SM00 &@ pt Q  G[P`SߍO,@  4 nrf RVZ4Z ZZZZZlZdZx  Bx 8 2/J&R &˱PPU@  &[@ptp@zPPTX \  &`PX \   V R x  Bx 8 2/pP  & [`&@` P@` &[@`pUY 4=Sߍ& R^ p[@&v? @ P&Rpڰvp 5 HqHp, $2/x RLL R 2/ H 2/ 00 00 ;/v 0 4@4/&R% &&[@ & pP&r R qWx RL R 2/ H 2/[@ `[@ @ P} Bx R  Bx M 꼁O-@0P 1DM@a3ph 6S0666S0606,6ᬐS 5  R !^q  pDЍ08#8S06đP0SP  0S0 S5T0岆0T00X#pW@p 40@pApX0\ 06S(X&06  #q,03/@,) @00@ 4/,FPJ0P0@T00CT0 @-@P6S@0 L0!608#86 S0\ 6X00 @ 0/03" /0S S/S /Su//N/0H00堥LG-`p( @0SbRP@ @P UL p0D!P Pfo@00@0plQ<@>PP4PLLO-0p#MP2`12~@0t0P D Lᗤ@@0S  XzЍ1 3/@LA-P@`pP0L S0@>p|0D0@ \ QQ 0LP  &p@00C@0P@ALL @-Ѥ 0L_Lp@-@x2dPS|"|"|2x" D3D/8D+D'p@ L, 0P/p"Rt"R/xLp@-`P@P ʆ@pbtR N u $ 0@Sx2| 0|2pLLp@-@P0 p@A-@Pp`  Y  QA-`pP @  0@ 0 PP@TT 0 p@-@P pO-@Qp00,MP 0 `P 0#212b0P0`@0Sk ,Ѝ褠D  &Pp00@0S  0RT 000ᅱ  ;/0P0 R0SPLNu/0/@-@I000@-@@8@-@ @c  L@-L幍p@-DP@K1 01  p@T   @R0S.`R0'Sg/@-8@0S Al00Q"<G-M0@P`` pn` =ZDr0| 0S(,0 0$ \0000 00000000`_*ЍZ@-0, ($ Ѝ@-0, ($ Ѝ 0!< 04 0 (   !/Hzhzlz\ P/0 !8 00 (  , !/HzhzlzA-<0Pp@`L偌!0 1L厌Ap@-P@ E0DP@Rp@A-`0@SP 6 p|PPiX@ S` 0\HP@Dp希L@H 04@SP P0T T` P LxZ<ZXZL@-@\2 P0PST T T0P L2D/H"@X㤄L0M00Ѝ/O-M8p ` @mh`d!0S X!SD P!SC H!S0 00!P : 0x00 00 000 0@hPL)oPQ0 S S S S (lP @tp!lPq00Ѝ0000@T$Z,ZZ@Z$^p@-\0P@ k_`4PP H.plPp0@ 00  00P 0 0@(?o2P0SЍO-@Pp  0 400 ,p$@ ` @+T00L00 ,p($@ ` @400 +<Ѝɏ_Z^T&Z<_lZC_0 @R/p@-P!A` ! 0RpC-aMPpᛂ@An0p ݊ 0` k0 0000P@``000*c'P{Ѝ`(Z- 0S0!Q\ ^010 BS   " 䄑0 S 0 / \P:/p@-|0P@`T   l@PH#p V00 000P`0@ꄑ_0 0R  0S/0 R/  0Q/-   QO-` @ 0  SR00N\ : 0P PUP 0 @0S 0#0JR㊑ PPU @X0 0 0 S(PI 0 0 SP +P  pW 0R  Z 1P Pp[p@- 0 BRPNP0@ ` T0Q@:T:@ #pQ p R\:p0-S>"0000( $ #0 0A-@P`p/ 00  Q:00 ^ Q0SA P 0` `0S: 0  000 @ ``A@G-(r@P0T@`RT` P(PЍTV Fh Dh0Z* sR Q HX TT BmU 0  P  pPP 0PP  0@ 0 SU h 0 bpQ` 哚PV *0`S R0B1 08C80 00 00008C8 QHR 0ꄑ _$^p@-@Q`P 0 d0P @pqPTp0SpPO-P0M`Q@0  EpP ` @Ѝp0 0@S0VV0p; 0-Q V Q P  P P [[90   P QPP V@  `    pR5PUP 0S(0S' RP0S000  P0SP00S 0 SQPPUVy 0Sv p0S00R0SpPUea0 S0 0 P剙QV 00 0PJP3Pp9_A-P@k`P p   BnP TO  fP@ 0@@T  R Q 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@ Q   BR  \R\Q 0 Sl!0 SDژ 0S0S0 0 S0Q00 R Q RSR 嶘0Q `U P0P0 RPPQ AQ  0 d__Ԑ__0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ I~0P@  p脑A-@`pp R( `0PX 0 0`0d0(0 0 0P0000 0脑1Z8Z+Zx1Z0S p@-@PpB0P 0p@/pp@-Q0S   Q S Pp#P@$XP0   |R 000P:hP`P` @TpP@ 0 00}ꄑ_d ___A-Pp`@ )1PP000q10S0@@`p@-P@0`S   00 (P}0S p@꼁1/1M/ G-`pP 0@T UK 0 PAG !0R"1S RP  lP P  lP 0SU P 3/P @P q0 P GG^/0 f0  fA-PpS`  0S EC@1Q0 S 00 03/@P8/@h8@)9@S 0A/0S @-/8_ B 0P//p@-@P0@UPP :^N3A"Pp( Ep@LQ@`@@40 0 P/@-@M \ \S R   koЍ@-@P 0P P 00000 yꠑ00SA-p@W 0S `{P0P 00ᔙ0/G-`܀P`U-0G m< 0$p*Yp 0S   0R0 0 8 n03/.0S0C0D@TPꠑC_X?AZ@-@( |G-`P @T@G0 08Eu뼀80S`pD (1LL0C(1H劍[ႍ@LHL 0!< 04 0 (   !/Hzhzlz\ P/0 !8 0 0 (  , !/Hzhzlz@-ZpP 0C~\0C00 7p0SV*p*/TppA-0@S`@M4 0^ 4  E0000000H00S 00 00$0H030,000 0 P:0S6 PU3 0S0400@00'$'$(%(%)&&#&#%"p圀0 phplH0@2@@0 0@ 0 }P@0 00@ЍL0P0  0  !P P  /$  $ /,  , /0"SS@- 0@SPM(0S? 0S; 0 R 0S 32! (`0V0R0S% (0$PyS x0xx 0B~S(x00Q:xx0xp`V  @T x_PЍT@@D@@P*/-/-/ 0!< 04 0 (   !/HzhzlzA-p 0P0`@ H00000#   20 000 P0 0S /P7&  Y@0 0400'$'$(%(%)&&#&#%"pP0 pPhplP0 0Ѝ"0O-_M008I 0$0(0#212P7@_ߍ0SP 0嵊(PwUP$pPPW@0 `@0@ UTVax 0hVPP$pPPW`7@7@0@ 808 0 0S+@P34 1`0L0C ` x0LL@QRZ(T303 @P`@V`$pW0@ pP0 h(0SuU 0V1a"01lP 0`\L 0PR AoVQ P`0R0t0P0S 0$ST0S 0$S0( 00 0P}`P9X0S P0wX@Pp W KwCXp00CS" xZyZyZyZ|Z|Z|ZyZT0S}  R# R $ 0S,0,LqP,00L00&Y@T _P0 R0 ( L@PQ ( (1T0S  R  00L00&/0@00( Lg@P.(0$P000T00X0L p 0$LI@P P0P0P`@0V0`P@0$ L$0>@P0$`S- P0 ]PX0S0S;@0Sp S S $L"@P $0X\X\ (, /  X\ 0?0::SL PP $0P`H R R: `$! p7/` Fr450",p 00 ?V F $ 0LTpP- EKP0P0<@K@i|!$0P000T00X0 p 0$L@Pn 0SPQ @f-@db@`@^LZ x^`000SW pWPRU 01VP00H0a WVaA7˿(%^^\ P/0 !8 0 0 (  , !/HzhzlzO-QM 0 ~ЍO\ Ѝ\Q|x0 0|P .m| x |  0d  h 0l bp t0dpWWWh R   0SK GR&7YD RA| R=d ` EP 0S U d FPdP`&V4004 0vA43!"@40$0$`0 0V1 ~oF0V P xl 0p lS tA0Q 3fh0S "S]2(0(0SX DSV <ى0 00 00d0Pt0嘐S, PU) p0S&W W W<P9P@C<B030SB 2 030 @0 0t*P/t00t0vP2,0,@T D@DT*ᐉ0000f<@1808`V} ~oFydP PB P 0 d5/Y NYY<n0S 0 0S#PZ0W00000D000 d0%P.t R R pQPPsH0404@ ,4 Q㸐 QԐ0Pt 婁Pt00t0PPM<.P 0 0 d3/dوPP2Y  00/@!b fnZ(%^ƀ@ĀǀgfffA-P`,k,pp@%t `P Wk0040 0(0 0E8 0@00ꈔpZp@-@`(PQ $kkp@*p@-@`PW pp@-P@X pA-@`p80P0 0 00,@ЍtZO-p`u@PS pPL fP44/P( GP= 000E(P00  ;U  E?p1GS ! R``B``0 0Q  FT0Pp W(0S0P0 Ѝ@9%^_A%^A-P@`pM4 e?  a?2 0!0 qЍA-@PP`-@pD0W ЃH0L P0 H0L ^A0 `0<0SP@0P8P0 8>2 43H@008 0 0SSY Ѝ 0C#[ Y0CS!23 U !5% !D!C ۄaP  03/`0 D`0@00800L01H0O>2040 0,00131`000S0 S000 0 ,cP 0, V W 0`x 8000`400`>h03` ,1`0p02640h00x0x0??!@W%^֒_Ā0@- 0E Ѝ@-? Ѝ0@-  8 Ѝ@000S/-00000 0/p@-&@0@ PM R00P w`($1Ѝp@p@-x P 0MS`  0S0 0 0 @T  @  0PG0Ѝp,-l 0/O-M`p8^PPK 405S0($@ 940 S;000050< 0NZ0<0 ~  M M d@M`00Cl0 0 00  00  Hl 0 Ѝ茖7@-P`@KX0010P @P Ѝ00S 0S 00~A-@p`ềP@P  ց@-`0P P: ЍGJ GPP!ЍG|40!  $#21240 0 P 0  Q 0S (!4[|3"(Ѝ5Z:400204048<0S0HP4074040 0 0H00&X0PtPtT0 0H00&40740(0L0S &^b_z_ȏ@-`S`PR@ P$1 03/PЍpO-`0Mأp P@P 6ᬀ 6S5 J@Ѝ3 V@433 K$1 0@4/@X T06-@'i0 0 0 2i@;'P0! {@P q $1 03/@eT0@ 0 8ЍOꌖ_(&^__O-M0( $$0P0$0p@0T0H ]`PH Lh`0d 0 `0d h$$0PP 3" (\J6 ,VJ$00  LLh004 0 004 h(,[Z HsG~0 0  H 000@T @DT)Y Z"U~ 50R( @xkvh@0D 0 @0D h( p05 0 8p zT \m  Q Q 44@(\ >@P }`ʿP! \J~` @5 .PP【"pj4hh0l 0 h0l ?h( p@p0 zJ}hX0\ 0 X0\ (hx0 #448#80(0SohP0T 0 P0T h`V`ZgH0L 0 H0L hh9X0S``V (0Y SY$00 6 03 $P` V OP40"p ` ` 8 Vp  0 05p0  `p800z 00?0 08 Sgp0t 0 p0t g7X0S( pK 000p z,0SB Shgrg(0, 0 (0, }g(0Y S  Y~,7X0S``V(0S Yr(p 0`PT$1 0`6/`[ V06 00 5 OP 0 0⥴6$A gx | x |&gL0S ( p p0ykȠ̐ 0 D  p80~y9 PZd5 X0pSd80<\Z0 (X`P_@  R f   fP0S pp( @00 00p0Cyf   fH0S ( pp0hp -y005 BH6 & & R R&WU [  0 P7P ZI T00PTxctf0/Ϭ |fgf0  pf 0Z0S Y060 o᫲0S&2 0S600db1f 0$ 0 0$ 540@P吢H0 0@X0gxT DdP< d~`PH00`VMxxU 0bh@Sw Yt  $09/ /yЍ 0 X S R 000h  ,y0SDT0 Kx $09/xY  ,yY U hx ,y @P 0S 0 X S Rh  ,xx $0:/wZ  ,x00`ZU  hx ,x @P x iꨖMO-$M pp@P0 `fP 0倐hS [  $0;/@ x$Ѝ x @ @MO- qdV Q ʀ !  , !p0WZ@p .00  0唀0 0$ h7x R +$@ !d1000  ! ЍHzhzlzMG-P`pU U7 $1pZ@ Z0UP d0' U+  C  C$0h(P 0(0$0 000w 0< }T`00`040<0  000  0ꨖM0SmO-0S4M%PP"P@4 P 10S R *R 0 Svp<00`Vv 4Ѝ`` 0 bP 0h wbH0S" 0 S S Rh0  0pw 0S  0R v 0 p$07/vp hqw00`/֖]MA-d0Pxq@M0D 0S S2T1pH1p(@< }U`F00< <0}@PT~PĀ%vP~hew#Yp Y@Ѝ`0< 0C`00(|<0S `V0S @P 0 h@u>wMp@-HuDP@`L@T403L0$j@P 奵p@MMDMp@-$@@PZ0DL0gkp@蓵M0L03@o/M0 0 0 /@-@ XO-p 0M !P``  @AP0| 0\ `0 000000@Pv?o2P0SЍ$ZO-,`tWʀ 0! $!0     !_@ȐPU_ 0! t0 x   !00C0 00 0S0´03/ GgHzhzlzO-dM0!P`@ q (Xp1!p0p@0c00@P &s 0  p c 0 x_ 0`pl!H1 0 0,p($  `<0P 0 qdЍ 0!<0$   @,(pPP 0!0$ 0<0  @,(pP 0!`0@0X0,(p0$ @ 80< P ̖_h](Zj&^^LZϖ_y&^ז__hZC_A-Pp`_@0S 0 0 0 A _dP 0@p 00S 0 0R000₄Q @-s/ _@->cop@-`$P @P@p_p@-@P@D@ pp@-P`@PU`U`/*U, Z Z ZZZ Z ZZZ Z Z Z4Z Z Z ZZ ZZ Z P 00T@@@ppƗ_ЖG-P0M`0 0` @p=0 P 00 0 0 p@?o2P0S 0 S$  Q0ЍЖ5 0O-DM(0 0P`! 2 ,`0800P$  @x80 <00!1 0<0 (`,P$  d 0'!0tqt< (`0 0 ,P$  pN 0!80 (`,P$  p=0 00!08 00 (`0 0,P$ ('(` `08! 0 ,P $  p` 0 ,00 ! 0 0P($ DЍ___Zۗ__z_@- R0R0 &*R#ZZZZZZZZZZZZZZZZZZZZZ\" \ 00SD `\ \ `00SH00S0 80Q L\00SЖ R0 Rp@-0@P&* R#ZZZZ ZZZZZZLP@D T00SpT 9,P X0P0 SpSp$00S000SЖ 0 /Ж@- ttap@ lh` `\` T P` HD` 88`ZG#_ЖZ8_hZ8_Z9_0Z9_XZ19_@-0@`` ```@`ЖP@- P0@ P@ dd d0 0X SA@P HTlЍ0A@P GlЖZ_ۗ__T_@- B 0RS d00S Q PQ @q_P ,,0APЍ_D_@-B B  \03< x00S @F_P PP0aAPЍ$00S 2_o@_D_ 0O-`Pp@DM(028 0p0 0`,P$  80<<042 0p0 ,`(P$  v'~ 0쑟cV @\TPA\TQ\U@- $$a^ @ [^ZG#_$Z19_@-@ v^@s^O-aDM0P'~ 0 0㈑<@P @'i 88 (00>@P @Ѝ___™_///0S/!  @-@K00A-@`PpW0PV0SASW 0003s0#0S0  " \ R0@-#10lS0! @. TBo0PP P. /0S/p@-0@S`P `UFUp 8 $00#00p@ r8 $00#00~PE@-@0M 0@# Z#Z ZnZ ZP >P Z#Z ZYZ ZSZ Z }>P ߍ Z#Z ZiP & ZcP  Z/Z{ Z{\ Y>P Z#Zl ZHP & ZBP Z^ Z ZX ZX 6>P Zs#ZI Z%P ZA ZA x>P Z[#Z1 ZZ+ ZPZ# Z# >P Z>#Z ZPx & ZPr  ZPlZ Z =P` Z#Z ZPU & ZPO Z ZPG Z Z =P; Z"Z Z =P+ Z"Z ZjZ Zd =P Z"Z ZP & Z}P  Z y=P Z"Z ZZ Z d=P Z"Zw ZwZq ZZk Zk @I=P -^ .^.^,.^<.^L.^\.^l.^|.^.^.^.^.^ P0C /-P, 0C C-Q`@PLM 0 6/|0 p10 0萟耟2pC0DPUQ 0#LЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ 6/  00\H0 00A00A 6/\_]^P/Q //  00  00  00  00$  (00,  0004  80<0/@-@L@P @ !C-PXp@DMp P` 0@DS DЍ@`M@ WpO-0Pp@<4U 0 i I3il8`Y`( ZU0D0 ЍIP\80S   U@IyU@DDAD@\ZU@DDAD@P C-\MpT@T @DT00\Ѝ``HPP@LP000//o/00//p@-@M P@`@@L@T@@mL@T*@Ѝp@-@M@@`PpaP(00 0 Ѝ@-O 000ЍG-@XM`@@`P>p@@@DT00XЍ P@ &LPPU @Dt@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP9T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 01dPEU 0 R/R 0.^0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @-000 0@0 ! 0#2 /UUUU3333 @-// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00m/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-0o @-@oQPO-(p@@@, P`T @.`VPW:/@P WRQp@-@@P@T@ P`Q@n.PPPpQPp@-``` P@^.@T`PpQPA-`` p@PL.W PU`@@@-0 0(0000 0P 0@Ѝ[@-0 0(0000 0P 0@Ѝ[@-$0000 0vP Ѝ[O-pP .` 5H@P Z 0 81@ Ѝ 0/10 *1  HQ p@-8R@P$3U @2C AQ   0 0#01R,# p 0 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,J0 0##Ƞ#\#40Q <1̌ .0#,B/.^0A-@R0@P0`?S  S *S R :[S0^\PP^1(R$#R& `0Sp0 R0 P P P`0SW pЍp]^ S -^ pQ[W 0]S RW00P0B?o2^Lo  S0p@- "!A0 P#.. "P!Q" Q Q00#&" p`04`@N8<#<# "^@E!10@("$"[@-@  /Ѝ@-@P $/@ (# 0"N^O-@0$M(`00p 00P0$00D2 0@00  q/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0O^LO^A-pP@, $`QK ?PU(7  08R(#)8 b\ `.`6`0pPDa(!"$a$"  .0Vh @Ѝ@R )@ b68 7 )+0(0G-PR0 p@q?p` @g(U: . 0$ 0 @PE 0$ (P`p(*?XG?0?PU  (h. 0$ Q0 0$  0$ @H< 0$ @ R.  0$ @H< 0$ ?XG ^@-@P $<.@ ( 0"P^ J@-@P @ ((. P 0$$0P^0O-P \M@00 0 0$8`00p@-@P @ (+ P2 0$$R^Vyp@-`P@ P P0U pO-M@ `~+0Oϟ0800000000 0<00<<0\0`0c$c< 0\ 0?8  " < " daa `!8 8 ahpaTa Pa.e!PPPlPede\ Pba. P`PgQ`&`pP`mete\ P@P@pbQ PpptbQ%Pntn pa bqx .btb, ]pfaa!&p| a!" `t` pe&aq ata $$p-npe.p`e!ftfl `(`(p ba.peqP``&`ete\ P,P`Pbq Ppbq'pnTn 0maQ b PP%Pbb,  4 4}faa!& a!" `` ]g&a -eQaa g% g. aDa b%g! $@ ,,@`,bA @σbA$ P @M,(P, P,Pn  _bQ@ ,P), a͌P% P%/oD `n!!  n!" ` 0-`&o&Hd! ?n1 @04l0#0#d,)?# 0 8;  +!!b,dq$@.( @`((b O@@O @( + p*i * p' n'ϠLσb $ ,뭊 "/"/"i.O@ ,(0@͌ @  $kA.i @$,@j4M )**k _,P_P )0P䝉P._%_%la 0k`& `4dAm . .$.(l$ +潋   i$ l fa͌ ..i&4 (@썈 (@  OP@kA&iq @$@DplM''' p kq,p'韃 pH`}o&$o&o&`h,oka) D`dA睉o&o&o&h$毠D毃 H+ ,, Pg$ *,齋_HP_hQ @Pi뭊_%(_%_%P_PL@g) ($@ꍈ!!kA)g @$@@jkq*_!_%_%p'@ $pLM!)})L?h*k1!,0/# 0/"0?"d! 0h!d1  6 0-   $gdg$h(, ((aaTag`d`@0mO O$bO$Xba g(p4͌ p $p nq(bqn(paqPp !p!!fqnqf pbq4 p"''lQ/4 l!f!P/n!PP ]"( +`/+, /P `!l!, /f! `D /" `/"`/"aa `aa! `ola H`-,$`,,eaaae o`aD`͌ ,*na*0Dean0`oaaH` l! )bA )Hbn@e@P@M!(P!!lbnL䍈!!0!`l`b@ o"o&o&dq/@ d!`!p/l!$pL h}", ! !/, h!d! /`! T ͌/" /"/" n!h!n /d!$@X /"/"/" g!n!gA @ /h!@T lM_"0 _%_%/0 l!g!/n!X 䍈/"/"`/"l L?`g1(p40dA`$?#p)?#p?# 0 p2lqPp,,,ph$,`q4 pn͌ ''ha.4 `&`Pm   POi.hA ! D@lO$O$O$ @i,O@(H@.ፈ..$fA,i@$@DaM.++fQ! HP%P,) ])h!!σf " @dAha$, `&-,$,,`!m!!e$ᯃh.@ b!(yZnܼb((pe"p(,@pO$O$$((@f" OeA0@nfq._$ @p' _%_%O@pL @}O"$ O$ O$h!.䯃f "0` `-&(`**ha 꿃`&L `m.._.g 埃h.4 b!((,gA"쏃P@$@   f"!g p4Mn!p !!$Pf!. "P /"(P/"/"80?d!. "f10 =00000`10<0d1 0\000Ѝ000,00(00$0 0 00000/#EgܺvT2A-0p! @` :   1?0 ?RP @Pc0 &:?0S:00 GA&-@P@-@ P0`S  !00"S  tpp0~? S U 0 # !1" 0S Ѝ p_0S^0A0CR/00L0#40L00L00L 0O-p0LM 0@084Q0Q\<0 8 0 p 0%00#0(<$ $ !l(a8 $  , ǁ@ #  " (b%  0!00#p0<, ! pa " ,ǁ(p #  " b% 0!00#,p0<, !0a4p)NON " ,Dǁ #  " (b%0 : #R?0V FA#E@P7@-@P + !? 7R8 bx b8   X  Ѝ0@!2S^0`( a!"$,a c"/G-P`8 p#T0.@``T%0  N! Z0DD 6ੑ  cZ&1000DDD0DpW@@@%T-M Ѝp@-@ P` !LN! !@ApA-`PP#*p^@P P  NPP q0PPW` *Pb`)\PXV@-MP@@@`@pT:Ѝ Pp0P00 EP_p_00yara0tcid 0 꼭 0 꼭yara 0 꼭tcid\ 0/\ 0/yara\ 0/tcid0S 0 w/Ἥ0S 0 l/Ἥyara0S 0 `/Ἥtcid@-0p3Ar+`P @ Y0*.P 0W@PP ?O@P0(ċ Ѝ /p@-@CPl)0PPptcidp@-@7P`) 0Ppploob@-@'@ @-@!@ @-@@6 @-@@M @-@@d @-@ @p @-@@k @-@@f @-@@a @-@@\ @-@@W @-@@j @-@@~ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@ p@-@P((0P pP pgntsp@-@`P(@0P pP TpatadA-pP(X0P `͊@P  P @ߊgntsp@-@RP P5(pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P  p@p@-@P p@p@-@P= p@p@-@PS p@!P0/tS^^@-ZZ@@P\DTPP P" P; P\ÀP0 P P\(:P0P0P 0P 0 P@\0 0 P@ :\0:`0` SP$0 S 57$00$0/@-(0$ @ BR00C#$0$0,0(0@-@$ P *  LPP$00$0Ѝ  p@-PQp, @Rp$0( 0CQp$ >!Pp00@-S@ @$0,,0<000G-@P8MeY@ , `0a0000P SF SF S40 0 YPP`pP@XK FX Z:X =X *X # i@ Q l ` $0SR00#  C R00  R00  CT$@8Ѝ33 S R 0C# 0   Q b@0S00S > #@ 0  0 SbX fX ?R0@SQ)0?S R  P  c5S CP2QPx B0  PU !p  ?Rv0@Ss`p b6b` B@S7a7r  C# c,1 cp0 0FXPE  0  Y=  0 fP40FU0= 0R9 WV$0  Q  0fU0'0 S# WV U 0S Y P0  0S  0 P  l $0SR00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` .SPp-@-@`P "SP@ Ѝ/p@-@P ESPp-@-@`P  SP@ Ѝ/A-@`Pp RP-@-@`P RP@ Ѝ/00/0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-P0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;04 8T`. 00" <0," @" Dp" HP"$ L@"P(  ", !X0#\`&`+d*h(lp'pP%t@$x "|)0#`&+*(p'P%@$ ")0#`&+а*(p'P%@$ ")᫿ +! ! +$ό, ό. . ,᢯*p0?0#`P@$pP% ` /`&pP_pPXP\` "P!`+q~Q^D`XP@P`,\pP.s%}S&]P``PpdpP% ``&u%{U&[`PP`,pP.wxWX`PP`*pP"zuZU$`@P P`*DpP"~%r^&R`P0Pdp`!4P&~P+r%^RP`Pp`% Pp,P%yvYVPHPp$`"LPtምP*{T[P`PppP% ``&q%Q&_`QPqp$P#g%iW'Y(pp#৒}rpp崐!p娛p+{tppȐ"p(p*'t|ᤀpp$p#'t(|ᄐppph "tp.l*|s,#,੪ሥᨊቅ .),( 娀!଀+ !)x #|媼 $ᩜና帐< .༐ ,஑ጞΌP0#T@$#:$68@P0 1. @ @$.$JA@@D 0$000.0@0@D010$0 10.0 1@$1@00$ 0D00.$0 1$@00$(00.,0PX0@\0 `00$00d00.40X0@0\P00$80 0.<00@0X00$@0\00.D0`0 @d0 00$H000.L0P`00d 0#P0 0*T00,0X0 0#\00,0`0 0#d000 ,h 00#l00 "0p 00#t0 0 0 "0#x |0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 0 00 " 0#0 00  0#000"0 1 10 " !0#0!0 00 " 0#0 1 10 " !0#0!1 10 " 0#0!0 00 " ! 0#00  "$0# , !1Sw000 00000 00$00(0 0,0$000(040,08000<040@080D0<0H0@0L0D0P0H0T0L0X0P0\0T0`0X0d0\0h0`0l0d0p0h0t0l0x0p0|0t00x00|0000000000000000000000000000000000000PKߍT^T^-@-(00SL ЍЍ/\@-@ / ?!BC @p@-P(?@P !0P0 0p0T^00@-@0 0 h A`z000S D峎Ѝ0$嫎TP 80 $A-P`0pS 5@P ` ptLlgT` x!P僎<@@ wĭl[ $0@- @  0T^P 0R @-0,QSho//ᝳ^p@-` @P"P "P p@"p 0S " T^HA-pD@P 6P┃`P!@B` P-@- p$0 0J@P Ѝ@Ѝ/`tPP  $00xJ R^@-@@ Ep@-@P@p X0R0 HPP  0Q p@%T^^p@-@P L0R /PP (0Q p@ pT^^P/ 0R /T^P/ ,0R0/0P//T^^\ ?o@-L2^0S0  Q 0Q0 /T^^P/ 0R/T^p@-@PPp 40R ͂PP 0Q}T^^P/ 0R0P//T^^A-@PЍPo0 RQ R0 ` 0`ᙂpP  H0R Q0 , I `pPꢂT^^&b^A-@PЍ 0R0 p 0Pj`P 0< S0p, I P`PvT^^&b^0P -?o42 ^0S0 So /T^P/ 00R@- 0Po/T^^P ?oH 2\0S 0S0QS/T^^fP 0R0P/T^^f@-(0pSM W`@V `0P PP 00 0P S Ѝ`0S 0 "R00   CPʝ_P 0 0#/-0 S RS R RP/$0S @-Z3@ۋ̭8v[8@-! (M@ d  `0P\   H DJ P(ЍP h ڝ__'_ U^p@- @PS2>p8@- @ 㔋 h8U^ 00 S  \: P03#/S  \ P0///p@-P0S 2`2@P 嘋啋@<@P t|TILPP v4偋0=@pV@̭v[870ET;W% P=Q PPS^3 .QPT@ @6 0  0 \Q PPS^ .[ ^F Ѝ[aU^_H-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@`pPS2U @R'SP U @0C @g@OoU0@d08D/o?o0CS c"U@SB BU  V 0f0?o c0B0C8/oo@p !1 Q  a4Π81@0 @V@TΏPO0QU  @@a4.Ό8?o/o0CS 0  0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/Q3 /p@-M@JP PPP$PPP(P0fS^ "S4 [S. + Ch 00C S9dtS3 {S]1S/  P3/P0 0 P0 ;`PT PU 0S  ` H1000"S0(0 10rS PP0 P$ލp0uS0eS 0  00( 0aS0lS0sS0eS 0+0Cd0 0`P6/0 0`0 6/Pm 00[[t[[X[Q@- o/@-IM@pQ`V P0P P Iߍ 0P PP 0P5/0 0P0 5/P 00  0p3/P 0 0p0 P `lU^A-`Q@Pp p0<S 0S !S0-S0E?o 2-R0SP/S8PEU0SP ,P 0B0S*\30HV0 S ^P0/S0(0U0(00>S0>S000 0$0P>R/R R0S 0S  0 A R^"C "R R0  0 "Q 0@$00>Sy=Q QrQoO-0S` 0p@P0S "S \S0@0%uP mP bP /P \P "P n@P꼑[0[0[0[đ[0[̑[ԑ[fP 0000@V 0c XPU 0 0 0 P ;8#8 S:0Z Z 0͕x S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 PUcYPW@ Ѝ0S <SK &S@ aQmQ#pQd;Qa@V X\0 lQ gQ0tSR0;SO>0@0tSI0;SF<0@pQA0oS>0sS;0;S8'0@qQ30uS00oS-0tS*0;S'"0@Y G-`WpWU P fP 0>SSS0 P0S 0SPP4Py$S0S EP  ?PP P PPyP(0SP 0p P V` P PP   P_ ___*5_x RC/A 0\R#R! R/Ao/0 P R   //p@-`P .yPP@p\^4@P@y<V4@P P(U0 P`000@U^啃0$0S @-*@Iԭ0,[@- @ 8  @U^G-@pP`VU@ 0@焑uPU@ `F¦`@-@_@\p@-P@@sPPpp@-PP T0Rx@P@p,00$000P00 0U^[ܟ[ U^0 0C0 s@-@P 0U S xªlT5Ѝp1PP`P 0 0OPP0 0C0PP@A-` pPZx@P W @` !& @`hxC-P0pS`@M>0}S "S Ox00Ѝ000"S 00  0>P 00S80"S0:S@@0 P  {P 0 P ,0S x0h P ,0S(0S  ,ZP TP [f^/_p@-@P `\0 R@VP PPPV @pKU^O-P0p@S쁟0S9 ЍO jP@+ ЍSP `P 00 0;P> U LL0 S / P0R  P [  0P 0S& P 0  03/P  0R1#P Po 00C 0P ,3@P W^ V^U^R_0,S<S3H8(@-@ 4p@-P@PL 0 0 0p@蛩G-@P 0R@ p5PP`ᅩ@ 0冡ᆁ!^ \ 0冁 0` 00V:000U^0P ,0R@-P000/U^p@-@P000p@Mp@-@P ,0R@P@>pU^p@-@P L0R@P`ר0S@#*+@$pU^p@-@PĨ@pA-@P x0RPᯨp0S `VP 0J`P pU^p@-@P @0R@ P`የ v@ۨpU^ P /o00"\ RP0\`/U^O-@Pi pt2 R0^  /PP @p@L0S 'O !PP |净0Q=P8q/y P,U<UU x1P` hR  @P 4PP KV.PMU@X Ѝ6` V P 0p000000 H P [K !E 0P0 F@ B! 8 0 P 0 0@U^ԭ,[04H8(V^G- p`WPu 00@ >Pu0S0,S  0 G 0P -?o<2 ^0S0P S/U^@-@P+ 0R'P`q0 ?P 0 0 B! 00C0000 Ѝ@襧 ЍU^0P/?o( 2\0S/0P S/U^0P -?o42 ^0S0 S/U^P/ 0R/V^0P -?o42 ^0S0 S/V^PG-@6 @`TPp P*  0 S @A?  S 000 01 0 01 $0 0P@ @0SA-pP`x@P (Q@rt0P@ A/ V^p@-P(/@P 0P0 0plV^P 0RR @-lo//0Sb G- 0PSGtS h@PR  pPWW(G0  0"!00 Pa#N<`P%c?P6 0DP0 `0>P* P08P$ pGP唀W%10``+P R0P&RP0"P Wa<`=0P =P/V^lV^@-@0P s0O-Pp @`QU A R<QYm L[" =QX ,PC Y ꠭[ȭ[[8[U T8*@U0 W- @ " @U0 W @ ! @U T*0@00@0`<S S CR=S Q"0S 0CSR30 R Y Y( 0<S@(0@SV^A-p`PV@P+sPP  P `PQp@-@@0PP2sP`s@P0p  0P @ PQPp@-@PP@PP @p@-@P H0R00S b @P000@lV^P/ 0R /lV^P/ 0R/lV^\ ?o@-H 2^0S0 RRQ 0 /lV^p@-@P <0R Pp P rPP m lV^0P -?o42 ^0S0 S/lV^P/@-@@T ?o 2^0SolV^A-0S6 (P@U2pP& 08!P( $0S%  h$ 00 R`BrPP 00  0tP Sr 0iPЍ 0V dP V :rPP P,rP `\^^/P/?o4 2\0S0SP//V^p@-P00S $# @U 0D@bpܭ[p@-,@,PR0 0MpV^ R0AW^@-@P 0R@<V^P/ 0R/V^0P -?o42 ^0S0 S/V^0S(0S @-0@ /,W^00C0/0 P R   //A-`P mqPP@d,@PqD,@P P4pp䒣0 P`000 8W^@-@@ݣPG-@" @`TPp P* t q0 SS 000 0! 0 0!@$0  [ @⬣⪣@p@-P@@IPᛣpp@-PP T0Rp@P@p,00$00g0P00 08W^[L[G-`0@S,0SkG P@^P PP 00 0 /pP  00C 0dP l@[P0 03/P  0R 1#WPW^XW^s@-P@ T R p`R-ЍpADAP`@ 0 0MP@00C0@@ A-` pP[p@P W @` !' @`ip@-0`SP@p0]S @0 @P  Ѝ P 000$ FP ,0S8[_0 /p@-P0@Q  0 Q000pPpp@-P@P0 0 0 0p@onA-@P x0R@ `PP` i@ 0qE 0q`0V:0008W^@-P000p@-@P ,0R@P@Ap8W^p@-@P ,0R@Pۡ@/p8W^p@-@P L0R@P`ȡ0S@#*@p8W^p@-@Pᵡp@pp@-@P㨡000p@p@-@Pᛡ@@@pp@-@P @0R@ P`㇡0S 0@Aסp8W^A-@P `0 R@pPo0@0S@ṡ 0 0a000 @8W^p@-@P <0R@ P`E@ᖡp8W^A-`pVP @Pj h 00c 0S]0,S00 AA-@P 0RPp 0 0a AZ 0!1 0S0C0000KA- 8W^0P -?o42 ^0S0 S /8W^ 0Sp@-P`@P (0S p@:p/XW^0-!00!!1Q100 000000 0#0, 0# 00!R0Q000 00 0 00R0000!00p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0r!000p@i000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG-P`0pX@S\@ @!  A@@ @H :/0P ?! Q@ \  !    A@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!0000\ !0000000T   " 0S`   T" qW qW2 8 T&aa..1000T0\00RqaaT  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG-4@`0P pE UWpp-UPp` +UP`00U400XS 0 A B0C QRP@`T@@i^ 00E \a0ESW0EA0ES70ET P  S  R 0 PT@ @  X`FXRtW^_  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/5  0RR! R/P/0@ 0A0S(*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//6A-M Wp @00S 3/P0`;P V 6/0p cPލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0 `` Q-0 @0  4/@P T p0  P$ 00 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@I@ap@-@ PQ aPp0< 0 Ppp@-P@AQpPpA-0@APS`B DaDqDQ? <Q? >QC &QC: TT0DS[[[X[[[f@\P /T \T "T T0 ( P Ѝr@t@b@n@@TPn_s_x_g_p@-@P 0Sp sPpPQ@-@@ g|Pp@-0`SQ p0p<@PSPpaP U>D @P QPp@-0PSQ E0p<@)Pp/!P 2P >p@-0PS`Q@p@P QQ p@P<P@P /P >A-`PPQPP0p 0SPU`@P  `P`<WP0 Pp 0 03/P P 0S PP|P`P`T T6P P(VP P|W^~_X^p@-@P` .+Ppp@-@P #+Ppp@-@P`E +Pp@-(댞_011/A-@pP`P `Pp` P102 P @-@\& P QRS  T00`LQ R S "  T  00 A- % M222!XV롹뱯T "v*N0R8(= b BcPhf\뭥5tX:+GD8wX{\z@;j7^0<"Xnc#48< .3Q% 30S#* :3#Q% 53#Q% 5Q *c\,+&;bjttJQegݥf rf^0  Z08S($&86.3ۮ/R 3R @00@0,U p2pZ pK`8@e~MTeg2$s0\"  000P@P8<4Oi u iFfvc뮳MBrPT=P'>T*1f 0i1@T(ji@U :K 1 @10dx1U P. l'%0 000rs/ťi!( A0( ?A3c01|pW2i@X 0 Xq0AD 0UPXh00@i?o|>D?,/@? N'554_̀<`PK4_ӀNU4_pMb@Ӏh] ._ԗOt4_4_̾W4_@ 0A @ 0H @ P `@ p @ p@ @ zssp_initzssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846>@,>@8>@P>@h>@>@>@>@ioexp_set_backlight ["$&'X4gklr'/57<?BCEGHIJKLMNORUVWZ[\^_:;<=>?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_ \\ m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    Ac@Ǜ__@`@a@a@Db@TR4c@xSc@,Rlsllsrasrror c^c^ c^^c^^c^^@$c^(c^P+c^(c^`/c^^_M3c^7c^P =c^Ac^Ec^_@ Ic^Nc^P Qc^Nc^Vc^[c^ _c^[c^cc^[c^ hc^[c^lc^qc^tc^qc^xc^}c^c^}c^c^}c^c^}c^pPc^c^c^c^pc^c^pPc^c^u[^^u[^^p c^c^p 0c^c^p `c^c^p pc^c^P 1_c^P c^c^P @c^c^P Pc^c^- K^)c^c^)c^ c^c^c^c^c^c^c^c^ h^h^ c^h^c^c^c^c^c^c^0 c^f^00d^f^00 d^f^00d^f^d^f^d^f^#d^f^(d^f^.d^f^3d^f^ 9d^^ =d^^ Cd^^ Gd^^ Kd^^ Od^Sd^Vd^uc^Vd^c^ Zd^^d^ Zd^bd^/fd^;c^oid^c^0/Ec^;c^p md^g^rd^wd^@zd^wd^d^d^@d^d^d^^d^^d^^d^^d^d^d^d^d^d^d^d^ ^d^ e^d^ @"f^d^ `*d^d^ [2_d^ d^d^ d^d^ d^d^ f^d^ 0d^d^ P^d^ pd^d^ e^d^ d^d^ ~^d^ d^d^_d^ d^d^d^e^ e^e^e^e^e^e^e^ e^&e^ e^ *e^ e^0.e^ e^@2e^ e^P6e^ e^`:e^ e^p>e^ e^Be^ e^Fe^ e^Je^ e^Ne^ e^Re^ e^Ve^ e^\e^`e^ee^`e^ ie^`e^0me^`e^@qe^`e^Ph_`e^`ue^`e^p+_`e^ye^`e^}e^`e^e^`e^e^`e^e^`e^e^`e^e^`e^ e^e^ e^e^^e^e^e^ e^Td^0_Td^@e^Td^Pe^Td^e^e^k^e^e^e^e^e^e^e^e^e^ e^e^0e^e^e^e^e^e^ e^e^0e^e^e^e^f^e^ f^e^f^e^f^e^f^e^!f^e^eqnecsccmiplvsvchilsgeltgtlenv^^b^b^^^b^b^^^b^b^^^c_^0.01.02.03.04.05.00.510.0daiadbibedeafdfafafdeaedsdeppmz\m@dm@T_bus_dma_busaddr_to_paddr_bus_dmamap_sync@m^Nm^Nm^Ym^gm^um^m^m^m^m^m^m^Nm^m^n^n^VA2n^T"\2PVABn^T"\2VAMn^T"\2AVA o^T"\3VA'o^T"\3 VA.o^T"\3pA5o^T"\3qAp^T \5TE0.iLp^T \5TEAiZp^\5TE!iap^ \5TE !ihp^ \5TE)iap^ \5TE )ihp^ \5TE-iop^\5TE -ihp^ \5TEAizp^T\5TEAip^T\5TEAip^T\5TEA p^T"\5TE A p^T"\5TE`A p^T"\5TEJ`A p^"\5TEJ`Ap^"\6J`Ap^"\6J`Ap^"\6ZK Ap^T"\6KPA q^"\7ApAq^"\7AA$q^"\7A/A1q^"\7A?A>q^"\7AAKq^"\7A/AXq^"\7A?Aeq^"\7AOArq^"\7AAq^"\7A/Aq^"\7A?Aq^"\7AOAq^"\7AAq^"\7A@Aq^"\8A0Aq^"\8ApAq^"\8ApAq^"\8AAr^"\8AXVr^T"\`Ar^T"\XVr^T"\?Ar^T"\@XV r^T"\ A r^T"\@X/V r^T"\{_2n^.n^7n^>n^Mn^In^Vn^Rn^_n^[n^hn^dn^un^qn^zn^n^n^n^n^n^n^n^n^n^n^n^n^n^n^n^n^n^o^o^o^0r^7r^=r^Cr^Ir^Or^Ur^[r^ar^gr^mr^tr^{r^r^r^r^r^r^r^r^r^Or^Ur^[r^ar^gr^mr^tr^{r^r^r^r^r^7r^=r^r^Ir^r^r^[r^ar^gr^mr^tr^{r^r^r^r^r^r^r^r^r^r^Ur^[r^ar^gr^mr^tr^{r^r^r^r^r^7r^=r^Cr^Ir^Or^Ur^[r^ar^gr^mr^tr^{r^r^r^r^r^r^=r^Cr^Ir^Or^Ur^[r^ar^gr^mr^tr^{r^r^r^r^r^r^r^r^r^Or^Ur^[r^ar^gr^mr^tr^{r^r^r^r^r^r^=r^r^s^ s^6s^Gs^ar^gr^mr^tr^{r^r^r^r^r^7r^=r^Cr^r^r^r^Xs^as^js^mr^tr^{r^r^r^r^r^ss^zs^Cr^Ir^Or^Ur^[r^s^s^s^{r^r^r^r^r^s^s^s^s^Or^Ur^[r^ar^gr^mr^tr^{r^r^r^r^s^s^s^s^s^s^s^s^s^s^s^s^s^s^s^s^r^7r^=r^Cr^Ir^Or^Ur^[r^ar^gr^mr^tr^{r^r^r^r^@v^T@v^@ w^T@w^H@/w^Lw^H@bw^w^H@w^w^H@w^w^H@w^x^H@.x^Nx^data_abort_handlerbadaddr_read@````` ```pmap_map_chunk ERROR TIMEOU DFwd_flushcachewd_trim^ف^I^Y^p^}^^^ ^7^I^Y^p^}^^^HKAJAPA_A8cA^AP^Aa`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~BBB8BBBBBBB8BB8BB@BBB8B\BB8BTRUxSTPBAB^^sysctl_wiwi_push_packetwi_write_txratewi_startwi_rx_intrwi_rssadapt_inputwi_tx_intrwi_tx_ex_intrϯ^^^ ^6^_^^^ٰ^^ ^ ^ )^ )^ )^J^J^J^m^m^m^^^!^"^THIS is A memory TEST pattern !)\uCpC]Cd^ClCt]C@]C^CxSܻU,R ##$CȴC4CxCCCC@ CC@LCCAC^Y]rY]zY],&:Y]Y]rY]zY]n@ "Y]Y]rY]zY]Jڧo Y]Y] rY]~Y]aX]Y] rY]~Y]Q?}-X]Y] rY]~Y]@ZC˔X]Y]I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6 Z]\] Z]0]] []^]  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN   !"#$%&'()*+,-./1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }  !"#$%&'()*+,-./Al D^expand 32-byte k^ DDDhD D$DD@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[jUS_&)ûIt~._dyz,(4y:b,ia /A&"3DUfw̻wfUD3"-  J1AY'A;B'{BP}sՊtS.&\w]w]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q\w]v]]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHw]w]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHw]w]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@w]v]DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rq^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-tkip_encaptkip_setkeytkip_decap^\DPD|DD܃DDD0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-ieee80211_hdrsize^БDđDpDDDDDieee80211_hdrsize ieee80211_sysctl_treetopieee80211_sysctl_setupieee80211_sysctl_attachieee80211_load_module_ieee80211_free_nodenode_reclaimieee80211_free_allnodes_lockedieee80211_node_table_cleanupieee80211_reset_scan_ieee80211_find_nodeieee80211_setup_nodeieee80211_cancel_scanieee80211_get_rateieee80211_tmp_nodeieee80211_find_rxnode_withkeyieee80211_find_txnodeieee80211_find_node_with_channelieee80211_find_node_with_ssidieee80211_free_nodeieee80211_create_ibssieee80211_ibss_mergeieee80211_end_scanieee80211_next_scanieee80211_node_delucastkeyieee80211_iterate_nodesieee80211_node_leave_11gieee80211_timeout_stationsieee80211_node_join_11gieee80211_node_table_resetieee80211_node_table_initPieee80211_encapieee80211_compute_durationPPPPPPPPPPieee80211_send_probereqieee80211_send_mgmtieee80211_mgmt_outputieee80211_beacon_allocieee80211_beacon_update^^^^^^^ieee80211_newstate  0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked       ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparamsieee80211_rssadapt_sysctl_setupf^-F<8F(7Fd8FC\FEEh]pF,GEE,]ІGlFEE$]FFXF8nFEEh]CZEEh]`Z)CZEEh]`ZsCZEEh]`ZCEEEh]4EdE(EC8nFEEh]sF     }E#(D(@AAA==A*ip_outputmFmFmFrFlFLqF pFsFXsFmFmFlFrFrFlFlFxFlF\rFtcp_outputsyn_cache_respond @@@@@@@GGGPGx?GNGEGBGG DGDG\NGNGTFGp'GGEGEGx@GHAG@GFGGGTGQGUG,RGpQG(TGQGPTGRGpQG@YGYGPTGVG4XG""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwlG0GGHG@GGGXGЅGG,GHGG(GPGXGG GG<>_4G^hG^G\_lG^_ b_8_P_##   1 @(IhII(III(III(I,II 22     * #hhu hhh_`III__ ;_Z_III_IIxIU_U_U2_U3_U1(_DIIHIM_U5M_|I`IHII̳I\I x_{  _I̳ILIIILIC _b _ _ _ _I\IXI} _}- _}O _DIIJx8Jt5J>J_8EJPDJ4;JYJ7J?J @J@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!!___$_*_0_6_<_B_H_N_T_Z_`_l_f_f_l_r_x___ ____________wsevent_copyout_eventsX`Jt]JtpJ0qJeJ,R4oJTR\fJxSfJ,RABCDEFGHIJKLMNOPQRSTUVWXYZhJJJ,R8JTR@JxSJ,Rrasops_reconfigrasops_init@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????@ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?*&8+&*&]]o]o]                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~]A]aS])]2]]]ͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠPXLJJTFJJPNJRR$JCEJST\JNM`JJCLJ0PLJ0RE J@RR$JCEJST\JSLJRR$JCEJST\JERJCEJST\J X]]]ATJ_]\^UW ^\X ^XX ^XXd^XX< ^XXX ^XX8 ^XXT ^XXp ^XX ^XX ^XX ^XX ^XX4 ^XXP ^XXl ^XX ^XX ^XX ^XX ^XX ^XX ^XX0 ^XX ^XX,^XXH^XX^\X^XXt ^XX ^K ^X ^ K ^pK ^XX ^XX ^HX ^XXL ^0Jh ^\J ^X ^X ^XX ^K^X ^ W]\^UW ^\X ^X ^\Xd^\X< ^\XX ^X8 ^XT ^Xp ^X ^X ^dX ^lX ^X4 ^lXP ^\Xl ^\X ^\X ^\X ^\X ^\X ^\X ^\X0 ^\X ^X ^X,^XH^X^ X^pXt ^$X ^K ^X ^ K ^pK ^tX ^X ^HX ^dXL ^0Jh ^\J ^X ^X ^K^X ^ W]\^UW ^X ^J ^X< ^XX ^lXt ^lX ^K ^X ^ K ^pK ^ K ^X8 ^XT ^X ^HXp ^dX ^ X ^lX ^X ^lX4 ^,XP ^Xl ^|X ^X ^X ^X ^|X ^K ^ K0 ^@XL ^0Jh ^\J ^X ^X ^8J ^@K ^K^X,^ KH^tX ^ W^ X^pX???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ@%K%K X$KX$KXupdatefatsYK XKYK(XKXK[KXK0XKYKYKU4]AcK*_. .. <]\^UW ^X ^DK ^?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:ZKKKlKnfs_sillyworkerKKTKX @]]]]]t]`]F]*]]]]]]x]V]B],] ]] ]] ?BEF   F''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  ]]]A?L1_8]\^UW ^\X ^XX ^XXd^XX< ^XXX ^XX8 ^XXT ^XXp ^XX ^XX ^XX ^XX ^XX4 ^XXP ^XXl ^XX ^XX ^XX ^XX ^XX ^XX ^XX0 ^XX ^XX,^XXH^XX^\X^XXt ^L ^L ^X ^0WL ^ԙL ^twL ^wL ^HX ^?ML ^Kh ^K ^X ^L ^XX ^`L^X ^\X<]\^UW ^\X ^X ^\Xd^\X< ^\XX ^X8 ^XT ^Xp ^X ^X ^dX ^lX ^X4 ^lXP ^\Xl ^\X ^\X ^\X ^\X ^\X ^\X ^\X0 ^\X ^X ^X,^XH^X^ X^pXt ^L ^L ^X ^0WL ^ԙL ^vL ^(wL ^HX ^dXL ^Kh ^K ^X ^L ^`L^X ^ W@]\^UW ^X ^XiL ^L< ^dLX ^VLt ^?M ^L ^X ^0WL ^ԙL ^uL ^K8 ^XT ^X ^HXp ^dX ^ X ^K ^lX ^X ^?M4 ^,XP ^5Ml ^DxL ^<7M ^ M ^tbL ^ M ^ yL ^0vL0 ^@XL ^Kh ^K ^X ^L ^VL ^zL ^`L^X,^L{LH^LL ^\X^K^pXffs_mapsearchffs_nodealloccgffs_freefile_commonffs_blkfree_commonffs_blkallocffs_blkfreeffs_realloccgffs_blkfree_snapffs_freefileffs_freefile_snapffs_isblockffs_isfreeblockffs_clrblockffs_setblock]]]]        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?*NN ^|M ^,N^X,^N ^ W`^M ^ M(^\M^MD^DM|^dM^X^X^XX]\^UW ^\X ^X ^\Xd^\X< ^\XX ^X8 ^XT ^Xp ^X ^X ^dX ^lX ^X4 ^lXP ^\Xl ^\X ^\X ^\X ^\X ^\X ^\X ^\X0 ^\X ^X ^X,^XH^X^ X^pXt ^|N ^X ^thN ^iN ^kN ^N ^N ^}N ^,N^X,^NH^pN ^ W^ X^pX`^M ^ M(^\M^MD^DM|^dM^X^X^XX]A.Nۋ_#_h`]\^UW ^X ^\X ^\X< ^\XX ^1Nt ^4N ^\X ^\X ^\X ^\X ^\X ^\X8 ^XT ^Xp ^dX ^\X ^lX ^\X ^dX4 ^\XP ^\Xl ^\X ^\X ^\X ^\X ^\X ^\X ^\X0 ^\XL ^@2Nh ^2N ^X ^X ^1N ^x3N ^2N^X,^\XH^\X ^ W^Xufs_inactiveufs_dircompactufs_dirgrow`YNYNYN`ZNZNt[NZNZNdaN aNAdN$_ ...(NN$NNuao_putN NN_module_start_unload_threadmutex_vector_entermutex@(;*_2IчHR_|nQn- q+R_ZIчH#_|nQn- q+#_SFU0eC쬊#_IчH_IчH[_-чH΋_-чHe_SFH0eC쬂_S'@ )Ѹҋ_*1@ )Ѹڋ_1x )Ѹߋ_3Dh&_=rGy=iG}_|nQn- q+_Y@=YAY@YBYTRUxSTP,R4>Y@=Y* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jnd_set_timer +_$Z͏_,Zԏ_Zݏ_@Z$Zrt_initrt_timer_initrt_deladdrroute_outputrt_msg1route_enqueuert_addrmsg0ZxZjZ\rZiZiZdrZZZiZiZiZtmZLmZiZiZZjZiZx>ZmZd%^hZarp_llinfo_outputarpannouncearp_dad_startarp_dad_timerarp_rtrequestarpresolvetZZZin4_cksumwqinput_createwqinput_sysctl_setupAjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGr_R_y_|_}___#_*_____^_____[_΋__$______e__ҋ_ڋ_ߋ__  gnts$k[pm[l[k[k[ʝ_^^0 ѝ_ߝ_|w[w[rbmnv[u[$u[u[u[P(_strtoullstrtoll_[$_[)_[^[f^[ߝ_X[ʝ_t[tcid[ԙ[`[[[[[p[`[ /_^^f^cb^mb^_yekd[ę[[@ 3_(<_8<E_H,M_atadЬ[([ܪ[^ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/U_loob[ܴ[[,W^,W^1W^1W^truefalseyara[[[[[_r_u__ ^_strtoul _Copyright (c) 1996, 1997, 1998, 1999, 2000, 2001, 2002, 2003, 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011, 2012, 2013, 2014, 2015, 2016, 2017, 2018, 2019, 2020, 2021, 2022, 2023, 2024, 2025 The NetBSD Foundation, Inc. All rights reserved. Copyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. INSTALL_C700src@cvs:netbsd-11:20251218195753-xsrc@cvs:netbsd-11:20251210163722 NetBSD 11.0_BETA (INSTALL_C700) #0: Thu Dec 18 19:57:53 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 @(#)NetBSD 11.0_BETA (INSTALL_C700) #0: Thu Dec 18 19:57:53 UTC 2025 mkrepro@mkrepro.NetBSD.org:/usr/src/sys/arch/zaurus/compile/INSTALL_C700 11.0_BETANetBSDmd%d: internal %s image area match_bootdisk: can't get label for dev %s (%d) no mainbus foundwdWARNING: double match for boot device (%s, %s) boot device: %s ziici2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller pxaiic: PCMCIA/GPIO controller %s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoop%s: not configured. can't map bus space couldn't establish power handler %s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferSharp Zaurus LCDw100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) unable to create new screen (errno=%d)lcdctl%s: this kernel is not support SL-C1000 couldn't register event handler zkbd: pseudo power management module zapmunable to establish nSD_DETECT interrupt unable to attach MMC controller %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference   base 0x%x-0x%x irq %d drq 0x%08x core %dmainbus_bs_alloc(): Help!mainbus_bs_free(): Help!cpu_mainbus, rrx, %s r%d, %s #%dlrthumb insn und%s %08x %s%s , #%d#%d ; #0x%x[r%d][r%d#0x%03x#%s0x%02x%sr%d{r%d-r%d}^f%d#%s.%c%d, #0x%04xspsrcpsrp%df%d, c%d, c%d, c%d, c%dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown]oshstoshnshstnshishstishcpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxstrtdaWldrtstrbtldrbtldrstrbldrbpopstmYnWlldmXnWlblimbimbrangeswistrhtldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsmsrpFmpF2bxclzbkptmovwdZmovtswpdmoswpbldrexldrexdldrexbldrexhstrexdmastrexdstrexbstrexhSdn2adcsbcrscDn2teqcmnmovSd2mvnSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtlgnsincostanasnacsatnfpuopstfQLvldfPRgdfixPRdhwfswfcrfccmfPRghcmfecnfevandvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddvtstvsubNo support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() single-skdb-k-dask-auserconf-chalt-bquiet-q-v-xsilent-z%s: curaddr %#lxnot in range%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botchL%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x Processor failed probe - no CPU ID %s%s%s (%s V%s core)unknown CPU (ID = 0x%x): %s %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled%s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DCPU_ARM2ARM2asCPU_ARM250CPU_ARM3CPU_ARM6CPU_ARM7CPU_ARM7TDMICPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15step A-0step A-1step B-0step B-1step C-0rev 0step B-2step D-0(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)step B-3step B-4step B-5step Bstep Cstep Dstep Erev 10step Gstep Jstep Kstep Sstep T*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=Invalid, Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap %s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)kmpagespmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table provided%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable device bad device not ready area improper i/o error aborted from console vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)%s: not supported %s: status=%s %s: (error not notifiedwddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %xwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed device faultdevice timeoutrequeuechannel reset, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramsIDENTIFY failed SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jdWARNING: block size %u might not actually work hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate address mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015ASwdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferrecalpiomodesetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitq%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout %s: unknown type: %xunable to create kernel thread: error %d %scnfunable to create config thread: error %d %s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported atapibus at %s not configured ata_hlatabusatdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer error%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x%sat %s function %d "couldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed bad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x %s: function %d: extended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz error waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) can't get SD status: %d SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenancecan't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x unknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s,blkno 0x%llu exceeds capacity %d , retrying ld_sdmmcconfig_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270Kernel is configured for %s, but CPU is %s : Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %d: can't map registers pxauart%s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostStray DMAC interrupt for unallocated channel %d : DMA Controller dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedpxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmacpxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicss: %d slot%s can't attach failed to map MEMCTL unable to map register %s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer couldn't attach bus apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM reservedAPM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %sPower Management spec V%d.%dunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedapmdevpcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) (manufacturer 0x%04x, product 0x%04x) function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) unspecifiedmulti-functionserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS %s: using CIS quirks for SVECFD605 PCMCIA EtherNet CardNDCPCMCIA MBH10302can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0DYNALINKL10Cne_pcmciacouldn't establish interrupt MEGAHERTZMODEM XJ2288com_pcmciacan't subregion I/O space memory mapped mode i/o mapped mode wdcattachDigital Mobile Media CD-ROMPCMCIA Portable CD-ROM DriveNinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmciawiinitcouldn't load firmware failed to attach controller SMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC CardWireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11WL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaunable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain; first aligned sector %u%s: not drained dk_subrLucent/Prism/Symbol 802.11 controls%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed %s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d %s: tx rate %d -> %d (%d) %s write fid %x failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout %s read fid %x failed %s: null node%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%xwi_scan_result: unknown firmware type %u LucentSymbol could not establish softint could not get mac address, attach failed 802.11 address %s %s: using Unknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: NIC memory corrupt - invalid packet length %d device enable failed %s: remote transmit DMA failed to complete ne2000_write_mbuf: negative lenwhere did the card go? setup failed %s: %d silo overflow%s, %d ibuf flood%s com: unsupported I/O width %dtimeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTDesignWare APB UART, no fifois_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO txfifo disabled 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1atapitimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfatardl%s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so%s-%scompat_utilinvalid AES nrounds: %uBearSSL aes_ctAES-CCM overflow%s: ctxt %u%s: tag %u%s: verify %u failed %s: ptxt %u%s: forgery %u succeeded %s: buffer overrun %s: tag overrun aes_ccm: self-test passed aes_ccmaescryptoselectedAES is bustedaes: self-test failed: %s AES self-tests failedaes: %s %s AES-%u enc: self-test failed wasexpected%s AES-%u dec: self-test failed %s AES overrun preceding: self-test failed %s AES overrun following: self-test failed %s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed %s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed %s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed %s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed chacha: self-test failed: %s chacha: %s Portable C ChaChaxchacha_streamxchacha_stream_xorchacha core 1chacha core 2hchachacprng_fast reseed/usr/src/sys/crypto/blake2/blake2s.c0 < dlenkernel %sassertion "%s" failed: file "%s", line %d dlen <= 32keylen <= 32jA%AESŘOOLJ܈yLblake2s: self-test failedblake2s: self-test passed blake2ssysmonsysmon_envsyssysmon_wdogsysmon_powerWARNING: KERNEL TICKLE OF WATCHDOG %s FAILED! wdogrefWARNING: unable to register watchdog shutdown hook WARNING: unable to register watchdog critpoll hook %s: %d users remain WARNING: UNABLE TO DISARM WATCHDOG %s ON CLOSE! WARNING: FAILED TO SHUTDOWN WATCHDOG %s! software watchdog initialized unable to register software watchdog with sysmon swwdog%s: %d second timer expired watchdog timer expiredswwrebootfailed to create swwdog reboot wq%s: unable to attach cfattach invalid vap id %dvap id %d not allocatedinvalid channel freq %u flags %x invalid channel (NULL) %s: mode %u not supported (caps 0x%x) Unexpected mode %u%s: no channels found for mode %u Bad IBSS channel %ubad channel ignored; freq %u flags %x number %u vap table full.5%s: %s rates: %s%d%sMbps%s: no 802.11 instance! 11a11b11gFHturboAturboGAMRR increasing rate %d (txcnt=%d retrycnt=%d) AMRR decreasing rate %d (txcnt=%d retrycnt=%d) No cipher!%s: %s keyix %u flags 0x%x rsc %ju tsc %ju len %u %s: driver did not delete key index %u %s: cipher %s has an invalid cipher index %u %s: cipher %s registered with a different template %s: invalid cipher %u %s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s %s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! [%s] no default transmit key (%s) deftxkey %u %s: control frame%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckip%s: Invalid key length %u, expecting %u [%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONEout of buffers with data_len %zu [%s] Discard frame due to countermeasures (%s) [%s] missing ExtIV for TKIP cipher [%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt TKIP[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt WEP[%s:%s] discard %s frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: [%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed reassocWPARSN, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d disallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handledmgttoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6Dtoo short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xmulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued multicast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %ureceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%x[%s] %s compat_20link-layer statistics and controlsIEEE 802.11 WLAN statistics and controlsieee80211%s: sysctl_createv failed, rc = %d client/peer stationsvap%uinact_runinact_probeinact_authinact_initdriver_capsbmiss_max%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done [%s] %s replay detected [%s] michael MIC verification failed %s: load the %s module by hand for now. bogus aid %u, max %u%s %p<%s> in %s table %s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u %s: free all nodes in %s table %s %s table %s: %s[%u] still active %s: scan set:%s%u start chan %u ????ibss %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c passive%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULL%s: fixed rate %d (%d.%d Mb/s) not in rate set%s %p<%s> %s: add key map entry %p<%s> refcnt %d [%s] no node, discard frame (%s) %s %p<%s> refcnt %d %s: %p<%s> clear key map entryneighbor%s: creating ibss %s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s %s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s %s: chan %d->%d begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %p%s: delete key map entry %p<%s> refcnt %d %s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d %s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble %s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivitystation timed out due to inactivity (refcnt %u)[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated %s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s unable to setup initial BSS node%s %s table, inact %u scanena[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuWPA IE too big, %u > %zuieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u [%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u [%s] encrypting frame (%s) [%s] send %s on channel %u %s: cannot get buf; size %u no space for 802.11 header?%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl0x%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%sTODS %sFRDS %sDSDS %s->%s) data type#%d WEP [IV %.02x KID %u] %dM +%d%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x %s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon misswlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtscf_endcf_end_ackreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocdeauthreserved#13reserved#14reserved#15rssadaptexpavgctl%s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d %s: dst %s thresholds %d-byte, T[%d.%d] = %dexternal%hu.%hhu%s:%hhuigmpplinetigmplla_lookup: new lle malloc failed inmltplmulticastsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinterneticmpmaskreplreturndatabyteserrppslimitrediracceptredirtimeoutbmcastechodynamic_rt_msgICMP: redirect failed to register timeout for route to %s, code %d icmp_errorforwardingredirectttlforwsrcrtdirected-broadcastallowsrcrtmtudiscanonportminanonportmaxmtudisctimeoutlowportminlowportmaxcheckinterfacerandom_iddo_loopback_cksumdad_countanonportalgoavailablereserve%s: refusing to send from invalid address %s (pid %d) maxfragpacketsipfrenplrip_abortrip_acceptpcblisttcpipqepl(unknown)TCP: invalid wscale %d from %s, assuming %d tcp_pulloutofbandm_pulldown malfunctionConnection attempt to TCP %s:%d from %s:%d (unknown v6)Connection attempt to TCP [%s]:%d from [%s]:%d tcp_output REXMTtp->t_lastm == NULL%s: no template%s: %d < %dsackholepltcp_inittcpcbpltcp_new_iss: unreachable%s: impossible (1)%s: impossible (2)synplrfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnmaxretriesglobalmaxholesglobalholeslocal_by_rttiss_hashabcaggressivemsltremoteremote_thresholdvtwtcp6inet6newrenocubicudp_abortudp_acceptudpchecksumrandom_startrandom_pickdoublehashrandinc(src=%s dst=%s tgt=%s)%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d %s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s %s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6nd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknodeinfomtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtu%s: ENOBUFS in icmp6_error %d %s: in6_setscope failed IPv6 address: "%s" is not on the network %s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s %s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctl%s: %s marked tentative %s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 header%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled %s: failed to configure the loopback address on %s (errno=%d) %s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6Cannot forward from %s@%s to %s@%s nxt %d (%s) unspec/srcbcast/mcastmcast/dstsrc[%s] inzone %d outzone %ddst[%s] inzone %d outzone %dip6keepfaithlog_intervalhdrnestlimitauto_flowlabeldefmcasthlimNetBSD-currentkame_versionuse_deprecatedv6onlyauto_linklocaladdctlpolicyprefer_tempaddrmaxfragsuse_defaultzonemcast_pmtuneighborgcthreshmaxdynroutesparam_rt_msgip6_init%s: packet to an unready address %s->%s %s: off < sizeof(struct ip6_hdr)%s: m == NULLpim6register_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full assumption failed: hdr not splitmulticast_kludge%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timer%s: workqueue_create failed (%d) %s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt %s: can't allocate llinfo for %s (ln=%p, rt=%p) %s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 %s: invalid hlim (%d) from %s to %s on %s %s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found %s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) %s: %s: starting DAD for %s RA%s: src %s is not link-local %s: lladdrlen mismatch for %s (if %d, %s packet %d) raw6%s: assumption failure (non 0 ID): %s%%%d %s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s siteorganizationglobaludp6%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket addr 0x%x%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlistinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-byteunknown probe strategy '%s'; defaulting to '%s' : I2C bus i2c-no-indirect-configi2c-child-devicescookiecookietypecompatibleWARNING: ignoring bad child device entry for address 0x%02x WARNING: ignoring bad device address @ 0x%02x i2cexec,i2c_bitbang,i2c_subri2cexeciic at %si2c_bitbangmii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4xOUI 0x%06x model 0x%04xmiiautmii_phy_setmedia: MASTER on wrong mediano media present HomePNA110baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDX: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX BCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyDP83840 10/100 media interfacensphyDP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyterQS6612 10/100 media interfaceqsphyi82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphyi82553 10/100 media interfaceiophy: 3Com internal media interface ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexphy100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphyICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphyusing Seeq 84220 isolate/reset hack Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphyDM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphyAm79C901 HomePNA 1.0 interfacepnaphy: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroy%s: emergency X server detach added (%s, %s emulationwsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted kbdmux %d: console (%s, %s emulation), using %swsswwsdisplay at %swsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDIDdumb%s: ESC in kernel output ignored vt100[>24;20;0cP2$u%s%dP0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d[29~[28~OAOBODOCOoOnOmOlOkOjOMOI[2~[1~[8~[7~[6~[5~[4~[3~OpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_version%s: unknown version %dwsevent_read mux %dcannot load keymap: console keyboardattach error=%d couldn't register as input device connecting to %s wskdetwskbd_detach: %s didn't detach wskbd at %s%s: event queue overflow wskbdwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entrywsmux%s: disconnecting from %s wsbell at %swsbell%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported %s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary ccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d wsfont_unlock: font not lockedBoldfacecd9660noplRRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991ASPcd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] %/@%/C%/Eroot_devicecd9660_strategy: spectag VT_ISOFS, isofs vnode msdosnoplmsdosfhplloadvnode(): pcbmap returned %d deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld %s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. msdosfs_rename: updating .. in root directory?msdosfsmsdosfs_sync: rofs modRRaArrAamsdosmsdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu bind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d nfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpwnfskqpollnfskqdet%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_initnfs send error %d for %s nfsd send error %d timer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s not respondingnfsrvdescplbuild > MLENnfsumntnfsstatsiothreadsnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%unfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llxwriterpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)%s: map corrupted: start=%d, len=%d, fs = %s, offset=%d/%ld, cg %d%s: block not in map: bno=%d, fs=%s%s: map corrupted: cg=%d, irotor=%d, fs=%s%s: block not in map: fs=%suid %d, pid %d, command %s, on %s: %s %s: bad size: dev = 0x%llx, bno = %lld bsize = %d, size = %ld, fs = %s%s: bad block %lld, ino %llu bad blockifree: dev = 0x%llx, ino = %llu, fs = %s %s: freeing free inode%s: freeing free block: dev = 0x%llx, block = %lld, fs = %s%s: freeing free frag: dev = 0x%llx, block = %lld, fs = %sfile system full %s: write failed, file system is full out of inodes %s: create/symlink failed, no inodes free trimwqtrimwqcv%s: bad bprev: dev = 0x%llx, bsize = %d, bprev = %lld, fs = %s%s: bad blockno %#llx != %#llx%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE %s: bad optim: dev = 0x%llx, optim = %d, fs = %s%s: range: dev = 0x%llx, ino = %llu, fs = %sffs_balloc: blk too bigCould not unwind indirect block, error %dspec nodes went hereffs_indirtrunc: bad buffer sizeffs_truncate: partial trunc of extdataitrunc: newspacesnapblkfree: inconsistent block typeffs_snapshot_mount: vget failed %d ffs_snapshot_mount: non-snapshot inode %d ffs_snapshot_mount: read_1 failed %d ffs_snapshot_mount: read_2 failed %d ffs_snapshot_mount: %llu already on list%s: unknown fs_fragshift %d%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mounting%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2%s: options QUOTA2 not enabled%s %s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' %s: rofs mod, fs=%smfsidlmfs_rootmfs_open not VBLKtag VT_MFS, pid %d, base %p, size %ld mfs_inactive: not inactive (mfs_buflist %p)mfs_strategy: bad devwarning: mfs read during shutdown mfs_closemfs_initminiroot() called more than once%s: unlinked ino %lld on "%s" has non zero size %llx or blocks %llx with allerror %d %s: bad dir ino %ju at offset %d: %s not roundedmissing NUL in namenull entryi_size too small%s: too big%s: nospace%s: newblkhard-linked directoryufsdirufs_whiteout: unknown opufs_strategy: spectag VT_UFS, ino %llu, on dev %llu, %llu flags 0x%x, nlink %d mode 0%o, owner %d, group %d, size %qdinvalid uio rw: %damapplcownowcownowpageamapswpoanonpllkloanpguvm_anon_pageinuao_getuao_getpageuaoeltpluao_put: strange, got an out of range flush %#jx > %#jx (fixed) uao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_faultubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_objectudv_detachudv_attachflt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmem%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainloanzeroloanuopguser_va0_disablevmmpeplvm_map%s: kernel object %p %p uvm_voaddr_release: bad typevmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressthread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using NUMA allocation scheme UVM: using package allocation scheme, %d package(s) per bucket uvm_pagealloc_strat: bad strat %demergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! fork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slab%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG %s: swapdev not in listswap_encrypt%s: vnode type 0x%x%s: swap to sparse file%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedswp vnxswp vndswapctl: miniroot copy failedswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiod%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d uvnfp1uvnfp2copy-cred-on-forkbufq_disksortbufq_fcfsNetBSD-CORE%s@%dELFexec_elf32#!exec_scriptvmcmdkillsextendscalls/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit path (default %s)use absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d fork pagedaemonioflushfork syncer%s %s (%s)total memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/initmaxvnodesmaxprocmaxfilesargmaxhostidprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timemaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetidownergroupno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvfsddbvendorsecurityAccounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptpid %d (%s): %s write of %zu@%p at %lld failed: %d %.*sToo many CPUs. Increase MAXCPUS?cpu%dfdcloseincrease kern.maxfiles or MAXFILESfiledescfile2dup2entropy: ready entropy: best effort cpu0entropy intrdropentropy intrtruncWARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) WARNING: system needs entropy for security; see entropy(7) entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategathersamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)%s: invalid type (%ld)EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY*fexecve*execargsshould not happensigcode kernel mapping failed %d pspawnlwpwaitnetbsdinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCforkmxforkulimidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated dopowerhooks %s: %s (%p) dopowerhooks: %s done softresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx pserialize%s: %s caller=%pKernel locklwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %d%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%d.%d/modulesBuilt-in `%s' failed: %d moduleautounload_unsafeautotimemodunload%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dmod_hookLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.plistplist load returned error %d for `%s'Loading plist from %snoautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d locking against myselfMutexphysiodphysioDevices without power management support:%s: %s is suspended by %s (delegator %s) pmfsuspensortransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: Suspending devices:%s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueuefailed to reserve PID 1 for init(8)procplexpose_addressproc2proc_args%s (pid %d) changing logname from %.*s to %s curprocpaxflagsrlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememorylockeddescriptorssbsizevmemoryusestopforkstopexecstopexitcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x Reader / writer lock%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old panic%s: locked once %s: locked twice %s: initialized %s: disabled kpreemption %s: raising ipl to %d %s: raised ipl to %d, s=%d crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s %s: unable to remove %s from sysctl null_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabledsigactsksiginfotrapsignaleventswitchsorry, pid %d was killed: %s sigexit 1sigexit 2sendsig: bad version %d proc_stoptraceWARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s block/%usoftint_init_cpu: cannot allocate memorybiosoftint_picklwpwedge:NAME=parsediskuse one of: %s[a-%c] none halt reboot %s%lluswap dumps on %smd0 (default %sdump device (default %sb)file system (default %s): use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLsysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version %s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content len %d: end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings%s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destructionpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleeptodr_attach: TOD already configured WARNING: preposterous time in file system %s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! Cannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcnt%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02xrtts%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %dconfigure: attachment `%s' of `%s' driver %s failed: %d%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachlocationev: %s %s at %s in [%s] cfgmiscautoconfdetachallconfigintrconfigroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namelocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported waiting for devices: done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sconfig_detach: forced detach of %s failed (%d)root device %s not configured detaching %s, unable to detach instance init rollbackfiniconfig_cfdata fini rollback failedfini rollback unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected rangebufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbacknist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? pkg1st%s has %d %s siblings:%s first in package: %s GAVE UPureadc: non-positive residureadc: non-positive iovcntdevice-enumerate-childrendevsw%s: block majors exhausted %s: character majors exhausted writ%s%d%c: %s %sing fsbn %lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectordisk-info%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%cevcnt/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not foundhashdone: invalid table typehashstat KMGTPE kMGTPE%qu%s%c%snointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipiWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS kmem-02048kmem-04096kmem-08192kmem-16384kmem-00008kmem-00016kmem-00024kmem-00032kmem-00040kmem-00048kmem-00056kmem-00064kmem-00080kmem-00096kmem-00112kmem-00128kmem-00160kmem-00192kmem-00224kmem-00256kmem-00320kmem-00384kmem-00448kmem-00512kmem-00768kmem-01024not modular%#018lx%s error: %s,%zu: %s lock address : %s current cpu : %18d current lwp : %#018lx lock error: %s: %s,%zu: %s: lock %p cpu %d lwp %pklogmsgbufsizemsgbufrunoncepercpupool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) %s: [%s] item %p not part of pool%s: [%s] item %p below item space%s: [%s] item %p poolid %u != %u page %p, nmissing %d, time %u %s: [%s] ph %p poolid %u != %upool item size %zu too large, use a custom allocator%s: [%s] too large itemsperpage(%d) for PR_USEBMAPpoolbusyphpool-%dpcgnormalpcglargepcachepcachecpu%s: [%s] page empty%s: [%s] page header missing%s: [%s] %u >= %u%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p (null)[% 4jd.%.*ld] %s: table is full - %s %s: table is full Skipping crash dump on recursive panic panic: autoconfiguration error: mismatching pserialize_read_exit()exclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecificbtallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehash%s: workqueue_create %d static_bt_inusestatic_bt_countInvalid IPL: %dxclowxchighcrosscallunicastxcallxcall/%uaioworkaiodoneaio_process: invalid operation code posix_aioaio_listio_maxaio_maxaio_jobs_poolaio_lio_poolefdreadefdwriteeventfdfqabortfutexinvalid futex opWARNING: pid %jd (%s) lwp %jd: unmapped robust futex list head WARNING: pid %jd (%s) lwp %jd: exhausted robust futex limit sys_ioctl: _IO%s%s('%c', %lu, %lu) returned -1: pid=%d comm=%s memfdcompat_80posix_msgmqueuemq_open_maxmq_prio_maxmq_max_msgsizemq_def_maxmsgmq_max_maxmsgmqmsgplmqsendcvmqrecvcvmqparkedpsetpsets_max%d:1,%d:2direct_selectcompat_16posix_schedpri_minpri_maxsockettfdreadtimerfdttyrub: would panic c = %d, val = %d not a controlling terminal no foreground process group empty foreground process group found only zombie processes load: %d.%02d cmd: %s %d [%#lx/%d%ld.%02ldu %ld.%02lds %d%% %ldkttypausettyrawttyrawfttycanttycanfttyoutttyoutfttyreftkstatnincanccrawccqsizecompat_60compat_43ttyldisc_init: termios_discttyldisc_init: ntty_disctermiosnttytabletslippppstriphdlcincrease kern.maxptysputc: required clalloc b_to_q: required clalloc accfaccf_seqpacketdgram%s: source too long, %d < %d bytesunix: inet: inet6: link: atalk: (unknown socket family %d)bad family %hhumbuf %p already freedmsizemclbytesnmbclustersmblowatmcllowatnmbclusters_limitmbplmclplm_copydata: off %d, len %dm_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d)m_copydata(%p,%d,%d,%p): m=NULL, off=%d (%d), len=%d (%d)%s: len > MHLEN%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]%s: no header (m = %p)unixpsemposixsemmaxksemsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %lusopendfreesoinit1 %dnetiosbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lu%s: message too large %d mbsonamembcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdataunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadinflightdeferredunpgcuipc_init %duipc_usrrequipc 4buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadyallocbuf: buffer larger than MAXBSIZE requestednamecachenamecache_statsncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultfstypesmagiclinkstimestamp_precisionlf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../zauruskernel_identruidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags %s: failed to start extattr: error = %d syncing disks... vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system root file system type: %s WARNING: No file system modules have been loaded. Supported file systems:no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... filedelaydirdelaymetadelayinvalid specnode type: %dILLEGALvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd)%slrulisthd %p ROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvflushbuf: not dirty, bp %pvflushbuf: dirtyACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVCHRVLNKVSOCKVFIFOVBADVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFSsymlink-target%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %dsyncwaitfdesckernfsafsfstchgfstcntfstlwpvcachevnode cache hashvnfull%s: cannot reclaimdead but not clean%s: bad ref countvcacheplvdrainvrele%s: holdcnt vp %p%s: cannot lock%s: neg numoutput, vp %pxattr-listsystem.user.security.trusted.xattr-namexattr-valvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedead fs operation useddeadtag VT_NON, dead vnode fifordfifowrtag VT_NON, fifo with %d readers and %d writers/usr/src/sys/miscfs/genfs/genfs_io.cgenput%s: bogus command %dgenfs: bad op%s: ACL_OTHER missing layerfs tag VT_LAYERFS, vp=%p, lowervp=%p spec_fdiscard: not a device dev %llu, %llu spec_close: spurious pgrp refspec_close: not specialspec_ioctlinvalid specfs vnode type: %dspec_read typespec_write typespeciofictitiousdefault labelWARNING: %s: total unit size in disklabel (%llu) != the size of %s (%llu) %s: %llu trailing sectors not covered by disklabel WARNING: %s: end of partition `%c' exceeds the size of %s (%llu) %s at %s (%s) deleted raidframecgd%s: blkno (%llu) + size / DEV_BSIZE (%zu) > p_size (%llu) %s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) wedge:%sdkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d %s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) %s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfs%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTccdvmkcorevmfsvmwresvntfsext2fszfsmdidle%s: cfattach_attach failed /dev/randombpfmaxbufsizepeers%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterbpfops%.*s/%hhu#link#%huif_%s: watchdog triggered ifnetifaiflnkstifwdogsdl%s: could not attach sysctl nodes sndqmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged DOWN%s: lost link state change %s %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. invalid argument to %sinvalid ifnet multicast command: 0x%lx%s: can't handle af%d The multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooks33etherrps_hash%s: invalid ifp (sdl_index %d) llentrypllooutput: no header mbufif_looploifmedia_set: no match for 0x%x/0x%x ifmedia_set failed%s: invalid timer type pfilpktqsyncpktqrenqifqcurcputoeplitztoeplitz-othercpusMask for route not entered rn_addmask: mask impossibly already in tree Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: Orphaned Mask %p at %p rn_delete: couldn't find us radix already initializedrn_initrn_init 2delayed rn_inithead failedraw_usrreqrt_timer_timer: rtq_count reached 0 rtentryrt_freert_updatertentplrttmrplrt_timerrt_timer_queue_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 %s: unable to delete rtentry @ %p, error = %d mZV%[Ag%=C+ˮ{0w-0 jB;rtfree 2route_purgeifroute_abortroute_accept%s: message too long%s: queue full, dropped message %s: unknown command %drtableroutend_delaynd_bmaxtriesnd_umaxtriesnd_reachablend_retransnd_nudnd_maxnudhintlog_movementslog_permanent_modifylog_wrong_iface%s: source can't be determined: dst=%s %s: %s not ready %s: called with non-tentative address %s(%s) %s: memory allocation failed for %s(%s) %s: called with duplicate address %s(%s) %s: %s: ARP announcement complete for %s %s: arp_setgate failed %s: bad gateway value %s: failed to %s llentry for %s on %s arp from %s: addr len: new %d, i/f %d (ignored) %s: arp: link address is broadcast for IP address %s! duplicate IP address %s sent from link address %s %s: DAD defended address %s from %s %s: DAD ignoring duplicate address %s from %s %s: DAD defence failed for %s from %s %s tried to overwrite permanent arp info for %s %s on %s tried to overwrite arp info for %s on %s arp info overwritten for %s by %s arpintrrevarp%s: mbuf %d too short for IP header %zu%s: offset %d too short for IP header %zuencapelemip_encap cv%s_wqinput%s: could not create a sysctl node for %s inputqgpiobus at %sis-rootmodelsTraditional NetBSD: Superuserorg.netbsd.secmodel.susersuser_modcmd::init: secmodel_register returned %d suser_modcmd::fini: secmodel_deregister returned %d is-securelevel-aboveTraditional NetBSD: Securelevelorg.netbsd.secmodel.securelevelsecurelevel_modcmd::init: secmodel_register returned %d securelevel_modcmd::fini: secmodel_deregister returned %d curtainTraditional NetBSD: Extensionsuser_set_cpu_affinityorg.netbsd.secmodel.extensionsextensions_modcmd::init: secmodel_register returned %d extensions_modcmd::fini: secmodel_deregister returned %d usermounthardlink_check_uidhardlink_check_gidTraditional NetBSD: 4.4BSDorg.netbsd.secmodel.bsd44secmodel_bsd44_modcmd::init: secmodel_register returned %d secmodel_bsd44_modcmd::fini: secmodel_deregister returned %d secmodel_bsd44suser,securelevel,extensionsfssptmdrvctltapveriexecfwucycomutoppybthubamrlockstatputtersrtdrmaltmemtwacpuctlpadtprofisvvideohdaudiouhsorumpblknpfdtviscsitpmmfiseepromdtracespiflashluaspkrhdmicecnvmeqemufwcfgautofsgpioppsnvmmkcovspiipmivhcivio9pwwancacpismbiosefisht3xtempscmdviocongpioirqumcpmioemcfancttyphysconptcqmsofconstunvidcconsoleopmsiplofromscrfcomjoymidisequencervcodawsdisplaywsmouseusbuhidulptscsibusraidugenucomopenfirmbiconsdevsacommlywsfontagppciiopaltqmlxplcomclockctlirframecirradiokttcpixpcomdmoveriosscomksymsepcomtslcdtwewdcpxapcicpxamcisdmmcbuspcmciabuswsemuldisplaydevwskbddevapmdevifi2cbusdrivechannelgpiobuskbdmuxcontrollerindexdackintrbase%s: %zu bytes @ %p unusedv6v7v71kv8otherhpfsadosfilecorejfs2vinumudfsysvbfsefsnilfsminixfs3stringpropstng%lliintegerpropnmbr%s: invalid base %d?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector size `%s' is not a power of 2.fragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointrdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! add%s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnetnostaticproto1proto2recvpiperttrttvarsasendpipeshowssthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=blkempty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraecbetbdchfesprrcdletdvcmcuiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdmbrgptre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeNoneokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPErelease11.0_BETAzaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X.old/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicant/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]tmpfsinvalid%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)/dev/r-t xx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%sprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/random/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/TZ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'random.tmp/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigdkctlrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICkern-C700modulesbasebase32etccompgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %sFATNTFS a-%c %c---%c-%c%s %s %s %s %s%s %s %s%s %s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD11/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s (%u)fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %sUser answered no to destroy other data, aborting. %s [%s %s]%llu%s (%llu)%llu%%<%s>%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dmkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%lliStart:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1153: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullPri GPT tableSec GPT tableSec GPT headerv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2appleufsefsnilfsminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataapplevmcorevmreseredbiosbootbootmebootoncebootfailednoblockio%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxApple HFSapple-ufsBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD dataVMware VMkernel core dumpVMware reserved/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeNTFS volume setPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d 115]g7>isB9H!KcUM$]M*O.P>P2uS6 T;YX:YX>i[D]J]P]V``effluzyrM}w|#z-EEzųƮųIϮe6Vخ}ܮ--} x9Y9} ZU %Ma@@Ġa  @@% <4m  y  @@  @@%unblock and -DNO_CONV?  GF$100 0Usage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directory/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrOutside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerunknownPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbin/bin/shcan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedrootsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsrwuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupmallocusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xmalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%s$<liLESS_LINEScoLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndadbNRpc@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%cSHELL-c%s%s%slessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETAKiBMiBGiBTiBPiBEiB-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu \%03o --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUID%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasenogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslog(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %skeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletinglink#%d - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinfalsePATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuerastatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zulo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not found%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink& 2 HZdp}p}}EZ&#0 0_B^BFB<B>W?j}PATH= RWtf*`dg`sncx`m`lr pn`v b    EOF reading here (<<) document  #',1Dc/6;BIPU]ekpw{Ġ _bR}-+?=tvz~Q@D@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'" 04! 1<! 1B" 8L" 0ZE" 0" 0" 0! 0Iz;m  !` $HFtt7ʓ  _ -  ;W `  W{x                  N>T>F?],bG&%h?pt1@z-@Y%Euu! )@u  RD :& * 1 6 > iE  I T \ ! d eh =l e p Kw 5{ ^ i\  e @@JR C$ C C$ C           @     @@  ( 2:@B M\dd] l@rx~=D #3#3233# (FbuTNX| ̋  5(.2<HNTX\fjrv|TNX| ̋  5(.2<HNTX\fjrv|5M'H[  " M i Hǰ3Xl˱ !#$&12345$68/959<:U;o<=@AȲBC0DWEmFGHJLMƳNͳOݳPQRS.T7U?VWWq\{acd۴efg$h$i$p+qstuAvwGx[wѵ޵5Uqƶ޶(?[sַܷ5=J.Twٸ.;Mgw͹ #8Umºʺ0Kfǻ(BUɼܼN[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]"p """Jop ̋  5(.2<HNTX\fjrv|returning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock W W W V        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?in_addr_flagsin_statuscommit_addressfKtKKsetifprefixlensetifdstormasksetifbroadaddrclone_commandusagestatusRSprintallmainziTyixJTKشKpJ RLHKxTe;Q,T;/T"T.Tu;5Tu;TT_TjTvTT TTT@TTTT T0T@TTTUU U UU !U@RSinit_current_mediaVGVVVVVRmedia_statusmedia_constructorVV,UUVV,UU,UV,UV4VVVVPVVU,Ul -V -VV VV`VV@VVVVVVpaddr_matchMEVQEVQ_VRVgLEVKEVKsettunnelWXWprint_link_addressessetvlansetvlanifX&YY|JY&Y _bsetifssidsetifnwkeysetifbssid^^^^^ ^g___g^[^=r* O8 __<_ug_ط__qr* _YX-_q^^5q$^$^UqYYeainvalid major numberinvalid minor numbertoo many fields for formatffs@ @3 " b*=J`q @@7<uBINW^cgosybnorripbgensbextattbnojolietbnocasetransbrrcaseins:bDb` ,nPbbTbZbbb hbpb xb~b~b@bbbbbbbb :bDb` ,nPbbTbZbbb hbpb xb~bc c@D~ccc@cciob@c bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror:bDb` ,nPbbTbZbbb hbpb xb~b@D~b@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac:bDb` ,nPbbTbZbbb hbpb xb~bc~b@$g)g 3g 9g@BgIgQgWg\g`gdg &@eeejgeff f@recvrpcrpc_getportrpc_callsendrecv%s: can't read disk label; disk type must be specified%s partition type is not `%s'mm)nannn o!oToqoooopp6p]ppppp1qXqxqqWTWTbSS DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYۡ4LuǢ'SգMMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING0123456789abcdefUGHRBD M@dmCLS1@2plbhw.disknames?jb***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]a: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataGu6\ ``F`#``#`b#`bԉ#``X#aaW#a'aV#IaTa#hawa#aخU#abs#abr#abړ#aa~#a#aa#ab8#ap #a`#abh~#b#b#/b8b#Gba#Vb^b#ybb#bخ#bbχ#bbΈ#b8bܔ#baە#bbږ#bb܊#bخٗ#cb#cb#collect"eme.mخNlNAME=Jo"""hs"̋  5(.2<HNTX\fjrv|>    "#$%   "#$%    "#$%&'()*+.    .21Lcs  ̋  5(.2<HNTX\fjrv|ghx1ENINUPLaPuJHAOHJGG YLUKJQD]IPRTMDUHH7H%H H̋  5(.2<HNTX\fjrv|h----------------------------------- - --------------------   "#$%@//tmp/usr/var#x#Ա##݊  Details for index GPT part - ̋ 038=p """@F5KPTJo^B6Tchhs=pqu|{Q57m  Y;#MYQp ̋"" ŊT|̊ӊ !SFH0eCŊuSFU0eC\Hah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+ċ|nQn- q+ыڋ|nQn- q+|nQn- q+=rGy=iG}亊;Mt?mWC 3KOO&2yD<#*=(>H3Dh&ǨR\ M}-ev@Mjy֬-чHT-чH|ZIчHp ،IчH""IчH2IчH̋L6 %?a"S'@ )Ѹ̊0*1@ )Ѹ1x )ѸӊJh - Mi W  m]  Y -      9mQEu  rb 0?G2THAdnv *************************************************************************************************************************************************************************************************************************************** control_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2`/ 4 dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_getif_discoversplitvadd_environparse_optiondefault_configread_configBb'c`de!f'gA"hg"ij'k'l^-m'n)o'pqN.r's''t"u''Hv(wx(z(y(A%(B2(C D9(E FC(GM(H#IW(Ja(Kh(LCMq(Nw(O(P(Q(S(T(U(V(W(X(Z1(4(6(('|)~)}))#)3)E)S)Q)Z)X)_)g)l)r)x)~)M%))-1%)))))))))))9$*))* **&$*'0*<*O*\*j*v*   rt_new0 rt_buildrt_delete )K-_R-\-e-p-p"'x-c()j(@-)C-make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_opensockets_os///////if_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfdhcp_initread_leaselog_dhcp899#9,9dhcp_bound897A9I9U/6Q9.2 Y9dhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpipv4_deladdripv4_getstateipv4_addaddripv4_handleifaI, I, Y, Y, A, A, VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B^D d5D jMD piD vD |D D D D @D E -E BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~DI||^djpv| @@XTPcs_pathƒX bc_base_maxb bc_dim_maxb bc_scale_maxb bc_string_maxb coll_weights_maxb expr_nest_max b line_maxb  re_dup_maxb  posix2_version b  posix2_c_bindb  posix2_c_devb  posix2_char_termb posix2_fort_devb posix2_fort_runb posix2_localedefb posix2_sw_devb posix2_upeb stream_maxb tzname_maxb atexit_maxb^(KdKj?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror_inet6_rthdr_init_inet6_rthdr_add_inet6_rthdr_lasthop_inet6_rthdr_segments_inet6_rthdr_getaddr_inet6_rthdr_getflags_inet6_rth_init_inet6_rth_add_inet6_rth_reverse_inet6_rth_segments_inet6_rth_getaddrip6optleninet6_insert_padopt_inet6_option_space_inet6_option_init_inet6_option_append_inet6_option_alloc_inet6_option_next_inet6_option_find_inet6_opt_append__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfree_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEX81 }}Uт333333333333333333<52l9D5L5\T5 \5%U           8<H<T<`<p<|<<<o|khodn`tDK K /4F4FgntsI K J 4>h] [ rbmn0Z (Y `X X Y tcid   <   0 $ ~4F4Fyekd ~ ?AAT?atadP H loobl t \x\xdxdxyara Ե  ( <>DԗT>tNNNNNNNNO O8ODOdOpOOO OO OO OP Po ,P8P\PhPPPPPPPQx3]]]]]]]]]^1 ^^T]^\]11^$^(^0^ 1(1\\\\\]]]x3] ]t1(]0]4]@]L]T]1\]`]1l]p]x]|]1]]]]]^^^^^^^^Pa\a`adalapaxaaaaaaaaaH2aaaaaaaaaaabb4bb b$b(b,b0b4b8bо > ? ?L ? 4>k /W rrHr,rhrr,,,.0ItN&&&N&pN&~  H8.bj1jcfhklmo op)p>pGqQr~uOtXv"w`wmxxܮzzvBCHJOPSTVeVXZZ  ! .>(G9a<(%G!9am/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin }-+?=###%%%}p t aEVeFI"iLlmCnfpbu*qҽs7ChXvLVVOx @=dd ׮ͮ" " ... ...&77 k1/,,,He3JJXAabCdhlNsuvW:w:z@eWS8eS8Ġ8e9GĠ`e9S`e->S8eQSĠ`eCS@egS԰@eS@e#S$ @e:SLHeDSZHe;MYHe5JKaܱHeU:MMH]HHe,S0 @HeJSt0 l@etS`lHHtXe]8QQ0ey7SxJLxJ0e)7SLLL0e:SLpJLHe[S0 سXe7/T/T0ey7BTxJ0e 7pJLPeR RPe6K KPeU6K KPe6K KHeVHc,XeYG,U,UXeFVVXeFVUPeGU UXeEUUHeWxe0e>W$>W0eWEWEWHeXft8e _&Y&YPe^RY YHe^@jHe^fXec^^Xeyb__Pe%bY YXea__Pe=r^* ^Peqr_* _Peg_ _He_Oj\!tKjawqawvay|awaxESwawMvaQwa9xawa}xawawa}xaw+  '@@:bDb` ,nPbbTbZbbb hbpb xb~b@~b@c......dA..##R6<|hnTlJv  w   ~GJ kBcKpJK !"#$œ%Ɯ&Μ'ќ(ڜ)ߜ*+,-/1123%4*5.68mʓ"ķηڷRd{Mod{ d{AvQd{m\d{[d{ed{e[d{ubd{wd{Eid{A|d{ytd{uod{wUd{}hTd{ij`d{9l$d{u0d{e5d{uz:d{ z@d{Azd{uFd{Pd{dUd{\خd{AZd{]gd{ad{EhTxd{ed{`d{!u8md{e[ed{id{!jd{mpd{rcd{9lvd{}}d{j d{md{b$d{]r2d{mѸd{9ld{ -d{[d{}d{!d{y]d{bd{y]d{=d{9ld{xd{xd{Ad{!d{MyƸd{9l̸d{9lиd{9l>d{ahd{gd{Ag.d{v*d{m\2d{q" d{uָd{sd{-|bd{ܸd{ad{ad{}d{kd{d{|d{iu d{rd{d{zd{m\"d{fpd{+d{5t\d{Zd{6 d{d0d{9\8d{zd{Q}d{[@d{-|Jd{ed{eZd{td{ePd{R6d{}pXd{fjd{9d{@$!N5 F v3b8 hz  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ..")4?FMXalw~J#*2;BIBP\grw."?w.Y}B\r"BJfJ}#27(""(((    l h b  w  i x X       0  $  k  j [< e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ is a directory is not a regular file (use -f to see it)`` (=   f/    $!1;=I"U>`fly=; 7   #28  (/ ,!8A9S]g& fr)~5e:%6H4 +,-.*(1?AEH/T/b'nF{ WmkRkRkYcWbkCkc kG ky wb YMYrWca"ib@d"qBh"4c"_d"A"D(Ie" :Nf\"nF"g":hx"lip"jJx!4"#AkpH]hHK`,"Y~LX0"mP"nH"l"!o@AO8YLp0HP(Wq"`r"`"s!"_wS!P"tT%u" Vw"<""Dux(iXAH"yt"zX"?T"!s~!@"|?#AD"$"%("Gix "p(h"$`"AH[wX "aP"H$"}/@$"Mc8"0!"(!" !"5(Eb!"q""$"5\"}"!L" '"<k""0F"W/>M_q}$N+;CHVhq +7GU+hty," (press RETURN)S  ,tags643{}abcdDgGhHilnNpPqrs tw xy !:#=#h#eZYYm[<<!C0)1<i?>@t?p+@|C%6$T9Cv:+v:c]2.22==s<?M#=*#,EFP3c&a:l s?hJ*# !"$'(+-.03569:%_K1_V=_UI_`U__" _^^^ ^MjkrqryrP!dJtKcLiMQcccWdIdHdIdJmdK{dLdMNacOiv^^w^<Mr=Ur>[r?cr,}^^^``u` i hss]^QErAa)aa`Iiah`)e5^RU^N^^^)^,]]^r%r-r5r!=raaaiaraaa]sussr br-sEsjrk rbssq"]p ] qqq]qqIb1bs tsrqbbbbbybihabdrqeeef}fmf]fMf?f1f#ff]]]]s]ffffqqC]I]&#g'g(g)fIggesgig%9ggggYggioy\\up\~p\p\\p]*]K x 1g  r% b7]bsb xQ](8U]{] h (_bF hemnbF}eo  xbF(_pbFeepbFXaepbFEeq  # 1 XbF J_mbF (L_m$ ; Qub2$@edb2$@b2$x@b 8b b b xb TS\sbFXcIqbF_1obFc_qu_Do Dnи5 K\gv~&Cc^17;CVSzFQeN c r  FcV 0?*.@Tar~Qfs !@vwj0Zs | ,!p!!!!"7"F"g"m"""""""""##'#1#=#M#c#r######### $)$?$$ %>%r%%I&g&?'['("))G**5+L+n+x+++++++++,2,],q,~,,@,,,,,,--!-7-P-k-----. ..."./.3.8.>.B.O.V.c.s........//+/:/M/Z/_/h/n//,4/////////0030>0I0V0e0t0001v2=3 464R4s444!Vn44W44444585Z555556;6L6W666677t878888]9d9999199,9:::S:::; ;̋;;V;;t<<3=O=T=d=========>$>8>?0 \Oo@j0?>?^?j???????@@@ @5@F@Q@g@ADACC D!D1иJDODbDoDuDD EyEE ]F FFJ2F8F=FFFKFYfFsFFFFFGG+G6GWGkGG::H"HpHHHHHH2IJJKXKV~KK fKKKLXLLL5MMEMMN%NENoNNN.OBOdOOOOOOOOOP PP'P;PcPsPPPQQQQQQQRRR)R9ReRmRuRRRRRRRRRиRRS S2S.FSQS\SnSSSSSSSSSSTTTT#T5THT[TaTtTTTTиRTTTTTT UU%U0U[TQSHU^UlUuUUUU9UUUUVVV+V0V=VLV_VXXXXXY?ZZ=[N[`[o[[[[[[#\\\[]t]]^EaPmTmYm]mcmfmjmnm`s`sds\sXs+s9/ ftpy@p"y,yyt@s yyzzz-z:zDzLz Qz Xz\zazgzmzDSvz}zs0zzz zz10z&Zu'z(z)z*U+z,z.1/I?4<U@#@=@5>i?O>?<@<A<B U>C <D |<E D<F B6<G<bRy<be<bacee]Z1siZ1chsiZ[ Zח[aZ.dA9 /%-  FbbbbbbbbbCēȓ̓ғՓߓ        \L  !%)-158<@DGKNRUY@ \!m"|#$%&'(ǔ)ٔ*+,--. .//0123"4'56,72889A:=;G<V=b>t?@[\\]ӕ^ޕ^__`{{/|=}I}]~c  . $.@,.@8.`@.H.T.(%4%<%D%#L%#T%#\%#`%#h%$t%$|%$%$%$%%%%%%)%%%%&%&%&%'%'%'%(%(&(&)&)(&)0&*@&*L&*T&+`&+l&+t&,&,&,&,&-&-&-&-&.&.&.&/&/&/&6';';$'00'0<'0D'1P'1\'<d'<p'=|'='>'>'?'2'2'2'3'3'3'9'7'8 (: (4,(48(4@(5L(5X( `(! p(" |(# ($ (% (& (' (( () (* (. (+ (, )- )/ )0 $)1 0)2 <)3 L)4 X)5 d)6 p)7 |)8 )9 ): ); )< )= )> )? ) @)!@)"@*#@ *$@*%@$*&@0*'@<*)@H**@T*+@`*&`l*'`|*,@*-@*.@*/@*0@*(`*1@*2@*3@+)`+4@ +5@0+6@@+7@P+8@`+9@p+:@+*`+;@+<@+=@+>@+?@+ `+!`,+`,,` ,"`0,#`@,-`P,$``,.`p,/`,%`,C,C,D,D,E,E,F,F,c,c,d-d -e\%e-#-#$-&4-&D-0T-d-h-l-p-t-x---------------...(%4%\.`.d.h.l.t.|.$$0$ 4$ @$@D$@tP$X$`$h$t$$ $ $ $@$@$@$@$@$@$`$`$$$% %% %@ % x333333333|MMMMM3333[[[[[2\UTC33* + 1' ' Q+ m' * S' 33`&339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž<<<=  33UU33UU33UUAEBEC=BEBEC> pBEBECX@BA &T@\\\2-P.-āx   @ X:333333333333333333333333333333333333 33 33tF  0000000000000000 &3333~3333(h33GGG (root)`33C,,,,,,,||̝ĞPTX\I_,b_vU+mn.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf /B!H""PV$bgtdd`yȣ(IIp`&p+ԌMSGTXTS620 4976 5001 5018 5040 5043 5048 5056 5063 5071 5079 5082 5085 5088 5092 5104 5113 5126 5155 5170 5715 5749 6432 6720 7428 7484 7558 7654 7829 7852 7875 7881 7890 7912 7916 7920 7923 7926 8031 8234 8473 8914 9352 9387 9402 9414 9420 9432 9481 9501 9541 9558 9575 9590 9637 9675 9723 9805 9929 10065 10106 10144 10181 10216 10226 10275 10425 10431 10436 10440 10460 10570 10590 10596 10610 10622 10633 10670 10704 10728 10830 10867 10889 10988 11043 11101 11112 11128 11180 11348 11555 11726 11790 11842 12115 12666 13196 13629 13967 14300 14413 14428 14437 14597 14768 14918 15082 15105 15129 15144 15219 15359 15536 15691 15703 15783 15884 15930 15956 16026 16037 16046 16059 16085 16100 16116 16129 16184 16195 16210 16414 16647 16676 16691 16760 16834 16907 16937 16975 17029 17483 17509 17538 17642 17748 17933 18045 18160 18264 18951 19210 19350 19386 19556 19597 19733 19756 19793 19838 20089 20185 20239 20338 20349 20386 20423 20450 20459 20493 20500 20525 20552 20587 20601 20615 20644 20658 20675 20684 20706 20724 20741 20752 20771 20797 20815 20838 20855 20870 20885 20903 20930 20957 20979 21018 21036 21068 21296 21370 21413 21459 21606 21762 21806 22085 22112 22471 22655 22807 22988 23135 23293 23314 23362 23372 23380 23391 23402 23412 23419 23434 23446 23485 23515 23554 23607 23665 23686 23693 23712 23733 23740 23764 23786 23806 23828 23859 23896 23918 23932 23978 24007 24041 24081 24116 24144 24192 24201 24210 24215 24224 24233 24250 24254 24259 24265 24269 24282 24291 24318 24338 24361 24380 24407 24429 24461 24477 24482 24492 24515 24537 24554 24571 24584 24593 24602 24608 24635 24642 24666 24687 24711 24724 24743 24768 24791 24807 24813 24825 24855 24863 24903 24914 24925 24936 24953 24970 24984 25001 25449 25665 25929 26201 26253 26289 26325 26376 26393 26431 26445 26452 26469 26472 26477 26486 26498 26509 26518 26539 26581 26619 26635 26666 26691 26726 26782 26822 26843 26863 26904 26933 26981 27214 27249 27456 27475 27512 27573 27611 27650 27806 27821 27867 27915 27938 27974 27984 27994 28005 28010 28073 28121 28165 28226 28259 28360 28378 28517 28539 28662 28676 28686 28709 28814 28870 28986 29017 29022 29048 29087 29097 29140 29150 29166 29181 29199 29222 29252 29273 29299 29496 29539 29543 29549 29555 29560 29571 29585 29614 29646 29658 29705 29755 29795 29822 29838 29847 29890 29896 29904 29908 29928 29945 29957 29988 30244 30293 30869 30896 30928 30956 31008 31014 31020 31025 31046 31062 31084 31113 31254 31388 31401 31537 31539 31541 31543 31560 31573 31591 31618 31622 31628 31633 31641 31647 31687 31689 31699 31714 31731 31765 31797 31835 31864 31893 31915 31958 31984 32028 32164 32166 32168 32207 32274 32291 32305 32309 32316 32438 32507 32795 32933 33074 33155 33202 33208 33231 33277 33280 33306 33349 33414 33476 33546 33614 33707 33926 33951 33955 33991 34009 34037 34079 34123 34187 34237 34313 34335 34387 34431 34470 34504 34534 34565 34590 34599 34611 34619 34630 34642 34661 34685 34734 34751 34775 34818 35140 35143 35157 35170 35182 35189 35200 35207 35214 35223 35233 35250 35266 35316 35324 35332 35342 35353 35371 35388 35409 35431 35440 35450 35477 35483 35493 35512 35528 35546 35566 35575 35586 35593 35610 35629 35650 35660 35677 35683 35699 35714 35729 35750 35772 35791 35801 35806 35811 35829 35848 35867 35873 35892 35912 35932 35950 35955 35961 35978 35994 36015 36028 36036 36056 36080 36097 36105 36116 36137 36143 36155 36177 36191 36200 36221 36239 36248 36282 36305 36332 36364 36387 36407 36418 36450 36466 36477 36490 36513 36535 37043 37073 37104 37132 37146 37347 37569 37736 37823 37840 37858 37875 37904 37951 37962 37981 38003 38082 38274 38302 38420 38442 38583 38602 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_BETA. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_BETA ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_BETA ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_BETA InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_BETA ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVDDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzSendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): Kernel (GENERIC)Kernel (C700)TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist.this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.t:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS620 4976 5014 5031 5046 5049 5052 5057 5065 5073 5081 5084 5087 5096 5108 5120 5129 5138 5164 5175 5712 5739 6305 6605 7246 7293 7406 7499 7533 7552 7570 7578 7587 7612 7616 7620 7623 7626 7748 7933 8161 8681 9032 9061 9074 9087 9092 9112 9131 9152 9211 9228 9242 9264 9309 9335 9376 9454 9572 9686 9740 9769 9801 9840 9846 9879 10002 10009 10013 10021 10045 10127 10133 10140 10152 10166 10175 10208 10227 10239 10349 10411 10430 10549 10600 10652 10664 10683 10735 10939 11147 11338 11398 11447 11715 12175 12842 13266 13588 14013 14145 14177 14189 14367 14564 14725 14859 14879 14912 14926 14995 15108 15280 15415 15435 15547 15639 15662 15685 15744 15759 15780 15795 15816 15836 15861 15875 15899 15911 15929 16139 16389 16410 16426 16479 16547 16620 16657 16683 16759 17254 17280 17302 17409 17516 17717 17790 17874 17974 18469 18707 18858 18892 19027 19071 19210 19251 19296 19343 19587 19720 19782 19876 19881 19915 19949 19964 19992 20025 20032 20057 20075 20101 20108 20123 20138 20158 20198 20215 20235 20256 20278 20293 20313 20335 20350 20363 20377 20389 20401 20415 20438 20461 20479 20522 20573 20610 20795 20858 20894 20943 21034 21164 21217 21477 21524 21885 22035 22204 22344 22464 22596 22636 22683 22693 22701 22711 22719 22730 22741 22755 22780 22823 22856 22889 22924 22978 23003 23022 23044 23049 23055 23086 23103 23130 23148 23169 23191 23210 23220 23250 23276 23303 23352 23380 23407 23460 23470 23480 23486 23496 23505 23525 23529 23534 23540 23544 23557 23566 23597 23614 23641 23662 23682 23701 23727 23740 23748 23764 23795 23826 23847 23873 23886 23894 23905 23911 23935 23945 23957 23975 23986 24006 24022 24048 24070 24086 24098 24118 24144 24150 24180 24194 24208 24231 24250 24269 24287 24305 24723 24924 25164 25348 25426 25481 25548 25588 25611 25645 25656 25664 25687 25690 25693 25699 25710 25722 25735 25765 25809 25822 25835 25872 25886 25897 25908 25919 25936 25947 25994 26017 26066 26307 26340 26595 26616 26649 26702 26728 26755 26911 26917 26960 26980 26999 27028 27035 27042 27049 27054 27103 27141 27175 27232 27260 27305 27322 27423 27428 27505 27519 27529 27553 27676 27757 27867 27895 27900 27916 27945 27953 27994 28001 28015 28028 28036 28055 28088 28108 28128 28344 28375 28380 28387 28394 28398 28412 28424 28439 28472 28485 28540 28598 28634 28652 28670 28688 28725 28731 28739 28743 28764 28781 28792 28814 28992 29036 29738 29762 29796 29815 29860 29867 29874 29878 29902 29913 29918 29981 30102 30225 30238 30372 30374 30376 30378 30388 30397 30410 30437 30441 30447 30452 30461 30466 30493 30495 30508 30520 30535 30563 30607 30654 30670 30692 30703 30736 30756 30805 30905 30907 30909 30950 31041 31058 31072 31077 31083 31192 31251 31502 31643 31770 31838 31875 31882 31909 31955 31958 31979 32024 32075 32134 32203 32250 32355 32498 32523 32527 32561 32578 32602 32654 32705 32777 32843 32941 32958 32989 33025 33059 33083 33107 33140 33160 33170 33178 33186 33196 33207 33221 33247 33295 33318 33338 33379 33678 33681 33695 33707 33714 33733 33747 33754 33761 33770 33780 33797 33813 33861 33869 33877 33887 33898 33916 33933 33952 33972 33979 33996 34013 34020 34033 34068 34085 34104 34124 34134 34150 34163 34181 34201 34222 34232 34252 34272 34285 34304 34317 34341 34364 34377 34388 34393 34400 34418 34437 34456 34464 34483 34503 34528 34546 34553 34560 34573 34582 34603 34616 34624 34644 34672 34689 34695 34706 34737 34745 34758 34780 34802 34811 34832 34850 34857 34880 34899 34926 34944 34964 34977 34992 35013 35027 35034 35048 35063 35082 35627 35660 35688 35717 35725 35762 36074 36251 36328 36345 36363 36378 36400 36450 36460 36477 36499 36558 36716 36740 36870 36895 37021 37039 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVDDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroSendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): Ncleo (GENERIC)Ncleo (C700)TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like MSGTXTS620 4976 5012 5029 5044 5048 5052 5057 5068 5074 5080 5083 5086 5089 5093 5105 5117 5127 5157 5169 5600 5627 6203 6563 7248 7309 7387 7482 7522 7544 7562 7568 7577 7603 7607 7611 7614 7617 7739 7924 8152 8681 9099 9128 9141 9154 9161 9181 9200 9223 9266 9286 9305 9328 9372 9401 9442 9508 9620 9734 9788 9817 9849 9888 9894 9927 10005 10011 10015 10020 10061 10198 10208 10216 10235 10249 10258 10290 10331 10344 10469 10527 10546 10665 10721 10773 10784 10800 10839 11089 11261 11433 11488 11523 11774 12179 12479 12748 13109 13289 13608 13628 13641 13830 13974 14170 14304 14324 14357 14376 14477 14632 14820 15007 15027 15106 15204 15242 15265 15355 15376 15399 15418 15442 15472 15516 15549 15572 15584 15602 15870 16189 16220 16255 16319 16394 16464 16495 16525 16617 17108 17138 17155 17295 17436 17633 17752 17899 18066 18624 18920 19101 19146 19309 19363 19498 19534 19594 19644 19935 20044 20101 20198 20203 20238 20273 20288 20312 20345 20350 20375 20391 20414 20421 20438 20453 20472 20504 20508 20528 20546 20558 20571 20589 20613 20631 20650 20677 20704 20716 20737 20767 20797 20822 20855 20890 20928 21181 21250 21305 21366 21484 21643 21697 21958 22009 22385 22540 22684 22824 22932 23117 23147 23190 23200 23208 23218 23230 23251 23260 23266 23298 23340 23376 23414 23451 23499 23523 23535 23549 23557 23565 23594 23611 23640 23661 23684 23693 23712 23724 23768 23806 23833 23877 23905 23932 23985 23996 24007 24014 24024 24033 24067 24071 24076 24082 24086 24099 24109 24139 24162 24191 24213 24235 24257 24284 24296 24308 24327 24361 24394 24415 24439 24452 24464 24477 24483 24509 24519 24530 24554 24564 24584 24604 24621 24647 24671 24684 24704 24738 24745 24774 24797 24820 24836 24851 24866 24881 24895 25326 25517 25752 25940 25982 26032 26086 26134 26156 26197 26208 26216 26240 26244 26248 26257 26268 26279 26294 26325 26371 26384 26397 26427 26441 26453 26465 26477 26495 26518 26563 26586 26646 26898 26925 27187 27205 27232 27281 27311 27342 27474 27481 27530 27553 27577 27606 27614 27624 27632 27637 27690 27739 27779 27845 27878 27922 27945 28046 28051 28128 28142 28152 28176 28299 28380 28490 28518 28523 28539 28568 28576 28617 28625 28639 28652 28660 28679 28712 28732 28752 28968 28999 29019 29025 29032 29036 29051 29070 29096 29105 29117 29171 29229 29264 29283 29300 29312 29347 29353 29361 29365 29386 29403 29414 29439 29617 29671 30362 30381 30416 30446 30492 30498 30505 30509 30533 30549 30555 30630 30780 30899 30912 30980 30982 30984 30986 30996 31009 31026 31053 31057 31063 31068 31077 31082 31109 31111 31124 31136 31151 31179 31223 31270 31286 31308 31319 31352 31372 31421 31521 31523 31525 31573 31663 31680 31694 31699 31705 31808 31860 32106 32267 32422 32493 32546 32553 32580 32630 32633 32654 32700 32755 32814 32883 32930 33035 33178 33203 33207 33241 33258 33296 33349 33389 33465 33530 33624 33645 33683 33723 33759 33783 33806 33845 33875 33882 33891 33899 33907 33921 33937 33965 34017 34034 34055 34099 34441 34445 34460 34471 34479 34498 34510 34517 34524 34533 34543 34560 34576 34630 34638 34646 34656 34667 34685 34702 34718 34736 34743 34761 34778 34785 34795 34826 34845 34864 34884 34894 34913 34926 34946 34966 34987 34997 35016 35035 35045 35062 35076 35099 35123 35136 35146 35151 35155 35173 35192 35211 35216 35235 35255 35280 35295 35299 35306 35316 35325 35346 35360 35368 35388 35414 35431 35439 35450 35481 35486 35499 35521 35536 35545 35566 35584 35593 35637 35661 35688 35703 35720 35734 35765 35789 35820 35827 35841 35856 35875 36420 36453 36481 36510 36518 36555 36867 37044 37121 37138 37156 37171 37193 37243 37253 37270 37292 37351 37509 37533 37663 37688 37814 37832 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVDDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : Kernel (GENERIC)Kernel (C700)TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trusMSGTXTS620 4976 5017 5033 5051 5055 5059 5069 5078 5084 5090 5093 5096 5105 5115 5128 5136 5147 5172 5184 5694 5726 6218 6507 7052 7098 7202 7288 7324 7339 7357 7365 7373 7400 7404 7408 7411 7414 7525 7710 7938 8414 8748 8777 8792 8807 8815 8829 8847 8868 8919 8935 8945 8965 9011 9041 9094 9151 9262 9383 9427 9460 9499 9533 9540 9573 9650 9656 9663 9670 9699 9811 9817 9828 9845 9862 9871 9900 9912 9922 10023 10085 10105 10225 10262 10318 10332 10353 10390 10600 10775 10924 10959 11011 11229 11544 12069 12432 12722 13115 13250 13263 13274 13420 13599 13730 13864 13884 13917 13936 14019 14134 14275 14400 14414 14522 14615 14644 14664 14740 14757 14775 14791 14810 14830 14847 14859 14885 14897 14915 15116 15355 15382 15399 15455 15517 15577 15608 15632 15691 16067 16097 16114 16222 16332 16472 16546 16622 16700 17192 17412 17523 17554 17681 17717 17845 17872 17912 17958 18174 18298 18366 18466 18471 18507 18543 18557 18580 18613 18617 18642 18661 18687 18692 18707 18722 18741 18766 18778 18800 18817 18830 18842 18860 18884 18899 18916 18929 18940 18951 18971 19000 19029 19053 19088 19123 19150 19337 19386 19418 19466 19563 19696 19742 19934 19964 20286 20415 20555 20695 20812 20947 20991 21034 21042 21052 21064 21076 21084 21095 21122 21156 21193 21224 21259 21295 21342 21362 21379 21397 21402 21409 21436 21452 21473 21490 21507 21525 21542 21555 21586 21611 21642 21673 21708 21735 21788 21798 21808 21814 21823 21831 21846 21850 21855 21861 21865 21878 21888 21917 21933 21959 21976 21995 22016 22032 22045 22050 22058 22073 22099 22118 22146 22164 22175 22181 22187 22208 22218 22229 22247 22269 22286 22299 22320 22340 22360 22371 22384 22406 22413 22438 22453 22473 22485 22502 22519 22539 22558 22868 23048 23259 23447 23513 23560 23615 23659 23679 23708 23720 23726 23742 23746 23750 23758 23768 23780 23795 23814 23850 23861 23872 23911 23923 23933 23943 23953 23969 23987 24036 24057 24102 24346 24372 24626 24641 24667 24724 24758 24793 24935 24952 25001 25022 25038 25067 25072 25077 25083 25088 25127 25162 25192 25247 25280 25326 25340 25419 25424 25478 25492 25502 25526 25612 25660 25766 25800 25807 25822 25849 25858 25897 25904 25926 25945 25961 25979 26011 26030 26047 26204 26235 26242 26251 26259 26266 26280 26298 26317 26327 26339 26380 26425 26454 26475 26498 26517 26555 26561 26569 26573 26594 26611 26620 26639 26785 26827 27337 27345 27369 27387 27431 27436 27441 27445 27476 27489 27498 27544 27670 27761 27773 27837 27839 27841 27843 27853 27867 27882 27909 27913 27919 27924 27933 27938 27965 27967 27982 27993 28008 28036 28080 28127 28143 28165 28176 28209 28229 28278 28378 28380 28382 28417 28493 28510 28524 28531 28537 28636 28692 28968 29092 29203 29265 29303 29311 29333 29382 29385 29406 29451 29506 29565 29634 29681 29786 29929 29954 29958 29992 30008 30033 30081 30117 30178 30232 30313 30335 30374 30411 30443 30467 30494 30520 30534 30542 30552 30560 30574 30587 30599 30623 30664 30690 30707 30736 31060 31063 31077 31089 31095 31111 31123 31130 31137 31146 31156 31173 31189 31232 31240 31248 31258 31269 31287 31304 31317 31343 31350 31358 31375 31383 31400 31424 31443 31462 31481 31491 31502 31516 31534 31554 31574 31583 31606 31626 31637 31652 31664 31683 31702 31713 31723 31728 31734 31752 31771 31790 31797 31816 31836 31861 31878 31884 31892 31902 31914 31935 31951 31959 31979 31999 32021 32029 32040 32063 32070 32084 32106 32123 32132 32153 32171 32180 32211 32227 32254 32273 32293 32311 32332 32346 32366 32373 32392 32407 32426 32971 33004 33032 33061 33069 33106 33418 33595 33672 33689 33707 33722 33744 33794 33804 33821 33843 33902 34060 34084 34214 34239 34365 34383 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVDDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymSendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Instalowanie bootblokow na %s.... Twoje partycje NetBSD na %s wygladaja nastepujaco (Rozmiar i offset w %s): Kernel (GENERIC)Kernel (C700)RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm sh stty sync# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private  . ..zero wsmuxctl3 wsmuxctl2 wsmuxctl1 wsmuxctl0wsmux3wsmux2wsmux1wsmux0wsmouse3wsmouse2 wsmouse1!wsmouse0"wsmouse#wskbd3$wskbd2%wskbd1&wskbd0'wskbd(wsfont)wd3p*wd3o+wd3n,wd3m-wd3l.wd3k/wd3j0wd3i1wd3h2wd3g3wd3f4wd3e5wd3d6wd3c7wd3b8wd3a9 wd3:wd2p;wd2o<wd2n=wd2m>wd2l?wd2k@wd2jAwd2iBwd2hCwd2gDwd2fEwd2eFwd2dGwd2cHwd2bIwd2aJ wd2Kwd1pLwd1oMwd1nNwd1mOwd1lPwd1kQwd1jRwd1iSwd1hTwd1gUwd1fVwd1eWwd1dXwd1cYwd1bZwd1a[ wd1\wd0p]wd0o^wd0n_wd0m`wd0lawd0kbwd0jcwd0idwd0hewd0gfwd0fgwd0ehwd0diwd0cjwd0bkwd0al wd0murandomnttypfottypepttypdqttypcrttypbsttypatttyp9uttyp8vttyp7wttyp6xttyp5yttyp4zttyp3{ttyp2|ttyp1}ttyp0~ttyHstatttyHcfgttyH7ttyH6ttyH5ttyH4ttyH3ttyH2ttyH1ttyH0ttyGstatttyGcfgttyG7ttyG6ttyG5ttyG4ttyG3ttyG2ttyG1ttyG0ttyFstatttyFcfgttyF7ttyF6ttyF5ttyF4ttyF3ttyF2ttyF1ttyF0ttyEstatttyEcfgttyE7ttyE6ttyE5ttyE4ttyE3ttyE2ttyE1ttyE0tty01tty00 ttystdoutstdinstderr st1 st0sd3psd3osd3nsd3msd3lsd3ksd3jsd3isd3hsd3gsd3fsd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2asd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2k rwd2j rwd2i rwd2h rwd2g rwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1e rwd1d!rwd1c"rwd1b#rwd1a$rwd1%rwd0p&rwd0o'rwd0n(rwd0m)rwd0l*rwd0k+rwd0j,rwd0i-rwd0h.rwd0g/rwd0f0rwd0e1rwd0d2rwd0c3rwd0b4rwd0a5rwd06rst17rst08rsd3p9rsd3o:rsd3n;rsd3m<rsd3l=rsd3k>rsd3j?rsd3i@rsd3hArsd3gBrsd3fCrsd3eDrsd3dErsd3cFrsd3bGrsd3aHrsd3Irsd2pJrsd2oKrsd2nLrsd2mMrsd2lNrsd2kOrsd2jPrsd2iQrsd2hRrsd2gSrsd2fTrsd2eUrsd2dVrsd2cWrsd2bXrsd2aYrsd2Zrsd1p[rsd1o\rsd1n]rsd1m^rsd1l_rsd1k`rsd1jarsd1ibrsd1hcrsd1gdrsd1fersd1efrsd1dgrsd1chrsd1birsd1ajrsd1krsd0plrsd0omrsd0nnrsd0morsd0lprsd0kqrsd0jrrsd0isrsd0htrsd0gursd0fvrsd0ewrsd0dxrsd0cyrsd0bzrsd0a{rsd0|rmd1d}rmd1a~rmd1rmd0drmd0armd0rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rcd1drcd1arcd1rcd0drcd0arcd0randomptypfptypeptypdptypcptypbptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0memmd1dmd1a md1md0dmd0a md0ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullest1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drumconsttyconsolecd1dcd1a cd1cd0dcd0a cd0 bpf0bpf . .. dhcpcd.confgroup master.passwd netconfig protocolsserviceswheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin # $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  ... . .. dhcpcd-hooksdhcpcd-run-hooks fi done  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dmesg fdisk fsck fsck_ffs halt ifconfig init mknod mount  mount_cd9660  mount_ffs  mount_mfs  mount_msdos  mount_nfs newfs ping ping6 reboot restore route rrestore swapctl 0umount ... ... . .. binmdecsbinshare . .. ftp gunzip gzcat gzip less more progress sed tar `tip ... . .. chroot . ..misc ... . .. db log runspool ... ... ... . ..lock ...a\^%K4"#'(),-@]^T8@@%^^x@ @+@-@-@L(@,@,@^^|D(@(@%_^8<.@L/@L8@`C@A@B@ 8@]_^\U_^(7@:@l`^C@D@\\pO@L@H@H@H@h`^pG@H@4P@8P@PP@W@0Y@Q@Q@BKBGBGBGBLKB,GBTGB\GB`GBGB(JBGB\MB^@ttmk%Czټ|Ff梂&Sk@5 FDtKDKDp^XND ODND^A^E^I^M^P^W^=^B^G^L^R^^^^^^^^^^ ^^I^^!^-^9^ ^^ ^*^4^V^a^l^w^w^^^^^^^^1Q_^^^X=^]]fZ $EEEEEEE]XdX@d@ h h 8"'-T39?? < ddi(dGaG\iGt`GnGkG$XdX@ X@^[Ht]]fZ@<'H(HT)H,*H(HtdIX]g ` I I Ip I I(I(I `$]^ȁIІIIIlI_XI\IȱII_lIIȱII_lIIȱII_lIIȱIIG_lIIȱIIk_l>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy((((((())((((((())SZZys[zzRTAL9CEINCOUYrUal:ceinDouyAa L= S` Td Z} l> sa te z~ C  E D NG RX c  e d nH rY'S^'s_'C'Tb'c'tcAIOaioAEOUaeouZ{z| OP Up oQ uq(A(a(E(e Un uo7LA7lBJJ">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||_@K,JJJLRJ4JJJ J0JJ J$JlKLR_XXXXLR]*_nK_KcKpdKLR`KPaK`K@&KdbKcKH%K%K%KmKLR_XXXXLR]@1_H|QLT:L:L0L\:L?L?LTLLR_XXXXLRl]#_N cNN(cNcNMDN`cNMMLMMMMM0 NlMMXXXM]ۋ_x+N.NN(cNcN.NDN`cNMMLMM<.N+Nl.NLR_XXXXLR<] NN O._l._O._b._O._X._DRDRc ('d2_O2_4O 4 P0Po|P$}RPPP*3_63_*3_>3_*3_03_ Notice: this software is protected by copyright/var/crash/%n.core $`JR9QDLQ 5U 9U HW` URR,WWRW`W RW DXO R RRR\W R0R\RR @V VV V |V _D]{RmR@H@aO@ o?_[Qр?]r@_@<`rlr xrLRI_QI_Qr@?osystemDuearmvtN_DRO_O_LMRqP_|P_KRP_P_LRP_P_\MRP_P_NRP_Q_MRq (root)`%n.core~~~{|p|| }x}}(~~~h{R@BY_0uX]S4@HPXXRhpWTWTWTWTWTWT WTWT@WTWTWTWTWTWTWTWTWTWTWTWTWTWT WTWT@WTWTWTWTTTTT (e@Hg@n_o_n_*o_TpT  @ LRĂ̂Os_UU0UU UDU|UUPUWs_UU0UU UDU|UUPUd_^^_Vu_VV$V^^ @ WWlockf2  ʄ_XXXXXLRXXXXXLRXXXXXXXXXLRx^r_r_YYYw_/Yʋ_|5Y^$@Y?Y,iYpbYl[YfY_c_ϋ_^_w_J_ _&_ ̛_!:_"?^$Л_%ܛ_(_._1_2me^4Κ_5_6_8_9_:_; _<{_=_>_@#_A(_B-_F5_GG:_H_I?_JD_MM_NW_T]_Ua_Vh_Wl_Xp_Yt_Zy_[^\\}_]_^___`_a_c_d^e_f^g_h_i_kƜ_l̜_mp\^]$ \^4]T^^HU]$\^^P]^]Ĥ]]R]x]&\^ %\^]]ܞ]#\0^R]^]^]^*^^^*^__Ч *^__ԧ *^__ا *^__ܧ *^G_G_ী *^k_k_䧀 *^__觀 *^< _< _지 *^ _ _ *^q _q _ *^H _H _ *^m _m _ *^ _ _ *^c^D^D*^7_f^D*^Y_ŗ^*^Y_ŗ^Ȧ*^Y_ŗ^ئ*^Y_^ D*^М_^D*^^^8*^ __h*^{_{_t*^a^a^6_a^*^[^[^,*^^^*^”^”^*^^^覀*^^^*^^^*^B^B^*^Ԝ_^^(*^^^8*^ܜ_ a^H*^[^]^X*^%^^%^^h*^%_^%_^x*^U_^U_^*^`^`^\*^h`^h`^*^^^*^`^`^*^^^ȧP*^@ @p@@ @@AH^h+^`^p+^^h`^x+^`^U_^+^%_^+^%^^[^+^ܜ_+^^Ԝ_+^B^^^+^^”^+^^+^[^6_+^a^+^^{_ _^+^М_+^Y_+^7_+^c^ _m _H _q _ _< __k_G_____^]^+^p^ȅ[^dd]?_hn_,@NetBSDAA(aeabi5TE  $NetBSD: locore.S,v 1.44 2022/04/02 11:16:07 skrll Exp $$NetBSD: md_root.c,v 1.19 2015/08/30 05:24:03 uebayasi Exp $$NetBSD: autoconf.c,v 1.18 2025/05/19 06:16:24 andvar Exp $$NetBSD: machdep.c,v 1.55 2024/05/13 00:08:06 msaitoh Exp $$NetBSD: subr_disk_mbr.c,v 1.59 2025/02/08 10:49:45 mlelstv Exp $$NetBSD: ziic.c,v 1.6 2021/08/07 16:19:08 thorpej Exp $$NetBSD: scoop.c,v 1.13 2014/09/23 14:49:46 nonaka Exp $$NetBSD: scoop_pcic.c,v 1.4 2011/06/19 16:20:09 nonaka Exp $$NetBSD: zssp.c,v 1.15 2021/08/07 16:19:08 thorpej Exp $$NetBSD: w100lcd.c,v 1.6 2022/05/28 10:36:23 andvar Exp $$NetBSD: w100.c,v 1.4 2021/11/20 00:17:10 rin Exp $$NetBSD: lcdctl.c,v 1.3 2012/01/29 10:12:41 tsutsui Exp $$NetBSD: zkbd.c,v 1.22 2021/08/07 16:19:08 thorpej Exp $$NetBSD: zapm.c,v 1.14 2021/08/07 16:19:08 thorpej Exp $$NetBSD: zmci.c,v 1.5 2012/01/29 10:12:42 tsutsui Exp $$NetBSD: vfp_init.c,v 1.78 2022/08/20 11:34:08 riastradh Exp $$NetBSD: cons.c,v 1.95 2023/09/02 17:44:59 riastradh Exp $$NetBSD: fiq.c,v 1.10 2020/02/24 12:08:08 rin Exp $$NetBSD: mainbus.c,v 1.24 2022/09/27 06:36:42 skrll Exp $$NetBSD: mainbus_io.c,v 1.24 2018/03/16 17:56:32 ryo Exp $$NetBSD: cpu_mainbus.c,v 1.19 2024/05/09 12:41:08 pho Exp $$NetBSD: disassem.c,v 1.42 2020/12/01 02:48:28 rin Exp $$NetBSD: bus_stubs.c,v 1.3 2021/09/18 09:49:57 jmcneill Exp $$NetBSD: arm_cpu_topology.c,v 1.9 2024/12/10 11:27:29 jmcneill Exp $$NetBSD: arm_machdep.c,v 1.68 2023/10/04 20:28:05 ad Exp $$NetBSD: ast.c,v 1.32 2021/02/01 19:31:34 skrll Exp $$NetBSD: bcopyinout_xscale.S,v 1.12 2022/10/20 06:58:38 skrll Exp $$NetBSD: blockio.S,v 1.9 2022/10/20 06:58:38 skrll Exp $$NetBSD: bootconfig.c,v 1.13 2020/10/18 16:28:57 skrll Exp $$NetBSD: copystr.S,v 1.14 2022/10/20 06:58:38 skrll Exp $$NetBSD: core_machdep.c,v 1.10 2020/11/10 21:38:03 rin Exp $$NetBSD: cpufunc.c,v 1.185 2022/12/22 06:58:07 ryo Exp $$NetBSD: cpu_exec.c,v 1.13 2020/12/01 02:43:13 rin Exp $$NetBSD: cpu_in_cksum.S,v 1.13 2022/10/20 06:58:38 skrll Exp $$NetBSD: cpu_subr.c,v 1.5.12.1 2025/10/19 10:29:21 martin Exp $$NetBSD: idle_machdep.c,v 1.6 2021/02/17 06:54:23 skrll Exp $$NetBSD: process_machdep.c,v 1.35 2021/02/01 19:31:34 skrll Exp $$NetBSD: sig_machdep.c,v 1.53 2024/04/14 07:56:13 skrll Exp $$NetBSD: sigcode.S,v 1.8 2005/12/11 12:16:41 christos Exp $$NetBSD: syscall.c,v 1.69 2023/10/05 19:41:03 ad Exp $$NetBSD: trap.c,v 1.1 2022/04/02 11:16:06 skrll Exp $$NetBSD: undefined.c,v 1.75 2023/10/05 19:41:03 ad Exp $$NetBSD: arm32_machdep.c,v 1.147 2024/03/05 14:15:29 thorpej Exp $$NetBSD: bus_dma.c,v 1.149.2.1 2025/10/01 16:41:13 martin Exp $$NetBSD: cpu.c,v 1.154 2024/05/09 12:41:08 pho Exp $$NetBSD: cpuswitch.S,v 1.107 2023/03/01 08:17:53 riastradh Exp $$NetBSD: exception.S,v 1.26 2020/11/21 19:46:13 skrll Exp $$NetBSD: fault.c,v 1.119 2024/02/02 22:00:32 andvar Exp $$NetBSD: pmap.c,v 1.443 2024/04/13 12:28:01 skrll Exp $$NetBSD: setstack.S,v 1.6 2013/08/18 06:29:29 matt Exp $$NetBSD: stubs.c,v 1.27 2020/07/03 15:31:25 skrll Exp $$NetBSD: sys_machdep.c,v 1.26 2020/06/20 15:45:22 skrll Exp $$NetBSD: vm_machdep.c,v 1.79 2024/01/15 20:35:22 andvar Exp $$NetBSD: pmap_devmap.c,v 1.2 2023/04/27 06:23:31 skrll Exp $$NetBSD: pmap_pvt.c,v 1.15 2022/05/08 22:03:02 rin Exp $$NetBSD: wd.c,v 1.474 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: ata_wdc.c,v 1.120 2021/10/05 08:01:05 rin Exp $$NetBSD: ata.c,v 1.171 2025/02/17 19:01:04 jakllsch Exp $$NetBSD: ata_subr.c,v 1.13 2020/12/23 08:17:01 skrll Exp $$NetBSD: ata_recovery.c,v 1.4 2020/04/13 10:49:34 jdolecek Exp $$NetBSD: sdmmc.c,v 1.44 2025/06/24 03:02:00 gutteridge Exp $$NetBSD: sdmmc_cis.c,v 1.10 2025/01/17 11:54:50 jmcneill Exp $$NetBSD: sdmmc_io.c,v 1.21.28.2 2025/12/18 18:26:52 martin Exp $$NetBSD: sdmmc_mem.c,v 1.77 2024/10/24 10:50:31 skrll Exp $$NetBSD: ld_sdmmc.c,v 1.45 2025/04/13 02:34:03 rin Exp $$NetBSD: config_hook.c,v 1.12 2020/11/21 21:08:32 thorpej Exp $$NetBSD: platid.c,v 1.11 2006/05/10 06:24:02 skrll Exp $$NetBSD: pxa2x0.c,v 1.24 2021/08/07 16:18:46 thorpej Exp $$NetBSD: pxa2x0_space.c,v 1.14 2023/04/21 15:00:48 skrll Exp $$NetBSD: pxa2x0_dma.c,v 1.7 2022/09/27 06:36:43 skrll Exp $$NetBSD: pxa2x0_intr.c,v 1.26 2023/07/13 19:42:24 riastradh Exp $$NetBSD: pxa2x0_gpio.c,v 1.21 2021/08/07 16:18:46 thorpej Exp $$NetBSD: pxa2x0_com.c,v 1.14 2018/12/08 17:46:10 thorpej Exp $$NetBSD: pxa2x0_a4x_space.c,v 1.6 2018/03/16 17:56:32 ryo Exp $$NetBSD: bus_space_a4x.S,v 1.4 2013/10/28 22:50:25 matt Exp $$NetBSD: sa11x0_ost.c,v 1.33 2019/11/13 17:52:12 tsutsui Exp $$NetBSD: pxa2x0_pcic.c,v 1.15 2022/09/27 06:36:43 skrll Exp $$NetBSD: pxa2x0_i2c.c,v 1.9 2021/12/12 08:49:57 andvar Exp $$NetBSD: pxa2x0_rtc.c,v 1.8 2024/02/24 12:04:16 andvar Exp $$NetBSD: pxa2x0_mci.c,v 1.14 2023/03/28 20:01:57 andvar Exp $$NetBSD: apmdev.c,v 1.34 2021/09/26 01:16:08 thorpej Exp $$NetBSD: pcmcia.c,v 1.96 2021/08/07 16:19:15 thorpej Exp $$NetBSD: pcmcia_cis.c,v 1.57 2019/11/10 21:16:36 chs Exp $$NetBSD: pcmcia_cis_quirks.c,v 1.36 2019/11/10 21:16:36 chs Exp $$NetBSD: if_ne_pcmcia.c,v 1.161 2019/12/27 08:01:58 msaitoh Exp $$NetBSD: com_pcmcia.c,v 1.62 2018/12/08 17:46:14 thorpej Exp $$NetBSD: wdc_pcmcia.c,v 1.130 2022/09/25 21:53:54 thorpej Exp $$NetBSD: if_wi_pcmcia.c,v 1.93 2019/01/08 08:47:21 msaitoh Exp $$NetBSD: dev_verbose.c,v 1.4 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: ld.c,v 1.117 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: wi.c,v 1.258 2023/08/01 07:04:15 mrg Exp $$NetBSD: dp8390.c,v 1.101 2024/06/29 12:11:11 riastradh Exp $$NetBSD: ne2000.c,v 1.79 2024/05/21 08:04:20 andvar Exp $$NetBSD: com.c,v 1.388 2025/02/12 05:15:39 imil Exp $$NetBSD: rtl80x9.c,v 1.19 2023/12/31 03:19:22 isaki Exp $$NetBSD: wdc.c,v 1.310 2022/05/31 08:43:15 andvar Exp $$NetBSD: dl10019.c,v 1.17 2021/07/01 20:39:15 thorpej Exp $$NetBSD: ax88190.c,v 1.18 2021/07/01 20:39:15 thorpej Exp $$NetBSD: compat_exec.c,v 1.18 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: compat_util.c,v 1.47 2019/01/27 02:08:39 pgoyette Exp $$NetBSD: aes_bear.c,v 1.4 2020/07/25 22:28:27 riastradh Exp $$NetBSD: aes_ccm.c,v 1.6 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: aes_ccm_mbuf.c,v 1.1 2020/07/25 22:15:55 riastradh Exp $$NetBSD: aes_ct.c,v 1.3 2020/06/30 20:32:11 riastradh Exp $$NetBSD: aes_ct_dec.c,v 1.2 2020/06/29 23:36:59 riastradh Exp $$NetBSD: aes_ct_enc.c,v 1.1 2020/06/29 23:27:52 riastradh Exp $$NetBSD: aes_impl.c,v 1.10 2022/11/05 17:36:33 jmcneill Exp $$NetBSD: aes_selftest.c,v 1.7 2021/12/05 04:48:35 msaitoh Exp $$NetBSD: nist_hash_drbg.c,v 1.3 2019/09/19 18:29:55 riastradh Exp $$NetBSD: cprng_fast.c,v 1.20 2024/10/15 17:34:06 riastradh Exp $$NetBSD: blake2s.c,v 1.2 2021/10/17 14:45:45 jmcneill Exp $$NetBSD: sysmon.c,v 1.32 2022/03/28 12:33:21 riastradh Exp $$NetBSD: sysmon_wdog.c,v 1.30 2021/12/31 11:05:41 riastradh Exp $$NetBSD: swwdog.c,v 1.24 2024/11/07 09:47:40 rin Exp $$NetBSD: ieee80211.c,v 1.61 2021/08/21 11:55:25 andvar Exp $$NetBSD: ieee80211_amrr.c,v 1.3 2015/08/24 20:58:47 pooka Exp $$NetBSD: ieee80211_crypto.c,v 1.23 2018/05/08 07:02:07 maxv Exp $$NetBSD: ieee80211_crypto_ccmp.c,v 1.20 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_crypto_none.c,v 1.8 2018/01/19 07:53:46 maxv Exp $$NetBSD: ieee80211_crypto_tkip.c,v 1.18 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_crypto_wep.c,v 1.14 2023/06/24 05:12:03 msaitoh Exp $$NetBSD: ieee80211_input.c,v 1.117 2022/11/19 07:57:51 yamt Exp $$NetBSD: ieee80211_ioctl.c,v 1.69 2021/09/21 15:00:34 christos Exp $$NetBSD: ieee80211_netbsd.c,v 1.34 2018/12/22 14:28:56 maxv Exp $$NetBSD: ieee80211_node.c,v 1.84 2024/07/05 04:31:53 rin Exp $$NetBSD: ieee80211_output.c,v 1.68 2024/07/05 04:31:53 rin Exp $$NetBSD: ieee80211_proto.c,v 1.37 2021/07/24 21:31:38 andvar Exp $$NetBSD: ieee80211_rssadapt.c,v 1.21 2016/09/27 20:20:06 christos Exp $$NetBSD: ieee80211_xauth.c,v 1.5 2006/02/27 01:08:28 dyoung Exp $$NetBSD: at_print.c,v 1.2 2021/07/21 06:35:45 skrll Exp $$NetBSD: igmp.c,v 1.70 2020/05/15 06:34:34 maxv Exp $$NetBSD: in.c,v 1.248 2024/08/20 08:22:35 ozaki-r Exp $$NetBSD: in_offload.c,v 1.15 2024/07/05 04:31:54 rin Exp $$NetBSD: in_pcb.c,v 1.202 2022/11/04 09:05:41 ozaki-r Exp $$NetBSD: in_print.c,v 1.1 2014/12/02 19:35:27 christos Exp $$NetBSD: in_proto.c,v 1.131 2022/09/03 02:53:18 thorpej Exp $$NetBSD: ip_icmp.c,v 1.180 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: ip_input.c,v 1.406 2025/07/17 06:49:43 ozaki-r Exp $$NetBSD: ip_output.c,v 1.330 2025/07/17 06:48:39 ozaki-r Exp $$NetBSD: ip_reass.c,v 1.23 2022/05/31 08:43:16 andvar Exp $$NetBSD: raw_ip.c,v 1.187 2025/06/20 15:15:35 roy Exp $$NetBSD: tcp_input.c,v 1.441 2024/10/08 06:17:14 rin Exp $$NetBSD: tcp_output.c,v 1.222 2024/09/08 09:36:52 rillig Exp $$NetBSD: tcp_sack.c,v 1.36 2018/05/18 18:58:51 maxv Exp $$NetBSD: tcp_subr.c,v 1.298 2025/02/26 04:49:45 andvar Exp $$NetBSD: tcp_syncache.c,v 1.7 2024/06/29 12:59:08 riastradh Exp $$NetBSD: tcp_timer.c,v 1.99 2022/11/04 09:00:58 ozaki-r Exp $$NetBSD: tcp_usrreq.c,v 1.238 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: tcp_congctl.c,v 1.29 2024/05/14 19:00:44 andvar Exp $$NetBSD: tcp_vtw.c,v 1.25 2024/10/07 23:17:00 jakllsch Exp $$NetBSD: udp_usrreq.c,v 1.266 2024/10/08 02:30:04 riastradh Exp $$NetBSD: portalgo.c,v 1.15 2022/11/04 09:01:53 ozaki-r Exp $$NetBSD: dest6.c,v 1.22 2018/04/13 11:01:14 maxv Exp $$NetBSD: frag6.c,v 1.78 2024/04/19 05:04:06 ozaki-r Exp $$NetBSD: icmp6.c,v 1.258 2024/07/05 04:31:54 rin Exp $$NetBSD: in6.c,v 1.293 2025/06/05 06:30:10 ozaki-r Exp $$NetBSD: in6_cksum.c,v 1.28 2011/04/25 22:05:05 yamt Exp $$NetBSD: in6_ifattach.c,v 1.122 2024/04/11 07:34:37 knakahara Exp $$NetBSD: in6_offload.c,v 1.13 2024/07/05 04:31:54 rin Exp $$NetBSD: in6_pcb.c,v 1.177 2022/11/04 09:04:27 ozaki-r Exp $$NetBSD: in6_print.c,v 1.1 2014/12/02 19:36:58 christos Exp $$NetBSD: in6_proto.c,v 1.131 2024/02/09 22:08:37 andvar Exp $$NetBSD: in6_src.c,v 1.92 2023/08/03 04:24:55 ozaki-r Exp $$NetBSD: ip6_forward.c,v 1.103 2024/06/29 13:00:44 riastradh Exp $$NetBSD: ip6_input.c,v 1.228 2024/06/29 13:00:44 riastradh Exp $$NetBSD: ip6_mroute.c,v 1.133 2025/01/02 16:10:22 andvar Exp $$NetBSD: ip6_output.c,v 1.235 2024/04/19 00:55:35 riastradh Exp $$NetBSD: mld6.c,v 1.102 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: nd6.c,v 1.284 2025/06/05 06:31:07 ozaki-r Exp $$NetBSD: nd6_nbr.c,v 1.186 2025/04/28 11:39:10 joe Exp $$NetBSD: nd6_rtr.c,v 1.149 2020/06/12 11:04:45 roy Exp $$NetBSD: raw_ip6.c,v 1.185 2024/07/05 04:31:54 rin Exp $$NetBSD: route6.c,v 1.25 2018/02/01 16:23:28 maxv Exp $$NetBSD: scope6.c,v 1.23 2020/06/16 17:12:18 maxv Exp $$NetBSD: udp6_usrreq.c,v 1.156 2024/10/08 02:30:05 riastradh Exp $$NetBSD: i2c.c,v 1.92 2025/01/27 17:01:53 riastradh Exp $$NetBSD: i2c_exec.c,v 1.18 2022/10/24 10:17:27 riastradh Exp $$NetBSD: i2c_subr.c,v 1.2 2022/04/01 15:49:12 pgoyette Exp $$NetBSD: i2c_bitbang.c,v 1.14 2016/06/07 01:06:27 pgoyette Exp $$NetBSD: mii.c,v 1.59 2024/02/08 20:11:55 andvar Exp $$NetBSD: mii_bitbang.c,v 1.14 2019/01/22 03:42:27 msaitoh Exp $$NetBSD: mii_physubr.c,v 1.103 2023/05/22 02:12:13 msaitoh Exp $$NetBSD: mii_ethersubr.c,v 1.3 2020/03/15 23:04:50 thorpej Exp $$NetBSD: ukphy_subr.c,v 1.17 2020/03/15 23:04:50 thorpej Exp $$NetBSD: brgphy.c,v 1.91 2023/02/22 08:09:09 msaitoh Exp $$NetBSD: nsphy.c,v 1.66 2020/03/15 23:04:50 thorpej Exp $$NetBSD: nsphyter.c,v 1.46 2020/03/28 18:37:18 thorpej Exp $$NetBSD: qsphy.c,v 1.55 2020/03/15 23:04:50 thorpej Exp $$NetBSD: inphy.c,v 1.60 2020/03/15 23:04:50 thorpej Exp $$NetBSD: iophy.c,v 1.43 2020/03/15 23:04:50 thorpej Exp $$NetBSD: exphy.c,v 1.58 2020/03/15 23:04:50 thorpej Exp $$NetBSD: lxtphy.c,v 1.56 2021/08/20 20:25:28 andvar Exp $$NetBSD: icsphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: sqphy.c,v 1.56 2020/03/15 23:04:50 thorpej Exp $$NetBSD: dmphy.c,v 1.47 2020/03/15 23:04:50 thorpej Exp $$NetBSD: pnaphy.c,v 1.26 2020/03/15 23:04:50 thorpej Exp $$NetBSD: ukphy.c,v 1.55 2021/06/29 21:03:36 pgoyette Exp $$NetBSD: dmover_backend.c,v 1.9 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_process.c,v 1.5 2011/05/14 14:49:19 jakllsch Exp $$NetBSD: dmover_request.c,v 1.8 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_session.c,v 1.6 2011/05/14 18:24:47 jakllsch Exp $$NetBSD: dmover_util.c,v 1.5 2005/12/11 12:21:20 christos Exp $$NetBSD: drm_stub.c,v 1.1 2019/11/16 04:10:33 christos Exp $$NetBSD: wsdisplay.c,v 1.166 2023/03/01 08:42:33 riastradh Exp $$NetBSD: wsemulconf.c,v 1.8 2010/02/02 16:18:29 drochner Exp $$NetBSD: wsemul_dumb.c,v 1.18 2018/09/03 16:29:34 riastradh Exp $$NetBSD: wsemul_vt100.c,v 1.52 2023/08/02 22:37:02 uwe Exp $$NetBSD: wsemul_vt100_subr.c,v 1.34.8.1 2025/11/14 13:12:27 martin Exp $$NetBSD: wsemul_vt100_chars.c,v 1.15 2017/11/03 19:20:27 maya Exp $$NetBSD: wsemul_vt100_keys.c,v 1.11 2010/02/10 19:39:39 drochner Exp $$NetBSD: wsevent.c,v 1.47 2021/09/26 01:16:10 thorpej Exp $$NetBSD: wskbd.c,v 1.146 2025/04/07 11:25:42 hans Exp $$NetBSD: wskbdutil.c,v 1.19 2017/11/03 19:20:27 maya Exp $$NetBSD: wsmux.c,v 1.68.2.1 2025/11/24 16:50:18 martin Exp $$NetBSD: wsbellmux.c,v 1.1 2017/06/11 03:55:56 nat Exp $$NetBSD: rasops.c,v 1.128.12.1 2025/11/14 13:12:27 martin Exp $$NetBSD: rasops_masks.c,v 1.10 2019/08/10 01:24:17 rin Exp $$NetBSD: rasops4.c,v 1.28 2019/08/14 00:51:10 rin Exp $$NetBSD: rasops8.c,v 1.51 2019/08/14 00:51:10 rin Exp $$NetBSD: rasops15.c,v 1.39 2019/08/14 00:51:10 rin Exp $$NetBSD: wsfont.c,v 1.83 2025/03/25 10:50:12 macallan Exp $$NetBSD: cd9660_bmap.c,v 1.5 2014/06/14 07:39:28 hannken Exp $$NetBSD: cd9660_lookup.c,v 1.33 2024/09/08 09:36:51 rillig Exp $$NetBSD: cd9660_node.c,v 1.38 2017/05/26 14:34:19 riastradh Exp $$NetBSD: cd9660_rrip.c,v 1.18 2015/03/28 19:24:05 maxv Exp $$NetBSD: cd9660_util.c,v 1.16 2024/05/25 06:27:57 tsutsui Exp $$NetBSD: cd9660_vfsops.c,v 1.105 2025/02/16 18:38:58 joe Exp $$NetBSD: cd9660_vnops.c,v 1.63 2024/02/02 20:27:26 christos Exp $$NetBSD: msdosfs_conv.c,v 1.20 2023/06/02 08:51:47 andvar Exp $$NetBSD: msdosfs_denode.c,v 1.60 2021/10/23 16:58:17 thorpej Exp $$NetBSD: msdosfs_fat.c,v 1.37 2024/05/13 00:24:19 msaitoh Exp $$NetBSD: msdosfs_lookup.c,v 1.41 2022/08/06 18:26:42 andvar Exp $$NetBSD: msdosfs_rename.c,v 1.4 2024/05/04 05:49:39 mlelstv Exp $$NetBSD: msdosfs_vfsops.c,v 1.138 2022/04/16 07:58:21 hannken Exp $$NetBSD: msdosfs_vnops.c,v 1.113 2024/09/11 00:27:54 perseant Exp $$NetBSD: krpc_subr.c,v 1.44 2024/10/20 14:01:52 mlelstv Exp $$NetBSD: nfs_bio.c,v 1.202 2024/02/13 21:40:02 andvar Exp $$NetBSD: nfs_boot.c,v 1.90 2024/07/05 04:31:54 rin Exp $$NetBSD: nfs_clntsocket.c,v 1.7 2024/07/05 04:31:54 rin Exp $$NetBSD: nfs_clntsubs.c,v 1.7 2023/03/21 15:47:46 christos Exp $$NetBSD: nfs_iod.c,v 1.9 2023/03/21 15:47:46 christos Exp $$NetBSD: nfs_kq.c,v 1.32 2021/10/20 03:08:18 thorpej Exp $$NetBSD: nfs_node.c,v 1.126 2020/05/01 08:43:00 hannken Exp $$NetBSD: nfs_socket.c,v 1.203 2025/02/22 09:27:05 mlelstv Exp $$NetBSD: nfs_subs.c,v 1.242 2022/02/09 21:50:24 andvar Exp $$NetBSD: nfs_vfsops.c,v 1.246 2024/05/13 00:11:22 msaitoh Exp $$NetBSD: nfs_vnops.c,v 1.325 2023/12/10 18:16:08 schmonz Exp $$NetBSD: ffs_alloc.c,v 1.174 2025/06/27 19:55:38 andvar Exp $$NetBSD: ffs_balloc.c,v 1.66 2022/11/17 06:40:40 chs Exp $$NetBSD: ffs_extattr.c,v 1.10 2022/11/28 04:52:04 chs Exp $$NetBSD: ffs_inode.c,v 1.131 2020/07/31 04:07:30 chs Exp $$NetBSD: ffs_snapshot.c,v 1.155 2023/05/11 23:11:25 chs Exp $$NetBSD: ffs_subr.c,v 1.54 2023/01/07 19:41:30 chs Exp $$NetBSD: ffs_tables.c,v 1.9 2005/12/11 12:25:25 christos Exp $$NetBSD: ffs_vfsops.c,v 1.384 2024/12/30 09:03:07 hannken Exp $$NetBSD: ffs_vnops.c,v 1.138 2021/12/14 11:06:12 chs Exp $$NetBSD: ufs_readwrite.c,v 1.129 2024/10/19 14:13:44 jakllsch Exp $$NetBSD: mfs_vfsops.c,v 1.117 2025/02/16 18:38:59 joe Exp $$NetBSD: mfs_vnops.c,v 1.64 2022/03/19 13:48:42 hannken Exp $$NetBSD: mfs_miniroot.c,v 1.1 2010/03/02 17:20:02 pooka Exp $$NetBSD: ufs_acl.c,v 1.5 2023/02/22 21:49:45 riastradh Exp $$NetBSD: ufs_bmap.c,v 1.54 2022/11/17 06:40:40 chs Exp $$NetBSD: ufs_inode.c,v 1.112 2020/09/05 16:30:13 riastradh Exp $$NetBSD: ufs_lookup.c,v 1.159 2024/09/08 09:36:52 rillig Exp $$NetBSD: ufs_rename.c,v 1.14 2021/10/20 03:08:19 thorpej Exp $$NetBSD: ufs_vfsops.c,v 1.61 2023/02/22 21:49:45 riastradh Exp $$NetBSD: ufs_vnops.c,v 1.262 2022/03/27 16:24:59 christos Exp $$NetBSD: uvm_amap.c,v 1.129 2023/09/10 14:54:34 ad Exp $$NetBSD: uvm_anon.c,v 1.80 2020/10/25 00:05:26 chs Exp $$NetBSD: uvm_aobj.c,v 1.157 2023/02/24 11:03:13 riastradh Exp $$NetBSD: uvm_bio.c,v 1.128 2023/04/09 09:00:56 riastradh Exp $$NetBSD: uvm_coredump.c,v 1.8 2020/02/23 15:46:43 ad Exp $$NetBSD: uvm_device.c,v 1.80 2022/07/07 13:27:02 riastradh Exp $$NetBSD: uvm_fault.c,v 1.237 2024/03/15 07:09:37 andvar Exp $$NetBSD: uvm_glue.c,v 1.182 2023/10/04 20:34:19 ad Exp $$NetBSD: uvm_init.c,v 1.59 2023/09/23 18:21:12 ad Exp $$NetBSD: uvm_io.c,v 1.30 2024/05/03 07:09:20 skrll Exp $$NetBSD: uvm_km.c,v 1.166 2024/12/07 23:19:07 chs Exp $$NetBSD: uvm_loan.c,v 1.104 2020/06/11 22:21:05 ad Exp $$NetBSD: uvm_map.c,v 1.427 2025/04/27 17:40:55 riastradh Exp $$NetBSD: uvm_meter.c,v 1.80 2020/06/14 21:41:42 ad Exp $$NetBSD: uvm_mmap.c,v 1.186 2025/02/24 21:32:26 andvar Exp $$NetBSD: uvm_mremap.c,v 1.22 2025/02/24 21:32:26 andvar Exp $$NetBSD: uvm_object.c,v 1.25 2020/08/15 07:24:09 chs Exp $$NetBSD: uvm_page.c,v 1.256 2024/03/05 14:33:50 thorpej Exp $$NetBSD: uvm_page_array.c,v 1.9 2020/05/26 21:52:12 ad Exp $$NetBSD: uvm_page_status.c,v 1.6 2020/08/14 09:06:15 chs Exp $$NetBSD: uvm_pager.c,v 1.131 2024/03/15 07:09:37 andvar Exp $$NetBSD: uvm_pdaemon.c,v 1.134 2023/09/10 15:01:11 ad Exp $$NetBSD: uvm_pdpolicy_clock.c,v 1.42 2025/05/20 10:22:27 bouyer Exp $$NetBSD: uvm_pgflcache.c,v 1.6 2020/10/18 18:31:31 chs Exp $$NetBSD: uvm_pglist.c,v 1.92 2024/01/14 10:38:47 tnn Exp $$NetBSD: uvm_readahead.c,v 1.16 2023/09/23 18:21:12 ad Exp $$NetBSD: uvm_stat.c,v 1.46 2020/06/14 21:41:42 ad Exp $$NetBSD: uvm_swap.c,v 1.209 2025/02/22 09:36:29 mlelstv Exp $$NetBSD: uvm_unix.c,v 1.51 2022/01/10 18:04:20 christos Exp $$NetBSD: uvm_user.c,v 1.14 2011/02/02 15:13:34 chuck Exp $$NetBSD: uvm_vnode.c,v 1.121 2024/04/05 13:05:41 riastradh Exp $$NetBSD: debugsyms.c,v 1.4 2015/10/06 22:13:39 christos Exp $$NetBSD: param.c,v 1.70 2022/07/23 19:15:29 mrg Exp $$NetBSD: bufq_disksort.c,v 1.14 2017/05/04 11:03:27 kamil Exp $$NetBSD: bufq_fcfs.c,v 1.13 2017/05/04 11:03:27 kamil Exp $$NetBSD: core_elf32.c,v 1.67 2021/01/02 02:13:42 rin Exp $$NetBSD: core_netbsd.c,v 1.24 2019/11/20 19:37:53 pgoyette Exp $$NetBSD: cnmagic.c,v 1.14 2017/05/04 11:01:16 kamil Exp $$NetBSD: exec_elf32.c,v 1.144 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_elf.c,v 1.107 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_script.c,v 1.85 2024/12/06 16:19:41 riastradh Exp $$NetBSD: exec_subr.c,v 1.91 2024/12/06 16:48:13 riastradh Exp $$NetBSD: init_main.c,v 1.552 2025/05/08 05:31:16 imil Exp $$NetBSD: init_sysctl.c,v 1.228 2023/09/09 16:01:09 christos Exp $$NetBSD: init_sysctl_base.c,v 1.9 2023/12/20 20:35:37 andvar Exp $$NetBSD: init_sysent.c,v 1.346 2024/10/09 16:29:10 christos Exp $$NetBSD: kern_acct.c,v 1.99 2021/12/05 04:35:38 msaitoh Exp $$NetBSD: kern_auth.c,v 1.84 2023/10/04 22:17:09 ad Exp $$NetBSD: kern_cfglock.c,v 1.1 2010/08/21 13:17:31 pgoyette Exp $$NetBSD: kern_clock.c,v 1.151 2023/09/02 17:44:59 riastradh Exp $$NetBSD: kern_condvar.c,v 1.63 2023/11/02 10:31:55 martin Exp $$NetBSD: kern_core.c,v 1.39 2023/10/04 22:17:09 ad Exp $$NetBSD: kern_cpu.c,v 1.98 2025/01/17 04:11:33 mrg Exp $$NetBSD: kern_descrip.c,v 1.266 2025/07/16 19:14:13 kre Exp $$NetBSD: kern_entropy.c,v 1.73 2025/03/11 14:30:28 riastradh Exp $$NetBSD: kern_event.c,v 1.150 2023/09/21 09:31:50 msaitoh Exp $$NetBSD: kern_exec.c,v 1.531 2025/07/16 19:14:13 kre Exp $$NetBSD: kern_exit.c,v 1.300 2025/03/16 15:52:18 riastradh Exp $$NetBSD: kern_fork.c,v 1.232 2025/07/16 19:14:13 kre Exp $$NetBSD: kern_idle.c,v 1.36 2024/03/01 04:32:38 mrg Exp $$NetBSD: kern_hook.c,v 1.15 2024/01/17 10:18:41 hannken Exp $$NetBSD: kern_kthread.c,v 1.49 2023/09/23 14:40:42 ad Exp $$NetBSD: kern_lock.c,v 1.188 2024/01/14 11:46:05 andvar Exp $$NetBSD: kern_lwp.c,v 1.270 2025/04/11 16:04:43 andvar Exp $$NetBSD: kern_malloc.c,v 1.158 2019/11/14 16:23:52 maxv Exp $$NetBSD: kern_module.c,v 1.173 2025/05/05 00:31:48 pgoyette Exp $$NetBSD: kern_module_hook.c,v 1.4 2019/12/13 08:02:53 skrll Exp $$NetBSD: kern_module_vfs.c,v 1.19 2025/03/20 13:26:54 pgoyette Exp $$NetBSD: kern_mutex.c,v 1.112 2023/10/15 10:28:23 riastradh Exp $$NetBSD: kern_mutex_obj.c,v 1.15 2023/10/02 21:03:55 ad Exp $$NetBSD: kern_ntptime.c,v 1.64 2022/10/26 23:23:52 riastradh Exp $$NetBSD: kern_physio.c,v 1.102 2022/07/10 23:11:55 riastradh Exp $$NetBSD: kern_pmf.c,v 1.51 2022/08/24 11:41:39 riastradh Exp $$NetBSD: kern_proc.c,v 1.280 2025/06/02 16:27:04 andvar Exp $$NetBSD: kern_prot.c,v 1.122 2020/05/23 23:42:43 ad Exp $$NetBSD: kern_ras.c,v 1.42 2022/08/08 22:31:45 riastradh Exp $$NetBSD: kern_rate.c,v 1.2 2012/12/12 11:10:56 pooka Exp $$NetBSD: kern_reboot.c,v 1.5 2024/03/05 14:15:36 thorpej Exp $$NetBSD: kern_resource.c,v 1.195 2023/10/04 20:28:06 ad Exp $$NetBSD: kern_runq.c,v 1.71 2025/01/17 04:11:33 mrg Exp $$NetBSD: kern_rwlock.c,v 1.76 2023/10/15 10:28:48 riastradh Exp $$NetBSD: kern_rwlock_obj.c,v 1.13 2023/10/02 21:03:55 ad Exp $$NetBSD: kern_scdebug.c,v 1.2 2019/03/14 19:51:49 palle Exp $$NetBSD: sys_syscall.c,v 1.16 2025/06/01 23:30:36 bad Exp $$NetBSD: kern_sig.c,v 1.410 2025/03/13 12:48:21 riastradh Exp $$NetBSD: kern_sleepq.c,v 1.87 2023/11/02 10:31:55 martin Exp $$NetBSD: kern_softint.c,v 1.76 2024/03/01 04:32:38 mrg Exp $$NetBSD: kern_ssp.c,v 1.7 2016/12/06 02:55:42 christos Exp $$NetBSD: kern_stub.c,v 1.50 2020/08/01 02:04:55 riastradh Exp $$NetBSD: kern_subr.c,v 1.231 2023/01/19 07:40:58 mlelstv Exp $$NetBSD: kern_synch.c,v 1.366 2023/11/22 13:18:48 riastradh Exp $$NetBSD: kern_syscall.c,v 1.21 2020/08/31 19:51:30 christos Exp $$NetBSD: kern_sysctl.c,v 1.271 2024/09/08 09:36:51 rillig Exp $$NetBSD: kern_tc.c,v 1.78 2025/07/15 22:15:03 andvar Exp $$NetBSD: kern_threadpool.c,v 1.23 2021/01/23 16:33:49 riastradh Exp $$NetBSD: kern_time.c,v 1.228 2025/03/19 14:27:05 pho Exp $$NetBSD: kern_timeout.c,v 1.79 2023/10/08 13:23:05 ad Exp $$NetBSD: kern_turnstile.c,v 1.56 2025/06/27 21:36:24 andvar Exp $$NetBSD: kern_todr.c,v 1.47 2021/04/03 12:06:53 simonb Exp $$NetBSD: kern_uidinfo.c,v 1.13 2021/12/28 13:28:24 riastradh Exp $$NetBSD: kern_uuid.c,v 1.20 2014/10/05 10:00:03 riastradh Exp $$NetBSD: sched_4bsd.c,v 1.47 2025/01/17 04:11:33 mrg Exp $$NetBSD: subr_acl_posix1e.c,v 1.1 2020/05/16 18:31:50 christos Exp $$NetBSD: subr_acl_nfs4.c,v 1.2 2024/01/19 19:07:38 christos Exp $$NetBSD: subr_autoconf.c,v 1.314 2023/07/18 11:57:37 riastradh Exp $$NetBSD: subr_blist.c,v 1.16 2024/09/08 17:28:36 rillig Exp $$NetBSD: subr_bufq.c,v 1.27 2019/02/17 23:17:41 bad Exp $$NetBSD: subr_callback.c,v 1.7 2009/11/24 20:11:50 rmind Exp $$NetBSD: subr_cprng.c,v 1.44 2023/08/05 11:21:24 riastradh Exp $$NetBSD: subr_cpu.c,v 1.23 2025/06/23 22:50:23 ad Exp $$NetBSD: subr_cpufreq.c,v 1.10 2023/04/09 09:18:09 riastradh Exp $$NetBSD: subr_copy.c,v 1.19 2023/05/22 14:07:24 riastradh Exp $$NetBSD: subr_device.c,v 1.14 2024/08/27 13:44:55 thorpej Exp $$NetBSD: subr_devsw.c,v 1.53 2024/10/13 22:25:38 chs Exp $$NetBSD: subr_disk.c,v 1.138 2025/04/13 14:00:59 jakllsch Exp $$NetBSD: subr_disklabel.c,v 1.3 2019/04/07 02:58:02 rin Exp $$NetBSD: subr_disk_open.c,v 1.15 2020/02/29 14:44:44 mlelstv Exp $$NetBSD: subr_emul.c,v 1.2 2019/01/27 02:08:43 pgoyette Exp $$NetBSD: subr_evcnt.c,v 1.17 2021/04/17 00:05:31 mrg Exp $$NetBSD: subr_exec_fd.c,v 1.12 2021/06/29 22:40:53 dholland Exp $$NetBSD: subr_extent.c,v 1.89 2019/08/15 09:04:22 skrll Exp $$NetBSD: subr_hash.c,v 1.12 2021/06/13 14:58:49 simonb Exp $$NetBSD: subr_humanize.c,v 1.2 2019/03/12 00:25:44 kre Exp $$NetBSD: subr_interrupt.c,v 1.5 2021/12/10 20:36:04 andvar Exp $$NetBSD: subr_iostat.c,v 1.26 2024/05/04 13:33:18 mlelstv Exp $$NetBSD: subr_ipi.c,v 1.11 2023/02/24 11:02:27 riastradh Exp $$NetBSD: subr_kcpuset.c,v 1.20 2023/09/23 18:21:11 ad Exp $$NetBSD: subr_kmem.c,v 1.89 2023/09/10 14:29:13 ad Exp $$NetBSD: subr_kobj.c,v 1.78 2023/04/28 07:33:57 skrll Exp $$NetBSD: subr_localcount.c,v 1.8 2024/08/16 21:54:17 riastradh Exp $$NetBSD: subr_lockdebug.c,v 1.83 2022/09/02 06:01:38 nakayama Exp $$NetBSD: subr_log.c,v 1.66 2025/04/09 05:38:01 rin Exp $$NetBSD: subr_lwp_specificdata.c,v 1.5 2024/09/01 19:56:18 andvar Exp $$NetBSD: subr_once.c,v 1.7 2019/03/19 08:16:51 ryo Exp $$NetBSD: subr_optstr.c,v 1.8 2023/04/20 09:04:45 skrll Exp $$NetBSD: subr_pcq.c,v 1.20 2023/02/24 11:02:27 riastradh Exp $$NetBSD: subr_pcu.c,v 1.28 2023/04/09 09:18:09 riastradh Exp $$NetBSD: subr_percpu.c,v 1.25 2020/05/11 21:37:31 riastradh Exp $$NetBSD: subr_pool.c,v 1.295 2025/05/26 08:32:11 bouyer Exp $$NetBSD: subr_prf.c,v 1.203 2023/08/29 21:23:14 andvar Exp $$NetBSD: subr_prof.c,v 1.50 2021/08/14 17:51:20 ryo Exp $$NetBSD: subr_pserialize.c,v 1.24 2023/10/04 20:28:06 ad Exp $$NetBSD: subr_psref.c,v 1.18 2022/02/12 16:31:06 macallan Exp $$NetBSD: subr_specificdata.c,v 1.14 2017/06/01 02:45:13 chs Exp $$NetBSD: subr_time.c,v 1.41.2.1 2025/10/19 09:41:04 martin Exp $$NetBSD: subr_time_arith.c,v 1.3.2.1 2025/10/19 09:41:04 martin Exp $$NetBSD: subr_thmap.c,v 1.15 2023/10/17 11:57:20 riastradh Exp $$NetBSD: subr_vmem.c,v 1.118 2024/12/06 19:17:59 riastradh Exp $$NetBSD: subr_workqueue.c,v 1.48 2024/03/01 04:32:38 mrg Exp $$NetBSD: subr_xcall.c,v 1.39 2025/04/01 03:16:41 ozaki-r Exp $$NetBSD: sys_aio.c,v 1.50 2024/12/07 02:38:51 riastradh Exp $$NetBSD: sys_descrip.c,v 1.52 2025/07/16 19:14:13 kre Exp $$NetBSD: sys_epoll.c,v 1.4 2023/07/30 18:31:13 christos Exp $$NetBSD: sys_eventfd.c,v 1.11 2023/11/19 17:16:00 riastradh Exp $$NetBSD: sys_futex.c,v 1.26 2025/03/05 14:01:55 riastradh Exp $$NetBSD: sys_generic.c,v 1.134 2022/07/10 23:12:12 riastradh Exp $$NetBSD: sys_getrandom.c,v 1.2 2021/12/28 13:22:43 riastradh Exp $$NetBSD: sys_memfd.c,v 1.11.8.1 2025/11/20 19:27:15 martin Exp $$NetBSD: sys_module.c,v 1.30 2022/05/24 06:20:05 andvar Exp $$NetBSD: sys_mqueue.c,v 1.49 2024/07/01 01:35:53 christos Exp $$NetBSD: sys_lwp.c,v 1.89 2023/10/15 10:29:24 riastradh Exp $$NetBSD: sys_process.c,v 1.180 2020/05/26 00:50:53 kamil Exp $$NetBSD: sys_process_lwpstatus.c,v 1.5 2025/01/11 19:42:04 christos Exp $$NetBSD: sys_pset.c,v 1.24 2020/05/23 23:42:43 ad Exp $$NetBSD: sys_select.c,v 1.68 2024/11/26 23:10:15 khorben Exp $$NetBSD: sys_sig.c,v 1.58 2024/07/14 05:10:40 kre Exp $$NetBSD: sys_sched.c,v 1.50 2023/04/09 09:18:09 riastradh Exp $$NetBSD: sys_socket.c,v 1.84 2024/12/06 18:44:00 riastradh Exp $$NetBSD: sys_timerfd.c,v 1.11 2024/12/19 23:50:22 riastradh Exp $$NetBSD: tty.c,v 1.313 2024/07/14 05:10:40 kre Exp $$NetBSD: tty_conf.c,v 1.57 2021/08/09 20:49:10 andvar Exp $$NetBSD: tty_bsdpty.c,v 1.20 2014/04/04 18:11:58 christos Exp $$NetBSD: tty_pty.c,v 1.149 2021/10/11 01:07:36 thorpej Exp $$NetBSD: tty_ptm.c,v 1.46.8.1 2025/08/08 16:37:02 martin Exp $$NetBSD: tty_subr.c,v 1.43 2019/12/27 09:41:51 msaitoh Exp $$NetBSD: tty_tty.c,v 1.41 2020/05/23 23:42:43 ad Exp $$NetBSD: uipc_accf.c,v 1.16 2024/12/06 18:44:00 riastradh Exp $$NetBSD: uipc_domain.c,v 1.112 2024/12/07 02:31:14 riastradh Exp $$NetBSD: uipc_mbuf.c,v 1.255 2024/12/15 11:07:10 skrll Exp $$NetBSD: link_proto.c,v 1.41 2025/06/05 06:29:27 ozaki-r Exp $$NetBSD: uipc_proto.c,v 1.24 2024/12/06 18:36:31 riastradh Exp $$NetBSD: uipc_sem.c,v 1.62 2024/12/06 18:44:00 riastradh Exp $$NetBSD: uipc_socket.c,v 1.314 2025/07/16 19:14:13 kre Exp $$NetBSD: uipc_socket2.c,v 1.147 2024/12/07 02:31:14 riastradh Exp $$NetBSD: uipc_syscalls.c,v 1.215 2025/07/16 19:14:13 kre Exp $$NetBSD: uipc_usrreq.c,v 1.209 2025/07/16 19:14:13 kre Exp $$NetBSD: vfs_acl.c,v 1.3 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_bio.c,v 1.306 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_cache.c,v 1.159 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_cwd.c,v 1.12 2024/12/07 02:11:42 riastradh Exp $$NetBSD: vfs_dirhash.c,v 1.16 2024/12/07 02:11:42 riastradh Exp $$NetBSD: vfs_getcwd.c,v 1.63 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_hooks.c,v 1.9 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_init.c,v 1.67 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_lockf.c,v 1.83 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_lookup.c,v 1.238 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_mount.c,v 1.110 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_quotactl.c,v 1.40 2014/06/28 22:27:50 dholland Exp $$$NetBSD: vfs_subr.c,v 1.502 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_syscalls.c,v 1.571 2025/07/16 19:14:13 kre Exp $$NetBSD: vfs_trans.c,v 1.73 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_vnode.c,v 1.156 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vfs_vnops.c,v 1.246 2025/07/09 07:39:39 bad Exp $$NetBSD: vfs_xattr.c,v 1.41 2024/12/07 02:27:38 riastradh Exp $$NetBSD: vnode_if.c,v 1.119 2023/06/15 09:15:13 hannken Exp $$NetBSD: dead_vfsops.c,v 1.13 2022/10/26 23:39:43 riastradh Exp $$NetBSD: dead_vnops.c,v 1.67 2022/10/26 23:39:43 riastradh Exp $$NetBSD: fifo_vnops.c,v 1.91 2021/10/11 01:07:36 thorpej Exp $$NetBSD: genfs_io.c,v 1.104 2024/04/05 13:05:40 riastradh Exp $$NetBSD: genfs_rename.c,v 1.7 2021/10/20 13:29:06 thorpej Exp $$NetBSD: genfs_vfsops.c,v 1.11 2022/07/08 07:42:06 hannken Exp $$NetBSD: genfs_vnops.c,v 1.220 2023/03/03 10:02:51 hannken Exp $$NetBSD: layer_subr.c,v 1.39 2022/04/10 09:50:46 andvar Exp $$NetBSD: layer_vfsops.c,v 1.56 2022/12/09 10:33:18 hannken Exp $$NetBSD: layer_vnops.c,v 1.72 2021/10/20 03:08:18 thorpej Exp $$NetBSD: spec_vnops.c,v 1.219 2025/01/06 09:45:49 mlelstv Exp $$NetBSD: clock_subr.c,v 1.27 2016/08/15 15:51:39 jakllsch Exp $$NetBSD: dksubr.c,v 1.118 2025/02/18 17:09:34 mlelstv Exp $$NetBSD: dk.c,v 1.173 2025/04/13 14:01:00 jakllsch Exp $$NetBSD: dkwedge_apple.c,v 1.6 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: dkwedge_gpt.c,v 1.26 2020/04/11 16:00:34 jdolecek Exp $$NetBSD: md.c,v 1.87 2023/01/13 15:46:40 hannken Exp $$NetBSD: mm.c,v 1.25 2024/08/25 11:29:38 uwe Exp $$NetBSD: random.c,v 1.12 2024/08/27 00:56:47 riastradh Exp $$NetBSD: bpf.c,v 1.258 2024/10/20 14:03:51 mlelstv Exp $$NetBSD: bpf_filter.c,v 1.73 2024/09/02 15:34:08 christos Exp $$NetBSD: bpf_stub.c,v 1.8 2018/06/25 03:22:14 msaitoh Exp $$NetBSD: dl_print.c,v 1.8 2021/05/27 13:40:38 christos Exp $$NetBSD: if.c,v 1.535 2025/06/12 10:23:43 ozaki-r Exp $$NetBSD: if_ethersubr.c,v 1.330 2025/04/23 12:17:05 joe Exp $$NetBSD: if_loop.c,v 1.118 2022/09/04 23:34:51 thorpej Exp $$NetBSD: if_media.c,v 1.54 2022/09/03 02:47:59 thorpej Exp $$NetBSD: if_stats.c,v 1.5 2024/06/29 02:18:35 riastradh Exp $$NetBSD: nd.c,v 1.7.4.1 2025/08/29 15:19:39 martin Exp $$NetBSD: pfil.c,v 1.42 2022/08/16 04:35:57 knakahara Exp $$NetBSD: pktqueue.c,v 1.22 2023/05/28 08:09:34 andvar Exp $$NetBSD: net_stats.c,v 1.6 2020/02/07 12:35:33 thorpej Exp $$NetBSD: radix.c,v 1.49 2020/10/18 13:07:31 gson Exp $$NetBSD: raw_cb.c,v 1.24 2017/09/25 01:56:22 ozaki-r Exp $$NetBSD: raw_usrreq.c,v 1.66 2024/07/05 04:31:53 rin Exp $$NetBSD: route.c,v 1.239 2025/06/12 08:27:40 ozaki-r Exp $$NetBSD: rss_config.c,v 1.3 2021/09/24 04:11:02 knakahara Exp $$NetBSD: rtbl.c,v 1.7 2017/06/01 02:45:14 chs Exp $$NetBSD: rtsock.c,v 1.256 2022/08/27 08:36:41 skrll Exp $$NetBSD: rtsock_shared.c,v 1.23 2022/10/04 07:06:31 msaitoh Exp $$NetBSD: if_arp.c,v 1.317 2024/11/13 09:25:52 roy Exp $$NetBSD: in4_cksum.c,v 1.20 2014/11/30 18:15:41 christos Exp $$NetBSD: in_cksum.c,v 1.22 2008/01/25 21:12:15 joerg Exp $$NetBSD: ip_encap.c,v 1.78 2025/02/26 04:49:45 andvar Exp $$NetBSD: gpiolib.c,v 1.1 2024/12/17 12:44:33 martin Exp $$NetBSD: secmodel_suser.c,v 1.58 2024/03/01 22:01:03 andvar Exp $$NetBSD: secmodel_securelevel.c,v 1.37 2020/12/05 17:33:53 thorpej Exp $$NetBSD: secmodel_extensions.c,v 1.16 2023/04/22 13:54:19 riastradh Exp $$NetBSD: secmodel_extensions_vfs.c,v 1.1 2023/04/22 13:54:19 riastradh Exp $$NetBSD: secmodel_bsd44.c,v 1.17 2020/03/16 21:20:12 pgoyette Exp $$NetBSD: dkcksum.c,v 1.1 2021/05/17 08:50:36 mrg Exp $$NetBSD: entpool.c,v 1.1 2020/04/30 03:28:19 riastradh Exp $$NetBSD: hexdump.c,v 1.4 2017/12/09 00:51:52 christos Exp $$NetBSD: radixtree.c,v 1.34 2024/05/04 17:58:24 chs Exp $$NetBSD: xlat_mbr_fstype.c,v 1.10 2025/03/02 22:04:07 jakllsch Exp $$NetBSD: strcpy_arm.S,v 1.7 2024/02/08 20:51:24 andvar Exp $$NetBSD: popcount32.c,v 1.5 2015/05/29 19:39:41 matt Exp $$NetBSD: strrchr_arm.S,v 1.6 2013/08/25 06:15:06 matt Exp $$NetBSD: strlcat_arm.S,v 1.6 2014/05/06 16:02:11 joerg Exp $$NetBSD: murmurhash.c,v 1.8 2019/08/20 15:17:02 para Exp $$NetBSD: sha2.c,v 1.26 2024/01/20 14:55:02 christos Exp $$NetBSD: sha1.c,v 1.7 2021/10/28 15:09:08 christos Exp $$NetBSD: getfstypename.c,v 1.11 2021/07/22 13:54:38 skrll Exp $$NetBSD: proc_compare.c,v 1.3 2020/01/06 13:21:18 skrll Exp $$NetBSD: snprintb.c,v 1.49 2024/06/16 19:41:39 rillig Exp $$NetBSD: strlen_arm.S,v 1.11 2023/01/15 08:43:03 skrll Exp $$NetBSD: keccak.c,v 1.1 2017/11/30 05:47:24 riastradh Exp $$NetBSD: strtoull.c,v 1.6 2013/04/16 21:44:06 joerg Exp $$NetBSD: strtoll.c,v 1.7 2013/04/16 21:44:06 joerg Exp $$NetBSD: strncmp.S,v 1.2 2013/08/19 00:57:25 matt Exp $$NetBSD: rb.c,v 1.16 2021/09/16 21:29:41 andvar Exp $$NetBSD: strtoul.c,v 1.3 2008/08/20 19:58:34 oster Exp $$NetBSD: strchr_arm.S,v 1.8 2013/08/19 17:50:04 matt Exp $$NetBSD: strcmp.S,v 1.2 2013/08/19 00:56:12 matt Exp $$NetBSD: memcmp.S,v 1.5 2015/03/26 13:34:51 justin Exp $$NetBSD: __aeabi_idiv0.c,v 1.3 2014/01/29 22:29:43 joerg Exp $GCC: (NetBSD nb1 20250721) 12.5.01 _$<x} \E}{z{/G QU&D aQapU@%`@XdeWE<* D! ⸨j:]:gx}ԭ[N^.IoHRKSygk6=L<$\0Ig5I$}R.O'T:I_KI?)gOzܽTKd~l~QO4I]s?ogMeCY=ŪS wJpzߟ\Hz)2QK|׌xοM6Jﯛyv*e^SOxo&\jרͩ8Iw$ϨTޞ^WN_ǒ<&y>]~G'p_M+i;pۡ뷿jd-MҎ9 Զ4Ȁ89р]>?IyHS 4ʼI_~/I?TJS}_;[i_ma^V^bC>*1uYPU.y@{)s~?tt}3٧Lk\SnB篃d+{'|~L%}c2 H.:t0ImusIWש*ݜ&KC] :u}u򻶡p_ŤzN~9HޖctYwY{:#i꘮}G;3T>2~ s[fw3Y[ 굽Ty9=lB^V'yONh _yIүsULӉij*:!gm'i|0M󒢣O˒;c6JfR% vA|zzd]|>=1U߬+>&M5+ɀKuPQ{Z>Yy] }4˃Ԁ{[62ߒR2)/X+b:^(gy#0oOG㝞x̿_+gizw*^jC2NtN$AZMcwKQϒgH$=O=~_y}7ye7 c5|mEϡOn1Yh+o%?ؾ?IP>o&Q;$u/hI<\˩y߹wN|l z LҫGtF/NYmd(Ҽ:xIBX\|nJG&CA.AJU=I%ƚO< [)~i<׍wCz}$LY +-}e>wZcL{wwsd R{yT"dHt]JRO6_.mcңjcKӀGWt=i\TmͿti|mqDK_pVz7jk?W(Z+nizN?jseחwoGYʘ;[|g/E h~uz\Cޭm=0ywڃ]#J_Hyiݿ^GDY>- vr}g,?I>sϪxmu`>?vk!Ŝ}fj[? ~3xSK>!]|y{o C16-u_QNmy,9yG߳AʗPlu{xypݎgCE{| g7ypF:OˇDXu5w?s \ICX/%ka;NA.:K3x'ў > |:l8=K{vż'>+ay~E?YY ׾_wשaA^?A'My 2sSy 8_5},<6Pۗ9=_Fz⊛>7@FK9/c 咍sc,ο}k5vR̮#r>m^Cy~>{r8ޘ7]q'4eA{㦼~)ڰ0[+&զnw'H| \o ̺:b1Cc6on%74ǯy$]/_;Y}ךzo,f ѢJ&=hi{AJNHg=W~^lXIu߸Ɩ6t`?\-4B'2ߏk쑃o\S>i(K/)u7k~ Nԋ+cRs471lsgLX+K_\״U){-JD!]-]73ǣ}[k9}ltl3_ox[[&mNNn;zd+-o}4@A4K4b'5^92v*}Uoۜu ;xq΋ylcg[gdZh#}J;G{!ɗ[\֎F7rnTmk#y{{s^q^ yȾ:陫kSy xJ*xۮ0 ]竔 b^\8#]9v=o}S{ȺUQ:z>ʠ mڮaX!}|[t-bYWVΑ շ}u7xss;KaZ'x[8W~nزf륉˦Tm*8陥^K{d.8u~v)ԕ1\nTߕ|f}ԋ/-ks5x`kwv\5 (u>RmJԦWs\<[Wzso~9/ymt| Lq[{vS{?e s*~y vz֯*MC/}O{gczD=o L\^k䡽}gU{vO<]34N>#w|^ự>co[1Ӑl!x)Ӓ17@>'}44.T6!ˎX^leQ9eSFvߓ?]mFePo8kSF=Ku ϫAO!9 x/רf](Nws-quQ b߯gv9¯.mDk,&T,z 1NX.[2g|dz3̓iڼ&n7r\6{뷮?Wxo?s y Y?);yfsۍQV?b{r)/ 뮽e(mqNS9'Tn:Nu_t"Ml.'ݼו^9e3ߜ>O+뵅꠲}W3s`:՜*!=yzیG6y կLf3cz3;H_swuyzN(~][C+i ڞJSWk]=C{f}Wzx*ޅ7*sbq2OTeGIC S, [aO&2}Yx7j|~?7g߮|. ^h|j̊}Vs[n-SvAA2Z1FpR첡{(Vu5oM㏷.tͧ K_?*x=ltƽ,cZk^OG';FwfBlZ9IǪf%<>sA_9WdsB$/|Q _1gvssy|N?|~BUw #kg%ss\oSi&)倎|K{螬[ xnb9}nqN6!cl?d[#Rs&|g{ͨ{ѣ^449=~ 5)[X|_gK㙖SxBjXOǧib qښY'S/ =%pB} #SF0Wlr&'wR|OA<с Eb!/}~RbJ{ڗo4͜f^؞f,x-T+YkeJ:iXacmgTIzΦvy>֞691kϕ8oJg.IQϙy9&s]y~#-f{y#&9xC0tGcns~xm/WD P~5/?7zx/?j6x1 7{t=m~lG.qNyEm'o/_滯7 4.?E[Z?4ڑa/9{g'Xb + U 'olc6}tu̙|۟r=yheʱOOgwϺ5y'-9ZbI9Q,֠5Ahegŧlk^sSu[y78iV^rMʹb5?6̧Zf.Vkx?esO57v&YͳJ";JEH@pqmk<8xcz܊Gb[+pi>հYچO58&K} oz|(@} bzὙ#+U-\v)s6g}؆t~|ä{ٽϥ-LWC~kO ͼLT>whC1)q9%nQևg k9qOc&{H}ӐuSh'_dw:e7=U< ז91ܑ՗j&KKvM[6[G[U?l:|=g3SqDB(9c쥶܏d[<1hfRNzN& 1nYsHEI:N;.hb\恖'>J݆u, #)ڣW5W1;V9t|X>7X&18c8wa;U33Lsum^i˩o6:VXi5hՆ FS+QF{z~\6Ggx= ?A.]$ʵBVm%yɋ/z2滛x\X>[c2vG{&Ckم-~W.+_W$Wu.imRW|Ky_WtYoX7k pT`8YWI%޽:X.Yޡd&}hEcl xv<8H^c0Z0{ aL_ بwGy }togbuom |E@V~q?T.B,’~| hKnK>xL迿H25pKrG&׷%,~~~.9LhLQʡ:G?K 8?0ߺzʠcGp77|R>؈< .,8hׅY\[{c=\y:˔ǯ&jSd>t ]|\όCN|xy%Sn#D\Ow]ƽml0\e:Il A/}=8c!\ދSh[=g5uq kvpר ڷD{қVuTzbZi`8G=e&0yAu7/`,1h_{{:y^V&0S&_<g~~y<ݞV^Eٱ닁^3z10$cb;õF1,c,ӳhS6ғϡocN(gɩ*cp6P 5,Fl<9Cw=m][c["g.I{=<$4z&O;7]$_]pOcwd.Hsd|u}FCl(mGyKD9o8OL~+INl ?|r=uf+vchGyg#t騘/9,z^IB,\ĵ|o>yɠ?at~xC׏ש?^#vM)/|sdwcދԄ}唍#пU~VࢃgK6s!dBvQk2miWV[~ޢ*lH&t[ANtNn㗉 ]gz2^\k;iY"M]]0ہˈ;yt~UKc ,ySC\oYpm<ދdX?)Uu>WТkBLu-\^xޘcK1LF_\(IRXC9G;QL_<+<3Tp kC'o찱eSbht1\>q*$ tέcg]0،RrYxYI%71 N {AW9oؘ J}`?=\xwvSCssvh2'j#:ߩ5954(w> K;Xs+wt`D梼[yEp?N>)]?t3)l$irG3-"1a7Py lC u06=aGi"ú,zS"Mnmڏc\0ޒM!69Yhgr9<%x78eE7[f/[9:ͯ=)p)u<ܣfp\w\8wacC~CɃZ\83Esu/f&פ:k';26t۬{IoԸx´d1]ފUK7 9Ӭ^6'|LKCp؎k9`#zB}x:ߊ􍶵g&,n\:ffjO~垽;zLT:7+f{x}#d$V=:-^mrm);C @JlQnԄ=2n86~ډe޵~(ښۛ=`6_4xm9ѵ,4n¾tCyqolXrތἑw`E8NbktxGXqg@IyΧQcy tύIv21 s${o\n[d·yvڞ ?DJ}(צ1;; ]F+t]T@gcJRFjDmI:806.0] ܽ(L_fe3g3GG'w<4;i߽Wwj"Sҁb6VZXo4k6xqraNt㦦ג@Zc5KF>TkOGYmGE~:޿6sǓz_[?N &3CX`/&,qx>Xa}xC)OE~8>|^qЧ}vr>4'PmG,c-I I垖|Aej{/U4xҝ~KJFp6eu,7/e3RǕc$׮u, vL0,wy}/JwVl\?(f90yS#bUcq3 Oe=XgK"-鸐-pJwyb|lQ B]ϡ@D6Mlk'9&!sl|5cxnޫIKIf4(W;ºB![5hڣR1cTݑӜ~W'yFrCb͞jgb*M?W c^ƹ9'.4_cT~Om0t@KA;/gZ_1%8${].'9+Yy>*m=?vٌ%7zL@کMИ%X볒Y[5BWQ_K>$ "Dr<}EG\\pLJv_kLtB]#gg&}H;+Q#ge#klXHsomvKnאKNp(U5gswPKг/KcP- դJ:1XK+wt<?t. #ɍ\DKZF`#U<s)s}Fh*y0?eޚ#`b/>JʣpiAų[n(zoy'#3'9xzoI~A:kzCcŵJ]kg'/ X1*pҌL\@cG~uɤK<R=וi¤õ ЏD&0^u>mUsC.i_+)oI>꘲O۾_ʗd#60}(@lO|w"Mq0 Q) XaC"&?ӈ*}pɢx%WLNJZyCӤK:gi_jeɶ 4L7w1lmQ~~[b@ hֹ|3SrY=?3N b/a=VdwG1VQkr)~)HPJא[e'xHӾce0v%5L@kS]9q)kA;Z~VwyO{^Cl*.k涯)?s{ 5r$-%1 `] =Q,7QW:B;1Vsئ_`߼ ZHn o"oO+O}$A59x9eC,om1%c!SZoif蛼4|9 U 3R %Ff!9[/壘.epȜkox&~'e/^هy","S[ N6X>1Q4.L%ﴲI/kj^vx 2 "h6!a{yiyjƲG,UlK;ئ(ǠzΏuI'؅/sXs9: <^tȔ1eȷM'XzN5 ieĘ#43^m1PxӠ9ΛX5I{mQ}ZɽPQяW}韆X?XgKq&uĢ X$棴~'9r|ɐ/6ؿe4lQt>|zAӵ`1`SͷȄczpxp+ؾ7^>^m {vi[~~&=AWWRԼbi:)!2l8>to߫}';l!յ~⒦;-^7 ~3<docX1mJ/ЖtFgY*G); 'z KK$L7$?Z?C0m GM>_SXUTulZ܁mYǛIƣ frJ`@=?{&gx l;0|Qv o!=|SG[Ér}^`Fܟ.GQ.m?}mS/',eFPG CD?V:\V4qX}%{Za//4 3=^3#B_æ^O#,r?əvV53>lbM7&7 {k_r%;Ѭ˼(ul*opрiH^+1G6"J5#g 61ߑ4uxmH<$_jmjGmLr ˲Y6[++"0ۥH?Kq#mkkdW 4 t7r[iTֱc/oykvNi?89&/Ph ŷ#= ވWn,dYϸ3e1A_rw(G [IeGZJ1^e_5>;iTCSț]i<,} kX%ҷ ;pO%Y͞[8et+Sh/6tyrIN}q;GfW·Ok v4ܰx[žeN9om Pp*-|MF4{%CY꿫ƟHzmEa|5.m7tw.q3:ҧ"3fW:N71qF` <cAT.wF꩹[I;d9')qְik}ӖCWK舢zg !+_o|!KeS3#qOa綩@}w IA&a,iquQŌN<|QwZx0bk׮a61Q_>΍|͕zXŹjX|ݍ_(;OTv&g? &~$ۿ ( Y͢A}b.hVR&kjCz)k%V4ŗmvt9}94raC#|I/>$;+0Q{FY}>">wN]xO45sTںɸ=H9s!ĨWH;.sNB?qHc氖C2 #8OucM[`2GHយ=_[dk?n'?$ ]*޶X?KIXh,oy6M_ZSWVgGӉ/i$LOӅ2gִ~̱?>ɟ6Ħ U&SBJn{ܯ;[^;s(iq;@l1ǂ DiQv!!23#CZœ`U |=chUGi#ͬk/{;Y,u,ցb?֟ *? XڡavEc@Krٽ;n}XD6lA}N3x4Dv|L=;$m+Ks?5I杤b=QoUreͯ~xCam4y\zД}S@gM%zc3L~c֘O1vmcG]edeF߭x%SFβս0nk|Df?Sdxָd4KY^6$##gbali_yp`..c:Ód@_}[&_x6l0晻O{ךڷJϷ{}Jw:?-sNY"q bsJ'Mm1a{梊>:Y):x|lJ&nPy|^bh4o)`^ wvE[JVZJj{:ZSżCh3a10-#mw|8ZW:4lC-׊FѴ?Xh:cP{H5A?(=dIX_Y=f<>NƠB[PӱS>l;C=/2˶$^6^EXhLX ]CR{Tnū pqgzϊ^o7Xy-iIJ7Dia#fm-8+)VPG+PX'.(}5 iΓ8A,M)e^Ik:b=[ßXCՎ*>g32elAaXp{߰cL>0!Ɛ <ϻS檍޵!؄g;q-_fu6 > ĺ<\bIE;Y0JN9Dwo>9=ȾW@f< wt~`uعmQ<|Q]?@6b9Xh/{zh~![8261P9+T>K͊mm|-C > |<ϮCDl:ςi8˄_X'of5멎+O4G;0kx2) Iꧤ+%š5a/r܈γ~V> 2`dˆDo1Uwa? 2v&]-\_0/s})#g wY1ּ>k+}s88FOC y_?ϞY1|yUJ}_qysZ2̥1ї &\.#,34}: &2 ab\I?^ԯM'/opu 2}jt^ub&\Y]2On]Lli l:kؾ%X:>SalI=m. s*2li I߈:IılOL L̚޿usvP`1MZ0w['-k`an͗y"ٽ- ~43`Ǩ 9.'iB,/㸋6ْ\XK6|wტ_)l=+63"&нL{_֞y6IY~ X(m%_U6kHw١d/PH4WЮ8>!'5c`l!]b-?O !g7s/HIE*(ygĶ!ڑF0x}DLf'G=n/pSE\e3tb=](u^2ƺ؞.vgjwB>:vGLk<官6kv_bepm;I'O@ۦ=m؎8!x?%?bie `}&Vf$p ۝ORYs7 ć&(3 HlwfaQkԏ-\qK%:}˥:ia) e:z7=^l{]sg-Ÿb򾃦HƤHb zW^ܜov+elSvm%%v˽ծ JFAֶi4Jl0#Ov|1*-v%[^/9?fd&ϗOh׳ַ @lZWAh+|BXYٱsDYXΗȂe =/V6L,L\scL]Ǹ_c}.mX"r} E.W"8%G!MyZ㪜쾨ZACsǑ7>jGc0ۨc#&h{ڧI_aM.-c BF eWL7hh=E//-qv"=8ϩߘTvCݔI,>9b\mKrng}N&#roy;'׽ScT_%cߢdW+z glm=cإtgR>RgtQa,LCq`{ 7`<&l9`S%'+$Y # (N1)g{[!VMbӆe-l&]= ?v>ֈ#7.QUfClfxe2v} Oذt#:{]h\'fOG!: }~c`g9MjnYaVdclmۺ97?6_[Lyz=D-n}->qY' l/tx]2|Զ}eéXʮaFqKm|Uϭ |d;)~uIJJ>fް@ūE}8ݘu _^hK)S$0NH 7|K\gWSK g,^-141XEs0v{*# ܋Xj%ҵwM1.W<[=.FQng1h+24xg]5&Ԙ#.JRul}UIj!L"*%1lX҇ HnmI:ٽBOӗO2cE{#%-k,&;93cU^˰sd{ruhz eǪVzs5/%{:Dsn  nv18[ !6ѵA4WqRxXO??]p ݐa_T ۖ<DDƦ]x.,\%lb~zE(-mAeXwDY>hjM$)d}$ɂ6ž&%4BjjHsƕ=O>5>K}`VPrr'Y\^6ypтQ'czfCÖ. } CmM ym酡qƖ\f){-iMNHFsGALw 4G5`}!^gYgdL+|?0shxmF:,7᫦.6; k@6Yت51[]3َl|DƶXK7FLJ5 'ъ k/yI6yҟQE=ϘşA9f.EɽvX<؏ʆIǛ'ַr7 Q2PiNK\W4^~߆~Nʙk?ogZw}[٘]Eq:a =ڨɵ®Mʿv/e%éشZgy=kK{)/cyY[@콙obZx`Z';)xVM FWM}pz>#=q"KlOiwbV$f NqG,M&;mla+ 0>R;|_U19?nh^zn9MD٘Yh^#NbP[d.?QeSRꝱ1Q?!kA}m-yCx%{CT3B;||9&.KAbl#VGǤq{vT1gf<xQǾ;:z2mWr,j,cL蚮MY0?;p#C1%n+_}-=0Vke垝HXb:<;db D҆*uuo+mF8<k,\%S-7nG#f>]aSvXu%e!OJKT:"4 {6FWLJb78z9F6^$$ D#wtye b{tb+fMD:-j! &NVM>^޽ 6>iȨM[cK-=Ӳe SS/JI;<ϴ?W6]7͗SÎ>2n==Du]>bLvB9Alf=Jm/>iEe"VĊY9l1_#|ͱj'*澈 ۪4L4}:ga!Jn%!۵_)v%\Ӻ|^fb_a'zD7v<I#p\VJ2NO1rM'+{1cK\E:xIF# r6OW~)uc}UDO!&ؿ8CL;7~/@سc2.70ߙ"<˛1  M؆ NS8V7[pxz G+]?쾔\^=dż R-q? q9X p)ُDm娗)9,=)e `#}x=5%Esoڊ~b_(z`6nY6p0D Ol:MSZ3K?Ws2*SXC`0.\&^-.~ivIG=Xr/PγR鲾Mvg_ EQJW?ZeۢOK 2)>/lò!=YxaW+yI~Ӣ د?z=+sϢlIX k eb,1]-'`tOZ)fc vf}IM(i;-3}'n.T11n8ƚbE^W4yśJņ} y/A ?xO[eY.P']b4haV2qUYd v6ۮm*8[(E ~Oe-q[c9h #4-SDyÁ[w@Sc䢌A ~X"lzrf`ʵK o-<+h D,tWnOM9>%eDw/)6,vsDf,tzztJKoL؁gUpRxG!Ewnd+y Y}w7F;ks EjxPʿpf[n͙~&p=Oc6 e4ncv8 {ep=z lrPTb=~}ʼWlgBtuy!zq`G}_0{##ʴxGY¯(D=;x?i9lr5F϶4N}ĕgGT|YWb ł {9@')/aw/C:X%blVO{$eYcRYc0bSI%s@~;G2 n%Wg<|1+}Jd & Ƹ&|a&}/F,fP k-flvVM󦒶~6_ [>-emi⋠NgBY4H7cL6l5_,6c+(7Av-x VsNנ!x 9F(:7"t[^7miHN(Gd;-F+k}'KY]|m7gJ2i\x ?{~] bvX>*O:x8bb%s0/{7UΡ{[ ̲<3duHy]ؗOmI9SŲQ10v(6Z3foR]Iy52sĝIT,<M]8l ]v> x..qPSNً / yu>G$p\ٟSʊ6M%.48.KR,ǜcb[c-2M`ux«<`aKqz`SH`XaH~uA;lZKgGc}г &wǤn{)i oᘎr/ RJy^VyFȥKA>,Jj 4 BO< sj$;b@;B#0ˎ]v=Lp$"c?c8W2Fh6)O.GĿ~qMѳ9`١Sb/SOMls›"47;>T,m~jG_[`ӱ2 OyRpQ?S潪Ci_&nK~ױq)%ʶH`jۃ6{h?序%c ͞[?-7 $٦0csI==Rb|;L\CaЃU裆A eb|;5c!@)<>Us G&S*1c-e$_΂+| l˯&7G>U8>#2w|x%Ār!}|i!]\uX6&/+e/Dmcf̕bPܾsFU^bE_ nG9ASOdOGn {s4uqXwHW@L#6D"1l|89$>Vдm[YcɵߖMv3rsE agp@*UBƈTlQ^ώ+=0<ĝ9tgY)N>ܾEkc|V~VsG}mҐ*ig @u@{vn=J_x\ܫPR-~IϒELĸ`/p']%a gW2φٱkDI\-n?fe6"0\TBm:?p%Nf,OE}1L*"\k,lc?J{ k,vEj+)~` ⪈]6_R_wC fȎoݲ[X=mSsO=fymA?G"Z΋2/ӝKws+=!\֝IGB2hͱ1zEQɺqP6&UXzTĸpl&U6x7 mp`^ԎzD~XL3MwA+q-vlC] "^;j:b6.Ho+ytdkg OGe+}e-8: @ [B[,Bw%@ݝ'MꙪު;?=s{zzZK  y>s}wY6حyvsUV.CF7s_.iLҾ8vO9!4? =L]:Dԟ;'~tq/mW 5ym 78 ׳}$9CR{肂t3]筝!:s?M` t|L'Zs^yVtq=RyY#ScLe*N3agTn;?Vf2勤_-ټ6ؽ1ݾO<{Dctx,Lo(1ow}NRyUն`57 )n!ooQzV Sp\:9~B 6L{.+̭fBЅh*Jg(2=O#fljSc \M PQ@'| -P(>#0T1&4=?:8(5vERωɮk/%Bhw{uy0f,=4A.ߏ3EB?w~b39]V ~?7#+z9jxT9^"pTƎs?,?gC9}y5Mc#C:Ԙ;PWۗq!rֱ7O-3 'r D}HAQ 6Fż[m÷@A}L8m^ƙ}0x~ tm/'E*,]';B|Іw>h3L?>a7>iË΂snh]\&].ƎՁ/6R4/+^]&^ߟ՚?#!y~xّ}Ld7(Mƣb wQޗ!gX"7؈[^JH2eѴRp:SD ^QN>,ӝXEpzLcYeXGgc9@: Ɓu{/Z]7ݶaTٺ9b&PG36LZrwSfc$}`\D䷮yBHnO _}t74gԯj%Gs`~κ*gn޾pyg7U 5%RcXC6DEl>ѳ|!t=ǿg灋w$.;;o^?,[҃ u|(YX_[(M|wB2%>>E>?"y &Xe'O}?$V@^$53/_w- tAG?kl- /BbUvKć({L@7fFNmy:&]!q#.~8&`0@PgqCyi0l.`Nl+]n_ d35Hk3!u9{>rAzoݎO'PUs|^oC~ov}-&6d#7 qԑ4vܖ˚)2q=]QU]ˎw4h_T(p5/մ/VL`kӥ vsL3Q~A.oZS^S M5tWWbDcb9⼀MTz,?+r[g65y߷rWuM]ݿ ͎ Ep龀uԼl3 kSWy6d/<|^ D|6=9/P9XL6{|3ZC/4Qe\qv*#Vb˙`GR#n!1w^ğ{b\"r9cy_zd1U3w̗4/`yBWʀ9HK$Z;(y}`V Lo=c>1ٷBHr1dN<77/}E12İ>|ay|3'ܞõ _v<ieileSsuXv?s '9[/r@ΐ8ZAh(/nƼK\;Cr \绦yfLyq_6t/൜?KUlݹj1?:fBq^w1*d6Rhq"\',_]<T%5]'yƮۍ=wq< ܶ9.FR&c_r ޖu%E>2~;]\ Yf{-Yqꮃ:bdG*x|;Ķ$@)G},ed"2͕?,L:wEXC~j5R,iL'DRR <}̷7XTވuhǴXJd_~ǜ::Mr 1o>{eΊ¾He< t` =zX3 @zɾ~dp]]C~7yNsCwΣoǔ|(s18K1愻Zj$3s{baT 4=~22W|,PDgy"/?#'+Mْ7Qv$F%y~03IW^ȧr>[e$ӋzI^+Q*<嘤v62/4$L ^ysGc"翙dui-bʀ~VF>624eUӓ2^GACnuvk _Ј4[%^#o+/8Dzfmt>#|QIi…ny4PqAwsjZaOn {rV[&GO$fF vpwn}妊"h+8+>.+ l?)B*Q# ]gM{ZL;E $k~y99|zgzkLLsĖGɳ?lf/w/L#κyiY8aw(-2/NS :"~=^95*x3o2Sv}\ t&>pzSC==g͎yp#Sϒ8\YLk+g1-hWg]97l6li2s :JcΩR,K~>/69ڞ|7py~ߕ{wg~,ߟ ]\.lߕ~Wf];ALg3nss6o{t6oW6%\8M]t)X'fV>,icKbL{"볙`mVZ~R65;eΐX^/kbWbm^Ax-11@oiF6[ .WY'bmJcaøI[=as竄OtunK޷Q}Q|4l #?~%%W<Ii)~#{ 7̑qsg u&|G} 䣡rn|ҟS9Jx`|οrTLgކ/`_/m+%|e k?>? F/ ?'-j2-W?cCkDx5\Οx)b9!1W |rƆ?3Z""4kp~{rOCobn3ndρ\o_)|E/sn酮qpŎ`r穄okQO9Zp§ Fn-32iPlŷ]T]S[û{)h;Yy gp 73TqZsiLjUVrʬE̺R[Lo^6J|!gC1W F |>yҷH=߂: S+L+"NAeCw++OwHT"okGs|S9@r #ycm]'Ӭ^RYwy io˦+3#^ y c(8{ U ަڴ=߿ oKx:J2 a~O!9Ux]a~/¶G+%>ʱU}1@|fS0h:;u*FΟu<{b < @5~65:TSr@o1\x& D Ƨ.tx|bCŸqCGŸx/B՗!zqg\o~ɮ n.w蹰W懐y2+o-`𝽪gXU-;*}:JWe=F9}`+*vۿBoloǦOrGtl+GqU͓կTY@Qy/ {'t{-"EG~EߐDoz>[]AkY7V{ۗc_z^0: ߣ~ŸQh%Z]O _E~iLw]䗾\ wعC~^ K7Ik8JF}|VAn@U)lWڌ\k"״%9*Gk"7Zjvlxihk3,9.2WM42|xEo̞Z z% F t#yE*U0ɹ~ W?ֆq f\#x٧FV\,`m9'\v/`;!S|`ІVk\GھP]CkV.UA3I/bn65},w;wKgE˨5!]C#z:5f%\#Qf`̑c\AZM X04Q79E >Uc|59Rԏ\~y6[Cɡ{T}$)oiR;l) 5u]TSق'usMMc:;wO;{72ъxMݒN[kں;~H0a- Ƙ'c`5C046ޘ Ƙ5R0\GXs}c 57q1,\nTchE>ųYSϟXKy9cĬ8ۊ:u`8|1}el=Q< k >4د(ұ&T>|YRXC1<$x07PޝPX(3B~_Z2)#ܹK Zֹ?<@,U+72B)+T)ZBMIJ =BϺB0 }tb pB#_\Ĵ ︪Z£̈́g >+,ehl=ǟ+wnog"\ _ty%_ n/̗2>\"ޗ/JxH"ŪiPG PO&]RvsԖ{QqI*]X cM.'|Hu*ֱWc9CS uXۊ3֣lRׯ/fz,V^bW~Jჾ,V3XcG_h깭s#e3/z]NV>?7o9َXo+WGyK׏Evam&ad-3sa[Դ6e50uf:yi@mwl R~`^hGm<96 loqJmwS/4v'ԨaMp=^|:ӹiK|@=C0uP$~3v o^hlu]8AL:rt:J7Nq8K;6d= : &|~IR2g{rԗ^[aN'|~},'|.w%ང Cb{IA)%S6k:ϯ 䜀\{ Ԇzz!Ϲ97/vkz)3D`ގoxnk`Gk0kr-iA{i{`{_~eag/؀!Հg`}B09/^zK0`Sh׮~GW?}vCPꇯ`O*H`fh) .3.3p#Os Y [ v~[)]N~;ұ>{`#~  }C]е.!%?A|q9b]R EᗅF=CYFS>vcoH߾وbG>FK2?7b=w#-4o=rcw#Xu~Wʷh:)U[)ؽAu]h U7C>w{QXe},[k6r禭_ Xc>;\cOϩkku'/kgL 6_ga=8oO_ flڀ;ə#lph͘4 r3,%V39/ae3߾O8 ~p"x2ω4j.p^J2¥F\% h.YH2,BY\di'J2g˳+c98-n]z'^bs>C3] :]sMv\dfb>XN?%n51PEiǨ7H#1vZ``m6(̜iтyؾz.mÍ$c:8pƘrC+j1/gc% em^߂c@t:1%\/&-Xg~K_8J!ւ@Ւ㈀_,h:ź-9'~3cnW M}[RǴ1EnLgjg#KZ @X5sJUTMSڳyyuYKՇ]Ry`cԒR0m15xZ:QZ=ܫ? YWr/Fmw:[̯[u2~ݥlv+j{Ȝo*U=%_/AVz.ƼOV,α*6j/^+saLQ8~Њퟰ^o6X/ /}V" p+#1R[sTzߊL[qH;oU0N1R?&tA\C0s s`Y!s󂐵^됵>w9L &cq~!g3hkXق!Uo-2:!5n-뗘C[VO~5L5D\k|klzk-AZqZL[GmeZB:E0dZ '|!v1$ k$7nO0WCƸD,irSUx5!+rc3yODhm^~{jhB4qQ0Fm?hFQ*؆{.:Ip6ah9Fi6|6ٚ3@Q0Wac}v$V;HËՏg0+?&>QֆN4츘b&#̕2\S苧R2SMMO70H>3.4N3* owYA;w̥+y#r~v?}pWo,<ׄG ?cEqw(ߋ=3=3'Ux͏ F; >MWu+4{6:5*\'\K0d܃u­u\]u}"|zK7Ox iug~9Qz՜g<'dg=/1m 3o.gu-9ϗNɯ+GS;XA2cu'pZcLm6tR=N>WIy3 >.3^I[;q\a=4vS4v2U1Cv_gIu8yw Q:u6kPCz "T8w8Jʀg"ױ q`9 rk{]Y=Kr)^\/s 잋/ 1޻*`Cе_ó[,¶t1Exϖ=052V˻pKв/Zv\3pj{xC]G*g7K_\Eyۺ(|`y6o l`cO~j֘]y]oU+w/No{6ʺeϯ+'Ӷ.]uYwxb$|$»r$<+$|7U]9§UvUコ{o骾AwЧʞJke7XnW֧aԕXC22 0[bM|MS[v5uց]1_|Rw7 $#Oۍcxb1ww žvF|̈́{^vO79 T7oyM0[>𷂱&3s{.ju˽D n@cwYuÌxӻwX\I̬!Ș[7CgCdgX@F|&2i==^qg qBY,C"7}w>0c,>#r.T@v]uW9*${F%Ot>'?kd {.[({p^!{|+c(Yj)L3XD=SRՏ(1_ב E}o>‡s=l_J YʹJ0Y˭|V -e-N2Fh^ީ V=WnGܿ Jpw2u7hjnH2ugMb&Ws=ֱeN0eH-V)seo%[&'e23%4zyg<{ Gc78XvURc g^ d߯f}DWA_@WT{*qLո> yVy>J×ѳ?ߦ><|QN/^U}ؿě76ꣾh| ęQ0䋷CX0oCE0LK52J$`L7P?m~C5,1,ytPCH6,/}W&|g_P}9VG ב:_M›o>|Y4}wˣ&m/d R?OAhO1C0@ X|\ܛDฟ@N~JS~.hۚ~Z|8x>3=+y`~ {Oԓvki~[zo䇃rx@0t|E ::y5WtI7z$L⦘\oĤ0W>41%m1&V:q0|/.\[͎fICímT'SK/,*1!2z h >9|~ц8/NǙ9+]xW?|]^N_)y?εV³8"y?v{]>m2.<³W0TJk|fŏ*~.̨|I7uyE]{ 5m`l!V۶*sm焰%g ?u nϊ0F5#kDٜ9܍2Ww$&µ-f!ٿr'Rr5[;\O *2NjA8'q뉆';khIҞk!j[VSϊeFCTO܊{!j/{0G a{hЊɄK{f>MCRu+O|^ip=()˟2DR I,ɋ̫!~GLOʻ!.;~42O~U ?ѡ◄N5U[0*n&AW]yƒJ !zXF?syׯͽ$J.1u^(UCU>>zD_aɿ8?.mC[w>>逇rs}Pn#{(e=мTicץ=7J1TY :) >È> Xu8.5 Ӝl-1|i; x.k0I:9N47-oZ'|ӖaA纍qֳ9sΗk6Yg/ l7tVwf?1y˭}V@/tK7f~}2w|φLwC#c8P g2 \>d8TG'˼E˃,DŽS;\ce/h5[E8_']d )ylMtnCGN:YQm]ù?? GQ߂M??~У=棞3m9M ?$rݗs2\}><}P[#m#/l2Bu߭G>y[{*#|_/YAWCF(O)#&os}$[:Ÿyn$\?秌P^|!.vWPg.P^>C{94&x:r}k5sWNmZm4RyZT_=H);RP/x jBO/I;~9?#E-#bge7sTUw/ǍXqOh: \ MY}??{scoo{o(mVI`/`g] _q}x}oMWXO?14%#Uf| }f{:RcWT#Sϯ_] 133:JG(.xz8t҉CG]QJ'd_ 07c-$V˽7'z ({y1~%A.SdG47򾢉c3S pkgOOl\4ճßY@{'7Jɭʓ7ywgvKC}M8#tӥhw8t4ṣΣy<=lS2sbN8ם1N̯aR0o њњvݢ}[};}{}Gc{ m Ÿ!_D_l%[cws I8L8Z;Fb91?4v"=nr==_#`'%x/ύ"_8XmeX*7C*tk/>cEwB h™ [80#b ฅkr -'EtGMy~8݄9Qm#\"mrA/B։ܟh}%OǤUDյGk6Qy3(c"n&K$^Nt-ky$)o 7?oX_: |NRڸ$_\$uz,N]#?c$頯> Wi`? dO>Yg%5d| ${[ɺuю56\0<2WZWIܷ(q: 꼖%v6V3G"T#*{reo:v*Әw[ ϒ=n\Ǽ;/'*S7Se3U~ʢwT*Z_N;0걷g}/Ii l6_,KkRہCfgNźBY\X΃g{ň7Bgr='|<}xtjF/yLc޾$uB`#:[}֜w2Xu]l@j_/mn>[Xfg$=[c>w&FN}g`Аo(b`Mlr hхu_7[DfL{gKvݍTﻳuBo5lÉ9jo+X.Ɲ P78-ۻrWeScC;Noۭfߋ9: .7#Kz[wɼN鯡K~9ڏ ? u.(wQMLG樜#xu,}ÉsYO< <;R%Uۂ;\{t/U~->׹ʓe~`M)?U0|u ƞ=Z0{ \(tpFW?hW?\oqoƣ}qƣ} LGL,GQT؇nI(~Bn_ ?(u'90kU'U4cڀnBj=9 Ge)~;o~L}|ǀX1F"SYfoˎ]~x=>3_~_"=o={__H/P{ trjKFµ{@Z~͝-`=;hU¯^ q<!u5o%v{jFSU)0Zguu0/фߑO$ܨ<>uLrүkúo:OCkf`y!|b4;KM/(olwk\n7/нj#{`ڑ=@u/P3)cο y7w[i = e))S/}8a/_kһ`"w,Rz"Ke~UcWZLUq5Փ()1m%96r"u{4z=f/-[6/JhJ{k-Lb;cl#>.L3ʵ{&-# &ؠI˸Чe˘/Y&4牄^|2ͅz2w\o# _1qR3f~k=Cxr]Ż\cٽ8zr'} ཫ _/Y`$Pa捸+X0¯IfPs9d=o쎂6 ewFRQ.M7ty`Ióʬ]J\N|6`~`r|&xS;/K򼼀 YOrЬ店CmǵƼw?ϴ1%S=^Zr;?6`o{qdHsekwӿMRWpך2u:y~,9Y*K1-{Ir%r3^<~Q52Fń5$AhG3v1pcZnR3V:>dCnRŐ[J}_YtUd'^U:R#iɚ;ϟy~zH%|GY# sӷ q[~N0jw\Q# cFK{._ݬ ݺ0LSfj]#9 @gVv}sď0xj}sYUvX,mp=+Y7x ~"čw+D&zDʳNZvVsWNc|bZ|Q` _5e ٤=Yn>4xws}D67쏯y^*߹Z}oX/1әUehoy.xz1Y93LG5^_0Z0xh`:T/'Ԯ~k\]Aq _'|k?\3rO]W?\'#{dvԉ4 $*Dj`/AWu N':iLtuI:W'`Q6#k3k!M/ _dߗ# W!|e[_W1תIr1_JHKx_5~\Nxױҷ%| Ԝ)Ӏ7K -p Ki3&#%H5r/.\N5?u=[u\ǧ:qS:qӳ)Yk ?&2 R ӷl*M??XRW3L1rGw{ױmjʃ7TTw~VxŇSxySu{Ny)C9~^y*6X2`zػ׫ Y0^^Hy!t\̭76x=xyk͵ 6~1ן5)v<_+[/t>q :d]Ag]]_|_Jc^Nrc^9kϗu3ےxS _$\Oy>^%|noWʈSg9zїQu81E_AbAaݠ~!M6-#^9跾J6? t{aAyr%-a]򾠑IXpoF ncrGu7{.THj^96ȍ:nT[3CQc;mvx.vwF+gʮs6r6|ߨާ7kKv{u| m>?6x7mSe&d#ߖd;j׆i|d&zMW'#ԏ#};aԎb12WWow۸IiE: 7g~A;wV\IG*'7\T!Ϣ4VͧjxHdDŽ32lCmV~=YiA6:oA?,y`ƯhY6fY_ͺ\tyR}m9pج1np[7=u* :h9ݿ,K=ǜ-ʏ-٢4H¿ ZEbS[h:^\-b?-3-z`?=-`zI-?cܷhtg-ۖg)ܒϼy[5*G,oG3ˎDeAF՗ekg7|l+c:*$7ބ^B HT4P@bb({- ޤQZ -;̙̜}~y={etcY1ד|0槜kW IϩCOO=$6a иL)I>pn㺞lDwQ߼M=ŶcpO9;a>z>T ,#:{^y*3PNsG/,'gg>B]E^׊xj^bRbE{rjHA,s^$Kb4rpߢ1VIGߋ)B I<,%vuoKBP/MV[gS7俴)a' ~h{I۪۾G5 7XuvK119 .̃~;-eoE3GW \%yBW{!tZ p÷B{ =ev}_?=]!UFP~?Iɏs{Yj`oѩ-g1cL"$IC{}H⏈Wwwt{˾8/Cz|ꀶݦh[ud^KuHR1vcGw՛~0l#G{7g؇+#;*ՇуNԇx,k!^Ju/Ec>%V!4|6H1a񻇚e; eZ')}L̐jk[z}D練[ o\ndY.n 0~GTpz+ 9g\y;N~~aS/F)W}eVpB=?1/!{y_Ԗ1}~_|3F7pQֹĻ:8/ɚWV0[q?x9u/'?MOyޗx藟E.cpWn~Tn Qgݔe/ՏPp ~l? o]USрk1nq7{!2 x6L81ϑ2n 8 {+OC(V~$c{{ڇDhi/\䃊VǥtqW|Ԙ\q'˖?{OX^/:_g_"̷BTݧ_hyi#~kmW/kimM|NcF>`3z*0œ@y lu !`7#m-Rܛ^B=WڝOƩdz15쫰0Im3@t? {,g3'|9fYvy2}Y{991@Bux2@b8nk 54qty8yzNG^1vne΃p:~l%c]7m [v 5FBqE36)# ,è`z=}^t$LGݏL*4Y'ȋ)3f $:Ad2 ^1+dKq|^5Q~5AԧĦ!_4V\kV&?Ĥa:t$< :}[zmXጱ0L$sj$뉾G1ؚwG7g i$1 猑?&JU]PFE-ozs^b+jbDLG{39o~?f,>o U9㼯yp7aʔkS>t⏦|]L{ ;Qp_3R"w3<{1Ɠ_8 <~c)y/8c3 ` zB`.w/Fz2Ac^Ç CKY'Cfr[JWXড(q["߇mEk[gIyE Ʌ׫64)!b.kuL{HcC.S7V85~ڰFa39?{1DB x5-Pjk3E'%oa>P&0}W'ԭP:B>xyrH'Ywij>T|' %\ :?=j;w(ZxW MTC{cg>Tr*ׇ]p,>;0K=S>9>GU}q} >u!;Ü'0ye~w>j)0SΫab'PQ0!K&'?uz9:L3L{L߳p96eZY~WUUU)v$XܖT3jnWrk7?b?b O٘[gls~w#Y9yqÀ/ؿ6CUz1nWEu(0W^&_:f 8#tar&:\[L9=cK18y㸿2\ل ˹2쇼n;cTN:Qvc8(37y? pp+c2_ܝ돱q>x(u 堌7zt}ۀAO: 9-FNG5'%)|;nmZf}+pɜ#n<Fsc|2|[7zӻdzYzYVgl+*߱^٦#w;h5!gG6\|ۍ(vA(g׊>.ʞF0Qo x6={);@2ƻv~XLu;@݌Q-q@uн`ҁ柚t?EI;Pe\ ߑK|wY3ʿ~m$A}#y܁*1i4aw( >ܕ1<1[:1,gn溡rc?c8a 2cɏudcT"6W42j=(nc3gMpǴ ngh9= =^wGYO^rf?P%A)Bn~#BIn,RXʴwBWG̏~{4&j]-2vѼr”;4N̤{BY6h_~}y?<ƷϷR~J͸hٳ&6P%yS%yN!}2JR9^ތ[O-cpN_83QǷ32>ɪꙍUks kb}Pu[NU(ƷT+r:1u#s13켿CBE^x0Z/l|.66y ~+sDh[5O34i o o3j{$붿kKwe,͋~Tc"=s,KvT+Ɗ?c%Vo+ʹ,yV Ye?zwwC_>{{^Azu>_' >8wwdvC|gwh\&8fb=brdJ*LBq9jp{٬/]V-oN#צqNMs-&jͨG3ٽz30Ϳ>{_=mֳ@=zd<;z^as42shkc/7]!~xUxvG;Y۔L;ݢkkNNstSM9u:ͩ)iNM9uf:ͩ4r͠9 S̠9iͩQ3hNAs SwfP["|+8ؓɷu|hҶfׄL4|ݡ+)zW?wq Ҳ鸙v =w̚It눥69$2vL3n$=1L3n$}16dm,Lzwsa=lXr%v-YYB8jϢ5Ek5v_", N@'+O]wW5k4KsU>~WuLK)~9Ϝ*L8UMfݘ%4|}Z6<>K?;h(l \=Dơ,g_+~W TnUUP{T}u;7ԻYoYq./w M*Cv܅sJ>'YM).:һfK~DX΃7OI"$<.hZ5guqy1ny"MEyfs:P Lyt\781(̓14O댱qcR<}XϘF̧|;?J5W7yRH};LT.8_lϧxW`5Wʸdv鰧u:R`zp9ƍSPӛ[ x|-9'oh~/ީm[ GIuxlӮ{v2ي26ﻄ. ]VA*q|7KhSc[ {e,_e|{|c'Uv2~|:< puutHqNdz7p,Su=֧`O.Ú\Xew"7Ǧ_ me݇gc.ڒ.]\dmಟa=|c"7?Qtaa:ϧ{%UK!cn9+c6Ghf.}g.펅:>b1壼r(~iJL{ ;Oc=S/ui/B9,P|+_w<"s9[#]t :g0Elk7u^B?5 VyC>koŷ OE6uw2$CES_p+S$0T` kS5| wrV%W=o"U|)1-=7y!{;|:+~¿i9ov\ _$v?9dXb%ݰH/.?0O` wI׹O.o~mEgϒY#yFt0}$|7G>xK,>Qn18S?X=#t1~(b^S xP~y'_L4<`5c| o1b>WFn]\tz \t17W<ݛ.Bq~$.ww3x~7p~<BH8wEs<_Ya|4/R?_*:N c?blTnnOZwT-%r2w-Ɍż#v)v#lX*qw11:bұR *۫KvR=_Ʊ3$zH_YGmqy2 }m/fE*\8m/0/<ێxAQZmb#ofAC!Tw+I5|ˮ{J4\KpLI8Ng 1%xw>LWe>fzro13F: _Ny/8Yk}pXZPkGxU,rٿXw;>q*$d}_g u.=h'`hCfF:L6b35f>AE˓ګq%&s%YzKoHhK ۗ {gHi/%>wSks}//pw/|\HXq L^^.Jj_LzQK>ywT:!!Er\)|ڒd|ƪ8>c8K}_9&5rZ#ڳc|Kg |;8}9<Wp/E|hcKvȭ>ܲB` >d}Wͫ}>BwPlf+?sd\)mym%ZR쥫d+Q^Wƭly,J붓+giMLV .)VJX3> Sf1ergXO|BĞ/+~sBfF^|%+9F*ZKr"yU\EfɎV6z}*];VZE6:V>^E6:${\Mr]tj&{N^sj\Y-SOr[/>s)a5p.=]Mf5Gp%p_bX{/j.p9iзyzj{K~vY͔Yz OJo:ePg M5r\N\k'<=9~OLDu"q  Koý5]YkA{ ͏4fTgǃ54?=J"?6|CڵvZ16NX~6Hd΀3 "kk| )ϓk/x2ZXEh144pN\UW% mG#9ۭX4(N19dsc_ m[ǵd_Gu 8UsPw\8e<+:uoL_.>sKɵm5]f{"n1z{pzϊ32\f&9f1ySgy|7|N߲Cy;ʋyCQ}p. p0n&./ eEa3težc cG_uScX/szn,ǦC/ra{ 1rZyE%ݏ4܏f;wLe3yP3ym$ySn]ϜV}ԹU9P[c?bV ,x:o5zTS>Ur)}6Ș\7.Ok~iW΃c>cZ~ '~˟.sc,sc,c\'1?FК6Za6.L}khnX^hhrmEs{l$;lo㍢boh(:#7PrIiLQn x+go;nލ[(uwPu%-c^pqhU{覣f8ZkQj0:oN[a{>iمqj$8qbw$Fgp=՝Mp}y6VGɳ8m",&Gh;?A4S<3y7|.IܜiM?ǩ67to(OP U/$6Tڶ I|L!ћ҉Dg6q4ZX6 :lY!]_)MH7\Jxrf<[89(g:큩3g\fŧ[f+yLV<b pzW5+#]Iǽ`rLոE//O[,thEoH'»?UϚ ~L2z{|Yt6K^as}wz_*}4 x:y->3.?g ]~7կ%8˸(lܝ>>6ZB'O\tv um#9~g-|+=1G-o^Wtp dk8J.;ҿ<g[h,û_o-޶(%c3 -7c.B~gt ߛ;` P`3VjGN[w.Ļt]م.8 nye˒{$QG'×6m`5q—h2V~xM!x cY;gG<pv#9{ /^$Y@?N>e~N/fs{ o{nSǒg|eּ>wk'%Yy\?ZgSȚp;-=K}wq pe6|귝 xy.<2} #?yy]4hE;+jzNsu'^<0ѽ+#c9wڳ=[WΫ qP>!m1\fc4gi 3v ] $]a~:5` y7j;cGTrߘ/vfl퍍a19 yxvʙYtu@''sX Rssz2zP ʏ>߂oc 3.u&;W :?2c7L{C#{ࢼIk'{q']ζΪz謺.wѺ5g񕭻gvY]Dwәhs5tV=|7D+wYId7UgCJ{(P=DcCPlE{(Ё=[-z-G ԅPlB eU[^-^Ez^+Noal}d>| vvi4B^'c=`}2G}_^Ok~y> Gt\)d>/N5il9@E?ShIrrym/Y ͳ_0w_߯Lk{ճnW’\Q:aIڠSV/q{~`|o;7~Q1rܗ:i?0Ϝ?ñ/wgib?ccy\/ ^#'T?de,x7x@dd)x@֘d}-w@JȽ2UNs@tMN9l;H$^q!Yt@Zeɔx)Crby|7Cg?; נ\>0ƨM5A9PΡ3EAAcAAA֔Asibm|M@s3a|<$z==☏1'a BPՔCS>OL]l}H.~o)pwS>|<6h<ݔĻȔx)&S>ݦ|MfXJ^[Ks*}C>];DkҿPCrOC,!aXWq(yX}CkC7zm~d;F\esqec[^l90F]j:2j  ꟃ*W*c䗏>&%U#d[7@1z11=qf?-;[Y o)DS>m7_|jʇ|Kwˇ QQQE| 6_) S>|LqhyvA81Fy:c0Fyc;3Fy)(S>|ٔx)>S>|MQ61NĢc|c0Fؒ16|`L[dߔ)=S 7l\>쌑`2c <؎1ʃ<81ʃMWo3:d|Ɣ)C3=Ns23Wgtәb>SO> 474ϻ}|\C+54;随>rnl-[+ysrltIYgw8x|6 ZwΓ~Ν}YIn'e_悅6aͬȴ"G櫲:ԨCij4&6Nw·D/sJdqmVίc#rS3"7>#rS3"79#rӘ3"7M?#rӒ3"7ŝiNxrƋJ<EV/"+YCJEV/xŋ.^d}"+YxgAhcփvإi;<+Ίkr}i}ܬUM\gvel/f1J\M g`;ϊu߀@=Qs[|uF*9¨_ ?m0 ~MN ~7ŀeg59A 8c_.FoƩ+/>G.}ŏ"# H߅r_umr\`"O(GEhwA ',g/1E@o-1LR~GMkoIV2>cޯqdW9S~~",È]ܴs7M;u/%h姍m<&D_zxvD#]ttCz\b_U7~HH/:n;:mÎ1kc_.ܝ p+$Ŀa4Ʃ/fx WBs$1NoN`s'GC:kc**88cGeUW` ]0Wc\x4-Z!\f4k|%]w!8Nx1༌`|p?,1qp߅!pLC̷6^aʯ5>8p<&X&ˀ[b_}</؟` 5'<Bc?zG6m_;^ׄ&|5{р;3m?--\[^5-:\٢55OLxV5<׍rzz)o6:Օ;<tMb;pE-a/&bk$mFg{5W6Nr ֗]B{$&vIG|ش?<ě4g.x^M̌dYSlgB\Q>Y($D\HgVH}=]RrW3|_:w]\3:ׁ.vݡ>.곰Ʃ/̣OT88Tq7Nv|1~ײTU@ o;O,W>7;m|[?_g-ϖ{3b c?OxuvSx.Ao%Ȝ*)yUe#Waw;"G[ *#\Fo Կ|y7 _P}W( u^fwM:⟹ '=D'4f%\lT{e+@JksQzZە^y'TyYG } dbLI!mNjқexKe/doKK~މ5s7I&@JjpwW͉*XC?߼yu79(x.UR@l]<1kmǫUG*mKM3c^s@q/}[݅7Mc09b GU.!ckX7us{Z*]cGo$]LkooltMGnSdVA-~nbĬy 8Oשg\mXs12F%ލ,P}Iuco[*MV;IQWc{[whZ}spsz('s72sQp;-|]O{f_L:#CO<4W)x$gQu.xX 9w8~1X$>ךz6q 2MԞOcPE<2'yΉ8mvߡ9{C {xxX1O<5Vqjp|.ߑy>\8 87G ?6us`?e:2~ob&>35s2yDw 󙟆/[p>a ?` pmEs?1FZz1Eֻ/~ğg9>m!FS:Ǿ6}M|ȴejr=ߴEKQ_ּ$w*i~)ߗ38m'aƨ;yyοXccO8Y'u"8YM<'SWנc qM$xa5g8sz4>1T+̯wϩS+*VO|p@ș_bOSܚNxތQ=f>u|o-̓)o~ ~;O(󸪃gh@s&b}}_y ~>M(>σ~~}0g&CLx!Pi|(4q8?sA\y T?txč {wVqBWxsOvby~O"Pt|i +VIdz*O߇r2حNx(v3rl~(1xHv\8b{1oc\k1Ɔ="1 iIWoG'# z$&s6i)!1LwLK뛺+YY~xc'_InΤry~3Hx> ӿuܱn#|"C/BfCSyJr:Ia.?mz˧bSw9{-,P<gS_ZTv#yc'apN5GJujMXIzD,yC_cUŪrW>J}|۲ 'O>6T,3p q eR8p ː1 ^e*GZ;T+4&4 >9^ }ob>6qiƎUQ2$ܬ5ip Rў:ў:pEsh@)%р?6I p[Cwf/ŀ0<+Ƿ'>a|` рRp=v8ބk Fq_㾔pIƎvb=Sຌqvh Gx+ՏvS&O.bېNAmɳ1{w7}NK)-S&ীwcC?ox`9c,p4`tTl_&`\v:Hta3.XހQ6@ujb9=j(_/șOrn{l I)y0 ACG8JtZ:/}mR^ޙl<㞤PKr~߻+&:Wٞ9g- +[8 PrI%CxrvNCB~ ް`#s`lA׶ɌfxKgڶ.3QԺJW;mWc|=m"!ؽmTt!ǥ zcmG&m3Q=XLQƘf3Q7V;ؙ(%oh_/~9q`3y/`'?q~L0 ]i{pP` ˸{!T.Ͼ<ѕ=V=S?y2|9@h>H7ΧױǴ"hqD~ʃrhا?a{*G_]C3Nv(&8pgN/;ƆX4bg)^<~/ęhh-8rX~8Km:64OT(5뜈ey^-,}Ծ,JRhso*39~m %z#8OXPLƾpyax6ۘ6l 6H?@ΓkU||72fQJu#g>v9KY\y٤L<8'+Էin6Vu༜nv3:ΦL]N@\+.z {EpU@տ 㖪>.dcO_(3L1;`w2Fƻ.g6~.;S8x"kbPjWriqoRt˙~ȳhc9g]4籜K.ȧoD{1+ĉ ˌs&ڧ >*B(Ful1W #"$֨oh=䐑aV}ێ a$Uu߱lӭv)'K*7FngX13\,c<׬u5c/z:15񢏷5>kUn UVmVu`ݎr~i=؇2c31c8ci~,;h)ES;=yvnG:Wܬ})'ҝR:`7jso="[tl;>x~q{+|1Rj~*}g,MCm>JA6 v=P}>F1h{Z<^g]D&J^| &t%,i*>kkUW`^gd?<#e6bi=t2:#Mlᵭ]}fbDs.ѵ^p|ॺm-Մ߻oD+^ك1vpxӆ7+cnI/kpq]cmNGĸ_1Ƹ1|2Ȁ 0B'M<ݔmnmhp|U3.7wϗ}>H wQsFqȫӀpY㮅<!AL#x9#HCZ )tY߻JF|D9DzW˖_F!u6]#Φfj_8ϼpϼT߼{|շL_z:M~J5{;wUF[ơ/)C.2w~'n׮yZWܜߙ ݭ ,<ܚi7}*k/扅z\cG/ SIm$O`#y:Ɏjvbq*go` 6-R9v_љ&W*Fgʿ*̽q׉žTDYH*7R);!MGPjcx3rrj m2RKn-T(;S;)?7eR;mwYt.'{.Ǖ~fY-5ϰZ{7=| (n{pE}S'Mޤ/& _(*> iM xc3#3^l9\:&f~$5 ~P~gzM-s#[4NǎP:ICRc2ZaΞFtƮ %('3R(ƙs&c|Rѯw$`S 6=}T@|j `4`l'7ݚNsdۤ!(񻸿{ʟ Scfd 4/@'j);r cڃb^2?Tj~AIOOf<.vhsz^5}Sӈgq5 c_Ƈ1cCHZ(kILVh`ZN4c^GG0qM~ =6O3Z%XZiEd Ę7F2]vO:,əNE߿kh9't/_>O'miS#/`ΪDZC/46擽qH75,Pm_ ϋ2MnK_u>*|:g~Z:dMI\S_T:Fr_ x׿~[TUgY53oRZ8gzO_ } <>>$ |e!yNo@L x_zu)O cP!۟NOk hZg-XG7)8oOyVշNO̯n,ngg֤'{?`޸#s{ӿ5cØz>Qj]wSoDQJOʤ:ǥuʗj\s vHM6 hd D!ɔSҫ3Gz ;@# NJ ?:5Q^GΌuW+f{^aF8ouC 2!L+21 Den2-Nn%Ke{*OsEWyI!|7{&z gr&{af*)IXv1ʙgz]2od#vc&U9U9_;)l>g̙+x#>x*.s43O6ݣ<>_g?6P ,vPfhK//0;2]' `- sYW,ޤmYt9k}Wf 2 Oh c_,lgc#`&GHYD+&ǫHFϬCe:>$6xO_GHQDS"-c~$ *m+PY2%t&|zy%RtGfk*:ܡ:[z__ )ŗ u[?Sgq&9pXmއ^o^( KeGrpi[YffY/p<͇(5r1>]X?$!=w8QpԻU.*۽hK5p&ƞjCt#^wr8~CƱ#v^(.NpqܟXfgCr=631(IِM O!x!`kYJ?9~Jϑ !sH h|X8;SnHdϸl`-Is55w>QsNƱ)Y)kjDV+'鮐)[]2 PWtgUrҚ  ˅ȅ> JO|N?Otos90@򜶐1jX-}+tu^jʇ^6|I9c߆Dsx2s:]I}g9r:<Q\EhcK~^;v2&yJ\E{9ޢdlQv2[W1y4yOQCAVD\Qu6E2(Lu~-\D|.9yUrj|㴎"~_clnLmz&lP.\>=f1F4WH.gGn̲^.l%n^24/~MsFh\a碁@so;Q^.һw^0ƾrԯxNxB.>, y4Ǻ*[?1 {5 @jd׆I=usztYwnezs~z=:& dvn/Ks;}cz[韯蟯Z2^[r |)Y?G!1#͜ܔuxNko6?Ж6jFV4p;n3 #~1K/LT": Xr?*~]]68& ~y5C?pƀ볞<ߑy~j9; ^HqƱyNoȺm]\(S28kwlw<Y>* D>/`{3c^wW뾿z,nmϻ,k29nǪbOUTCYNh{.H{pW=[{1:фߵ FX>hnm1;FphG4E8N?<I>;-?5 1v!hwT!?ܵ a~9m\NN\&@];?*gZ~Y7ͽ%f[}:Aތ `2E@eZAC$=O^$-@9e yN]WdX@d?w{f2yt~m`n`'A?zy4d~)9[x ?_1; x3g0xǀ^]A|"W Ug˂֥f^.L#:؉j[Bavr~,' >Y{(9B'$K; Q%tBBBo{S, *bAEAQ, gfo湻P>o^/ϖٙٓG4x*Sظ?>%gY6g߰,r.)|=UcJ{7P~g ~xx}@Jy Kn̺opڌ=hx{^e_v3i[sz@;˻Ə`91ΑqT*ȱ QB[H DCx' k*cll_9@Ԓ?/ZTH֌8W 2wO{iH ("t̃"./xxY7Qeh5kQm<*)2M~㷊oO)Imc4*WئĤ5^Gp:Nz'בEiπQTxZRQKVT|?gl-Yw?mS3l}m_zL*|zaM{KEg~:݅ρM w;xP$|vܱK99s\zk.<5ԥW1#PNۉcYb?ScL,ǸDs?d8f=8n%2}j:h(dŞ-G)yzXuZťL-w RDŅnJkj-Nxc?9oSzKA7 q1cl1 ow{ظڲXp`lϿ2;ϟ _O?^ nOl$ŪZIP.QkJTryR喒}wcw2&m* LO J=9~_RNyv.Em6ďr|)9X彷p`soR)H */pr"KCT?/%myX)`:MW:o2Zt`nT:Ŗ~r -da-?ϔ)!<U닋B)XeӀM)M|Ŷ3<c).-_JQxwJwhb.\mHD|n%4JƩEDI#?y$°79*y>EzLK\E%g3 oGI K_nqξЭ(ً%F^4}Zı o-iKt=-g!R<0sW)Z6m\ic\h9'5ZIsL~3|䇺y}Dx^\*Vgۋ|R&gd̳zT&pև1eS^ \WRTwoqy 4@dC T=nѴs: Rt5cA9Je|Jocfl#cRYEY?)/+1](+1].ˉoh9钥[Nb*']Js:_T(GECѮS>3h OH2m澝8FbU 췅]r9 [jf>n7ڍV⸥+tmXRb*lsSvjng\5*Os{܁Ҷ埭?lsL:A˧:?e ]躯-dGo=\^lyч+/1tΗ"]-/;}v%]/1)yP^*\~ {*qsB-'zWLVbM*O_3~>4r7sҩB47 U6~"7ؗfU\Ykm>gvUyx!ӻ8*cBY}6_g)*2=GE8no W$KfݠGWd<ZbX3#C2F7fH#Xf[1廤ݽc4#+\Usk{P쳠ܖO ˠzmEoc u%9RI/VE9+13ƱkP]?EV%؝Q/՟񏀇q9Hظ3JH+{ob|co2. (}uh;-߮$}kUxSO^Uk<*{,ʀZ *ZI!NANЌTx]ytPZ)|>} JxXeŕE_,nb\Y|jݿg~`*Kӕ|e5\Y1,g?Kϵ|KEOiuz)ӔccX(Io +ջ sZċs"U$B*ϦhTޮY,Q%?*UPrW?=o| mx/Xsǖsߪ"%uU󯁶|ȺPHܷlwyzy'%|gJ/07Wwr9+=}4<({rlnoi>([U}\nYzU}Ъ.3g9_{Ue^T_k_Aw(D o|u*C5mXNzEgݩ8~?T93'B-tkV=8)?/|Pbb;wUILc}\Mt_~t\7b(+C{,C5sC?˾3|?Ϊ>zp}0𛀻7E ^!|.) a!j9k>Fښu_q0 C{x<7/|)y?+!DgiS:JXuJG:"c63g^B}2p *zʫ*Yg@[_wC^]]5\yӱc~lc×tlG yV"ԙ~s j s6u.<5iy2l6:pKuMoPY5J/ 9ohFo겦G,eϢ/:e^MpSyO!gej_}^-·|%P}i,>n^:k֧d-cmvpY gq!g,{B5dO kv =?9O2'Ydƫ۽+:]WCbn!R5$fݙjRC*o 6U.\s?jZ b'uŠ~1_3)WWr[uU7loTŚO;wIњb.QSۥk:cX5*czt;]Mѯt~5]~tH5v;jN)5en95/cp~Mie.TjlugJ~6z6m5%ɚ"8^T:W('.'D Aͼ? pZBw⼑9:`-nlo8`3jIj$NdZrfZ2-jCZQ^b'z5q͚׬%q^[hw0ބ2F潀/".wjݎ7kݎ" ԉ=rP?v0=`WVצ6QNbmkDlתMcnX6cwͶ - O^X#`cgl2>4+ƎkO~5d )' >emk6s և?ѐaOc'[OuQ"UP? 4㈵1h;lD-Cc4y:]Gum] P]+ u^_e^U65VUϼ>7-u(SyWxCH_cunb@t0ط G :b?_g*n^Gd_ȝ??~X`늟.|"?,u%h^ƨ/xxޅ|׮.ƥ-uQphVN^S.- uE*"\:0 p i?V.T:)Ka]{o%I[f ue|\6TY9ѻ&oy-{=!j+:ugBcV'w[6 *Sz".eyu!.Ĕ_-i?:Ĩ<s/`szbZOl z]=Ygדu4rD`ZB(MR\ pP˩_qY/\\rW|3kqQ鵷 XW2(^gHUzW}hyZ":.k2\5,Ƹ^/6xu1ڶ`Ds5 cm} |e~?LaQuB)ʋqOs)pWpSNxe9ڍF3Fc*XV2ICP]x7O>3iL[ }p#c47||>sl]y4iiM'Lrj!kb~0)C]Gj st(z\Is=~y2/w6xYCi ke8/m qk@vT5ʼ|ȹ/2F9tCsc[2n(&pP7C@fRC_y IE^ ˼%vi(i/6;vC04!OTu!AdlDur7:\PݗӈK׈t<5":nH YûMӯƿsS^ (D@FbCE.kg;΃/_f785F"<! XbCwam ;r5s:.y*3~cM mi,͏~6G64r&0iô9t09/j,<vӍl<}J<}mcecN |ygc٩(c&̯ vnw\/j,׍e]7v}ǟ|pwuҒrP54<:Tɣ=h6*=o`~(d\8cgp_5>A(o6)΁M^P[ˬD2Dt%خ܇ѽMN20HJ48.ht.Lep#uG05[ơބK$Mv#mo":wH싏HkNؚy Ny4u&MSW7%)=k`V#B5ҧݣ|l bɠcЪxw_.5s.M7UzFc\WU}l&=Joҋ឵.&i*{rMej7u38fq{4Cξi`]LL~ԷނlAnY+<̇E~NA_췼x>}_ksy~ [XMnV}ԧ7ߖI+ ޣqbsg55t)o75AIܷo^}9e$b"C JGBxquoFYF9eEt7&O$[k%ZlUu[5lׂQeB΁o!2~_W~렬O!= GB^ul[g.9Ϸ= q.w̷q+88 ^oIz%-Y x ` |7@h[?ȷKͩ=-E-m9#v\ܻ"~-}l[3*:wO $y;[x*cc?R3ye4ߌ7?s[;m+9J|sɼ.+a9Er!FCNxwĈcV.w_:D]Cgm?cW|Ux%IKq<3m5:׆|Y/;1=o =/ۈ-}T!"=wAegzijAmmſ-{[g|P'Q/B\kS-wͶ߯R=Nm>> mEޙ4{y[/>x֖hlo[ |~,c\~V7ۊ~>n.#ۉ'7XSqYq>8ǤW>^;.ikY'XAX[mXj+c&/sۛANy-1DNޞY?# ZvQ:Qz{eI}/+cbdc9o'㾴܂ۻˎr/Ne71]XQ;#v2_X|KC>h#fvAx';N֫NȞƒy !yU9ytD}זmtEۋ(=Y+p"!y)}l4RlŦq|?W' x-nWnU9;&ɯ6dl˸P9-=ݛny{O}t yrK#G [d'@\5z.c,7z;<3 8rp>}c\esƨ}L8:b`9Ӎ'qw5,k1|wO򟚓Ϲ& ۏxN@ql\puoC >];ȹW I/ 3w5r}s)t|9dg*v4팇fVpZ鋈8]#]?uQ?3洏;+5?8rSx F 3!w| p&7Y<ޅeLX˼cj,᎐~Ϲ/= U7ZCfccyMC_X%ԋ&rg},˱иӸɯCȗsP%{c_q:;X3ls 1Ik8X8VJˇ"(8g|"N!N_'&ق9ρWCzaNC[Q:n2#\//i܋DUNRDv&\j.9` ʷ8eFxjq.7،Dz\fv3;pnnygv}bGwspd.,~ѡeL}[IerSV妗7,}۶36̦73u3 jc˹SJT^_T}t`FNXb*e:Ȟ;:4βm,|NUd'vq~q;V,^Wq_ߎu>[Xng~,v .|w\L4nk,Ex؋,6绰..o3V CcWKuaZ~^)oBE;S:ՃZzo~o^fRw5"~}7gˣ۫\r3% =4 ]hXۅo|q}Յd+]W~GvQ%cw,'P ![ex2:x|i&K|) ϛ{.Y; ]`=Ӷ{ t]%nrϬUaUhr cѢ:nuUts(bYflQTӮR[-!qgcW|8G\W\*ɧ]emWy+T)ǿ>7Kjߞs{1k7: jǟM<O"F^Tg056?j2nՍӱRYFs{Yov3m*g{j[Fn0XX>cgw}B+c}6{{{wwx]'~_xNc/cW\f_%Ź~Ʈc|[;TY|Z?u#vMtt0ams;}\|pUdd溛|N_ WgXS>\XccyN=ǻ&,{p01>C1=΁~j[8޵޿V;)dG{ǧS('!][s*|كזzbqAqw(?(?s|a>΃%89]cioO Z#;$8>'N/[D.9'rɩ8KލSS}YxyΤ^/(|UؒoQ%˚H:?܇GGWU;SnA9>>9`Sd%{\DPb}?ӒY+4Vsf#K!9VSۛ-}slӋ㳝¬8'{s#{vJ/.,"17 i)+A4O 8%zV.*B]Loًd) ԛGaH-wNgluc,M1@u5vR:+9 xy!ޢǹ[~-{4}dчZgޑO2uʠ۹vwu=xauɪ:POi>6#ks9bډu E5~7Urn!>pIeadE#W7>DO@9^2vy>l43G%qy4L3|)9k}~Oݗޅ!ic|6zɾgYϹҾieoXӻ ugr}.^X0$m ?n]1o}^Z_-k}p)gUSsYWMU֏cRN/ xX[j?u+ƷF?W'H\~гCnL?ڛuCخޯe~d` GuXfXϽ췐l?ZE٫מ}޷^| ps79#nW \i7NA<NI~z K[UөV)GxCIoϚY4 ߺCH Oy 07?/rɇͶ7k9wTkXB=@s ݜ%³Η:?yạS?*v į };yC~H$F)_'Az6`k/Y94Αc9') xMj;"@Y^`{)?>ь1F٧c_:0ƽEƸu6& iHgXnQ:wpX ?OyyƯᗁ2S92HtFN_5>+̲ ;?Hl Ck ( ڽz{A{8ṿiArz 9{ӱ];#:x"A2g1^kVe;63׋5w1cj]/OvS`繩w'>0XΎG3?Ύ}hP6>GѢrNCկ*fBe{r_ԿO>&ٴ)DNU% ,J#J?y?IA|i(.i[@!½#_0EGRXHζ뢌. eY7ap[`\Pax:㺀2nx㖀2q|p0ǘތD2a >Mxy6/6cPK8M^p(:x5/#hclڝxAF\1Yǻu|c\3'c(q9@ꮲ 3Bم˅?' a4q:Σs#UGn#>clCF(yRdzDؾBXƑO/~)G Y5j#Ժ\?Sm(62~262|Մ2j|*d61 u0 [3xF _9Q4c tkQe1Σ3o&Z^0d \#V^4qSjf\qC1RjZ^V}HP7GJOGHo}ȽI^E.(92=hgBj⧝B^|j^JOV:j=ˏQWF<9_mœtc|sI:J6@QnWeg>Va)k2hy>:JG~Qv'GrE38.Nagxb9Qb :rz&9yFSl`/6hyoA8K&Z3hO@Sa)}kmFga2v"e\ nt\fܟi{~qhvh=5Z]ogeÕfce-㯫m>(i9}Ǥ\Ʊgٵ Pa=2.6 Һ<]SnAxlch`o0cmQshU~0C2 cdiW~WLj^1t{k1FL#~rxOX9c,v w> Y$qx63N9Xu,` e(M&uU|C3΃:cɟ}oo@̧X^hukc<}Lx@7 m`tC>x|މ8 0 c@Ǒn;wc<QMq"{B>8_\qO522e}qd{CZ1hf2qX;Nti%dxĖ|)^BfNUcԁ^!^tŋA읂)x;=xf|.%f@x93K:I 6hc5܎ǪFXN?˂ q$ʾBRAYhn!S^?X?N G/2~l,6aF"'c*8Y!]1D?A[Npyu\k]#>'D6x)O^nѻxYӶ^gğO b,[+xL~ sWIHI>YK' ksZˑ_7yR/A#axh::D/ݬY %]rd $YƷ(Ɯσw]N=5. +ɼg(xӼ xטl80|ж*-!_ϦϢlޏ1LId^ =ډv~z?p˹^cǫ<>׿0i"U" pe8}D@8d8d/!K|Y ;?A{hx_ŕh9YH΅Lr=<~C']wd\BW_)'Q;O_$~Ix&Lb\ sѦ1)tht~&A9H?|ġ;F|ݡgaγXIGϳj}pI)ϑ7q7I$Y6֣̪I0It[' ?I|4O7'۱X_5# 'YTq9bP"͇0F]>ڇy_ޛ)e1􂿝:h}5@O^%9td,; 0gM~6[92רjef9W_ve$gg]!S,E&޼:o>[^dS:w'+=Ydo&zkL~n`SH7m9E䮂SD"rW)䃃4\oYc[=鈈ZO@ƻNM?6\¾NZ:M;iNqyϥnclǐlg?uۃ׏)ߔgOO:563;5屾[ ߯\ǔ{1Ssx*;-?T S r}2|\#nc{1驢}ߝ*W_v/n9漣/T:5UxKJ^re a2svN|]c^q71#N?|eө|\KڃYEۏ*<ӹ3ɜ1Jx?kccqCrmGGBӏ40Wwt~+?,8 iyf|v!g{f[cpi7?Z.2|e!>k_L⋹z?1C!\y%ƺ/s}%CbޜJ3i,lWycQg !gvtG?s]'By vlSL|ѣG>C8Wsos\28ai5mݶǥ0irgS(kgD3^H"-(ߘDI^$Q!<ǐGkSDWXwju6FNTq|eϷiy=.Qn&ω'Jl^Q[{ONYmXݔGSxINϯqO&^EӞ*jQQwTTz!^ܟrݤ} qKq t0&GAo r친(‹&bz"L"s0yN" |?p:QguD^;s}HϷۦrw‚ƒ|pLrݿtp%94sy^Kx<7w%=<ʨeua.1CE0} a !(Kqk8ON˲rz˸s96(%(w(d y}m ;%Z~/.yx 3AW KPH\dPg`ߣ|2 Q@c!c=^/ͣukEϣu aZXt1-geUv\d~$;'q'Oo'?kꛁr9#O8Wy4'0>6s1ne=ΧŢK/'' 6w O OBOS%lޖ?$QD'DfJʟD/DI߬|bDsM(!q>$^@ǫ˷Td (t*uY`.$Ikp|^IOI$Sl(cQ90Y5ĄQs8cσ [q>{\:Dw{0.k9I`ö 1x ˑI1/Yzgʕ]<2<%$$oC 99$18 M Sry$ a,~_<NxS/?C$ u%glRأ:&F-xoq+~Ruk6\@ ] r@Lxw͑xK8ݦD7 ,5K d@|vZ {gQ\(1P _HuƸ~~KJռ:BZ5:sB;B^,%cC6yvv!;G.n1#u!x}΃gKD̎4h:졳1MιHΦrN|:GԺ܄eHj-3ZNM' 5f9]_\_'N߲j;o?!.ǴG{Oj*?Py/xg*?< ,?Z~yB,wx|ׯA,рgd%>L냶.}E"GAI"[$w&+?? ПY~l]8̟SFZwfyWȿOs?Ci;?502,vY_FЬ!'[Ų^,* }{JG|hM}1u)ZQɚ{rO닉x;-}rO?_bٰXbcEVxgGMyzt}+_[Xo#cLgLgPrlü 0󊂀yzې9]} nDb ק-\K>0<{%"a{xV7%]A)Kd&CPŞ%Bǖ^6ṷpO.ܼ<ː*\t&?.>: vc4h)Oƥr7s˽3vKKV1J.%[ NL5T䨖q셤Ҽ=o;.:h)KIﴄgCaM6{xn"[:|tʜ޺T.o҇Ke}2cH٤+h˾T~s}d2.~l-4 geOΓe[&Y|ge·-UgXk\el8i#`7yp].xٟ00MJ X&2O1d7Ý,d4o-]&떉i "4M$َed2:]&}B5ۏsrsq[NXyd>m̰\Kܷ~˽I{|/BiO& jp zUY.XMZi**lJ^mc֪nek[sryZ.6x9mc?w6cu^y5QǶ~xQƨ9mCS_.'ZEͷSZ.wN6 ᴧKcm7v>anq;Zlhϯ}AEgEyK³#ۚeX9#~14 X8Mng}zOƸO>}i y+drĐ۱Bbȝz>mƸOBb0u|ǔS> +W w*XX/d;u0qZg&ރO;B2Ǘvr|fk^YgN. gn\H%+?|`W`1PR:g{aW^-4t֫eucsjwsj=14޹`5 ;W3F{6΃{qM=ypMۀ`:ی?U E'p5Ѯmk[ÿ05X#yș@S~-U~ҋ F| wRu{5"׽zQ[C+<ӑ(6{/1 spbƮXV~JHoNՃ}R5aN'\"W'<< OpbsN?sw|+lsyxׂw()se.Ted_b[;saҐ~ c.S߫&ܫ5rvWm? 9݂Oo=Ķr&FL76ʞQT%(t ~-?[^]6ȸ0m"%YMı/y~MR7VeԺM&ӧ]>ڇqɼ =|}MI-$׿H% U>g\#] q7hom񽻉xO~ʽ=f}n{UV3rs6S/+ڈyj>CʖmD\{& gO;틟8|mS=\w}L.uf(O'pfw:79}xN.|Z6[7|ػYo&fIGGSw6>k ^ XT?:ȋ??,og柀?I}l &MZN~To}mdpAl#0ISowU,x;Ȭx&ɂ#eO@lɲ٣l5SGqz"vSS{[ʳn>ﰝ ?qm$~v?{`2©wwP;Aϥ*+;\s-v?t,঩EbA􎺷;DwGP9SD𝐀Elr"8>)黙Mx;dۨ ެhe Ep I,<JH/S䈂-~Dz˫@;K$Q]g'm?{}hStwN5]wvaI;E'3ʴvJC֝wJ泦?0T,oUЇ_|r-u)[[o*6[ܷhIE.kC( /pYxҩ<>S/ʝ9?]r#vI=ϸY d3]s]"r*"z*|U~( qJz~ (1KSc#1K3Tjؕy ~K֭$HG g9̋ћB9]t 34Egc7{zڏ9 u.ZT/| ˷^[NĶ\F~mS>. ٗk-wD1ec=cl矌-瘥+ca/չMD`V́/)\]!9.;^ Qg఍o9cVҿdaΌū3f8͙.<ūз^z}/ѷf.L)Z̢ګ/;m,/eSe\Q^e+h=X5 UU ]Cqsp-ڳ{g;F+-孽tn˹H~+wW\La}r}{>>j߂1ǝCq}8ie(ML{2c\%70F9q/%N%4{؆Gwc̅e2gX=u|wo>r(ڜh(}N` _pk5F}KpoSϴSe=Y;s/1 wynOsV ۪}Oޓ_3$: M5OՃ'?(&hO:#{<3[g*\OHm7or9}=p?r=Rdpoo;@r:=Hi_ ߆$ۢ {cs~U=(s2[|_1}NIyo$?kҙ @ޘ?Lo`pkE6pH9$ !d0ƒ<%!ƸǝpcŜ-w!t0't=.9)|Eo/u\Ga]C<9,2N3!j|'Pٺ+Ko:,}Døz?}w+yEҟKf8"؍ױ5vD0?}яȼx' ȾY:Yzh91hBRfc|r!ȹ:"{Xl<":GD}쟎{LNTpj\˧'_#rV)Kuwӑ'+yԡ g:Y9D7C_ضOp,U˫ۜC|62>q{6N21fDw19-3p4[)؁)>_Qx'QrT?QfV;ᾟi#8Q+[a}F}#:Js }72DȞq/^h`Yu xQYg:*D{J|G%-X)bgewQ8gnKǥ|!Nb5FXR|&?o_I@{ 9yNi=/:J^{\i7-f?tXU?ĪR=@"~9 M8&z2DTQQcmcU͙HܤC6돺cb[M\9?9h"q,1]dd=dd-<{NTOZxʟK+85:]TC;.V8Ir#cLor\3-M y?}̍38[kEo?Rvr/QqUDžƼ%goq!wɻBi"L']SO߳i& LuBx'qVA3װjIwa툤9 IIARsgav-TJ#W[*O wp:~S#Q'sF绞St h\þ~s$p*$Ŵ\2 6Q}}?H2;i ic5L*'Rf;)zf'E˝۾'Y/zqđԮخx!LIy dI9om'E68tRR:p$@~|${n}v1W) ێ==wΡ~9gmx؈vmݷIas)w7;pSʙuw.t 98=B] x.Wޙ4wL'O^}{~yWnNmDY4̺̦fڞLsWB#7ӻ[(kވt\(jLҗp'g ?(]^'00sO7E34?/4>t "-9{5ֺGgV J*"\ uĽ5aYEʩ*n[(OWY"}%/YygG+Y1LKm2]toG_ߗ]arqr}n붎Oy2čfIF/<" eȕ1)%VXd0$k</2!6%F:\9mX۵ߤz=u,20|L/-E"[$s7i:ͼE.Ts"%hUsӤ_=vi(B'ybnQ&缋rܔlɞ-{^lѶm~ <qlZg] 8ݻY.[.>`uOdKNٶi>)/}ҧL}%kk:EoIxodK@x<ڎP%?l93 6ܙ,"Ė^mlEz_\gvD'ڹ}$聨v6swi~z/3}{3 "<儧{oOq~v`ylǮc횻}}bcg7D#?mtdur؃qƐAp}Uws69[^ņ_L0A.u{ >|O5)Pņ`!;b_L";1gs~y1ofg ->OԟϿqY3MA+2O3ˎǟֳ͌Gb 0%g?GbvR f P.%m3Wu9쏌1Kt̍^[ L>K:՛Saofn9Oh9O#rs0 ]Y\uU?\5+Gre1Ƿȑ}UrO >bcУ9stH͔%sD|\">͖mK  xZv}asKu­sͩK̼%'w?Ӎ ҍ%4l Xb櫀p'1,RgN]N81lgz),&w"]BmK^ޥB? t#wB%E; :㲟ieЏtY/߿Ƨ_ZbY)ǍM~qޯCn[}a=;,C&=~_eKaG=\9uϱqDF7F.߃ 6^fp?j-Ƿ!llxp]9cwׇ1:;Ax/.,3{w>!cc1>e|6GeF!LrB/]&9INMDo§1ef/rHlN]rCW.7QclZnQ[圏W%yX rLks"^t26) X}x-w[AispksHHSߺ/)urѷ,77u#Y}ohx./:m+Q35]ɭY1~DQEE}s(NZ.g3:rMr@N kr1_rRn[<[nrvqs\bi"L|g#N pwLt߫϶\! 6+ć0X瞪?e ^Hee쒒YaЇVy+l400prWH.pz탖lٛ\Voc%ܙns}A.q5-UDӒms }M}^R(mPz ZeX˙]9+$wbDxi \50}q>{eSSs2_D9RϩT͍k x_Qx^~beTvIyc—r;M _|cntzej.i~;y׿R^SwvY\ 7xϝGe=[5uM ڦчڷu1uFRy@-6-sf\4כiqͧ-oD~*oń[پ^Z\^p+\JC]iϖc3^=h y}f}ܹRq <({^zscg,:={F#uUr[5m㼰ȩ4ڏ+9tJsNzȌ[ebz2﮻k{VGW1n߾21W޼UFV+\erR|UV69u[6VO6Ψ&&wMNe}\ _PVP{տE1o ckj_XƟc0/99ܙ _2NW-U<^^'W mu&癜?_m^YR{"}dInuFR~Ӑ]dFqC]^;jm~ &|q!¥ ctj[9Scwcһ y65ջO-cU_2U\5Uo:5stk`ߣ:(wcY{~Lr+ gr T<'\yԳ Odawh;T}s5W_=Ͷc xyw Ueulʝ4~QϞZ"|,5{DF Qm3qAI'<$kRc 7X+y[g oZ+6㌥#cؿ#<2`Xz3ȀpmOҶOf>9s1csNBk+qM0nI>!_ '܄1rTs ߶޼2zx5>5 _o.!<1^g܄y[e<|D+?s s;9Dـέ7ْp3 4I8e۵ W`, | cln $ܜh;0cC&EImuJY~$G0 9|1'?<qV'g+g6!\ĸ \& 3e2Jᄛ0Hs h~1z3VrS^Զxr/߽#}"W~yWdy6c\G/E?/hOK[?mqE;%/o&^_wƪ_vC{Lj}_ɘԕ1~ \}]gùO\&l9?D~Tg6{c,l;l:hfr`\Cg^,9ol_~~sh=W(}[շn=YlkO3Ɯ>~Nc6XBafD<@=3j7uM?YK?s? ^I &m߼ozs+u3s N›;2G; $W}kcx}S6S<:KLYƼT}}شEl;-ptaG(g,; =St>R}ޫD:JOu>>mf>mC:k*ݼD>ko5pV;Ӿ_wM)m玅[V:([z:b X]߰vO"%OA'ܜ J@-Tp NU 1]r;.brn[e:m]>q>X-7n['{R jfca;1'TϫUd7긭99JΉnJ<~?n5{=k+3Ttתg_{N 9嚷'bnJh- b}9WfX96|:bj/M^W|Y+%^|{&_QᔠG>7~mG>#47LmG쯗/zk'^ɆP /I1v|+#)i>׆kÔCw\"<`4en9_psȞ0j||p(hLE7U^zeز n7 ޤ ^rXv.eG[߰,ʁ L$G̼6ˎ|TrHrAZ\ɗs9Fkߚ 49:1}+ _m$ t~NG{?'Hc'W?'r'^z^djMh- B/>C}6  mw٦rn3wd -'- 償4/rcm9}xkACS'ډ}{-GSyg94ᒊ&s[n!.z׵sw = ~mt zƊjR]/v~{Xk{_$&hys=pNt o%|-[ 4|{88NA÷4|;~Lj<.rMf {3c'%1CwI $]8{ O"=h[999%m2b.>T0ڶҋ`a.[K:rdEkC߲K|`x2轓W0/7Fz}\rhǖA}޻l lyDN.%>nyvT~ /hv8se3F߮e܊p޳nm\vT:ncKg}w c[[;=Yމ)Bls1\lG~~4XGC[q_њ z͑eȽ#<@nua`|Q8>MT 9&~ n:nbzQ%.jɧTcp#1MH~="?GdpL?~ o~/=C{F1H{DEcKU{D.#:>c{1!y0Of=^W;(b7iIxl]Y' kQk j.?'_Q[J{09@/orWAY̗s^ᥥjnY.d8q3yOJ?u~w7m>Oa~t݇ö?1$/#'8U}ccyod>bw3ΉN  1W?k9b>^wqN8qgr?zsNbd"T~H#hxb\엳d]엘K~9[Iqu"GJ56Oǜ%y/oꗠxN=NxK§_!BvZ~w?_'//?%M?X[_viPSr|Ud!55g;3ޓ1|j0|j" /9Ab 8Prju se!{d)`9\m\Q(w4)bB+D8 gA x.ۓ3V #.K3Z&uS(wy %8 <0Rf^l8 gWc5ю5Wu]+ջV1x@+s|&ۋ1?\AxuĹXG`IQs?A '*ijO!Bdzo3|E3ͬW4C!E3xf2 rȤc-4gpZhutcoc'<1l/ہc"c:= 7b c7>.` ~&&Cg cQ؃0ƾՒ1rx:x{=}Ɲߌey|qȌ <~!!hb;!Z\Nx#x L,q*.~q E$9}F|nE8.9s31_6:9ݶCtdG#栿mNxSJƇ,8RO wr6LEW6 ;>-yLF1nvCdCe/~سjžen{v^޳Lx hi{^~qXrKYW$3Hd@ՋDv#qe".݌//22%_%.7kn@َRƺjCx7r A-wz]9mS$ɾХ'(h+/uw8pE_ECgE9P~GE~3 `TT|xjέ-["3ۂ"8X$z":GOIM]#3 {ySO#L4}/e'/…AW#|=1Sˬ ܗ%Y As 6<m[֥y'|\8㾑t-­iryK~G'' ㉄G6 e$<K QwOc5cf^6 5 1%T] 7±of&r7H c?We}S,6쏊ņYYHT 9ŒKXhRՇknRc<9OՈĦu*r~Bsp:!8 E۶mm#s,"r*|l,EHvC/I|h7.g-i%b#`w*g2ٴoKn#Ig2%۸s6Q"{Hn%y.WJ]"ǕHnI%xjyDMz˕%&O3:"\3dt8; _KMJKJ/?){˝ ; Z0z I\^ktN;~$ zZwB{f# }D7>> эƝh #'Dخ̾'qKNsjOy61{w1vϑ㽧㽾 1ޛJ7kOr{ 룞9AňgњuO3f;ib \Cxm1w:itT[N=v;0vGCy*ӄ>ռ :8Ex)j5 Vw%&:z{|Ǟ7'L]${9)g $ܐƓU֘]RyIj'ASFoomN8xJy)} 7!Jg 8dl_'NNS~t*Z~hy)N*=>~")C(/6!;`ʳtO }S.gZYFM8ݟ>|'ԼrW{ȈK6<ᗦ5?mJ&>myݍ<-q}}rF6'RL_~{p/L}i`yIrOs쾢ןvflc{gW/&\n3;~;s~p Iqur Y, ך0s۸>mϘ;j`K} {g [|3|'WwTc27=BF1 s|JIM~(d~8#3-e򌙗FUꌬgş):+~z ?rY ;C.xVYyo߳Κ~vs\}sy'{0LraO-:k|ч5A;[_{o*?M1f NRzz[R+Jeܮ%hn=~IOҳwp?1/͖v'HGݘ#^2]Rw`og{̾ܳ y^#&w%m_%S>~/Bwy7ɛ*HrW7wfA^2TtR1J͹-,;^aM"g((ѩq/"K[zTdb--_ބs=}sT.RUu9_?sBOz_lGy9Oϝ<G&41yu[_7ϕ-K}qN:'Ήo]9[KxŶsaOEu)8DչEj|^l7Yzb}^, >/3^"܆{΋ }^%Os ?f b"Hm}e/Q;ϩ-%^V|צcq{@YC.\Gm <Nw¯ԓźy0rjb %:^ZndvhEGh*}EwBa y>1;ͼ8?pwx~exW6XǙuEhw.Ca'9uc^A8kMPtpO˳ WbaZZJ -6'R5|?XuGոm˺gҍaπ;0N>~; p}cCf~tzIi,M31+{'\kbso4xCn1dΌz aAx66%lyߓsיfѳl.~wsSہ^1{C8?G>Wb []5`uj+ېt&*m s.x0Z#')xC7ygD`>}gD?ud6:sy75sܕ_9Tj qHR6zԏ?5cjr<@D%7f[MFμ@.Av`ڰA/Q}a_"֗yl~܇g'OOͰ ϳisl}›mw=動\7?Kl}R>[pO"caa.oS)c0&>V>m OOxOx_wp}WDOl}m}m}%~p#tϫLO\Ӷ>rM.nSp '''q<GK'OxOK[>Bl}/[z#<,~ˎ'xVS\Ͷ}c+C:cl1F#[<'|O>7 ?ak/_ٹ3=ȸ(3m `;%%&:rw.'k}9>9X1c@9> Fx&wo0_yLP1yLP1Ac<&[m;noŎu;nW}ǎ[7# q㶗Y 7 5Rgp J>ӱF8/ƪS2uؾt#aoۦ?ԉ𜐙L-g~XE}~JGWK=./3)Ò[A- ~(KWZNdĪD?::KUkx/z~m>]̈́3"(W= Լ"lccܐΕ)ۣ P=Kx ^WN=6\%a_6k,ud cm} g ኬ_[c j,}yuyJA+c?;;(͜c?22w18l?/q.T㼯4|Yg?1\BRL|O4uTճ?kD|KڲsN1u5&#!SV{:ʭOs=>g T=Ǻ"ὸ5rygx\ #h _E7gwQ>M3*ʉ2W9O },'p"CxR#Q 4%5%~$Qe3Qe QrjEM=Dc&' __p* ,bmEl~f 4cI|B/` ޳у s3|N Ï}(K1?e7?̍jӜߘϼq:%3I~$էO/O*Nu>'}o:}wnDKJD\1-wo9b&P~+z9ߍh@/s.H6eIJV>Z??Ǻ_m3D?~$9'g~ Yƃj>L0$}$lP;PI2}4p4G;dι.qm~ӥ?7 V^,{Id׾PưA5`|U#&ntv󜟭 |sgؑn^^?gdJ]C(4YtЦ?d*k9^Xw]<J3e.>4D<7w8wdx8' 7!o|mqV0>NW4tblEE3]㒽ܥIM)ϒwNy\T!Zèu#m7u/%w+)e;|IUao g1y*#Jm}H \p c&H<|m`m}M>o?93/16OlE8Ec]xjd%k~OPv4*x ˊ Uy<ܮh싐`8c/cqlQMxDŽg0O1gco1` v1c*۾? o2Bn܁ĂQߜNxW߰H7>&|O&QTK\tTx&T;m;_j\z6F66FctaRTCG;4TC>N=s5UaLj| ls:ɥ5{7kφo tM~þ1w'juX˽HpZS*^;S pO̘Tp~ZUzޞ=# 6H<;sM4|Ƙ+Di&z̭qg9^{ƈ&6Ć64Mlh 4o&~3=M|榉~"M|~sr#b'K%ZXI|V'̶Omi>pAF}>[҃MzKeYm;ki?!l~غ%#+IvesU0w+1M鮍 Hz.|%#6'*IGZC9bIDȢut,^ToOmc{neb8V~1D~ډ,WrTFfMs/%:{SÕW%-~;T1衲|E3=\@<"Ê G?rkHWгq8of=tj Svs꾱4xsQ5HP*8x7?fZ?̲b3wAD[oC@dryI.m*b}U?( zmYn*NuUn~c߾:cLnfq/hΌ~aNc 81Cy,r#] Cl? 9֧ +֯ܳl o++h@M\i  л}!#WB7^p7dFؖڜpO,0v6$ޣ!wa!2{!2t2{|VL }Uj/{8XH*3S1 ?q뻜!M3§2dZ7gϚtX#fP6j= ^;Cyrd{Ԩ lb+.CUf2<*` ۸Ӎ>ƨ1!.; 0Sg?oD~4ƷdBryL3VC{dsڋd۩f=y0\b~CBVYL]&gkD9mzWiNTvUщ*:Q*:CUE'[UtUAmۤyˑ#$l;$eI8϶I81O _72Sm{3nW6*yRMW _MjB&t>* 򪾨sJҢZ=d[/%{n} "շJhʿ< 1uH$rg3yݸ7ys>?Qs ;bR}a=e -t{w <v95窬RNɒZ>79YI9R={G2IY$b#<@ ܴNyݗYCQMjM45Ci 8f[emDDe3$uWCNqA²= m#ʿrq?m5;1¿,5~v|^AR璮(vġ4r#:KrMwO؎I]UaLFR|?7Q$J>/Z咈]%i7C6y}Cr*ADigS]*hj!π=HDC1&в)x`Ѩ1tyxP9Hi+Ej~(} j27u(\Q̺m`d+[te$mmdRh= d䕨Cxژ-b.S!oDc$Al_Wn _=^}[rmroէ#{W:_9;S뇇#CHI<|rDpq~}$=ޟ-WB9S{|wꍷˑW^=,CnV%$>߯VwR^? \}xtwl=~G?~Bm>%-^QXS P/n~!xW7Pnο)؟fiHٮ4|tvyuxۯA=ӯWY]7 ȴshl'YA}_ЎۢHcKnʈ\2} [&P%,R/`vuﲲ_>J\Ÿo[m^n2o]H\Lm UD0h`/#}.y@\'dʳdAbdDӴEYeS}/ў7oߣoR%ѷOD.p+Ϸt~)%Nz|>?ЦW3.o^q5?},{ BѹW͕F"ZL9BtH2\|b{r>~<|s?O|H_527Wom)2OLdoa\&$a9(Q{SS5#ZU"NF›ukp#I컦lU`yt=WaڦT h;~e MSwGhRH1H{vBA&l8ӽH ~ 30X]ؾsm[e)QZIvL,n[xL;^;\na^Y${ϊf>ˢLAfLJ¤ 3ʘGCҭ+jWQQh6VKV)I\m' )9M[D/1in)#:ߔXfSC7Re ޶dP RRױZyWQn¹b0/fkol B\!LIYH!3|Tb'(G>&E)ͣs/]#'$L1*t:iO6U[63.>UXGSHl1ZDB$N v Q/Ye@ - (KK>ub+lYcfiJC.sLwzi!-[CKV:Iذy 2Sp\  qب)Cr)$\!8 _[ 㵀^RIOh/O}i+%Ӹemat2ǕDSms%l;!c65-LKL?d)mIoF4)ckB[/w5Ra>f QfX:['5H:?v+Jvyjev+X#(@&M=?̖b;Nwc[l 2<@!!CtRj&M6j>dn/ Ţ*B[ ؿE):Ԑuy@7q>|=*mN}Ѝ ɯ33k M` bj3'AI'k '/ג,_ixduЗL2#Tm]OawLHS2Ds29qX‘RX]Ɲ51`Ű<H wKet)̥qma ٜk8.FF,h#Qa $0,dTǵlciYXe6n6.9_d>#&^ @q&KFm%\>E I` ?nahCWfݱL*ٱ[mgh{}H*:`P#z? Hr?)~ s0/idfK)na3H*',C@PHP-rT`GGZouUSLp1`M9:b$?)}UֱҩW~SNV9g!]rZ,үaq)Ynݡ_TQ'P0׈lIٶ2~5ғ #ˠH;"~CT4mq's㸕  6q)̓X,ͶB1XUKGJXwc]6܁<" f!%Kjjb(Z)c̐z@ts4>x#\A,x5fXVS>m-)t_q1l.3Xsח-qHPHl-N#6Cni Ӭ$GF붕җ,dE׫|lrLΎz\HGu>JdXHH .RH(v+ Nە,{ъaJظ#%V"Yӽj_ ::X+&QYǰiҩ]-HO̕t|^zmبJ'L> DMV}.h&k4!)GNJx Od\'ӂ h!(˺LSkHZ'/Edd{TGߎh.;GO^O A}0[őpPZi95m'}g YeS K5)+}bYd$4~]?%38ը|!>iVH,BjeZVf)Xq %f3X`OS%MZ~{)3w)ͭ'BlG0PsS^t L|'D".{Y*BbSp_LLmb! &܇TƔ)CT5#* N~n\,xrj!DU."&;[ K'A칌X 72Ncl:Ɛ2KmƪWb/.x:XNzXIhq?HvζD}&8K@1" >dr׶^iHV2uqI!hԚFt:I*PЬ_]uߍ.XNB{l ջOA@LN03ΪW[ztTH&Of">sDc7>GAe2?/ײ.=nk:vX:ay9sn%͒oCZqSixV.Sh͏_h$֙VӃ2:pXbQ|i )~xk 6__|z\M4i|r "="i@AA.d4} vKK\LAj}r,WB;J4(;A%v ÆiM%d &qxˀkY5ͣEarA;;+e4S!Éq$S/a/^||11 !#PlUke2/u וe?;HD^ ؀40% p|l ez#\ C#u8L{w _ SÞ~1"-!@C0g_.#48hv\CsF3at D!^ ȢMf CYkP\BɽaS3Fdr(s&JXzHgCegn@"P\_c.|:g]+48ec=". ^?%r0ᮈ>kH j)dX(/E/ Z'D=x Qa?m5gcJvҿB.mex.NYfp Ęv תrZHtNخ#Owa6pggtdpnl}WXy7$i!wtB8ºh 薷,\Lu+1Sg8`ĶvRV9vWI %Ύ|Og`z(c\:`PF2S|1 B},^˲7m天q UOKt8bj#eZ=I霽,IɂY|3u[*õ+$|^[vK,i+-4nA(ΰN Ƥ_d.)H3iٌC7Lj Q،'ԐA,(w/4 y: 1XfvN9Vz &!, s 1픙|I7|s'²ĺj²nqD\Yn0,EC8#fK{A2ݤx#k"|z}av1Ml-[ 5ŹX^gub~>niB8W:.:)l7Dޣu??Ѫ܉զ,Wz4ccuP2!apA SiA`3m*GG@Fe=ZA*4<,A٤ ^8iCh ?\wjؗf̢ SSfӾ})[I%.=2ߜp4[#EtO*>xo~^=\Sp%L4\P;<.ľ>~zvrr,ma3{2 -ГJ7}zMT$U1x~ C%!t1\շsY*GS#J/Q\L T? LX 5QOXX*x/e& t/˯YK;n[=\b\[|fb^=z̫7G0Ο.߻fgZb%jBDښ 3 Eda.e^T 8%e8=+W,y*9'k*T.P NVf{/FLT$l= Eؽ@n H,P:D8.ݏd3&ڑmۤJXcӺ6!kq)fW}V\8ïmAֶ{Y}& L|7ՈemFrlf@:,_jI'ZOeP`yf_uh)ڏ ۚAa'htR x*'<z+ 'C՛ n T,N]tޔ@Y:GmF.G`hd.F{^${b%~V@@_t4Bҫ@{f% `St#N7 3+S:Edb{vX؃}?}?}?}?:ꚪc*n{!^ZJQ46/8)UQ.լr.Ws3^jq svY3@xv׵5ܸvB5ET,Q] LzecbУ?RӘ>j󅋖X0殗b8a]S˲0!~eABZ}d7 ?|g7?ڭ' RxHНꄛ [YX{f@Om}=*O S a4(U]D@_CH&]M|9uySڭǏט9U؄1Ϛ?jhd\Xd/q~HCϖVVP`tuvG0!%-NAd~Ub_.!,gn1UBDdf/Fk? WʌF!!͊.\$u ,:53JUdyv|')WW`Nը28L=h`KZ@򔖖)}w^t)X`@qlWsW\aYF#CB$z.Dnx@2J@ #gz["^~mn9S.4$x+y3b]z:0ϭ]"#TBͺHS:Aj ݈T}/$ ɇBG漷,2L(O}qj,نq3ֳi j0 )#`j,4Z @@˱ňWP*}Sڅvc bAE#Ĭa+g1lR SguБ cYo [$bM:AnV/,?hILa3%ӈNF. W;f)u$EF=^WA Zs18ҭї4.1np-h]d׊QE4D #>H2e9܀sLi} u x "rӕJv4l/Y(ICэ_jo,M`k ͨ,cƉ QuYcInvӊHT!Va8ǗBOBRȲl`6 eN#Ny,hʼ8VbX%lCvܷ\2FGĺS,[28 xVub:Ջ?nkA.DZ5Cv(Z)ʔs6mJĶJt֘hF-f"iJ~> v0)ฺ,TSR1|YUmȀQz#%$v[ 1IsJfm$ضrWm,(~h2-j@}'eh$]@uIPm K /Ҏ3`Yڛ屓H:.; m'7O ppq<(B4KQxTşM^]s|-7TBƆdv78#zv:YRyq EL㺬0U_գP@B(m03C)!ݓǢWI7l!5JHpC9*J50dVA\#inɺ0$MdHJpd3@:Z=CکWhW0/ 7<@jS< @y54չrIF a ׿ [UxMW)SoUuGК敁JY0lel6.]@Xam 'W9YՋ. 1uGl`䖸Qk(eRz̓^Ii6Y14)^mILpeIH֐S$~7s'2Br&X3Q{&cﬢ5!^ !v=(?32~'vwl/tcAaY) *z-0ai#V?$j *TmPٓ\̹iƚ%&+@@xTM5 #wW[] ;qLWVH i֌ђ^~tȂ`Hˋswo|[=uP-8Ίe?ҼoW"߸®%5O9G 7 ,L`L̨̮cXJ{ب8M=R7S'8¸TH2$_T Q-^Ka,ܱns6*{ د[Oz&eq)t=K 'u^1(r[ܩƞ:*+J0 &e=Ox`@Ty[% ]m$3⣁"@z}CCcCB#B|2$aL@(_e*ze!,G~'~sCp ]}-όn jQCˍJ?cT'A)id><Ң܉YdσEb=ja+gЈkq!>eYC 0âMu@ E;=Jb:ޅ 4N''. S󆄓јu )4̙%w`\֋^i)J(7%rRo37L[{ye;VEgyN7VL6Wh %[PW|Uk ׄԨrsfZ62l/[+]: t}+!e"iil9rduCS2Ymeߋ1(mjZ,A#LvY ٽɪy9$1U;u)ibLX8qJ :~=<P:0<8L>ʰ*O",tDzxöAĖT|;O5/zURS4 O3S~Rôa8$ðij@j!@̕s^,!l1,SBv<+|Te8=SusJM  YXp!يhҭTTY6]SlIVh;SPJWjh`Y_$(i˄y<{g=%h Sx"P֛w'/A_΃A M3%M1PmT61L+c 3Me]Lnw^xIz Z1np;bf|viq17+&^5D?ﱁ{ZEfQ VM. g^FGMa-2 ȠYRRY{miV,v/f3˯bgi9 Ru(I|DROy ]J;Ã%TyQ",THߛ LgX0?'.pbK-v TȍX$i5'&ޖZ(4ǰ/Vm#_>R:8ڸ3sqaP}aͅ$$_jjeB?(dU(lP)LU%D*+}:lab:'6I_QhLpNݯ<\^w)v nu~wWNȸ'4LK!ԁyեM<u@r\jehfoW!b Db^q+T/ Sy#J"<сm}XӦAu8C;2, atcYs5a}Iq&D|E Ia/,6WnGZ8W#l۴F٘em543k(FJBczQ*@:9ϞlOU'BW.Vg:pe4hCPIY 5hXX ɧ{^1I T}/ك2W&jֹڬf(ius'0(/IHUOvJ7i ?b^Բ/ Dn}f뾒3_)|.>73~j*B(}\1y]@E!S0_j#>\}Է5T ()`aSnJ = Zm.KT >b;I 8^Pw A/Wo"|^L {uNK6Vvv6+w!FdAQ@쵭A".`HX ߵaI.~r_i47vu'"{^-UpGJ_h/$6:D^*|zX?ܝ_h{޵LƭWsPz*L%}9p10./vir=iտYV*7jE~]*)C(EA>H}Rc.{P`ݪUjܖPZv DcP8{̱OLR*-<$(Ld6u8†j+a꭬p;&kf"ʌmUdE6 =[lgt5h|I z¶f!7XFqc(7X8`3u׵['<_[(=Dj}c]bWقZ1nz ŪɆ݇FXC>}"ջv";4M8p4z{4` Jbl7~efj*T::ˡ|EN܁ > nV4M͢mU &fr0U!p haZŴ0}pB?d2hdpu^EڿvcT?sK.d]L6FoxQSL0Huc*ձ)y&LIX6`&Ԣ{oLoQ07jxt(,V?ۉ³qL=*g*E ]`c| u?W߱qW0T疺@\jCP B!Ab^[rԴªez5syA!)>L xE TéP4R+ZE Y;RAǷa[} `D8mRwf2b—扱g@bmKv ȀԬ,Mø uF0l`/]*x8Bc$5nvqg5s&ea݄{/IE7Sf8^94ȨᙋQgQ'n߬`y0Ԕݕs{(ynVKT3V"EMvDY1/;*1+KTmGB#}Īk /tV4,Gu:tnr[YPDu">5ۇ{¬ .L̒`vK#H-BO^,F5YC37a :0J)Ÿ:*ZPc|uy Fua}!V23;B_mLӖ^PEM2sʂJ-Ulzojaf1V@U؊]"_"&QOH@OèύxЃ񼘎CA=)num| '%Ҏ%tT8<'=;T ou",vR a1i:Or*R]ث:-{%(I-[/u5{"ƮQ^)7+*I|h,]|hEt\giܪxa6C0)Xse4-ro)x\8 GN|˞/ޫ\l/LEma%Gl# ]yT^!.ݒ.״<2}z~.e=Y&ˀ :|4me&=Gȡ]PPdzpP.bhšb0xĤT$vd{S7i럿(m};,nDBb%Nge&1|Wt9쩷5k֛XuHG.v|\g_7ŻMU-[Ln& 2™NwmfUǢVDq*%"QI GF.:+|yroM {̡4|xAz0 ğ ×7 !|uшG!l0g&d[$d|~WuI.yQi(9K֦|njǙkezcei@b򳭇#]my_%P&3 cBؼ)!ᚼ<_D:-E-]͂if9mIOņGD(JEOU D>8~Xn!6] ֆ:8KP_zl^ǣRPy(-vNb3v7&%Fy"OtIʦl\ʶ=$_ȇ&:)ot㥵d*xQMҴY{__8jw#޺~}y_=t w.坤&>xOW78]ܯrx㭫n:~~w~RHW_W{a^qjjuO?o﫿ps{}<]]ğ~bû_׷<8w~>$;pFR<?͑?wV_;u/?_<^?%]nxKT:U]UDƩ5nIN`e|\̴;WMdߢ󛇕tw]I~!zoW7㎻營:x~4n~T78}n"[{vwn*;qxuv;ֳ=ciO>q-Q^}7a^~A , n .Rk#x?(&ۛ~Ɲ~O@|W8!$A—u(7\C>>WRagU8C,)^s"ȴ5T"K^ǿ:*//C͑guѮ*(uzRAv|i wpkT.܆#;a6hL(JѷU y-F-BԱFeٶIykE?}Olq|A4}aッ0'X!>dBIY5&ٟ˞G͈ro !Qp 87J{h 'S4+: N巐s[BB!|IKy#nBkH L%|G,n XT`C1⪕;Bs4j'q:*B2AV.TE-T!..p,7g+7L.E MU n.G: FfۇmTB H}8D Qeaj׬!EBuwL8ͯLIdx ̯FR=I V*dXae"B L?B_E~9~~|3܊TuYdۉ G\H@L&6xV@wmo44:c{}Q]5jbj|>0퉂ef˜m`ȶ⇛i"Q֑/ɴYF%uR)P<4iʭg n%i݋+"I>JUݴsB]9hXp,_"<%,BTڏC.yPFCk]$Oĉ˘M8RvŊb)!R- 2T %g!4!4W 5UJv:Lfug/`Yd D C&hzj9f.\RHRkQT޸=JhqxV(ՄBx ?2PE'D14e좏)Y /fmCz-H}joЪt%+d<3ϚgKȳhKed 0U2Q.ܸb`{A/&)2%Rm2 p-CIy,'vHvH3 L\Sh">eaxzRU]]tZji`n/d]5"UѧT'z\uG8E#/+:^¶Qm_?aƾ%EK?8 7 WO;CvM-|OwgJ\^}V;KdǪ6ug 垡K /WX OH} 7ny(fRɪSAk Oǡcjvy*".jl+GYa1jAF|„ CY}1萚7j!0қFȤ>>`!_t {DpVۥA9,4m܀^ ONǕs\RU?ec7)|ҙA`,Us:+ ;=L 5O/.!V d88@vc)ʞc{o&&Lo 珳GsNƅ#. a<qDG"h'o+b! 9<[Ow{6-QlMG4o3w4/sM-6K+^qP(~蠅ѹgkc 'զU>jQ {&6r\dZ.< c Rt{ؑLol K8mp?Wnn8~ŶT,-,}GaII*͉&[vY=ku]}͒Nd\߳%y6$!2gȥ vРrNs|4 *<d(Y@orVTz"MFVY8QP to6rİQ5mc}ٵoA_.U_r c- óϼr”[7ձ{4qs׶$Y9#hJ2Qv\Z_\fsUVm#Eс㇊iC[e?+X(Vvt%-E3|<;% "(gFCVp Xq49gTrf3vKgU:0&2wx\H.ot)f*Š'RKԨ`%2$Lr[$U TۇC>jx 6\\ cVlȷl_l%A>vq%'8B:E:|lکtS JT86tW쑸_K#-3L.xܞ+H`; f.&nAKh%<O (Oqg:ex=# COcMܰX\j1?,Wq&.O3uxm-zs,X!h吚|'rH7׏?K^9~~Zv:]ܿv{=Wo ##ջaޯ.u}9]o_}??;כ}|:;~xx7C8>|Y>^z]w]Ͽ?LxP/ow}?݉O =?w>_n>q9n}~C2ra|T +`״iޕ1mv8m0z+n+ 7e ^SUuH p(jxXzD::ljbɐ 2(IUb^mD >ED]~){@Ym160ץpA3 ^%%^2ouP |/ &v-' 6#ˉLZ"\eDB7ZTcӂ%5AF#s*Jń̷0''&dx `y7#dAp0XI!E u١I# P(,h& k g)b 2.Dz-\@cmBTi23F/mXڏi66QfzQ|7ȸw&wqPk"\O%qץQb.J)C8NaȮA^R \"j,)G*Fn!U'8ȢJ[Ck3Ib>$)7U؞ͷpcu {*n(_]\_}5/f~M!#ıw=R$JUw^~ f^ss_Z~͸W>1)o֖ (YETF XbOG]lmȁ{ft;{+3EeW53Efd$TS"LW>)PL.,x#v)0{EGr](Tc( A4My#,~9%-˼k>%%m+>ζ{6uKLj{7 bK+aO 1 /W7J-ޛ%keh )/Vb^ ,CRZ_=]bUĚx1a+EuQQ:OaȼY\jGIC풆gNb7={2$ C/b_Vxޙ\Q 5L{l q<^>5 ɸSN bτ]y# /vJ<[jCKY&V״X'D npdrxb.vR1f0{bg=BlGOycEIpP ۅMPLfsƏMk`d G2򆤒ekXoѽ8$\ؽ(3t͔_p @(mKDGi7jO-uFPid 0b豈H/CjhTd9@@v42Ų6E7@ #s Js壶fO %Mh0 },L;f'pkyh , \43`YhxLLL!fm}4&:ܫ?pXrI=,8=2 t,*cE,`/M郏7:h*XAa)ھ"bP weMk2 _ ζDf+@}DQR&s0:I \c, _jI`F]Ls@bRkD1TEqky7XY1>4X;3Jtpbȣj77G^n/(O7H+yc|pdz"ȶc㙽|ɑ $WH_on$6\onoVLJۛqYŭ,"IX׻R?!=y:'QTB;an6i_*hmZaTV ̓<i]٢t͢`JOȷ8+L]NqƎڞ~}Mԥu*ړFQץOD΁*n۲\۵ bN7HmT:[qS9^M)7xV.[}lwϴ<gPqEn -=ăT1E;;_++;hk}n$/KpUTLQhhzlX,П8ɀ>eDOsOL8r{f}Xec=|ks6>!B =yq;ʴ/P޾WfKVJjct NRS[Qq)ZUŘn 0Ejҷ ,/ zH5U>uEQx _ϢǨ"S] z"k;~ɳcJ:xTDvT;ƭ hƛ\vKp(8 WO>!疀?RZFrzqY,pn=4"Ho&rz C\Z2-/-'"L⃨q<=!uvv?F@|V+O!Yp8yM-aawp롲iU>)=g% d1׸0R 6}HEg$p@%o)'fT_MI/ɾ D05h A]r@H"J^jp Q̔CC]o:EJΆ70$ N$\.hkntrthD}J%S/ݹp+e CWUJlH0'y2<n*ŲV,H(y` MrlGBƩ~#XnU BSnq܄5b:EI BV%މ%QxVn1 `.e:mvɄ伪dIEt=x.~fTiU)ԅue9YʷJy_<:$n f+! 8|1 iQ-uS#\[d|-B\ I&b'x\|Iųa(0NYٶM$JW(@,r 6+ KR6fhЛOa@PK$-Ɒ%*=6@{60F ;%!b:j̄,9=M0TUWm_yta(ځo4 4ta+Mnތ W^:t :?:od}$Ӣ3nQ#b3w6}OZ?2M\懅2M*(T,rފK(d4}S^/VB^ ^2Ln%26ln: Zbwl(LV@_$7d >&*AfNu繈m 0JxLv̨0-y/r#n?>~Y &[PGY滶T1y:femj 2g'8ˮ{DYDFġ ,vS7 R_0z,٦g+pI#hvs0kuxS* 2[ӢsO=Bdxg0` Y pp:hMebz3s1wTJ3LeURam/A,e"n _h ]E]7m0MZ\٢@}Lk6A%Wؓy6Gdp<}gK]"$d y8%۱<ey6l?FlԮJ:arTlj3FVP~qalhc]Da~Rdg|te{۷aI%=VuȾCkR +ɡ v QSo-D놏xz&&<8Koܦv@),"ioaQMYJI2$jaT AUkQhJ5@os7td@NZӺyv=+T[!%ImbT4P}Q!eA SZx~B_BO^WRG8݈U#0eyT!&r+jqJ#oUoI[BIJE$ TUo+hwk$mm7FY#i!_l$u@ +X˃UG:+H"|KAi4P'=BkG<4.XIņƲ,uf@87ōiPW9[X/ooeʈ~K˻+ɲFlju7'{F[՗(5MCL]CheO1ch~ [ڹs0 ]pD$bp^=e^W$vG 7Ft`mvq]T"'9Ο}u>9Ũ6nWE&'Xs[~O7cAn/Ddaw-1s\m8en{!Z m<7O"@8G'Jwj1($5SS.'N;;x[m/U2О,x!eኁd Jz|qe P]C-!D@8r#g>>>Ǜ>{>-GWNs!9Đťp-fDcf/OJ|W#[lA=錿pیfXmX( d'lQ37 i7ŭ'ɧ|L~k L20_Uȗr P}M+(vF}(au2fbT|zũAܦTºoGץ0q$J[#]6fVƶ(R@\}[':uU-ਵrUQg;Z̃>XFPOCfyㇽ"Lt*_Fl0:Vu2Bp@hB0^Eɳt%WTxkEC5^2zkt_W}BWe;z#_օw = ?)=rr؊gs~w]|@;N8O%U]aj7S\qVn(Z@YKž~UN>R4r8JCd#GlZ#l(<^/1 X|슁87 7)LU r .|ݲEE6\eFP8_sfU8+o884 &f!߄|2ld4כ$&xNJ)ަ8h6}|T] ܥdШ!(D;T$r5mzML8GN%l55^3; T5Ud*0{Κa؆/\Cbne-2ekICW)X0kRF8EsCnؒ] *Oj !\YNd0E䊟)@O=+8:2Ў*u-UsFO^|؀F. >K tќ˚q1o5LB ϟOC곶׵/d /YiKB}?M/ː;sM7њ1BC]"i N3 s?F[rpmlN!2s_v0]d8톕>,J|*ђ^{<>/m䆪 QIc;_ݖ- g6w v!A%r^H(Ḇ4Vx~@}w͹Y)jRK[!B%Z+? RDkZCPH;#u1RlgdZ6Kc+ "I^>:|ǙWՓթ|)J-Ƨ > ^R]8s?LiI(0㮖vfuӭnƍ.m.&w-A@⇰hNDnJ%C$OOH\6׍h0܈dՑ s}&k KF[8.ʛƔ)剢4mTrK45S6 AU=a4`ʬ㣤/կ_OXqSw>M_G/Ľ}`d;^x Ap V ~'[ym iqLh=._{j5kšѪaZ5)g$F{{0%D |F T G!''ʑ PPalV&扆&'V}v<. >,8#`+C:!o%rLa.4ch9~ w +2bT)6E*Yx?u/IytUn-mb3(RhF¿>L]C}hJtLvF[n mXj / YſUgg<ˏz#_tȘ<Nu*n$XzQn[χL.>2} h?q{wb[3@!lPA w)w3@9jCy`m?r C`2ӃԀx:$SQL'+OER;8Nv^'7{bSyZ,BN!eRkf@ hѹH L^AriwєlчV6?)SG%)#NTb馨1Eh 3`MY5><]ŁCFa["Xv0MB^=,7 ͱ'h0LٵJL*B<>Ӗc{_ף ƊE@STר٢o5w4 b =+-&aTwCq0&ۉp.أH* Rfx(b)8r:>c0毧<<t#.e,v)ubYݒz }J੥ z8Dxg2?k=E%7ZVTauC _9F !ͽ<;l7 ^UX1 Gh͐\s6Bu9vb{l4lQ^rʼ G6Bb>e.F{ƜfgN˨'1>Cw7-窣uX Ux]h/V\u%HEAVL"jo=#;@W-C}T')P=æoK^uϑ^\ܟV"w_V VQF3ڶ!)ߖҩMH}v}G4Y@%_ܒ_,ә&O[Иc)<4Tt1żG3ӠA$(P6T0+iȄTDbI"22*Tߤ/lJ[#bXf4nok&o9-T-гɪ4 [*[77F~R=΁#B{Dy꟬OuX}&y3]ş:ӯۢ9XJG?g?NVO m*Q6J-l À6ź$H> ~ack Wչ>08 S26oH Cney{z; η,QRS1:E|1[ R9Ȕ⍔T6v' _w߉\PBvV!Jn͏~S8df_#r2 Iҟznrvaڞ VMBe?IǕg30tN9Zrw[FScS$5&ΨЅi r}k+k"#!A*T;ִS(dԌ^~g `=VKIm3Ӏ.U| 1(~ v4CA&, u϶'uBhKZ3mYg< CvEI !Ua\M;O<㪔JO o:VWy{:"dl1㖈^@F`1ߧdžXbdʓQpT{N T\y(E$Scdv!bIN860dDS~ ׁ'hdN*~c(@;t%qc0]?˔y>UME.?P O4ꪒrU7?=e=?ٮFz̪kup"8Vm*'AL|,%iLׇr QF|_zDk$4ap2yTy0̸Q)JWia)|4Nən5ЕJLJNds7.hT/ʕ΁(K)e^`]3BoTP z(OM~GSwh[+y'JV OnQbl^c=F (^VV O=%Qsd Xl+7y86_/gtbq? xq9{z==0K.l!du.|ae@jW7 Vz 3E-&gۉ01 w W{yuӭ_1Xr2bĪj+O"6Q> ?@Ě˜ "'vW@Dz, K^t6AS|'.Li&prg xb@2 S E!x2>y̿_Is_&ƱX=AL] Y7}\A$aZBvu̒c.oQ0sc%Tp;받9㞷$%/" ᅉn̻xq{ +ORg2Xcc2݄rL^EB<01rz ߾CMX*4~>,xϚ= :\>du1Bΐ5Y"q.DၦB ÁCT-j_K&X0l@!_%\NITMm`'*!H^i6Fd䏀5S4r*FB"c`3(2ҀmnI-vN P~@!tpy2] 30xI]x[!&V %E r0d7Y`1̀oԯ5a"4Wc]` يF^T-Kt؅JpWϱEa' > 4ȗ]R8B#xNN1bgonUX,ZE&iۛoW&IrZ7r*ٺJH7{7_iVyRbmϥ!)fB}A“#ξMEbUi򶝭. P1)ZK+'+/~ޣ_//3OЋi)y}jZmg990{S,|>=?ӊ?%i?|=7)9Lg$S1 (c#A5'QnoPhPucR.Ag/4`B ԰JgMxSU5q]@!+ [)giDðvG-xm#aoYߋsR̯T-AiF<^@ikV~;f=k:X:ȫ:\jk+6,+CJlɋ;˰bgΎG/ؘt?j~<>$9]WJÄpepf|?X '(H2s(]ڌ6i4j2.+9ۀ@_GtFikX"y5άp$kc%@}a<&N ԃǎNĶڭ[Gm@Ή(N*p:_B7V ~}u3Ok~\݆K+FXMo}ɹ ZqY8戤D ل@ HZ1 oLݎ]NT1N',=:Ċ7.oUv)w8\=7`I'I]{}-Zv[%,l;0 6:9CIB:Yv8`1LlCڸf\z m=K8Eq*+\]?|@$W~@Ub73:u73OO^[֝O.駳?IOSPn`ϥdY?Ig*U|D{cѶTO˵ SJΉum`qG &\v!xW7_Y[ 6+Ѡs4M1,m&b 6|;H,^9qkl];hF|bA6:uFOb= oc-ťh%;Xv?}C?Y?+mXܱ mkZK\{AbE)sI5xؽ˂YQ*(:z1E}Q{$sh}a׶-&RT"-4 b"UŁ Tk&cحgK9 yѸ(b´:jr .^ [h.,|-BG}, M-D%쐯Guz@T5bR~~q$@2q~I s]C$$[&j\~uzkjčB`S<È5`㧺V9蝹\t  s {  K&A0`N͓@-sZ燦:1~VdƬVF=9m B´,Լ5̩}*Cxy(Àv:vZu`iq1/ZKuD,Q1 b+iY>DYT160&}a'P>1f+pWoŸDԝi -K"} O$/y0r7;a)HjѴ\Nn>OH[J.R ~3(w9.}TfEG S u ɔNMA4yI@F.ZS鸡ex84l68bBm|Dq#_ a֤G90Hj7}@x/z!Q/f$!ZMG; ]04Q0\4'YKE:2kC+NSF$JкO,5B19$R3Jm竺x}\^BUSn"\CdhHS:` yIC2 ]Kǀ:\C0YY.7*[Yi{ρ'?9FB۾v:Q9ԊРvBK6I*;ٻ tw^y(nHC(Nݜ0zelΖ.E,VE+J_Q^X`- 2kױ"/2})x} b9 jDPP+ Mвj є"j583lCS޽YYn +An{ '[?F/&B#t xݲW ͤsHYw]XYCT ;%,2R}/?\|~|)4.ep+swZX **ɲN~t6X΍g3C9$`o 1X`R}[sNXFLށ*!@*[cj6GBt`9g@kK @hD Hb,D ia W!#y.;@g񝫨˼$zEV*|}Dȏ+ ȏ7 d@)8 2&Q>a @xy9ˡcYt {keOxې$ fOU6]6ws?ݧq|'oen{j`c]D|4/+$CZ U PM&Ti؄j72f =AܒѠ Q [e[1DD@jcٷ\bzNTs0b mmWU4kӤ;C9ޔR!$>h?VD 0>߇V 、 àl74I9JO@b Pys\ qP;"V/`Om&9w_i-SHZQqNbEwIP1'YV$k>P]xQ7m]b, # [Ҿ\hxR~/XZM…ئ m y[{o)^~'m |>y_nj10e 5lwM :=?1s˶/*|4m[bG]v3tQToMQ. w Ajk/B[ +c\=ޮXgI+hvmP_-itx&\e@ G?yUB,+͕__1DGXnjʖ 4iƺx.S"'sx1i ގR)̰aш&•/@F*6zwk?[ad]冶x#Ihv#no%ZzIYBPS~_]  q CЮ_ ཹ`_64igK,b;c> .g1KJdŝx}q큡AoP:~y=nnFkJ)XEp\R&,b5~E51 `M`m> m12q·2^Vpa㺧 K8rfIHV&==I`J x d|{wS *b? }3. ` .=tS^*_O;0꿳75gTOK!snm/*98d,ӧ xTo{Wg6O"d{l õ4d% )3&x*tQ~NE*$h.b@E ٷ$ yXu)/ׁ .'m;; ؚzOV*[UYJj2 L9b* =V8u)CjFWuܗ®cg1k s9Nb+l؅%a_Vy͇ 1nDgEbwUA UPYr>\ၳ;⫊PKSO fgMm+sZZO ) 3uPQ6=U`FaXB6CuЌRpC-ω6+=A+W^.QK[=3dGn=oU4/QO>؋C4fnUmҠݏ вp/!qc\ܡ3ͺ'v˟o?|}kU2ީᖁA兟Z|]YO8?dE3%A%cy],󴆄-((b-҃-ε%dKvzNg#x~*9Y ;'Fi`zd_ŦnY]mbhS]0!T1daovTwv\G%࣌Fܗ2t&B3 >bͰ.}6pR,@P~}elٸtn\ ưvah$`"Y~QQJ@Q!# &W7\@gluԽw_FC9}H@_*(f1CWƬu"E)`Ωck}@-t]. aYMC_k4 p8wbHϻ_ƫ]3<@uᑋ|CU&PD;v6?1L$]Lp_g焧ǟ>ŏ7lqfwH_^G_ɠzUh!V09\V/1MCɽ1\r Y9dk\z/. GڕLh"X7&]{[KoA ("+ X!z(тU!a.YݮWrx kWD cCo7LS`q*-|׳/1Fp;( _- [cu'3*,h2s7pO{)˼!? w on벙TUa_NnjᰍwgZ6AHCy :MʎV6|Mn0 Iy?ovmN<Ϙm6j.@`zq;z64NH́:罔Z(2%Oʗe˽Ȭ㯽$39e;۴mH$?s]?b]M,a`l|0͟PLV{-bKc,Kmy%PldYGUyzK.!>Ѥ +!vhW|E8FQTT]mO4}yzTsG/0jG Ǵƃ/%9rrY@&@xSԚc`&E.Aԝ& @XC ıZljݡp\߮X{xCGMJW`( ̻C Xjf)LSrFY5~w0٬:od@S.^iFF\=xk`iᄌ:{Qǵu0RQo4RCKA[vuCOxU#,%P5{`lFOj6=W0xWk~_<>\rsq4zx׷iϻ'<(f7?. x}G?~uqvss\ DZGHz//S7S?Vڜ`[W 7ki̗l˅M;Kqa PIR Txq^q`P (AzѦYǧ@ xM*w-*LCϧ=}"rJE po}'ԟo:R5 cᵺR6\'[仔gkG]̬ܡ DmZv !U|LOiceO?:vENLC2?7 >O "j0"剙KAߌx,xqJ^Ё9pyNB w[\I/cޓq ;Zp9۹ܠ7o4۶@{zʥXM> f"eq3JF Q$;" `kAt}{gMX@'_Dk!th lZ**MggO9V |ivsȟsUcۢws-%gΫ$EQ9LX f P9 ~R up d;.^0c*o{MUs- j_q,itʫ(y( Z]8J\=Aчp$O 6|9h)ORqf#ԯ~+2f͹.E{% ʪe ˒]rL&&@Dyv㱀aC٠1lV՞Fj-kDQЀRrִ5cviwv鍁(An#&XkH Nk@<)e^S X0xÃE5ʇ(m|,ٕr+^=x C`o7H|bo{+Ƽ[mH{me\Jz<]#%EGXX"[F2, x;Ldfr͕70*%VJQU*A9(R|c+]s% k|[Dv! }6|L\kd?'- pU(+Epa1Sw#"xH:GiK>,w܍=2l|S=D ]̋p\<獔ZgPD(f2qZp[4h )΍K;Ru-WmPR^ #1G:_Jˈ|SuxƏ9#Pa8΍vϾmo/!jX­(*"bH,\jTLC52ò#qC+`b5#f|3&ʆ !֯#@2!l0[%hƂ6TWq4kw1d3@ LwbFІʚQݫ-5z \G^sAK1)#ļx'kH)2y ɖ=1V"}bg ŪhB 0e+(֑c.j+.…Iro/4""g(F%b=JQdc|rɀH`_{#7.$gM춂v;M~qc8fϾ>!qxqڳw__]~~4}v5svygr8vv#Cɝ?\=znNwsG0# bFQLVRHt a_m jtokmwAMU\\l쫽_gfuWk9MG-eM\2%"b|k u tF_[ADbg<DX,sl:bp ]FԞn/Vpy8e(-HU)K_#*ZY B=mo>5+=+ Vbhd<۸0o-`[( JH2R %_v0 df])f{WU=Tto O>_X ru]!Z=g~V8O]مZ8ʀ td56-t9W=fh*;͙_`!Y4'x, p^x (p08/ -H0I+lJ^y!Ý)s8I)q}{vC""-&#t=Oϵc+̉؊ c vMJM {kP -Kע9wgDo"!hk=gJ bxEmS"*XW{Dā`0(U[>BA|ZM FP#覲 +UA0pvw-cˏox?;R4Tf_!f?9Μ`1U*KZ-0Oa-. i .k!lm5@ZF`@% #6= x8- 4Rmwh%Dx3 Ps!P; 0 UT2F̎'&uv`\X ={TE?33D݋+^ ʡqZg^Ľ:0'`KC/0pkpVLBpz@힥=؉)@mVE% UPrY;(8B)?6)JV~%oesPмc@S#{v&!iU7;KK CK5(iQ TK3'QWj,2cz^W##sd(&<*.td?Fg2+ԫoiT~ݠ{b5sTFA*x"y}ׇSbRX΄p|}+6#J.EfudcW}!Lzú%[X@Epۀ=j*=B% X KrN ]@l6"{ T֛%+CI&:ݳt}"& kee6vaGZϊHRhP z0yUȩWDL3$<%Q2O/(aƕC.>-vn bǒ򆒠،%c:A%LJOOG'-U@K].beYi7%e]"! c*hoWv ռot|u ހȚxĉ&YJtx{w.C`Q<^ƠRm;dn1h<ꐕF~/{6adŪxl_% k4,rUY|^1 pZDbWmk {|3T# cV:l{RSg ,oLfC*"`9\&`?AU.-YEJ]Sua$RtXAG$9֍.[tKZk,g-B_4TjMQػ!܉xBV\F!C@$;< Y/ ޵e>9b~yUsqƚ'`6~VC҃}G}d i7b i֗CG:ci|8#>omWiJc!#(>z5ƔST)|bKP v޲w9[ܦw7@G`ܟ 0ͻz\=" JVk G{8ԷIrn4,EzC¶?UP躷`| k|2H0~S3=TAy➔\uf"lၒǗRlNEؾ` R>ED|;fDN/6as^` o?-fm9'Jз^.||,٭ >: lVQ[/AL2Qr P qoX!g/G^]:qޫze|lq_/ q>lWe(O؊`f~#tn3DrƈB$4|vc+gfJޗ- J삸%/a,-_ڈ\`hF=+#~M9J(=,E(9&6K;Zw" Kn/4漲Q"Th8&KJQ&6Ӳb9.=) ٨㢔1%a /hxrQ?n?1{.o\}HsλF,d[m`_8y>f[YgR o^wa_zM[+`˱/;t~ ;3ji[5~i֎w=j]KxHLxBqJ6OF!0uOԉNjjI3ߑJҕ2@v.ї,@ګ4pcd(^eJI8E[_c@bc(q*HFeUgK?Dr/<s.m čq^NzqҫW05WR 5Єps=xKv7ԃp~߃싺hoZΩB=~E2G5[,3+u+ۈI̢T~3>d"ԗEn3:1ӣo Z3q[4B(8=URH= s1@Wȃzb\GbI) o:@E:"D0(0q#trUo_Ɨ-k̊~M lJ |gpSWiDT M!F%`db=%l %Qp*m|d 0 z/}j)͋(7鄘aP #`_\4e:3Iw=,g7og{HA/=}mKo5%Ç;,,^"a{x n"S8UEܓEZYt+f"8TT2J@iJA,Hб[g'i]㕰ׄp MX}ӳap pp=6 rqލ\m|Jr_XTnBTqzUMAPn Qv(!%g $ܭM9iVx? >G|bV6.%O)̓ z2d|(xL*eHDࠇwoۀ%qMk7q@~|wml1 !.SsAjze-75^yrX؍TYn/ KY,+(a cdBMӥ$V@ʡIoon8aGG Y ^[qʶ+ȖaHjeЩM=ё/j[ˁg@z!X0 `װLU'Lj+, "Vz䶐~TxI3UsrقIX㜲闪<7zxDz-)ڇKމSu%"Go zL0b)0n xLi {dL6Sd:3w0{ʸX7p]ȣIqq@DLck[G^-]{FK:fBfqNg7:Ngw|%QwxN1Gx2F2T62ȍ@Bn3I*}˅Ob-t85q851oC580( A ,j^O,مꥼ_k`\5̴̪mJ鲇`?2|g2_\>"8k7jvHdqkq}bHI&>kEISm*S .X`a9C aTdN/#t$ @X\G(u2N Bݶ:&]7]GDA!H6 H |1z۟?pa0teYއ>sRsz 0>5{msƫS+ {B/sW% Ի [6" Nvdd<7PNiU8 wI % ΅:إ8Ԯ-dN҆j]?ynO_eN18J]<) ?&DŽd;cgߞ a뀀>T"k[jyB ̾'Wq;f>uv@ -)j8NnGw{4IVm˷c65L@~b(pp c+t_ʘ+=GS~,O6,QQD,LwZ`j[as<=t\^Wuvu#jTgފLU. .ba~`)IW d!yjZcqCOcJVAƆSb?;[it[`J3nr(vt #I탎 J?R-"RdB|i؎|ni;ڝ]~+d%+U9q2S%1@z%uNo{%s[w۠H#87}5ckliaڍe"#3ԊW DGm*yP)OIg9̐ ^(Vauw6فtj;Pk@"_~3TJ,ĞlhcȄ h f⶘;"9TԔug#7!&'}_dlֹocn&$@XFj #F"D ] A?svSYq[Yr6O<'M6ݭO2ƅҚGqM7ݭ*"2u8b-sdGQ)7PxQtb(6wJc1@?B [rIb,Miq&T:1N^9*/r6H2 IT#4'J81[G'm"ΩQ$dO7 jė8F*0-=HtR-b00) Yg" `CAkTO ELRBaϞJػn`dBZQ5#t[(Y~=߃7FZ2ӻq_2K`rj gZx!aOϏBqM("ӣU X8z9v.+&z|˞6ҕw864LWO^zmkxC !*:mj1PVfL@+m } OgM F\netbsd-INSTALL_C700.debug:d@h@#`@*] 5M <l@Kt@tnx\|   4@ p@0@p@@@@82@@(@S$@f @x@@@@8@@x@8@d @T  @D - ?t_ LD(@]L(@`s(@p)@ +@p,@,@$,,@d,@t -@-@2 G<.@RT.@]\.@Ti.@sL/@1@ 0@d@1@tT\ ^\l\ y\\x_ 7@$ 8@,L8@:@ ;@;@$(\< Nl( a <@s>@,>@ 8>@P>@h>@>@>@>@>@tC@ C@PD@D@ $F@9E@PHF@4bF@0\u\T_ G@H@H@H@H@LhH@dH@<(L@HL@P@  L@O@("L@/pO@l;<\ Q\\0h\y\ 0\0`\\  \\ \|  #  0   ?_ GP@ R4P@b8P@n \@T \@k \@} P\ `\  \ \ \  8@d د@ @     @! @> @[ @s @  4_ @D @ x@p\\ $@' \@/ T"\@A !\@Q !\@b T!\@s !\@ \@ \@ T \@ \@  \@ \@ T\@ "\@ @| H@  T@`( @8 "\#\'#\ D @@T @@g 0@Lx |@ @@ |@\ @@ @4 L@x @d (@@@@.@lK<@f@(|@4L@H@4|@@xA( A' A5 ABAL\At4#\@t#\ 0   $ ($ b d f f  f $f #(f )0f 6(g >@g I`i bdi xhi i( i@  @ 8_x x @  HAAAA$BAD1CA<DAEEAS,GA,]XGA fxIAs\JAD~JADJAdHKALAdxLAMAPAPA\SAxTA$UA$VAVA|WAfAX(fAT3P^Ah=^AlD$_A@Ld_A<S_A[8cAbcAPj(dA|dA#\#\#\#\ #\ $\ ($\ H$\,t$\ ` d 8gA@gA HgA\gA/LhAh@hApX$iAjqA<{tA8$\@tA,ltAtAvAvAdB`Npz Otz _t{ ,!B<lh!B<z!B8!B8"BTh"BX"B%B8D$B4x$B4$B{ { l,B$-Bp/B 0B0Bd1Bt,1B62B ?3BTG 4B^ g( r6B$ 7B(H7B@7B\:Bt:B0>B@BABdBBt| GBGB$,GB((TGB7\GBH`GB$_GB yGB4GBGBHBlIB(KBl(JB$LKBtKB0!\MB8x8 &\QeB8e fB,y8fB4iBPhB"BS"B4c"B|"B"B"XB\"LBl"B"Bh"@Bd"B"8B"BD"8Bd#B#B@#BP#\B< #B *#BX8#`BM#tB`V#B(b#Bo#B@y#PB#B#B#tR],#S]#_#B@#,B(#TB#XB4&B$ B0$PB$B)$B5$B0B$B P$Bk$B<v$B$BH$BX$tB$BBd$|B$Bt$B$Bd$B% B%B4+%B ;%3OD`M3QD,[3(QD|h3HPD3XPDq3QD,3x](h} 3l} 3p} 3t} 3_3H_3RD4RD0SDd|SDt4SD@x]44 y]@4(y]z]H4z]P44z]LY&z]\4 k4}  |44iDP4iD4iD4iD4iD,z]4z]z]Y&{]40{]D{]\{]s{]{]4} 44tD4ET(>E@5> C> L> [>İ k>ܮE w>E >E >\E>pEH>E0?E@?(E %?4E07?dE8I?E _?E(v?E?E?DE ?dEH?E?dE?ED@ĶE)@`EhA@xEN@EZ@ j@ ~@~ @  @ @ @ @  PEw>hE @E@EhEdEt@\ElG @$ A( !AE7AELAEbAEwAEAEA_AE\AEtAXET BE/B`EQB` F]B]hBЏ]8?Bd rBh Bp Bt B B4 B8 B BpFTBFCF4C\F?C4FICFPCL _C@ sCL k>9F w>:F ? :F@C`:F|?:F C:Fl?T;F Ct;FCLI$GZI%GwI|&GIp'G,I'G>Gd?GtIx?GIx@GLI@GIHAG JBG J DG1JDGDJEGdOJEGbJEGwJEGdJTFG@JFGJGGJ\NG<JNG0JNGTKpQGXKQGd6K,RGFKRGYKSGdoKlSGKTG K(TG(KPTGlKUG`LVGL4XG-LYG<GL@YGDaL( tL, L]G L<]GLX]GHL]G L]GLL ^G$L0^G|L^GLL_G$Lp_GLt`G|M`GMaG!MdG|3MdGX@MTeGQMgG\XMPhG dM\iGrMkGMnGMuG MvGMwGMdxG\MyGMPzGM]M M@$ N$ 'N( .NG@QGJQp؁ WQt؁ jQx؁L oQ؁( tQ؁ Q GQG QİG4QG\QTGtQȱGRزGXaF0GRHGT7RGxWRGrR G~RGRGRGt]]˒] ؒ] R8 R< R@ RD SL ST ,S؁ :Sف NS k>0G w>PG >pG >G XSGkSG wSG<S GSG(S;H TFHT[HT[HU[HU[H!A[H!U[H7U[HNU[HdU[H|U[HUX]U_U[HUllHdU@tHTUtH VHH<] ]ʖ] VHT1VPH,@V|HlHdLHtLVHTVHdV]jV  rV  ~Vpځ V߁( V ( w>H VH|V\HH VH(VDHlVH] w>hH VHVH W@HDWH%WH9W@H`CWHXWDI\eWP nW xW@ Wp IHW IW IW IW IW IW I0W@ IH X IX(I$X(I6X,IEXI<] ] (] 4]TX aX nX( ~X( X&ILQ0(I X<(I4Xp(I X(IX5IX6IB] O]]]k]Y&y] ]X8 X@ ]XJIY JIH+YhJI=YpJIOYxJIdYJITYJI YJIYKIYKIY LIYLIHYXLIZtLIZxLI/ZLIEZLIPZZLIlZMIMIdZ`NIZL]IZx`IZD Z]]] Z]8Zp@ w>fI ZfIZfI[fI"[fI7[gITS[XgI h[xgI~[gI[gIaFgI[gI8[gI[hI[hIP[8iI@iIdiIt[jIh\jI0%\jI:\8kI<L\tkId\lI(z\(lI$\0IPL] \  \  \IȁI\ЁI0\Il\lI@\IT\XIT]I4]4I"]IP?]IH[]I$5ІIf]tIxq]I@]]{]Ğ_]I8]4I(]\I]]]Ȟ_]ԔI^]^̞_(^ I;^lIhc^]L^О_w^I  dؙID^I\^0]^Ip^TI^I$^ȤI@^I<_@]<_XI$_|I@3_I@B_IX_I|m_hI_\I8_IL_I| _\It_I_IX_,I_I`(I|%`|]-`] 7`]HA`] T`] h` ] {`] `$]``]`]8`Ԝ]`](`I$`I`I`I``Ih`]a,] aI$aI.aI=aIPMaI^a8]<hat] waI$aIaIaxI4aIa]a] aI$aI aIpaDI#]Ha] bJ,h>J(h?J\h @JDhd@JhPDJh8EJdL]]hh]0i4 -iEJBiFJ0Xi] ai]0ki]xi]i]Pi`]ip]("-H it]Jh7j]Ji^J8i^J_Jd_JtiX`J,]i]j $ jL_LjxdJ0XjdJhdjeJ sj0eJ jPeJjfJj gJPj |Jj\iJj nJ(jpJPjPpJ$qJdkqJ8k rJ!kzJ{Jt3k|JD@k($ XkD$ ^kL$ qkp kt kx kPJDkJk]kt$ kx$: kpJ@kJ$lԇJDlJ'l0Jt=lnJtPn Jd anpJsnJ|nJ@nJnpJ@nJn,J8ndJǡ]n]0n* n8+ o* o]&o]3oȼ]Bo]Poؼ]^o]oko]yoo]o0]o]o@]oA]oP]oS]ao`]o]) pp]p]2)p]9p]Hp]Xp]gp)0 up+( ~p+ f4| p w& pJ(p Jp$J8p\Jk*dJ pJDpJpLJ`qJP#qJ 9qJXLq`J4`qJ,tqJqJqJqJq]pq]q]PqP]@ r]@rLy?L,6y|]yܞ_ByX_ULnyYLzyhLyvLPu xL8y?M(y AMyCMyIMDyXIMxyIMyJML!zLMHzNM`bz@TM`qzUMz0VMzVMN&]]&]R;:]Y&M] Z] 4f]t]] ]zMzTMxẓMzMz\M0zM,zM$zM$zMzM {M{MT] ]] ] #{M,{lM7{M87| |5N<] |UN]] } YN@)}](>}dN0n}]I}H> W}_z}$eN0}]}N0}ІND}N|}N(}N@}\N`} } ~@ ~N%~  4~$N,<~ND~NP]T~"H j~# ~ # ~ ~ ~ ~NX~ N~N~N#0 9N N,$ \D# ]lx% }&P h&P & ) \8NXՀNN`N`-N@],  )N,?N,SxNcNxN8Nx1OlN O4ʁ@O0xODO$Op"O3LOALO|Q]]b- vd_0FOOOSOǂIOHقPOh_XTO!VOt1lOCTnOVoOloOpOLpOd / ȃ/ у/ / $/ (/ #( 20/ :4/ H=/ SOk OvO|> @/ L/ Ȅ@ ӄODOОOP+ OPGpOpOdDOtQP/X a m__Ņ_O@OL$]6]/0 +@ 7D BOMO[O`ktO rOxOdyOOO@hOO<POxOƆ\O<܆OOdOtOL] U] `]Y&p]~]|? ? 2 2 "2 *2 73 C4 U hl_O<4O8O4O‡8OЇOXQhO cO vOltO,ˆ]\? _؈O O0OD4OXO #O,[(]4p? D_mO}O(OO ʼn4 ΉOOXP01H]?( _DPD\]W?( j_Њ?  @  0@  _ __0P<lP'`P'PL`P4p]'X@1 /t P0GPF:PZ9PmGP|EPX>P@PPċ EP؋ JPX4BPl9PxMP.?P?=P]=Pw<8P0 7P0X;PHP4CPIPLΌ] p_t_NPAtUPODQPQPfx_|_ȍYP\֍4ZP8l[P\[P5 5 5 6 #aPC@bP@TjP<kl v6 6 6 6 Ɏ6 6 6 $6 8(6 S,6 m06 ~46 86 pP pPÏqPPӏ rPl( H6 L6 X6 \6 !6 .@7 ;XxP|HxPSxPt\LyPLjyPHx]}P}P| e0PPPŐ]_Pd Pt֐PP XP$|P P0']S]@Zl ll tl l  ˕m  n0m  'Pm  Upm  m  m m  Bm  7 7 8 8 Ȕ8 ڔπ π Ѐ Ѐ _,_X_ _$_(_,_?0_q(P0PDP\PdPlPLЖPLP\`PTP,P< P<+P05(PAPS`P<c@PXtP4PpP,P\ PɗP,՗P 4PxPPXP4P4!LPJP86, L< _= i@ xH P X K ˰K ݰK( L L  L L ;L SL L  h< uS`S`SSXSñtSHұSSXS` S` L 9L S<)0S8SH'`SLS4GS[SoS< S\SdL N Dz< ܲ< S4ԷS@S8&= 3= >Sh]&]RN [N eO o4]5] SxuLSO O  @= 4_ɳ_SS58S8\0O cT4Tr` T P _TT۴T<T8tT'lT|=TTTexH q_\TTT$׵T84T4#Tp4$TT-<&TH,P W= a>  q> |H)TP)Td)Tt  0P  PP  Ƕ> Ҷ> ݶ> 0T@]](-> 8@  G@ Y@ D5Td5Tto6TD`6Th8Th9T89Tl :T4@:T4ɷt:TXѷ:T;T,ڷULUvUL^U4r8UXU(UPxU(UHUU4̮UܮUU+ UP<^S^o^^@XU,UUpxU4U4U|U@Ud UtU#U@+UD9UDUQULYU|f<^vP^Ă } } } (U@'Q^@؂ ܂8 8 pUV4V4V,^<^ML ЋT TVdVtV} dV@q(V@zhV V|V| Vl Vvd!VLX \ } 9} <&V*V\^ ^ 0~ -~ U~ >_b5V<t5V,6V446Vp7VT8VX9Vd9Vt0:VIV$KVVV.^?m^ w^^ ^ X !| / >^VH^VT^V^^Vn^Vx^V^V^V^V _V_V_Vl_Vh`Vp`Vx`V`V `V`V(`V6`VAaV<L^LY_{_leVleVpfVxfVgVPhVPTiV, iVjVd"tjVd1jVH= kV4GTkVP nV\oVPh^Xv^@4^} E E F @F F F F _wV<@wV8!xwV4(wVv`xV1hxV8@xVSyViLzV{zVv{VL|Vx|Vl|VD@}V@}V@}Vp~VVdlVt(VH^\^"p^2^B N _ h t _   V8ܪV8aFܭVWF(V^^ā ȁ VvVv VLlVhV4V V$VVvVvVL%V@14V>HVK\VPYV\dV8m@V y`VV7VVV@VH,W@R,Wa-Wt.W (/W1WL2W2W 2WhT3W,^^( 8 H '@H 1H VHH A DW8Y섀 \ h@ vH 8 ( 3, XUWT4 ZWT[Wd]W`^W_WDX_W,_W( H $LgWX7gWHhW@VhW|opjW{@oW ^^^^WWDPWW8 @ D %H .P <I KI YWh̶W^^  X \ ` d h l W,WT W0W@(W4WpNtW,YWDfW\r@WW WW$W0TWlW8Wh WT-`WEW$S| a jX<z8XXX@XlX4X\XHDXXXLX) : K W h {   I J @XXXX08X$\X, XTXl2HX?P XK"XW"Xdh#Xhy#XL$X<'X +X+Xl5Xt/X .Xx.XD4XPP ^_ ^f ^ p ^ ^   +0 5쌂 @0 K  W$ g@J sJ K @?X,l?XT@X@X8AXDXEXDEX|DFXGXKX< TKXPMX NX\%SX2[XB[XO\X8^\X4m]Xxh^XoXuoX8oX8Xx^^tX@XȃXЃXX (XpvXLvXX(X<9XGDX<XXhbX;|XtXmXwX$X XTDX^^X<8XD|XuXX8X$Xp^0\X|@X\P4X_X p$^8^L^`^^xXXt^__ ^  X 2DX@XpNXxn8 z@ XP@X\XXtXH^ _Y Y0Y&Y6YE\Y T|Y^HYgXYtnYhu4Y}YXYxxYTYY|YhYHxYP,YLYYY@^D H L P 6T oX PD_/Y/YH^ H_|5YX^ d^t^T4( L_<t:YhC:Y@TY\n?Yx$@Y@YAYBY^,l DY4DYDY` EY@K DK HK dHY$ HYHYd*HY<60IY(CXIYHPJYD\p KY<kRYhJDSY+TYStYYmXYVYh]Yx0ZY\YpZYdl[Yx[Y'x\YL\Y4]YpbYLcYpY w>Y >Y >ЈY Y4HY$lY(tY<Y PYt`YTmY@ċY,k$Y<,YYY(܍Y$ <YYD'LYLY4 ԎY($Y5YlFYWYpqY } YY HY#Y ^܆  䆀 솀   ď Џ K K +K k$Y<=DYJ@Y`]YtxYXY^@^^@؏ 쏂  Y\Y<,Y"HYl4YDHYX^0Yv^q ~쐂 Y Y\dYY(^ _Y8^07ZdN ZD$^ W w>Z b$ZLppZZZDZL L L $Z,Z<ZXZ "xZ 5Z>Z<MZXd@ZLZZHlZ@Z@ZdPZtZLT&Z$^  L L *L B`(ZT]p)Zo)ZD}<*Z*Z8$^       aF\=Z@Z,,@Z|@Z-4AZL8AZGAZtQBZ_CZw CZCZdTDZtDZGZPIZ \JZL%^ %^    ( Ȓ В !蓂 4@L CL <L TL cfZ %^ w w>hZ hZiZiZiZiZiZiZiZiZ&iZ:jZOjZ e8jZ@yxjZ(kZkZLmZ(tmZ(mZPnZpZXpZd\rZdrZlrZd1rZHEtZh }ZtR}Z`ZuxZHZ4Z(Z\ZtZxZ\(%^ 5%^9%^I%^W%^ d%^L%^,  )_LԑZ8_ v Z$Z@M J$Z(XLZphZ(ZLj&^y&^ZZ88Z )^S)^h(^|(^(^(^(^(^(^(^(^(^((^<*^ D*^ L *^ T,*^ \8*^ dD*^ lP*^ t\*^ |h*^ t*^ *^ *^ *^ *^ h+^`,^p+^x-^x+^-^ +^,^ 2+^=P-^N+^Y,^l+^y,^+^,^ +^L,^+^-^8+^d-^+^,^*+^8-^PL+^ Y,^lt,^~+^8,^+^+^+^,^O+^$,^ yZ-^`Z(Z| Z,!0Z1Z@G[|c.^ ĭ[[o[.^ [0[8%[N^ O^P^ 0P^@pP^ R^@'=[D.=[ ;2S^@rW CxJ[\tQ[,~Q[,tS^LT[$pT[TT[\ U[`U[<T^j[Dk[k[1$k[Ck[\l[4nl[\pm[$T^ T^T^CU^ ĭ   $ %P_[$u[ou[8v[4u[ u[v[0v[|w[ w[(w[; U^RU^k,U^ LU^ ̭ 8 < T_XU^ aU^<[L[>P[h[$lU^`[[DL[[ [8+,[4;`[\p[[x[[8L[xܟ[<ę[5ԙ[U[k[h[ [[x`[$[0 [(* [B U^ _ U^} U^  V^ V^ 6 Ի[xN8W^ fXW^hW^ |l_,[[ttW^|W^X^@_4_П___D_P_` M    Tt!Dv  0Y8WBFL{OV(a iHwYXJXQ|QQtA0( SRV`GX|E`EcI.4VXT,9MnRMnnXRz,[C4@ XR $hTT4S  A0@~[$K xUp>E8CT3DYJH0O,oxW`VT(m(P wM[ St7@T  $S| T[T Jt]Hx ^Rl*4cX?NxHd#OlVBOi\BXduPV Mn4 ^̀ L^Q[ lV@CYLIYJ`Wt hQ|`[[(Z$ ZԆO L,Tp`Q H~OXR#@#W|,\VPQ 6>WP>@RMne,PXscQ$|`C@DOI eP< lO$̚K$KVMnv .v BVPW,Ql` nMNI4 wdMPT80qJTܪK 8PX Y$Є[$MnM`, Mn<N[VԂ ZSpMn4+TpB4 ^x[SVMnFhLQQ SF<!+V|,TI,A@N V|V5T`<)ByП_4S4WtN=EBxhz v @ 'H [7gOB]$MH1C,YAe}O4rMnX`R mRxZ^iQ$It8wXpMn[ F@.EV,>h` OT/B[d/BgG,pOIz T08O\wNMnMn XMTWwRH`\&Ik} r@ @K[ lxXP$LV8Bh Zh]LDSܪ  'R[JGZP_ztO  E tB<yP@Sz[+ @[T<[S  Ā % ,Vd 5 @ D Mn[ VLP[0d  t }O  pZ(  NhРwP ,W  C< HEV< F t ^ M[!PXL!P !@,(!4N2!cFD!!LV!@Xl!K8}!a !pS@!|@!@4!G!|Rd!@!x0C!4P(!LrX,"pK"ID'"MnK"\j[<W".TTp"fJH~"L[$"^@"S"S "hSl" "Mn #I#W1#X0A#0a V#LHDs#p]#dEd#(H#,B|#/X\#\  #Q #O$#H$@0#Mn$ЫO$$X$DzXP'$]M2$bJP?$!BU$(Bm$ \t$F $p $~[$  $pP$$]$RZ$G%@:U%[Y )Pp)T)جY<)<, )O)ɀ o([()>Z*Mn*X@,*R\u <*,T$O*@`]*Lj*xQ0F+Z}* S *(R[*Mn*< *6T * Xc@YF*tlPx`#  *PB$+W04O4^4 WD48W4Mn5R45dYp#5S(=5R4L5tMY5> b5Tl5]Tz55 5Y 5,R[58@WL5kE<5Hp 5,^5|  5$Ox6Mn6 '6Mn>6Ȁ T6À j6x> u6`& ~6{]061X6xYD6([D6\v 6z@6S 6^ 7 S@ 7Mn!7#T-7N`97\PB7LP7(Yb7S p7LR"<2V<7U(7Mn7N7X0LD!> IH0>(-T >>[J>,/BU>x2A`>O0p> y>.N8>Mn'Z[,>< >eJ|>[[>yP>H I > ^>dA ?6R? "?8E45?4UPeQ8@? D H?$VlP?HEDg?CW0r?@ɀ ?]?HJ?4QV<?>L? ?$H$?PQ@?N?|OG[[@](xo @< @9QD(@XJR6@,WdG@ĞS(U@4GVP]@LTr@X@ăT@tpU@ D @$Ox@ @S @`RSXAܡ@ !AG8 (AxAl;A`@T@CAWhKAO[AQrA GAK AF FDI &FO45FT@ RFW_FMn{FWCF"EF^F`CFЌ[0FMnFETHF@ GD:ZG[xSE[Q[[^a[Mn[@Y[4YW[Y[B[a y [[\LU\pO'\Hd8\1V4F\|S<Z\{]0p\Mn\TT0\ \,bS\LS8\D> \@\xL[,]Mn&]tZ<5]MnZ]YBtWm] "A](@]~T]gZD]3A] ] @(] Bt] ^RQ^Q '^ `R3^wOTA^}[L]^Mns^] ^h; ^W^8 ^3SH^CV|^Z@^Mn^HY[S _ E,_`@C,,_]A_XZM_ ]_dXOd$W^dH qd WEdhI dtHdl@TdS@d\d`9 deG,eDSlFeyBQexFp[ebOhe[xeB(e eh ^eSHeaIeYTeSHpe ^e\OfXLf> *fUt5fW@fClJf<8F(VfYbfG{fx f@fpQVfX Y(fZfKdf0YfXxf[gnKpgPZWxL? g@/g< :gKHg}X,UgMnngMnKgTg@gTgT#ZgT0g(M,gN0g4ZGhAHh=OL0\[+h ^:hRJhA|ahMnh}Phhl@h  hр hTPY>j0 MjQh^j @fjP mjoDj St= j\ADj jY0j]j|> j8HWjW0@|RPjSkIkjD,k~XD9kCJkJ8VkXAdakK[ xkWk@UTkSk v kWPkz[pkldQ,kS,l8SlMn$lZN3l$@ Hl\A4XlXHjl0K|}l^K1@l,OlDSPlW4lO@lmQPmHU [0Ym0 cmUTkm4T~mDSpm,R4mBXm_@m &Am*Nmp!WHmnRnA#n5n"AEn X\n@]pnXAnYnT,nYnP_ndKThn1E(n&Wn f oWX'ol 4oJJoMnfo$BwoY~oPoJDo,4S$o ^o SoSoП_o{@pX[T pԀ pL6H8"plX\4pCI ApMngp0R,|p9 pQ pL[p@pQ[pTp pM$p SH qDxLqT8 q P4qt|[KqB,Wq kqV|q@ q[\qbIiWqXSqE,qdZdq@@r`+ALrS(rP[0:rXXTrMnqrkN}r|  rdUrS(r^<,]r\  rwT,r0 rQHs$Ts_+s@ 8s AsW`\sQ[vs\  |s Zs"T|sr[st]Cx.<;Z<sMnsW  t[@tMn8thWQtĮY<gtOtt̾B\tQ[tRtMntStMntRtl@u u8Q,+uhX8uU[Cu4ZMu\RYuVlsR,[[`uX nua u]<u[0u^u@i uqUu0KuP,u| u^ vM\vplSPv`R(*vzY49v8VGv$m[LivdS wv(%@vȪH8 ^t> vlO8v0DDLvRvfQvl@v,RQvMnwg@wu $w ] -wD^Cw^w VLЌRjwZQ8ئ[\- MP>hQLQt]LDhDItwTJd YEOZMnхXF߅E<U M U(([@@W0  AZ[oB(x$VlY^`LR4džM[O(dO NHR@&H8D|1[R8H M@NH`@plM}  [xS$YXTʇY@RX(b(Z4u$YB4YPJ[ ZAԌtA4<XT @ǀ Mn29A?<[4SAXgPT^J$uQ@n(Q|XF@0F,TD8^BDu 'N|MnԍP]<4[[M47T PUPz@4 @MnZ\PVb(? j+Adx0", dQ [G4/ZDpQXHWT@ӎGTێR KT`TW,R`V<D(NPX  &8FV|.  8JCP[0VPb KHn@$LT@uQH'^EV0[ ЏMnMntT lO( OX4 RpAZN0`4BdqN}]Dl<~[#Y$ ^@ʀ 0d@VW elE(x\ Mn@€ L] or[T[ƝbPٝ %ZHX|} MnN8245R=OO Z'SxpxYxh%S,TL h3AF\z@ʞMnQYT8AM @dXR?[X9 6T8MlK^'@xkU}؞QH XR!ApĖ lXɫD٫ITXhQ ߱Khh eX\ %K(DX$xS*LA=` RFZ[$OTRP^R[,w^~JMnXZ4ѲdVH`R Ā hR,? U  `IzX*B(DJX`@Aó Jѳt[@ݳMn  nXJP(GY-F` 00E I>ZVY _|mXoxhCd|PT,hUWdJSSδLQ[(Mn,Ra h W,J`1VaG o]h\S1KhhZ@0OŵLW$ҵfXߵSLH%K 9ZL@3MnJHYTIdN,RPEh`DGSj  [@rP PZYTEݶMnRHY$Q)HFp;$SD\ VNhQS!dB$g mSh|xQXBh^X@Ƿ`Y4ѷUx[$>pT&^[D$d@0;L MMnc؄C,s.X@4IR0l@$@&K]hȸY4ҸMnԧ@ ]O 'J6HBTRM^TP k8 UThUo[HE X? F,ȹv ߹8J[@Ѐ  D \J8#$S-8MZ?xCQf@Y\K0d[tX*WzX  [Xt2Qx&[Id|  ƺ4 غTlM4WL0YYG )[:|OKA0*oFdV  XxSh3dAPChhZDMMnkMn}0WLSD2@GhP>  dkO 8v `ZT@KO,HE(`W*8K|9]<J ^_ k||GwXW\A9CJ|MnC$)J3X[x Z2WlE @DTRPa h\)KxtZh~OMnc@PW 9 @آV0BST,!O-IlB StYT 8\[[c]n wXL$hUTWNXLM`OB`BT$ HF(UDN!l]4P@ JHlUlSC0cPF$vYL,z[0S4h SPxV@hT 4HSZ0 UTGZ+d$ 5]\?, K8_I@WFRfpXTq0VP|KKO\G4/LMnR_H]]&Q\:8V\gQJ`$S[#O@j  s|Q$}  LAX[ddN|PD4@Vԧ@Z@DX(F$@xVP\[[%lف 08-H @IpJMn`LI<hdQzMnlI[@`S0ZxdA ^MnOTT ID# 8XO4XblXoha xOZXR`QX(lC pYTZlJPP3AHX8$]@5MnO]fxA4wSUxXVWUT`  Mn;p R4 [t pkO85NFCL[MnkC uMn dkDXI0Mnԧ@Mn Nܩ  !8C2jYC4cRMdKYVVpjFTr >KL(XlOT<@.YcN (Th|@8 hTTM`[[(VWRM 4a ^(GNkLeP\BN\4SI`DZ|@À  `AHHQU(X(N$@H4QQ`DpȀ bP2U,VID`W84TH _OdH " W$:]G^^^-Rd:$rP0gStȁ@(XXl Mn0+H8OZ[[4(.Z @3ZAQPT5S$e]x~lX*W\Z  BPO, ]$pSH/dK>B؞ A$]$HgXVMnu[0ot[`ZK Mn[^MnP 8 ,NpHH]\(Al-|DDP8hJXRD~@(bXTmB`lYLH&W(|;E$bQ4QXW\fJPQX pbM'4yXT1LU<  E4 Q[n,OtTQKDMntPA\@0TVDx W$"bP5X8GT\QB$cL qF} nP4  S4UWWlP0AT,Y-,NBXW$gUhPcC<}JTUYVh  RdYZ,x}SBB (](9 [@ JP T kI`{̀ M, W$ElXMnT6 W0SF{P[0 SdY(X\VT&(~ 5cP F@ GTHOd[Hu8 NTNLMnUhXEԧ@Mn;O[[4@@E X]( CD%X7nS\FIT]ؾ[\lR4yU0T%LLLbJT\W\lK]pA0;H @X Mn)X]S:NXHK0Y bS\wh^(< @_BxWW4P E\*J@@UMn7 [D@4c@\G\P QPT$_  oȱI8~Mn~@$, e@Xi MnU@@<IH 9 ~[Xftr 2}X0?(SXM ?ER-Lx`hIlkXRu^Cx/S }\I<MnxrX,}@8]x@XRPL( [DRdiP qA@_ l)[TpVqUZ[,O XRIU0NQ)|[hB[B|XWnMn S$?RMnXEJcJS,MnJdWhXNc\N|t dWd `'TdXdHJ^<lqXD 0T@LW  T K( `E 8 TeC,B N@N )J`c , m z@| T SX Z[ H TH `@h U@ ,C$ !hKhAH!Mn8!XK!`S@xZ[,X!,g l!Mn!?Z!KDp!H( !tA\2X 2H 2 2PUd2 V@3TP3 $3 73S@L3O a3R0n3XRy3cK3@3hZdpl 32N03(KL3XNDD3WQ,4| 4P"4Sd.4U`84QI4TWhR4W k4 }4Kt4tI 4bP4|0J`4kX44]<4ETH4yB 5GE$5H=Z-5R875L N8D5][H X50X0d5ƀ Y`[[(z5\pPD5^5HW85U,5lWx5$\(5A$5LR5oDP 6$v 6 /6HUh@6@BVF6LU6R]<_6UPg6T$KXz6萂 6PV6 I 6Mn6Mn6 X6TR"6$a 7TQ7Y,7MnL7u T7بCa7؟]v77R7X,7LTP7Mn7 G7G:,/ 7A7Q 8 N(8؈T$%8X,48\XdA8ˀ _8Wg8mP8Mn8LTp8@X8?Z$8HX8 [Ʉ?V,8-X8\[[8C9+N 942Ud9TcZ>dQ0(>C<>VN>PY>zCha>pCt>Mn>B0>]>DY>譀 >dX|>Yp>tM>`Sp?Qd"?$ 8?G(J?RZ<T?\V d? z?|/B?`RQ?pC?@ ?$D\?čZ?xR,ݓ8Pp?YW0?R8?ZQ@00A @;@0jR'@ܥU:@@@M@Z[@ e@4@`y@pE@N45S$NN]cNXqNnNLmP8NDePNdENR4NZN$_RNMnN0S@NQO`ZD  O  RH? /OtT,S3QDS$OVSPfS(1V8zS U$ SRSHSlXS~@4S, SJS, TXT TI<"T[04T", =T8VDT\dNhMTMngTFsTkS|TlQTlE8XZ[TPMdTXIT`L@TJTT09 T0I8TK Tl{@4U]$!UiS@IiX  :S1qF(?q ^QqvXdZqS rqD ZLqmP<qKZDqXNqZ\qAdq Pxq,Pq| q5Rh rCr^!r, /rbO=rM[0@x VreZwr\B 4 D rPrXDrؤUr(iO0rPJrHS(sP`sMn1sER :sZGsx YsVhs`TusMnsZsYsH sHsC@sRSs Vs t4^%t~@$;tR`Kt\TpSthO@`tlRjtVtt, t%^t4_t t$^ptMnt)Q8ulW  uEuMn.u8NT=urV(Lu0TDdu̝Q,tu$@u^  uHBW,ux-Kdu *B8uO[uXu^ v`Mv U&vlW7v0SKvYYvV`v&@pvp[vćOvǀ vdUv{X,v@vdZvMnwLR"7wp R$fpI Cwl@SwZPew9HxtwPTwwXLwMnwxVw cCDwS,wW'B$xrR` x[0 u~0WQ~@0NP~"@x~p|[~ W@~ ~VT~x|[(Z`C'hO47|H GV4:TY >Xi}SxC CH0O<G@< @P= pKH0S+R#DI[(+<^AEHOxTTDdVv,TOx `R[(ӀI\XkO )YlgD + @KhK SdMn|_@Ā *BTƁMnفMnXp  Z)IP%@(?MnT 'JX)W7h J-Jh_\O$l+NXvL@kCTi@LO!, ƇMnHQTR"m[0SCIXQ`cNTZMnr | @IT@AXpOL\G4Ĉ$R[W|HW0a oU@0"@4(P0$3EDEAQC YDKkKuUl dQhS$4 lj@F4щDRQ؏BPDRlT,^ \&C )$P9@4DEQW Z$[HteMn|dz]AH׊4Q@ GX]LRh^ [,)P(7uSIÀ a p ||@D^?SDJTl[ ܋Ol@(B(l=RS0D'T*ԕIAGRhM \([Dj8R$zO#Q W#@T$K<JXҌOpMnl\W,`r  Y2,LChMSAv 0BT9 X[0юMnPH ^[$#(L[(@@OLSXe FIXrt,T *H8  l ʏKP؏aZNO[4Z0'J,MnIE_DRg'BAL<7MX$XDWn[̐Mn8EL  WTxY([(-X\@^UlLwXW^ j`R8vT@  Mn, ɑ4`, ԑtK(հT\hCX WLDlD-SK>sXTG0` OLR"fPYh}[40\[OOLԒ|, ݒT@80v р, ZX{RQ[4LAC@QpUТVdT"E R[ 2NÓMnٓW\P< cKY|(F09|SJ-U Y h ~,X TS TO”.A<є0@ xFTX\9 O,X  ЊKh-̀ >WHdD_ FllEy8CH8IІG$DD.pN:}@(P][p% dW kWXrDBl\Z<YMnå} ˥Mn7EHMn3MnI^^lpX,lN4w P@ˀ l@زVeP˦S@צvVtXQQ8I plO0(ǀ >MniH@xLd_T| Id/T@§S\ЧMnG>N`R HN0 G $:MnME8b|Z,q |^tN0SdOĨ*B(ڨ8nFRQX SENd,Q8=`U`F SdQ<_] i wZ4XR4$TdSթ@ |WxUX̶]~M `PQZ(]FN$2sER "S(.JRD: MMnjMnY  SD5RU4Xxʪ ZתKhTh F@$RQ&0UQX9 ,B QDDH`BT(poP@,XpV@SWDP[Hҫ}K "ZXv (jX^%MnF$T`V`N]HWk܂@}&^h6BIR<%T ^y] >[[x(IKр ]،SwX[SLY4? Mn` A8D_& Z80TR"F(I S ZPYl ~ ^8gWEX  DRǸMn?MZD@@K0L(*F@7$Td ?0LXVr  m pk@N0`H\JιqUݹ  FE@MnkU0Kl*$W88^Pd7T `jHnjPLUTB GUl}X,EXNH^_vLLlx{M|~TI\ [< ^ S[LWLL ˬ Y$cC^x N4%8QG85MnS|[kWHy p[xMnTgNH=ElZTEL (QS8!HBDN\@N(VGSHQ,T]]R\fMnJR,/h'W< S(u < `|E\X$O8+| 70H<QЃB]DNm`YN, BY,}F@pTE0}(̬CVLl ^NP pVD%tR."Zl;x@`L,;AXd@iTEEL} p=WtXUsN|UO8P5NX[bZtځ !Mn5ȬOJJPa^xpX,X@pD T  `JRXTBNE t=ZlP|@,0oUADIH,M ^\SgtTxuX8DChCA\QT0CRaF89LHTROTOx"uS40MnPW]Xhso xP@̂ ?   WyJ:AHJHx]$P TWD Mn Wh/GDl@@KZ8\Mn0 @I uB|ET$ W(A(SNR$(|@(@XMnDR!XEX<xX Oݟ]DP[0eP X|sT$$zO@PS|PN[XVY4/XJh  X,D I,.P|7ػOTKMncn[ }NMnCI@{_ Jtj^U4J]B@I Mn#Mn8V0WX<BT4K", TMnʭ[p46N|8@tbLXMn,TXv MnMn.T@^$$U*x@7}OHdX<YnUj TzL@R0xfS\Hv \ULRlRHPLTWTOMn|P'L-N@:@LH/ dMn) S1TS]xDdQ(5 LdM[^ P@ߩrT@ $g #N`5ZDFX*ISYaMnAAWL\ O ^D,B [DB<|U<T49,O\L`[[(]Sp[QDYluV | pSPEPTNH<8QMn+Z4"[T@dDU a,8DnMnOKGC0йQDL3RST0W X  4EpHYMn4(V;ĮJ$N^fVoCx{,TT[tnPEPOh(W4] R G$'CU5֖]D,VKl