08r)i<  r)i7t tr)i@@<@T 08r)i<  r)i7t tr)i@@<@TU r)it`Ar)ir)ir)i$h r)ir)ir)iAr)ir)ir)iA.r)ir)ir)ipxAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)imDT$"r)ir)ir)i (08@HPX`hpx $r)ir)ir)i@HPX`hpxN$>r)ir)ir)iK$=r)ir)ir)i M$Xr)ir)ir)i(08@HPX`hFAr)ir)ir)iCr)ir)ir)iAr)ir)ir)iAr)ir)ir)i!r)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)iar)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i!r)ir)ir)i4!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i B!r)ir)ir)i B!r)ir)ir)i!r)ir)ir)i"!r)ir)ir)i"!r)ir)ir)i"ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)iar)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i!r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i!r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i!r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i?\!r)ir)ir)i>\!r)ir)ir)i=\!r)ir)ir)i<\!r)ir)ir)i;\!r)ir)ir)i:\!r)ir)ir)i9\!r)ir)ir)i8\!r)ir)ir)i?\!r)ir)ir)i>\!r)ir)ir)i=\!r)ir)ir)i<\!r)ir)ir)i;\!r)ir)ir)i:\!r)ir)ir)i9\!r)ir)ir)i8\!r)ir)ir)i:\!r)ir)ir)i7\!r)ir)ir)i6\!r)ir)ir)i5\!r)ir)ir)i4\!r)ir)ir)i3\!r)ir)ir)i2\!r)ir)ir)i1\!r)ir)ir)i0\!r)ir)ir)i7\!r)ir)ir)i6\!r)ir)ir)i5\!r)ir)ir)i4\!r)ir)ir)i3\!r)ir)ir)i2\!r)ir)ir)i1\!r)ir)ir)i0\!r)ir)ir)i2\!r)ir)ir)i/\!r)ir)ir)i.\!r)ir)ir)i-\!r)ir)ir)i,\!r)ir)ir)i+\!r)ir)ir)i*\!r)ir)ir)i)\!r)ir)ir)i(\!r)ir)ir)i/\!r)ir)ir)i.\!r)ir)ir)i-\!r)ir)ir)i,\!r)ir)ir)i+\!r)ir)ir)i*\!r)ir)ir)i)\!r)ir)ir)i(\!r)ir)ir)i*\!r)ir)ir)i'\!r)ir)ir)i&\!r)ir)ir)i%\!r)ir)ir)i$\!r)ir)ir)i#\!r)ir)ir)i"\!r)ir)ir)i!\!r)ir)ir)i \!r)ir)ir)i'\!r)ir)ir)i&\!r)ir)ir)i%\!r)ir)ir)i$\!r)ir)ir)i#\!r)ir)ir)i"\!r)ir)ir)i!\!r)ir)ir)i \!r)ir)ir)i"\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i \!r)ir)ir)i \!r)ir)ir)i \!r)ir)ir)i \!r)ir)ir)i \!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i \!r)ir)ir)i \!r)ir)ir)i \!r)ir)ir)i \!r)ir)ir)i \!r)ir)ir)i\!r)ir)ir)i \!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i\!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i!r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i!r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i$!r)ir)ir)i4!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i !r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)iar)ir)ir)iar)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)iar)ir)ir)i ar)ir)ir)iar)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i?\ar)ir)ir)i>\ar)ir)ir)i=\ar)ir)ir)i<\ar)ir)ir)i;\ar)ir)ir)i:\ar)ir)ir)i9\ar)ir)ir)i8\ar)ir)ir)i?\ar)ir)ir)i>\ar)ir)ir)i=\ar)ir)ir)i<\ar)ir)ir)i;\ar)ir)ir)i:\ar)ir)ir)i9\ar)ir)ir)i8\ar)ir)ir)i:\ar)ir)ir)i7\ar)ir)ir)i6\ar)ir)ir)i5\ar)ir)ir)i4\ar)ir)ir)i3\ar)ir)ir)i2\ar)ir)ir)i1\ar)ir)ir)i0\ar)ir)ir)i7\ar)ir)ir)i6\ar)ir)ir)i5\ar)ir)ir)i4\ar)ir)ir)i3\ar)ir)ir)i2\ar)ir)ir)i1\ar)ir)ir)i0\ar)ir)ir)i2\ar)ir)ir)i/\ar)ir)ir)i.\ar)ir)ir)i-\ar)ir)ir)i,\ar)ir)ir)i+\ar)ir)ir)i*\ar)ir)ir)i)\ar)ir)ir)i(\ar)ir)ir)i/\ar)ir)ir)i.\ar)ir)ir)i-\ar)ir)ir)i,\ar)ir)ir)i+\ar)ir)ir)i*\ar)ir)ir)i)\ar)ir)ir)i(\ar)ir)ir)i*\ar)ir)ir)i'\ar)ir)ir)i&\ar)ir)ir)i%\ar)ir)ir)i$\ar)ir)ir)i#\ar)ir)ir)i"\ar)ir)ir)i!\ar)ir)ir)i \ar)ir)ir)i'\ar)ir)ir)i&\ar)ir)ir)i%\ar)ir)ir)i$\ar)ir)ir)i#\ar)ir)ir)i"\ar)ir)ir)i!\ar)ir)ir)i \ar)ir)ir)i"\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i \ar)ir)ir)i \ar)ir)ir)i \ar)ir)ir)i \ar)ir)ir)i \ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i \ar)ir)ir)i \ar)ir)ir)i \ar)ir)ir)i \ar)ir)ir)i \ar)ir)ir)i\ar)ir)ir)i \ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ar)ir)ir)i\ !r)ir)ir)ii!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)i ar)ir)ir)iar)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i!r)ir)ir)i!r)ir)ir)iar)ir)ir)iar)ir)ir)i!r)ir)ir)i!r)ir)ir)i!r)ir)ir)i B!r)ir)ir)i B!r)ir)ir)i!r)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)iar)ir)ir)i!r)ir)ir)i!r)ir)ir)iar)ir)ir)i ar)ir)ir)iar)ir)ir)i ar)ir)ir)iar)ir)ir)iar)ir)ir)ir)ir)ir)ibpf!r)ir)ir)i $r)ir)ir)i$r)ir)ir)in$>r)ir)ir)i$r)ir)ir)i$sr)ir)ir)i$r)ir)ir)iAr)ir)ir)im r)ir)ir)i$r)ir)ir)i $r)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iAr)ir)ir)iZxH9o>>Rg)(] ݠE."[fTE.N5tґ+}^}i%z:H[JBxLAm}b r9C*.<aNaw9Po0:mk~'Un|KW;_dDj ^m8]hs{ee(A$.TB =e&64*2]:'b5ڱc\LGYTEmOרf4 =p M &)nG|mds :y)ϭdaOekaBlLh _5G*k\`"_?l6iVyVRt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4!"4 (L!L!M!%%,LLM!%%NetBSDAPaX NetBSDearmv5hf3D0D 0p@-`b&H 6O-M@T  @P Ѝ  Lp` @5Xp0S 5%0 0 |5X 0S_d50S&<0pP(@90SN50S0vp  pPJ400<T$尠E,00CS0 2Pᔔ Pp  PYU 0 P00CS0 10 X80: S  +& +pP p Qt  X0 0 0\3$05x000,  00 Q00S(D 0 0 ``p8 p  000Y H 1(# f 0P @븂P~ t0S@zK"I 0R 0[0YY]820#4 4 p00R0S 100S  0 7(7 Pʨ0S;Ia@T c@P@ 0R?o20S 0  H1 0R0P( x@%P p@0S "P0S *P XWTy P0Rt00!;P pb& %MPb&Xb&\b&Tb&lb&W|hb&hV&TU&db&Lb&r&|b&cb&0@-MM@ P p  ;0U$C dP TTۍЍ08 P0 (0P X %db&Q@-@ TP DD,P $ 0P@ %db&Q@-@ XP HH",!P $ 0P@ %db&@-x0 }vµhV&0$/Ps'0$/r'@-)*H@-$*^@-*u@-*닶t@-1  0 0 Ѝ䠶Hs'@-1  0 0 Ѝ䰶r'@-1  0 0 Ѝ伶Ps'@-0  0 0 Ѝȶs'@-0  000 ЍOr'Ps'<00/@-0  0r0 Ѝr'߶r'<00/@-0  0^0 Ѝr'Ps'@-1 0( N 0c Ѝs' 0@- 00 :$0P@NЍ%,0C-`!A圁圑M!pW0 |! R0B=00 B  T0L 8 R<B 8!4100!0ЍPP @)=ShP 0p00S  0 P0P      0 3/R ! 7000@080L )D0r'r'Ps'@ #=s'FYs۷80p@-|@PtP00 R 0p800 p0  B0Sqs s'Ps'r'0 0 0 /Ps'r' @-(R M@- @-(P M@-80@-M0@@(3/P $ (H08 : S( 0h 3/ 0P  0 0Ѝ000  1/qpcw0S 00Mm8@@-@[PЍ@ =PЍp@-(`Vp80@ 0 3/PPh(8003/(Pp7@-@P`P O80 (0(3/@"w PBwPЍpr'3 PO-MP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A(] 000+ xpt| 8p  ЍO0 P % Hpp 81/qp4 '  ?P p 4 'v0S4 tp0 0 0 0 "o0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0 004 8pX  FЍr'm @r'dMvR/ R 0 0/\\CC B 0R00!/0"SSS S S S S SSS SS SS SSAQ0A/C-MhB0 0  T0 0 8  v ?$ Ÿ ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!d!!4! P ` !4\o4 " BXX P!d4 4Io4 " B   !d446o4 # B  d44#o4 /0n8p<0@! n` @d44o4 ЍHs',Mbr'(!hp TmU@-@R#G-A `00P4 82#&PP0 (1/qp $ j&봀嬐pUЍ0S0C080$0( 3/P 0 `V`PEDB&0  Z $ Ps'Mr'%ѹ@-MTA P04 00#!8 0 (1/qp$ &P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p p0h( 3/pLp #U0* 0P`/RP `r'Mm@-@L M 0Q   0   QЍs'omO-IMwM0@S`. 8S+ #='00S( 0 0t00"h ! !)x00#H #"|0 0&( %IލЍ&_ 0 V0 `S 0E0VS06  S  S $0S0 600000S60 0|60 00 h6Rdm 0Rr0C0C00Q0 0S. ,B< :%6|0P X$  ( ( ,0S 0 $0P0,0(0000 0S $Y# 5%q(0Sp%0 h%00   0PP5 ,0S 850 00%0(o[5$`VM / V 7* % n840$0z'(0吃# m 0吳e&p4`00S0 ,0S#$`V 0 !40S l\ /\ * m0 l 0$ m !5#  0$`[d5 0 !{0$ ( , r0  !k,00 0X 00,0@0 (0$ D81,0S 0`QP L0P0V40> / V Ё'* om 0  <Ml< 08p$(Fl ]m 0 d1 Q !@o!S/ %S !`V U 00 0VP 0帱0CS000!000\Q00`PR# !RU``0``00'Pc 0a0CS00jl0` 1 1S 0S11a0Sڐ  S`l  P6 0a0CS00=?10`! S:`Fp00  1S p3^a0S ʼ1`0 BRpE`  S`l  P 0a0CS00   pu'chV&8w'{( Q 0@30/@-Epu'`01S @-@0!S @a_P /TP /pu'&0c7@-A00 S1 RUVʐ0\00bPB'dj 00CS00- 000 @ R, R uP Ѝ00!S HP {0 Sڰ 0R0CS0000 0 Q  tP   pu'4]&hV&?A-O0 R ,Sp WX ! GYQ_YR\|X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}X}|X}X}X}X}X}X}X},kX}$mlnX}X}X}X}X}X}X}rLsX}X}X}X}$m|yX}X}X}X}X}X}X}X}X}LiX}iljkll$mmndoopppqX}PrLsstPxy$m|yzX}({PP00 nR pR lR 00 S  PP1S 'PPPP0 nR pR lR 00 S1S /PP0PPPP0 nR pR lR 00 S1S  P0 S00P0PP!R "R  R$ 000@ `PP 0 nR* pR# lR$ 00 S{Py PPP~0S!S M0S 1SkT ^P0PPpP`T +0100 +0X R000@ <PL 0!SP 8P00 nR pR lR 00 S(0S M ^y.PPQUH  P G@ooG`GoobPVWP101 P00 nR pR lR 00 S PP0SPNʈ0 nR pR lR 00 SH)0S << vP0PP0SP.ʈ0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PP~PP0 nR pR lR 00 Sw1Sw P zP0PP  P P` 0 nR pR lR 00 SR[P0PP;P P0nQ pQ lQ 00 S 3 PP=; 0  P/p PP*0S\ `Vl0ViV PPPVPU$p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SPʈ0 nR pR lR 00 S2S0|40S402P0PP0S 0 l0C0S030 S~1S 2SqW P000@ 0S0 0h`PPw 0 nR- pR& lR' 00 S[1S[!0R!S X K0S1S 0c `PPP 0S0L 1JP0PPPr`0 gRG  R7 0 B R_` `@p?U`0"S; b#pR1 rR1 U0 R 0 S( 0U0b0 * `P'00CS00 P00 S2S 02P00PP2P02 P P  0b200CS00ULWP!2R002 0nSS pSH lSL PP0 nRL pRE lRF 00 S1S"4]&pu'{0%,% tx'hV& &;l-(OPx'8w'0hu' %H!] z!2R000#2 0# 020 2 2020P0PPCPYp PPT0S) `V0V PpPӒʈ0 nR pR lR 00 S,1S,02P0PP0SPӄʈ0 nR pR lR 00 S P0PP QR000P0P00@h `P 00 00 P0 nR, pR% lR& 00 S!0R!S  CJ0S1Sm bWW 0 P0S0P0PP1S 2SqXP0S 0 l0C0S030 Sp P0010CS 0nQ( pQ! lQ" 00 S3 00SE^` T`1@p^0"S8Y`r 0  PP00 nR pR lR 00 SK0S 8TPP0SPPH0 nR pR lR 00 S,P v`2S1HP0PP P   -@-0 0 ЍЍ/'tx'-0^S0]S0]S S]S[S .0L0S^30   Q  ]Q RoG-`ጁP@0 SS&tPD(!,RF`a`qU`0``00*P,]2( $U 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a \P0  0@S  0Gcu'tx'v'hV&pu'Mu'!p@-0 P< P@01SE0p0S S u`Pp@0P 00Sp0PP00 ?P l0X 00{0Q P0]]0 ,(u'(tx'\x'`x''hV&O-|b|B0 %Q + \r\P00 SM Y< U 000b"P$&]i 00CS010  Q0R0 00CS0000 S0&0Q@0C0RapU`0``00P 0A0CS0000 P \S0P 0 S 0t00S|hhP 000S Sq 0`00 Pku'y'v'pu'hV&Ow'w'U&A-0P0 0p@ W 0 `BP! 0 R00R000 1BQz\@X @@po\0"S,$@gR000u'y'HO-ScpгM@00 0GS TcsT`0``00xP=\` \X00C0+0&SK BR D R: Y J @p RLP\S v00C0S @Ѝh20    BR   0 \SH 1B\C00 BR?ˆr L\ DR-WpBp@| \   P [D @<h00C0 AQ 0 T0 Tpppp  Pu p BR   @W0 `0CS0(00oq0  by'v'pu'hV&O-M0@ 0P 0k (40S  0 0 000 (0 pP `CԳP0 S pSP(0Y01ڜ Y   $ \$P [c` \X  BR +@30 #   BR 200S 00  Y0 0(PP0 ߍ000Y\ Y   $ $P  BR 200S 0 z Y P004 Q' 0 p1pG Y<Z  L1 PZ8 40H00CS0tX 0 00"2 00(0 TP< 00CS000\^W 004 00 vT00S 0  SY< NYXb`u'y'v'hV&pu',O-㴡A0QM0Cp` 01 00C S00`NlЍr 0 P5 3P!` 00000`P00CS000  [  E0S00CS0x00` P  Pxu'u'v'|u'(y'pu'O-M R B000bsp 0soЍؑ؁0S1  0 0 0P@ 0##੟ɐ Y Fp10S 0000000p0CS0C01; & \" \  00#0L\ 0C000@00000000 0C LN +u',%u'"y'v' w'w'pu'A- `P 0 0Cs 0x 0t0 l  C A^  00@pT }&@ 0y'u',%u'G-p@P0 `R0  PM(S%H0  d SP (0 ,K(y'hV&@-X0 702hV&O-GMdM0PS@p$Q403/P V0: SX00W +C P9:X?0CP0: S 0S+P0: S 0S 0S 0/S&P3P0SSP(  P x#0 PN+C 0P 4#]P]P /hV/PbVPppESP! 0S0S rJXG X00CS0krpp Pph pYWr TT/\H Z0Sh0S0?o25c 00z?G YU.0.0 VG=0JPT.0.0 VG=0INsP804@p+l0l 0 0  L00S   MhV&Q Xz'\z'4z'$0\ 0S  `z'Q M0L0S/0 0 0/0@-M0S    4 ;$sptPhЍ\0\@ X0R@P0 B ?mK 0Ѝ@y'z'z'o z'z'P `00CS`0p S00 P0S X0X /XU&: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\y@T10S H10S. 00 00,10'p ]@0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?J 0-T00S y'z'z'oAXz'\z'Tz'dz'z'z'4z's@- @P@P `PU00S @GT CЍp0t  Q \0 \@-T (P@$U$pz'xz'p@-P@Tp0 0C0  $A @G-@0M㵻(3$30S` V0Ѝ0 0C0{ 0XPS !$0S 20Sm 4 "; $"pt ߻0(  p|H20S 04t $p 20S   h0 : SK( "0 08"$4U10S10S51!0 0H 10S|10S : S0: S t`x81p 01Rp(1 B?I 0'Q p| , pP^, 00S xz'0z'y'z'=z'oAHz'Fz'MPz'Lz'Xz'\z'Tz'dz'z'z'4z'1O-@0S$0010S 10S,0001!0 q0P0S ЍOPa0HQ(0P  00`SpQPPU% Ѝ  B 1`0    0S[  L0  $R,   V y'z'z'Tz'dz'4%D%xz'410G-S$0@010S 10S,0000 0 0P?0`VG`|렠pvPUG m0 0C0 W dp0$S,  `YpP T`y'z'z'Tz'dz'4%0G-P@0T$@0@S 00S,000@0`0娀S㨐@pVG -0 0C0 W ,$p0 00 S p0$S,  Fp` y'z'z'Tz'4%@- M @ ᥸p ЍT  P \0 ]?P 00 0S@SQ0   K?0V&0p@-P0S``mH@P SIPX A↵@P8 B0PtϷp\z'[MC-CM@GH 萟P``M \M`T *F0 3pPPCߍw ? @P?Mw0S ?@P?lP@Z&@-MN jhV& 000/z'@-O-@Te-MQP bPn M0Sr  ᇸpnP 0S gP w 9t00CS01p0pЍ0S GP PPP>pPX ⿸) 44 Rl(p3 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (080! 0 X 00CS0p YX 0 P 0S  x-PP X0: S YP@P  P  X0: SPX pPb0S ㌲  t P= Pҷ @ R (÷P ἷ0 ¯S , !00  A (! 0  A {{zfSpᖷD00@0 uP Dᄷp lrP L0S wX0;X0XfP laP L0-S _ PVNpPx0S  HaOpY@z'JThV&U&o/P T.pMcs@-@ `PP00P UЍpU \@0 P4vs@H%!A-~MAM0pS P0` 0`P6Lp! p~,gP )L@!1P~܍Ѝ0 0`PL ~,JPP L ~,AP `0 0PKx W Q `104 0PK0( b1H%mP0x00CS0 0 /O-`UDMp E0%00000 0000S tV"4`0p Q 30Sa4PZ|OPZK0d$1000 0K<$PzK $00V 0030p Q  #P0 0[K#00V0030l#PFK`#00L3000DЍp(0: S ]0 S" P 000 S|2"00"0 0R0  Rz2`2Vn `i S0% 00 0KAqpJ0S 唠00 0p) W W)2`V%  ? ID 10 R0  S0R 0!CQ:++R:0'WW`a~0@ 0 DT04[@T ;0W ` W00l W0~, ~l0`Z BP* BP*Q*S  Q T0`H%z'x}'%T%&(z'}(\%B]e%m8@T'X't%}D00S/@-~M0@0S~, P~܍z'H%@-0p@$0l00S Ѝ00 0@0Q :J, /PH%z'L0@- R<U/P 0 0 I/z''(X'A-p`P@ C0PPEU`@T@A-p`P@ 0PPEU`@T@p@-P@Tڬ` 0Q@Pڄ0  Q @;;S p@P00T@ I(0, D/( .H%z'X'Pq@-,BPU` Vb0P$00 p?W0 pGWhPhI0 SV.00P ЍP#ڀ;;S 00 0?0Q P?PpH1p0$ppQ HQ (% 00$0SP ( .WI0S00QI0ES00JI0S FI0ES $0Sn.;I0S 7I0S 3I0SPU *I(0, .H%z'$((Jqt!0SX@-M`Q0S T100CSD:.Ѝ0S0SS/ 0070S S00.S@0S0T0pS0p L)?Qo 0Q 0Q P 0>QHD  .ЍP 0SH%z'@-PtaMP d1@0S2 SU@D;00U0p0p >0QTH!-Ѝ P0S(0S 0>Q;H  Pڌ0U 0?A  dW-0 P 0PH 00 -H%z'?nX'mO-Mr,M R(`RX0E@FP0 0S ጒ000 S (0S d  T";pL20 0DA8"0J.J? "00'To" ?4܍,ЍT 0S =! !!0` HA 10Sx1pp1 00A8!0JJ?08!00,q00$1(`(0 C0娀J 00 $0 @ 0x  0  ` @ tTꔷ%hV&z'$((p'[('(2'Jx}'Nh``'H%qC-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S Q1 9 0S pP (0: S0 0 p10S10S PCPP #0 0 0S q4 p 1 800 0S00p0000 S(00(000 P@0S 000S x0AP 0+P0p0@ 0X8H%x}'z''('('('('(z'% (($((p'`'A-MM0 PF#,G PF",RB$0`SF 0`CĂ0S2t+p|AP} wAPx 0 u S( .p`+l^+h2Lr0`0CSXXU+R+HP+DN+@L+<Z+P,PAP000 0;+2 `ލЍ1+0S  R  sS SS YSQP+yS+$qx+l +<+P,AP 0S8 4AP( ?1P *0S(*PP P0000**'(H%z'\(('(#\%T%Sy%,4\ m '(Qx&0 300@-@HpSp`蘷%O-L|q| \0S(P1`XX@P"@U(,L0 R1V10S *@DT  A+0d#0UPTP*PV0S tw*`@`ꓢ"H 2/L0P ! 咣#, 0:舷%|%x{'%Dy{'$((O-@Q0p`F@ f[ PppWPH=* ЍPT10S ,*p@ 0$0 3/P$ 0 R T  A@$+ 80  3/PtP`\00Sd `) Q < 02/P " "$((x{'i%'y{'@-AMMP/B@P+ p`p P/00P Up0p *AލЍT0_"?/0P0 0, 00`*ꄁ',x{'@00CS0 |0 /O-0S$M00`Y P$Ѝ$P0,03/P00T30S ,@C@sFP7PPP 0030SY  PV H20S v!P!P x4 CSR P8 ,G ;PC7"y) H70/SWP= A#*X | 10S  P0S !S 0l!202;/P Z ,"81  0S a0S 1100C `]0D0 3/`7 0S 0S 0VP0x0CP0&P"P0403/O$((((''((('('(''''('(x{''(@'@-<@% P_C( (<x{'@-p @@JC (@-@dp=C 0(@p@-MPp@-C0S  0C0%C `p 0: S@S NS ЍpC`C-MzPЍa0H03/P0 03/P㪭tA]pP@ 0AS0 @0a3/PE0 0#P)3P/P WP0/S4P\< A)00 006@ Bt 8(0(03/\ gr0 P$(('''V&U&'(O-MPЍe0H03/P0 03/PP,D50S 05P pB%'50SuJG>P 0(03/ #P 0AS0 @0a3/P|4C003P H4 C(P(40S  P T 0 0  P 0R S = $ `0Sd003p0St00PP p@S`3`0Sd00/SXP;, A$( S0 0  P0SW 0S = $ `0Sd002p0St000S "SD p 0 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P |1 Hb X RP$PP ,1PV30 P E @ ;/0S0S P0S 000[\000*4S 0S 0$((&(%((''(@'(('(((('''''('('('('(%'(G- R@}P T T 0 4&@H03/P0 03/P0SB0 Y Pq0 09paMP P: 0 P0(03/P@F P0 0 @0S 0' 00OP@' o?P0 0t0 0S TPP \0 CY yP$((.(('('(''('('('([@'T0@-0S\PP 00H03/P@(($((O-MMD嬀0$0+ PP PpNP:4( 2 忣 040p&(0@-PM@ DPh00S Ѝ0 $ R\ 04 0R\ (((0@-MP @PЍ000S0: S|w5POPU Y:H 0P 0A,J: 0((m W'(0@-M@, 0000S# Q0S 10S P'0S% X0 ?A3c000S&!h0 ?A3c0  P :0NS :` 0Ѝ09D 00S p꨷%%Mbrp@-@P`P p bP $0+9 0Yp'(@-!@QP 0+90 @D'(O-P0$/SM`p//)@P7 PP. jp /00 7P&  P!00S  P +P0 Dx Ѝ'(G-@P 00/S (QP 00Q G  ZPI90 0`0S i뤀夐p0 MP.90S@$<jPH0@+48 @.D&( Ja'('(kA-M`P@pP5(10S Ѝ 0RP  0RP 0: S3P P8 0]nPW LP 8 P W$ 0@?((|m :(40@-: SM@=0P - \ 00[ P0 Ap 0: S0 Ѝ000 t:P/  0 fA-pQ?ZdV`Pi8P!0@1@0S/0(DS7 (1!0 0 =  "4S pP?8p 0K 040Ѝ@$<@0(DS PL(DPL(DP 00 0'('(%%&(O-J#3(tQJM0 M`p P 40CS񟗄@`xh32P x30S P0: S* XP2,3,0(So0S| ( 4S~ 0S20S 4m0C?o2 000! "p"p7"0 ,X7Z/ Z\20S0 P"0 J>0P@z=0 Cz Jލ Ѝ   Pk@$<Pc@$<q0S P(4 $R;<(4$(4R;<(4(40W2Pz P#P77 0`0 + C`\ \0Q0O0S0(4 008 00'(G'('('(%% '(k4f/O-Mp@ W 0DQ 0S8 00<000SPP0C080pG0S `0S : 8 00 x! x3  P< 6@0  0R X2@ ?@ -Q*6@0 :0嘰 R ߞP` hЍTT X ! ` `@h((d((p((l((Rs@-Ѝp@ 0@`P,Qu6< 0$ ᆿPg6 0&(0@-@MPPᮿ00<00S =  J"Ѝ0'(G-`QM MJP Y@ #p nP p 00PP=! SR J(Oݍ ЍPJ68 = $ HL0RP J(L00 0I,QJ58 PT}'G- QP u000aq@T+00CS0,pT0 0S0T@ 0 S@ 0   uP 0S@ 00S 0 S P &(&(%U& 0 0 S@-0@0R00000S0@000S `CP PP40P'('(&('( A'(p@-PP 0Sp `@P` .@P0/S000000f PR @@@pp&(h0 RX R  H R/< R/ $R/Q/ b&( (('(((l0A-0S X0XPX`Xp@0T R S9 p0@'(&(hV&C-@b,M 0S0S/,Ѝ0 0P50C S>#### ######x20S X00 00!P 0 000! " PPP  0!$5$!0 0!0 㓝z I XB3(4 : S>  S8  S%  S04 0L! 08!  J1/P6 S  S0  S04=! 0400S -Ё ;ЂЃ"040+0 4僽PI40P 00  0  O&('(5 '(Ip@-8M@  ^D 0`P`Ӟ 0U` @፪P8Ѝpcmx1A-hM0@S\ thЍA%Z`(="(<p@1Wpp P0 0000084P40CSH$0"60"$B0( =4 CR+x 4%hЍB>'T+S+<  '(oyy  .@-=XM"@p:(ⴞ0 XЍ7@-@Pp (P Q Ѝ00  \ Ѝ0@\0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qqp@-@@+0CQP0"S : Q%R0W^$B0CBSB 3b 301@pQ0^AC S*p P@-*0S ^*00 S R( \000C R@30 ? SR@*:@ 00 C@ T \A C@T2  0a0C R"  p@-0C@0 PR"S :$B QN%R02W" 0C@Q `@ 0Z1PpANQ0 C S*80P @-  //((A-@4=P $,PMP>@J >0 -R,Q0 00 0;= =, 4<=2 @ 9`3@ <2 3X2 @ .83" *2 @@ %2 @ 2 L 2LP 20Aⴁ娑00 RK aR eB Q PAHAHAHAHAHAHAHA,AHA8A@A !00000 00K1]PJd1 J T1 I 0 I Hꈁ 0010 L0۵1Pd H'(G'(\((&(|%dO&%'(hV&V&T'Vz'l((%r'('(% (('(((-%ܷ%ҷ%ȷ%%%((|%'(L:U&.#ݰ%nGΐ c ((((%E'(((-[qH hV&^ (('(('(p{''('('('('(%'(l-z'\(( G 0.$((ȶ%dO&k'(x% U#L#U'0  0 G 5가z0P  ,G#,1 F  1@ 'P00F JP|`1*PE1 E 1 D s1 1C1WPC1PB 2 B 02 A @2 A P2 p `2h2l2 p2x2x"|2+S0020" R002XR0 B+S002 C u0 0S3# C*SS8C0U Pg000Sv|30Ueڌ3PEPhPN0000S3 Y0P  /&(l0P/`0p@-0T L@LPP@0@&P6 B&($((hV&'(GA-` @PA?\+ \ *\.  Q R( [\SPQU  !\@@]^.!Lo \0S8 /0S 0R0SP/ S QR S0*S S 0PS 0 P0^ p-W pW]W ^W #@^ ((p@-@@0/SN00N P`RpPQP`Q*C0CT0@"03L00Q*pQcK 1@-M MP AaqR P/&P $0P0Sۍ Ѝ.S@T|`l @ @'(e &0 4DkO-cM M33 "p@3]PW00 `00S 0f00 0gP` 00 `;RSVz 0 0@;T* R`DV:  cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 N 0@&P\P   (0 0CP;T+ 0S( `0V"p0S 0 0S ᄵ0S s E0l 0 xs@T *0S0T00  R S ( 0 '( hV&C-`PMM RP  p\SP RT P0S #  0Sג\S R. gS PS$ SS GS ’(0 0=pS sS0S00 R @@@(PPKP }ᖒ;@P p FP ; 80 } ۍЍf'( =A-PP 0Sp`p @PL P"40 pR `@ @ @'(X0A-TPT`Tp@0T  SU ጴ0@'(hV&`10SS p@-ZDT @ Q  p!Q R$R S0  0S- T0 04P 0S/  00p0S/  `00h" @0/S000 0D$ /'( (((('(2A-0j40@TPp 00S0o`0 00/S @Tx0T0o#P0 SD fP04'( (( ((2A-@0PS' 0`.S0.S0S/S \oP 0 Q CR S.R  S.R0S/S { 10S410S 4P:4 CSR ! Q`V 0/S0S.00 p! ^00C0V0@0E `V#>_ VP:4 C/o"SQ  S 0 BP  0 C 0C0T T0A0 B!"004]&A-@QpW : J(S20d 0= 00CS1000=P   0 R ⨁0≎ᩑC  S.@ 3 b 30  J(LPu[[0P001  =ЄЂp 0(ZP0<x SP0@ LP00 0 CPP t00 08P` #PJ>PP P >X(( )Fd&(// Qp@-(0PS$ l` |@P|t 0000\0 `%V0 $ @pEX((O-P`P Ѝ#:J084YqW V#g /0p00K0CSt3l IPk 0<00D3  a  d 㒝 (|qp  }? $00040J0H1P tq@0 B<(1 P lc<0 㓍 H K06S 0S 3 CRUgSy K CRZ 040r;;000(4 9 xS!04(4:(404(49(408400C /Q000Q($4S::  $R (4 @ 04&"**0000 02S($0 *4($0)40($84  R  KS 0 040r;;000 0KS8  0( $ d((l((F|X((ARKO-z4MS@- S `cV:60VS0d`F`0PS/S`S 0EoᨂSXA | 0CS@P hDP0P 000@aT8@p02(A-ppP000` 6@60 060000CS@000SA)()(p@-P`@T IPV 0@p@@-PG-Q=0@T: 0S W@0 Y =EP P0 V VX00CS00 iV 0 0 0{p` @2(R%gH%C-3sPc 0 p3@0! 0  0080 B 3@ 3 00`Dl5蒟 0@ Ѝ/R@R R@ m&@ B&Qꈝx000000000000000000000D000d$0l0@0=S 0 "?R 9R:BP<ܝ|R) ~R$ ^R \!000Ph; 00@=S= >S 00@<S =S 00@|S0 0@&S0 0@=S0x g  +R0'o  -R0(h )d%b#`0 ]4]&t)(~ h)(|p)(\)(0 @-X)(0s@-P0`0Z0`0S@ P 0R@P@   P@0S00S 0ST P000 R  ЍpX)(5(%[ ~ "@-L ^dP|0ԡȡ\T @@~, \ 1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP !FRcO-`pu딠 %RP@@ &R X(4! 0[00 @ P@P@ ЍX)(p0@-4M!@p T` 0 P@4Ѝ0@P SWP@V P@ 0 F2P@( P@ WX)(9p@-@P0)SpX)(O-@D4M`pTV TY T( T) #T! @$TU "T 0#S@P  +4Ѝ'0DSYG x@W'0I S@ 0 0S@P'Y00!p0p諞 {W! sz!P l0 @@! `0 @PWWM'T@@p4 @P@u X)(~9O-M8Pp`4! @00 R@0DS U# 0 \ 00S^^ :U 00SY` p PU@ 0DS ЍX)( C-`p 0BS00@SP! @00P TP@@ ЍX)(G-`d0SP@! p000 PP@X)(@-M@`P2PL0P  IR NRpp PpEp@@0SP@ $z2ЍX)(PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P22Sp0@1PH0@P 0,S@2o%x%p0(5(M@P/-0 /RRR00x)(@-@PMލ0/S\ ኝp ᅝp 0RP 0RPm p@-`\1@P 1D0p@110"SP Vp}x)(p@-T` RpH0@Q 8 WPP _1pp@x)(%O-p2WR 0S)P {B000000000CS020S 3@T  Ux U`W LbL(1|82@000/Sp?EpPI0S0/p0CS0oppW002000pA0P00 J{000 hVU` RU00CS0810S 00CS0 0W00 pR0S/S0@D001@  P  R*0000t/S0S  P 0/0CS0 pG0S 00CS0001@1@1@x)()()(p0(%x%&0m A-p`@000P 00CS000S q00CS0Pd00S b%@ HW 406 R0S 0Q)()(%x)(2G-BM8)r0@T%U@P' 0.S00.S000/SSJX20Pp  `PF | ePZ( `V+XPP " ` 0 E`:0E{ @#|0-S0SH1@T@@}UP0ᱛPw0S p /P0: S W  p/PX P PW 0S| pt /PsЍ脸%2( `x)(*6Y@-$0Q @ S@x)(up@-L@QC70P000S LTPP 0S}@@O 101gP00CS00 P 0 O0pz{TJ2(x)(%G-PRp p@1`0V1 q Pp j Pp `b\TQ @0T! \0DQS񟗀(||||$|DL|||||||T|||\|d|l0@ 0BP!0 BS@@00CS00 O 0@0 @T0S 00CS00 nO 0 0SY00CS00 YO 0 ;O 1 0h1@ @ @ @ @ @\@@蔹%2z{9A-@ ` PR 0R 0S S Op0S0 R O0S  OU  jOTuOz xoO^ Td@00CS00 N 0 AN|%)()(%4G M% 0@-P? 0,)(40@-@Q P)(@-x0@T   @@@@ @Y@00S 4060S Ѝ)(l0(%-$0@- R    )(-@-  0@-)(-@@-00 H@-P@` =-@@-  3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ L 0P< < @-N,P /  )(0/)(p@-@PPPP ݗp` `P їp` ՗`ps@-P50@T x0 6 N 2h0h`@T POT0 0 @ P@DЍp2(o%)(B 6(s@-P`@0S'L<0`[ &k PG{{'jfk[[틘06S 00S\ `Ѝp @0t0S0T.S N@)(b!0    /)(@-@TЍ0Ѝ0CS꘾ s000 P i0 6@ 00 0@-M@ PU 0 PPcxp y,P   0HPPTxp 0   Ѝ0 v0 0)(%%@-@P 0S0S 5P 000 F Ѝ6(0G-`S q0P00#됡@T0SXU'@d1$@00CS0D10S +Ѝ00S P UᲖ\ x6  R }*P00CS00S UC0S呖CUP冖@ 0Sb#)()()(gC-@PcM^0P& S'%,똓sQxX<lpp4S#$0@30S $K0S 2$P@@T K^0S 0S@+T ^0S$0 0 @^0S 0S$0S 20S 5H+ @@$@++10S H0S Ho^0S 0S$0S @TM$@P10S H,10S G 10S G00S G  0 $ 6 $0?o2$0-0$ R  h00S G 6@0L<KU+  Ѝ脸%2()(5(||%G-MPp@1+0 뤀夐夠`oAPP U+Vx0$`W U ^0S W P 0`S+Ѝ5(h%%)(P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 P++S p0@*PD0(00$x+0 $ 0$/း%x%p0()(A-P@쀟0p0`0{^0S 0S 0S00CS00 0S  BR0 00CS$`0$`0C0 $0 R SP 0$`S S)(%G- M䑟A^`PV $`m*pWT0尡p0p00WZ 0S- |1|at4KlK K00CS00 J 0= K00CS00 J 0 J  @N^ $`R 0S S00CS0 p } 0S pS00CS0 0$`0C0 2* Ѝ脸%)(5(6(%A- M@ p) 0 0PT@T/ 0S0$`V@ 000P `0@0T$0 R ^ R 0 R 0$0 $0) Ѝ`05()(%G-@ဂ`p0FSo᪢' 0S$ L2LRH23^J8\JY8(WJVSJ00CS00 I 0 IQV000  'P7 V a< 0$000CS0l10SG  D EPg P00CS010S B00CS0 VVp00S #00CS0$|00S 0S0S000013I8I0G^Iꄸ%6(%5()()()(82p@-M000000 20S 00S 1Q13 `II0@TI1)I├PP& |1 1@?0S @T H1儜 :D@I8}I1I0S 1 $ ލpA 0 000 0WBP00CS0 0@ a0 00x0 ?00CS0 0S IIlGID0HX00S @00S )(%6(%5()()()()(0@-`0000 00o^0SP$M4P @M(000P pW&P 00S v?n000 p0CS0(00S Q($Ѝ脸%)()(?C-@0mM00@H0?_00x?0 0P@,@(0@ L? `0d00@T 0PoP0 `0W@Td0 0n 0hP@plPT 000Pl 00$0`0S$}'`0 S 0D0\>60S @>0S$0S 00D0$ 01C 0>0S$0S h@mpT@ xP H087S 7S) =0S*00S6 -00000,(00 0p(0PX @=&0S(7S%00S 0 0S= 8 < , |p@ P <0 M<8 <, R , ,( b%P000t<|<0S @A @X$ 0 $ ` 0b<;B1Gh@T: =pPB`P H00CS00 rG 0PppH@T4`@T @ `[00CS00 WG 0 H@`@T0j PU#00CS00 ;G 0 :G00CS00 'G 0  2BPP @078:0P @PPHP: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP0077S 0C8#8S0)SS B708#8SBP0 Q A!Q>8 R 0 00 Q0 -PP -P R 0S0(0(00(00S 8  @  (00(00@07004070<00L˙P7 X7H 00R}0( ?$0SP007GQhJ 0D'000 00007 ('00 '00(07$ 10103/$60 G6& 6& EL0S Lt68 H6  @ R] 4 0  X $E(&00CS@0 qPq60S H]P 60S%,0MS55$5 h0 L\5,,0( I0000*,( 0D#E0$0(0S,/ $5 50S 4,0S p圏t<$040S 0 @0 APDT> 00<0$0 0C0 000$D00048l \XQ00CS030S טP) 40Su*T0SXQWK38 \3 X3 3\ `30廘C[*00<3 0 0S '|0R"C"0 0 (3 B hL00S0P0x"0C0000Q K\28 ,2 (2 B 2\  *00 20 T0S!00CS0 1 R   01D0S$mߍ;10S *0!SS{X1 08 L0H@5Kq|10@0@0S0  @0ST1 0$ @0S 0 @0s0 R#0S0   B  @0S @0S7S@<=H0 L00S \;6(5()(6(5(% 2()(l6()()(6(%P%2(2(l-dO&%|%%)()(!t2()( B )(z @,0S0 =,0Sh@@P >FH0,000 H hgG@T(0S p00t" ,0 0r,oD)HE0/)(0 /)( 0/)(0/)( 0  /)(P@-@'P@|<0 QP cR   )( 0S0/)(00@-/0M0@0P P P0: Sp  Sd PЍ0P0 : SY# PP6( r 1p@-Px@x`M$P*00S R#0`000``0"`v#$Ѝp)(2(@-Pd@$0`'0 RP  B R    )(//C-LM*8+8 p(0@<P@ `D `$0 CLЍoG%A-@P`)pWU rjN8" 00O(p2()(O-pWC R``%` P0S:S2FEԐ@ @0S,W@  @0T/S/00,n 000S00P R:R0:SPPP@DOE"S"x%%)(@@-PM/p 먐PK  0 `@ T9p0 @~0!0P 05pWZ0S 0 `T=0S 90S 50 S͍p @+" f`P T T T0@@T >0DS)(2 A-@MP`Rkl1000  8p!XZU hBB Q PBLBQ<B 00AS 00CS00 OB 0* 00CS00 ?B 0 ЍQ PBB000M l00CS0 TzBxBHD00S V0v6(d|M%)()(p@-P@@Pp 0S%SpP @ p@-P8@Pp 0R}Pp@ꈛ L0L-  R0S P P\ 0 %)(G-`@嘀0唐0P0|Up00CS0h00SG0S0 S 0S00?kPPp)()( %)(0A-`0@0pP Q Q:R@ @:QR@P0SwppR %RwD$%Ppp0V:SP0@w@6(' %A-`P倀000|Vp00CS0T00SA0Sp00Mj@T`)()()(0A-PSp R+ኧ`a@T"W p0006L 0 @0 0 'l00CS0H00S C`P `@)()()(p@-P$@Pp0@P0ꈛ @-L@000@00 uj00CS000S@)()()(O-PM/`@ 0P @@@ (ދP000 90S 50S 1000Ѝ#   P@ |HP @bPR R R R 0S  0  " R0""  " /R0 dpP>Z0 R"000  pPZ m P2 @@ 0@00Q  0S/R10SZ #P %pP A0000S R pJt#P R  R (&P0 * R; R 60@@D= P R  FG T@0000S R   BR =D R9 7 a6( %)(%p!)(%)(O-@M`p&PP'0S*[ 0ᬲ000`0pSw|2!| S6hBr?01 P?PЍbPEU 00p`@[ Q @hxV  0P!0X ZWYV M10 0 _0S& 0s1TP P*X 00SW0 0 S0 P 0SPYT 0s P kO@T2()(%`*(6( %p@-P|`0000S S@GK000 00 00000CS0p00Spp@)()(0@-Mt@ 0P0000X0>00J 00CS0$00S Ѝ0@Ѝ0)(%)(@-gP 0SKO-SM@p`%P S0cS ``9 pP vPp VP``*00S/ h0@ T [ W>@P"P4Xh Pk   R񟗩00S"" 0RPW>= >0@ TW 8Lz> P 4s>>0 R @ T Ѝb>>A00CS00 = 0 00 x100/PXP!  VZZW YD>A>TՈPW7>W~`F9|iWxWtWq ~W 0` @ p`=`'<2(@l Rou%6('t@8O-MTBTRp0 @0`V' VV:V  VF /V   BR 7` F RL! R  |a[  0000SHB@P p ~[/R 0/S n0b]P ЍY] @TW 0 BR  R  BR    BR  : 5 ꀸ%d*(p0(% A-(A0S 0PS0 0aqP0S00 P000^f00CS00S P 0SRh`hp0P RP000:f000CS00S d*()()(h*(s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `ph@0S00S=STL00 <0 R0AD1U0 S 0St%t2(2(A-``pP0@S  R Re00PH @d*(O-Mr؂P0B0000 0000$`40CV :4`PP00CS0E0S00CS020S * H⥅P+h0S 000PP pe P .10S 0EC0P0CS0X10S Ѝ000 @H[ [` V (QP  PAP 0 SR BR  R  B ~  ` B `FAQV  RP Pd*(%)(p0()()( 1O-p0PSp0 Ѝ1嘱 @` 00Y :[V0S @ xQB `P V' Q`:00sQ @ @% Y0S" SP P@P PQ DoP @@` d*(6(h*(%A-XPX@X`P0p00vd0p0CS00S d*()()(p@-P@e0 @ pd*(Q@-pP0G`0S `*00E@`P;P P `R@ Ѝ0P@@0`SP0S0O- Y X0 S@0 S@HY" \YX0 S@0 x00S7X S 0S 0S<Ѝ@0SX0 S@0 Q@p X S@0S0*SS x SR ?S[S p0R  @R @ R X R R  @SS0S0^S!S00x^\| ]\Q000``S XSQ0 0 @ 0000xQvS^ P[Sd:Q" P-Qf]Qc \QQ PP $ ` $0( P1 0$0 $`( ~P%L0A0PP QPQ P !$ P80QP*00$dP d`0]S0 S 0p@X'\PP  8QP4\SSPP0 SP0S p @3~ O- MP@0?S*S3 [S;0^S!S00x \/]P? [P%:P$]PP/P^ P 0/SS 0:S0:P0]S 0/SS  P0P/P 0S xPS@0/SR"@ RA0$x RP  R \$$Ѝ PX9$P| 0U0/Sd 00E{pP $0S/00E0S``0` xQP 0S V/00D0x RP0  Q: 0  R/00@>f0P .Z. B/o" R  P V0 c$d*(m |h )(0  Q0@-0 @\C\0CC/x^ࠑ\@ \ 0 A-@QaT0S 0@0@ 0?S*S  [S R 0 p00$0SD P Y$$$a0$000CS0H00S R 0S }0Pd*()()(p@-@ PTp 0@ @@d*(G-p 00 SQA 0P `V `R`F@ V @<<<<<<@S`` S =QQ RU  0P   P~ G- M⨀0`@GP0 (q000e U00SV-00ED`PIPE@T Ѝ00CS0@p0( RO-@@0M-S`P S! C RH4?So @Sy 00C Sh0 0Zc`0S\ 00S=SWV 80 R8 RN0aF1@ 000U00S gWG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 D7Dp@,PW@A0S 0g0CS00  P6FBЍ666-0000Q00S h6h pR`&XV(0 0S 0S/00f0CS00 w 00CS00 v 0S 0e0CS0]0 00w0000v00pe: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000vH4  0440`3p00 RI 0  U  Ṛ~0d R R7 V~AQU R xx  BR  BR  BR  ~  BR   ; ~ 5   0S  QAQ$AQ!   Q R V  BR + `w~  0 BR儡  BR  ~ ~  `K E a Q~p 00S T 00 S00CS0 0 p00CS0 0 00 00~00; 0  00 00~00 0  002(t2( p0(d*( %h0()(t%6(%O-0$M00 Z0 0H'0=,W0J0p0 0 7'0` 0`F#ZGF@Y0/ 0o`6@P Z0`Fk   @ 0@R `F( h6@T @@T*T@@ Z 0JSG, A79 6`0`FP 0 0S Z?0Y : 5% @ @AQ TK[Y0I Yi @ ZD5  A0B F0  %5T 0  Z@00@@S[P@ 00㐴 Y" @ 0 @Rd$ R @  R&$$&&H%H%H%H%h$&&&&T&3  AQ AQ~00AQ x~r K R  BR  ~00  BR V~0 0P @0RP[ 2 20AT[ @T 000S[@Zp Ÿ0Sp Spx hSo T 䁟̑00CS0"0 娑0 A0000 0P  00B 0C 0000000T00 0`P 000l0 GR00#S000 B0S0p0 G0 B0w$[m$Ѝ|00S[0000p0SQ~ d*(p6(%%"p0(t2( 5(:UxO-0M P0 4ԄдД00C0~Q 0 `p0 @Q Q!:Q =Q Q QX   L  BR  V PR AA KA P񟗇p+(+++((*h))W 0S@ЍQ Q@Q =Rp( `p(``# P  BR  wp w     BR u   u   BR    ( R 0BQRQ B  W `   BR  v v 0AS Q AQ~@P   Q @~  @    }@P h i  ~Rf=Q0Sa 00 R   @6(%d*(%5(p0(x1G-Pf0lAlS 0000X1Xq0P0L1 ` (V0 S$000`0`0CS0!0 0@ p X 0   i 0  R 000/ 0p ꄸ%d*(%x%p0(5(*( @-0@ꀸ%O-TAT`0$M`F;00V 00CS000S 0S @pWZ00萠 @;0 ZHRꙂ! P00 R @.()()(%A-`!@SpP% K&WVV |1N0S9 U 0S0PsPrV81Rp=T!1@! !&0@$$060S& $$$V&&U 0S PP r\rP HHV WT$0  l0(%,%)(d/(.(1 08 N R S  0S  P Xꄸ%O-pRB0M`0  pP 0S0S ЍP8804000@00 #"P%:T 0S0 10S 160SdTf P c100CS010S 0S 02, \ Q R05S00|) \~  ^Lo \ \ \W@~  ^Lo \ 0S 00=TP 0005()(.(l0(%%)( G-pPE@P ?P1N0St `P@rT @rPpS 㠠`@0S0S 0S0S#`@Y 0 X 000 -ꄸ%,%j.(A-@PP PT0Q 0S |lP@ pP@ ZP@||06 R0S@@d`Q 0p) 0 0 Sku2(M%%O-PTdTt,M @P Y8 U0!00S5 @nT pTU  P300SU00S00 ,Ѝ 0J(P ",P t0S 0SD3 P#Zp `X*00SL T0 @@0 0000 QBZR00 RiUX *Y ^  \2pP R  Y RQU@  )260S&  @ Y00P'  P0`0V 00& 0V0S(0S0S 0S06 P 0Q p$@J0S 0S @sԀ0U0X0S 0 S0C0 p0SY UX f) @0S 0S2(.(y2(%np@-@odQ000` R 0S <1,Op UQ!r0S 0 00D1  S ?` 4` V0P 40``0S`0S\00CS0X00S p800P0V0S )(,%.(5rO)(@1A-Q40@S% qP`0SP00CS00 % 0 m&0Np P.j!P}%lP000T00CS0@800S ,.(M%,%)()(@- 0@0o2(@-@ @op@-`@00  p 0Qp\ PU%00p.(A-db 0@Pp0U RP@ЍR R =RU "0Bh 'Rf 0 BRbccc0cXbHcTca1) PU ^ S \R 0R  p ` Q\1 0 0A Q "Q."   Q1 010p} 0$ S0." W p 0p: !0}RQ 0 0\ d0$ \0" 0z Ux 0"  PE@r.(@Y4%A-@$tM`Tg 0SdPUPegePfPf(fee\ff,g4g`ghhhhghdDh h8hhh,h`h`heeS 0S t#`$" 00CS 0SDA4#P$;P  @`@P@PrUV0S 0S Pl\Ѝ@P@rP i 0S P ]PRPIP\ |klh0`aHPqPLUH %{  0 SsPoE BvP 5P 2P /P ,P )P & xus.(Sn/P )S@g#*{63 .;n5;AFAKP~ [2p@-@``PTpU 0S@ @Tp/P p@-Px`x0PP6 R@N0S2@@@0S@D. 0    p0 p.(%A-@1P0pS`3 R4 0N0S- PlV0H@0SlV0H@0 @000W0܀ ܀lV(0H@V0H@U l0(%,%A-P`p p P@ 0 AN0 aO-Pr- 0M00S 1v a100ԡ 0000 S  @PЍ0SH  0 Q S/R Cm P" Q 000X00S*  RA PP0S:SU@!00S,@LM,"@00CS00 ! 0 ( `0SP0@ 500/(06(/(D6( )(rx%p0(%%A-M`.8q8AP0S Q 6V@oP 1%Qk!0^0\ P0!1U00V0S^0SP60S .0S !P&P P0$ЍP ^X8 0P0C?o205(%%%h%.(0S/p@-@000jP00CS0p00Spp@i00S d00CS0 P@T` `@V00`T0@0l0S V00T00p@c)()(%p@-h@P000jP 00CS0 Ip@K E00S )()(p@-P@PU_ p@- HP(@-~IP!p@-P@KpA-P@P0`S~U0p~00 p0 000CS0h00S 0p000000C000CS000S x%)()(P0 @-j 00C00/x%00  000   /x%p0(p@-@tPt`0000S0000H0 00CS0p,00Spp@{00I)(x%p0()(@-D@ 00040 00CS000S@_)(p0()(G-qA0@0 00V0IP?o20kPSP) 00>0 000E000PS V 00CS0l00SG& E  P0( `_0`00)(x%p0()(T 000@0A00CS0/00S/)(x%)(p@-$@P0 0C0C0px%p0(p@-(P(`@0@D00C0px%p0(( A00C 00 0C0/x%p0(-A-(M@@`DHpPpPVP u T(01 0P @ @p@DP`U(ЍAЍ/T (01 p@nJ0 P ipX4O- PtPTH~eOW80 \%P0@-g넸%mp0S/p@-@PPEPp@DDA-@1S@D`pPU 0@P00` Pt2(O-@Pq刑00`0S -R  RF -R0SF P +R: `cP Z TPoP0S TP T``T |0|0T0rP0S \MT PT<0@@T0SOzt2(2(m%A-PRB00і 0`00S 00S0S006X pWLP HP6p60S0S60N0S60N0F0 0CR?o20S  0-S0F01PQ00SQ0 0SoP   000S  00^0 PA! R   R0 0ꄸ%t2()(P0 f@-X@000D00S 00CS000S )(t2()(000C S/ @-EP 0  t2(G-0p PR 0S5Q 0S 0@ 0CC10?`@! ,g`` `@_@j `` -R \ -Q0S `0@T0:SF 0R@1T0:Y " @`-@ `0 T 0:S  @`@?:\00|@Y00 X @0 CB!08( @ Ѝn%oP@-HeD0P  Q 000CH Ѝt2(2( $0S Q,0S/-PP -PP R0 @-P :R0S0 ^ HPP0@:T  ($t2(4!G-pR@ 0S PP -R`@@$0P 0S 0S@0-S =@T 0T T@1@DSq0000@CA!0`@S:0\:0l0#1@ T030V:0 000CS0 10S ~3  0 #@0Sp` 0C  0XZO0a0C  R0 0CS0H00S M@0S At2(J[m)()(p@-H@HP080Sp0u`0CS0` 800C803h%p0( 0R @-@T wA 0 B   B /@-@0S@p@-@P0S0ڈ00@0B2 ! ! !!  !!p@-@    @h% 0S/xQS  00 S/00 0/0S/0/~ 08 0/=P/P/0/~ 0 0 0@-h%Cp@-`R`@P:P t00P pd0 Pp0-S0S0 0pV ($00080@p`/(\/(Xh%O-MR 0p0뜒b"p%Q  X @  [c { R00CS0`Q``@320`0@Ѝ X @ ,\[8R /u P0  BR (000hp 0 S B R  [000Up X R  [R.@@  B@80  , Q P Pp P  Q  R P000@00 w 0 C (%%p0(x%ؒ h%0-@0DM P R`0 Ph h "  UP 0T<0< 1 0 01 0 h%f~ؒ @-M@P0 G 00SPRp@`T*vpPT @T>PLP @0 PЍ@x%%2(l000S p@-XP@T T D0T@p8040@p 0 /h%*(oX6((%6(0@-@C*(p@-d@dPi\Ppf P 00008  P8 P Up@Q(%h%A-DR0@T @ B 0S 0 @0r 8 0 00CS0!0`)V*V V v va A ` 0F S꬝Ԟ4@ V0@000 @\V. |V ;V&P0 @ ;P0 @ @0 Ppx&P0@ @0o|P0@ @00@0@p P  00P000K0  h%(%*(*( G-pc00@ T T+P,0S)㰀" UPP @) @@`P  0RP `FFa@@T 0  h%l p@-`0$P P g 0R$, (@R   RP3Pf    Q R 00000S@p 0 BRp@ Q080@ ph%@-y0 000h%@-@oPp@-. @fP P @0 000p` P 0`@`h%O- С`P0 $ @CPp/0 CR00SY%3PB'V0  H100SD (100S @ 0YP@0@Y PX @PW W! V! s0 @00(pGWVoP0V      000h%ؒ O-KM 05P0@00400 P400D0$Bg`P  0S {= 4 0  |4 0gt$0000 `SH4 ` L,4$ ($00CS0c 0Sf@pW 0䃟RPp *0PCp0pC0 Sڈ#sV@0  0 0C0Ps000!=0 000CS0030S0@2 0 2 0 02 P B1 2R Bz0u`0PUZKߍ20S d2h@d2dpD000 0S V0 `PPA P5 \P p'100p PP 0000 00CS0\00\0@0 $P 0 021#20#"P0"P00CS0 PP@0000 F@!00CS0 0000DP38 ..1@@*pb0PC2P \0070-, M00CS0`f R {00^h%)(%)((%x%p0()(:O-pἯ弿M"/0ϟ/0 QO  `00202280 00\/20S0S 2Y IꤲتԴXжt\/Q00S; P.Q00S2 0P0C0p0000Pb\.00CS0*H.0p210SxPpNTP"Pg KPEpE U0@#S?X0L l(d p6p P00@ S0P@ A0@S7P@a0@SdWP@ W_ P H'P 0p@Wk00@S"`Wc'PGYp0000Pg<0 0CS00C0~000P0C0l0P@B00@S0P@5 Y p0P0C0t0E1`0@? @?o2;R0S 6\P$\Pp ?PPpppWppUpW 6;E SD 5:0 S0 U0C *0?0%3?P00 Q ~ B  PA0U!*00%60%3?00 Q ~ B  ?PA00 QPA~P•3U5*00%90%6?00 Q ~ B  A0%3?00 Q~A• ?P B 00  R P B P~   B u300%<0%9?00 Q ~ B  A0%6?00 Q~A•  B 0%3?00  R ~ B   U?p00%?0%p0PU 60 d0 e00CS0? 1P@0H21SZ0 0#<R00SQ 0SJ60쀟SPV 0P@0 P>WUT@>P0 |P0 &PU000@$P0 Ѝ h%(%% x%p0( *(*(X{ `/(\/(4]&~ 2(%ɓ p0(ȓ P0 ,  0@0 0 S 0Q >W @<P >P" &P0000000p0p0 ((0 P0(0-P   pO0YP0  0{P BP 10 }0 010{W0E000C00Q#PpIM}PP 1 " )00 0: <}P,p S0SS|l R 00CS00 - Г n%0Tp@-@ 0T PR R R& 1S#0 PpR!Q QT " "D0600S0T0S 00S02()()(%@-@-P @ D/PMYPh @-@P YP 0  O n5(QA-@ 00CS00 |p|P ` ?U UH?U!P0P0CS00 `M,G-@Pp000 T` 0000CS0H00SG0S 00S n-@)(2()(P P0  /\ Q0 S//2(@-@bM0pS910S5 0SPPT,2C 02S p? 0Sl UX U` Pp2 W`RU(Y@D0>T000 0i00 M10S WT T T02p160S02&S- S SЍ0S P$16 R ! R0S 20N02S S S PS S SP PPP0N R TU U DR60SS S|2 1 @$ 2(l0(%2(8PO-`@T唾P P@ᎾP 0ቾP0FpS@` PCPBPtP34 fPP`tDa0S! 000[,U 00CS0 PT40S 00CS0 40S P@U00P@s胟`1 R 0PU TgO@`@VT c刃@Q0S 00S 3@@TP@P @PP?`FVXn V@8X @ᴒ异 0E0pP 1`V T@@WPT \@ T @@ Tv@X PбБ@DP; ?P`1 y10S PP0-S0SPV @X Xqp0S@ ap;0S6 0@0U000P1 qR ^+pVP 00CS0\00S 0U00 PP zW%2()()(H ,} %FA-@P⠀0` Pp UTA0S 00S 0@D0@o000CS0 00S P2(2()()(p@-PD@`02S@20CSpkV02p2(40T0P?o20S 0S//2(C-p@`1010r!Q0@S10C1 ЍqXPU X2_Pw*ݼP 0S 2()($0@P/!!R /2(p@-8P\2Sp@?<9\Bp2(0-MM01`"R !R X"R   1 1d"1!d2S ,'TPl1, ,TP L!0,00T@P$1, @T0dL`0P, U @T 0S P00CS0 ! J00 0$0(00D>S 00 (JKFJ"!0312()()()(0@- `"dy2(p@-@H'P 0PPp0C/U00p脔 p@-T@TP0 0P0 )0 0000CS0p00Spp@w)(|%)(A-@R`P  I0PPEU`pp WD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP00000 00CS0h00S sDP`00000C0 `5()()(p@-@P@0SH00Spp@00CS00  |%0|%0|%@-@P*)Ѝ`-@-  Ѝ Ѝ/-$0@-  ЍЍ/|% -p@-Ml0, @P(0 0`0CS0a0`1@00DЍp@Ѝ/G-@'`P$ 0S! pᩰ0S00CS0>0 " u00CS0/0 " 0S VpW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU TPP 00CS00 '  |%0Q|%@-@@|%@-0rS0G-p0 P0R(0帐@0=00D=`@`F@VPpPER000 S=S B`` R`ĥ`PGQ@ꀸ%p0(x%0@- 4@ 00C000 0#IЍp5(0P P PR00/0@-@DP^ ^ R0L00~ A-( 㴀 R c(p`@pW p0S 0QPU  0S 0S   3/P@P005(0SfA-@GPU p`pp0S'STP@HAM'ᏮPP,  EBMO A-P0@S`p    3/@P@PX #W p0@=S0U 00 00CS00  0 00CS00 x 0 T i%PO-@00pS 00P㜠Z 0 T@PU* Ѝ`V Y   [ QʁxaP`0pp5(5(0@ R P=R/=R/A-`P0S=SPERPU@'㦸\0\pV!0@qpT 0S PVpp@p5(5(1@-`0@S @ PPV 0 `q& Z h4  `R Ѝ@c&Dq   R <0 2/0`N& 0R , R  00 0000@!L@0P U U0 a00CS0`00S Ѝ@ƭY0#L 00P P Ѝ脸%)(p5()(|0-GM00l00 0OP @0 80 Gߍ 0 0  e)()(A-`p= P ᦭@VPp XPm0DP @SO=  0V  @A'`ЍA50C\0-GM00lOP00$0 0  Gߍ)(p@-OGX@0`P%@0U<V ` @-)0Bߧ %(0@-0 00 ѧ)(% @- @ R1P\ * ٧Ѝ6 O-@M`<'!T0pD P-R lRC 5R -R| `5K@P{2 000E @PppGWP 婱PW pGP™儲PE0%S``PX巧pW ;sR R`6pTP`2妧PU W@1 000 PPP@U aDP@ 1 DKp ZKPt Sh91\O@P J@P0S0Sp@!Kp&0 0] X`0 R P!q *S00 R dS :F?pv \  TTs7?oo4]&P L mh k %Q [  y 0@-DMf0   0@@DPU#> @0 %@    @0 Pxtt, Ph DЍ0=P *(*( .n %H?4 p@-遧00S 00x 0p p0p@0   PU P@P0P H0H P p Pp)(*(*(h%2(2(%%|%%%p@-00@@}0 0@0PU@0002l0A  R 00CS0H00S p@^@C0PC)(t%.(%)(5()(P/p@-@PTp000@p@-@@aPTp0   SC"""""""""""""""##@#@#@#@#@#4#4#@#@#,#,# @p@ 0000  n0000@ p 00C \ /p@-@P5 0`P  S'$$$h$$$$$$$$$x$$$$$$,%,%,%,%,%%%,%,%$$0 0 000@0pN0 0  0 000  00 2  0 000   0@-@PM  0  %  0 00P0 0v@Ѝ0@-@`PT@ Ѝ0000p`@PP000/0P/  R /$P/! 000/7( 0P00/7(A-@pP 0` V  V @00CS00 a 0@ 000CS00 O 0`7(%A-p@`xT [TP'T/ 1Ta "T* R1  !\0DS()''''0(T)''(\)'''''''d)'''l)'t)'|)'(@@7T/T @0p00CQPRApET@0P@0  aCPBW0CACP70C00CU@W pRx卤h0 p \@RTႤ<0  @ @ @ @ @ @ 7(4]&Q l @-P`p@P \P 6/)0 cS 0<0 Ѝ0S0P@00 #10#7Q00AU@MS0-S@6/P^S   +@^S@0?S07(4]&0 0)( %p@-0S @0AA 00p0@S tPP0 0CC``00p農"Pp0`0PPEEQ 000p7(   B @-P0`V) 00埲  :0 000p@ 0lA A@00T0,A Aᰣ00 Ѝ7(4]&Q  @- P@p `0P h@h0 AAx00 ЍV@@T @ 0 AA{7(  @-`0@T/ 0'R"RPP0 Ѝ@- Pe +0BpP d0000 0HA AK00 Ѝ,pP7(4]& G-pᘫT@P@UH/P00`E (1`0@07( 7(O-08iP0X0,9,M P1@01.%Px @0  000P@`V8 0S5 0S1LP X $p|80PEAU,ЍP@@\V $(8P00CS00 7 0$ %V0%S@700CS00 7 0P`0p*Sp`0.S0@*Sp@Z(Ꭲ`pp@0xZ0WZ%Z A0J R'X0J S@611111111645@66661@611111@6111 61@611@6S6H251666Ѕ\P  ᚪP \c 0\\ s00vZ t 0 W\\#LQ 4D333433p3p3p3p3p3p3p3p3p3p3p3p3p34b '\ \\ "\  \ M\^0? \@^0-000fnrtvaet 0P030  C 1 01vv똓`P d P`  d2  %Pd  x s0v0 t 00 p B`0 0 =0 t0  l c)v t0 < <"0P 00t  |j  v t  j 0et 0^h0P $0'S"SnZeX0S$ L v t   0# 8ɯ0$60$  Yt 0#v t   0t 0NVBT^0 <嵠7(%~dO&  t- 4]&H&`7(&MC 啪0C-Mtq 0P` dp *8@P 0H p"8@PH 0p W  ; PuY <YkPP0 0ES, P L0ES^Y0?S0 -S00PH0,Ѝd 00S00H <PH`8P 4 P r x    0s@-@0 0 \9XPX`Q P 0Ѝp@900 9 P%P PWO-Mp:(P `聟葟衟000SЍ@P 0S =PP _00 cmc[lҩP 00 Ta4i[HǩP 00 0P  Em 0$0l[ᲩP 0 0o[ ᨩP 00 ᡩP &m 0(0 `Q 0 SᏩP00CSL m0 0 0Sld &P #u0K00M00P0D0 0C0D080;800,0/(<0Q8 00,,<008 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@>0@-d00$ 8 Ѝ@-@4000@-@4000@-@(0(S00 080,0Ѝ`t p@-@:7PP률땡GP[`8呡<叡@卡D勡U\兡`, 87`17V0,0pG@-@480,0@-@48f0,0&w8= @-8@o8#( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8b@0<<@00,0@-$ O8P^ Ѝt@-B8P^nt @-78P^ot 0p@-MP`0@-S00(000 0P  P6P 0( RX  0 0 S40,J03/Ѝp=h P A-@`PpQP-U@Q;P00  P,P 0-U  `0p@-@Px @0P ,pT 80$P< D0TP$ <0<Ppp d  p@-P @0S V700Pph7(Q+  0 BR @-%7 M- 0 S^0@Q 80^  ? 0  / /np7(h7(x p@-@dP`V PU7p1`HV4M70J7 E70h7(2igMH C-MPp`s@^T H,7V@P 6 @$       @     T  | p d X@<  Hy <u@ 0q $m i  e a ] YU Q M@D@ <$A 7t@  < S S  SH  D6 C"VyP   W        uȅ@0ST  Al?P6" K6X@ xE6@W d?6t @ Dx8l ,` TL@4(@  T4 @QV \ T@Dt8 0d| \ x Lt  @p8l(h d`3[@V RNJ FD|B@l 0@:TY S5Vl2<08 *(@@V  S W   2VxApr`VЍ00 d @4V   Q  40넑 @0l 4 T l@ p,4:BIPW_gpy%+:}BIQYajP  -5;CHOV^fox$,43yAJPX`iqx@-֩ _5X2hV&00@-( P 0 0 O5H2x7(hV&s@-@`ة0 00#S@oPͩ0S 8 Z00S 0 ZЍpM0S/#Sp@-@,P(p0P 00px7(峤@-PRP@ p`7p 0R" Ѝ茩0"S0SO 00SS  00@O4]&@-T!PL0  p@f0"SZЍ7(@-TPL0 p@K0"StZЍ7(p@-Pd@0S 0S 0SS <<< U   S(000P 0p7(\8=p@-Px@Ql :Z#P L0 P      pp@ @ꀢ Y7(0@-@MPP 0SPH00Ѝ000 0>P0 0 r7(O-P`Mp` 0S@v;$ , P 0S \ߍPꃯ0Q 0S Vs?@0P P@ P@0 ST WpU: 0S L 5 09/PV 0``7(U@-o0S S S8 4 ЍS$ Ѝ Ma7@-lP$ R`rY;@ H$0S p0 jY  ^Y Ѝ07(#=(Itp@-@P 0Sp@0PS P00ʾ00Sp@-H@H H`HpHP0Sn000l3 ꀥ hV&=C-PMP` 0S00(p0 /pAP" @/Q `0p0@1P T0 p'PH$0@@ 00Ѝr7(7(0G- @TT3 HRD2DD1H#3( 4 3, ( 30 38 34 2#4R! 2!4S 2!4S 2!4S h2!4S L2p!P0S t02T!T0S \2 ,LPp8W ЍGF0S. a`` h0 2 0 20US !S| !3  \20US:3 0U  $20x 2pPV& LW~$+o4=FOXaBBjrO zO (O-Q ,@QlP0QT 4QP@PQ,80S,00 80<0S804 <0P<PP<zP1 QB"9p묱`8X0apS pR  _ <0R\XP 00< S8NP0S9`(寡Q A(娡Q :@P0S0 BS `a 0(h R  R* P*ha (Z77(y!G KxO-;$M p* b 0P$S  ߍS 렲@PT[D @P늤4 婫0X ZS' ("$0f0Qf/ j ,2!S!R !SS衟01,21S 1a(!"$a$"R R P@0 0꘡1Q#>00 Q,2,"b"!4b4# ST 0 p~#> 0"448#8 R* 0S 0pkj9 P 0S 0 p]1Sq j  @[01S j2 f/j ᗤ01T T%HM =(7(VEW}}WEVo'VT9(V&A-P@p%`P %R 0R000005Sw D $0f0Q, wV  7(=(7(p@-@,kP  P$p@a$0@-0S ,P7(@-P  7(O-@4kCM: MP00 8P( 8PP008ⲻ80p0S :7P  @00 ᛻Y | P 1(p`  pD P$4  X p:0 $0 %P$0S m$02P 3P pGGqr῟P,圙圩$ pW 0S$00k P$00 P$00$0 P$00  /@፟P pWa 0SY] 0 0$0P @2 8$ 1\ x$ b(P $0S  S;Ƒ8D0;RZ,( SP  C%IP  @ P 00$0P$0S ++RP0 0  $ P  00$0gP$0T0 @ P  00$0VP$0`0  P  00$0EP$0X0  P  00$04P$0\0 P p۞P  0 0$0P$0d0 ,ɞP  5 0$0 P$07 ᷞ P  l50$0P$07 {ᦞ P  (50$0P$07r jhᕞ P  40$0P$07a Y(ᄞ P  00$0P$0x0P Hs P  00$0P$0|0? 780aJ0S0S  P0X:h XT0 0I070t 0 ST 7 . 2Z/ ` Ϲ0S 1 س#0000S05 0 3000"0$0   00$0 ]P @$0!SL @0$0|2$ 2 , @pCލ Ѝ0S 0n  QP0 E0P!A"AX0S 0崡0S 0C RS񟗚hl(bhl(b(b,m(bhl(b(bl(b(b(b(bhlL J0S0 0S Pz  0S$ o 0 S Pe ~ 0S$~ t 0STsl 0 Sk PI b 0S$b ל>W 7( ȥ $*/*4*7(6Eb7()7(boC-M7(( 4]&nr0s@-`PU V  P}F@P hЍp`PD!<0 x0@❹V ( O$00S ,@-00%p@-@5S4 0PSP p@@Pp0S 5S 1S RPp5S X `Pp@ LPp*(( PpR7(7(aedArdAs@-PA1(`(000;a5S 4 5S P0S ~0S005S  Pt p0pPD+"5S ЍpH HlP8 7(WEVfd%md6%xq7(gdG@-@P f/F@7( 0 I%|=(md0S/!  -3@-P\ P 0S S@@ >P@Ѝ0@ Ѝ/U&p@-4@4PQ=p@`+ + @%""@-Mp@p0l Q d P0cS CS SS 4儸sS00ۍ0](C""0@-MMd@ PP 00YSP ,bۍЍ0mP#-#?# 0 pT=(V&@-@M,0 vP  ۍM#zp@-$P@ 0 p@OV&T9(T=( @-YMMt@ p\ YލЍ<0< S <fCPژ10YS<0<0+rdAa#z##*@-0gj z gz z4 'z'&z'z{zgzzz{*Ѝ5#7@-P0@ 0$S0S> 0S6 TQ+BQQ+ QU10S+ 8@0 ቙ 000!C0ASvtvtvtvvtvtvtvvtvvtvtvtvtvtvuvc0A Rx*t* Ѝ0zg{{' Q{ zg{k Q{ { { @](##@-MX@X0T Q L P 0nS yS0 $m00ۍ](1m$$K$P `00CS`0p S00 P0S X0X /X+U&G-P 0p`0 D@P PO*pG(T@Y @0 @HcPp Epᄠ 0  a U `V` ` XsЍZ$jTtV&O-M M@hP`\%\TuTT0S0#!pD P MP   P'p0 p( P &  nTt`(p P  ]P `)ZP<08 Tt`( p P  ]P )0(0Ss`, p P  m]P )0,0xSXs`0 p P  V]P 4l)000$Sr`8 }p P  ?]P U)080Rr`4 fp P  (]P l>)040xRDr`< Op~ P  ]P ')0<0 Rq`$8pg P  \P )04Qq`$!pP P  \P (04xQ`$ p: P  \P 8(04(Qp`P p# P  \P (0P0P|p`T P  \P (0T0ۍ Ѝe$T9(V& w$1 $$$-G $$% %:%]%}%%%% &,&K&n&&&&&'.'M'j'O-M M@tp PS `V30S0`Sl:P`P8apEbWWnF`0E `F 8ġ됳0A"S0#1` pvp P( AT⭘PH#<<" ' ⒘P0S 3/ PA  P,ࠐRx%.A <p P" 4SA4`S> :4`P92a0C" 20< S :A(("YA'x5|%.A p` P0 x5< A B0qpA'A 0Q<0PAHx[0x5< 0RA | syP 00 00S pP0`(V R s S 0 00 0`PX'ލ Ѝ''% '1 d ''3('^((D((T=(V&](( - BR0 R (A-P@ ( R1!(0 (0 'X0 X0 tX0 ` ( H', <'0 0'8 $'4 '< '$'$'$'$'P 'T 'dp0 1R0S*0X`p\PQ 'VlOA") .)***#*.*3*<*N*a*v********+0+a; O-pᔀ 2MSR R@`aX 8QU ,[R 00   u0"@` B& 8 ,   ^08"@ ,&( 0 ;' !R21` 2' 0S 0C RjSgЈ$Ј$$$Ј$$$$$$Ј  1 0 0p '8QI T '<0P+8姖Q* 8 0A0 @&2<0P+8卖Q *ЍO0 0 0 0t& d&8 T ЍOЍ<+E+ a+i+S+on+++q++++A-@Pp(D&@Q`8SA  0`++ 0`( "4`#/A-P @"440 "440 `lp  ((,,004488<$"444$"444<D$"444$"444$"444$"444DPPTTXXQl`pQ("448(@"448d0`PV@P ~ {0T0A0T0A T"440A7(@-@l40Pm08Vf/კWEVT@-@P TP8#!00Q@/WEV7(80@-@0S B08f/YL9( 0\ P0//@-#LL@LPL`0 @%88Y R" 0%,|%R0hV&S,P7@-@ PT4P0 08P8 0$p0 >K Ѝ0P](vd20@?o2P0S@- p`P @P P P P@V@lPH@T@T $p0 8K@@ Ѝ.k,a](ud2P0@-M xdPd@ z$p HJ 0 4g$00+ +_$Ѝ0](zd@n,,,s@- @Z$p J0  C$0 =$0`P   4$0   -$0  h&$0  P$0  8$Ѝp](td@,,,,,o-6-^---p@-( PM@`P $p  ( V V h #PЍp (bH( #p 0QJ0 #](}d(@-p!~d(-.P0@-M @  AP@ -J4P4 #p0 (JЍ0.]({dЀ2C-`!圁圑0,M@Pp00  p0SPXX@A #p  4IeP qP p` $0Q 00S*@P IQVf#W !V0  R00T#tP 0S,Ѝ00* *  D#`@l-dO&<.](|d?.N..$o ..P@-$M /@P 1#p tI0P u  G0P 0P  0Pp@vp@ 0x @d~ p@GU@@_Pptcidyara3rbmngnts by MM20D S/ 3C5C$1 4! 8<0/a(0@-0A QU0&Q  „?/.01 ^ L043c 0P0Q  „?/.3@01 24@5 ̎ @a( 213/P/a(A-PT0p(,`I@E,0T@@DA?@?a(@-?00@0 (20,20{0P!P30a(> 0R//G-0`p(,BP ^ E @PPW ,20CS(20CS G0a(e4`4p@-M@`42S%^  E 82<"@ 0(2,"xЍp@sqZ<"82El@d`M,"(2H0YX"\4Ѝp@Sa(L%i4r444444e5y55s@-P`ኔ   0SЍp00S@y0"S1Ds@-$ML@0 0 0 0ohV& 6A-P`0 p @TʬsE /,s0d  ? qp  RЍAoL`l0S`@D@,+ ЍL%88a(A-0ppP@`pl!14P S H d" R S R, 0?M8Ua(8p@-P0@0S( ᠒B01pa(O-TM0(00,0x0$ #0P㈰匠s80@300<080S: (2,3`W(0, 40"404 D$0@?$0 0$0 00  @ D00Sb"dPP D$00( ,00 ?1 0 RL0 $R0 S t2000#1-R0" 8LL`P@4Bx0P00S ՄP  τP  ɄP% L`0L00 S? ٌ0< |g2jE%KUP14W\"?C$50㏌P@\2S@0x0XR@x0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (00,00 0 h$P @TЍ P @j?a(!9L%)9c(U&][94]&{9!c~999-s@-@00CS0 JP` Pp ptC0 P00CS0J0 Y@oЍp@Ѝ/U&9]O-0` pCPp/B$0e@O 0Јqp Ѝ  R ЍOt`0S 0᷈qp `BE,b w0S L%9a(p@-P@2S t`0n/(2J1!41#41U @0&"UU  p@@PC @@Tpa(k(c(G-@r,6`P LC` VPmYTLE J$Lx,࿐0U !VU ! [E@s_Ps X2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@t000a(Z$A-@PXPAds 2F✐ t B B$w00C0a(O-Q40 Ѝp0QSP LaXR XF0 pQ 0>80Ԣ #ZYPPUJ0U @DQ ČUȌ̌X L X0PZ 80S 0sPU*‘ 9a( :2:O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q  32 $450 (, T02Sx Y< ЍPT 21倰[R RS$ [0 0 2S Y PAY 2p00`@p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$v00C0@@PAy`d1S  14 8<   P00P2S. Y  a14a8a<0#d1a#h#?09412S Z 0?0\1QR02S 0 ¹0S>0)S Z0)S R0 Q !Ps?00 0:o0@  L 0S8&a(;L ;o;L%<<2<f<&<==<;;<<<U<N=q==;Y8=A=A-4RUP@P@DЍp(0PPB1P@XaXaPTS <ЍA0!14!8!< 1 11p1 1!1<0 1 |1 ?0v1!1<0 `m1 Ph1 ?0<ЍA`a(϶o====>>&>8>I>Z>l>O-0P-4M`@,0 q 0Sၴo_l,P0`("p/o" R 8 0+ 0(  [ 0 U䢑 Zz @ pD H L( @` 0t0x0| 0XS T0@˟`( PX=0H @`21S /0.30010204458<0 TTQ6 R:HL"T 1"R. 孤4Ѝ0(Ro_0hP(0|H 0 P(u( 0 P(lx Vt  @D H L(@`0XB`(@ Yw  0 pt0x0|9pW2SjX 0!h ?  49 ܂,j  R    0$  $   00@P`T 0 W0S 8`p@W 0`S$0 @0u 000 V 0S@8Xr\" 0ׅ`@,@ `SRp 00 RW00 0w,p0S| 000 72PS XU9 @`@ w@ ` 0R('0Q0[042 @`S`Q $ 0q ^A$ D 0 H L@   @`021S  "/0.0010T0 320445 8<0 T @` @`2S 00 0P52S X@U @ `@ 0S4 2S H"%>0$0 0 0S- 1S*  X000P$  00SX0!14!8!<!14!8!<X $ $`LLD(`0 S( 21S$ / .0$40 81 <X S  PX 32 $45(, X\ 00$0p@`\3"Rq2S. l ]<0 00 P 40 00 PXS (00D#$0 #(#< 0'4 0'80'< p 00pr0 @2S` BT0`l#PX 0 1<A 80@@,2 0C0@0@p`(2? 00@@0`Fa ?`1<A 0?``@@,2 0C0@0@`X(20? 0@@4`Fa?`?``0S 2S@ @TJ041S0Sg 0s XPX2 0 RS  0BPTo_P(La(϶}>>oc(>E >5>M>?'?6?G?W?c?G-p@B42gS0,r,bP42S 0P*U42S 0S ֡qԁP 42RSfP:ǡ42S]1!$1(1,ЍG0Sd S^`兤d 04Y2S L` ` 0)P"PR S0SЍG{+@D 0ЍGSP 0Ѝa(q?ڌa(??????? @9@C@@-0@M0@ pp`PLpGߍ\ ៈ0  0fP \ Ht02S 0S " `PH :!SR 0Pd;R@k@a(t@@-0Xa0 0LAP d2S8 !P($!p! 2SP0U0 $tp" Rp\EU$p0 00P d2SP P@ Ѝ0P0!!1 L%a(md<a(@@k(@A-@T2 @PP P  P@ `p@T 00S p`V@PD00S @@@P`k,T(h%A-Pp`'&@&&000 0@@@A-p@`T IFPP;&( 0@@%@G-M0h4 P@ TPD ᠃P @ 0嚃P(4 00(0 4QT(0 ,0%4@# 00@,0S @@((,0@`00P0s刃0C@0P>P0 !0P1P,30  ,3Q #   c0T0< ^p@8 PA ,0S ,=;< 00S< 00@ $dP&0FSʆ`%P0S -S@= ;xP00@@P,0S ,^A0 BYP 8800  0 R00S' 410XAXQXa40C 00C[8븇0S0S0S0S C K0S C AC<C7$0#4 ܍p PS P.(oΧF 9 TT1TH TTl%Q T^ 20/(0/(0/(,@-@-  % hV&G-P`pJ@0S  0S X| ,U tTY0S 0S@ (V%V-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  RC-M Mq@` @PPݍ Ѝp!r ddPp=0D@@rOeP,0: S0RP00 0T)PP IP81: S  S U rg)PP 3 3P%PPPU r"PP @P(|h UV (MdVtVVV@-C0P  44 0 Ѝ    (VV0@-4S 3/ (@-M00 @d 0 $ՅA@ (@-;@3hȅŅ1@@-p PL`@@0 7/0P S Ѝ h00ꔐ(O- MM06@  @  @ 0p$000 (02P(LL@ ܍Ѝp 03/0P0  m!P @$0SP (0SDUI1`P 0 W U euX0YY 0 `p  W p[ 0S $P % 5 e@uUT \ 0@W0SU 000 !0q0S# 0S,aQv00CS0"m;@ T 00CS0!c; P @YT Y@DOoB 0Q   @OoB\ 0 @0  0 0 SNT감(\XjXU&V&1mbX@-0M 03sc000@So  PP* R! PP<] 00@   # 0PS PQ `Ѝ0S 0S 0S\0S-\ 0/@  \0Sp0 @ 0@~vp 0S0S @g0S  @"  @0St @D LP@ @0 @ `!0xP|"%#   T`    P @@``a/ U ] x Zp h 0@`감(((tX{zXXXXXY,Y8YYYYoYYG-0@  0 P 0S< 0  Q*a PPZ   0P` f pЍ!URQ PB l [0 p H0 0W40p P , 0Q0   040 04! !$0 0 0( 1 0, X0R`P` KPD 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0px00 QP   s  0P ^P y^pP1S1S1US1S 3S3S3US3S,  pP0p* 20212 1300p 0pIx00 QP  7    0Pp00S1<01@040  0%x40  QP     0PA0O  A0;^P 4W ء 0R  N eYX`V P0E#| 06#++R`HX< $0S,0,  RT0C|D0"#1P0P  0QL \0   0P 00P00h00dl0d@Z3ZMZwZZZZZZZD RRaArrAaU[/[O[[[[[[\\#\@-p@`P 00 P0Puw 00QP 3 Ѝ P 0P< !@ !0 P0Ww 00QP 4  0PZ[@-@ L0 R0!0!0%\l00l0 |p00p0Ѝ\ P0\030# |0S L |H00L @  k 0zP000r\\G-`XpP @ lP W Ѝ0!0呗 0vXY DF X0  X0 P\\O-@,M0p@$0l@`P Ppr3$PP @,Ѝ 0 LRŸ0XPT QQ9 QW @5q3Q \ \\\@! P PPPQ   @P@CL0!Sp sppP0 S# 0 Q q 4(  0L $ P 20 2 p(p,"  @ "  p@! P0 S@  2"!"0  0p@ ]M]+]]]t]0P s s// /]]rO-M`@PpP0S Ѝ X  H r0A D00 s/ r ql  `*P0p@P q x `0 P 0 00 P 0 00 ` P s `0Pt P0 0X `<P ]D ]^'^:^^^^__2_R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0_\PO- p`0\PPX $P  qQ0 0\Q@T(2 R0@ P" R S C0BTX t0D s  3 0 TX  R 0 0 p| P YP  L BPTR2 Q PE__`I`_O-X`0Mp@PPdЍ |0Yl0L 02 R0 r00 P葟P#ر 0 ST&R rH 0/KP |  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX0!  0t0 QP \ P\`G-@@P`pP0S 00S <0s+@qa$0S  0S 0S,0(  0  `0S"P  S`pl S HD@pP q P0Q-*l0S 2S !&l0q<0 `@q P R#S 2S pP Q *S 2S pP0Q*l0ph hTPP 0Wp0RQ@0```D 8 a@-XP?`\@#@3P@T@TpW @@T`L(O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ00 0 s Q P P0 W:00 0r Q P PLR 0 P<0T 0qB(Ma4aO-M@L0S<`@DHp S!-P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:gaaaa(0 A-B?$@[`/p0S u0ES PC 7{p@@0T?  C0(0 PK %/(O-pcM 1W, 01 SP0 S@0Pp(0@@D0 0$04@|D0' R$ X0`1#b#<000< 0,009r<00 QP cߍ0P@4p(0@pD0 0$00 C``02# , PV00a280`F0L0L08 SD00S   80< 28000,00q<00 QP  (1 0H 0  RR R0(10D04L0 `0L0C < *9P. (1 0(11  J   4 ,0B0 D0P 0D S140S  ZI@(1  0I@0;+ x P(10(10@4 40 0S_ 0@ H @0(0/os" R$ 00 ,P 0y0(00$0@0 pS@0! 0C@0@ 0㓲" X 0X  PP  :X R: U$0p 00pP0 4n U/0 00pPd(@\Q UpW$     Pp PK/\y g0x!P0p0p0q P$ b QQ#hQh  0 U P p$pp000 000 0p,@Pp0S*0  Q b.0 Ab  @ @bρ G?@ L0C@s PQ*W w 04L |1r 8 <|1 0W4 8 <1t0U`0  0\|xQ1PP|!R \  P PPL0sPP|!I6@0|1|Qx1U0P U* SR   1S \lhP@ I0@ 000014h0uPP 1|!RJ PP 1@]300 0Q (0R| U$0 00ppPt, u)e00U0\`0) $ 0(\T P0000 0 0T 0P0 0 0,E@W 0$ Se1Sb I_1 S0(0YRhtP0S 0Sl \d|RR P0S02S 0S0SV 0\2SJ\E|!2xQP >PPx 00I@ s 1 |1P 'T$P PPPPPPL0Is0PP@1@S!U @[ShatP=PU p|1WS P@ |qppL0Is@ppP !SP| t@PP 0 1|10|1#40L0s_?00010PP$ K/\ xPP05P 50Ph00h0Fd 0ES:\P |!d1PHrH"HP : 00|1@2PPp818 ,80PI 020SP0 S0 U$0 P 0c000 000 00 0,@ D00S< 0,00n<00 QP80,R0 PI Pd01S\+!0\&P %4QIP0%8%\@0 Pi(4aMaab"b- ,b\(Kbcbbb_c]m {c&0bbbac=cccddYd}d1dG-@p r W pP\aPP Pp=( P20K/vD08QP0Q:" 0PS00  Q pJxPhdP80 "8 R 00 05 !$x(ddddYe0eeep@-@5%SQ% 5%QPR 5UUQQp  0Q   0Q0  (A-`hPp5{@ @ 0% Ņk@ŕ\(O-OMPp0P* b5S 5唢@TE  {rP@ ET \T 5d 50 ! S$5"R$%P0SOߍdP  RR @`0d B2" 0}m JQP d _d0P Eh0K/0h0 u0D! k,qr0d 01(  v j  u  u,10,1#40L0sK?000/1001001#40>000310 00 000T0 C+m(%,5QP Hd d0P e(ef(eee-G e@-@ P 0 5(0/(0/(0/(,@-@-  + hV&G-P`pv@0S I 0S X|@ |U T5Y0S 0SPv@ %(V%V-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @PPݍ Ѝp!r[ddPp=0D@@rOP,0: S0RP00 0PP P81: S  S U rPP\"Y"P%PPPU rXPP @P(|h UV(MdVtVVV@-V20P  44 0  Ѝ   (VV0@-4S 3/ n(@-u00 @ 0 $%uu@? (@-u@Wuuu@G-MM`P@p`PR0 `: SW/s0P  rR du00A 0C @H#@ V& 0S UP0P帐`0PPJ0: S,^0"SAP@TP&P :pP  PP 1@u3M`@ S @ SM@PPZ VPPn UD e-4@+S R UKFPXp!t0#E+PU\00`0L!0+ @P2 Pt0S`X PxP0 nPP W80% ܍ЍnPUz fUv +TrU $(f0f F>fF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440`U( $0 $(Rs XXNsddhhllppttp p@-"440 P"440@ UUUDDU@@ UHHUL`LPPTTX~X\{ \`rp` pr p@rp@-`"Q@Upf@p@-@PTTTTpA-P@M4Q->CT->?n}C@X=X\:\79>T9>:>CT:>CFT 0? AC>TC>mGTFTE~EnFTGT 0X J~pXW}m  $$((,S>,hTS>GdTFaTHHLLPPTTXX\\O-P@`Pp !"441!"441  $$((,,00Q࡟\5 S L5s`PҀp0,$ $Q p W :YvTrTpXnX\j\`g`dddhah`l]lpZptWtxTxS0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P \`" :x"0S1 \ L0008t 0 HP( $0000S 0  0.P3 p\t.P#0 0;"0K 0 8 @   0 0S r n  P1 "].P ЀL00 0P0 H [ y 0?0 X0p20J0  000r00S$ 2j0 H0 h0H [0 Z0C 03#  4 S 0040EP!bx1 0d 0d0  k000C0 0 S  8  0000 1    m0000 0 !0vs  0+00S К(<(eff(x%4fgh('gfT( g2g^g|gg(g,&0ggG-P`M@HXpAZ 10S t10S 00 0O P<ЍG(PE@U> 1 RP1H i0  P!`. H0S$00S U v 0S 圁0S G B@ЍGdX0-P L0 ЍUؚ(К((g(x%ehh%h;hGhT( 0`( "4`#/p@-@HP081200@ 00 /00 @ohpܚ(00S 4 /L( 00S/L( 00S/JL(P000R0S82O-@ `RMPgD R0R0`ď080S  C/ S ! R 0C00 0@#ἰ? 0b\5p!Sp 0 0Ϯ00 ?@U '  ϬR7 R  0 \5S0 00/70/0 0 Ѝ  [ T R  P00 0080/(ܚ(Ԛ(YhThhhhP0O-@P:1 R0* 0똑嘡0 `P3Qx 0 T B:\50 03b00,"1p R 0 0 !Ž p 0b`0 C c00p0S   0 .0x 0a T0 0x 0a400,00S Ѝ(h(ܚ(T|(<(#0O-p PQM P*H PW0k:, `\5 0 0a00O,"2@ R 0 0 !Ž  @x 0a`0 C c00 d0@C C@bA c30B$ 0, Q,040(0PÏP089,10S 18P0XpC9 ̡PWEʸ 80,80<01p!0<S0<0<0Ѝ U8  P\EHEEHkH U00H0 S0TP0S0<(԰?0WTEFU  P 0R0SE ?Z0:P0EU 000Qꐚ(iܚ(T0(((<(,(h(D( 1G- 0pP ``   050@ 0S 0 0 80PS `P` 8UH0ZP000PS a`4xbQ$,$ (,`(PP8ܚ(:i(<(_i@-@8P X080萚(G-ܡP0S100 B?p` PAP` 0@`8@Pp1 ?w`\10A0I00 00 0 V0 (p"(p p1 p#(,` W Vp`0PQ%d$0SP 1@0  XPP00Ϡ^P0d000 A<(ܚ(d(p(`(\(l(iP0p@-P @?`800P( 0^!SRpd(p(ip@-X`0SpL0LP0@1CA0S000pp(\(l( 0 0 /|(O-H0MS MPp` 003/ ލ Ѝ30 P00 +0G000 tp¯0 @ S 0V  0_0W0P3p!0S& @3Q2Qg 0*"  10 !G 0[0 02H+ 2R2 t R9X:000\P  $Q$+ "2P Qv{ {  Qt Qʰ1+!!0Q3 !03H0 R0C?o20SF P1 B <+B0((P4 RP& P E} P 0S 03/     0P  0`V c7ܚ($(<(,(DiT(ijjP(0O-S㰄0`P0 V0RM#@M( , : S T \p"(5R4<R P  RSV 0 0 h0S  )dV ,!dv0 唓B?Pr^0` 00p0S 00W \ 8ő @5D0LT 031 a> QP!000T00S 0C600>*%P( 0ˏ d u 0T0 C c;  뫴 ht((ܚ(X(jT(((L(U j (H(<((@(O-lM3P@ 0pZ`!\P  ? 尢 ? &0 }`2儲0S0 S 0h"S 3S Tn@X `820p] 20SPs \`X00X010S, B`#'00X0S 0 0 `0\ *l!00ST06 0,!S0\P 0_PuZ0 20 00 04$04L3 2$ @  *=G0(0S 0PX P& PlЍSu pp5\t2`dܚ(t(T(((L(U j<(((( (H(O-Pl20Pp0@P"`V 0 0 Y0 Ѝ 0k Ϡ?R 4G g@ WULQUW TV A0 %00100 @ [ @TPTpF@TP T  @T 0  P T 0 !00V02 0 %` 0 Y0 Y[@P 0 000\000 %00S0`0000 ܚ(<(kO-Pࣟ4MX{3Xp0 raPp0 g3G0 GA3B3w T 3(<P 4ЍhT+a83 0p R OA 4000?02@20000<T 7T- @ @TpT0y6@TpT 0 0 0 @T p & T 00  08m000XC` 1 0b(P 10010SZ 뉑  4000?0娱  0 X0  XY@ $0>  10@(Pr 00 p4000?000S* A0 0000 0 @0S$p0Yl 0 `00P $ 0 00000 $hQ<(ܚ(k>k@-_ {khV&s@-@P `0S 0S 0 5ЍpkO-MtE M`P0S 0S Hp P 0Sލ Ѝ 000S  P `0S 0S 0S >0S} 0Sx 0Sdu0SP.0S 0S0 08Sd s/2#' 00 " " 0D@? !? 00? 0W 0Wd!! 0W0 pPd,0SS "04 0 R0  0"? 0 , R( 圠*,4ï0AO"8?S% 78P0<P0Q R0" |0S lhbPUt @0S HDb@PUn ,0SP@PPDPtH0S  `Cn* lKDxl%|0S l,l?0p00S00/%P 0,0UA:000S 0S PL1 H0S 0S,0S P  1/P   000(P 0S pP kPP PК(ll'l>lSlxlllllmAm`m{mmmm#n*nWnm^nآ(Yn|h F nO-PH0pS`M W0R0: P <"p`G,"0 S m20SQ uЍ౟࡟ 0@ 0 000CSY?00 1> R. !P\!0  S  L P (  . 80< 0 @`80< P0 V P0  ?$m0 S@ `00 R 0SQ Q\ 0x((oК(o((vo(T(oo(00S 4 /L(00S0`( "4`#/L( 00S/=L(O-M,M7L@"p<,W $ :00S`HW ` p9P( 9XP 0 0 00؍,Ѝ:00 (8P t X8XPh0S  0D j@ P i0S  , d[ ; [; W   054%00! ?0S S :00/0S 0 S :V0 0#03 R00S l:0S7 `  02P: 0S R< jP0 zS04`Ə@5 K)Q9000 B?bUpQP%90S  0 0  0L 06P 090S, ZXP09 SPp0 SYQ980S5  V0;R00*h0S- 8((d0 #0 (P ed80S (0 0x0` ^ (@(A70S 0h0!7'(5SW/V S:'<V  3 #\  RHSQ; 0 0B D U0$00(p aL7 UPP0vX ZwPe P'000z 0@P P6BPx"h0SPp%Q_'qQ PpQ^q U0 EpPQ Ppt ?A7#Rp 10S0AL 0(  Z$0S 1000S 50S $0S 0#  t ?RT$0S 1000S 50S $0S  < 10S0ꊡ  0_000 04 0 S 00  000 0n$0000 #600SH40S l4P P @pt3000 00S1 LPX S00H00S9 0S 30S2 \P&  0HIDP 2 prLtoPd<2 0Q\00&& 0:00@0S428040/<0a0#QP8`\@P 1P0H080a0A`ppTPPU0\(85  @5D0L 0T 32 b< RP1Q 00pZ800 3/ UV 0 P` P00S 4jq0S@ 4H0S*  0 # P0L B#P]8h<((`(((ohj((T(ܚ(((Ԛ(pК(-pL( p'@` 글t|$\5Sc%Ϡ<# pD ?'0 WD40S<40W SW ,4,t`V0x@@0`S 0, dYS 0 :0030SX 30ST s0S9 3S0? T!. 0 D sQ< + 1 0X30qA101[S>  0(A 0 Ń># 0S  90S\00T0 @T`0V T?  @`@T` 1 0X20qA000P 0P0$V !W00 0 pS ;*00p0 VTX0 @ @ PX``W0`3V5L R 01`7: R 0@ 0/ 00   0K0 TR 1VS0` 5  0P W@*  A 0V 00t(ܚ(T(D(($((((L(<((qhV&К((U X(rqr((BrO-`pܐܰ 0M @ 0 0  BRЍ P PU QP ~` {{@ pQ RP Q @p@((v 0`( "4`#/O-dMX ;V0P0\1 0X1 PP1PPp 0,0SdЍ0S 0,`@dQ0 `00䰟@ 0D RpT0 :N`P 0R0A ST TX0S @PptS8(ܚ(@((orhV&<(L( 0000@/00S 4 /L(00S0`( "4`#/L( 00S/7L(O-MH@@`MVP`,:0S 0P *S *`0080< 010S y0 Q0P X P )  P9`0S 0S T)D P00 09 #R0p0,0S01000A(0 0!"4410< 000800$k0P@ ` [_V@00C0M U100 0Sz nQ 0PtE0$S 0S '00P7~`| .0X0S01,000iAD'0 0!"44,'1px 0pp00ppP*0S  YPa 0 1J<`YMPU `@  7< 0<80< 0 80< @00C0 Ɵ0 00 0Q.*0S  P  0"pWWލЍ0S 80< 080x5 0< S dRm0 00$001 ;_ P 0S 80< 0805 0< S 4m0 00`S $`! B("( p ; ᴑ;P@180< 0 80< U00C0 80R<.PSR$ .R  $PPP3P`080<4l3 R0 *30 0NP2 0 0q$Xp0AS񟗴x llP0SS 3 00#20S40000LP x2 =#R0؀20 0 #R0tQ& l20S`20ST؀0  P  : S000 0 0 #R0 Q   0 FQF?d!d  @10 S& L>l#R0 š!ɡ0S  0R {ؠ 1P 00 00lPd0`P00C0X?P8\  <(D((@(m rWuT(s&0L(Ys&sr2srqsr~srԚ(ssssssqtК((rrs&t0t;tJtO-WM M&0AS}ꨥ,Hܥ,, vP7 _l hiP }P7 00[@ , 7 TP 70S 60V6 vBX R0`06`00ĦĶ100V0:6 Rp0S8`@aVwPV}Wލ ЍT P@P (  5l 0S ` F Lq@0 00@(0S S㜕u%pN`pG(pP* 5 0  B, !D ]850SU 00(000]/0n 0S k(0pApN0SpG(pD bQp(?T,p R40xpS@09Y(0G5 A,0 S1 #(R& S000000!Y"!"7 dxhp9  (  ]/%   ,0 S1 #( R S),)-*-{ {d` p 0S(0S , Q2 p2W (,@R@ )'Ax 0T!W"!"dh ZR@ )'A 0 T dx@0 (0S 0$ QP 0  s00 } 0$ 0`10S x10!l10!00C0L10!P0 X00000C0!" }pH0S|@0{ 0 0C0v 00@qft~gT(t|g}to@(\(l(t(К( (tWutthV&<((u(u;hL(GhԚ(Au&0[u00S0`( "4`#/L(O-M̒"0`1Ca2@Tߍ0S p@FDAG@DPd0l p`f00@00C0 00 R2PU 2PUp0 0S0S)P@R1PPUPRPU P0:0000S 00"P D100C0(P X `PSP0P0!p!0 000LS" dTaX|!Pe 0 0w  W000pATt\(l((uuhV&К(ؚ((((ufe<(ufO-`쳟p3张PM @?J \P  ? 匣 ? c0 0P`30SX30T ST H0 S 3 S 0!@ 00000CSFTYr P 80R000303L32   ?^J` a Q2!,S Q0pB*(7`2@20S P P B PЍS x 'Pi?00 1>!  R1[ 10SJ0!T  0 S@1`0 ? J00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 pPp@ܚ(t(T(((L(U u (H((((00S0`( "4`#/L(O-lMX ⤒夢Np200,0SlЍ0S 0,P@dJ0P PD00040P1@ 0 0 0DRpT0;:`1AQ \`X00X00@SSHԷp\t`d`V %P 10S  0@P=P 00S  0f 0S  Q\ {{00徸 0Q  000T  L  <0Cܚ(( vhV&X(<(Ԛ(1v[v(gvvvO-MoM@P_00 )N0|2?0SX0S $5Sڄ0SXxPYX0S $XmX S R<f8?`0Vd2 P\20+! `" d" BM00!X d"B1h21$\Pl2ڬΟ\0C00p21`t2QB1l2? 2l2V0CL0=SLq Q\20B ,( 0S 0『$5> *95d>X>0S +0 0객 S0B$5111`R B- 100 ST $| 0S% 4 0帀- 00$%BR㨁0`S<B11@%L0޶PP  U PN 0S <P| *堀4<<0S 0 00\0 bA?L0<5A?X0 =<0T0.H0(M; 0VHRQX0h0@ @0M8 84<ϠQ bx{ S P,0 SZ?^@ *P< x;0S @ A>+@B@  CP$; @@ !M000P:J*U4: :0S 4G0 0؍ߍ0<00<`/  `!.0i0S ,pdgH 0  I00y+\0#Q  0 i ?T L0܈St90o So d90S 0l)S 3S  0S 4 r0 0t80S 8 0S8`0`80`O 88o;\Ş&"\ `  0 0Ϣd h  pBnj `b"368+?P囓)<TPD  0RTT07P pDP0W`C ?Q `,00C[(S +Ϡ\<#Q  0h ?\0化S  7/0S P#D60夦h M360S 00t&\Q`\uX6PH60S6@65;o\Ş&"\ `  0 0Ϣd h  pBnj `b"36e  `$5S8JGx( 0R #0", 2R #,2$24"00 (2S W08" x S0! 2aK 2D%S\2/< WK 2%Sd2/?L LKW=SL5s45`?? p`00SF[ 2$Sd2?/0?  (2l$0C(2 2Sd2?/0?  (20C(2`D0P ST0030^`0 D0 d^"{ `"{,00C[H@F ?A! |"k 0AS  20 2(2@#0C(2 2Sd2`0/0!!!`pV0: 0`P  Phdqz q08PPN$20$2<0S4 dfF 2,"S\2/0?! ! 2"S?ԀP5/`20PZdFpF0 0 F9F000$5S `0t63 03080D ` ßD <R ,2`0,2! 2Sh2/0^>^00\0/nܚ(t(x(К(vf<(h(Gwvvvw,wwD((x(jwhV&T((wp(t(,(؝(wwx(8 8(xԚ(xXx (ܚ(H(L(H(|xT((x(xU x$5St2h ` 0pp WS $%S0! !,r  $ p t (p x t|  x h L3|l  bh l "D0'P3 00ᆡp`Y7 0$S\0000S7囡!"pW`㵏X7 0 %S\0 000S7囡!PpWO-PLL`@T(p  W @^9y>yA-Q0 % C@*r`! 10" q0SU 10a)0 a*01t10S 0 0T 0@# 03A0S4 Ea@ 5*< 5/000S 0 0@TPYUATt0Tp Pd0 0S L P<0 0S ܚ(К(Ȼ%ry (H(L(yCyZyT(y0/D(0/D(0/D(,@-@-   ㊖hV&G-P`p9I@0S  0S X| U cTY0S 0SH@ pD(V%V-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  AC-M Mq@` @nPPݍ Ѝp!rddPp=0D@@rOTP,0: S0RP00 0CPP 8P81: S  S U rVPPP%PPPU rPP @PD(|h UVT(MdVtVVV@-0P  44 0 Ѝ   T(VV0@-4S 3/ D(@-S>p@y#0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//<(4O-M X hDhhdhP@quP@D@:0 0 P\kP SЍ ??0p  P\PP0S 30S30S xrp3p#0Sh d#S\ P P0S D=0RS Z$c*k,0S O@"\5S2 2\5\5" 0C"?o20Qh [řX24 q'8d p $2 ?a?:010S?,A!Ϡ<#\ Ÿ P  0B ? 0Se0S 0āh  ,0S |!\5St1\5P l10S(` XA. L!0 0@! 0 *+ 0S  0 0 00O/]@hpİppHT* 0R A 2l( P( (0(6{y((К(y|(zd(5zNzL(zܚ(8 8(T<(z؝(x(Ԛ(zH(p(t(4(dzz{9 O-M *0M08pPPBE兰 80S t :P/Er p0: S \ gPލЍ48H0,hSO )000S 007 7009   彰` 㸰8 㲰8 㬰[V``Z`T7P`VD ?7P Q P  jH8P0 0o86 R>0 0p 0<&0&0P7p0p(60pw>0 P0p,2S# *?P *?P *.qVXZ hY 4[ 0SZ?관X V. 0XC  >0 <\:P$V, Q3C ?=|PeP 2S|3%8 S20#"20$#20PC 2SB404040$4`02P&V20A2\0@22 0x>0C` ? `Fbl> 0 |J=H ? 0`P-tT#0\`P`Q=S/0 5P` ( 2RV0 S0S_c 5*< 5)3 30S 0 0`20S 0I#0 0R V 10S `2R\\0SD{2= C0 ,0|"t000 00Cpb&? p0("l `0S10S!0 R=S0S lD $000E p 0L%000X30P%,Aq *`), 10S @S0 04(\(Q{`(d{|(P(w{{((x({{L(P({F {{&|I|u|||T|}}}6}}O}p}}T}!~Ԛ(Q~L{q]~~~~2hjU#h(,FК(jWux(((ЁX((h(d(\(`(l(p(T(~z@(D(<(l(&BH(ܚ( (H(؝(k0(((,(L(o=SZ0SR Tp0 <<00X3P%0*(0 |00S 0 00S5 0 >0S tPq 5*N> 0:#: 5((1u 10S 0 000S(PPq00*(1U 10S i|0 00<cQ0,zPr 0<0*j((25 20S I\0 0倂0 RL%r0L%r0H00q" T 000cH00SPFPr*8(2 20S * #0 0 00L40q"  400cL00SPs*(330S #0 0 0x4pW/E4 ^  RpW\ t0SPT4Tt*'d4\40S $0 0 04t R,5S0%45S R! t004e0SP*'$5v50S T%0 0 00刅(0S xQ$ V0S0< x (%0S8Pȅ*~'5I50S ]p&0 0 08%<5HSR$ ( H00850<S_^P*P'660S /B&0 0 0܆@%D5LSR$  L00@50DS6/P<*!'L7D70S |'0 0 07 70S ,帇 0R" 0Rz7 0SQ `@PLX  e?p@ Tʰ8 @/  @!. A@O@@]P 5  B?,@f$)P0 ( 4   Q LIϠR  5d)l)t) G)pA)PWpp \9  1 P, P'Qڨ0Q, D0 0S }Pz*o&:: :0S NaD*0 0 00S W0S0QQ 0 0S KPz*=&::0S / +0 0 0P W0Sh W0S W0S^Q  "Q  oW0S&! iW0SQL<Qk aW0Svq [W0S0 UW0SH0085L0<0@5h<D ,5S0SP ,000<0,5<0(5H04e0/85L0l0<%/@5D%0*%<<0S -0 0 08=0S 4=L=0SHm*%T=jL=0S ~0Mh %=w P%L5s0SB B-000=0L50P5?T5V>X50$E- 0 0B0T1 `R.B!!@tN00 00L 00*M%>>0S ,?.0 0 0@P0 @DT@8 HLd Lc B 0b03"4 `@P Z( \?0S  8 H4L0d @ B b"30P?0S  0p00P6@ m|6PtE h0d& 5000T60S 1S <9P06  (6@ _Q V @ 0`P@@  04 8 <%c#!$c4"%S 50S TP 0 0 G ``0  0 04 8 qԚ((qV(X((T(oF,00S!4!: S *C   S D00S @-4 * R  S//L(Ԛ(|1A-`0S hd7@ !TL! 0S<10S0V(11 00 J00Sp@?z.00CS0P U 00CS0 P PYU 0 P0  0 0 SNU К(o|(,(ؚ(}( jXU&V&p@-PD0@0`S ( 07PpК(*oO-01 (1$100 P 1 P 0P  PPPpp(Ƣ @ ͧPT`00 XT  V  p WP @@ 00p耝(|(ܚ(>(((O-P10$MϠ,"ˉH  p口P 0H w w:0v`(@T - 0`P$Ѝ? 00 ?  g  P 0 0 0?QR0 0# Ϡ?40  86`0@p 0-P(Z_L(#nO-pM0P8 0̀P0`Ϡ,"  Z0 Ѝ 0x@Z ЍO ? P ; ? 0@`P(([4#nC-`P@U (1$ U 0P PP0 0T2p`*0 L@D0T@S   8 H4Lđ0Ϭd @  Bt b"31 }0S   0P00`0@T ЍP(DŽo҄ (ܚ(L(,( 0S/A-@p dQ A0\0 a2Pa0 SR P00@00 0` PЍܚ(ܤ(,(0(@-0P@T@THd pL `l0̠p `V W @ 0 0 00P@0@00 Ѝ(ܚ(p@-XM`P@X 9 `P @ XЍp @-Q$  \  H0@S X00S LQ008G,P00К(M#p@-@8`8P0 +9$00Sp p@ܚ(t(L(0 /(\@-^* 0<80@400 0c31Q(?X(ܚ(л%O-\M@pSR D00 00S` |P [00CSP \ЍO %`T `80XYH`o`00D0000 000D0@ p L 00@pDP ? :30F 0/ `@V @@% p%*@D0@0 ?00F`F+ B\ЍO|h ܤ(1 4f&0e\%2R/C-@=MS}QPH 0SV-PV.10S Q!L5 R/ as0倀Szp  M80S  n 00 X0S _ 380S T # $ $0 \# 0$$ 48$( <@$ D?>L H$C0 5L5s0P500ߍTbԚ(((L(0 \P/Q/ 0 Lœ|  ,PŒPŃ , TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> S*3`30S 0P 0ThSXS吡Ts务P`UU00Q AP 0S ?@?1jh`P"hR0"00S8 lr003Pb0S* xB0S* 00RE>0X4*l 2p610S J]0 00SOXP10S O1 PQ`1*?X1` H10S 00 0H10S <O,1 P0*0`00S 0t 000S 0dP` 0s 0 GD(T(,(0( (4(l(К(Åܚ(P(<(H(L(((((|(YYp(98(t(RԚ(ܤ(lO-PPMp8 R B@0S 02 ?Q00@aV`` 0[̑ YP dt \P  ?HH  ? }0 J62r0S0c Sc 0!S 3S  00? 0!0! !!0S`0 0 0 `Ul!Ϡ0008 L3R 24  B # R#  B ` 0Q" P*50`0S '` ` `Ѝ0hS  $  B$ $ R$  B  ܚ(((Tt((((L(U u( (H(t0A-P`p`ATR k@P<[0S @ X51p0AT(80 0 1S/ 0S/T(`0 5 /H0P 3S P 3S P///ܚ(^FPO-0(P,0@4p8`\ P P0P` 0S 0 S   000 00 00S 0 S P0 v0       (ܤ(X(Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐp , P 0` RdH$P/! 0 P  C1  1 @-б 0` Ro/ 10#/C!000P/@-ܱ 0` R t X L   /  /C! C!/! !/@- 0` R(! !    /  /C! C!/! !/@-e O-$5 SW@ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ 9PP` PP` `WqP P7 ( sp 40S  Nߍ<08 H(00,0 0000400!4 04$0D0(0P gWZ  KpTp Ep*d X 8 `.3 8q ,q q q q 0,0q0 q  3 p 0`?`a8S?Pb   00*P*00 i 0* Ćd@edAۆzd@a1F*=RA-PMPp`;@ p@P  0P6P[U00 ## ݍG-MM`P@p`噾PR0 `: SW/20P  rR 300A 0C @H#+@ V& 0S UP0P帐`0^PPJ0: S,^0" P@TP&PB .P  :PP @u3M`@ S @ Sȼ@P@PZ ѼPPn UD e-㯼@+S R UPXp!t0#PU\00`0L!0⦽ ⋼@P2 PC30Sᓼ`X PPႼ0 PP 8W80% ܍Ѝ/n-PUz f%Uv 妽TrU 埽(f0f F>fF F@00S 4 /L(00S0`( "4`#/L(O-p\1T1`00Pʟ 0 7, X 3#ˠ121@ R` 0(,0AP!0R00S! ZJ% 0%#s(0!ZXl000Z T00 pp8P,0V(ܚ((К(T(WuT( 00S/yL(O-,Mp0됡`P@0V000,Ѝ00 ?U0$p$000 000P$00S X00 ?+$0P000  $90ğ^ P Q P +Q 1 & 000|GYq `[Pl3  ,Ѝ8QPXLPD3P0QSt? T)` ᱖ 33 $`Q0B$0 $0h @bPX$(`0 $0R. 000V0A+㢗P2  Q$``! $0@-P$ S0 000B`㼱"3@0 $0V' 1 1S2> 410S t*G$ 0R00 00?000P+ 0o(P0$00 00{ $0 0{000 0 R  000`@`00S  ܚ(yyV(К(hj]jۈ O'gaL(^FF^1T( g<((*WuO-P1AQ P1a`3$MS0_ 1Pr1100` 00 0p8000P0@T <_P$XpXT 000/ 0bP'0Ġ[@    0S mF    MP PD0$Ѝܚ( yyV((X(a<.К(T(p@-P0 % .  @Q 0S pP# #3 l0# #:>0 @~0SpP pܚ(^FК(o,R/^G-P `$ 0p'@V` 0'@`` V`@&!D`( G-PC4 `p,00ȠX㉑ ,Ƞ0 ,$ Ă Ƞt h,Ƞ 0 0! ## ?Ѝ  :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-P5>UM 1 !  A+0@`S ppJ` 0 U 07Π 0nÌ ^VQ 0V>  0P" G`p P 72 b0 RV1Q0V"0  P 0 P$ ` U P ``ЍBt J 0A-1àQ`P |0| ||*0@Sp࠱ P$` p@QL ࠁ PQ B } p@-@PaSl0l ll*0C800S   0&0080P4 PR*Sp0 ꡊ , 2 ,0S/`0@-@0  LD,0,0080S 0  *0@(Ί ,0@-S ,0, ,,v*@TP @ݕ  O-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D5@D0  00 0PT U0#03?\[[UXO `0P$0<5Q 49O0$0 ᒕ=D 0 XR @S"<p!8pL0(0$0 0H(0 0 `,0`4  0 4$)HP$0 %PT40  (00\ 0P,05S00SUSP3S` 4 $ `UQV  `F0*00<040@00 C3 4`00DHpL`<0@ RS80 0 ,H0 PpT`_@P,Ph3Q 0Q+ 0CQ 0SP THpPL`P@ T@P" P0ᦒT`V@ !*P` !T@*00P0 0,03p(0?D00T P rHL PT0RP H_Ct0, `S24040S@p( D0 % 0 P  X Z 1!<(H >`J400 0Q 800800p?(00T 0`RZ@p(0 $ 0 P 80S0 0C800S   0``O@  D e$@$\Ѝ0$0(LBAW:\д f NBAW   ʋG-0,0S0 (PБ@`00qW40S*Ѝ! 0 P@P   k@Pp F A-0`c,0@Sl0l h(PpQ H0< D 0P@DT@+  a C-0`c,0(PS0 X(p@Q |0l x@PEU  0P !  0 P P ЍA q  s X0sC-@0Ђ D`P 004 00P 0Ѝp(,(!X0sC-@0Ђ D`P 004 0P 0yЍp(0(R0A-PQ N`p@0P R   T0! @P 8+4uP㑲,|(((׌o@-,@P,0S <00(@-,P ,\  D Ѝ(p@-@Pp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp<(L(ܚ(27@-0S S2+, R0 ELi `Q |x PC'aQ* Q( PDP <4B 5*< 50d30a3 220S Ƶ0 00@ 7.Bp#x3@ Ŝ ' 0P z`XA 5*< 50d381},10S ᑵ1 @ d3S, CQ,aQ$ 0AS#MP R@0a3d3*0Ot00S cvH0 @ S Ѝ08Ԛ((ܚ(o: (H(L((Vx @-o< O-0M` "##@0p $@ 0$0( pPc0S@P@# 00") qp=$LtUhUaU$ bU P?i0E SSSStSSSSSSSSS0;p$U @< 80 (P 0 @-0S ,00#!( `$H P P0V qЍVp FpnP`4 ] p_ P`P0V:P0V PP p=0[0T$$0 !!S Pl  @N'0 00$ 0S Z(0,  $ 8 x+p Q @p1'0 00$ 0S Z(0,  $ 8 [p @0P x  P0 Pq 0 ! P0< dO&X Ս"n`G- 0pP@P` V   00000G `00000O-0mM`t $P0@004080 0 ߚp40S+ mߍbP AP LP d8徐4弐cP iP0p8/ 4@ 0 0H4: S@ @0(0D0,00048`0%P  P 0 0! xITd (p 0Q= $ 0! $刑匱@P 0V$0 0/S<<`V $pPpL<J0"<>P0<0f`P< `v qHױp< 0 0 n?C0 < n?n/@0P < Q<!$%  0#$0@0P!Sf `V|s 0S `0S  R$ R Z m0H $8H !Pp$`G0pR $ 0pK qpBZ  (,PQ(,PQ S Rh TdO&l zd@)LFQ zXmՏO-P-D,M@p`$P ᒙp($0S0$020S'$p P V 00 0P0Nd 0 #fP AP PP \cpP$p,Ѝ`P 0`P ,$ ?o  00 00 `> p 0PEqp p Up`hdO&n UG-@lpP p`:D10S:E A p= o09 6X $$ q$pp+ P%W00S $$ a$`p YPPU `fV rV GTP$$ E$ Dp$`wdO&Ӑ ) E @-o< A-@P`pPL% hhհ` U  HA<ʰ49%  ° A rhV&Y@- R0Ѝp` P@qP 0 R SR  R $$20BR R P0 l-, P/00#01"$#ꨵ O-@  @T \ p `? T00 Ѝ@P 6 [ PP P7 U  Q*"ƌʠ? ,͆  RQ*  R*Q*"É?   C-HaHqP@ @ 0^ \ ^0᳀ 0S@ 0S@ 0S@@00\ ?\CT:^ *$@A0607;00@R0@Q 0BR !C 3"#O-`$0P@P 0z'0 0Q P f@ Ѝ ႭPC-P$4 p咓`㓁(`@ 0Q P Ѝ  GP404-0@-  Ѝ Ѝ/-@-00@$V 0 Ѝ@ Ѝ/-@-P 4(帮  pЍ Ѝ/O-MPp`@PЍ ZP P 4S x 0T0P$ Q$VP 0S 4S $ X 4P S $ẌSG30 0 !0!p`0  0 0  0 @P 000 00 0 0 P 3 0T0哇+ P#(` ,`$`V$R ڜ  0 `  xB   @"tPY 00pP0Spfk@rݑMO-$MХ@pPP? 2R 4S  0$$Ѝ0m Q Q0   RSRQ"  "S 0 0000 00  0 PP4S 0S,  00 000 0 P0P0 <00SS PẐX  , 00`V4S 0$R V P0 RS  0 000P\ H0H 0000 0   H;pFfU&BM`}G-`Mp<P5@P$@#TC^t E@0$4$ 0840; p+h p <px H4$$: S! R B.T լpD $4S8 (4,$0.B.  Ŭp 0 0"dR04<$4,$(4$t0K>Ѐ 0 N E  !00`d؀E$t0  :P0`P 084S    0p 0gp 0p pp{ p 0pps P P 0" RPp5:Ѝ Z0pY"ɒޒēd@ d@$:P@-@P 4B BRP ,p <L4( VЍ@谪Ѝd@ѓ@-@Pp P P 4PS 4 6cA- @PP0T p ` `Xp0 p袔$$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /O-`Pp M@6 Pట`d `P0P0000% V:Ѝ 1000 0 P`P10 0 P U PДohV&Z ڔC$$0A@-P@-@ t`RdbЍpP DP 4U R 0 l-!1O-!PR0_otM`@R(0S00S "R0oU tЍP PU 0SEpWB (0WS>!RSR6"RSR.pG/0[ P# 9/p " 9/p 40 T m0 $8  P P  _P AA-@pP`P 5/p 4 5/p 4 QC-(00pS4P Ѝ$d@ 0   l 0` 00 ( 0`WP [oO-0 0P哊딀匠p@T Ѝ` P `VH Dp 0 p@l-T ܕA-P(`(p@0 @T訹 O-P$Mp `@Ȁt 뼰0     Q 1  - x0 p `p X0 \ p`s00P0    $Ѝo *%8 O-PQ04p@ 00` ЍP P0S* E g0`P      04 p p#p p04pp   ;W0s@-SX`@ PIj0 ?o2R0S Ѝpl-!@- iR sR aR p` 4ewp@-P@P (`Pp Fpl-p@-@T 40`P P>ppl-iR@-- 0 aR bR LR( *sR% tR@P 0FP0S`00p`(j0 ߖl-͖p@-M `@P`U P00͵00Ṩ0S ⳨ oЍpoQG-@MP Q  ЍA~␀ p$㽅`Px hB~0 00  0 `PP  Ԇd;:O-$MH@`&P ,`$ЍPP 0 0 "0 $ Y># P0*Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ >P 0000 0 pP a4  F$\ `  0V,S( 0$84 0p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 00PM 4$$   $ 0$$@xp7 Uؗk@00S 0@-C^M E@$偧$$E0+ 0b41P[4Ѝ0 @x("(!f"`#XT 80 Z @XP8UdO&8 DO`rЙn0$ 8O-DMP`p4 52<0 ᗏp 0S8 ! R4!DЍLRd a0BS)S&ttHt\ttD10S 4 VP $ @P  [I@ 䰟P  ; T +0 0@   T 0@ @ F P@p6dO&@l-.zXL U& A-p`(P@ǃP 0p`P @00! 0$0@-@P$0S @O-B@@T}Z jg9hV&VR R R D@-R R///// Rp@-0@P! R!@TTTTTT R긓T8TTTTTTTT pp B R"Sh 1` `@T0P pppppppp ߝ(O- 0`7@PP Ѝ0!S R hᡁ0P(Pp0\4SH 0o0$$$0P8 S  R RP304S ڠ0"S1 @㪢0 E 40 3/p 8 H0 0($ P P 0$ 0 0S (0, PpWEV3S ߝ(^O-0,,MP`p$0  5p@20S$`z|P 0 0!  pT AT fT @,ЍsT00$1p0 0 00 0@qp 4 `00p x0804S 0 Q51!0  R@ 3R602G/ Zp p 0oo`@ P 0 Jp@p R @١0R R 0SP0S0  00` 0` 8 H0 pp0pW$00(p,0`}dO&p X8Ҟߝ<(<A-@ĔQM PP An``llph`paPP Ѝp,   0 d;8G-@Pp% U4 d! A~ⴐ崀 p $$ 0 P ! `" $`p P 00`$B~ 0 d;WtQ O-M@9P`;Pl51 -)$R 4S Ѝ4SP 4SpP  0 0"VU o g $ RQP  U05p 4S 4S  0; 4S5 P; 0  0pP ,  ?o  0D0 00 prp h 0p<$P, ޟUC@-20SK@0SD00J@ DP 0SD0SA \^<40$ 400#qpp, 804<0SP$ 0I,00 P tbU@ qU H04 8PpPTЍ$$0 $(`VxJ0Y `0 XW0 0 0S$ (0 [ P*0W0 000$00(0 00qpp 0 QP Р 0 Zp , 8p p ,  꾠dO&< ;T ȠO-Cnpሕ FDM@P# !pX50S LDЍqP sP 80Up#  0qp PPp0#F$$04`P P  0@40P0  0 H0 0$0#P  P 4  0(0$0 ,0  4 PSf 4,  (WUXtVP 0T 1 T00 S :0 U 00[( 0 4040P (, [0V [(Q,UX? U0U0Xt.P p (V,#X@! 01p8 0   U 0 0CP_ Q QXX 0 0  4p P 4\ "$p0 0S 004  $ 0$ R40H Lp $01S 0S p0`8#8&h$ r/0$0s?`mph4 4$$  vdO&h z͡6< ?pۢC-P$M0@ p` P!! ᤆp*0S00 P 0SP0SM \^H 0T' 10S#!Q `O.NP. a@ P P hppppppppȩTdpT T w,$ЍP`8dO&| jgp@-M(@,`6#,P X0X P00͵00Ἕ0S ⶝ rЍpo@-WM M`pn@T8 G0S @^< P哝 0$$ 0$$ 0x 0|x P x xpx 0jlhm0 $8P`L^#<D*Wލ Ѝ蠣ϣJMn c@-0@ n 00 0 09Ѝn@-Ma qP@PwȬجd LT\\Ѝ@ `  pЍ|  p!80pp\XT0 0 (8 P @08 0@TS Q2P  Ѝ@؜֜ $m0 8 0 0 ` ppx彜1S1SDPЍ@谜ߣn"0:գo)D Q[_P `00CS`0p S00 P0S X0X /XڝU&G-MMP"` }" yb):2㠢堂堒rp@TݍЍ c _ `Vj @U   `"0F0 BAB P 60S81 B-B+B(&$ ! @|<#⭬P%$ !P<# pm0 $8D($# b(@B0 B    E0S 0CS 080 ԛ E k5q+nM |(¤oBnG-0㜂MpP `@ P! pd20S$^PD(@6 lP`Pa@ Px\\\\\\\uP xP @ЍPP p*PPP0S00" P 0S0S \^ 0 Q  A =&(0pW ,  ( Q   }   up ꜥdO& E k5q+Х@-LM@P`4 q >1D0 Up T  P 00S 0iR TR a0BLR :lR s0BST pLtLЍT }p< dO& jg @-0$Mq` 0 0@P!! p$0S00S P 0SC0S@ \^; 0T 00S!   0*a@ P ط 8TtpT T  4$Ѝ\dO& jg-,M0$00 0 00 00 00 00 0 00000000 ™,Ѝ䓦7@-@ P00b0 0\0 0V000 P   S Ѝ0C-M@pP `@ <0 060000 0 0,0sS 0lSp@ P$0㓄( Jp l@ P 0㓔) 4p Ѝ@T@Tp C-`PTC-@PTM$TЍC'P`4  q1L00@0 p 00S  0PP 0UR LR ~pa0BS830TЍ80 p L { dO&l-R@-@0;  8 茥(R@-@0Q (   "ꜥ(O-eu5M@P0 ᢀp50S ЍO0oS00*d`PX $$Rp5p%l hJPF @T*fPP= -ofP/ И@P+ .\v*00CS񟗆PcP P4 kLP o_P 0Sa cpP x JPn`n H\KP  4VKP  PKP  JKP  DKP  >KP  8KP  2KP ,KP &KP  KP lKP YlP  QP ZPY ZLP @X RLP pic PJPU {n"80xVx KP P R2")JP p lPk @cPU p $ 02#W:0 LPE  ,cPP? [2" IP4 !0x|x JKP) !0x x ?KP "KP "t KP #`KP m0 $8+0S QmP  n  KPp@=50T ",u00Ѝݩl-dO&` t zX@t (5DMXesnŪ{   E (dV&O-@-슟zMP` ~p :0S ЍO 0FS iS:C>`C$T/P YT Ѝ!PP Y P9Pd0P0 bP00$$0WPYSmbP xbP (0WPTE ?mD0 HP $0  r4 Q/JP 4P]0P 4 "PZt pP00000W000000S 000$0bP `b0P(0 kPP DDD!n`P !n$rPP04 IP 4`P `{P @ 'HPn H !HPh @0 SD00H0 RL0$ 0l` 0,qpD  R$4,, 0qp 0`} ݓ$4P `$$ғ$4P`Vb`P bP e& tbP #kP'8,0 m`P m8&? ` 0qptjp GPV3p o  GP   GP  GP   GP  $ GP  X GP q@ GP  ( GP q/  GP r GP 01S 0r/Ss?p, ղ Ѱ  wGP s/ pGPz$$*$4P(jP䳟z m`P  m$$0` GqpS, p0x< HPj <pP < <(< HPZ <P 7GPO  1GPI L +GPC 8< HP <$ 8 FP3 8 Z* 0c$ Bp $ ๒P$4`  0qpp$ ࣒Y$ 8< 800$00(0 000M$040P08\ p,` 0$00P00T0  DX@0`$$qp$$g$4P000H00L0p`"$4'` 0qpf$$F$4P `+dO& l-/ Ef < E ݫ(ƫ /!@UAt (5DMXes~dZk@׬0@-M@ P   bp@ @8 ᑓp(0Ѝ0 'i@-SM@P, m0H0P0X0`0h0p0x00 00T 0 0\ 0$ 0d l 04 t0`@pt 0 \00 DL`|`pD @D Sߍi@%i1!i=@-@  .  u0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01P A!AP8 0`0?oS c`2 06P. 0I00 0A. 00P0oP A VAՒ000 0nʒލЍp`Ò0 0A. 00PH0EP A4 4,A@⫒v`(P(oIRft?4_s@-6PP  !P  )@`T2#ЍpP  00SQV  ,@ N0 R !O-M@ Pxp*p"ʸ`P"   ^P- b^P:^pP bp|^P b `ADP 0"h 0R00  p!  (DPr 0SohQl @  pal hb! R R RZ  0PW l Z ` QX (s<HW 0j0S, @ hՑP@ `ϑpd HQ L 40R !01Sp0S 3/p\ U 8 Xᰑp \ [ 5@ `ᣑp Ѝ ${( ˭Mڭ,A-p]@P@^PP]c_Y^ Phi^P i`Pi@- EP Ѝ'A-MP pC@P00p`ЍpP = ␣4 >p !0 >Eҭi@-@p @A-P`]pP`00taP@W?0wa R FA-P`]pPB00VaP@:9?0Ya 4 F@- $RCP#00 Ѝ!p@-8M@ PACP1!|]P -a0 Q0s0S00`PP  ]@gDt `  `< P]`gV8Ѝp3E <}i0@-BM M@ y 8p 0S 7  /  (0P(@0S700$0/ (h 0dP(@0S Bލ Ѝ0N+@F#@iҮp@-Mt`\PP `P@ T0T TV`  q4 p 㔶Ѝp} <i@-M@   pЍi@-M @rBP0 C p  1Q0r R08C88 1p`Ѝ3E :iis@-`P p@@@;BP0 H@Pl0_ P@ L'D\P 4 nЍp~E :7@- P@=pX XPE\ P@00 <<u0400\@ Ѝ0 ˭̯֯:{(7@- P@p` `0LӵD\ P40 00Hm\@ Ѝ0 ˭֯:p@-M`[PP00Ѝp_P@Ux>k@Pd㩵P0 +p@㘵8 P@ PP {m i%@-$Mp[PV00$Ѝi_` k@Pp d0 pPhHP P`@ p$bGml2Gi`@-B؎ Ѝ om@-0M00 0  Pώp `j@P2 ` @徎pp 0 dpRP00bS emQU ]ᜎPxi yMs@-@`.PP  1p$ l0,Ѱp@-` MP@-[P ^ ЍpX (   f^  Pn[@seDꂴvi 0@-,M@ P@P0 1 p,Ѝ0 0R0s0S 0 $0/^PP 0 6[@;eDE f:p@-P-hp@@@ZPH0H HHn^Q P$oUlp$֯ :@- P@]@P/00Ѝ  p  m M@-@-MX @;@PD0D DD0< 0~ p$mЍy E :i'@-MX @@PD0D DD0< 0] p$mЍ| E :i5-M0( 00G P Ѝi%@-@0/Z P$0$ $$_ Z@̯֯ :00@ P/a CRWC/A CR=C/@-00@- M@ J0, 0 p㶳 Ѝi`P@-M `@ @Ýv {< <G  %Ѝ  ;?o @L*%@-;@YPP ンmpL`P`0 P000᭍t0@`Vm`w` X0h@ @@@@P0D ᙍd㐊03/` ]%oQWxhV& //// 0L0L0/ᐼ% 0T0T0/ᐼ% 0\0\0/ᐼ% 0D0D0/ᐼ% 0d00d0/ᐼ%p@-@pP 00p00D S 0A0CS0$Pd>P 0@p萼%@-p0( 0`P/ R/ꐼ%O-04M@@ !T20. DPďůpɲ 0$ (`pVD@PT P p1cehT6l PP@ wp 00JP`p R  P Q R/6 0TS $ P\(P  1/ P ⎊@0S 㹋p "SR(0Sda\ 2/P W0 [  ፉ(ɚ;NO-MMPp  X p`%9 pP$ 1000$ T-寋  ᯋpk x ᢋp Q X哋 O8 p$0Q 僋$_ X@T ͝X00@0 0wPjT 0 @0㵝 ,0@4@`p 0Zg0Pl0q 0X 40,@QpDg 4<Ci0H0S $P314H0S=I0S:Z`@T 0 3/@: " ͟렒M0S:00%  p"pM0S  @ @03/@r JBI0J/NpI 1RRa`"%J` 1 0 d1 T|p 1 d\!1 H嶊D`#%Js!1 @ t1 x!|1  SP@Tf 03/@0 3/ݍЍ ʳJiW~is{h%i.iB\t( -!i0 *%ȵӵO-@PpP  p ǰT PV@NVPT!㳰vV`P `㰰PTU D1O0S KaIaՇW {P.Z  tP'  J>P! K0S 0 L0S 0M0S 0 N0SO0`S PPV 㨉 N(Ѱ0 ݵN('V&@-,MP@wpP V`P(  p0S h7P ;P00@ @+0, ,Ѝ语T(8i( .@-P@n0P  @G-@JVPP0 z`@ Y㔀YpYZPP  ܘppP  H@@@g@X{ 2bT(s@-@{V@P00ЍpYPY&@P <` ܘPgu 룹T(zs@-@QU@P0 YPY@P T` 峘Prgu( iЍp蹺{ bT(zA-@"UPP0 `@`YpQYˣPP hpD >FJN@'{ bT(@-@d >;PP0P PPL 0 S@@00 >00Ѝ趹E bT('hV&0@-M@ZUPUUP PUPtKUP d0P P P P< PDp$Ѝ0'XT(7i s@-@Yhm yP LeHPH`↗ P! ,ZЍpU@MI TG-M`@PK `ppP"㱮(  6  ቚ 7p% ((( px" <@T t8Pl2P\ UR TЍ0 PI%e@Po $@p 彖t 0R k)㜇 㚇` p\|QՇp R%P\̇ ㈇mKP;ЍGfQ\ 0Q    1 0P孇P0 RSn ᝇᛇ # T0` R P U 0pD```` P꯭ 8i(i,< FMqa/P (S o*%I  mPp@-P`@hSP V  tT`P x^`u^ 00pUSTpg^A-@T 00`PpX 0p @-MPPo00Ѝ`0 000p@ 0 P W0PW 0 p 0 `P0G-@(PC00`( w P1r0Pp*0X!U0"R0 &"0#0"SЍrE0P 0,  \p 0 @0@-@P ] @O-`,@pP(0V0S 8bP$P$P 40S 04S 0S(0p(`8P0$0S(PdO-M00X $000Ѝ 0Q`?  0Q> 00 8PP; XV^pP ,,p`F,4@[T /@P00 D=0800X5Tl (f( R R[`7"00IdUx 000 ȹPo0"0CSi 0BSe 00Sa25!445^ XpaPPT  Ჰ $pP UdXB  0 Ap; 0STw /PPZ!08!10#R0 0i8XcP Z@ H0 YP@T 0CS00x C00 X ^0:T 0CS wQ0x L @0aD\W@DAD\ 7@D@SB@0 0#0  0@D@ TOU@cTl p㳫 ORPS\< DO\0 0 0`0!T[ ( A-X Pp@`PZ00@0PQ 0 p 0 `P0O-$M`@ HpPX8 P W0  Psp` 0p0   0{M%O-MM`@ <0< l 7KgKP~7[(0'S` @0$00 `F@( 0R |P~$0S0'V$0$:0 :0: 0:$ 0:0 :0 :{(@!0! X [s0 /C BRZ  0  00=C$0Cɟ"! 0P PE ^p PdyE00X90IppcppCppPpp Spp@BppA`$ 80PX0` {!0X@"0,0,0S> E{0( 0B'S(0؍Ѝ 0$0d(S   BS>C0CD(S Q:ȟ "!! CR  ##9C0C"!% 'S>Cǟ>C"" N=C0C Q 0*S ;S. RU 0C'S;;;,;4;;;;;;;;;;<;;;;;;;;;;;;;;;;D;L;T;\;d;l;t;|;;;Sx55H4P6H4H4H4l62S# Spt 0S R Sm &S|h 0R  |T|0 Lz0, 0 B@, W0S 0S p zp`W>z 0R0 z`0S z0S 000 z00C!倥娀`pXP0  @ zp` z0S W  04 8 <$S Wf0S  +wz0S 0ozhz ` 0dY1 pG4  `000L04HpY400 03c10S1և!u Bzp 00I 8z3 $( P  #P# ß P#  zp|P3Ip#S0S lz0S#  P zS8z0S $y s 夢 `0V V"    0`yV4y0S 0Xyg <y` 00dY1   0G p00Z10 `0&"R 1 !o 0B0I y1 $( !P  $P|! x Pt! TypLJ|  lhd`\XTPLHD@<P0ima xp6̜( ( $15;MJ~oDTKXauk|PI QPP1 $ #(6;FQ[cks}p@- M@P` Q4P aPp@@X Ѝpi@- 8@+P(0( ( ЍE , f@- 8@+P(0( ( ЍjE 8 f0@-MMP "x@PۍЍ0@X P+ @wP@XۍЍ0@Rw0S0S1iS20@-MX Pfp@@XЍ01$k@iAU@- P@*P@0@ @@o I\p$Ѝ藿E D Af@- P@*P@0@ @MQ >p ОЍv E N f0 /T%/-@- M,00@(000 P  Ѝ@Ѝ/0@?o21  @@@@0\-@-  XX ЍЍ/@-@X[,x 0S/@-(-@-  XXE ЍЍ/-@-  XX ЍЍ/@-\00S 0  0000 0WpЍ(#@-@vH[vUvp0wypH HZp@-pMPڬ2P0 PS 0P@ 0 0 00 0X|Wp HlP@@ ((@,P0P4P8PS-00!0310@- Mx 0 V@P \E RLPP @ , 0@@VP 020Ѝ0X%0(q@-4P4 @aw  ZwSthV&pbP@-d0 !X !T@0 60\ (0000/X m Ph0@-d`  !TD0 60\ ,00 00/X m P-P040#^4<\$0000/X m PD0 40#\00Q 00/00X m PL- 0:# ^4 0Q$0000/X m PL- 09# ^4 0Q$0000/X m P 4 <# \,4Q00/00X m P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00X m n $0@- 00sP ЍF`%A-P⑔@p`WЍ P 3M@P p7@-0P@U , ~S Ѝ0A-@0nS0oS@p pׇhP`UPS0nS0oSUPPTPP'T@-X0 urhV&O-MM`<(0pr y, rP(0T0(00 ZLꃎ 0@0D00 p0op0S SH Q 00,0 00n: /@Vp@-@PᴬP0 0/Spd2 p@`2@- q n hV&O-`@ Pp(,夐O렰0 0000 Xp0@DTq oPX0 ᎀP@㧖9 O4dO&l-l-ݩ< (@-M@A> 0@0D00 p0OopU0S SH NP 00,0 0hmF /@Vp@-@P)P0 ^0/Sp1 p@1@->mhV&O-`(,p崐崠崰0@P0 +Xp00@DT oP0  PT&  WmA+!Oݩl- dO&(-MM0An @H 0P ,0@np 0m=p@-@PᷫP0 0/Spg1 p@c1@- pmhV&O-PM@ P0Rr`"Wp)20 R. +x   &  x `!p 0 *00)0`Vp opz 㔕uPfPMP9 9P$ GP g@Pe e e e eee ee e e ee$feUP|0 0|00|0|00|00|00pt`x 0,PE~Pynp Z,0p0Y00t0V0;;0x0UNj$00|00|000ЍY00t0l-HdO&x|, (-MMJNP0 @P300 0mpl0 0 0N/0 4 000@0pnlBl Z7@-P @3O0Lo SϜ 0 Ŕ Ѝ0@-@A0P @@-@IC0P @ @- @O0S 00S0?  㙔Ѝp@-@P^P0 㓔0/Sp0 p@ 0@-{@-/40 0000,00(00$$0 nk0ghV&7@-P @N00PS\ 0 N Ѝ0p@-@ \0P 0(pֈPP,>Ppkp@L(O-@H p@H 444f Vp60pGWQq 2@FP0l ljjjjjjjjjjjjj\ljlljjjjljjjjjjojoj$ppjjpjjjjjjjjhlllljjljmjj$mjj0mo lop0ppjLphp40S =4 40S4 0<007aE0:8h$0000000D309@0;g)P04P 0I 08(0@0080 ]}PPv0       +  @   ' B ,# R #  # R" , @ ( "  )            |20  ||000$0 X|000 0 4|080$0 |0:0<0 |0:080 |090@0 {|000,0 q|000000|0909Rf01r`00$00 0 0tS00,wL00 xE00007000+040 E Ѝ%8%l-dO& ((( (MP(^ <%A-RMMI>0PC@(0L P@Aq吁H`( L0`4kp:0KSh0  R <( Lh0 -(i0 N( h0N/@  0lPP 00,P 0.0T0 PLPT0 k0$00 00000|00x00t0 0p00l00\ d0X@,kRݍЍ>(<Bt Lp@-@PȧP0 0/Spx- p@t- R R @-/6@-@M0P`p 0i000 6kPPЍ0P0 0 0k0 i0P {s@-`000/@P iP0 XЍp 0`( "4`#/s@-`P@d00!  Pd00SPPP @G@E  0jЍp`(: S(002P0/0@-@CMP( P41010 0000000 0P WK< 8j H00Cߍ0Cߍ0@o꠆B 2G-`0@8Ppp6 Ƞ,̠Č Ƞ,Ƞ D4$03 00n4408< h0e,b<0pE0< D(0|0040<0pp PH00ЍpHPD PG gj`(stN sO-$M0 PJ@0` @PpT V0<00$Ѝ 03/ Z0p@ ' 0P0:@ 0 `  p00P LH0@3/piPJ 0 P 0T@Pp0  QJP P @0 ` 0  i꠆W C-MM`p/ P  P@1L#d8$#4d4# N@41@*D0 0@000 @pߍPHڀ@Td8$#Td%4d(G-[ 0MP@*@.0P` :0P`P+]  00| 0 [P  X+0L 00<0ppS0 W0S000S p |p`  hP 00P0S`!0!D0D00W 000 0  P0b"!4b4#P0P0Ѝ 000<0ꨭ(>d(-0-M 00H 0@P ,㔏] zg  Ѝ@-7 ifhV&O-PM$  0 @00@"b0"p0@@" SQp20a0CS g@P~}}}}}4~L~|~}}}~}00p00@֑p 0! 0 yP#x P /0S Q   p @zLz [!!D P 0S Q    .z @z'  {p j+6hp t 0[4S08pS @p @Ѝ?Bl-l-dO&y` (,_@-MMCN@80 0@ 0(00 0[gp ㍎ 0 h"h! h(:=0P( lh,;0P , Tg0LgލЍ4g(gV 7@-P @H0Lo SϜ 0 ? Ѝ0@-@A;0P @@-@<0P @ @- @H0S 00S0?  Ѝp@-@PأP0  0/Sp) p@) 0`( "4`#/ p@-"440 @"440 P"440 "440᰽( $0 $( XXddhhllppttp p@-"440 P"440@ oliDDc@@]HHWL`LPPTTX~X\{ \`Lp` pH p@Cp@-`"Q@Upf@p@-@P*'$!pA-P@M4Q->C->?n}C@X=X\:\79>9>:>C:>CF 0? AC>C>mGFE~EnFGݼ 0X J~pXW}m  $$((,S>,ḼS>GᴼFᱼHHLLPPTTXX\\O-P@`Pp !"441!"441  $$((,,00Q࡟\5 S L5s`PҀp0,$ $Q p W vTrTpXnX\j\`g`dddhah`l]lpZptWtxTx0[ KpHE``$5S\5 S`p0SP%P Sز , &!TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P#` 2R  0  ?<#΋ 0 `x 0`0報 C c00d0 `c Ca c0b0 0  0P!\pQx 0&0Ss $$TGQT`P@U_l 00 ЍO _0St hhȀH XȐPAU8P,?|($(U TTt0p@-`0S[\ @L00S000000B0E0pl(@%PꈚlPD00/000/B10B1/101/ ]bhV&O-eM  dϠ 0@Ì `0 1P50S  100 R(0S\nPpЍ ` P5B` bL RW@QWR5HPP/ Rd,T̜ P  "D PD1  2D1" " P 1 21a0 8 P U Pp000 0$5S ? 00l1>0@D@ @00C03`0S30 0C0 0#0030 3#00020SQd  0@ `?50 ST0T00  B 0P SX0000Y0,d00? 0 0@ `5?n 0i댠 ,1#  0X ! ?P0 00C000 \S T10S  2 dϠ 0@Ì `0 10! 20X*aT40Aນ8 0 B0 080$0C $$  $ 400@40 08 R R` /  `1> ``& |($(U =chV&@%O-MM☵`,* t51^OR0du@DSiaH51*`_ ?E 0S/nE ?0?E4[P`؍ߍ 2@ŒD 0L 04;2 0d04 0l0   0SF0LSia441_}_0/`&22220_E0? 0 040hl 0@DU 0L /0d4;0 0 0@$ P` 4 <0#0p R0C000ps_x'x`P20S6v 2䢟 0 000`0x  `  Z ~X PZPQ <,I 2\0Q0@/,040<09(080 P? 0P@-  0@őD L 00 /4;01_^ 0 d0@0_ 0.1r 0傑PV ^`P} 0 /{\0X0`0d090?{(,0{ P { {F 0@Dő L0 0/4;$0 ^^ 0lh d 0@Ì `01@%(|(A%%\($(TO--)MM,0=0?0(8$0^D0D`0S> 80pW:,0 0 0 N\(0(((`(t(lX4 P@P`P P@ 4 pe^3 Ep@ \3T@  }?SPp *c r?P lC(Y0S0,5 Sx0<0(5002 0,%S0022Q04<^Y 0Q|4^Qpp" 0 04 0A P&^C 040A 0^: 0 4Q^1 00 Q* ^( 00Q(^ 004 Q]1 p00W/0G,\3Sr1\s.XXT1X0SD] X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001] p4P 0\0 a Q#t(l(D%H%<(H("Kw@( (6N`(TP( |(@%TL(L%8(D(X(2! dS,QS18$Q<4R:xi] @0\5 ?>C00p#!3x00084$0<0D04t p@p嘖000pXsL5P5| P4H   ?8@`D ? p?w`NxtF01o&"  A00&"n0  4%8$05<4R] 22 p8400 0 0<SoPx8N @P@0 ? @P0PP* ? @PP(5#R0:P@0$- 000[0 a`Ә%"`0 ?001>0[`0 c2#, SZ QZ3 ?001> !00   B^B0.P`0/2"0$ 0  ?V`1V`#T0`10F 0I ?  0B@TPἐ 嘀 00B1  B[1 ` Y"B !!0 R0C!I0B? 0 `똀 0  B![!0`S1B 110S \5u @P`x1 0F<Ĕ84CP0S`84<Ą-0$5BPSQɑ,`RB@L0 0 000060S|0` ?4HL4P0@0 6@Lp;'![Lp00R  QDL7\5?>C00!#4t x0Yx7(T0#2! a, A3 31  0 =@P0 04 `  0H$4  $ ( B, @%LV.  R*h 0(E < <(b X H( \ P( ?.@Xd@+@B@A.@B,-8 He`吡 @40 `K ,p8d A YZQ  xZ0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423tr0S+ᔅ됺 ~z000d0S CQ c6Rc(`P 'z'z {'+SZ @ z0犸 08z'(Ȋ (+S|,Z 0  R0:1P000\xP2#00,Q@@00 (p00 R00&(0 0Sc@ RZ QP0 넠@t: 1J0jF 0u`K%00S>\(^F*e`( h(U&ht@V&l(MT (U o/P Tk$0(((t|(@%$(,(8 0( `00Sa  0 $#% z$0+ V.s|00S  C 0=S,0S 0S0$0! ,00C."$\ ^  00 0?d 2 B< b10 !Y$1H p YPP04SP0 0R0 S00C0 S 0,00P0B 0,0ST p开8嘥ȿ+" < Q \%l0R@.  (0 0 @DU`@40 4A20 R40@ `0```0T04u( s 0 ` pP3$0X`0< I9pQ80< 帐 P0x0 0 Sx0x0t B\0X1`01Q0C00h0`0lR#00B1 d0R*82%dU0   (0 0CH0 (0( 0 R R` ` Y 0$5S  l01` p0000S3d0%ST0T00! !<%0SP5X0`0`P500Sd0 0Q N   H0000080@ s`Q H0+H( 5P+H H000-ᴰR㰱 ,  BU 00s0000T0 10X0岑0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4040CS T0C0@ 0dw`h4  80QT:  $5SʬG $`$`(0wV0S ,4 T d,04  0,4 $= 00`  Vj0S   0帀0 Xx0#`x X\># P 0?d @ `0 < T9\%R `i0SP,xi\`/ `ƌ$  $ l0`S`  0$5S  l01` 0000S1d0<*ST0T00! !\*0SP5X  ``S 0d 먐     0f00080@%0C40 0400T$*, Q`?0@$00$0l0h`0@ppT:S $S0ppS $S00S`@0P뀐 H(ꅝ 00@8p`0x41pY70I@X!@k@000T: 5@$\ Q 0@08(0  (0d0O@N 0NC n 0p 10SP=0S0 000S.V08CM = R0ł."\5S 00 0 d 0/ @. `3,0 0$ $V0000S0S 0,00C0S0 d>0S xV0S hV>0S 0 [V00:*,8]P>0SNc C>`?0S303040404 0#pCVW*L|V.PdoV.GVi0S ?0 PS?\5=S,U??^ E?0 0S 04 K dLĒH 0@Ì `04 1,$0S0S 04 3 d ,04 0V 04V)ݍЍSngG-`RMXr@ |PP` s|PP` `P P7 ( Up 80S  5ߍ<08 H(00,0 0000400!4 04$0D0(0P ,WZ  UpTp Up*d 6|Xt" 8 ` 8& ,X T P L 0,0F0 B  wUp 0`?`a8SmPb   00*P*00i  0* Ćd@edAۆzd@a1F*=RA-PMPp`;@ ylp@P  0P6PSU00 ## ݍp@-@PsP0 {0/Sp# p@R/bG-P `$ 0p@V` 0@`` V`@&!D`( G-PC4 `p00ȠX㉑ ,Ƞ0 ,$ Ă Ƞt h,Ƞ 0 0! ## ?Ѝ  :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@O-4MX00\0p0`P`0 ,0@, 0S% P 0 zmS;aSMSASB0C0b0C S4,,,,,,,,,$SSU0@0T 0DS d9R$ 0 p"P T 8 0U$UQUDT P 0 sS @ @ @U00@@@ X 0t0  Pjz0S00 000 000 P4Ѝ:]~@-,@, T@=QhV&L4 @-0 @    O-@0p |`GP0 00000ZI00SB_: W `B?F ᴐ(,(P0  /PPP\!1cQ\ P/p@-XPL0(FS 6@0 d0 P 60@\0 <@p(0P  C @-y co`/ :s@-PL@` 008O0V  @yЍp踶(( Us@-PX00SL0@`ă5#000<.0V @yЍp贶((( th10 PS/C-@PQM@MP`6`@f$a 1 P0p9 0 T:@6S0O@ ID6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PT 0+ۍЍ贶(((ж(( G-DB`p .PP("(y 0F0( 40 A06# R 0 !x0 60C 0 !x0006&0=06 0  B 00C0( 6V0:!$``Vp 00$&? 0(0 6 C c0&0 $&?0`L0SV&% {0: S h&0 d ЍG0< ((h(P %A-Ta00S FT:p.PP  0 0 A1S0SS0 P @D A01 S Nx0S @2106&0)006   B ! ! 00C 00(U #O-GMP@X@Q?P>U㰐Y  0@00D/60d& 6F @  Hᨊ Td> R`$0w2 h XSQ 0@H0 } 0 R (cR 5-0$00ᓩ (00UC(0  , (0, P  @R 0 0 $0F 帼0 060 6< 0 $0,娌D (@(200UX,0000@h P  D`0 0H\ d04LPPoP 0T0;L05h-L0So h,;PU ᎿPc  %L 0R V0400$ & \`# @ \  110B00F0D$AO0PpepeC0CP!P`\` :00pv,P`0"  g 0(0d0040\0080<<0(02,0 0C0(0C)@ p 000 SJYLj 000 pS D!*&A 7 @ .P|) 0 ( "*$P 6 !"0H& 00 9㙫PpD |IH& 0SK9 R070Dnv$0S 40S `PD@ 80S<000 Sg0C  0Zp, 0 001(0@`@ QHR'0 Xx0S7 0S00S00 0  C02#(0FO7P p OPPXP 0R SHS SQW`@pb Spm0 00 Y:Y:tV3006X  0+(01 0Y0 JST  060 6&CĦ(6Y:$0TSL0S d0 P V50SapW~@0S ^D5L R d0 P# 0PDT%_oRU+ES&0#MH6 C 0 ᓔ)6 4 0눔x 6`U0CT 00C0CSX: B5Y1 21[0!!!0 Sq# 0 ᓢ"  0 0d$&S: 060& 0vg0.dNxGz 0W4#0003 NpXk0SMf`F`VI l30SA NW @ND3PUBL0S \0:`0l 㷇  PP1z P#f37tN6|0X0000N09630 ;Pp`INtጇ` Mp` z7X27ENX0000Mf&1 #?1# 0RP  *d "x 0 |P0PPP!f v *w`P!\ *P 6 p!dS!PU:< U*!:0U:B,0 9,0 xp$L0S\^UB: 5((;(c(%%Jж(ȶ(%QSNH(ض(X((C(z\ U&ht@V&o/P k$0At>nl <%%A%{ f,(((0Q:BS! }0 B6 sPd  00 P S %%* 㑐  0p1Pl1  !7P 8 `U&@1`P`60U/0 x x/L0S `0 1 #'$/%172M\X0000|L&09020 |P((  /0 `p|2& 0x9Df0?o2U+u+&0#%6` c2H坼 H0 HDLGߍW@G-`RMXr@ ssPP` $sPP` `P P7 ( Lp 0S  ,ߍ<08 H(00,0 0000400!4 04$0D0(0P #WZ  LpTp Lp*d rX% 8 `h 8 ,     0,00  E (Lp 0`?`a8SydPb   00*P*00_ ⣬ 0* Ćd@edAۆzd@a1F*=RA-PMPp`;@ *cp@P  0P6PJU00 ## ݍ@-`p0   @P(00S0?0\$ 0S 0 ?rS\F\GL \ gL0 SDKT ЍE%KUJ%FZO%A_ 0 @-PP@PpP`P DFL<<0 P=LU@3I hV&A-p`P@P V 0 qG-`RMXr@ rPP` qPP` `5P P7 ( QKp 0S  ,+ߍ<08 H(00,0 0000400!4 04$0D0(0P E"WZ  )KpTp #Kp*d qX 8 `  8{ ,    0,00   Jp 0`?`a8ScPb   00*P*00c^ G 0* Ćd@edAۆzd@a1F*=RA-PMPp`;@ ap@P  0P6P9IU00 ## ݍ@-0H@\   RS0@  0 S,]&0 /,)Q@-$ Q:b =OO-@-yM Mh ⥾`010x00@00D00400\00L000 0<0$0H0(0X02000040080,03l0<080404h04d0F00G0`0H0040P0050?0,0 SR h X0S PX@ \0L 0H0- S @0D 0 ?0i/Hp$ \0@ SL0@0∵$ RHP )x$ 0@zahPP##`Hp$ fIP T)\H0aS 1L\ : SRQt9  @P@0j V@r@DOoB@b} P pY00S  Pl  pP 3m`PUb@0D 0 t0@ 0$D0@0D QP  D0h @ j80S~0x S10S10S00S11011|0 0180SL0 RS 00R0 R0S> /导,0P00 @R  T_![0Sj 1Sg 1Sd 0 @D̷1C0S [  [ *0SR3#:\00<0S @!0S |P@ T <0 0P U8 JPpD8;P@@11 1 1 d000Z0`S`Sx0S4\0L 0H?0$0 Ip+ p`PpC0S)0p2 p1S?V?`#)$p& a1S)p Q1SAe1S X$#Hp< k 2"OKK@0DKP?`|L0OK\0K@L0 0Z0T0Q0S<I[# [ [  ? [l0S |-80S l0Sd0h 000@0D0 0#h0S  d0S   T*,800S0 [0S0S"  0C0T {0#SuϷ0S0`0S SX e,0S , 0C4,00`00l0S1|0 0S010S 1h0S(1d0S,140S /R40P(0&dGb0P(0 (EFpp(fG0P!* Rb R YV000S(dR0(0S00[X`1 00PV`5U0000AM0pY㤂 ,ᨵg'HAU p9 0 pSf:Yf$.0p(Up` u ? 0`SM:(!XR&0S ,1 S$40(00p000 [ 0R5 R4*P (!RP5P"S4U $R,1SPP,Q,1 SR U |\SRQ SP" 01S<1 P3P%P5 1CP0崶Y [0D  ੶0P000p+!`GP1T0b# 02b!b&X 0S [ ) Y': [ჶ00ŸS#,!T0 S:0㈀ 0[n00@ŸS#g00S#? 00T0`000Y00 ! 3 qW5e:0+a! ` +!  G0   [dQ [XQRU10A+!2"+Y0 0@b"0` t0 +! 0 0@G00S1!YV*0^l M8U4]&j1bAM{ AoDcl/?;^ o2@\dlu}[-G ptOhV&,)gfff URRaArrAa [0 [00S 0, S00R , t 0 [0 [00 \U* 0!A ,10QR0XLE101S0S0010 [0]S 03 $!q515E000 T0EP0S E1,0S E1\0E C?0Y0  ~E>00E?00!0DsE1L0S XlEY$! pfEtdEPr(bRQ\EZE,QUE EH0S yލ ЍS0315q50 [ 1 1S|0_ ?#H02@`4!PP kHD?C#@Y 0 T02#H0 [00H <080$40`0P0#40d0,0#40h0@0$0Q l $   Xt  0|0 4Q0X080 S 840S d8ழ80 0l 0tEx$0040S' [#,q4 0W0W03 W00S pZ@ D0ppV0S p 9Cp T (  p ᩸Z [,1L CS/o" R `0 0 0 000000P00d00,00h00\0001010100 [L0 @ 0  1$00(0$1,0J?03K?03)001x 01100 0$L2?@1c4 04v 08#$0 #(#<l 0& 0Ct ?Q X0Q40S00|00o00 0 R  S4XT n@'? $ BpH TS l (!R R S 0 S7071011H0T RZ* J\Q\0 [0+0  S  R   0S* 0H0< 0JR?o20S F(0 00 25 010 0P B24 0180S} 0`( "4`#/   k B* {S@--in A 8 /eAD00@- 44@4P\P 0B"" 0)-@=B'X)@-驸 2D+A=hV&G-@P ` p!>0P V0 0  rPP G֣pP`00X 0i0S < i0 ዷV 0)l-s@-@lP 0  E=X X0TBLЍp 7P `5=$ 0B0)M@)@- 04#$$04IQ   B ЍM@-$MPp  = @1 @00 !0 0B))B1 pB<`P\pATB<DBTV@D:$ЍB%c~%hp@-0M,AP`   0 0 010R  2   $0Ѝp@BR  #   $R ζ0S1#$$ 0("( 18#! 0Ѝp@mB0Ѝp0)  @-@phX) L@- L0@ R0* 0 #  P)P `00CS`0p S00 P0S X0X /XCU&p@-`q@8!RP#<10<10 .810CS81V <1S 0<1p0 hGdE`0JPp <10C<1(0 810S810)%V&hV&p)0@-@-4MT AA`AdAhQ A`"R d2RKA Ad2SA |= hk0:P{PSP1A k> * +['Hk;[E{7 F (+S PPP A 0 @@zj{ k[@  k[+SA4Ѝ00B:|k{{'*k[+SyA@@?-C6?Y@)%0)B[q%)ؿ)p@-4j0d2S?0)@0@-0S0@d2S`2"R2%0)@-@ 081 ^"44”P -Q\4M2=p2 04T ֤ 00 3 S k@@ 0T S S00 0K#=PC@P0S+K K_30S3/S:K+ &K0 @ V@PT[K>P 0>t<  t0  t$  0S  08xS`S*?S DS . y000Vy*0C P<K+ C 00CK+ ▝00CS00Va0CS-|, ...|,|,\/|,|,|,0|,|,|,h55|,L6|,|,565 Ы  :PK 0@P( 0@09  90S|90 0K  K V ⪫D  PK 0 Y PK. j=K  ⍫  PoK P 0K. 80  s|  ݬ@PU T80S7  [$  ŬP= 8<08808408007,07(07$07 0707070707 0707070'70= +  ╬P K  PP 070Sx'0 0C!0R3x X70S0Sq K 4 @P PRKh <PK t0@Pp[ K> 0 pt`hP@@0V"0T  HT\HX0Qx0pW h pR000QSL00D0Q㱫DD0@*u0 ` X\ X0S 0V)PPP PP, K 0P@0 K. l<K>x%x 0 P;P `@@pP @ VG| 2 0S$0 0C!0R3 0S0S 0`0߫P `0٫P c= 0,C 0  R+ .t  < ⱛ0  d0|d0`@(4 KR p 1  1 S 01 \Q \HHA/p@!bJ L0 S1P00P0P D0S( X3 R  h;  X   `H0 S   \0T0 S `,@0SG @DUYC  ة  BP0S|& x 0 Ʃd  0PcݍЍ ⹩4  ⳩   PPA0S, ,P ⟩  P ⒩  Pt ↩  PPh@d0SXT000+ MYh'Y|h 4%***d*hV&K Q _ `*%9 "X;4*Еcw4]5% >\|*H*gfffQjJ dm &0}\'ONVj@0@-0iS03S !rBZP78**&l0@-@d   L` @0[ 0V Q*DIQYb*@-`0@Px0 B0PU1 S2P T0p0S @0R<<U4, 0p: Ѝ%|*H*k!V&pC-PD1`0B8! Y!tMR!p@  10S w: tЍ000iS00S 00S  d `PK9W @ 0  P ( P000 p 0pf W@000%|*4*zV&8*H*%`0@- B@T0@T0@1 S2 0P   0S %|*O-tQ0S hhT @P 0S <@@ [ R  R  R* T Y    ```_ @$ R 1  W9 V 00030S3Ѝ  R  R ` & "  V Q `Y V 0 D X@00030S 4`50  9X0000  000Sl 0d8 0  0@0020S ` 0 Ya  i 00 0X@f0000Sp X     Rd @ 0 0 @T R(q0S / @T 0 @g 0 $ @ 0@Wl00S 0 P} 0l 0Dd8L0 $\8|*4*V& hV&?Qn*l1G-0S \\XqX@` T0 :@18a P8qU @T+$PuP@`0S 0D !0R3 PȐ尠U 0S 0S   87P0S0S `0S  7@H*V& p*4** |*= 0A-0S P @`pT V @\PT$@ 0S$p$00_`@H*V&U *v O-!1 0RR㤑S _q儡@P 0P0: ЍS DPJ`P( 04] 7000o PP@:SR  0n7{ Q y~`P 0tl0 000$m0008*H**V& *p*   hV&  % 2O-0S  b000 Dg1䡟P.pP@ "0P0p0Z: P0 *@@ @ W0: R0*0 S( 10 R S U0:W00#03RQ00S &P 0000 S Phq \ X6000P@ ЍH*V&= *p** hV&C-MM Q@P 0S  N0 k_000@T0S <Ā@p T0:ۍЍ`PP@p0 F Y >  .000PU2 H*V&V e p*0A-0S 넀pP` U0(@TP`0  RF000S B@H*V&p p* A-p`P@P 6_p0S` 00 0CR?o20S 0DoS 0 hV&  p@-/0@P 0Pp SRp*@-8u0S$ $00  0 52  *H )  hV&A-P0@0`/0000 Sڤ/0>+b T0 P<ⴚP0? 4 ~00?**%0@- @00|0@0Ѝs@-@P`P @TZXX 5?0 00?a+"+R  + D3Ѝpw hV&$0L<S/ @-hP*%$2O-@`CMV b@0DXCߍpTW B/ ᙨ0 S'44x'xpl j@t1P0S8Q 0SD{'{{g W:0000[9*0S 0 0S 0 000R*Q 50S  `X0 c#.$cc4"0,4 4Q0 P 00000S  ` ,**V&   *H*D@-2p @,P20@0% \3O-p0]MS DDe@c@C < 804#300RS   #03Jup"& '_RPP "PZ4W  0"k300RS[  0"`3t#upd"lL^PL"L  PpHBHHHr0SPY : SVH`P؀/0 ;10L<aS$ 8 8  @ ( D `  P  \  T ؂ +b P< P P Gh0?0H @P _P)PD  3L P _PAP|]ߍH*V& h* *8*%  *R %p ~ 1 |h *  * n`NN* hV&% @-$@0 00: S*G-@ q `0S+y1P 00S UP0 S00P R HRڄ00S t3 Y `(P 0 Y00:$00S ( q3p*4*hV&  |h ? O-AMM`P@g8pP 084 0 AލЍO/00 09/P7 0p!p 02 o`Q D D @P <ݢPD z@P@ +3  &3 !3ŢPD b@D tȠ帰`TAލЍA. 04B   R ;0 0 2D E@D W`0 ⋒ 0 D WJ *m hV&a &0 A-MM00 /R p@`.PP 0S P@ۍЍ0 D &`D @P 0V HP`|h *p@-0@ @P  P@p@-@|0@:3O-tM0 S tt:p00RS`3`  T3T#0c1LC4#S@<<tЍO!0 2(PL  < _2+[20p`000࢟ಟ@L<` 1L\0@ ~WI < h`VV#W  @Pp GL<0@'pl0xSiSPcP 0'0@$ 000 1L<0@ A\5dXL ]tЍ0 0C0`10S 0S`%0` S\0X0h0SS  9890S d00X00\ `0F0P!ac 0<1d/H*V& 8*h*% *p % hV& .*6A<*@*[u`*Z-  #A-MMp`@PPx 0p)h!hN/@PX Tt1LH< 0k1ۍЍ aD D< /PpUA/?/ U`k /p0P D1ץ x=16.0S .p T0TP 4 +1뾥8 [E8hV&D*<**b@-P@-H@4#S 0 ]  400#S 0T @*0%0A-@P` 0 P0:| 0pp ?מ0@$aH00S$`2O-lM0pS ||x2YGl.PP mP L.H{0<`000@Q /*` R 0?*A0 Sg@01 8 $1 0%1 0`080<夓0@ 6y p.D5ZlЍ 00`V@ 0 /0` 0 @T`$ E000 0 0$00(S0,00S0(0 0S000$0S0400R@0 1S0 0 0FH*V&O<*6hV&jp**X*h*(*3C-0MS Yr 0 P000 9000Ѝ  +PP  d `.\ 8Q-P  4 $-( @0@Db `P +P w  - +1RQ rQS! $0SP P0hy*0 +P`1 D1L1D10S0" 0 AD@(CD(P@\ (00(( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t' R" H*V&p**m 7hV&(2T|8*X**h*$* 0`( "4`#/@-@MQ 0 3/00؍/:-74).&w,T,%<00@-@MT[0Q@X0T L0LP  @  (-Ѝ0@U@*I*hV&0P @-- **hV&0@-Q 0@T0 R ||)0AS@ jЍH0H B,P~ ( ,%**hV&E %moA-p@@P 0 0S({ ` ` `*L0@-  Q4 0P ((,) Ѝ< **hV&@-0xP 00S@%*S` I P@` 40P  $ 0 ,Ѝp**hV&0@-@0S 0$P B5/x00SdPP PqpH0`P@> 4 0@$^,W) Ѝ0**<**hV&p@-hPh@4S 0SP LL+H H0P0$000R0p 43**Dnp*~l*0s@-@0PS  40B3/p00S\0 )pH0@P`姠 4 0`$ ,)Ѝp0**<**hV&p@-P,@P@p P @l \0p@-XP0SpH`@P 4P  (@p(* %*hV&1A-Pa0510pS :p呐@P 00P&P'(YP+P=  0+lt+P/r T L0+000@,A (**$*d*U&.1 t*C-Mla! \\ Xu+ 000 @! \ 0A0 g+08 !Q  0"QY+/U+X. , y\ J+ 000 `  k\ <+8#`Rp000F"1+t F-+d00@ PPЍ*V&*$5hV&@*c#*4S_|O-@ḣEM08aSP  +됳0 @00T*0 ?o2Q03S P30S D3 T@#@( *0S  Eߍ0S 0p0"0)0S 0"p! 0*V- V V:   B B B0 0 M)l"p0S0S T 0L 0P- <FPZ 0SF KB  B B B0 0 )!  B B B0 0 )!V! V V     \!!=\+aH*(*4*V&) %H*FhV&k*L*;**<7p@-@0MS WPP P P ۍpV0S60S  00P 60Si ] ""442h|h|004488<<HHLL|||xx|||9^E|E}|:^Ey|E""442""442T0ASLh\ ` Pk PI lPdT0S40S xxr00[XU R O!"441$40F""44"2"44"2"44"2"442(3(,0,T-TX*X\'\`$`+ʙ 0# #100 0222#0 2 0 (0#(0/,0H0T0, X0/X0\ `0/`0d 0,d20i0005/(0, |2-02R0L " S" 0x30=00 2R # |00# #X0/80\ /`0d 0 %0L0<040h00S!&#3 |%t p1S 0SP! Da! AQЌX`Č %9-0CS %  R0 R R 0N\ \0|Tt0- =09!m,*lT*H*V& k4*&}Q FhV&g %` C-MB2P000R0 b 0M0 0S q쑟=聟0=P  RP 0AS^؏̏=0ꄁp0W\hq P  RP 4!=0=0S p20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ%0=ۍЍt0 h0P0`0\0S H,@*~*T**h*+*hV&p* 4E]zO-AM30A(0 "S $U+p0(У͡0AC 5/0(0#R00 Q#00h2P00 (0S $1(#C5/0(0,0S3,00?0!P#0,0@ +P Aۍ<ЍP(0S +p0(У͡0AC5/0(0+p0#͡$0+ $  BRʠ0@SP (0S 1 P@0S& 0 $00S  B'$0S 8#R00SR 00S \0l 9P tl$x3  P8P0S*T*+* %*74*V&0 *n@-@0SS*O-Mw0< 0 0 4   ؂@P0 80 0 @0 0H0@0LP0D`":PPP S  S  S;  S h0 `#p SK  S"  S<60S 00 #(60S "6v0S -`!P_ 050S  z#Ѝ50S P 0 L50S @@ _# 00000%0p,Z0S40S  E#40S m" P 0 0 8+* A!A!V00 0 `40S T 0  -!30S  #30S30S *" ?!P 0> "!"!V 0 0 8**P30S` P [L 0 0#p00 020S  "20S620S ! P9| 0   V 0 0 8Z*W*20S 0 0 m"p00 0d  10S 403/   !TcV00 0@X10S00S 0 0 8f c 00S  0  4\ 0 3/`V 4   0,"` G *OhV&H*V&D*<**@j%}opq*@*hp -xn;0**rds* \A-1(   0 !S@ 1 1R 4S8 !4|q04&|0`a@00S/ P0S  R+* RS-DP- !0 010000 QP 0PT0 $M )P ЍPB!0P;C0P|80S050 00L0 0 @ 00 0**T*jp*|@-Mxc0S llhChS0S Y^P-0#00,O!H R03 2r 0500K rP5"0C590C990C9000lP|n xϾ0S \2d"`2Q09T09 <0S 420C90S 20tS|2"CC2% P4 0R0%S P p H ;#;S ;0``1  v0@%S ) < 0+C? R 0 0B 0S a\2P 00S )X I 0STP=S 000ЍH*V&* %t*p!hV&*(*$**,*?XkT*I8**X*h*m (4*/|*x*-@-  y3 ЍЍ/hV&x07@-@0PS \P &H0 <G  Ѝ0000S 0  Ѝ0@: <*hV&H*9V&|0p@-@PU 0P D 0< p000SP  <*JhV&H*rV&p@-@T`P T0:pGP 0S 0@Pp*p@-@PT0*p/P 0S 0@TP0@-@  [0  xhU0 dPO0 P8I0 < C0@ (= *D*p@-P@P @0 4 0D !0R3 p|*hV&A-Pp`  00CS0fK@ T 00CS0\K P yTnTyDo0 @00  0 0 ShV&d*jX-@- T g2L00S @P@0P_8Ѝ@Ѝ/hV&L*q]R7@-P@00S#)P 0  Ѝ0R00S,Pt0 dX00SD D0P<$00S $ <*hV& B H*[ V&@- @  P   P  P  l$P l L\0QX X , H@0Rr hV&       my  !0@-@MPPPP<  P$0$ $oЍ0P!#!*!+0@- M@ \0 00C Y双6 ۍ3!p@-@0S g't00SPdP 0@00ؒ <p@04<000Sp p@3S!<*g!hV&H*x!V&A-/`@P@Dp/Ѝ/SpPP 40 003P0000S@-@0S  0S 0 000h00S@ sP <@04000S @!!<*g!hV&H*!V&@-@0S 0 000d00S@ PP 8@00,00S @!<*g!hV&H*!V&@-@0S 0 000md00S@ P"e 8@00,00S @}!<* "hV&H*4"V&C-0M.S4P@A`p0/SS 0 0ZU !     H  B  <  6p  x0X  d* 00@ @BЍ@*NH"om"u"T|""""""|@-B"A-`Axp@P` P PB00 S00ЍU00+"""p@-BM @P`0E CR V icPc0FS`0  BލpAS P0P S00@$NnBG2+ #"A-P@`ъ<0 PpɊW TBA+"@-M6 BPKB 㬐 0S0P  P/B06PP p@;PP 001G0S8 0 00T10P0-HapW 010Q05 S:; S0,P!0P=0  0P 05 P 0 .Ѝ  _S-S x]p00 0P0;C+$?#Z#4]&}#+(*g#0@-CM@P0,  0   >Cߍ0#+@- @ R200+#/@-$M0h ` X  @PHpP$ЍPU D0PuA#D+"p@- M0P P@  ։4`  U Q Ѝp#+p_ -\M0 P|  \Ѝ#Q -CM0( j Cߍ/## 0`( "4`#/p@-`P0 R  @  0!S` XA 㢎!>T0 d0 Dop+}$W$p@-@PU U  0< $}p@巁v $$V&$P 7P P / //$$$-M M? 0⼸ۍ ЍV&4`00CS`0X X0 X /U&O-pQDMDЍOu@x5`pP !W200 u00020PS0C000@@ Rp@T3 W+X( U U P     F0 .     6` .0I  p8M p WV&$ +H M+3<0S/@-@PMQ PЍ@ p31Q``X00CShhhhhh(d   "1PЍ@L !0S SL   zd0AS&ꤻлػHk 0S0PЍ@M$ Z T P L0⒍1hS fS5004003001 2008j0CS PЍ@=0(0<0$0;0 0:0090080070060 05004003001 2001jS$ $  Q Q ( xVPЍ+$ %$%o-% A%  `%r%%o%|%%%%%u+%%3&R&*Z&@ |& &O-@R@P .{PP @{PQ/,v Ѝ0O ++0@-@QPM 41a! 4aDaS@$0d@Oo@@1e% 4eeT# ! "Q  R P Q T%< ʨ @,YvЍ0%(T h \n%T @ 0cP" $ @ Z++O+++ t0@-Q `.@!@@QR  0+,  +0s@-@ `R  0P.{P ,u0S ,u|Ѝpp0 !PU U H 04Ѝp@!Ѝp@% +O++@-@T T 4 0( ЍЍ@,Ѝ@++"!Q p@-P@ T p@<'   p@0  p@M"O-TM0@0"00 p`0 @@@$(@P PTЍPPd;0 @@Pt̡p@T:TЍO50 EW y R@x   ;y0P `yK ,\100 0 S0C000  Q,4P 0` l0 0`f L` `X`00CS`0X 0@X0 X &+,% ,U&@-00B Ѝ@-0  : ЍO-4 P@pa TAD -Q P P PPP@D`FRPP00SP Ѝ),@-0@ 00 Ѝ@?@-Q 0,hV&@-n,@-AMQ M`@0Vp0dm/aXQX!0TL"0P 0(40 Aލ ЍP00 ! !01 ?t0E !R 0Gy@P㲈= #=㩈<T0 <M<@D@`0H0\ s@ DD! +,,,,o,,+ -'-I-@-+0@-6S ~H +i-@-wlifxcpdm/ @P\" T\E @ 4S, @ i-v- + +@-銈  ~/hV&@-0h@  0@ 0\0CS @C4]&00S/p@-@8PU``p840#U:X 0rX0X00P4080 0X0p`P -7@-@0 P0 0PR*0 B Ѝ0@Ѝ/O-dMPP @ T0D 0 S ٟdЍ`p | J ]  ^`|!0 r0  0  ` .0 V0B⫟P ⻆%4]&//C-@㸀帐`Pp@"!0# U 0 |pp p9 rP@T0S0-P    Ѝj/ /o0-,M⢇L0$0H00D00@0 0<0<  $$0Z0n0w000)0hV& 0-7@-邇`P`@ T@ R 0@  &000 Ѝ0@Ѝ/%+0p@-PP@ 0S 0CS 23 0 0pqp@l h 0 00Sp 0 0p\ Up++0p!A- (`p 0 pЍ P f8@P 0 PPpЍA:t01Sh0h  0XXpX2` 0 0S ` FP `0+%I o0*%A-@Q(p1S1S` W 1SQU(W1S WЍWx1x QU MЍA <1ЍA4wW(QU0S) S S ⹅U   g ⧅U  VWЍAP   ⓅU  PC DD> ЍA+%I V&[-G n1 1L&4 0Q 000/ +%1A-JMxAM1Sh=pv`0 `P c40 0`pp0S JލЍ;X P0A7J. H00A1$L  $Hp`00P0 pPpY Li0S8b1!0 +<1a1~1p!G-ptA `1S1SP V1S \$V1S V1G BvV 0 \ DGV~\\0  嘠EPe0SVGxi1S  cQ 1S [ 0VG +V&%I %1A-a M0\ SQR$SQ S0A 9tS 0 1S :AuSpsRU\@E@PVT @dA ^`+2V&%I %A20@-P$M@0000 PP#p$Ѝ0 R p 4d0 0 1S4*0000 0!U2+o2O-lqM 080@ D @CT Ѝ0VЍOaR`" 1!0 0 @@p Y PP 0 @@ p R ;Z xx x00CS0@   L X8g,$++222(3P30@-P,M@0 08 0 PPpf,Ѝ0 P   4!! 0Q P0Pf? 08 Q(~  y U2+%\Mt3p@-`M@0 0( 0 ``Ap"Ѝp R  3|P10 01SL0L F 1S*1SP (!9 U2+%I 3O-DMhZ2 0S 0 00 (0lP (P(0 %"`P(` P@PDЍ`(Pvp ( $0  pp$PpDЍOT(P 0u$  (0CS-  Z3S崱堑P`p( r00R0S W 0G0 0,o ,`1!0< 0( (0(Ps p( ἀ( U((0$ 000  00 0 000  00 0P$ 0 0$1SH "<!!!! ~ +3U2@%D3C-M⬀`` (pᶀW0P0 000 0-lPPQ ЍP\@P PP 0  PP$pЍC 0R 4 20W400(00 (Pr 0SQP m0 Pp 0!00(WP0Sxpx1Sh 0`DS PpP  0PS  3U2+@%D3*%0@-P,M@0080 PPp,Ѝ0 R  ;20 01SP  zZj{e[fk0KZe[KK[K+S U2+3O-pbM0MSP@ =T S &P8"82J@   X:80@ 0 Qp2o1ٍЍ賀 Np  "R| 1 X RX X PR*1 21 0T 1S1!T0 0*~T 1!0 0*ripy 0 <cr Y@y  0 <Ra+P MT33O-JM{ M`@Py3 j ', HQ  (  X7$R Z 0XS XQ;X PED0}4H0 1L00 1Hp`00 D0ppIpXL0 10@sXp&4 0#Q0KX00CsGX`0]zXP` pWI-%X 5AL6T&8<r86/ 641 X00 l4`w 갠Z 0 R(0 R opP }1St] X0@sCX 4 0 0 0 03AP7/0%00D0 Jލ ЍX@  RH 1H0 pH0S# 0 0 @3S H  e8pW%$RZ 0 000@P0@3A4/HpX񟗶  0 0 @3SP1 04S) 403001P 0 p 0400 [*'$Y ~0 S P40So 000   $ $ 0 `p8`0㛣#0S P   B ( P R0X0,( 0P$0 ,( |$0H0 ppKp0p<  H0 pp;p0p+;㨀H0 H0+pp}0 Sp HKpP H0 pW 00H0 xpH0 ppHp0pH @P0P pH0 ppp H 0Q+H%m oz @%I +24C4N4T+W4a4j4r4|444J44| 44444 '4244+4 5%5O-ԿqM`=P `Rm@Pp Up#*0Tp?SpDp00h|/`P0.0809` R  0P1S<KW@`  {00 14@{0 ,@@<@%@&m0 0pP@ @WX!3W0 SC0JSI \ 4  =lP@8PwP p080(w8@ P T@pwP3Y =y - 0S qߍ,l0P00T | 880Sd  0So|0Sp ywPY@owP,T hwP cwP040 [wP040 SwP NwP040 |FwP l  `=wPT %| 880S4  0S|0S  wP T | 880Sp  d0S{0S1!R0 0:q~dvP9T] 0`080 Ro aBQ#       x                 ikklgj   p p  975{ 8 38 W(   R{ R0!P  : <0<00140kS00   0H0t9Xd)  l{ 8 8 W`   RZ{ R0S*  %00140kS% 0404@T0qt4tT:k 0{ 8 8 Wt  R{ R `0  0140kS0 S01X40S   0H0 4@Tt0@s;p00k4@ThXfX01S_4@Tj0@sq f&0@A4@P900.04 081x P8Be80U08080S@00 @ c/4 4 6@ @ke68 80 p@ @0Y-1 `0400<0,0@'p'z XT0H?o20S T0H?o20ST0H?o20X0S0pp0r1!05 1"04 @1@SXa 0  y 0H0tc?D`D0H `5p`epH0SX ZxH-0A1 d! ^`0D00 0P`qp!zd t1!0`100CS<$H$1"@ =Dj@P qߍOdoob4S t043(0 0,0c?0040(000, 3pdp;WP,kI RT=00D@l t`P0=S "8 R0 8 tP 0=Sd h"8 R @`  tP 0=S 0"8 R  qߍO( TV04@00,0p@RVD@0S 1SL X*  APP `V-,  0 0(00,00 p03A6/00`8T"Xr(,@\PX0,S(` T'&Fy Xqp 5W6@ 05_555!ю)575555C 56866d7667!7?77777 78%82A8H%YV8_8u88+88p!5+00S, S S0&P00CsL "" `C0P LPT00T0pPdpWC6h0l PJ000&00' T00.hPT0x0S!@@T T T0P 0$00L @@ @0' \@00 J00.0000h 0CPP\0 p p WqߍOmx0S\0 ,`h00@0 a0000( ,0p @-,xP@  | p d X L @ 4 hV&=V=w======>t0p@-P@T`&s P  p@4p@w +(>H>@-M @ tP( ) PLۍMp@-IMM @`\PyIލЍp kP0 u0 pohP 0S 0S0 0S  vPMg>>+@-M @ PD;ۍ00 R  VPM+H-p3M℃M`#PPWZ@PrP @~rP@ P04lrPV 7 ;P00S , þP  @ 庾PPi P tHrP ,mg[ , PU,I(P0S -V! J1! 0dJ P RB PQ v 0 UxtJ|!|1h @B R$BP< v <4S J P pRkPh 0R :CoP᫲ q > qP00 S5VPv0p tvh0p T +>; M>>Ƌ>>}  ?>y >_???:?hV&?O-MMp`;.pZp P@@ p 3p p0Wıp0Z:z0S ލЍ0 0W@P` @PLqLL?HXqP(1 ZpV㟉 1Z SP vZ.pZP vZ.20Sa00 0Zn0V9 Z-P uZ.X@)0T:Z^P uZ. |dI edA8U?+"P?_?@-0` 0 0o`PP 0 P@Pb`P Ѝp@4(PP DЍpx /P O-@-tM< 840PPZtЍBn0P(0 ( tpP&U  LT T T;xTP0t4$0'oT6P0X4XT$01P0H4HT$00SZPT(4T$0P04 0S0R0S00 0 0 (0@` 0 0@TF*303 03030#T0 Pً(0@`P@,@pW6*40S 0dS0ktDᅄ x  0`pt  ;Xzpl X `(;m0P02R$0n 0BnS01 0<0S 08 S@ ?@0?D000S, 0竸S相0P ?`nT0  4 JP 0L Pn?L 0HHn {H 00{'{,0 0,0@0P00D0@ Bn| 001 0X0 p`?d 4 $;`p J?  4!; h$p X0  0T0Q {0h `0{'{Pʟ 0m 0Pm$0 p6TY@ Aq%A0A@A@#!AAǻ^AeAAJAAAAAoA,B0SP0勤d4 00kS% Dp $0Xpp $;`p} 0@U 04$;hpq h0` XPɏ 0m 0pm$000@U  0`ym$00$ 0P,0S0fd0kSㅤ7 q 0Xp@p2 4``$;6p( 0U 04h$; )p  R) AN)X00 T0@ A { {'{ >)PpǏ A8)0PU  A {0 {'{m 0m 0 mT0 Y@odBjBB@-ts BhV&A-`@4pS  BP"T0DPEE$UX nP00ynP 0-< 0P ($3MDPE@D+ Mp@-P@Q0 0 pOnP @0S \p$Pp Hc^D 00< 0p R$^$%(F+Cx+B4+0+,+B@-4800S ,0,0 p #HF+(F+,+O-MX M0S1 HpW-Q88Q8`@`(0 Td0+ =P 0  0Cۍ Ѝ0 000nS ?S aS ppS qS|0 | &0h 00L0͛@0 lF+PF+C(F+U&(Cda+9C0]&jIClCCA-X`0S L00S @P@@0p0pP00da+HF+lF+PF+T0@-@@i3@00Sm',0, 0S00e'<XF+,F+LF+++RC-PtM` 44E  P RQ ğE R`S kt`F0Q ğ R   TDR 7 4* CR ` 0S $ Lp44 \ P2004ß@Q [Q \QR $Q  0R0F p1 B!$QH lH RC pppDW_ R @T$P \P! P 0P P00^@\ 1Np$$ l  T\pH 0 P p00$0 R  x"DQ"00P" t 0Q "4F0S 0QX ]Q \QQ0 00DS000S+\`tЍp1A$^? l0HS pppDW\Q> $Q" 傀ಀ 0R8F p1 B!$Q, lH Q' DY  DR R DRڵQ0P00,Q ]Q 0 $R l\p0 Q,Q ]Q B  DR Rm DRiڊ4]&0]&T+e+T+T+(F+HDPA-@@P@T ;.@ P`p0Sl h0 R@ P ,0< 8H(0@A%/P (F+I !x+4+dDA-@PpP0@S`00|0 Rl ! R 0L 0S @!P@`T !,+F+J+%D+BBP@--0 Cx+DP@--0 7x+]z P@--0 +x+DP@- - 0 0 x+(F++DP@- - 0 0 x+(F++DP@- - 0 0 x+(F+ +DPp@-0AM 000 0@@Su-T1 PS" 0S00!CS;P 0S0>PP 0T00aS`0 00S`0`0 C3;PaS` 0` 0R`0 0@0S0@T@ @0Q0 00S0'Aލpx+3E#E+EE(E+|+G-1MMP -<4 1ݍЍP0$C:P 4@@0 PZ30S Scs 5@PQ 03 cs@0S0S PU~\30S5 0P/ P30083  0(3S 3Q 0Q300?o2 'Q20S 2 0[P0002@0 0R R00 R ?P 02D"000 H2 2Q T100?o2& Qy10Su 1@P0001@h, m0 QP0S0T筻L,PU Q 0S 0S0 0P+ 0! 00 0}00Q Q000?o2p&Q|00S h0 0P000<0Px+?Eda+* +,F+LF++hF+|++EElF+HF++KEC-PJM Mp0 000 0@@S+1 @Jލ ЍS2 0S! 9P 0S0<PP T0  t1t p1 R0 0S0QY`% 41 0S (1(z! 9PY#P͡0 Hn0S @$00 R   R 0 (t00Q5qp P0ST00@/x+(E+|++|+(F+gE3E+dVE 0 0 0 0 [+E0 0 0 0 0 P+EC-KM MP1+2 Kލ ЍP0`"C9P L2@@D2000,hP 2 0S@ 2 . P0 aQq0S 0S 00 3@P .d1@0S t6PL1d 0P <1P 0 0 00l00l+PL0H0D0LP 00 00 tF+xF+(F+x+ֻ8K; 000 0@-S$000 0 F+F+hKx+F+000 0@-S$000 0 F+F+zKx+F+p@-@Pp@0 @- 0K+x+0 @-z 0K+x+PG-R@Pp Pʄ!ЍP`P? P< P`TP5 _-PT. Y-@PP%%`. U(1$1@W 10SV U00@ $ $``PK0 0 S  NV Up0l0@W T00S H0H 0DD S 8  44? EOF+F+F+F+F+ֻ(F+KK @-j0x+P@- |0 pP \00}ST00S H0H廌@P40 , 00$ 0x+ LF+(F+%LPL+p+l+P00P0Ss@- 0 Ѝp0` 0S P@P 0Q R   L 0Ѝp@t$Ѝp@x+|+(F+gE+ULsLLp@-P0@P $0 p00wPpF+x+LA-Pr 0$"0Ѝr0S 2 BP80S10S 14a0@ ` BN0崁S Cc!!b"  A   c# P0U0CtQ00CS0<H P?00CS0@? P7,! .PS01p00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 Sx+L+(F+LlF+L$`+$`+$P+U&L9M[MP00P00@-SM  0 0Ѝ0Pl  -P 0)qpP@ 0 $0$U@00x+3E(F+MP00P00@-SM 0 0Ѝ0P {-P 0)qp L0@0PW#*4 00S 0000x+3E(F+MP@-j$0 P\Yx+MM@- (0@kP0 @w(F+MP00P0SA-쀟 ?00ЍP !-P 0\0`P O!PPP 0RPx[@u[@@U. p M HL L00x+(EH/P P00P0O-SM  0 ЍP  ,P !@P@ 0R@3[p`.|0 `@P0L0 Р00000@@0 ix+3EH++F+EEPp@- 0 0p`@PP P P@*p0 ` S P@@ @00 0(0x+Mu M(F+MJ+J+MA-p`P @Pd0 `AP 400-4 RU0 Ay(F+*NF+@NA- PP   R ЍA@P   R  \@0S00Ѝ@`px+%(F+oWNA-0p`P0 AP6 Pp@P @A7P 00 -00x+(F+*N`Np@-PT@PH0 p<00S00p@(lj0 0PpF+x+|+(F+qNNp@-0@p@SP`0 pT00SH0p@@姉0P0,PpF+x+|+(F+NNNp@- @x@RPh0 p\ RP0p@H倉 P0 ,Pp F+x+|+(F+N OOO-MMPQ 3 ٍЍP0# Cc+P 3S`@pX 3 | &[PP@P)MK0t'` P00S 0P @B0S000p@I22@0SP$S \S00P" 0   0 #" P00B   BR 0 D )bJ0 \Y@0SPiR0PS 0 D)bJ0HY@P1Ljh1 0S x10SL1h`10S ,0專00CS0.   J0 03/00S 0S 000CS0 S0  )tJ!00000i0 _X 0`S8 x+LL+$`+(F+nPh+4]&@F+JJLF+JF+DF+TF+@-@P K00P E00P?00p0- lM  X00S ^H d0l P000p 'XF+HF+P(F++-lMT00S ^D d0L P,00p HF+P(F++A-@wXP `p0 0C0SQ3  HPPP 0 B RQP 4 0 0C0SP3 p@-P`@:NP ;- 0S1PS !|1-pp@--,+`y)P %NP008 -S!0RPUPp@-@P 00PU X ]Ppy00p@-@0`PP<pI0 .A0Sp 0h R00 Ѝ0 0S0C B RQ"  J+PP/0S/0@-@Q0%Q#0S P   R   07W0C2007W  B4]&G-`P(P @ gOP  aOPU0 00P0 10S / NPe e*P@NP 0pS42  PpV*:PMP pN*P :MPQ p000 SP@0S 00S1 @RđU|0 ?h OP0 0 U *** 0 011  0Ѝ @p) PH 0S000)0S 0PS S St0 0S 0`S@)H0pW ),pPQPJ+4QQ$Q`F+}h \F+o - BR0 R  P R !O-!M M@0 P<@8@4@@0D@@@NPm4`0 p 0S 0S 40S 0S Lᚩ@4l!ݍ Ѝ<P&4Y 0S <@@T `V@pP /ZpTKX`V G5PUp@ @l0S ;Z@P d,P X'P H"P8P0 K000@0()@P4LP 4@P@)44:LP 00)<PTXFP`U0@p7Xp P2`Xp4$4PUp& P`U X@QPPU XPU #HPPP @ @ PpW HpPp3 Q  `3 \+ WG=0 080 S( , (#(0 00 0$)"00 0R S"  c`pPR  0(0P Z , ]0%T00S9 llX% 0S1  + G=0 0 0(00$@0S0S20}S$ @/KP00Y@VN 0SK U +HF$+HF+HFH` D+F=0P 00$Q$`(0 A `00+SF=0  0`0@@DcT@@0P/YP0,00(S  R[@pQnTQQ|h hF+bQjQrQzQQJ+QLF+pF+1 Q "+x+hV&QEF+lF+EOF+O-iM M8hLdlOpt͍40,xHD@|0 0PH0.600K/p% ,A'@0'4QD'8aO?ⰐV=La少H'TU01p 0S `cPP d0sh0sl0sp0s0St0s t!U 0S V|V?0S P'?0S0 /XPA'>'`?0S 00SV4 $_ 0 0 .=0S ~%P' Vi<, )0S  ~O)0P$.p>pN0 0 r)00 PQT /=0S-=p R* 8p p$p0p-0 RXUP;0 00|S =<h0S;0x I\M X= 4= e`X[,IEH;P0S000  V$ l:+ 0S 00S _0Py 0Sv &ܪpS ⴤPPP 0S : XPRvSX :HRKPPW xPx0SV x0SZ +0 0$ P$P %IP  0`!U/1\1X1T100p `10T1S 0S \AT! 0S TP p @UR0 0 '0S 00S P P&\K8UKύ00,! 0!4 8!0R cPP0000X8401010c/d`P VNY04 PPtPt0S4 0\dU@x`PTv t 0k_0P0/oYP80S PPk/@ꐗ FD BD00S Xk?/m@80 S00?o2c$PFP0 ]P60S P 0Su%P 0Sm%6Fp嘆VS@P3x)tCl60d6qP 00@T JR fWP 00@T ;R WWP 00PO gcM`ElP<|t'')sP<o060S(`x@T*4!@'K,'$&5uPU<LV0 0( (Fy & @5 d5@T O?00$0@4!&p40SdPK PT4T$T& &Px (4R$&&p0STP/X3Uc \40SI 4 j &TXPp&'p8|XP 30S 84LXU4cb30S 3 8 _&U@b U&UT  L&R`0<0`0&$ 0@<BP= GP?  0 R (2000@/ "$`pP8p p$p0p!< 0P+ȠZR @P p2Q00S P PHT p4 HTr hp+nT\S+S5SSF++S.SV&`HSS+x+7O-OTNOTT2ThT|h rTF+TTT1 TopF+L+$`+(Th+@F+DF+hz J+E0UBUPUJ+v'SdUyUUUUJ+UEEU SRUUUVq*%UU%4]&VW-V[hpd 6 Rd060&00R 6R P eT60F! 6@6`l0Əs l?0l0L@T? V  9%PܡJ*U0 0  2 R@ U0"0C?o2? U ""0A0@崿-000 R ;R HPP |000 R RT 0S>0S(0?'"( ,0".0S ?0.T0.͡@!͡!..R0n"0R0.͡ 0%$PP#PP0S0S80S#PP XB5(H000.R0@D0$ .0 pwx'xT PPT p\ XTX\ P #P U l T R90S x90S|9tyP $aF0S @DT90S YpF1!0S   PZ0S= S EE#<: <:` T00R0SC rPqJ  9$P   ;OP Ub d:0Sd: P _** ϠP 0; R#E @;R.sr ZO.Q!03/Pp;@ P; R0 ;Q;F`+0 0 S dh lp#0S,p< 0R.Ko m.,0S 嶼000S 导000S 娼000S 塼00|iލ Ѝ0S 03/0S 叼00s@- P@DP  DP0P "Ѝpۚ`P  DP 0 FxUpP Ѝp@0 0S S0S $ D0PPPQ QQYY-O@-M0h 00P P10S 0S00 0 Ѝ  qQa @T0 S 00S 0s 0 :0CP 0 S000Bp@T hMP 0|S 00 0S00 0000K+LF+  +J+F+@-$M`p P=0000000L@IL0P/S:S y@PxQ@V幻P $ЍU0LP᫻ @= = =0/0PPP":PpP&@P /000 09@P00 `0@@DcT@@00@0CcS1S@Ox+|h OQQPP00/@-:R,0 @ ' 000/R@XF++@-)Rx0 @ d00S X0X0 p 2<0000S  R@XF+HF+(F+,+@-R@`00S T0T0 p 8 10 10S Q@HF+(F+,+l0 @- X00S L0L0 p 00 101000XF+HF+(F+,+da+`0- lM@ Dd <800 p {XF+wY(F+ +0-@lM@ 00 00 0rS sS phd <\d <P00 p 0M(d XF+da+++YYY(F+ +Y@-`PP@ 0@s8#80@U 0s8#8000@? P VU 0A0T0Ѝp00CS0 S0 S 0 /8O-TMp|00?x0 X"? 0p 0Q0`P0V0X B@0 @040SD H 8PZ0S= S DV0  %@P*P0S P0#S P|0Sp l1 R XaR 0# BPtp uTЍ ?$0000  PPP0S P0#S@DT|0S ph@"\B$0 V `|#L"0 0 "@BF+(F+O-BMMV@@ Aulp?0a>0 @@0P86 p`P,6P<N6  BR 5 P(50S5V % 0U 5B0WU S00G00S(+ h; 0S+ 0 S( Z000[9  BR t$5PP00CS0h0 vA @P00CS0 O뤴00 0 {P8$ ap0,TS (400  00BލЍ4@@30S VW@@c3!%A3 0p330S' U U# cT$30 CRKH3000+ [)[00E @0A>V0 `W4$2 22 =U[2000 t"00K 1#T0V CR@U-[ 0S02   00 020 CRUT<10S@d@60 @S405  [ [P [ 10SʶU50F?o20S d10SX1p10S} U T U00T0SyT} dT([@ 0S10S 3/1V0    0ZR\@\ 0YS P 9/ 10 XS P 8/0F+ȭ d x+J+ L+F+J+(F+$L+L+dJ+ Z+4]&x+LWF+-A-` @T i0 ЍAЍ/p00$  P+xw@l0 h Io0S@ LP 5/L+#Zx++ȭ J+JO-FMs M`@  @-M )M 0%M0$0`3$ 0(00,@Y0P S]N堹0 3 Fލ ЍY0 @,Q(z92@@Ȳ@aGT  2  Y 0 PD0P|2d oNP `"`dW9T S90S 00S ,, 0d | PP d⫸@0S00?o 2hPK L06X6D01@ @[p l ჸ41  .D0(66S0d000 d08Aa0PS jP P 00S t0 |0'P@ 0 @0 0h,@0?%+F+EZx+x+F+T1 (F+TT&+^Z. L+L+ZZO-JM WMsn0p0FXv600S00p 9 PX6   60 9PXJލЍD60 0000 97S 60Sa 6 Nv0050S# 䵟0S5 Q S 5R "P 0S 500CS\5|"v00l;0S P97S, 5D 58%8Y0S 500CSX0$000(00000 t PN 4#0000S40܀C XSX @4000C 0h00d0$ 0`0 P@ CK P 38w!>\ 0h0d<` ((0#$0#c# $c4"$( <7$("", &R h3U0 R0S R3""4408'0P 2X0097S0000 0 0S  |0 p8'P820 00$0 0  J pP 087zP0Ķ 97R` S㸁 0S [10S/ 0S+0,< 00 00,1 BLP8!81 R  x 0 ) 1Z&P 0S 0097S;70:70?70>7='<0S P0s00UX0 ,0Su [X  T+tF+F+K+&+ZJ+xF+(F+[F+LF+F+J+F+Zx+Z [([$L+["+[U[|[[[&+['\F\t\\\ 2@-`pBWLM LЍ@ pPk  pe 00011 0S<0 |q?!((00 Q 00SZ=9Q ='/@#b?!"/p8LK0S HK0#S 0(60 8pp 8K0S 4K0#S Ե psp 90S0 000 0LЍP4c00tF+F+J+Mb\+\\A-0H`D0 82V p R R B`R RB`b2 Q  ,600EoE?AA?R1 $!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41 Qn u80sx<0syxFP0040Ss00Sw5$ , 0  |10S6 00|S  0P<9,,0S X5@540 ,,0S +|540,0Hp,0:PP0: S 4 <4 n00, 0ǡ4 P4 00S,  P4 000S!8JH4@08@S\4@n LTP@00S 0>0004 s,f$4 R4$D4R P -3C#<0s <30SP 30S 20S2P30SBr, 00CS0~,Bp`X VmUP I0CS,0#p,000q002P001!P m40S 40,3/0,0@00@:1 R0>PF0 SR1#d80 ? 0!$$P000@ U$,00@ +000@ 0 @0 0 0 070 0 0 z, 0`$\0 #8T< P,0S 40,3/0MF++F++F+F+,F+(F+^,^0+,+ +J+ U&+E#ESF+x+.H`zX7^]Ey +MJ+N^ +^^?++F+y^^@-EM h,$ `@_X, 00L,(0,0D@PD04<@@P@$<$00< 00Ao<<0S?;0SW 0004 8 + R<00S0 @0PKPN,1S4$@P $00|S $MP$/C@E0SR E0 SN $ Q); (1RS ,1S $00-S0S : :$ <0S $ Eߍ0S|: 40st80su\JP0000So,0Ss9 9 9T$ 9R P90S PE0 S $P$00$0T $/00:E0 S$P$T H90S<<9Q0SPPP=<0S!0S' Q+80S >(P  H8(|80sS|+8  t/Pq00S  L$Pf@S,,0SP 7 7 R0S]P,1SC$?P!7(0P7,! L7 (0xp(0wp 0: S '00'0l7 R,`7`'``LB$00|S @8$7((0S$6|6,! x6 600$ ((0S6$6R P 6F60SP 50S 50S5P60S~ 0CS0<0S 5  (p(:Q$,0%p,0(0q(05P001!PL-D0 SE4800S 00(3/0(0,$,D0S4 S<Q  p40S 0 4R\ qp} X%$&X0p0pq,4P@$P  0Qe凮P$l偮<0S t0 0 @( 0@.P` T0 00( 0!Pwdsl( 00CS0( pk P @`( 0@#d50 ? 0!$0 S0  , 000CS0 ,@ T @0S  @(>!, 0@(00@ U>,00@ jC0 SG1(00@8 ~( T!000t, 00CS0,p@ TD0+a$>+a@-T@4SHP4q4( $0R 3  >+WOa(B+o0P |@- P@T Wp`W VL\ P  R/X%O-@pM`| =T oTP ЍOCT <<@DT#Ѝ|a 1 !Q Q@WP ЍOȋ 8S 0S reP pP 0 6P 0 X  , 03/00 0$hP >+:baaX%bWN8($\!\R% R (8 -0 \ \ \; (R ( R (8 "\  \  0 ( ( 0!R/\\\0^ 8(0\ "\0 0(88S08 S 0808 >+%p@-H@H0 (8@08080$8P  Up$80 >+h+ha+@-MAa(8S =j0 S  30) P p p $8S 80pP\ UP 0S ,8S0 j (8S 00CS0 0 p0 08, 8$ 0p3/48S 0S 00CS0 S0  P0R H@ Ѝ >+h+iU&TbJJJ   P/@-@P(P dd@-@@0s,00p 0Co%(F+t4t$0 00/O--KMPt0 P 0 0SZP=9 =: k{`Z0 A8 P@  Ak QP@0J03 3# `#(0{x吪Z` &\ @#[43(004# 0fk`  [ (f" 0Z`< (00<0f 0" H0` U  S  R( Sh"01 0;f#;Z0S;#;0 d΂*"?;#; 0 #5;0?;#;0@#5;DE!X@\ `U0XUڸ1QQ!0 P IP! A Ak{H{7{Zr(0P4ЍO-p-MM0E0f "  ]4 Ѐ0 P0p PUp0( RPUp4d"R 0*Pğ^p0S 0sl0S P D07<40S` ,$1`$S 07 {0 A (# A0f{{:?dSd 03 3R - B`P  8 BRڒ lh"B 0\# fL#2`@ß 0 R#3SPS 01000 "f0 $` P(0 0SZP=9 =:k{P2 AP090 A k Q 5 P;!%#3\QP  d 0!00 f!W1@P0G10 `RdP 1*!3^1?^00=x!P004d100 p 00S"%+0!gUp<  @0S00d @0 00p MߍY@.A++F+J+F++t .+M+e+Qo e eeebe(F+K+e,@~ ee-P P0 P 0  AH0 A k{I{7{ZUxd0P |  `5f@<U00<pP* 0@  @->=@O:=@p@-Bd00` pd00CS01p ,P P00 @R0S"P8Qd`d00CS0+jp "P \Pd00CS0]p000S 8A0QPA p0 0 `V嚉p0 Pc`d00CS00p 0@S P,P \Pd00CS0p `V0 0 7Pp@+% f+A-@lp`$P@ .,PP @P PE .P@OoB@+O-(UmM0S p EPd z<0S mߍ0.1dPP0͵,4P'0P0S SUpG Ph4P PP P0CS|    p- P P P0 PsdL:7P P 27P d0p P 0? h忈d彈dp P 0S d0p P0? 埈p P 0S{0S df0 P P d00CS0$p\2\d P Q4280 0 dAQ 00 p1@S P0S!   Cb"c!   c# 0\S81Pd00CS0p0 dL\00 p P`, ^0!S^0C0 dPXX F+.+$f$`+ox+Pd4f]ff(F+fLf4]&$P+$`++gg,F+L+0@- @0SᛥP  ,P 0  00@|0  pქPX0 PzP40  0qP0  4]&QgN|+Vgbg - BR0 R  P R 1A-0aS0P0P3U +P 00.S Ppd1ldP (,X1@P L0 ,P1T4!4!00,1 $$ %U 0 ! A0q000 00000P0 0 0pS0000PTl0l0  @U x4 l5P$0`cJ+F+Lgg(L+$L+(F+lgg,F+p+t+0+D4+dD|+F+N ggp@-@P K| 00t 00l lP0h @Q0T0 L0P@D0@ >80@0S, 0pL+LF+t+p+h+J+F+F+F+,F+L+P0 @- <00S 0000 p XF+HF+(F+,K+A-@9Qp0S `0S p T00`PJ000000S t`0S p 50000<0uT $ 9pLF+L+F++gO-P"2 AM MR0xB p" R S4 P 04 S` 4S4P  $Aލ Ѝ4Sg1+$;004P/S +t$+p$P ꐡpU0儑p 00g000000000S L1oJ<12$1 R100CcSppW100S 0o- 0000004SU00˅$DхPPTy J)P00da+hF+H+LF+J+|h hhF++F+,F+0uHx+$L+.4hA-@Q0qS0`00S Q`Ѝ0aP )P f0 R 0000@ Pl00}S0s00T 0S$@,a J+F+|+(F+Th}h$L+4]&x+O-P聟a0AS000qS4M Q 1a4ЍPF (.P00l(P00X 2P"LD u3P$4A(!0200 000@, 71P 0 @ KP 0$0cqp00P0}S0s00U 0S(@8Ia >J+F+|+x+(F+hh(L+h$L+hh i!i@-0(@( 2ႮP3P+.iHiA-`Ph`pdT @P @ @P, @Pviii@-@Pp+0 A- 0@0PS0p`0밀P" (P 0S 0"S0 R S  p`"R"^ 0 00l+J+F+x+p+$L+0@-M M P " @2Pۍ Ѝ0vPl"4/S1 @ w2P;0@TP/Pm iO-@pP`W 1@@Pp3:1pF1谟`0X1 00`T@10 10S 0 SY B0D` Q000S*00 0-0 Ѝ+(F+@- 7P0P0 @p pP0 0SP0 06@Ѝ(F+ht@+P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0CF+F+iF+F+0@-0 00% B0S# R 0S0000S b0C("( R S (     8    $  0 Ѝ 4]&0]&@-`$A0S0 0 0 0!0p 0S:S50P0S0 0 00 0p0S:S5000l d0TpT000 $0$p(ЍpJ+jJ+0jPjmjC-@㌐pA\`\P ^T1:00"\ \ L 9̠ W\\ ^@2O-`p@A R %R Y0  0 @PcUA +/U-U<%U  GR0%R0PMU20S2 2"0S0 CG0Q .QmU P0mU nU|2G0Sx2l" 0 BQ P082 R8cU.U0  K" R10S /Q Q000S10N[0N B B0 ^^/[S0C0S*0\/0C?o20SRQ 0GSE.UGTb*0S P^*0SPZ*@PL0G RX QP 0TJ*0/SE*0< RS=*09 S  7*+0S2*> @ S,*0 0 0GS$0P(0&LF+x+h+ol+p+/A-p`P @ȁP0  T  `00T  .0@ R   `FVp`00CS0 X? PpTD000`000 T00jjU&jC-Pp`a.0崐@T] ' 00)a@x0@P`0 \hL0L 0 P 0 Ѝh+?(F+jjU&jjDF+@F+G-M@ `4P 00T 83 `P4P #T  30S+  `Q `V` Ͼpa40E. @000024P El"lM4E@Xލ ፽p`,0T $ޞ ွp TӞq010@S  ⩾ 0$ 0/ 0$ jpO40$S*F>C0S  ᎾX4 `$Q(00SZ=9Q =(/@#b?!"/0 0/p430S 30#S Z30AS  T0 0000 0Bp 0S 303 0 pwP0T P3<001 K+jak>kJ+MbTmp@-@Pp@ܼp@-@PP`.P <.Pp0Sp.p?[ sk@-@?P k@- }Pk@-@%}p kP@-"Pl.l@-0lMPQ@00 00 T  40S P U00 P L0 0 0 PACcpW' 30S ,@,@@ `IP   P `@PJ P 0S 8 a000P P02 S2 PP 00 @T p, 1 P 0 0@T a, }1P כlЍ(P 0S L@P@E B, ^1  P@7, S1T T0S -@P@&#, ?10S @P@, 11Tw 11@T 0 0P`pVu-PP)000p 00 0PhQ XP@J+Pd$OK+(F+F+AIslXlU&p-jx+gl'I2I:IDIh+,F+LF+L+$`+(Th+@F+DF+p+l+7@-Pa1 Ѝ0Q0S 1 1{Pʄ! 70 CRhA R S0T!L1P 0S4,!S hP 0S 10S 0 0G@ @ 0@0 @0 @0 @0 @0 00S 0 Ux+LF+x+l(F+^F+dF+J+l\F+F+l]z 4+0+l,+++l++* ++++pF+00S#@-0M@, <00 wP0S8'~@0Ѝ0@hF+KE-A-+00 0P Ѝ0 % @-@0S S S 0\ \ \R@ R0 RG-@P ?C&뤀   ?<& p ?7&t@` 僷QT@D0 DЍGbD s0s@T*Q!s00T% nMmG-AMMP`P>&B|R p2 h2h 㴵\2\ ͵ 0 0 0 0  0R  0 S"W ,@D` Ppᨡ0S1  㟵10S0 0SR'@@T  lT HCD1< ȠLȠ\  P0 [!1 S+凵AލЍP0S S  S0 0< ȠLȠ\ жp 0圠0CZ )Z <C0 @D,+@, ,0,,,+= n %)n+(,n0@-EM,P P8@PCEߍ0 ,PP , * % `+x0 <  X+TPݵ XC@nPnfnsn= %n3O-PM ㈓@p|弴`t`.+h#6X3X ˴UPE!<4S`00CS0' p00R0 SjP!18C8S: `&eP22l18C8S  ☴ӔU 0 0P`1 P8C8S 0 ` 0 = P\S,18C8S 0 ` 0 S 18C8S <18C8S ܵl18C8S 00p1 N RJX1P+  V ,118C8S WpG(㬕P`*<18C8S0  ЍS R   RLNP0 UA0QLLDhB ,D,= ,0,, %D,n<,+(,+n)nnp@-BMd,@P4P1 H4*1*,!: 1  ϳPP4B`1,00!0 ሡ0 0,P pӹ41 U PUP 00  0@@@P0 T0@0?o2@P0SVP%4Ѝ,,,+D%tdO&,tZ- d,,H,e t+tuV& E %<,uhV&vql-*tst=t`W Ztt'u @-<+@-@M h% \0P0 H00@10S % 10S0S@ЍP  00SY0@P峐0 00S^0S T00P0P@0 S0900 㬰{%D] +,H,D,M t A-U0S7P@@P|%0P /Q4 ` ⎁`PPeDpMHu0S+ <5 45 @,5 (5 5 R- 5+ 400000@T ,P004@Ѝ0400/S@P v v vlh,rX(r 0SQd0S ᴂp=0c 嬂sp;0c0S000S v: e 0P0R0 P T3Q |30St  l: O$\3P0S 2Q P 5 o2: @4P2  : ,P2 l!: $P2  : P2  : Px2 !:  tPX2 ,!: XP82 uu,uL <,!$ %\8Hvgt 82 k,-H,P,%\,%`,X,=L,vT,E H,vmD,E@,@-$(P( @ᜯ ᘯ㑬hV&#vHv @-0S +tT@-00CS0jp0 00S00U&+@-@#PP; +. + ,0@-M0Q@00 0p#l# 卮 ⰶP 0 @P00CS0p0 O# L#h00S0@oЍ00 0 P 0S*000+lf MU&0Aq P/P//00@-^@\P R NQ | 0\ P0\R@ @ 0$R ^ ?<,nvPP<0  dÅe"ÅP^ @?d" ef"/+<,A-|x@xPx`xp 0TS 0T `0h2Sl T 0T 0*  @{vx% %vv+0@-4M@Plⶌƌ 0<, p"lR < 0 2  8-C8 S  0"!8( 0B(0R><r> 04Ѝ0+ %@-`0S@ P"0S 0000q20\@r+vp_ 07@-l000Ph@ R R l  R  P4d03/ Ѝ0Q P %+l%Mp@-` A Q1S 0SP OAP00p000P P0 P0 x{P hh έ\V0L@L  "  \ p %+E^R vhV&%I,00@-18C8S 0P D㟪 %P,,0@- $@K0@ c0,,(,p@-BM` YP@0 S`0018C8ST01y0 ጭ0Pn00x0 BߍpB/ BR 0.00P y0001(, %0P,0, 0?o2 0/ %@-AMj!g! R c!`! b000000@00  Pڶ0 q P 0SS WS BSr0 +ܪP  Ts!0S  10S0 p@W 㝪18C8S ؀0S R     |P W 0@^S00CS00  S00 P0SW ,\m D,,+ %P,p@-PH@P@pKP P DP @ % 0/@-o/A-@PP" p00CS"Tr r r r r r r r `V PPP0 P00TA8 0S P0000 !0S0R 00 nw}wA-PA00C!SaXp `h0000CSP@t s t t t t t t `00CS`0p S X0 X 0 "S  㵬0S`00CS`0p SX0 X ! KX!㚬C0 0P0 P000 d/0"S00HA84$0 0P0 T,U&MNw.@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 wG-@|1P2 pqp =`P`OPP2 00PF 0P > V @P @0S@0S700@PP?P PPP P 0!SPy? w T,. %A-M@PP\1   ,@P `p崀  \lPu00u0ۍ0 DP 0@ 0000S >  P00 Z %w.,wp@-`@.PP 0 n=Hp(vPB@p s@-@P` mJ   R  @T|Ѝp(R( dn0PmP @OhP ,KcP D,f@xxt yt xX,0@-M@@0(@,0 0 @P Ѝ00,vx0 6oPPPP0S 00@SPz X, %D,@-閩(,ͱxX,@- @呩 勩lP  ק0P3P xmtkh m\ ħ `ЍD,xt yt xxxyf@By0@-4MP4PX 1<18C8S =Aw 0 9 0ćP 匧DR<P8 ㄧ0E, R y u;P! 71PP 㝇0(0S$4Ѝ0=R00ES} } } } } } th`\XT HިL %HyD,V&Ty.Zy_yX,xi 8eypyyy0@- (@3D,.-@-ފ0 R   ЍЍ/,-@-ΊW-@-k0 R   ЍЍ/,A-ARp`P@1T pPXN`@DO-dM@P倄0P0y0P0 0 k8p800,@(P40@0`@P p0p,0SX ,0S5TX L @@[ X  ( 0 0 ( (cದpkP T+,0o0,00娂00T񟗾8  H h Ȃ ؂  $ 0 @ d ( Q 0S0$SXV0S  dЍE3 P ( 0C,0N@@ ( QQ , 0C@( ,0u( Qh 0C@( ,0j( 0C`@( ,0bV@_ ( `F  ( 0C`@( ,0R( 0C@d( ,0JV@F @C ( Q @0C( ,0; @8 ( Q @` @0V @,T"80(3P6 <(40S!꤃  ؃ 8 R0 X (b0R040880P(i:[8 8 (b0R  $0 N  $0 P Hx8 Pß0000S(;:@SX (  P0C S,0( X@S( Pl0C,00 S( Lyyyyz, z:zUz[zqzzzzzzz {/{U{O-lM($ P߂PU`` 8@ p0  0<02 @02 @0` 00eK@P h @` {M`@0S( P @$0 lЍH?@` ^00 S @.  C< 8g0ЍC该0H%{{{ ||V&} p@-M㤥P* 0: S0 0 S P@` 000uЍp p P @TPH0000 0TB,| |1|O-]M0 M-SP0S 䄟@p<P8 00S0W0S' 0S"'디 ` HpPxh4P ]ލ ЍOv/O]ލ Ѝ w s@paW ]ލ ЍOy0: S  SQ ᒣPPDu ឣP ᗣx60v: S+k$ 0P@`=PẄ [P p  0 0!00 0Y 0S0S`-@P``NvL 0S 0` 6P V .P z{ Rh^R\pPS {Px!1Z[ d 0F?C[p`4 0S!P !000v P: v?b  0S -vĢpPvuP-Kɢ 0SĢp<b,H%qQ|`|}r||y| ||||}7}I q}U&0 R R /0@-@P0R0 APCU 0APLU aC\ACP 0^0\0R0 00@- @P@@ R!P X/IP00S D00S 80 &/"I#PM[i,A,,L%@-J'@-ՀPp@-P@~p 000/,p@-P@0-S@@p IP0Tpp0p@-@0@MS`P0 @  P@ЍpPU P>$ 壄00Px%,~R @-@P @600S@,p@-@PPp00Spp@R,A-p `P@P000 P P0 0 o@-@P P0P00S@d,@-`qdMPU> 0S; _P2 @@?T/  1`00 @ C @  I00 *S 0 000?0`?ZP10#H H>CP gdЍ~\ 0@-$M8P0S 0@E@$Ѝ0x%0 0/,0 R,A-@0QS`0@S` 0  ,0  z,@-@(=St00S h00S\00S L00S  `400S  Y0(=,B,,B,PB,TB,0P/0( P/,,0 A,0 $ <,0 7,0 2,p@-D0@0S 00S 00S  <0S <0S 8S0,=t00S  \00S L0P0(]Sp@ zDP 0SpB,,,TB,PB,B,B,/0 @- @,$00S/0 R/ B,,00SODB,0  ,0,0P@-4 P1 +P00p@0-0C0LS ``P P"0-0C0LS rvp` 0  0.S00 U`T  Ѝ0 @-@P P  P P ЍQQl0l0ѲQQH0H0 Ѝ@Q$QI MS^/p@-P4@Pp@?0S +S70+Sp@p@@-@@@    ~0 0, 00@`/%p@-pP @     <00S   4u @p  ,B,D0@-0S 00 @T@IE@0B,,@-@0 0 0@,@- Bo 00S tC0 x%i,A-PRp@ FqpADFqp MP GPp P`UX@DTUtl@8/p\Vt @W@T*U  A )n $0 0) 0 00S/ ,pp@-@ P 0s cD@p%O-`0Sp @)0   ?990 VጠY†T00S[  RP ‛@  )D`% ,P 0S  R 9  (0/// ,T O-Mट`V 0IS(,  RQ0 R005r:4) "P  2"RfpV  rq$ <$Q  $Q Q  0y# 0P {  {`  @`  0 PP 0 @@0bvyf`p{VX!SR@ 0?  0 qp1CЍ QP$0 0@R*20 R    @ @  " @@900 SP05:Pk09a 2 q4   10SO  09ϬRXV a0SGlC002\AP10SI `10SEPB H1 09 0$ 00*b4@p 09c|p  RB 0P  9 l00St0PRc0SL00S\ O ,C,tB,% ,M4B,,X `%\P,800S 900// ,@-`@0Sp <)00S000(0,0(0,0 ,p@-@0Sp Q 00h@y00p098@00sp000B(Pp 0 `% ,,)\P,G- q`V= P@;U000P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@ ,\P,@-P \00S @ T S9 (,0  ,p0@-@TI0 qp0@ @}00p ,\P,p0@-^ 9 @ 0@&)60 P@ ^@T ,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/ ,P00010 0/%7@-P R I0 00# Ѝ00R* 0@!"0@@qp Ѝ0@WA ,;0@- 00 Ѝ80098<@ q|/ 00\ / ,A-`p!PP"@f 9 @0@  P09   w!09 r`A, ,@@A-p`VY@  @ @ 0 :xP0 0p0 lT  00%x0@AA! ,,0P / ,\ -P0S0@  P2:1S0BS /O-@DQDDM`@|@0S(!U B ЍO bS9 .S8 00C S 0  ? QP @cS@U:t@0@0CS000 000C/  0?*QP @@,,[K,,p@-@P 0SP`pPQ  P@dPQVP7@Bx P0S  p P%%sA-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o21@0@ 0C^S0SXP@u0C?o2,,@-`MvxX@PPLPHPDPT 8S8c(s0S3(3(!4!!!8!! 0 -R  UR +R  >Q @n?y0:S f?q0cS .S bS S@ @0,S@pS wS0 SP,  KP 3wPz@Pv@Pr@P0 0  SxTPTP TPTP lP ^o0,<,H,T,,,܀%,'5,4]&  0/,, @- 01SP R t0 T!WP R HHw@08 0 J@"P 0,,?,H C 0S 0S 0S 0S P////// 0S# @-@PPPR0 `0aR R S R0/0 R /!0 R0S //@- @P| , 0#-?00&3?=0?0)6'?:0 ? 0? 0,9$?70 ? 0 &?*00/<!?40 ? 0 )?'0 &?*0P@\@P0 PP@@,A-P` @Pt pP `P @P  @A( @sT ˅Ӆʅp@-Pl@P XPpHPpp@U p@Pp1 O-MM`p 0@P (P0: SXsX  3WP $ y@P> xލЍ R R R00 rP@ P kPP @ dPP 0"SU T 0S0C0ʡ 6/ VP 0mS P.%%P P / 1 ,s@-@P` " 00 B0ЍpA-@<`Pp R 0S ap@$@-P`( p@0` G Ѝ,@-`@ (8R808Ѝ< 0 CS  8 0C 8,,p@-`Q@PRpP0S   $0Sp p@0S S D0V@ ` 0V, U  p@%$(0 ((((8 0 ( /,%0 ( (( 0 ( /,%C-@`p0S Ѝ @oP0S 0S 0 ( ((089P 0 PP 0,,,7@-P@@@@00S Ѝ0 7P,@-PP@X: `8 R8 R8S Ѝ 0p 8 0S08n9 80 8 00S08`9,X,@-0AM0 08S0Ѝ0S 0SP8 (0S8p0`00 0C?VRh B(08 80C 8 0 CS ڤ 0`,X,@-P@`8000 00C?UR 0 R00C8HhЍp k 0P 0d0S 00,X,s@-@8 R  0R0` (0 RP08 80 8880S Ѝp0CR80S  00Sʵ808,X,p@-p@XU N8PE``VH0 (  p8Soppp,%(080S @-/,p@-D@0S PX*8 P 0( pp,%p@-`xP@l0 R(0p0CR0R:(0 ( ip00,%7@-@m@P@P  AP Ѝ00P$ /,0S/0G-P0`Sp@U @0pP0 @@@ X P00pp @ P00 B,P R/-@-4@$P(0,0P $8  ,%7O-P0GS` 8(hS?Pp $8SDG(R008(h8! 0S0S ] Ѝ0S08R00(hjP08 0h88S 08 ЍO`0F?o2P0S `&0 S PpP0@S <  ` p l l l eP 048`048lP0480488080 SZX0488S0S S 8S0S S} 0488r04880Sl 7048g048e048048[0488S 0S S8SO0S SLLJ8SF0S SB048a04880 S80 S4US80,08)$h0V48H"3P( 圓R( B( (( WPV  YPPl;DpH80S 48PS8P Po08880X28Q W 048 D}800 QXPPUBL@b405XQ&ZY [`XZ`PX`Z X 00PJ``` P Q`*ZXP@$ 0P,,,,%,)|h pC-0 M !0@P 0 0 B R   0.S 3 `! P`4HP X7 Ѝp0 P`000C/0 !GP00,70(8R/,0$P00 /,00S/  ,d O-MⰑpW]$ 00! 0U R`PQ PoX@0QSQ0Z00z@P9 p P 0: Sp ~ P)d0 R'0 X& >@X K  0G0  x*ɻ2mmЍ"P00p,%hA,Jh 800S ,00S 00Co//,, ,p@-|PPF@T p@``mT0S S VS 7Sg@ @,p@-@0S00S 00SI8P 0p@qp  00S Rppp0P@ ^P0PL0@p<< SP@ ]%B,,,,B,$,@-4=@>4G-@ ePT0嘀0  0`0p 00ST V0 000S T28 ,$,\P,A-pP1 @0000`  (P0;0 A' 2 A0  PP    P $5X A*,Wp@-|@Pp$R0%S!S0C Sp S} $ 0C SnD  7S ESM /Sp0  00 0pp@!p@?0P S+S@ AP ~l0S0pnp0 p@Z0 00Sp p@B0!S $P [l$t00Sp$dP`p@&L00Sp7D00`Vp(\' p@4p,,,iooup@-P(0`@p@L,A-`P0@@@p0P/00,0S W HT T 00A* ~,z {,Q] p@-MA0 70000\0  b0  ]0  X0 S0  N0  I`P0S1 0 ;PU0 D<<080 Ѝp,ņ|h 1 ,@- 0@ %0PiP/,< S /@- 00@4 Ѝ!&Ȇ@-@r0 @ ,|0p@-@M@T 0S P0`P V@Ѝp`F0PS ,@-@D( 000@S 0,@-@@P@-@G-04B-0,2凋0$r0?0@Me`00S0S  A10S x0S 0S45L0P P (2oP`0S P 1_P 0SV80S! p62O80SeV|Z0SP0S[ /S TS S S U U"*8=P d2Z 0S B:1! "1,,,\P,,B,,؆L,B,%%,$>dB,B,HB,MA, ,~B,A,%8B,Xs%] ,ˇІoއ`B,,7S< iS0S P0 P P P 00K`P iV 0FcS񟗘h  < ,  < <   | (  h  x   P H  l l d   X | ,  L 8 p |   l  H ,          P                               \ 00E.U S``ydP ePeP= Q0S`Ec 0SP0@_U0b ,0Sl U U000#=U00S `J V P+U@  U !UQ0-UQ00  {@0#0P MP 0 a0CS00 0`/P  ` 00P 0Sa0@S @P000S =V!P 2,00 @0S 0|$ {-P 0S.P ,Ta0ES000,P ,0 /UPnUU0ESf( h | *U( @U6 !U[ Pq 0S US'T60S# PP pf0SLW960S 60S0 97R0<  K60S07S ;07S 00,'# |C/K10@S @0007S9 :<#0CScP A=P 0 j0S e`q0 S (0!R0*?0I$80S { n0 S h(0!R0*?0/ !R00 !ı#80S!R0Q !R0 0!ı 9 09 !R00 !ı\90S!R0)!R0 0!ı !R0*?090S 90S `0 S 08:0S y0 S 0  "n H8L!LjR00 !00<0S0 !0<00 eSd0C0<0S 0d !0<0~<1yP0rP0~i0S 0!ıT; [5 /U;0S0SPl <@ $<D ,<H  P 2;!W?P@!R0 0!ıPH &,P P !R0>>0i?Pd!R0 0!ıP& !R0>>0Q!R0 0!ı?`P,E kP ?qp X? !R0 0!ı?`P+!R0 0!ıP h?`PI P 0`0,`IP>)P 00,00 &20S?"V 40 PP U U ?V"R0 <>P|P U U +"B0 PlP U U J"10S %PXPs U U.P!0Pl`!` %(P0` !R0L1 0S<10գ?0/0 $!0 S00C00 C!R00 0S00գ?0/0 000 00iS #h0 :P00S0802Q,%] +3DB,X,,,/P B,00S/,,p@-@/!P2pO-S`MPp``@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0c80$ 0S  P R ! CR 0T@1 CU * S0SS0S0 R Q80 60P R* 0;0P   80 eP Ff [0J0C,,0   /G-pȀWY+p S@0, @PPP sZPPE0S`0S P B 0 0R R@0`>p@-`R P@ c0P @@@ 0ppM-@Mp @900PC  RT0Ѝ `? `m>P ?0? `P>P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SBCD00SCB0mS$00P#8 0 B,,,A-@P`pTd p\@Q<QPP gP @P% @@@T AT T e00SCB00SCB0!@00CQ#0 DPzdP fPP Q gR 0S 0R   R E0 iB,,,@- @ @\, @-P@,\,@ @-P@{,`,`G-(2pW pЍPP) P0`prb@P 0pqpc ểӃ? SZ c0F 0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0 00vS cS eS LP @UxS ?P @Ul 5 P @U(X0jP+,d,p@-`l@PP<J,<0SV@` `<D IP+p\, 0 \, 0 \,7@-`P@ PP 0S  P Ѝ0\,Po/@- + ЍMA-`QpP P P@P%U0P 0 P l @bT @P 6/Pbˆ҈@-~x 0pl ll0P \ \D0P P<0P@04 4 ,%$%ڈ  )2<BP1C-M0SK <10SG 010SE P` p FPUiP@Pe@ЍPЍC0  @RS dTU PE 0DSd@T 0DSP @@,, ,G-@M`0PSS003 @ R S0\R% :R R D Z lPp P0H3/0S@@ R0Ѝ< P/@-Fp S( x*aЍ00S @  h g*\0PT T O( 84qp JMA,QwG-@P` p ppp 0SR 9萟蠟V)W0 p@pW0pT: 000@R(V0 R  S 0@S0@R(V0p  S 9P0F@ @%%p@-@QP 0S R SppQ0 QA QR P/@ PRP/p@-`9 PPp@p>p@, 0@-M + x@sr  ) PP  000Ѝ0,,400S/@-$@P P@A,,@-@P  ,P/ @-p@''0@-M@'ۀP00S@)PaP DP OP AP )dP oPi;|0t00SЍ0 ᰀPP0 00qp幀00@+),‰`%DO-M$0S 0S B0S@ R u P 4X ЍL >@j Pp 00n pPPP`X1P H,P  PPpP0S P``30STPQPN ((@(!P3`00P0`0 tP0`0 4P T ( _ 0b Pk& 20SP `JP   @( YP Y |2 hd2 p 'L2p@20WF0b,2P 0S P (P11P =)&0S )/1 \ qP HlP h1 Pc_L10S Q\_ 010 (0 qp 000Sp 0 =P  R0  [ R 0 0P: l X ,,~YhB,,Mq,,C,A,,,,,%B,\P,%ŠP0@-@,00@-kP '@,NJA-`pP`VVPU@JTWlP0\P, 0 ,@-yP@0 @ , 0 , 0  ,p@-P@@P Pp@7pp@-@`P*PpVU p@T Pp PpA-@Qp`P gu^q^U1G-@䠟@P`  @PUЍp pPF^7BP ;^8p0SkЍG,@-W00S@ @y,0 R/%R %R0 sR0/@-(@0SP00,G-`dd@p00CS0 +p PP 000 P U 0D IS  O_]Np@P@- 0P;A-@>0 0Rp@`0S00 R0S@00`P0S U  P@00%%O-M@D`(p!PQ Zf`@pW*p%pP` P` X  P UpV`PC`0` 00L0@0`~Ѝ8hP ^@00%%J@-@+pFPPP Ѝ@謍@@@ L0L 0P0`S~] ᕍ@ ] Ѝ.} A-PPЍ0S `px@u@@[PP D00@ 0`&~W  }P\}|h \@-@ @A-p@`P@0S 耟P@0S0# CV* UR@ R %S0P &@# CV* WR   R %S8 P0 ^ @,,C-EMPPEߍ@ 0@qp `,|Pڬ嬐P ` P:T0S E|P @  M0SpI`P  P@,,lB,A-kX10S@GkD1 RpP? ,%@ 1P````P 0p0000 00Ā`L} \P@pW ^p[W Po0S[Ѝ ^[@,ZQ%%cz 0A-0S@`S@0P P }@p`P[@[[,@-@<P 0P o~Y@-M@P sPۍ@ ۍ1O-0S# 10SPpuP 0 `|R@0 -R` liP JP H$@ ЍP  PPC 0| J[ ` E[V @T P uX%X]{P ᲌T@@P@T 0l000@l`<P#@ᘌ0S[#Pj  "qp 00S #P ЍOl0 `F0`v40 ЍOiW ,B,L%,,lA,B,A,A,,$,@B,%A,H00S <0P/000S $0@///,B,B,,'G-pP(,`@wP"V $10S1`V``ut 00S000T T00 0+`~+00Y J*0Xs@P W ЍGd"VX V 1,A,A,,@B,O-M`NP P @/P! ЍO "qp@PV00SЍO0Ae"P00 0@bЍk"pP@PX!p 0^!qp0 @P$,,\P,A-p`!qpP@VЍA!  0@6Ѝp@-8P@0SPp`qp @,0P  P/P%0P  P/P%@-P@p@-@PptP 0S T0 0S @ 00C0]W[Wp@XW  B 0,P%,0/,A-`P$@pT'AW80@20 "0UP00040000( @0@000S 000 PPU: WW@   0P%,P/P // / /00//000////0/0/p@-@4PPP V4Pp4/O-M@ ؃d  0PsPPP0000 0 m)@P*Ѝ000 0 0a)@PT <P0000 0 O)UP@=U@T> ЍO *O-4M(0PX0@ ,0ut @P4Ѝ40SX400 ?Q)(@PPTdp00$0Dp P:J  ` V0/ C:p` P P@ȳȃ00P0v V `V@P,0S4 x3X4 @ P6P)X30pW0  0 `P20S Y Y` P P `V@Y*-P `@T_@ P0S x20S  P0 (0 S =  >&PI 20S @0   1 0R00S8 P Pd p 4ЍO V000 P0m 0PA R TA 0 Pp``y81`@P !X$0l$0@P_ V Vd@Pr P P Pl PX@Put$0O$0@P_{, 0S V V0$0$0S <@P I`0 A,,$,\P,XB,,@B,HB,B,B,7@-P@zP ,0 R  000 Ѝ0,O-`V =R+` =R-`8 s Y =R<VG +VI -VL 0 S 0=V C/o" R  R P ` 0 S;#S0BS 0R\S 000SR  `RY =PV&* P+R#)`0P=40R  0R  ӿ0R  [3` R R R000#=R00S000=S 먡+00`0 S0S  Y Y Y ` Pzd` ` P` e0S} 0Ps {L)%,!&U&.$ߌ-oT$0 RP  /,0 14/,$ 0Q/P/H&@-04 ,    00,,,,G-P匐剀,N@(NPT`ppP UOT QO  8 ! 3 DO BO @`匀,A-@4pP0`S 0P0aP ,@-@$ 0 @z,P 0 R   /B,p00S/p@-m\@#PPPpP 0S8@pPp  lB,,I@-@P00Ph0 0  ;0@-(<+(8)(4'(0%(00裐,Ő,,,,,P/0/,p@-0@00P0 0R 0.PPPPPPPPPQQPQ(H(D'@'<'Pp P0 Q00,,,,,,C-PᔁM0@Sp`Ip`ll!0 0!0S~0@ 0  @ aP00CS7  `PU7 0 Ѝ P 0-!0S @P 0R 00rq U h Q L S  {PwPxB,@B,A,B,, B,p%h%,0P$0 00S000/@B, B,xB,B,p@-L@P`0S0000p01S 0t'P,Pp@-`0 p@TX10S P@@p(1@0PSP5P/o`0P@@S  1CP0 1C%@+P 0S$000|  0p  0d  0@@PI 1CRP ,,,,,,,O-MdtC00wvP1Sy\0P1 0S T 0 S1C10q&QF 0 0000PP20SI 1SF P2!0sr R0l2ap01UPL20SDXO 1R.sr0nS`J j`0F[J 1RKЍ1S  0C# R Y1S1S  ` 0kP  00KU1 0[0 `0S5& U J& 0R 0èQ0pP 0C001萄 S rI  0,A,,lB,X,,$B,A-pP`p00S HP `P 80@0@D@ 00@TЍlB,,X,p@-P@2 02PpA-`HPp@GE$1S 0P $@@,7@-Y 0 0R  x00S U d00SX00S D00SX   ,X,(B,$B,A,,,lB,<-0 R!  ^ !0,04/,0 R 00S P@0~0/0P 0/\!4 0 / B  0/,LB,0 /,qp/G-p` @PpP 儐u U 0 0 W 00V@00CS7P P 0P@P,\P,PG-P0P`PpЀ@ 0@Dx P nV 000U00C0C0y TʌP 0 BJ 0 Q@ @D 0@DSB,\P,G-p@0@`P@0W  S #R0C00C0Ѝ -,P  j 'H 0 CpGA-0T@Pq1k`EP q 0P 10,G-1dp`0 @PPP0 rS00TD`0PT@X,,,p@-@PPp\ P0S0NIp PH&@-0P H&80P/ R/0 0S 0 /H!,00 0S/$0$ R TH!,xB,ސ,A-X@ 0S0dS 0(0,`Pp` pU`r0H!,X0QH0H 0.4 00/ 0 0!,H!,1,A-@PU  ^"04Pp4 04 R0PU R4`40 0 P ^PQ p0࠱`  0H!,O-1P0sUPP@PP0⸡p`@` V R0 SRA 0 V 0  W0PR 0*9PA `Y0 0 y W`@TP0 00 0` qp +@PPAp ` W0 0O0 0`qp @TPxB,H!,\P,P0G-cpPU !R00 RS@ U W0S P*P @P P`@V0 0 0 000 r  0@P`P`d@W 00 000 r  0@P`V@H!,\P,G-`@뀐P@p0Vs 0SP@`-P@tu TUP,G-V@P吀ጐp0`P80 @p 00  0`P 080qp꜌H!,\P,800S/,00/PP//A,A,00CS0 S0 Sh0 /O-P0-SP d   8 l)fpeP!f@P0S,@ 0R S%|@T lH~EefeAX   l 0 ЍO`P @@ D@4 0 AfHE] ,,} G-@ $P`P,$upP `~ | z J! R @yz  0Z Pp@ ;p Tt p@yv v*f80  p ] ,,C-`Gqp pqp@@PP.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P  W :,(A,A,>.Pp@-9 $P" 'P= P !srp? p^P 0 &- P& vD06 p+Pxd0`]d0 T0f&@PAP,@m006pU,:,c,(A,G-@tPp`4T#0 5T Ta0'000P0p0 3D@6T` P'0:,@-o0@-MPh@P   srЍ08!P D00 0 &,:,@-HP!sr@ 0!0 &:,@-  sr @@@6P0&6 C0606Ѝ:,,G-6@PP`j>T6k.sq 00P6 C06PU p)`CP0ЁPP  G.P :,,`B,@-P ,0 0R B ,bl0l 0@- ^ @^TSa04S '005S #,:,,00@- @P QA6R 00:,G-[X@pP PF`PDC`ACp6W @:,00S/G- M`e@唠唐pqpp6W @ Ѝ 0  PU!P P P 0 ceB,:,{0@-00mS Ѝ 00 Q >@P 0 S#  PP0P`0 S  Q0 R pV`PPp Bp00,17@-PU0P( P@ P0 Ѝ000S9@PP B^PB Ѝ0@H00S@ Ѝ0@? 0,0 09 ,,`%ۑ0 ,<07@- R ,0,@P?@ 0 Ѝ0&,@B`B,@-P M# @0.S ^00S Ѝ 00S0 0 00S000 p hcP0@  0R 000@0,0& `B,!CJ<07@- R ,0,@P?@0 Ѝ0&X,@BDB,@-P M# @0.S 00S Ѝ 0S0 0 00S000z p b>P0@  0R 000@0,0&pDB,C@-@PP  @M Ѝޒ@-@PZP  @> Ѝ0Sp@- Sp00S p@t, kl0p`P p@qpP@ 0 p@u,lA,`B,P07@- S SBl0 Ѝ0ܾXPX0@PP >A@z Ѝ0@5A00 0 &&=P/L0@-@0S 00(0 $ @A,,A,|h P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P@ Ѝ04@P,0, 0 10 &&O, &B,M0/0pB,P/VP @P/5@-@| pl5@0TxSPLHD@<8@b!&L(SRi̓$b˔@-V0dSK@S!1 CRJT" R&0CO  R  |  @P3 @.A C#Rꄚ  ̚ 4 L d  k C \0 0Ѝ10S Ѝ@00S  00S  00S  00S  00S  h00S  P00S  800S  00S  ~B,>O-`-HMN@00PP*0 S 000C S ?  000C/  0?pEpU:Y U :TЍ D0!R1@0P S 0,ST40, @0D@D1!0C 0 4,x&|&C-PM MP 0-@ ݍ ЍC` @@0Sڐp吀吐 P]B0U`@P0P NBD @ݍ Ѝ 8Ax&X4,nTc|&nMP@-  0S 0 0ЍP  R lЍX 0L H 0<040800 0000000%%~P@-M 0   0t0 @ld P 0S>000D ;0Ѝ,0P @(B,$B,P @P/ 0 /ĕ,P/00SB,0/@-@0SB,0/@-,@0S0 0q00ЍB,Օ0/@-,@0S0 0_00Ѝ B,0/400S/(00S/@-(qp@B,,P@- 00@ ^S00S00 Ѝ0N /&1p@-P0M % @!`P@@0,S  R0S 0 ,R 0p 0B0S\ 0Ѝp40@00 00( _ @A,A,?Kc\}P@-P A7 ЍRS+DSSS 0e C R ( 0 8 @ E C CS -S 1 CR 0CrS dSWS ^S0S^0wS     0  E000 0 FK N R WR Q S-00 0  ꚖA,800S ,00S 0P//\B,A,A,$0P/0 0 0C/dB,,A,@-PU  C@ Ѝp`@stpPQ 00S0\Q0S 0S@V P 00$Q00Ȗ,B,@-0 S 0,, *^ Ѝ * ^pA,@-@ 0@A,P/0S/P 0  //1 oP@- /ᬑ 0LP/pA, 0@-L   ЍpA,Ȗ@-`MP@៺0-S0p00Cp S T 00ЍU X P PTU $PT00W`O-P$M cLP 00S S03/0L0$ЍeL0 @``Pp 0 R @@-PD &$PP 0@093@!+P0P0U0 P @0+S3P <⃺<9P/P0z@ pZ#2aD[@TA7nP0S -P00 0 +P0P0P aK[  00 p @ =RP   R R tq000SPP000p00CS H ` ` ` ` 0U ?o200@S 3/TWU 0 [ 0S00S0000SL@40 S 0 _P&00S pA,A,,(R@-@PM @PU@`p0@ mPPU   c,A R  | 000CScd   RzV)00SS# P}U  U Ud0?o2R0P 2/0 RP0 VX 0 |Ѝ 0?o2RP0U U U7W0 0S00S00W 0 0S00S000ES` RU U U , 0 S0R0  b R U2/U}00SS 00S000 S000:S U000 0 ~꺗ɗ,P,s@-P`@း000C S0 ` 0 B ^ ST00T00VЍp( `}S 00 000S/P/B,A,@-XP@PL0  0S0S  0  03/$@k&A, 80S/S/ 0CS/$&O-@LQMp0S [= 0S 00 Ѝ`V/$P  0P! AAQ-P $ SQ@ S0 0 p@@OoB0 R ` 0 0S 0Wpp& @- PP0蜪&/-4M@20S4P 2      Z2 0S 104Ѝ! 0R0< $0"1 S 10S 10S1 `11S(  Z2 T!2 R (10P!0000 d R  RY 0000S P 10S 1e\ 1P 0S~ 0#Sz ,0 0S P 0 !B,B,lP,\P,!,4B,&$,&A,@-lB,@- ; Ѝ@-PX;`@@@S 0`pZ Ѝ2@-@;P <<謪C,G-` @$pP 0(S%0  P@@@0^3#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-<0?B3c/ ( 0 0 /YЍMb@B404@-@@T XP0  &C,,@-@0@&0$R/ $吼C,p@-@8P 00R:0 @0 $p&G,C,p0s@-@@d`D \0 Ѝp偼0U4@PP \P,C,,@-@@PC- `?@P!M0`p0PƟ0 0 0 eT-00EPN9Ѝ趪A-PX 0`p@ @ 05u0 P dU-  D@C9Ѝ趪O-0M` p! 00@C QaCQW@CACQ7@CT?0! ` ?0 !@PPX [ЍO-PMpP 00@C QaCQW@CACQ7@CT ?0? p ?0 ?@``P[ UЍO-PMpP 00@C QaCQW@CACQ7@CT? 00 p?0 0 @`I`P[ UЍA-0MP@PЍ%P p@0pnP# cP% dP  %PsP xP   @`0P`D@0 0 M`0P 0A-P@`pߺ<Һ` 0 $C,@- R$00S20 P00S@o p@-@ 4P0 4哹P~p@ [00SC륺hd0`m`P뙺H0@늹80@0@S(0 p@ C,0B,,&,X,,0@- 0 ЍoǪ7@-@PP Ѝ0@(0  0~ Ѝ0&p@-@P;P %@2P D800S00 QT㕴p X,,@-P1@0pS Q*㮴0 0 R 0?o2 `lB@P 6W ^@Q $㏴000 PT @P s6` Ѝ6|B,P,,@-@P `y600o/O-|MpP `@; 1 Y0 00  \0ACX 00^YP P0@ 00  `0 W" !Q0S|Ѝ@0/0S00 0 0Q P0 l0S0 0AŒ\Q0X0HR?!1P^ A A |B,/p p p@0@(0@ 00/0@,G,@0p@-P`40V0 F@ ӂ!1P@p,G,T0p@-PH0 A@!Q0a0Ӄ1B0` ֲ`Pp,G,0 0/!A,G,`0 0 P0H0@-0^@P C0/G,,<001P/0 R2:/G, 0A,0Q@-@q|0A `0L1!0sr 1!0sr  Q G,,@-`P 0R@T 0  .500@~rq 02C Ѝp,G, 0P0PP@/,0 :Q Q .Q 0?Q  \QQR/ R//A-`o@p0P; R0C @1@C" 50000G,1 p@-@DP0Ts 00CSp@[@qpp,@- 0 @ Ѝ@- 9 Ѝp@-@0PPS b0C0S| 23 0jS BS bS 00mS tS@p 0lD`B,p@-dw`P`00ST;@@nkN g,PVc`p4!G,A,\4!&C-$MV0`S@p`$Ѝ:S/ %S .S 0 pX@0S0S x?S \S0S 00@ 0X 00|xX@KXBX DXV @LH,X @ @ @ $ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @  , @ x T \ \ @ @ @ @ x @ @ @ P @ @ @ @ X PP50S4P40S 40S Yqpz P Pi P`4 iqp @Pav 8P0V{0 Pv3XI 00BH@6X? 0   H \ $  Q0R 0 oqp 0 t2P0h2h"0 \ P B B?|g긷qpG0 PP01P 10111 1v2 P  T10  0R0:P0P Pj 0P \ 0 U 0R0:0P HmSA Pc ^ PHH_ 0PG,oG,,,xB,,A,,, * 01&H0@-@@00SOoBl(0(01 0 B,A,G,&,0& 0@-P P0P0^  @$R \0 P$@R@0^ @R \ 0 @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P 200@p@-P@T `0S`0 0 p`0@0000`S @@@A-PQ@` 1 P 1 PP7`ЍPUp0W"0 S 0 @o0 0PP 1005㢯,3 ⥼2P 01P|B,P,A-p`@V0  ` \ Q(P  RPQ(SQ $0RQ? " $ \ (P Q S ^ U 0S P$RQ $2 0SP` 0 00`Q0S P \U 0SP `0 0S0Q  R \  P  RQP0  0 U A U0QPA00  @-boP/P,C-M@@8`0C`F!p/ऀP< A YЍ0 I/o"P R  ? 0 Q   Y0 ? @ P,O-$MP`T0pP@0L00SG RD L  R Q R*H)  H00@00000 0 YH  )-  0S0S @ 000 000L000`0C P$Ѝ@P,0    /P,0A-@0S 6PT(`V0(0l00Sdp@ '(`/qp ͲN@00CS(w,P,,,$1O-`wvB 1!0РS ЍO00S PА@00CS& ЍOM 0qp   0Z qV Q {랲P@ Ѝp%,h%,,p@-P@T <0@@@ @p `//@P, P,p@-PH@U p@\Qp@F(0?o2(0P,HP,p@-P@c p0$ 0P !U@pHP,O-M,070( @40pap70<0h78D @9L70S 870/S 0Ï0@{t , (0P0s007S(00(00 0,00$0 `00060(0, rs   T000S 0S$Ѝ(0S,0 00000H 0C000L0 " 400 000zy+  0Sqpyqp0S`I00 00S0 @ y50S PIUPe U 0V 1P40S 4L H^04P4U 'V4PR0 QR S P PS P400S0R0S44L0SP`rPHL0 #PPUP: 0 0`0hP0p`PL0 P* G 000 00 L0`$ L0`     h ` D0D0P$ T 0P@TX\P2. 0. P ` @ 80<T0s00040T0PU$00CS$0P20S g000 00 L0`e408 CGPPI h0S8 Z5  `J!` 0C pQ0_00 p`0S0' 0 aP0o 00 N0S0<1YPPYPUp1- -0S0$0`P0S 0S < @B X0C  BS pa obZ0Yp0Pp0X,,`B,A,A,\P,xB,A,P,A,A,B,lB,HP,A,,,p@-P@U < 0P !U0p P$@HP,p@-P@= T 0P 0 Up PS @P@HP,p@-@`PV0010S0 sr ^U00 s00 ' 0P p 0P tu !R0(P Vp00@00S 0Sp(0(0Sp p@B,p%h% P,A,P,p@-P`dU 0S0P@T0 P@|0 pP,@ƪ0 00000@Pp@,0P00P,,@-韴0PPP,O-Pг4M00040c@0P 0 X0S0  P4Ѝ0 $00 $0$0X S38 <|r utE T %2`0 p0@_  0 rs 0Z0 P @0s00P 0S/d2 0  c4 P 0P0@ P(200@_X 02X0QX`pP 0@` p P 048<00 0(00X00 00 0 P|#(sr, R0S0tP 0 'qp@P *F`ut q`pu80<V 0 s00 } V0zHPu 0 3qpm @P`p0X0P,,0@-MJP @tu 0 kЍ0@-0 ( 00S@P,A,p0p@-@嵺IP PP0 P 800S(0Sppp %P,A,@-$@$0S000R @P, P,|B,O-0,M "0Qp 0S?wyP tC 00#  dPL ,Ѝ4S0S (30S 0S(0S 0(0u0(0P+ X`@PJqp@PNر뮯@PfR00 (PlBlb0 0 0(0a0S 0S D(20SX 2``FS iX1H1X`( 0 @Pᜁut0`V$@PxAut` }810S ,10S $g@PutXZ@P 00000 0 0)@P 0S 00SJ YHSE qp QP 0S 00S1 P,3A,@B,B,,`B,R0@-$ 00000S@ \P,B,0@-$ 00000S@\ \P,B, @-80 000K00S@ \P,B,@-@P x0x0SdP@ ,\  1A-@TPP {밭&.spK Jj \0 @  `Ppn0S0S 0X 0?00]00 ,00SA㉧\P,\ ,X,,,8B,G-pl0P` 7 @ ᡻P 0S 0S S`P,A-` pP刧@ +0Up0P s*p@-HP@T<0   p 0 l)j)h)&`P,O-AM(RMK`X)V A0 0ѹ0p  P 8w0S0000AލЍ0!S   #PA>04S S S ᾦ0S  00 [Q嬦0S 0 C Q ? 0   ^R000 Q\ S$R0C 0N00P000\\ 0  C R  C0&.`P,O-pQpPpMW My@xcPJTpd3dC  \\Ls ^ PZ PUA (3T ,Zۍ ЍpPS@DT2P@  @@ 0 u+X (| Y@ }(T@"0S000P ;04P ST@ D6 Pp 0Q 1T YP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P? T00p000,`P,&U&\P,4]&d5!s.0@-@عPѹP ̹P pǹP `¹P GPG&~@-@P @P P P,@S ꗫ1O-M0S" @`0 ЍO^<Pp00 0 Ppxy@`00S 000S  0P Ѝ 70 000 { 7' 5' 0S @``P,\P,ΫxB,lB,\0@-PP R^0S @T 0 B`P,&\0@-PP R^0S @T L0 B`P,&0/`P,0/`P,00S /`P,@-QP GPGP@-0lP,//@-L@ 0p PS0PЍlP,\ QR0* /QS QQ*/0000/@-@P &000000/0S 0C0//@- 0#3P Ѝ@-@ 0PSR? P >BQ`  7H&` PЍpA-`pP@T@  A-P`"pF$@ kQP ,00(00 0dPЍFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@pR   ?PP@PT*?P #SP0s@-P00@a0C`S4   $  T        \    d  l  t  ,  PЍp  000@@0 0 0 0 0 0\/\\A-1!0 m \a[P@1!0 m[S[\_ P0^S00@@]S0QE ]Q0'S! [S \SB@[T0 T nT 00 \TpR0000S[Q.CQV 0p@]^S @p^404 0 8,mp\00b,b,ܫo D p@-0P @R RP D D <@D@ p@ @4]&b,b,f1C-Qp`Mp묁0@ `P0Y 0 0PR l1@d1`\0 l\Y R T R 0 0P@$ 0 0 [S[0[@0[S [S . C R 8" [T \[R@]S  000TT[T@  \T  \R,0 R Ѝb,b,b,k,00@-M00 M/SP $S+ +S00+ 0 0 9S#\S @P0 0 Sl0IS@P R00ۍ Ѝ00@00 S00@b,b,¬O-@T Ѝ0tS bS rS aS @{S000pW G`p 0S 0QU t0t Ppp0 kb`0V ܵP0 0#PpP,8k,b,b,O-MDD_.0 0\0.> 0k S \|.t>0 k Q   |  X  ` X l 0S 00@0000 0S 00@`0`S 0S @p#S ;S 0 p00@\ nP  P 0S| @,Sv p0S 00@P  0S  00@[VXP 0Y>P p4S u??=0p0p4S \PP kP o00\0:>Ptp0`0d 0R000d00S 00Sf W?P00  2 02e00S +ϟ+㗟 P0 e0+0+J⽟gJ?Jh! 0> P*?\PP zkD?P\e ( p$ =\0p != 0`PS(00?PX5000.t0\`0P l000S SP@ o0 l 9(00(06xb,U&yf,b,Mb,ز².@-@P AeP@-@@AP 2ep@-@PPp 0 &e@-@P`PP  0k+p0 c+ Ѝj,@-M Q qM`0S000@03 0@̳0S dz  0d 0 0S S ` 0l.?@P *0 > Pj0 00ڍЍj,b,b,2.@-P@  0S|d \0`p `  O80P S w dЍЀj,0G-pA嘁0 0`PU , R:(,=00( &U# \U   0 R`Z &R\R`P , R:(,00(P    "pr P qu PE ,  R:(,00(   >  0j,4]&A-@P p0R`*W0 0  0P P O-0㸿OM00PЍ080?PU 0PH0 \ R0S40P0\0 P R 0SQ0A 0QES0=0C>S|< + + + + + + / + + 40 d0 + + + + + 04 + 4 + + + + + + + + + + + + + + + + . 9 ,/ / + + 0 P0 0 + + 0 + 3 + `4 45 5 5 9 + + 9 : : + 9 S S4 0PS0@o0P0  Q Q*S  H S 0Q sh0 R 0R0 0R0S0H0[0S 4 0j0 P^S0@oPL0 R: L ` 0pn00)0800400S<;8 00 [4 00&<0S  H0SSP80S4PU 0`  EᾣP0800A E4 ח0T P 0  004 0 0  0:00z040 0H:HR <00s, 0P 0S d0S 0( <P2S 0 H` 0S0`V: b$ 00@ t9@50S 0sP 0Qb H0$P x0 0H$0ѯ$0 S8`0V:-$S P`000 00C 00l0P `80 R:P`80 Q `S p 70 P   R: ` 7B7` 3<'1 01S:` 007 |<0 S0`(78 00 tg4 00 <0S  _P80800 OP80Sf4 00<0S  80S0p4  Hሢ`P <000F400<0`4 0Ǡ<0S  V 0400<058 00 V4 00㯠<0S  `L0 R: L !` 0pP00pY R  Q $5 0?a4000  ~P 04`Z Z 0Z 000 G 00 00 Vt4Z  0Q\ <0 0 t  PQ8 p0V `XDcH0p0<H<p(0000S s4 00<0S  p PB"000Q 0 0  0p V0`0  `0P  ~ P\   p V0S` 0  PX80S0s "8p0 z`04 0b840P0 Z8P 0S 00Pn80S0sp!pj8p 4 0=840P 68Po P R00`<pL0p<R80SO4XL  0`Rl0&004 0V@*000b,j,k,pR,b,, > > 4? > 0  _0 0 00 00 00:S 0S0S W00 000 0V 0S`: P 000BS qlk,0p@-P@T P ƨP1 0S-? $@ ? @ \@ x@ @@ 0 00C?o2S Ppt0 0S00X0 0S00<0 0S00 0 0S00@lk, d-0@- MMP6@P X ^ 6p8^+ 6 P6ۍЍ0MH0  BR R RV9 /U&hV&@00CS0 S0 / <9U&@-(Aˡ0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@itl,1@-01\ @T P#Oo\B@T P P P QQ R P\ \ P P Q R   i-tl,0@-  `Ğ\ @ T\    %R    tl, i-A-pA0 5S$\! R  (P A@<0S 0 0<夢`p娀P0U00S 000\P _P H ㊢08 0儢P6S i-l,A hV&l,+p@-@0`  Lh4T  g7th pdPPT p (P000ST @U&hV&tk,ȳs@-@P 僟P?@P @0?SP@P` Ṭp Ѝp/ߩP@RP 0S S U@ꝫ0S00\a س@-m 63hV&0@-@<TQ T00 60001S R0Slp@TX` T@0$P@ 46T(8  0@6tl,MZahV& i-ht}@-# 63IhV&7@-@P8  ᯕ0S 0@T *00 Ѝ0$0"S p`@-@F P  p 1\Ѝ萵p@-<0XPP%0ATp "0R   DS" @D-Ap&0 0p2#L @ "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L "L /0 0p2#L "L /0S00//00//H0H 0p@-@P@!R0 U0 ,0P01p|,,01//00/00/00/00/00/ 0  /, 0  /,F 00/00/00/00/ᖸ00/ 00/@-@D4,00/@-@6\, 0  /4, 0  /4, 0  /4,/00/00/00/00/#00/+00/400/A00/K00/U00/g00/t00/00/~00/ቶ00/00/v 00/00/Z 00/F 00/ᓶsO/g b @-0  0Ѝ@- @+@-,r$5 0S04c@- +@-,k @-0Y,\, @-\,((5 0S04c@-\,  @-蜶 @-01,4, M@-3, @-2, ((5 0S04c@-y4, < @-p,< @-g, < C@-^4,< @-V,  @-M,  q@-D<, e@-<, e@-4, e@-,h, @-$,  @-Z,  @-, @- 0,, @-, @-,  C@-4, @-, $0Qa @-, @-@DpP d 0' o 0@- 0|1o|,p@- P' dP% <P  SuP 5P 0CP  @@PV 400C`F V$P P P0S t400C`_}l1SS !0C B/?!1E^xP00 S11W?zP`PxP@a@1S4020/C(PZ( @@Py } @} 0@S} x ~ x { x y x y x x x x x @} x x x x } P3P$0CP?P* <P >P P10!1 NSPN0Q^ B 88C8 P P?@ "0C S񟗉 y y { L} { y mYvPq P1asE P w||1S'ʰ1 dE P wm|P 00P1 RE40S 3/ h PPP h P,ЍPR0h ^ 0Sp0W 0[ 3/pU P `"E P rw g `(|g00x00A<0 b02P 00P000b|gl,JfPhV&c-RS4]&c-(0]& 001/l,P0 R0//l,O-PP$p`*@ [ !  0P@ Ѝ000 1\$<0*P0 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @l,UP/D0 R/0@-A1 P Ig< @śl,O-0Bp K'W i0 00p0厄 Ѝ`440S 0S pP  Y000 @  S" S00 50S ipP  Y Y 0 0 0! R @ S0 0 JpP  Y0S  Y00000 00` S 0PSHP P0SPP'p0 002p0S -pt ?C S mYPU  l0X!0C0S;3PP0 PEZYl,4]& @VUUUO-$MHZS  R0P 0L`DpFA :0Y0 0S 0g o7i̕뤳`Pooo0@@0@ 0000. 0ESET 0 D 0T00Ө?0S0 CR C0D S0  0wioX 2 :i0  B凃=W P0{ P>  PN P P!VUA`E D@DP`4h h h@`"PD P AP;  JR !   ` D00@0!P1 `V0p00@  d`\z`F`FV0p00@  DPEƁ@DU`E¨` Y @ ᭆ @T`— R    BJX00000S 000 0 0狆$ЍOg0Y S l,4G Q=4]&hV&A-`PlPp `n@n@0T `P@ P >P0000l,@-@Pp 0%0T0* O$p@Ѝp0 00Rt` 0 0 @6K$@t 4P  T(&l,@h0p@-P@XP0Ps H` R :ոP 0S@@Q@puT(&l,@-@!B0000l,0Qll,0ell,-@-@00o  Ѝ@ Ѝ/-@-00 ` Ѝ Ѝ/-@-  } ЍЍ/@-@@M@-@M@-pMP@`,0 0(/ 00 0`Ѝ@- ЍoO-M P`@pm@mUkT0 0`P 0 $D0SPZ 0SW L00SSDȓPPL00PTP^y@DO@W :p XPRWpV`KЦo`0 S`K0 r@PD0@ O=PT0 0P00L00D H0T OAZ  s dVxddЍD 00R00S 0S gL0X#3pysP 0 ps똰GGff A?0 EG{r``PGG`eel,Hc-@-,, ($ *Ѝo@-`$0P@ 0 > 00 0`Ѝp@- Ѝo@-pMP@`,0 0x(! 00 0`Ѝ@- Ѝo-@-00a   2Ѝ Ѝ/op@-Pl@lpl,@-!7@- @ՌH#OB$eZPU % $ P00h@PU o%T s$ P00000S$$ Ѝ0 ,* `,+ m,hV&+ O-AM@@m$PP4q@ & @I$@! ᅯ@Pࠟ   POAߍ`V W 3u`PX Y  ] =R@U8@ `Ӄ.hV&6!5+ 1@-pO-0MM 0p@ᴃ`P2 ԈPP* P tP 0S0 0   f c HPPtP 0 Q0 0PۍЍ0P 0 >0  0= :+ |h ,00S/ 0P M@- d,,X@-׋P H"P <D"KAb(^"Pq@|h A-@M S@徖00{U%P,  Ⲗu0S#|P  X0Sl Y0] )PeuB@PaD'D*nB^&(ЍP@R?P ( P(20S mAP'.Ap0 $!P>r $ X$P 0)AT NPP AP p``PP 0q+Q S0p 6&V`T(pA`T-@p0T-:W@qQ  R@4Q p0Q  R@YAPQ`003/P 00  h0S  R l 10!84@5AP,|,T,M@-MM+@(@+(B+(7B+({@PލЍBr@P `0 @@@@@ @@@@.*'B(O?/ |Q L-MM+ P+ ˁ+ +0Á @@P  1?ۍЍ/ |Q 0@-M g1@@@"#P @! P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$*AP3BP/[P+W@P'AP# 0P} f=}  0S 0_ Z(P @P4o0m-&!)*00,|,b/ / c-c-@-M 0@@@T?y#P* <@  P 00*!R00$Q 5*@P  q0S 0` 'P%(8*Ѝ,|,O-`M  0 0X#*0S ` 0 SS 0np0 S00C `@_0S :ǐPP @B pQ %S0S iSc %S, dS E0T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@  T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0RQ\P0S  S t00@Qb0cR^0  3/PW Ѝ 0 C4]&7@- @PU f! L00 Ѝ0llt P \ N!L  چ%( (0[(`,+ / / / / I Qp@-P @0@0S   $0p@ 8 0@`,2 ,7@- @cPU !  垆K00 Ѝ0 PP |  分d00S L L0[ꃔ0 , ,* 0/ / \,ޑI 0 hV&s@-`4Q@;k[Y8| aexMaet ae7e?a;8|g 0Am@PxxZC7́P oB!B`` /{Ѝpc-MhV&)0 O--{MpP`ᲈ0 p E 0S  P R  0S p hP ΅XP Ʌ$xp@T Pe! T0B? 0QP-P "J@P " J00x嬎Ph姎P; P  D; e;0S a;&P ];  !H00J{3"0{ߍ3c 3 ,0z"!03`ˋ1,0ʋ D0,0,L0 L  0pP,00z?"!!0 P#  f PL  YP U $ ld2P ll;D0S hPU KL nP0 T 0  SR FD1P 1 V 0I2 iz?0YC0P0SP @ 0V 0R0SQ ӻ姄0S9 $ P_5zu  PS 2 d,,2&ptbtt0 f@ ,`,1 w0  "0 ,0 U0 c0 0 ,D0 0 0 0@-0,M 000000 00P0 00h0 PPP@P DDr@0Q ,l,Ѝ0@!, 02&hV&0 , -O-iMps?!0{WP 00iߍOЍ/lx@PX1P L!L00+@P jZ` PPW0FSV030#Z0S 0W0"H!` #P Pp0W0HU80P , 00<`,P],. ,p8!1 1 -O-0MT@pX   p$p0 `V\  @M'U` PP<P@P BH E0# PU 0'SP0U*S/ ᪏P | [ 0@ 0 0H0 Á1P1Z ~ .z4p`PUQT( 2S022SP0220C2   S`` Kx$00 0( 0 0p|W  @0   (PU d4cd0U 6 A^W 0X0C?o20S ]wb$]bex@0Uk]]x00CS0000FHT0U  [$0S  rC8UXhxi 0%S @SJ B B*∏D00 {/00L 0.RP 0 0ċPH00Zp@P 0A0 \ 093 4Q8hUnx00X (#S1d@p0U d[xz  0UX ~al]bHxnrT PPW  yWK0ЍO Ѝ/-1 I1 ^1 /P ht@c-U&,a1 0@-CMlb6PP 0S .Q倀@P8 s{Cߍ0 Pl{ m,n,G-p 夀夐PB`A@T:00Z W ,/Z 000 LP EQ 0 Z@h1 4]&A-`Pp p@ ᨎ4 p!{ P9@o,A-Pto@pt p {0S DQ0Q.SEP @$ $z zm,m n,@-M4 0PDP x z 0PDP j z 'p@ ( E z FPU)p@ l`lp z @Q)PPЍ mz iz`!iq,%i0q,o,8i(Dq,TO-M4d0 @&zT400偈0 ,40P,   -8 4d0w=C $ CTrP, .͟ 0Q(<P 00 0( 0uPPPPP8<@`,0tD0D, Dq,v `<J /  0>0pa Xvy ᅉPP\  P;PU 1sS 1lS;"000 _P p@ v ! H lH QpXKX[X{01D+0~0 UP PP KP FP AP <P 7P0:4: @p A*o0p HA0xp H0St:t*10ll SOP 0H0H0A xp 0 AP<PH , $U  @_PPP@;@P- ,y)0x])0wXֈP\8 0\8UXLy0 yFT. 0)0z? ;⽈@PEPS,PN X0 )\6SE p0 =@P: f5 %"xp [7S' X H DpD47(@ P (0AAP\XP@Ps:4S 0 zP '0APGxyP 6T'd0b@Pal\8D'08\80WP8 Jx8( L}'8P00P8 8x8 :}&8P0060S\80\8P8 x80S h&8P8 x8 }P000S\80\82P0S\80\8P@sT %0}J\8%0|B5T$A Q0:$R$ Q9ğP \8şWt^H4   :ᅪ4SP 0@?S @P w4{ 0Q0:$R##\ğR#$R#W%HR3$$   (Ts0S1 `P 2@T UWQHH#00S "0S @# ~C3S3 TE 8"DC?00N?C0C ,>$P0  0@F0@PdEpP$A?p@x0a80CP,0@,P pr[0S ,n ~$X >0S@0 <X+4AS< ". 0 0S DLD\$W5S !(o0 0S $,<$X}Xzm,1 ,1 hV&1 X1 1 P2&4]&D uo,,s1 o1 |h iNq,w1 O'3 03 /P 2 x8!o,I -2 5 >n,q,Mr,"2 ps,03 ;2 c2 g2 d2 2 2 2 2 2 2 2 2 3 2 73 R3 "3 3 dr,A4 ,4 K5 kr,0q,P5 5 5 $q,R 6 6 96 V6 s6 ~6 tu,6 6 6 6 7 /7 M7 6 P 01/x8!oC-鿏MP@(p1P3S0 0` 0`:0 00`@00`n0/0 0P 0P/S/00 0 /S 0/0 P0% R $b@ ` @0/ߍ' g7 n7 v7 @-pCM`x@܅PlP#d0RXPP @ W<00040 `(PCߍ' o7 ,,7  \,@-@ @,@-0  0 P @0@ h28 0/P  Ѝ, ,`,Q 00@-@XMP0  0@ P x0x t0E>2l@P/Q  0 LL 12 /R@0 @0(Ѝ0m,, ,,,Q T,-MM[PHP  eu au0 00SލЍ`0` `TPP0  0@ e00 `4,>,,T,,Z,7 8,7 @-CMRX6S AP \8lP XT20S HQ2\6S 8L2424"0(2 r`P\8. x^10 eb:4S ![X\@10 O:4!SO *00 0 BDtAttL2@P) x1d 7X4P1@.0S 0!0'(!(#0S   @qP\6S  V i@S{Cߍ 0 Bm,m 7 , 6 3 o,7 o,8 8 7 eNq,8 2 $q, 8 018 <8 d2 g2 n,V8 q,n8 ir8 kr,8 8 8 "8 @- @T^ S C @TR00S0\\ @B_TQ00 "#0  @ ! 0  @  0  @\RQ @  Q  G-phM@P 0S'hЍ0 L03/P 0`  Q 1/P P p08℠0:/P 0 083/ 0\ P0//!01000/ 00#0//O-`$MPA@T # pፃP00 @0S 0S0S$ЍP P00 S yS, R ,0S R : 8 80R:P#3///@-@M MPp! *0 `p Wd5\\ SS=S 8 d3R 40 c$0 ^ڍ ЍTT9 9 @-`QM p@ ᣟP PP PЍPTP t01@$PU@@T @D 0 @3P9 F 9 n0O-Pp0 '"M@pPP ԐԠ`W0 R PЍ 0L03/P  0놁0    @$0S P @r @r`,9 p@-P`o00S@ 0p@*20@-!Qp0ML0` 3/P< 0t@T 4/@0p0 ƀ 0 0@$0S  @Or$0 @JrT d @Dr @@r@Ԁ0S0C@ ,$@ }*Ѝ,9 /P 4G %0M0S/p@-@PH 0000p@O-p|M@P Y0P,0+`,P|Ѝ ` 0S0 !X V 0S0H L03/P X0p``P , 10000U00 0P100 0<0008 0LpP ,0<<0@D"@0S P 0@  !D00 0S0 !Z Q 0S0H L0 43/4P X0 0 0  @-Y P 0P 0Pp PQ` QX{PQH "P <080P/,/(//8!8Vp@-Q4@P0@@DPp 4Ppx2&p@-P@P  \q $q00pp0@- 2&@-y 2&G-@MPP N/幄 3q0 0 0S1 0S XP a7-P ލ߅0S ۅ0S1S P P @l0 1h0$1d0(1`0,1>1S nP >8%0>`@`Ԡp( \pZ$  a g$0J_Y 4 P 3SG Plt + '00@? Ԁp䐍0GP 0S0)#0C?o27 #3RR  0R6p7P 'S0HpA(\ C~ QJ NhP XP L P ,04! @<#d p~2P  @000@"0Z0N?P0'SpH0AR 0 B Q  > 00B,04! 㐀@<# !0pJ  } yKR t00K?(0811$1~0 1p00 @0Eo`YG_FPE~P 0000!^9PP 00S 3/pO003/No-P4~P (S(""+"n b+bn`}P@``VB& aV>+"rn+bmn3\QQ0QUh $P 00S 3/p $QUY 0` p `` pb.x;8/0  ``px`".;6/0S3   .n ^n0 0uq倁們`PU" b ,`P  T^dP"+"nb+ "`P ~P# ~P }P }P }P }P VxT m  m` ,P; |h (9!,|,S 8U%: Tk,T`M>; TL): 00A-p$0p@` PAP0 >@ p C 01/@P00pЍpP@00003/003/$Am.: O-UMMPdh.(@4P,.z(Q_ x[G8j V`V`$Z^  UݍЍT  n? 00 70 0P0@0Pύxz#Pp40,Z^4S =07h400C27\4=1 V =V?h400C26\4=1 0 000000000 00plp` ( >0440X40s -1yv0 00 0000 0 0z_p` 0440640s -1ଔV4 `v00/ nlE "lX5@[^ =2,XL=1Pp0Nόfp h \ h$v00?00,Z000Ӧ?%N?/&"@LdT`( Z4@0S N?/$"84@pW(4 0}10  A l "l l4!0p 1$,01( L!!>,H48 C6$ 1^(1)04 $,10 (q ,148qHL$!R  p} \ z^x# @p#P0"$1H00 4;$ Bx2P p>{\ {U $100$10H0 0 0:0G80<;80Sp Pr $003/$`{PM `qQ! >,!  c6$H(@GS  GPn<PK "<ISG 0.$10B04!8C0(1}1S0}1$1S `4@@,c-U&D ZM2&|,,0,,o ,v: _PP$030/0@o//BO- M@MPA E0*!Rp0)Q`U0 $0   P y Pp ,Y*"(0$0 i |$(pP d4\,P ܍Ѝ<4p vn0Spp0 @0 4p0SW00_ , R\  000;x8,9/PI0  ,x8;;/0  ,x8;9/T0S8S0CS񟗕    L        Sn "Se S P0~  R{ <pWv  &P d0S T"8 H8  8Rd0S ("8 \0S  " 8^`0S ! 8TX0S! S! 80L0@ \Q\0S ` R !8 x8 ͖lQlhǖ`Q`\TQTP⻖HQHX @1R<0Q0},P00P0)0YP0 U @' 'pPv 0Q  c|,; F f); |h `W : y B; H; : W; ^; e; ? l; : ; ; : A ; : ; ; ; ; ; ; : : ; : ,O-MUM08*aV"e&m'@&| teX pW &0\0  T #Q 0ŧލЍ ; )qWd ^P FP!' P % @ P @pH圴` XBT0SYl d \ 0S 8$D 0P000P F0hP14s10#5:$ T&R&P&0S K&I& D5.p Fy0PAZ@DPC@  pm `5V T  `80p  P 0 0 ,0ST0 S00 P0p800SS40 0  0 ;x8:/P00400ST0(ll S S t h D D D D D ` , Sc  SV  0 <0x<0PPL!@  PP ,0$ 40 ( P 3 ~ ,1XP$ xP 0005S04+^h 14  t0 S r0 iq%а 0İ 0|,< V#< ,<< W< s< o< "P,= = = = = > 0> 6> <> E> L> 2 < ; 52|h ; ; ; ; ; < < < `= A F ; < 4= = Y= ; O-AM@ MTXXp P` $@P`T $P```PP@Aލ Ѝԃ"̓C̳ @"3(4@$80 "DP@T@@<X P ` "430(308 8@4"2020Y P  s"딢娂  8@4p20d"d2@DDAT P2P"PP:z$P @2 8&PI,2,  *20)ATp !0 UP'!W%0 Z@0S #P 0Sx H04@ 0000@;x8 8/P6  %P !%@P 0  |x @%%0 /p@3W:/p*@09!U> ; 8Ud> F av> > > > > m۶> D9!> ,< |,M`W o.bV@-0`M2 pR !,^RЍ04P0 @ PP@4 xp8;7/P  PBtv,tx,(0@- @"!P(@tv,@-$@2S 02tv,O- t@P@B``P@   gPP@ -u0Ec#ะ@pPU* ЍI WP  WP BI@    R0S 3p4]&8U@-@00 ^P Q P 0 iЍ C-JMM bpPy 8y@4PTbH*PhP8b Yo`GFWI  7vP 0000 !00P < 8<1P <08 <@XNo<0S0 0< 8`PX 40,0"1 010100 0A000@00 t@@@@r,O@0S8 0S(8JݍЍATP 08`$!QQ@0RT<0P 0 003/@<08 S 0S(0S 0S8(0S003/@<08 S@,8 (4& 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@4M`pP0S4Ѝ0 0L03/P 00@ 0pP180/C-`M0MPp PPp@x; 9/PލЍ0A. PPxP;5/P A> ^o"? 0@o/b 0!!/x|,10/up@-@4P0 `1e1111px|,O-P䐟䠟䰟@p`0/ C !  !0  Px00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 Ѝx|,4"    0@-MP@/.ax1, 00 0d000 0X0@@@@@10 00@0 ,Peߍ0 x|,O-P4M`@p 0SpVP pPp 0S00W0#S 4Ѝ0L0 3/pPP0 L03/P+ { 0 Q{ 0S  yd0 0P  P 0 0H  , R  T  X $ \ ( ` p, 4@8Td A- 0R0 DQHa@ 1QRpB   !LAPAP#0` AN0Q     TTAU @@x|, R? O-p\BMX1SL2X\1S,2\X1S \QUЍ0C`1`1Sc`[r1SP \1 XX1! 0`1V$ 1x C H0C 0hP 0 S 0.S  c6p `Z!XP SaX`00 0f"X4w\P \!*w000: SX1x 2 \1` 0$ 0 X1 ` SX10 2 ( e Scx|,X4& w},T * ` |h p@-MMPkPoۍЍpP`@+bc P*t+(c P*+"c P*P-P$[|h p@-&Mrn@i(TK`P7 i< 00x|q P (U7(V ij_D @P ލpa[? b\,P9!5C @- `@01SP@0S01S0  x|,  O-M@NP! c0  0븢p`Y  pP 0 07P0SߍP W%0]PkrP0 a0CS0S p `Vp08Sڠ0S' R$ S\0 0 a00>  vp 0h1U0ſ0 0s0ZD+ p t`p S0P![h!R( 00@P(O  00O0 0S*?0 !C P0  00t00 00S 0xV<a0 p? `W d@edA},? x|,M C-H1 @1 R0  (A(h9&Q   R 0<1LPDTPapH3pLP /pU `1DP1 )pU `1TP1 #pUP1 `1p808 Up!p@ ЍC/ S9!X9!x|,y9!oR? @-M@  P @oЍ@-| 0S pP`0 X00T T0PL008 80<, Ѝ Ѝ,? 8,4,Q A ,,T,@-Ml@p9t)0 0 0T00.00 0 p $0t !Ѝx|,9!p@-L=4P@ ?%p@:? -?@-@P  l R4 '(0@"Ѝ0@ Ѝ/? ? @-0  0D P L0L D@D @08!( @0 Ѝ,, ,Q ,T,-3M MX GP0  4pP po3ݍ Ѝ|h #-3M M FP3ݍ Ѝ|h 0@-M0  0 0S@Ѝ0h0h h@PX0 PPP00L L0PD@00, ,0P,,<,@ 8,,4,?@ A ,,T,@-0  0 P <0< 0440000 0$Ѝ4,A@ ,,,T,( 00!S/ /},( 00 S/ /},, 00S0 10 1/},x|,11<0@ Q !@-0 " !/x|,0 10 1/x|,@-Mi/.s, 0lh6 0X 00000@0 ^,@:ߍ\4& x|,H 0D /Q/QQ Q/x|,\4&@-@0 0 0@._PЍH@ @- @0S008,\@ 0@-AMlhP N@ _  P<04Px9/d0Aߍ0s@ x|,o@ @ ,P@-@ 0P  Ѝ`,-@-  Ѝ Ѝ/-@-0XX0@P (D  K+ Ѝ@Ѝ/0@ @ 2 -@-0XX0@P D  ,+ Ѝ@Ѝ/0@ @ 2 @ @ 8@-P P P A A A @-@mP@ nPo@-@0nP 0 P s 4,,\,@-@0nP 0 P s ,T,`,QA-@@1@#PP1P#T|p|` QaP (B(Ab!!@@887[A4[c-\,7@-@/0P @s 0 Ѝ0BA hV&)A 0@-EM2@DP ^ cP0000U (0($x:@Eߍ0,x|,1 Z@-Mt^pA ^ P^lH10?k `P$ a@,ЍB 9! B A-`pPk@P!p fPP 6/ApO-@ M$a`P Ѝp0P 0`%0VSS TP$a-@-0 0Ѝ Ѝ/\ -@-0 0Ѝ Ѝ/ᄌ A-`PMMp`'P pJpu@@ F*V ,(($$cp & 0Su 0CS2PJuS0 ) 0j 0S8 0S r0S 0S QN@|@P$ d0 T0 @nD2P{ 00b0C?o2 7墏006G(10SލЍ!7SkP1Q! F?pF@8oh!H1P<0  0M( ' 0S q0Sv 0Sr 0So QN@P 0 v0 @PYF? Q. QNFHnRB qaB }B pB ,oB B ,<,B Q C ls,X4&m' 7 oB Z,,B H I -MM P  P hۍЍC -MM P  P SۍЍ)C s@-_P' P[P E%Pr0S 6 |6 6 6 PoH` @AP Qp@TT#Ѝpm AC x0|+R/ @-d|+\0XT0PL0HD0@~<08z40x|,\C ,dC ,nC ,H,Z ,,P@-@ '0@=W\,p@-@M L(@H@Tn0 #H ,00,0@@&8h,Pp0: S HjP  Z Z܍p,+n 8'nQ @P@PڨaD <PT81!l|8<hDQiX1 08808PP oQ P00S ny<  R t00 00000 000lp@ m(s(0tQ!4,,,T,, xC 9!'B  ,8,,D O-CM00qSP `@h0!`.60S`PW!000 @ @3/@P CߍW! 000Z 0SX 0 @T W  00 0  0S l00S `  P0W0 ! !  000,,7 ,C C MC ,C x|,7@-PQ0@ SS 8`0 000] Ѝ02S  D D |h O-pUM((0 4Q W l#ß0/SCP3c܃C00P/UE_# 0SPPWC1 lEd  PPP$ 0RP iP )a^ 0 10S 0S7 0 1S30S kP`F %p2p0  H0L0  H0L0  H0L0  H0L0  H0L0 h H0L0  P H0L0@ 8 H0L0U lЍC !SH000050PpG0  d 9/0 00(0J08,`^ < c 0 X,,o G G G L K L n 'G n ` -G 0G 7G >G GG NG ZG bG jG oG _ C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``D0 0pp07/@-M0@0 3/P 0 004000 %003/ލ@-`,MHP P@0 0 0PP@00 RS THP pW `P00P00P0,Ѝ @T@0/W/0  0PH P00P04]&0@-$M@D0X  0P 00 00,0PLH0Dd$Ѝ0-G G-%(Mp@PW V\a `XPPO`DK0,` SS0 Q "S `P  P !X$U0%$U ` 0 b0 0000 0 0000% 0MyPPT(ЍPM 9!xG l:!G L 40C-S,MP80S,ЍS S S !S S @P p萟``?`X 0 e000  00000 0 00 0 0M`P]T:!N da xN O-P(AM@0pP U ! `<#0!(p<#UP <fP |O00 P \P >O0T00POX!@I 0 0 p `@AB:x  Q * Bq Bq BQ B B  0`Ȱ 0@` X@@p0 0,(00 @@@@@ p@@`PqUߍ pv'0N `∀pDK j008*b0A-@0<0SH04 `pPZ\V09R\?V090VP:0 A!r0S/A-@P0\03/0 0    `0V R!  B B" G10C+Rp0 !"P! 0 `pPP !@` B"G00080000$0 01P0100A4\w qO-OM@P H(`a1fV@@D`删 VT00C00 0[0 V 0C$ 0,0,pP5Oߍş[@dşP @T00C0p0NC2 VH0 0$ 0RԴ V 08L0X T3/P10 00H03/ T 0 0000 3/P#%#t&0 080x 3/0Plp _X̍ 0 0|30x300 07000F00, $@ m01 SH0 V p .4t1`X0 PP00P0003/088q0X 0L03/l 0 , t T x X h H  0T`X 006/P `0d Q 10  0!s"D  V p0 BvFD!2 B"lF1ᴡ0C100C0 #_ `V`s`V T00 03/P0 0D 2#4`0Z5 =P0a 0` 0d0 D p 00C-FD!2 B"#F10C10 0?o2100C0- !V ,:!:!`^ @;!(W Q A-Pp`a!@0P  p0Q pEp a^`P !@ B"E L^T0 01`0(`10q0000Up 0S/ LP0 05/00P 8p<  @  0P4L p P $ Q:  BS:Aߍ L`0 (06/(0Pf 8< b @_0`4 V  V  R U  U  RE ,A0  ( X( 0P X ( p,$ ( ,0P 0 pP`[p0  eX 0P@^Xp`LP` Pp `P@>0` O-0AM@,X,H O-`4M0@\0P3/0 X ĀX p ppP(W 0Y2 2Z  "00 "  !" 01 " X "  !"0  0" " "  !" 00CCW 2"(\0E0 0l20h20d2 0J000 0H0P<1,pp@12(x(4Ѝ嗓)08q P ,0bY,0PZH D00]0Y 0P P`%0,00嘽0P8 @ 0S[00S[ ZP qP00S`(0,(00V,000 0i3/`p ,q\w H_ g uO 1H ;!lG R d r<,|h @-@P0XP/[P0S0|h O-pMCO TtUl4{ 00 rs= 8b0  * 0m P  0@0 B )R R:PR Q0r Q0CFS0TR000US00Ѝ@0  9PT00U00X@0 \%D1R4 !8R0 !R, R-RH T00U0(V@ P9P 0R 0R [X T00U00} [XxT00U 000/SS<;!p,X,pH s,oT8 T,D, 8T`,|h O-0MSأ@pЍ`  4W @000PS8 cSG MS  0 mS  sS. gSR  0FV 0S cS !MS @MSCS GS W+0C?o20S 000 00SSSR mS @ R O-OM M<00(00 P08 @0 (0PP0@D0t0P P,0 0H03/800<00 0!6 0R 0 , 03/ 0`` S04 H&P408&XU\a`0$040&00000$0o,`p`0pH0LWX0h05R0p0l_h % `Vp SVh `U TNh PUHh VU 00,0 TPs0.씟+)0`080PS<0dP0O>0=C0H0 8<0hU$xSU 0S T0 Ps0 000H0P0 F0VPT0S xVP 0S40Q00`Q0S 0 L0aA3/P 0P P  2/``dF  pBX!ZP0?UUP(0 Z [ Q PD @0    SD0 R8X#' a`0"$0$000,000$0%$0t Hy 0Tx 0 \o0  0T` 0$a F0TȐ 0 W0l01h 0Lt0hp-H+EF+ AF R Z*pV 0 TrU 00d0 Tr08 TrT0P0($00 Q030#Q0S $0A,0"PH yp 0(P &A00P3/` 0``APQ1V P(0 [ J Z C8V@0 !pPP FЍ0$ DH p,p@-@P4Sp@Tp$ U@Pp+Dpp,I G-px`DTP RPP@8 0 4PP$0R04p,I A-TP4SAp`4 4 @0B  B Dp,A-@4Sxp04TU TU T`040 ο0 4ƿp,I p@-@P 0p@bMp@-@P& @5op*I    @-o@-o@-o 0P/p,0@-PM 0 xPP & 0PP @HDڝP0ԝP0Ѝ0@c;!^I kI ,@-&@GA-A0J?`V=p$X"0 UPPЍ >p C 01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a|,K$0pQ@-sk[ #"T R0//s@-(@T@ЍpH0P0 w{003/@P?//@-tM`P Q@0 p@@#P  30@Tp@tЍT0 @T0x p0p d p K`P P @,I |h I I ,I I I ,I I /@-N @ I 8 ///@-0@Q sɺ@o?0 \ 0P000@-4MP0 SX0@T O 0    @ 0-4Ѝ0O@0ꄴ,//G-pᐐP@`VT0S0S PP$1H0PUO0 X xO0 `p@I ,0SR00/p@-@PJN<0<`P" 6D0# A@$!p,X,A-`8P@OpP( ? Aꈴ,@-ö@-p@-@M @bS0p E0S YPPL00`V 44 0( ܍pc4,J ,J JJ 1G-`1MP@11P!!  xxaxaut@Pl7TnPhT嫿P 0[㮹ߍ BkB?M VOpP0=SBM ?q@B?`@F P 9 BPt@5 t P \0 FD F:9@  .I WJ ,MlJ eJ sJ 1A-P1@-dp11PT T T`T`  P D ^E 00c ,:9J J J J J @-M00200p00`0P08@P k@T 1\ 1T1O/1 P1O/1 Ѝs RJ ;$0 @- KP ls,C-`CM P@ `PR9P pܐ܀0` 0`0S1O/1 Cߍ5S  Lp pPX \\oX0S D 81, 14, K 3,,4K EK TK yK K M;ƸJp@-P@1 1  p,1p@-P`UP@Q0  p@|K p@-P@ᢸrP $^11P N/ pK V1p@-@P|1(1 FP1 1 pK V@-w@6K C-aM@.pQT[B嬂rP`U U.Q20P$0 _PZ l"0(@80UPW H",PU , _L$ 0.,P@VLPKл1PL0P P110PU)!,A`pPp0S7 S1  @QQ 0 0`P@Pd1`娷 PVP aߍ@\(!0:UPS!0,0ꄻN?P0@9 jD9   & 0F 0 0 p000  մ@ᱱ <& ,,,K ,L L =9:3,4,,,5K ML c-c-x 8 KA-P$p+a@P-@T   帼P( 0 ˿ P 0 mC P M@ oЍW``{X V< 0㠿L  ,L sM M L M 9M iM h//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/,O-4MpZ$ (%t,@P @ PR000f 000V0 0J  0V @P 0J@TPT0@P0 0 00000 0 T0$000R0#02S4Ѝ; 0 0 0S  R# S   @ 0  00PV@00V @P 0vJ@TPT0@P RK RH RE (  , ZQ R Z5 TT  Z! 0 S0 0@PV00V @P 07J@TPT0 0@PT00@PT Q Q0   ,0@-4MP!! 0 P P P@4Ѝ0@/@-@ Ӿ@誹M p@-P@/NP `@ HK0P P `Ra BQQ pQQ 0@S:p @-Hn0RH #@-;0@-@P4M0S!1PP Q*  P +U 0@S Q 0S4Ѝ0,p@-0@ ^T00PUPU' \$ST (p 2@Q^U@.P@ @$ $ 0 00C 0p0 M ~p@-,@PN0P ;pA-@d`dPp㌀0S\T 0@P"Rp@P;!, 00S@- /Ḵ,0,C-ẋ(pX,P0`@$ 0АYĐY T  T: X0WaU U VP P 0U Ѝ :V0  M M ? ? @-@P 0  M{@xYl q$p6# S0 D P`;#S0Dp0 d00`0\ h0x00X6 P$`P`t0(08 Hm000 00 00p; MC-`BEM0SP;0p rB0SkB0S| dB0S ]B0SHܭVB0S0խOB0SkέHB0S00$ R!000 V F 3nF&> 0!C> f`20 010@0`omP,,O MO-MP崬0@尬0` P(" `b0  0000 @p!@䡟000 @!币P0g0p@~ D@p@ pld\@@Xn  H!0 <e  $!`0[! 0p0 R  22 P.2Ѝ 0p!>0i `s ` 2OT 0p-0@0 NR S3#:`@0oX,,G lq,O P P ,,P 0A-@\0`3/ pW@@P@PĮP< 0DW  \-W0 U    ! 0  0 1    x  "l , 000SJCT T0T TTQD0B@@ rq,q 8 u 1P =!yeP s@-@,`P夯01ЍpP,0p@-(M0P,03/`Y0@ S:000 00 0 0 0 p` ɥ0A06m(Ѝp0 \ O-@-MP4,PЍ rpP 0p r@ @< D PZ0H03/0S@`H@`A0 0`P |" 0 Q"l2 2h"I0C 0 0 000 0A 0 0 0$储^ͨ0S]("0P L0 3/P X0P@T`@\0`0 S8㰭P\ 80S ,0 0, S001z40P ∡0L0 3/0 0P0@T`4  C- pQ<0PE (0EM00@S 0CSEߍh08 3/``0d8 9/0 0(00 ``笫80 pp07/@-@8q@M! !j@Ѝ0 L03/P @-@8q0M!  V0| 1/ 0 0S 0 S 00Ѝ0 L03/P @- DM0@ P 0p` 0ST1 T @@âO0D W 0S90ߩ0@۩ 0i&0 L03/P 0 $ R @R ! ! `W0巩0@峩 0T?@DЍ 3/P 00S@ 3/@-,M╩P`㑩$$Pp@P   $  p `PPT000,ЍI P C-D MP@C`0@`|0&PP\  @0H03/10 0PTY00x0p`HB@00403/ 0\@!D1p ` 0R 0  003/P< #$#%0 000000 060 00 0yp`@Oᾦ0S @, 0H03/p,U@:@0 0S08C801Ѝ=&|,, @-@80q0  003/P1 04ЍP2 0@-@0GM00@3/PP$0SP  .`p0 000 `0p0S 00@03/PPPGߍ/A-xM@`D 4 BP0l00$pp0Ph<@P3 tP ZB0h$0\ \,T „P 0X*08 L03/1 0 10100 060 00 0帥pP<xЍ 0⊢0p0S 0h 0Q*08 @,04/P,qP 0n00 0?o201=& X>& 0O-@-lM0$3/0H03/20PqTW0pZzP`U 0!0 0 ` pP0 0(3/P`Z LxA"##$0 40R ! H 3/080 L3/p? 08 L03/PP8 0 R5 `#1//L"P#0X 80T3/L0 083/p 0倰$0Y 0㙮.8($  pP `;/P PlЍ|,5O-P0MS J?0SYU 0SX5X%XX?`VL H%@T dL0u0%> $% % F   0 0  qd 00巤p`;@=0弤8 @,502p/`$0`4V 4!0 `N 40000 f0,0 pu0$10 0$10\\0d00h0@ 0l0`p@00S<p0  PÁt ,l3 000000 000 0  080p>p` .3d,0ფl0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV 0P2Q jЍ#P00SZ 3/@@OoBS f00&0r 1@0@!Rx!@!x@|@pPpt@塠t0S|0X*@DP PQ 0!@x 0T:x0S@ t@OoBv@|0xT:@|,P =!eP ,P, Ro08 , ,< up   ,P >SO-[?UM00H48@< ` D 宨P ᩨpP۩ Uߍឨ0P P40,Q̩3, 080S 0R@ <0S6(1SL 0L ,HLAP4#0C4  H@4#; $夥㡥 @0P€P> @T 2"B 40P 0S 3/P,00,02, 0SU@`PD`D@t w T2Rl Y0N eH@``(HD! @<#P`T@NP ` 9@ 9,9,00 0000ަ @ᱪ 9   , 妪 9, 坪900P1:1!= @0 000000 00000 0vp` DPD0U4 Q[T Y 4v ᧢`ۨ,,oP L noP =!eP O-JM M/0`@0PP+*P) ~0S% zt"`0`r`!`/=0P T  0CT *0C/Q 00P|?@m+* P:q??0  P+0: S `Vb?>00ꨰ  PJ>0@0/S- 0+ {* S dP+ o* P*P 0/S`0oo`bS 8p80&000 SV|+* P*+* P*_P ?@]?@]XJލ Ѝm Q I |h @-B[*@-M @P(0  &@P  P 2Ѝ.0S:$c(#"c  8#8S O-M` )PPp X㼠弰`p /P}'Ѝ0S @ 9P 0 5VpLDP Xp $0 @ͬ奧Q Q  Q G-Mx `P`P PP<y+)@P@m  0ᠬ@ @P:+J)3J.0レ++Jv)$J.X0tTX mPP~D4 dPPu$(+JV)J.0TPPe+JF) J?` =PPN+㈁刑PJ,)hp0 0J>BP 0. P UT &ލrP@Y+J)JqPPpJ.@0+( P h lJ>PR Q %Q 0Q 6Q @Q LQ Q uQ Q Q Q < Q Q Q >&Q ++Q VQ _Q H iQ /00/00/00/00/0@-4M@0#|0$P 06P` P0T0670 P} CP @(m4Ѝ0,X,h,O-MA Ad2(000PB(0 0000= 80s#0(0`p[05 06%500%`x0$0 0$0S000`5_`@ @`|@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0 SW`vp p 0 T$`0$00  0 0 0#ѡ400 0`00P00 0L$0Sr D Ҫ3 D0Sa @Z%S[eP*%0C?o2 00;0, 0H03/$0, S`pH0LC +0V   05 X00;000P0 pX00  00 (00P 0 00 0S r(0 8DQ0v1;0H0$0L01 0,!<10$00H , `,7, P 0Q00000S p, 7, P0,0 [wR0,4  74 P Y p00p,0Y08p,B YP P 0,00000;0(\cQ  k,00Z,QovR X,vI 4]&|,D |h C-pQ|MW0PSSp` 000 P  "  4" 0@T0 S>T2x@X"&(@@@,0S:0匠,"(0PP@  00+0@080s=0 0( T hW|Ѝ#f!@&(00\1 04`!00 XT忴@!0(P R P@@ =!0 0 h0 @3 0400t0S00XT喴00P0 P@| 0(O@h @8q 3/P,}R gR R G vR R R 0@-)@MN0 p\*3 +@,P 0-*ٟP t&-ҟ F 0.ȟ0  0Ѝ0!0P8q0 S+P ,㭟P %za ,X,>!R , A- @"(0M39( x0PQ2d2 5  L! H! D!, 1 0 8!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FA(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp00>!lO-p4@`00Y)Z]p !!:PV 0p  0 P 08Q 0S  #%00,0 84p $0T0 0X05p0 P,[.[ P Q  040 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$PP `tPP $0 Sz22@|x 1 0100 0A00000@lӘlByx0SS(ᓡPPL p0(P嚡!1P刡0PA x 0R`( b ",0x  By 7 7 0 8Ph l崾,0( 040x0?o21000Ѝ0ၾ~|,4 uO-pᨁ娡,M@0 S000 /00 ^0S,Ѝ/S  "/00P`pU1(`P p㘁!PP PP%0(` 1`{7 w70400,00 `T00X08`庢0100& 3P 0_0庝 P᭡`,WO-p\M@P4 `儰>70 SpU 0 Q$0S   $ pEP9\ЍO|*.]7" P: 0pR  ,`VT` V 0 0 9 %`00000Y3(0S` ` 0 RH03/0p``0[   80s pȟ0PP00@0  BR0S0SP 0[p08 r  *   * U0'0U " [P R 0S  041 PP p00 . P 0$ PU$p0p[0 ^[np0 PUp[h0[( _!P$: p00 00$0 0 $0 0S 0X 0XZ 0 0P pZ$0 0 S)20 0S  00 00#0 P.S 0UPpС0Z 3@ D Z0)  Z$ RRp 0S  S0 0Q0000 00000000 \Ѝp  0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S ^P 0 0 , 0R0S00`R  1P` 1P 0 Q ``T R T  R X `( 0Sl0( L03/P <00S D0SS000(( rTL0( 3/P 80<00S (0, S004 Q 0( `O20PP0Z0[ U0s P 0$p$ PUp0 80sd0 : 0  U0 W[p㐁! 0 QQ 80s 0  00UPpp0  R 0S  0x/ @p0  0  .,P>!|,,@!|h D O-@-M`,p0 40PVY pĝpPT Pp0Z:`PU`J6ERUA 6&t300#h R 0  80s0`F`pHU p 4h0S 00  80spHY pPp 4h0 0l0L03/, 00Y:pPp夞p0j0P80l5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0.PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr틟8`0[:8`ppWp < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0H.`V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/v8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0  - V00 400Pm۶R @!]R ,! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe 웟000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$ - W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`p 0R04$( $ R( 0  0H3/P* $ %P 0 0X 0T80,3/00T00X \ $ ` ( Sd ,  ,0S} P0 P  R0P0u000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80sb 00_ Q Z 0 SW 0 SL0  3/P@D0 RP RP0{0 80X T,3/00T00X0 0\0$0`0(0d0,0 0Sc 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQCPp`,0 0UB:8ě  0$ $0S  p p0 R\p{`P p0i"P0R[p Z[ Yl:PpW 00U0#S~ p`Ѝ茀 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0P0000 80sp 8Hp0!8p 40X 00 0S 0P*` p 180s0 L0 3/P 0400H0,8 00,0+$0T00X0pPq 00 80sh p 0Php@-@P(MJ~(0S(`,`V000P0 F0 0PP` p P(UP,(ٚ(P(Ѝp000',喔(͚0,`(Pc-R h,O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1S<1@1X\>ACl70(0Sp, H<#0@ 0 '8  '0 0 W &%, Z0V80000,  0 ݿ0H0C80000  0'׿X垖040H0H0P00T0(0P X0L/W0 000850p0  %  %  P%,  (P 0 %<  5 000000 000 00T0]pp M85P,03ᢓXpW) 0GSC0.>( CP$ 00S H @3/Wv@DpH L0] YZX03/ 0 05@0 L03/P 00S 0SpW+ WP+0pH03/ 0! P7/P%$%$)@0 Q1\YK @1003/Q  01/ 0S 2"-$Є  0;P  0 Hp0  @D@儀 0X80X> 6Pnゕ?m,0S +pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P~ 000|,,op4088,TdtDup |h "S A!R z@-} 04M@Pp`#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-`Yp@P 0< #80 s#  002 -  0 S R( 0S%  吁( R Q0 2-T 0  < {+800r"000S   Pv$ 1 SR8C801/Ḹ,0! /Ḹ,$1p@-S@ x1SP $003/p@x1ߗP$1 0SO-KMM@040`DpPH(00S >I @d- 0o- 0<0%"P{ 娻 K@T8p0 00U 0 00000@00 ,@@@@0ppK܍Ѝ(Y(0S*o< !8 ;c&@@D u-O-M0M,0p1`h@0pP 0S (0 S> 9 H -00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000 00廐p`ލЍ,⑍,0S*< !, 00B"X R00C0C0000S0 0,0A$P길,D u-@-@,0  !<$10(10,1P001.@-@,0 0! 0O-,MTPPT`0p R ,Ѝ "P9 @@5/ᤕP`K t,` V`G2 j, "0  00 0(0 00 *`uᬖ0,ЍO/@[;p@-@Q-l@@@@@@P囒 0  P㔒40 Pl厒<0d p@PP兒80 P<,0 Py00 p'7S )AS *+p@-PBMH`@h ~ VAAAB(B\BBBBBCDClCPQ0 }PH sBߍp`=00PS70`240Pl`,80S80P8 8 X0S0!V@ 0 P\0 `0S @@ `d0Ph0Sڰ 0@l0Sڈ &@|p0SH @P`ۑt0P^9KS :US ;=>?aS kS AnBCE@-PAMH`@  V(DDDDDD`qK0 @00S    8`V@坑 0 #P啑0 Aߍ(0St  ¶@d,0SL  Ḷ@@00S0  ᮶@ ^/P /KS n12kS 3@-0AMP@0Q*E FFFFFG G8GS q0`N f . 0S (0S  $  ,`VH dAߍ4/ q0`N B  0S (0S    ,`VP$0 ;P 0 P0 Pp0 P\0 PH0 P 0 /P 4G MoS    60S O-@MV M<Pn 0 0x R#` R0^嬵嬅Dpad80  @Q D0 Pə  ęPD L   }`V8p00(0S%ŵ$Bl00,0S$⸵$B_0000Sڤ$⫵$BR0+ 0 t0B/゙PDdpὠx 00 0; Q <0 Sn0y0!$僵 B*0#0 0=,0Sn0y0s B0# 00;8Q30#b B 0x#0 0=<0Sn0y0R B( K 0 R $#C B 0 R "5 B0x 7#0= 0Sڴ"% Bx 00 0=$0St" B0 00=(0S<" B0x 7#0=00S" Bx 00 0=40S! B0 00=80Sڈ!մ B|0x 7#0;! H!ƴ Bm0000B/㠘pWxX0 0  @8 PQ+< 0 \x S0L@T܍ Ѝ/,,wvS S S S S S S S S k,.H S 3 PJ S T T T T T #T -T C-`RGM8 C"U0S1 `F` f됣0p⇞ 0S Z V`,pYV o$ <M4`a '00"  `Mߍ@N 0  0S  ' `pV 9 0  1 PSN0  T' 0  0S @0S@ ߍGC<0040!00D@0Fo$ 0DL03/00 Fppqr0S !0*PD` 0S  p8` V0a0 x Q0W 8 < RFO    0 /@-@嵍 0  e R0W| 0  ZT kT (S@mU /P -G vT &M|T T wT .O @-x @ '+0 @0p0xd=@ _T @-@ @ '000(0,0000cd(@ JꐯT p@-`TQJM0@s@!   0床1S:UV4VVVV዇Jߍp0@ 00 @@0偎P(@0 (`0 0(0000 0n(EP(E4P,@,P0@00>&u5n67p@-0QPM,0$0`s@|!  ( 0Y$1 SIWWWWWDXPX\XhXtX1 $ #PЍp0 , ,0S$0P@0 00 000000 00EP0E@!^HP@@P@8P @00>&u, nO-`D00H0$1PL00P00 0000T0 D000S D 00 D0P 2"b `0"   "40}/ 0 S` 0C 1ġWߍ,,T ,,0, 8Q ,HA!\A!,,A!gqPv  0" 80" 00$! 0 0D080W0X L03/Pp 0SWht0S 0_SLʚ  l"0 2  0 00` p80 KG-0ĠĐ(MpP@0T 0^ ^ 0S 0 @֭`P aV@(Ѝ@z ,C-4M@T2P!`pPP 0TL0 3/P  Q000T0SX0`pS@, XT $0Sb S H H0S004Ѝ0CS@D&7#"4,30S/O-@SMP 0p#00i\⑮`P HH t@3P ( m  㛮  000 咮Ꮾ,pP0S* XZ'0 tPP Tq 0 x0.0I1P/S X(⒌0(0 00i0SvU (# 0S `Pp 㶏00!15:% p ⪏P q Q 0, ($! p h$ 㖏P^0 0 8a4Q101T/,,,Q o.V |h Q U U 0S@0@-S@00 0S/,4"O-0زEM 02@PT PP0 2P |1S$ $P| 003/P `2P X l@Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 pPP2@0S- $P* 0 x0D 0Ѝ0 0  00 0 0 0  00 0 0  0  00 0 0000 00000d00` `0`길,|, , W 4,>VhHE,\>[m^, UdU8CT,TY89(A@-PM@L d`P(<2P0S% , nP2 00 BP P< "0 4 0!P⧩ N ЍH0S10S-  DPP'a000C R  R41"$0  000P0xp8` 7/0!0 00P`0p] U00S-  P'000AC, ^ ^! 0P^ X^ ,0SP\ $0@ ">S,4"t,!W ,", : ,P,.W A-0M$AT@ Q 0P`p@0 L03/P 0 @p$ 0S0ЍQ@#*11P0\  R&1p1pWpR\-l1h1^0\@@T @ TC @pW@dpW5V8 0# @  R @ RD RV @  @H00\ PTTXV , # P 00S, 00S,P8 <0P8 ,t,,P,,,\0p@-T00P PDPPp0AS@  1SAA0,|,,0@-P$4M0@L0 3/P T  0P  0S4Ѝ0R20^@ ^T 0S",p0\ Q0/\P  ^U Q0000@-,O-GM0M40d2@`TL2 00V 0 0000000@@@@ h0,p@c<  P G܍Ѝ$1SpA08 L03/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 x0`@W 47 4|4 VL0G, <0," B,uD ,0@-DMP@S P08 @\0 D@  d  60 0DЍ00S길,0@-@DMP. P0, P\0 P  T  0 R X  0S0000000 0DЍ000S길,p@-@Q@M`P<|@P  T0 0SP@Ѝp@軅0@00 D0U@Ѝp踸,17@-@SWH`܄8Ph Ѝ0!{P4PP<<0P0<0P0<0}P0<04PuP<0 S, 0<0jP<0 S@  0"{080#{0,0${00000#4+@-@PD x , t 0 p 4 l 08 U,0<    0 0x` 6/Ѝp@IЍpUv A@-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P 0 $傯<  <Uo 0$PP0 |! |Ѝ0|,a80@-S`4M@Pc00 0P 003/00$1U Ut  4ЍS0  000 0xp 7/( (0ȉ ? GLW "? p@-00MPQ0@$ 00x` 6/< 㩉`Px1~x1a1S0C€10ЍpVW p@-@<P _P $ ㎉Pp0S@}p LP {Pp0S 4! B! 7P  fPp0Sp 'P R P0 R< MPpp4"hW "xW W 1W W O-uM M4p Z-H0cS_ C0SSyB0S ƂPBؒ0SyȲB0Sy2 P    P 2     PT2 LH   @  Pb00002 @@K @xP@ PHPP< ,Hh@ ,D@/1 0101010R0 0K000PP0  }p@  PAyE} 0S10$1S 10 0Suݍ Ѝ3P`H,Pj%Pi1S |!R ェP >&,,P,,,,t,,,4,,,,T,:N:|,,@-@700S @PK,W @-@PЍp$QU0 "`P > PP C 01/P ,00 H$L Q>|,80S 0 @-/ A!m W G-`ᔐ唠@PX0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`8 @ XT P $Qj$00S U  0|1 08Ѝp$P qP P Q ᝺ P ] ᥭ $P 길,A-M|8 PU`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `pXDD2 08 8/PD> 0!! `7# 0 3/P"0#"#0 03/p 0` L03/J⢬ ,p` 0SWp`?`B414!440<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv v  0|1 0@$A! A! W ,G-`RMXr@ PP` PP` `UP P7 ( 5p q0S  ߍ<08 H(00,0 0000400!4 04$0D0(0P )zWZ   pTp p*d oXo 8 ` 8_U ,U U U U 0,0U0 {U  ᰢp 0`?`a8SPb   00*P*00G + 0* Ćd@edAۆzd@a1F*=RA-PMPp`;@ Ჹp@P  0P6PU00 ## ݍ /O-{[ JH!I[ @-1` QP@1`qdQ@p@-@pP0S0ST 0DSTPS$D  p# @0pܸ,,08S^,/,-p@- @ 0(  P0R0PS 00Si ppC-NMMP<Ѐ@` u$0  ` P`PḎ000 ;6@PD pNލЍ蠍 }pX ydG-xM` ✐堠@pKP! !0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZL   YZ( ( ,[ `I! I[ `W S %; O-`BMMp@P/0w; @喥0P0p X@;$  ok P) z BލЍZjP (0  h   Tk0/SX l0H, l!14"So[ 1 SR 1S  RS1S1Sr`2p?B冯@0Q 0 STS "0SO[@!kpPI P 04 8 < QR@ Q  A R !Q Q Q "r " 0FШ100 " "ko@ U01U01VMKURXA- 0MHL`Pp t1t!ttPj@PP0ЍT00ᙨ 0R`0 !?020 20*02p004 pk 0PS" $0Q00 L03/P Q P0Q    R D0QR003/Z tI!I[ >,P/A-uo\vwR2UR@C0B0Eҁ@0$H#8@ 0A- @ P^U0PP 8^ @T kgP ` ` `b` ` p Sp`" 2 `q`!~``Pa :k00`U08qRP08}/ ^Q 0S`P82S01111111110 8m2~/P/<`0Xh40S0Sp  P p2S222=040WP 2SX/[ O-bM M Q 00P $00/;㑣0P0`bލ Ѝ$ jp `|y?00@ V,(Z 2S 1S,2,",,30@0 Ḁἰ        0S@!? U㪋p㊤ < (-iP^bV巊T&PRQ 0 op k W p!p'q ?p? @\p X W p!p'q?p0?g@P%  0epJ  h?WU E ,( ph"j?W U `d@ I!I[ Us@-RU0 @u`d0T `Š P";0H0I`04 oЍp[ I! I[ \ @-@ ^ @ T@@@ Pp` TPPVPU Sx   D L"4 0"8 0.4 0.80@0 0",<< . 0,,O-P@pdM04005Q 0} Q Xg QP8B0^  RW* ,50'D0Q   R0RS }υ0^ @^TX 0SQQY WpdЍb004@F@  0@TT0@ 0@4P SI 0`P P\ X 0`VBT@`00T40^21 SR8080<0 0Q"80 0<0$0 0,0q?Ⲡr?020 2S 01 (, (0 PO W2m`!R   R" 2S SP 2qrⰠs?0 Ȍ \ 00 0 0\ 0W<2?h "QR 0S2"C02#38^0WN dJ,0 (S$ 0 802o0 <04pP6 @0 Ē2Z02H[ 1P[ 0~h (0L0S 1P0S`10T80< q?r0 8Z o0 ^Q  Rp0 ~/O ` 0( R 0C0#80,\ N\  I!TI[ XI!lO-@|MHX0(S S|ЍS S7 ( [8(D S0} @(00$0,,QT@0S4000(S$0000Q 00S 0[SX770QP"~, 4š $(( (00) 00P0U00( 000$00 00 U00040 080408 0,000, S 0 08B4X6wu? v?( $R BT@200r/q?`0sh 00(` 0R   T R,0S0u0<0$f<0pP=X50~;\0o_P"0H```V PV @g0( 8  u@0o/O @0S U SQ0-  T 000 0/ !o/ S㴲< $ 0 Z,0S00@P0PT0S@0 P P0Qb0@SP0 0HL R   ?  ?/Z[d0P @10`d ἐ 09/0P@\Ѝn|,G-p0@PH8L041\`  S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/|,>00@-M 410@810!`0 P00 0Lu`0 H0PU ! 5/ƸЍ0|,4D @- I@ ]@-@  0xqo] hV&@-@@0s,00p *d0Co?&0--?$M0 0  Ʉ$Ѝ-4M0 00 000P4ЍO-p-KMD UL " C|4 0`p0 `V0 R`V"R0*` ğ p$T0S 0s 0SKߍ0S P (e30SP #)ӄP#S 07Ⴏ{0 A (T# A(e{{:?dSd 0ᴄ 3 3R - BPP   BRڒ "B (" e"2ᕄPŸ 0 R#3SPjSt0100(0 \"ez0 PP 0 0SZP=9 =:rk{1 AP09 A k Q 5 P;!%#3\Q0  d 0!(0 eT!8(1@P0& d( SP P*!0"%+0!V6  @0S(0d @0 0(p Y@.A0-0-0-0-P.0-M0-e0-QoI!eeeee,0-0-@~ ee-P 0P 0 A D0 A k{I{7{zWm0P x  ἃ`>f@<^(0<pP3 0ᧃ@  ᡃ@-G@rC@SRG-@  9700pP ąH`P:X:00X 0uP3m @-Pp@`P0S -S :S S 000`  0 P00 ЍU0S T  sdP4]&p@-@P"p  `@.U700@pp@-P 4` p@  P@p@-M@ Wp$ ЍG-`p@T2 P  P0IPE PP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M p 3ݍ Ѝ|h p@-P R`@0 @ ɂ0 00S  UPE P3Ѝpp@-P@@@ׂp9PppA-@Pp p` j 0W0 |0WxX Uh0X`0 P  0P 0h`ЍU0 P 0 꿁oMc^ ^ _ m @-`0tM0FP?o2p @p Kp1u@~p h2S2p L0V#4 - tЍ膂h"_p0 p@-@ 0 S " 0PUPUp@`0S   0 0S ``0S   0 0S ``A-pM@PU `0S@PE7  0Pk00ZۍXa700S @ Q@BPE@C000  pL/E0S A0#S @UX J! _ 2_ D_ @-MP @  bp8 lۍP   K!`1p@-0SM@` @@>  <P  0 !   p0 S 09S 0Ѝp0 S   000 00P0 PS l0@  pDL  Ѝp@ pP_ !K!5K!l_ v_ p@-@$`Pm]Pp0 @ `P0 002 0pSp@-PxM@`  j0 0p@) p'  p! p  p  P P0  < p,4IxЍpE BJK!P_ v_ 0 0 s@->@P`Mp @t0  p``X0 :p <0@  p Ѝp<ZK!v_ ,p@-@PqP 6 c01pP`qpJ# P0#1pp@-pM0 p @ 5p4@pЍQG-M700ۍ f  Y ` @V ~@pP`@-`R00 Ѝ@PTp ]@P  Q*@ 0S0S0 S   0 0S0 S*]P ` ^^0ST  y 00000 0` @@0P ; @-@Q@ hK!L1p@-S@T1S#d1S.RU9lRUppbV:lX^lbp1CS^L10CL1L1PSK^0P11CE^T10CT1T1XS=^0X11C7^d10Cd1d1hS/^0h12,P0C2bV!^bp2,P0Cp27@-@0 PP" H1 0D1=80-@@ CB Ѝ0@d Ѝ0Q@-@    b~P p 00` Ѝ@ Q @40 pЍ@ ЍP_ K!#v_ Q@-@    }P p 00w Ѝ@ 1S70|]>[P| 01 @40K pЍ@V ЍP_ K!&v_ t0@-M0@Q0$-+pB Ѝ  K!_ 081/@-@d'P0S  P 0800L0S S@'_ _ hyp!@-RM@ Qtp0  Ѝfp1S_ 0@-800@@sA P@-@p t10cSt14 Ѝ@R @0d  Ѝ_ `&Q7@-@  ,, _ B}p  P?} Ѝ0@- P 11P,|1@ R  | 'AQP |`00CS`0X @X0 |p 0< Ѝ0@ X0 X Ѝ0P_ K!V&U&#v_ p@-PD|pp@00X @}pP p@|1 _ p@-P@ `8 0x8 , >U\& 0 0 008 , 81pp@ _ _ p@-`<1P:<1x1S0p0@Tp 0S    0@-@T 0S @C-`P+.H0$:0@0   10 &000 0sH00,PQ 0a(!"4a4# 00 >Q & |Pp W  g080_P040 Ѝ 0b"!4b4#@- @T0800* HP  : HP%p@-8A > R **X K 0S .@0 S   000x1  @  0SP P0 0'0 S   0[b rb L!{b b C-MM0000"@0xp@00F܁P+ wP`apQ v?07S ;0 S W l0 0\!`1 1 `Px1 (ލЍ PpP  R쀟쐟PU $Wxx x  0 S   x0 pP 0 Px1p  P  0S 0q0 PL!b b b 54Q@-@  ll+p07S@Y0 S 0VS0S@P_ L!A-`R@M@p PP U70 h0d@ЍA"QP6>pW<@Ѝ"WP->pW PU>P; P"R!>pW-U  *P 0S( <0 *-  2 <0# |) 0S h0 !r 0S>0 P 0SV>P  *@ЍAHL!2;c Xc c O-@p$M`(PIP  BP 00A $ЍOj3Py .P000 pp XSP    00pGpG 00 ZppIV4$pp pp B]#3ps 81 18100x1Z*  uPx1C 81181kP NP  6Pp4PpUPpP xP nP p 0S 00 P  YY p 000 0SZ81181$Ѝ P  YY p 00`` ^00T0 :0G [W0 00x1 Z R& ` @NP `[` @H0 0 0`0  WB W W 0S 0`0 7 0S [ xx0P 0S [{0x ruc c c c c c dO& N!c @->@T( "44p P`0"@"44 0W yVL L0 b"!4b4# 0@> *>0@D Ѝ耼p1p@-SMP"!` P%@P T 0p1!V T 0S X\{ORP Dt@tAtЍpp>0S ]0x1@T l1S S  @>0S@ F`l1S   {0 @ P 0 @  B00.$p ,*l1S Rk fk M@M!k k k k 0 R/ 1/0-/A-@P 1 !  SXp0 RqP 0`0S 000S \ \QP0 S   000S00@00P10 paU0 l IM!Gl Hl 0P@-p0p ppxq 00P R0   U l YM!l p@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M`@Pt (0x`p`FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLY@10!<`41V(@p 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@P@P0S 0S0 @@ l lM!l el ʚ;vl @-@^00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@,p0 000"#l ЍMb@Bp@-P(0 hPUPUR PU PTP,PP@PP4PP4\pQ@ l M!l P 0 )@->0PT0/ l M!l P0 @-/0T0/ l M!l //P@-(0( ((@008< D0 l M!l @-,MP` 10U@0$00 0@p000 0<0S nrp,Ѝ8010C>S>00@( ( 03(00@000 0<0S80  p @I l M!Yl @-XP@P sp#R@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/q Pp S  0QPU `0 P  S   p0 #r00C0HQ0HPLPU0 P(P0P0V00 S   0Q0 S ,  0Q0 S 4  0Q@-@@QC-@PM bȂpT0SY 00C01@0S D3/2" (PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0SH- L0 S* ?P% HLH R 0|S0       @@U 0 HO0SPp0S} `Ѝ\ P RUk Yh T0e0S 0S   PE  \P 03/0- l M!l @-8 0X(@ 5p@ t@ЍhV&A-M`M4Psp r0 qp@ p@ۍЍ4F P ڣ# "P  RP@@#C 4,0 @4   R?&hV&-@-  Ѝ Ѝ/@-MMP`@u0 p qR  0gpۍЍ2-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  j ЍЍ/-@-  ЍЍ/-@-  T ЍЍ/-@-  ЍЍ/-@-  > ЍЍ/0/?& 0p/SR?&p@-MMt *pp P@;00 dSV 00@ۍЍp P0 4Od?&M0/?&@-@ @#R4 @R?&p@-@`Pl;T k4 P P   RT V00pp?&hV&Q@-@P:c@%@O@-q@ o01p o01@!>qp@-MP@` ,  0X ,qp 1@ R! (0 p`Ѝpii$0 /L0s P/0 #:60#//A-XM>PU;V0P0XЍU2700p@ `R0 PU B0>00 0<0  ,> }!PP> * l @-@T?@Q/c@-@T?@0P/ R R /0G-`P M0(0S @ P P P:`P 0!00 0  0S80 00 Ѝ080 00S # P`p  P`0P 0iS.S  P`0S4 040:S4]&0@-@PDM QP@T h00p@DЍ0U  jP @0S@-`@MPpTЍ 0S P 0S Q 0  pO>@P @-$000Q/Px1P/$0/@-M@    ;0 opЍ~iO-YM `F/@H9X0KpP pYߍ0pM 0S 0S PP@ Y P @T0SL0P 0@S0@S@@T1S X1 2PAT1S@\1S`1 $P5\1 S S R@L1SP1 P&L1SPC_oRPU@j P0HS 0s0}P 0*81 T48#88 S R p S 0 S T X @@?@0?H0p 0P0H0}>H0 @n0000LPPPM!Nl l i8m m A-p M X`P00 @R  RT T 1 # 0@ @ QPUx!@Tt00 Ѝ S @m@-@vp !p !p` mȀ %0R% -@  %A  !@   + "*  ) Q%£ £    + "*  ) Q%£ £ /A-`PɈ@P─@Ѝ P\ LL0P q-P pP *%M!A-PR Mp@ 0S0T00 Ѝ/P P&`0 00 0  0S XT G8PP/00T U8Dm [m O-@P%0"S0Z"SJP Y papP wxp700 ЍT WOYpW T0p000 Uf*`X*T 0\R PxR U*0X :p@`0\S6 TPp`p@3nB P8mnnnnnnnnnnT0Z`X:T 0 0ZR"T 0Z@`V0\S xRc0pPmR0R@ bR RP T ZY~Tp{ X0#0%w*rT 0  !     PP0S T U: RM U*`XJ:0\S 0}  0 P0N[ SP0Sl  1MPTPp@]p4]&P /0 S S /S/P0/S 0 S S/0/O-P=@P ЍO^=`Pll a ЍOJ U qWrJ@P  NP 1 A Ѝ=0@S- GP'[ `PHJ ``]I P 0 0  0 0M!lm p@-@ $J`P 0SJ$`P PP(0S $J0(0$0p,` P,` PO-4M10CXP`p@SHԖԖ\ԖtԖԖԖԖԖԖԖԖԖԖP~h~|~~`tԀu$uԖ|uuu(ԖԖԖԖԖԖԖԖuuvvuuvDwwwwDxuxyuy zz@{{P}u} ~ԖtLЋuЉ4ԖԖԖH`lČtuԌ{ddt̓@,  LyԖz(@TԖ<ȕp{{ĖpHU-  `Pp$uP@  FP7 7  '$ !P`0@T\0S @U0 @7 0H050U- H0?0P 4I0 @PA t01x4ЍFP 0 pp 0S 0PI01#@%U  ChUH070 0 JpP! .R 0R77@0U h 0/pPL H RU H0@1Ss@H000{U HP00q ,0 00 0 XN,0S ` {U ,0!00 0 ,0S < K Uz <1E8b0w4儒0000 0 PPP00 0 P p@ 0  @P UL <18b0w4儒00p00 0 PP00 0 P0@  H0:0H >P 0<0UH& 0S# /Ip؀P  &P00<0/7`P 00 /00P 000H060U ,0 00 0 M,0HS  >h 0A  a/ph  P 4@AK0  U 0 U ,P 0S U 0 p H0 50dh0 50,0 % 00 0 ,00,YpT 7$ UyPePUl700 5 0 $e 5(@p 0 (  0 p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 L,0HS 9U H0P SPH0;00H090U `h i`,1pP D`P 0$'>h C_FH0Q7;0UlQ P0l1 P0l1 P0l1 P pE0P p1tH000|UH10 2v PH0 2n PH 0 2f P PH X H000RH020MU  0pPl] H0 S;70:H0205H0600H0;0+H080&UV <1!8b0w4儒00 0 P000 0 P0P@0PU2 <18∂04gr000 0 P00 0 PP00 0 Pp@0  @U =6P d pPWH0p000S P0<00 P WH p P  PWHp   P  P  P l P=WH#  BjP S  ($p 00t ,p 00qpPh $ ( H,8   P< B7d hPWH B& $rp= BpP9 ((u (r H$8n  P  Bm ?&M!1 m m m 8m n 'n :n Wn an n =n n r n s n o o o o (o 1o Lo Xo eo o o {o xo o o o o o o o p p Gp np ~p p p p p p V q z %q .q tGq ]q 5z @z qz Lq @q q q Lz z z z z &z .z dz ]z Vz iz z p vz z zsq M!rq r 4r .r V/ PhbX@ DP3&7 D000 0000 0P70P7} G000 0:00 3000%0  Op ` +8 0 D 0p0 D+ 01 P#Z H0E,y>P0047{ (8P,:|؍<Ѝܔ80$080,CP(/0782p47,204<7囗 SJ8?@p,D7囗 SD@w?H'0l"L'87<7@7D7p"H7L7088 p,20!3 (!(P ((pW 400000(00 0N@(0S 0 S S0P\S @ p p8000SS ,38 P,,00  C0 ?oP20804P0P$0pB( (P f((0S0' &  PN(PI Z$dh ړPP78=0p0@(0S 0 S S0P\S 00@ P:0  IpPpP80,CP(0)S YL 900(hQdqd{Ppdq PH P0S (P  P 0S (P PpP| 0)R00S  P W400000(00 0 }0S D:$ D000XT!U!1-@ T!V!r 2%m r 0Q//Q *///G-p0@0P `3P` Y 0 0 R:@CS@D"@3X HGU( HGA-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS qu U!u u p@-P @Pp=@-v Vv @-@P 0 YcFg@Cv DU!u Pp@-h0h hh g_@P / :@P pv OU!uu P@-,0, ,,Q 0 cTv WU!u yu p@-@P,0, ,,pPP pyu `U!u P,0, ,o@-\T0S<gNv gU!u A-PQP0 OHgU0x ` @T Vp 0V 90V@v oU!u uv >p@-@Pp PPpT0 p@1@-0@T ^@00T0S0 @- v }U!u A-@QX2X"XXT0p  Q081800` |PPW Vpb$0S^ U @@&P "P @T T0Rt0t 0SP t0+ t0( 88P) W(( tt0 . p0S p0S@hPT0$0x x0Rt D@ t0 p0S (v U!;u v v v v v v A-`PP c_@T T0Sp@Qp@- M0 z(T0S0 PU|0h xPc_`@P H 0  \  Ѝpv U!u v v w G-0MPp   GP &81@0A 81(P  0Ѝ |B 8@T{   1T0 R0 0800+ P T8p0SS90SSFPT0c >| `P7 |0   P @T T0R88tPY0Sx x0R   iT 00XXSP  P T T0R88BP\>p0VS tc_ @TG 0SS`-90SS)PT00S8 0 H0*: S R   p g0S c0S G@T Q00,6 Z@PU!U!U!w #w 1w Ew U!QA-PPQ_@` p 0t0cRa0100FS  !A/P@-404 4;0S /00Nw U!Yw P@-404 4Q0S /00Nw U!Yw P@-L0L L}0S So/00Nw U!Yw P@-H0H Hv0S Sp/00Nw U!Yw P@-L0L L\0S S,0@o/00Nw V!Yw  bp@-@Q0 >RP0 _0`S0 SQ 0h Zp@p0 p@3W0 p@)w V!{Yw w q+0P@-x0x xxQl0\ i P R !P BR #@@w #V!Yw w p@-PP M0 0S@T 0d($"4d4#@c@Ood@T $S !0@0 Ѝp/0h`Q 0000P 0 Nw *V!Yw 1-w 'A-0S00@Pd` pW /0000Pp 0 |1-w 6V!nYw P@-808 88oQ,0 v!>000Nw DV!Yw w p@-@PQpiZPV!w C-TM@` P `qhp) 0 h ````h 1 pW0`pV& h 0 0 Sq00`"P!@03@000C>S`00p"P!@03@0 dp@ l)PH 00 \d\$k$P p* Xd p-"p]Dx p 0S P Q [ T  CYp  #:YpPO PJ PE P@ P P9 X00S 2"Q`` Mp  Gp %P %P0 x1`$@ 2p X00S!XppW" a a!8p%P `V%R  p0S0S"0h 1SqP2Ap@0-j  pb 0h!pZp @ pP 0$8!pGPpA 1 RZ  P4 ЍZ p pkV!x x _ hy_ ` x rb _ x PV!x x by  =a x x x x x x U!y [Tx rx zx y M/P #y ,y Uy 7y Gy }Q ` p@-@Ppp p@RRA-P`p@@L0s  S  U@ p@@@dW0S R H R U p_ x hyQ p@-P0U@Sd` 00p P@)@T:sp/gy V&@-`PM1pSAT  p@lLЍ\ cPЍ@!R 0$  00 p@ *a@V 0 !}p@`P p%0S lt00#40 PP D SP ]7( 0(V!ly qy V!2y V!y y p@-PP 0S 1 `@0S @@p00p SU   \@ .S0.S0_S-S.00  @R"0T0 0D0p4]& @- @0P PT00Q  DP `00CS`0p S00 P0S X0X /X}WU&p@-h1@SP~qPPE @p ┶0.SSPP \hP LcP < QP 0  .PPF+Sy p@-@P'Uc 0 U0 tU0 dU0  TU0H/@,8)0& (#@        U0  U0  U0 U0 U Np@tɼ IPz p s z z z z %z -z 4z ?z Kz Uz \z cz hz pz uz ~z Vz V& 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP]0p0 0TQލЍA. !. t l0Tp`0SPE@E p 0S:0@D0c z Yi z O--,MlhpP. p|`  @P_3 0S  H j,P$P@>P@ X^P$0X2@3)00,Ѝ P,P, R +P,PE0S p R* 0 3 0 8$ R, R  P 8$ R R ,Pp!@P !!!*%z z P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@{V00ЍPWq"0$?S 0[ PW RPPUT  PR70 0 O .0@I0 0IU:D X?0 0 `TT  DSPO-p0 0$09`@P00W*0S T [700 Ѝ!0 *00K@P  00T [ 00 P     @ \Jo"  & Z/Z#T [\*00 0000K@P\ZT [T [ KP|4]&V!C-RM MPLHp`p; @G?pE  Sp V=p >4 SpTG    |0 Ip P; IbP <I/    VRލ Ѝ   20EV002 0I@ p  p@P0P@T*mp0S4 cp `@T*T 0 uSp @ Kp   0#$$("( XSpm @  0d#$$(B(   04!c#!$ c$" 8SpM @@   0b"!4b$#  L   .0I/ P* I/ Sp$ 0S @00SP%DSp00M#4  ?-G nZA-p PMU@ 寲ЍR` R o00P0S 0 -0 0t00#Q0 .V 0 00 0QP0S 0 z z O-4MX@p 0S\`d` (0S:0 p20"4ЍO 0  ,   xp0,0 ,0SPCD ,<Vp 00"0,04ЍP V0 00!00  , p0Bp00X!0h `F,P 0 S(0SVP$ (0S(00 0$ `;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R0, 0 (0S ,  09,PV!z z w z %{ O{ p@-P`@P 0S $`P(0Sp,` P,` P y 0P0@-MMP+ gp P0@ۍЍ0;0 C#@P ,P @- PΠ R-00\L  ^@-Q00P`PV0 V=`V xЍp@@T   0x@ `DPЍp`Vx1@P 0>0S *\P PU@P PP`/0P@-000 00jQ$0 @ `{ `!l{ { @-` ,M00<0@SP  '0x Bfp Op0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xFPT ,Ѝ0 8 0@0S V0xPTy9 A-@`|VPFPPP2Xxp`Er-P x倂|"x20 2V0  |20|2@-Mp@`P!  ( (DX( 8pOPU@ T700@Ѝ i///0@-M @ +PPЍ0 3"Qqp 00000)?Op00000@ 1Oplp 00  0"%Op< Dp { `!{ { { p@-QUp@p M-0x1p@-p@-FM>`V P00Fߍp@PF/ 69  0宯p01 0 `r0 HF?)O 0> *Pd0 F?O ii@-@MqP4@ $]P P@Ѝ`!Q@0@ @@@-0SSP`///{ `!l{ $0 /Lp/Q @-@p000t0@0Q00@-,M@P(    :T Np 0 00S p,Ѝ08i(p@-MP@  `    (PNPЍp:iC-PQSM M3#mT0S3"`V2"@p@"j0B01801T0t0H0 0C@L0@T3H 0H0L00L0@ P T0X00L00L0PL0 0L0TH00H0XH0 < 0| H0 x ;H0R `0p 0`00t0H0T@L0 0$L0120@ 2\T@D@@@0@L0 X:  @L0  AXH@L0  @L0  XP )UPEPPP@ D$("(5Lp`Sލ Ѝ C  XH@v `!l{ v v  C-`Mp"0` 0$` 0 z-pP @T+Ѝ`+PPA 0 b-p0 S + `@`T*x0V*00+T00V:0 (P|P@ ( 9Y 0@P`!@-DM`@ pP@  =  ᷭ !> U 134  R2$ $@0 DЍUi@i|@-QM@  00 p |20 x2"LЍp@-]M#PKp PP -R 9000S0S S SS wR0S HipVPS CQRS@ 0`  x@P -$0 Bp 0S$ H H$hH Lp 5 $ L 80St S S00,0S  R000@0S  R00@ H @ 0y H!>50H \0vLp[0S 01S dd0Sc0 0 0 00 00 `TRY>S SM  ]ލpRIxW@P= m@9 a3P0 0- H)1LP[%0S" HdM P N000Sii@`!{ @- 00 000 0 +Ѝ`!2S/2S00/@-@@-V002@-S0@0 @@V0002S  ㌝/`!G-PM`p (P彿P(@P0 0TT`09Jp<00 FK ,JPp0S p  Kp PU0S p %J)@! (( Kp | P~Kp 7/PP sKp l'P Ѝ@&| /| qB@:| lBpBfB@0G-0M@p`0P U I0S1P   ↿ P崡 00S V 1!X0 P000nP0 PPP0PU:000000x Ѝ@-  K ЍgB0p@-M2S@P`x (?VP@0  `(J'00ލp@  `!B@-P`2$MS@p0  0*00%440 0 0p` I$Ѝ@-@AI )@(@-@pp Jp`~B 0`( "4`#/p@-@^P T00p``0@D^"000œ\p@Tp0,R00 -\ 0 # R 00O-QRM@@0~01`Q vV00ЍP0p Q :8Q@SI b딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 e'P 0 0B % 0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S Ѝ@-@ 000YP  R ݽ Ѝ@-@\0S \0\0@-@`q0`H0`00@-8@$@D0p@-800P@% >Q" &T⠽0x1 RpR 0S TT0Q  >0S ,p@ y0800sTq| A-p`KPT&P@00<000S@ (0? e@0K0cScO-@IMḠȐ`Ap0 4Iߍ0RS* R? )0000K C&PP d0S  FRV ( Q  R L)Qh 0 0000200> 0BS0*  0360s RpS00n T) $0K0p C80$Q 0 DPV VdP h  Q 4(/$ ׼8p HQ@`$Q DQV R <0S @HT60 <0 嶼 @V20HS80 0 t婼@(1S p0 H0S=00(  ☼(100@ S G F P81#<141816%#8100F0p7spVg 5Sp 0 HS+00 %A Ch 5V0@B WeV M 5S8Vp0p 50ST 0HSt300r B 0HSe 700  0 0 "@, 02 S307 ,0 4' Rl Ip0  0HSA20 0 W@(1SgVp 000DKP*0W(1SW(, 030 PV:0BST  ,,S P R:(, "  PV: ART  ,0 00D0C0W00HS9000 0C!4 1ᠻ@ 4S Y 0 HSM00 $A ⍻ 40@(1SWEVuW08 2Sk  8 "0R PHt  [:0Q 2 000000  @V5 VpWH h 6SD 0HSr^00 &A C 60@4W08 2S'V0081 0 Z00 HRO P0@W00  ^00HS>t00000@0 HS3<0 0 "  2V0@ WV}[Q0000 00@0 0P0"9 |0H R 0   ں @~0, $| | cSc25| | 7@-P\ R&@P\0S x0x08  Ѝ0PP @0@ vp C&| a!2Ev_ A-PR1!0@ `ᅺ0P pC R0 0R0 06 30 00} P0 0:000s P00;000i P006000JP00ЍP 00000000 0.p00 0"p0 00} a!} C-@PMU"P, 0P`0P001H0i0P0 0 v븀x0`  ($0(10< cV `!P (@B  ) 0ta!P( ``(1  ( ɹ0(t!pù0+"70 (P  0p  `>```g!P( `(1" (> *>Qߍ 0*P  _ a!;} Q} @-0p0i0 MS$MP`. 1 !p Cp@p0S i Rp ۍ$Ѝi@ 0 Pp F8QQ0500 04pP!P(& <e} U&$2|} a!} @- 0080PP `V@Ѝp0S  @P  00O-IMPp HLPL `PR  0@PIߍO#0,0#600 0400 0 P` p00,0S2 V30a2@0 0!,0 T>`0 6P >x_@PIߍO@{>0 P VT` \`00Tg>D0 ` ^>P} a!@} } /} O-P`@pQb帠,`P,2S$PU`,@ ,#DP)D, Q 0S,9  D P,`0a!} } RO-F00! `pP@T:p T  X ⢱00U *("0 lp Ѝ0R0   @=0  zDp   = @ mDpPv H A-RMM00@` PRp0F R㼀 00 ApۍЍx p p @ ɷ= ,Dp 00CSM@- 81S Q S0 000 PЍ R ☷0# DPD30O-S4M@ h@@ `00_0P o0 00 0 pP 3 00 y0 pP3 0 0S0@0`[00T0 @P0i 00 0 `P` 0 $ ( ZXXmpP  ,<$e(b,8_ `P@ [0!P*"0 0EP 0S $)( , p$ 5(2,8/ P@0Sh0` 0h0  0304Ѝ$  0 k  p(,׶wtp 00 !0 ApPp @ kZj $⿶ ,⻶,0pS P@,0$S  S St0P !R "R hp( $(,8 $P@} o} O-PM0@040p0`2` ##pRp#ppW9 pW6l0S~,0S0p㄂,0噇 2S0p80,0噇 847S0pl,0噇 p"R000, 20wS4~47S ;p 0 pߍ00 `2$p $  0 p 00 `2($p ; 0 p $; 0 p(;| 0 p#0}0P,04l0<40 zpo#0n@0"04,040 hp`8p`5pg2pn,0 !P ,@ 0,00lS  R, `" pP 00H1,0,0H0 0 p 7Y, 00}R0S 0{00P 0Ip p 0 ,,0 !P !, `"P ,0 0L00p 0 ,p~ (~ L~ :~ a~ y~ @~ Hp@-PUp@bn0L0pp@- MP#p 0` 0 0 `@@po?@ Ѝp 0 `~@p ` 0)`v@p  ິ0U 0;100b@p@-@pP`8!(0-080000&0S  0R  dp`H Ѝ@@00 p Ѝ@ Ѝb!lGv_ O-`@p 0帀SP$H` 000 0 0000 ``0 Р0 `  $_:! 0Q0003H081v H ЍO<0 $A: 70003@0St3H000s$8040.: L$S< 300080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!:00 *S:G{k{'{*z8 S zTkg{{'{* z$900 H0S0SU h R 0R<0S 0S11H000s8040 P14 P18 P|10 804 d@ 0R00i8 |00.0 ap ̀h`0 ] P0 x10S00H.2 r P 0dh0 ЍO Ѝ??~ ~ x ~ ~ ~ ~   ' f   +4,6   !`   A-P@`T 0S0A hp` |  S 0i0P 0S <0S $9   .p0 p pO ppK000 00p0 pH  <00 0$0 F#5 FAd0h0/ O-0R\MpP@` 0$P X0 #3P 0 RT000 p` hPP. dL0S0 0@S@0#/L0}O?H00P X0 "2P 0 Rzgjzzz{T0md0S  $ P $[ <X x' h2 0`208#<410,00000<00@0,0D00 <$P(P Q48`LPPPTPH0<p` jpY  YPPP  hu&h0 0108#<48#8 10 E00`<΄@008#<4 01 P00\ 02`Xv &<04S#1S0810 ^ \ЍO<t  7 0S 0@ 4\Ѝ7S zDI b!O l CDC ŀ Ҁ  \*@-`pP@`L0 )h0X $7S R h0@0 < ` 7 0 Ѝ@$0  ׀ I  p@- P@$ 0 00L0p@  +p@-PUp00CSp@0D $r7  (R000L0p@+=  |$,p@- `P@pg800  B\500L 00<0L008 %p@ V z + R,A-@P` hu 0R 00(P3 081HAp` P08!(0 A+P     Ph0h hhǯ 0 d0 Pe0 $}A꓁ Ł ΁ pb! } h00h0 C-@p0 PR  R $ RP508Ȁ `6  i@0S PP  P0  lHN81 R*P 0S 07S Ǜ Ǜ Y  S:4  !!  Q 0 S:500 0Ep00 0 ,ЍO Y 0 0Cs0'o0S0 S0L0  p    0 0P l0 0SY0A060@ 600 0p0 0  `P  0 S 081ei6@P P0S0 0<S<0P0Ѝ 0    06 0P6SY700S00YV0S9 0Ul00 0P0 RS0t%KSK?305080 qY 8 i&0 5 @0S0 R 3 P   = rZ0S Y Y 0  Br.  Br*L0 - $P$0 0 0 Y & 0 W3 @ $ 0 0P  S 0S0@00 D$0 Y<0<0818 ?  ; 0 P0lP4 000а 00 0 0P00 S*P *  pլ @ 0ЍO600 0<P0( 0S * oP   p妬`81 000 0 0000H ``0\0S   T!0YP 0 8 R 1@ЍO3Y Y' Rr   0 P0Pd0 Yk 0 42  pЍO!ꀄ  1 H d t } l* ` ׃   O b!x \*P+? - \ A-h0PR@1 A0@ 0BS`pbp ȫ0 Ad$ O-` 0 0䘠x1P@pT ЍT 0S R T0S> R* ^P   04@ׄ O-,M@`P Q0 ,ЍO`F VWP0@SS 0SP0#ttx'xVI:PQUE0VB:  ᦫ""448#8S50V2:1 S/ 0 0P!' 0S 0000<`10a  & ! P 81  0Z,Ѝ G 0 B 4b!  @-Q` M\@MP  A0p000 p 0S TH ! ۍЍ0 W`V \@TP_ b!$2A- p`@PAlPU0 A0D0S0 A\0S0 Ab!6 A-M0M0 ;`pp@P @ p0妪0<000C$00(00$0C,00@pV004p8 \\ U0`$0 05p ݍ0Ѝb!P_   p@-P@{T  (@x1S0pSq 402p 402022p R Rp07@-PX0D @P 0S6 >0P 7P7;00@0S02700000 0#0 Ѝ0@}|z  P<gjzz+S$0@ Y Ѝ0zDY 1p@-@P0 0aUph0Spp@1O-`P@T Q Pd0S  0 0pd0 ЍP0AQ 0S 0P /  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 b0800<0  P`00 00 /0S $0 pWp:#<0 2 0 0 R0H0@S 00ppW\0H0-Ht   pv00} ` ~ ,0`( "4`4#S /0 @Rp@-Y00pPQ0`PE `@@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP// 0RSQ SoQ&/\ Q /Qh h  /h h0 D0 R P///@o/cScx1G-`@PMT. 0S pW$ P ⱟ |PP@0Sh0S d0S4$◟d0 0S {PPPЍ|0d 0|00 00md0 00g090 @P] 8 PU9$0 00 FPP 00A>d8:dX6M PP 0|0d 0|0XxጟU" *8PP ߧ |{ P<p{?0S P 8 P  IU` GP < 0$Q S "  Q  ᰟPp h  5< 0   hhpP: t0<0t00 00 80dQYx X |P ᜟ  U kpP ⋟ȐY $0% h  5< 0   $0<0|U! b!*! v N p@-PP1!ͥ p`01S 0S 0S 0S  0 @T 0Q0 PSP 0U d0S0h0d0p@w b!! 2p@-@T PP@0pb!G-Pp`P@Ѝ0E @P00 4l@P 00000P00 000l, p, 0 1$00PPZ,0 8p0S pc0 CP  0@R 0 0000@@b!Pv C Ԇ @-@0T PQ8 00*: SR h0S dP H` Ѝ$` dp P (0Q,0Q  п `P  800000( ,0?P0S 0 h dW $0Q 0h0d`0SHrv  0S/0S/   O-M8PRH0` 0xP̦00ЍSpP P0 X@ XP R R R0 00Cs z@ЍOP 0S3Y0000000Cs ЍO^4? @PЍOc    p @@0 08+0$  0 Sc!Pv 0S/G-P@M T 0p `x100 0@0 0 @_@ЍP/@-@TP@A0S   0:p@-@PPP 1000p譟 P 00p0000 S0 @00:S 0S @\S000@:S @1-4]&0P/:P@-^@\ :R\:\0P:P@A ^0\:R\0@S0/ C& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO4E`VK `0P0E@ 9 PPw 00pCލ Ѝ@@;04pW 40p(0= yP  0 `R0 :R`00Fd4@0  0(8804 PF0P {0S .O p PP ;000P>p 0S#00 0k8`p@[ + K.0P R 0^.0SJ @@ <.0P 0S00 `0 SWG @DpW :Sp:SY @\Sp S Spp p00T:C @DP 0SJ .G0@P0 0 Y@ S 0#SS `P@<0t[ {P:0p0e7 p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0 @D0J`FP  0S - j 00, @ ` P D,0嚊  ᖊ,0@PEg P0S -$ D0A00T*y PPR 0P1- C& < @-0  0 Ѝ@-(@ P 0[0 01-C-MB0M00pS 0S`! \0S)  R&    RA^0C R[ ~0Pv Ps @ Z Q0l/P ލЍ ~0P P 0@PZ0 PP U PK/P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  1-4]&( p@-@PDp@NA-`= @P@ d# PPd f_ 00@^S0S:S_ p0 R0S@Ad PJ] \Sp0S:SH 0C^ @ 00LT1 0L\0TSpASBC\ 0jlj,idjTj,i,i,i,i,i,i,iLj,i,i,i\j,itj0bC ^ 0 0 00:0 0Pd @0:SS0AR0@A $ P A-p= `P@ d P`FPd0٢ 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P -P(1-." G-Q0S ̑`pʯ #PV00Ѝ  ᚒP00CS0Y Pp0  W00S@( QP   , P P00SW  X  R00S 0σ47,P R   S@T PR   R (1-4P4-01-@0@-0S yP `P(1-P8-@-@WP08G(1-p@-P@PPpXPp(1-@-@AP M 087S@T (1-P8-p@-SP@ P@p p@-@P & 087S@T (1-P8-O-pPW`@P @ ЍZ K P 农PT  RT@ Z //////O-@@00S 0P` 4 PU00 Ѝ  {P00CS0X Pp0 0 ߟ  V00Sp .P    P P00SVppZppW  P P00S  P  P | P ` P H P 0 P$} :Pxh8-4@-04@0P $6,Ph8-.- X0@-0S H@ ;000D@FP0DЍPh8-8-@-@`0P0`Sp 0+P PP Ѝh8-@-@P08Dh8-p@-P@PPpmWPph8-A-P @`pPЍ0 (084SPUP @h8-@- 0 00B;P Ѝ8-A-P @`pkPЍ0 (084SPUP @h8-@- 0 00B;P Ѝ8-@    /A-0@@`P@0 Ep00D0& SQt 0@/0PA/A/O-@PD[pDpG``b0Y:0z  Z # 0@@DA 0DA\0:Z: [=0 S: p `$ Ѝ `p<-A-@`Pp/ () (# (A (00@-A^ 0 n$ P/o b2 0.0AT d$ Pon N$  A000R0@-0TM00`p<` @Pႅp TT0 )p:@ q<0@404 4/,00S 0TЍ$C&,@ <-A-@` 0s P0S)0p0pGWp0PJ)P @P @pT0 @@PP @<-p@-?@0, p`000000PP5p0,0'+0@00`o`L&p A>0t@lTllH0SpW W D+P (P 00PpXA C9R񟗈ԁ0PԂȁ܁$8lȂ܂0000&000%00L 0 R0C00S00$000S0C…0L 0 BR~0 0S0Cx 0vL 0 BRq00'0l00(0g00)0b00*0]000 0廜 0 ;/Q֜$0S` &0 R 0  40><LT@C3^A00@C32 \  02` 3 d ! XC2 hhh 00C0'08S 0 0 00%֒&`| ͒e,`PPDAލ Ѝ, !//P 0H0<-< $C&T6\ M {q8c!=-(=-0H0S/<-0Pd /<-A-PDA@M|0`S*0S'&0S S f|&0P 0P@ @Ѝ &ĀpW*P 0 000’0p&p@ P`0pX0X 7/0S 0SP 0 P0@ЍA蝒<-(=-$C&,@ G-dqP@0L P12C1b05R0 0 0&0S  ;&h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00S0S0PS &0S,P N,@GH<--!\  0L0#0<-t0@-M  L0@31 ^AP 0C! 0Ѝlⵑ<- @-L 0 0@11D ^Q       <-A-@@bM0u L0 @2# p PW%cP_  Bc p\  Zޙ$0 HD@,X#10000 2R01   0 0S0" V00 S 8 ЍA X 1(4/00~X1威0 kSV Q`ЍQ0S vЍAp`\c  Zす l @l%0S  Zo a00@<-c!C-`QM0S 00S` L@P: 0s%@Ѝ ⥑널pW   @圑 ὑ00|0pS0S %@Pp$00pFV@@$P 00T p@``pW 0S:S* c ᄑ00ppp<-(=-O-`PqL10PSU$,@T,P@P6 h0d 0B1 `P 1⽐h L0C R P!050%Pd @T: @ 夐0 p[L0CY1T*Q@@<-G-QT0Sj:\0`S& 2 c@Oop @d(0d$00@X1 0S. L  B 0PI %Q * RB  t0=408@S 1:X 0p@D7C 003 c0< ?o@@Dp@  ᯐP  ϐNP `! @B0 a 2!`!  000p10P<-$C&A-p0@@ `P PP00`Pl P@%Q *0S  <-$00S:@-@@W<-@-P`P U(0SP@P )@T \0@ T0T 4/$ 00'0S 0, ( @y"Ѝp<-$C&o qO-$M@PpD00T0SdS )@TPY P3@טH3H 4/Y(0S p0dpY`WT0W @p pp0Yk0 # 30f*[`C`fQl: L7~@PW KL ) D2 10Z 0F30 %0S6*0S  \0@P1'0S 0 0@!$Ѝ舡K @PD5P1Z0;0; E 0 `F`X L063 %0S    *0ST1)@T P 0@?0 f`[x [`K``fpP @P00p KF K0`F@  L @ю%Q *0S  @<-$C&o q =-@-M@p0aPD(0SWTP )@T: 0@0 4/0#880 ~P0U6@P  㦖'0S 0 ( @E!Ѝm@P %Q|0S0S Pϗ 00<-$C&o- qO-@QP$Mp(0S@ P u`(W +0TP\\0T**P* 0`0?o 0c  `o `S, `P T 1q*ᔖJ'0S l p@` $Ѝ4 T$P030#P0S X 200301S%T#2Q EZ*0T00S  D`P 00P`P0 0#  0|0S0S @ @p免,o`0<0 0  p`  ȍ`P% 0   庍%T#2Q JZ*0T00S  DVv 00FP )0S 00@ז,0, 4/`P<-q$C&=-oZ @-@H0'0S 0 00 0< T Ѝ@Ѝ<-qG////4C&/4C&000/4]&000/4]&000 /4]&000/4]&000/4]&000/4]&000/4]&000 /4]&000 /4]&000@/4]&000/4]&000 /4]&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/Z& f0 0CS0 S P"0 /p@-P0`@Pp@ Tpd!0A S010//d!0P/!R/P/P/Qa/P/0000 /4]&P/ 0S S//@-!@Ô000/0]&000/,]&7@-@PD@P 40R0PP 0  ! Ѝ0o4G hV&PQ 0S///lC& 03P/Yo0 ACP 0AB0P CSoPS//O-M@X @ЍO SQ`p rT} 04S`\x<P0@`S@T~L_U!` =@T`PE`0rCT 04SX:`\V00 ٓT  QX Q (   F⦎P@PZ P   T0`0S0T?o20S@W-Ѝ @&0R @T`0-@@`00P  0S S @0V @ X 1̓@0@V X* 00q!00S00/5"(]& 00S00/`" P&0 ///@-@H"3DP (  @倆hV&-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A -00ЍQ@P @ p@-@P0 `P  \*. Q  Rp R  (  p 0 B 4]&<=-qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00} Ѝ0S/1>3 !/0S 000/<=-0S*p@- @P~Q P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0 0C@-@0 0  (  ( 0 S/! ^R/0 @-@0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!Uy0`0A-s肟Mp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0S| u R0) Q/QW\PT|PQ0 0 |R 0S |0 3/000Q R R0SQ|P.0 0R4 R/0S, 0S 0 c S0000  B 0B B00 "0 00 0iR R R S: 0S   B 0  BЍ<=-A-PRp `@P 0!D000A-@Pp`0 SW' WV00S񟗋ꀮV VjpGPX1` X``0P 0 B 0  Bs  BG "j A> A``0 F  BU  B) "L A  C d0 SHPp  B0s  B`NpG`FPe`AA-@`P0S0<R"*1 21<0S0 0PPR0S*! !x000S(!!!,p (]O0P A, (0 ,PZ&0]&,]&A-Pp0 R*S\ ]\ t`@BX T 5PŠP`C& @-R@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00<=-< 08 C800/`Q'Q!//4]&p@-P4`@@P@p Tpy!Q 010//y!$1p@-@0PS0<Q:1,0 R40S `$0V':8p1PS58 0#p(00<^ 00^ 0S8op 0! R R0 0P`Z&0]&,]&O-@P 0RM g P&  ` P 000Ѝ 0@  CNPP ЍO 0 PS@  0 00<00S*^Q000800R ]R00-R Ԗv0S* ]R -RQ\U0]Si-Rk0 Sz:0S00T6000S8\ 000006 8^C8e SeR ,0Sl40Si$0Sf<0Sc(0x_ j 0(` pc0@`F p@ tUh 00C0c-R [RQ :R =R 0S`:  0Q00pS00p00-S]S0pS00p4 R*000`BV R:0pS00p0 S>*R; :R8 ]R500A  X0 ``BxP⠳ 0(SB(0<R$  9MP    r P `$0  0$ 峠0S00pp0Q00pS00p00-S]S0pS00p= m R:0pS00p0 S*R =R ]R 0S0 -RB Q?]Q< -Z00  V1 0S. V0pS 00p0S ,Z00V0S Z40 LP   `hFh400!0`Რ40 P0S 00000 P  P (B( [i 0]S S `Q\  (B( 0  EB#ЍOF M Z&<=-4]& 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@4]&0]&,]&C-@pPP\X [XC`U*00U:0S00400 00 X 7JXX @0P U1@P(p 0 S *R \R0)S ) \ U 1L  mHS\* VY \RV )RSPVPE0xXF )AXXat0SJ 0PB It i @ 0 D OX &(  RPSxPA4#X  z 0   0`00020$U`3: Ѝ e 0S00200 0RSPU S 00 @2R00PS`U>:$Ho0*S P 0 BP  B   B0   B0V0\S0{SPP0SP<* ,R9 Q 7 410000 U0 R     0 S *R\Q}Q00n 0RR \P 0}S Y^0<0S 00$000*Xe .X< 0e<=-)>{^ ]4]&0@-``P?Q@ $0A  R SP^Qn [Q \Q 0S Ѝ{Qx |Q20V:0S00500 @0` V1@`(P 0 S*0)S  )p V 1L  0 S':0S00500 R*0*C?S\{S0P$  Q0 0S 4 00 0)S  0  $  $  0  (  (  0   0p00030 0V:0S003000 <Q >Q x`P  &  R  #+S  *Sg 0S9* *B?RP {R2 Q/ 2000( =$,Pu 0S 00h2Q 0   0R  0 S`|* ,Ry  2000< V0 R  !   `0 S*}Q00 0RX}QR  Q +S ( 0  BF  B   B0:  B~?S {Sz   B0(  B 0  B  B  B " A 0000S 00000<=-4]&^ ]0S C-`M pQpG ᳄pL@P 6W:( ЍPPP P $PPxP @尉0 6P uPP  $ ( , 0P4 8 < @ D t00|0 _000G R:0S005000 S3:  H0A 0HP  00Q p0 P>3S! 1St Sq S <0RQ00p< 0o )  sSW S<0RuQp< 000p000Q S S SS8 S S4 +Sg >SQP>3S S' "S 0SU\ S:?  <0Sg 20@0020 0H  @  H0S IPR, 0E10S*P  B08B0SE0 A1S*, ^ R0C*@ Q U B!U \1L0XR#3S#^S!7l80SD 0>Q Q QS 00 0R 10C/TUUH(<=-Ee$1p@-@0PS0<Q:1,0 R40S `$0V':8p1PS58 0#p(00<^ 00^ 0S8op 0! R R0 0WP`Z&0]&,]&0p@-P0@S0<Q*@P80 p<0S P pH0@0@P(00Ppp@Z&0]&,]&O-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T )P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  cP?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M4]&Ҍ O-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0( 0 00 002   0 pX = Q  0 R)  R # `ZX !,    R  $  S  R  V  PP$ X$@1`v X PP(@@ xPPP @(r P  @ @$ X1  RvX PYtt vb  (B( _V R  !    _X RG v@(@X 0x  v% YPt P I_Vytu xLt  _`V `R`V t@@ v(  P Px Ptv  O_XO 8@Y (@X bY0txPt- xt v  t v  (B(   _V _XQ ( X ,0 _X @itg v xx ,    R (ZS $X  $ `0 (ZS  P 00004Ѝ0S00 x| @P 4]&O-MP`80U:Ѝ0 q>3S SY S$ SVSc 0 F>s2 R>sp 0 `800 0@WZR  D>sp 0 I800 0@@ZH  D>3 1> Q p0p-800 0p@$ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T xP0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  @_P?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M4]&Ҍ O-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  1P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E0 0000S0R0SpG pGPt0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-3S SY S$ SVSc 0 F>s2 R>sp 0 G800 0@>ZR  D>sp 0 0800 0@'ZH  D>3 1> Q p0p800 0p@ ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-3S SY S$ SVSc 0 F>s2 R>sp 0 G800 0@>ZR  D>sp 0 0800 0@'ZH  D>3 1> Q p0p800 0p@ ZF  DS S S @` PSp S 0 >s0F2@P0 P0p  0P Pp 0 0VP P  `pO` 0 PE p>#P  0 0T  0Q>SP!>#"RPEPO-P-MLP覟@pH0W: TЍ!>3S # S S S Sp  p0Ga >#RH00 0 P>cpSe Sp Sp & S *Sc &S0Sd 0000_Q0SY 0S0 0SP*0T _0S 0R0S>.Se S 0R  _ R Q RT P _QoP R00 00_P0_Q  T (0B(R  T @ T ,P0S0 ]0S00S0~ 0S*0S0T S0r0S 00S00S* T00000_R0l30   _S R  R E R * T_ R P R8 S _0S0\0S0S 0 S  _0S 0R 0p>3p1># RRJ RL R! 8Rs R>c0G`T R 0>c0D2H0 00 P0 0 >c prR pRd[L A T0F  WP?0a !0R@p0A0!RHAH >3 0G  qP ~0 @ hPv01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 BP0 0 M4]&Ҍ O--lM%PQ0y @%Qt ppq        Q 0#RS. 0 YT,Q 4^ 80 0S~ <``F`Z01S` 0s vQR\R 0C1!S` `0gt0 Q[ 0000,@4H80<@ y PP  TX0\ L0`cy Vd 00 S`FY10`0 0 ,`P XD0S 00D0 ,`PD00D0 0R < 0JS : V PZ Z `p6`XD0S[ 40S,0@440S pj, 0@ R0%00D ;0$00D0 ,)P5DQ/*0 F0,0`P& 00D0 ,CP HP 00000D0 ,0H0SPHDgX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XP4P HP PR [S4 0 Y-,Q 4^f 80 0Sb <``F`Z$01S` 0s vQR\R 0C1!S` `0eEZ&:s0 Q.0000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S8 00D0 ,`PD00D0 Z ` 0R< 0JS: U PZ`XD0Sf 40S,0@440S  p4P MHP IlЍ, 0@ R0%00D ;0$00D0 ,P5DQ/*0 F0,0`P& 00D0 ,P HP 00000D0 ,H0SPHD^X 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPpS5 0 Y,Q 40 0Ss 80$0So <``F`Z$0 1S`0s vQBo \R $0C1 !S` `0r0Q000 0,@4H80<@3PP T X 0\ L0`wV 00S`FY100`0 0 ,` P XD0Sa 00D0 ,`PD00D0 0 S` 0P< JP:$0 T $0PZ`XD0SY 40S,0@440S , 0@ R0%00D ;0$00D0 ,BP5DQ/*0 F0,0`P& 00D0 ,P HP 00000D0 ,H0SPHqDiX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppn plpj-Ѝ///@- // //p@-08P00@S Pp0hP pH=-7@-@0P0S TP Ѝ0P H=-@-@P 0S p@P/gP 00 0/ / 00 0 0 0/////0P  P@- / H>-ތ P P/ /O-M8`SHPPP PPP8"`!P`03 pP0  lp, 0 'tp@ tp@  Yp@@@d/t 0Pt(tP&t 0PEtP`Ѝt00@lŸO-1MM   @PD08 "( Ap C. `pYK@D;8 (@50Sm pȱȑp  ` ᰱ00 $ %0!`t0p@ !0 s0SpP 0S Rs001ݍЍs0S 0K0S R Pp 08D<4! @ P0 0%0Z  0(00h,R @B1ݍЍ;p FtH  gt0@-M0P  Pp Wp@ P Ѝ00 0Ѝ0@Ѝ0A-@@0s. PP0P 0)p` ``00`.spp~X`p $s``r00`s 00h4p@-@PCM0 /GcP2 ,EpPA ` 8@r00Mt2 7{C>@ F0 P4D@ F{@#h0S VS00 SCލp@@0Sr@h0h 0P@0 # P@1:r?00@r00@ p@-MQMP4@SX TD /bPA QP0s* mPaQaP` 0(pG @ 0@hqp> D p7 ۍЍp,0s i/10p +]Er@0 P@0  P@1:Xr?00 -p 04Lr0#S @Fr@Cr@-p@ ;r00|0M %@X ` @-rP`O-$(X,P0p-S`@/U'W1 ? mkZ0 0gkP : [#P?5# yq 24x2 zPWi@rUZ0[% 0@-DM@ P, Pnm~^w_(iTTx oT0dYP`Li0PPA)* 3!R ^!,! RX \`T0R@p 8T 0VP T ` 1<`S> \ Ѝ(00(0000,00,0`@PT01C`/ADP`@T0  T   0`0#[ )[U Pǟ ,!\ \Z ^X S:pU T0`@P0T0701 <` 60PP`@0,^0 <P0  0=R  @%0Dh0`@< D {{APP$0S`@"Dx`@ D  ,\VPfS `@0 S  \Q0s<D 8`0d Y`@0 00000Q0`@00L(0`@0(0,00,0D(00(0?$0S`@"x6`@0002`@P0L dS0 D`0D0Dd D 000#$0`@0$0 0`@0 0 `@(0$ S r <\m=Qh$\NPHL X@0 0D0h`@0 ST<\O{H@^{L@0D h`@P0= 0LS0$%h`@d @$0P x0v> 0`0?d0t00P0?T0l0@0?D0p080?<0h0H0?L0d0/X00\ 0 00#$0S`@P" R"  " R,"2!x"~$0S"x`@s`@00m`@ 2 0 Q00$:($^0<P0( 0=R%0(h00c @DHL0 0${f 0$t!#:6 00 0.$0Ϡ.>L!! 0!!!0C 0"  R Ό ( "!P$?#"0/  "1? A ,  , 00S($  0P 004 `@00LBHBq`AA?d?>h^<^>l""""'.%Q(\)\²( `@R 0S $0S \0S0Y :6l 46 0! 0Ϡ!>! 0# 1110N 0P 00( # 0,$0(0.,, (?"\ , 0\0#0  "$0Ϣ 0, 0<(0,08C.: 6 460!$,$0,΃1,#!1110L0^( .$0"! ( 0." ?"!00 (  "͌0 ( 0, $ 0^ T P00t"000}eA0`@00=`@2 0 Q00:P0 0<R$0h00c 0 0$Ue 0$$##:6 00 0.$0Ϡ.>L#! 0!!!0C 0"  R Ό ( "#P$?#"0/  "1? A ,  , 00S($  P0#`@  0 P09*^3*{ r0s{P T80<`@ 0dR#  \ Q $ Q $ &PT8<`@  \0000 Q00SPT8< `@D !{`@ 0 D!t`@ 0 !m0S(0S `@50 Q00:c 0$ d 0$8&#:6 00 0.$0Ϡ.>`&! 0!!!0C 0"  R Ό " !( &P$?#"0/  "1? A ,  , 00S$ (  R0#00 `@0D0`@0  0C0n0 @00 0Se 0 h00$%`@ h$ 0$% 0S 000000$0`@2p rp t t `@  P0P06  0# D%`@D000 P 0S  %`@D000 P 0S!D% &`@000 P 0S D%P R  \Q%8< &z 0 R#P dP(  01) :60 0!$Ϡ0! !>*0!!!0C 0P88*! /.P P$ ΁!$?   "AL00 h00H%- 0C00000S P0 0  B 0@0\L$   C00 00Su ^ 0 0  0   N+ R" _ZO-Mp@$iXl`00i0W0 T/ 0 2c1  ?80PP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T (;0d0P] 0TPP dPN$`P0Sʼ Rʨ  Rʰ  R 0 0` 0S0`@dp?O$@T'pET0}Np0`@dp00.i0 @Dv^D PE  0H000Q0SX0 0d0800QpHP 00| 4 JPQhltxPWx@RSY  Y  d@px Ut Zp 0Sl0Xh0[d0 Rwt [%[8P0>C 0C 0p00@t0p` VP x0S hpt0 0000@4p d00Pg x8( "ό R t0"! R RYv 1 ?)/!! #.ǟ/ B Y? ?.P  Pʉ 00#1?4v.C BAQSx  \tp PpYh 0  qp 0rqpGh0S@T`p VPy 0R?o20S5h00ߍ 0,hd@ 0 qp@pK Q#! !pY@#NRp \TPd0 P0,P`000 `0  ZR 0`S 00@ g 0d@  lg0S 0V0ZS0 dd` P PTdH 8<d@ @Dd8 HLd0$`X\FZP ?`p@g0SB H2ß̓"bY2+:##c2S% P#q8PP 0d#0dT0>H30@p9mg00Pd000@p `P ?/( R ß&0Q| 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,lX10( #ΌQà3\!=30S 0@! B^ A 00 0'qp: @p(pCf#00f0S@@㴰p d @p괰[0"c01 2c1@T 0f0 Q  s!P fT00f0S10(` #ΌQf00@pvfT00]fT00\lF)\P(\ ףvɻ %I$@-@fT MpTat X00 R 0 R 0Q/  /  ,,   DQ p@-0l` SPPH 0@#  T\  Q p/ H  Q j.0 0#  Q/$00Ɠ\ 0@-o>lP 0@" \ 0 /A-@P `p@P@0% hP PPA-`X@@P pjNP@0& NP PPA-`X@@DP pH@P@0& 3P PP`O-` M h pP8 찟` nPP P @@ &  P P0S  Ѝz P W  _ K0p0SL A-PpQ `@Q P 0@DDB(000S  k`*@- Mp``PP( 8e  00S@ -e0"S" 0`000S0 6/ Ѝe0"S1Ds\0`T000S @ Ѝ1Ds$ &J <d @-@ @O-`P MU PP2SpPK  P@N P K <10`0@P6 0nS# =TPP00Q Q 0P ^  0\  KB" 0 0Q@00oS@d000S p Ѝ4  'O-BMM@pudD 0 0UP:TPP  UPo00]P C @P@`KE(0 PPp 0P0  0PPp `G@P" L 0dQ PkPUP p` 0s| o0 *_P $@PP0 PpS [Q P c 00BލЍP/U ` P #p@c0SQ  OPBލЍ O0H00 PPZp=  Nc P00 0Nd! 0 0 0c@ 00 0Nc0 !  a00&c 00 0NP}xc  P00 0Nqlc` 00 0NPf \&p \ zd@ 4$| ,  ` X ( - M 0  PЍ- M> 0  PЍ- M? 0  PЍ8-0M  0MPЍ --f( 0P    0/ 00$p@-P#NU@pb,0,0? `0  6/p| p@-PMU@pb,0,0? `0  6/pdP @-@P 0003/8 @-D@P 0003/ p@-P\U?o20S@ 0 00 3/p A-P`fUV00P00S@$0$0p0 7/h p@-PU?o20S@ 0 00 3/p4 p@-`P@PpPb( ( 0 @p@/h p@-P@P p 0 00 3/p -@- M  yp@(0(003/ Ѝ@ Ѝ/ @-yp@0003/pH O-$Mؤ @00`P 5W0Sp$Ѝa<0` (P@6/$Ѝ O-$Mؤ @00`P 0Sp$Ѝa<0` (P@6/$Ѝ8h !P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// ///////////////// L x h T p 0 x h T @ ,   $ h $0(- C^ 0CQ$ :$0S 537$05 0$0(0, 0 0#  $0 0@-@$ MP05505#0%A0!0%$P$00$0Ѝ0 $0R  S 5,3,07$050$0/S 5<37$05 0$00 /0S/, p@-R@pP$(ASp0$ R05>37$ 5 $ !PpO-DM@YP@f P, p@8_ U a@Q UL UK t`,0  S#3@  57,050,0 Q,0 S 57,05 50S,0 R0#0C R00CT,@DЍF, 0R0537, 5 05 R, S #0C 0S 0C 0S 0C5$0P$ 0@YC @0S1 `@@0 SS( S R 0C#@ =0 00 P, Q0Ç0,  0, 0 P<@0S80S ,0 S 5>37,050,0@q`@T  p FT")TW*0DSSQPONMLKJIHGFEDCA@>=<;:987bT1 ?R10S. 032 b0 B12 00`s 0 00Q,  P0Ç0,  0, 0Q `YfT ?R0@SQ p9 b@S B77r # C  0c1#0p0FT 0, 00 R Q05 705,5 0,0 5RQ05= 3 7,5 0,R`f 2$01$0```0VS@TI1fR=0D?o20S00FR:DoQP Q P=T, Q05@7,505,Q,0 P,00,0Q  0` Re 0Sb `[ ` 0PV `  ?RL0@SIp9 b B77rR00`F 00R%#jo%#jx%ju-M{00{ Ѝp@-MP`@0 0 4/ЍpG-PRM[  `Tp|PCa@/NP @1< 000pp. Ѝ80S&  1 00< 0 ppY^0S0< 000@ ppH^0Sx @^0S X 0 < @0^00,^00\ | (@- @MЍ.O-EM M`X@Pp+`E:I S\0P@'T 0 G\@0PT| 0 @0EAP H HUEލ Ѝ]00]00 | @-`@M pPXP% /[ RP$  rR$   0@ P@ rR  Ph 0 @Ѝ0 Ѝ@0rS ] 0 A-` @p 0P/S /[P @0 Sp 0 S C f\p@-IMM@`PP p 0: S X0 0vp IލЍp=]O00@IލЍp5]00 p@-IMM@`PP p 0: S X0 0Kp IލЍp]O00@IލЍp ]00H - M 0  PЍ0P 8 Q  8 //p@-@P PP` I `PP u NP  p@`*|PPp-40- M,0   ЍЍ/)HP --M  Ѝ Ѝ// -- MN<P 00  0 ЍЍ/(H0-@- M@NP  Ѝ@Ѝ/O-`Pq,Mp;  PR$ Ppp @P$] PX P@ 0 @XP QN ,Ѝ000:Q!0P00,Ѝ'Xp@-(M @P`E& (Ѝp0 0 &Hp@-@`PNpp p@<0< 0p@-(M @`P& (Ѝp8&HHp@-P@0 0@`  Mpp p@l%Hp@-(M@PMp `%8 [(Ѝp\@-@T0 0,M`P Mp p% B,ЍH%HC-PP,M/ ``FV` p@R V `@0 @T M,Ѝ00 0:2 0,Ѝ$Xp@-(M @P`% (Ѝp0 0 #Hp@-@`PjMpp p@<0< 0p@-(M @`Ph% (Ѝpd#HHp@-P@0 0@`  CMpp p@x#Hp@-(M@P5Mp `?%8 g(Ѝp\@-@T0 0,M`P Mp p&% N,Ѝt"H P $ Q80 8@-M80@08 Ѝ880/LL0000 0<KQ 80880Ѝ/"pP/0@- M@0@00S 00000 X x PP , d00KB_/P00 Ѝ0@ZNP, 8!4,0H 3O-0MPP 0 @D `p@ P P00U pp00C  Y 2ATT00  RF LD@D T\:[ 2 0000~`K _L0 V0 W7 X2ATT 0`Fs 0Ry FL  0 0 B0SH 2L0Ѝ V0  0 !L 0 0pHX<0S3 0  Lw  B 0@  0 B  BK`FtZ  B 0  BK 0 z K 0 0S B 0 0 b00d  0 0 Hp@-@PKpp p@0RS00 /D0D0p@- P@ Kpp p@PH808 0 QR00 /Hp@-`@PrKpT T   p@php@-P X @ 00`VKpTT  p@pTH!O-P M m 1D`00 SH,0?a@Qp] A10A1[10CPup , PPDEQQ|`0Ap4 @[0S8 0? P PP@[u ,0 0 00GC11[00P0,0@ Ѝ@ 0 00yHD0D 0@-00 @T @P80@080@-@P @P80@080-M0 +Ѝ-M0 ЍO-PiM ȡ̑Ёq Q`P@ P|?`K͌U {PF͌(Z ZP>F͌(Y IPtt>C͌ X 8Ph0>JB͌8W 'P\=̌1S PO=^B͌`x= 0@ S708T 0H0P, `P P  P P P P` P< PP( QP PP (P Ppx PqP'( Q78 x00CS40000C,0DPPh0 0HLpP(T l( a0P^ , `  `Y i V2 q @0T0 @;T, 0Y  p @daZh@0p@ ͽpP'  W  V 0`1A1S ,0 00@!1S 0D 0| 0|?piߍ00,,00PL!!\Z, @  B  $ P8<@ Z& 00A 00@S= 00  1  pW  Pp帿W ,PZ00 0 p,0匰0[$0 1p0@ @pEP  X 0@0@S 8<@PP(04 0R(0Lp DPH1H00P@@X$@L0P0 001P0x,`0P000FX0To0P00i80PHp( `Ta( Tl( Tx ( T (  T( JT( T( ^T,  ,  00P@ap 00P !AH01 `0V0!P0 @`好V0,@ `X4$0Q1B/0( `Pp/`P V  P p (` 0,0SU,0 00C 00,p ` W# 0 C 0`S: Q P01! @TQ @FT0,   @0,, Q 0@@1.p`Pp`$ӺPP- U  p`$p ` 0SA 04 ,01 Y 0i1 0 S1 1QL ! @0T0p0 @T0 ,00 P @T! 0R1V@`㋺@0P T  0`,0 SY,0 00C00, @ [# 0 0 B0!0@SC 0a0T !1 P Ua P媼U0,000 P0|,0Q0P0P1}`@9`0P T  0 @\4 0 0R080000SyO-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @7Yߍ 000Sk HP0Sv p`0S @0S p0 S 耍 0 S  10S N \X0 D@-<@M $( ,ЍH0 D@-<@M $( ,ЍdH\0\ 0 R/D@Q 0Q(00?H/H$P0P0/ D <  R ,  R$ 00?H/$0P07 A-D   R'P?UH0@aaS,p10 0D   C(  \@UL@U(  R 00/0$0 0 (Hl P  `0H?30\ -@@  D\,00D//$O-PL4M  0pS4Ѝ崻PD H0 L ! 0 0|!0:|@塻P` 0`D0ZP`@P0Z0 T'P V@`|@`0:L ?3Q 4Q< D pH0L  00|"(099`P0S R,@PR @0P 9 R0`S4ЍT `@004  0̷`Pu @|`t$0 0 ]H`0` 0p@- PU 0@S PHSppHp@-@P 0PS P1<pp0P0% H -? \| 0DR0  0R0 S000 0\$( /($0 0 hH 0 0 /hO-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n =1Q0'0 0 0 0 rЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000$ l@40,HC-pP☂M@ 㮷`P {p2@0@Z- @022BBB {`@2C{@@ÅCCjPU C# pP pK 0p R\ @B0 @@@q(P9 0 @@@f(P. ?p* #p& p0 @S(P  &h000S :3S ЍP p[B2T@ TXV`Ѝh0S,BpPa\4P{ A-Z`pPp C[BT2S@ T1'%000 R A A @-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0Dl00TЍ!f <@0l 0 S/ᜆO-`Dt@M[p+1(($ X0CS0S4ڸ3 P*40H @08p{8 t%p{ġ\T(ÂLLßDDßP<<ß44ßx,,ß ߂ß@ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ d2 0 0CLr'>ppGl`( @L T (0Ѝ>\@ <V ^SvP#Mx:J'G#D #AH#>p-;-8`_5|2o/p,r)y&z#{ @|h}`al( x ؇%+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxz@8p@-'^(@@k( @%LT(Pp؂O-Mܶ6 `0&Jҭp6划006 0 000SVF % p 5p PP[ K p?P4S S S|V0SpPn 0@l   $ `00 4S  00 40 s 00bR$ 4S4 0%00PЍp PP 4P40 s 00bR4 44000P ?21 R R0 ; 0( $Q B q 0 ;0 pP.4 S S040S$ 4 0r0  cR0$0`S 404#` pse0 ;0  p PP4P0u0PPcRT T4S{0z$0P s 00bRS4 000V0ScpP 0@  ^ $@ `00 4S 2 0 zS 202#`. pY p 0$ $P0 s 00bR40 ;0 ㅵp@ P< pg 40 s 00bR4 4$RP2$0$ r0 0C aR?o$2&100 ?c p p 0pT 4 00 TP0u0PPcR TTg40 s 00bR4100 ?c0`00$P r  aR$ $ Q0   4 00 40 s 00bR 440`00\0\0! 0;Pldp`8QAD0l 80p@-P@ 0 PJ TT TplO-@Pd4`DM0+ 8 p$Qi w :Q|#R3Z 300S 8 PK0@ VJ0S0:3S `00X00! *0`00<00 @A40 0 Hp@-@P/<ppp@@0@0p@- P@ <ppp@|HA-PCİP @pT $T`0 @@TPp00<V>):P@P@P@X@-@DP @DP mCP-0S* R"'0S[P0mS S@0S 1 CR#0@S ;S 00C S00 0@S0@S mS 0 C;S R  "!0@S; C/o"f f O-P0,fS`MpvpJP U0 pr(ʍ"(0I"Rp 3S(0$00 0=PK T=P ڴ XRX5$P50 2T P850 0504S0300SL p0SI 4SC 4S 0d$V、匑Tp"2 =PN 4p2Z LQU P P 匐P !oL4Ytx2 PY $4x2$4X|2 Pm 3|2gЍH5S4S 4S0?o20 D $l h $ <% p 0$0(0lX CP Y CP Z CPp2?;~0p220P_0 r("(0H"Rp7XD  CPZ2Zx2X  CPx2?;~0x2V  CPx278x2Y CP<2|2Z CP|2?;~0|2V CP|278|2v1S05 4S1zL%R.pZVY  gCPTx2!78x2|"ZYZT!T1tx"|2OZV*  LCP%x278x21|29p2Z0 S;,0 0D | 0 00P0q}pI PX 00C a0HSP 1,TX[00CS``[TY0IS`YPY0 0CP7Yl0 0 hHp@-@Pp`P0P0C(, ,1C B00P00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0S 1H`?c`` AD Ap0@!qW#갑@W0 8 0| 0p@ P@ 0@00C e8g0 00fHT0 ?o2R0S P 01  //p-(^0,R0^Q!R@O-M A ! 1@ 0Q3, @ P `p0S! S#A 00 0C ```P  (0R0 (000C0T0 02/p 0PS@(  Ѝe4(0A-S$p`4@P(0PS@Q Qa ppQ p 0p(0p(0S/p@-`@0P> (0@SpP0@-0^ 0 @ Q@R0O-@ M`P VTppC0S  00C(00@00 T0@ 0 S `%, 0 S@p @ RᴀD`pD塔 `|p Ѝ@0 S RR Ѝ,P d,0 0P `00V  ppG , B,(pqqA0 ` T` 0Dp4ޒP ,00 G@p`4 0Tp `0Du@U   PB   0SQ 0 0PC $ 00\R =@U 0 BQ 0C R G-@Ph 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000U1Q0/P00` 0S0  0V(W ѳ`F`V`0X0P`UPW`V``0 @p 0 $p0PEPUP \_H4@ PQ0 /$ $\/ P/\A-PQða@`؜1Pp0$ TY 10 0 QTD$ 0R U ETpL @10 0 QTD$ 0R U EBp:   0D  Q SC$ 0R U E,p$ 0$@ P0*@0B0TP @T 80@Tp` 0Qt\H4A-PQÈ`0`pP0*@$ P rH00@T" 0UZP- 0S* 0@- \&@T!\8x ƌ8 t ,0A@0@PU 0P0U00 S0/0?o2?=XA-P$@0S00â?4 0\/@ 0T `ApB 0S%0^! 0S0X J!@ 0 0 08@U/0P 8 Q@ @ 8 //A-P 0 BS0@( p`0,,0 0CA1!0 0g`@0S( X0@-J8  PE? 0RB8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 O-RQ M40|`pЎ@Pu 0ሰ(ȎP,m PP0` X4% 0080!0Sa0 ` `8 < X$p@0H0|0L P0T`7 ,!8 \0`0d0h0l0p0 Ѝ㲏P4. ㋎P( :"R! 0 R80SJ 0  V 0P 0PʬR Ѝ ᵐ᳐ ᱐ᯐ@᫐ A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,CPP  D0HRD0000H p0$`!bP@0SЍPЍpp@-PQpA`@7 Q`1000S 1Sڸ0  @T @TU p0 0` pp!!R& B(B((0 C RC00!0R0ڸ : h2P000S j @T 0 0=-M  0 ЍC-P@ p$P ?`LH/\O NI ^pGPE ࠡPJ@ 0$ @C@-PB2@` M0@0 !p Q,  !1pP0 01 0@00 @0"! . l!OP6X10 R00S Ѝ@,QP, - Ѝ 0pP00 q00@00@0 0 0Ta0 @00P@0 l0Pp  PL0 0L 0F @08@0 0pPT;p~~`A-p@`Pi,TV!0000 A /? O-\M( 0H00*#Rj(/@ T4   `` RX080@80@  @ d?0SP(h?@ ? 0<000DH0 0  0SH @<000h0S80@0801 H000 S4x>( P0@{0, 0!0 8C8PT' H00F  @HDHT,0Q0 00SH00S\   R ,  H D S400,01$00Q$0 0P 00AQ 0$, S00,0,1$0000 S 40pLH0@0D00|00jp 0SL01H@400 0,0000,00 0Yk0Y 00 0S` S0F 0R^4000,00 1 1 01IY0CQڸ</o"L\ Rm Y@L0l00P5P 0 0 SPT P+0 0S0R0S 00Pp ɟ`V0 0CSZ  S[Yp$ 0 AS 0 V P0P ` P R  0R  `9(00S< Q0C0  0Y,0 0S000,0 0S(00 R, 000:3s D  RD   00SA 80 T8( 0`V 00P0 0CS 80 @o@ NN Œ Č Ȍ N LL80\ɟ`Vpl08( 00S=0X *1h"0( ,80 04 ` 0``0, W Pp!q@00S{000 @0$pd 111qW`H7H'HH0 #<00 00S 0X *1h"0d40V @ 60S O6( 0p}Q;0A0 0C00| 10 0 S( PP 1 11RY@ RRQ 0   W %( R R !%`FPA p0p`P@ !?3 pGWaFfP `/0 < p  L  aP 0P0P00 PP0P0D0T H00S y080  400 iH ((4 0 p`\Ѝ8 L0h `T<00D RW 0 R PP! [R  j[ $R_   0E0 0pW  0E  <000$R ( 3@ H000S2( 0<000h0S0F  0 0Rx 4000Vk0 0C B 040H00 R d1S\Ѝ4 0080@0801P00C\H00^>0SC S\1( 0, QA@`34`! ,\@XP ppX@P HP0@, Q J   4p@,@ APWp@PT ``8XX4(d  r$pXp`TPp P0`, @AVPUDE q@DP P! X @   \`Q  ABQ`P P4 BQO p @ p   ,@ 0$8 R p P p , [!, !`w @@[`o P0 p WPn $ Q  $P,@08 p P LPA\H0000`, Iy$ @A`0,  \0 `@0040 0  0}8 0#00@ 0C40c0 pWPx p p P,  BQ 0`  R G 4 DP  LPp 40P pL0Y0I D|  p~0TpP:W WP@ r@DT GpGGD@d00: 40R0pp,@0A0,00W0C00P p p000E,0" PU U Ra0 R  W R R"R10 S0@a 0 RAA LD8$ `P@@@D ,@T \E$ P0B `0 B8 B!! 00C~ 0U40P0 P,0a0 0R0h400,@P d1S ( 87@ < <000!R 4Q R dP  !@ ``B 0E00p~ 0E  <000P$ D8(  <0 00<0,0 0000Sp 0 PC<0U0 4000P4b pQ_ S4S 4Sy W00Q?H5S<  \9( @` 0  `f( <@0 0L00 0 3<000A( x>@ k0 `C`0  <000tW ( U0 U<`? 0 0LEP6Pj <00p 6U YʕbH5Sp@TL 0$`P@@U= 88PP `$= 'tƒ /A\  B\  ^tƒ    /01P0A 00` P;ʀ:l2 S3030 /@P%0000CS 00000000000000000/@-P@M@&\\ Y #3t P P 00 1000 0 [Ѝhp`P -P\P Y # /0 0 |  0S h h0 8=0!H00 R/@- 0l0lH881 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R! AR  x0t0 000:h/p@-P@0@`M0*l"R R`   P H000 40@ 0 @ &Ѝpp|02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R. R !`@ '( v@ Ѝ1=00QM0SJ\1`20 L100 70剑Q:20t1=00Q!0S0`20l000 0剑Q:20h000 0`0`Y0!Q 00`M0!Q 4p0 0 0/|0| 0p@- @00CS0 S 0 S P00QpcP00p@-0CS@0 S 0 S P003pEP0000 0p@-00P x@pp@-Px@p 0 00S  @-@J Q P\,Q    @/tH0P JP\@-\,AP / P/0S/p@-    @ BJR@P`,PTa@@@AR  Q0p3O-0PP`$MCp@ V w0P   BR.)*)0002T0 S80  22 0@P  B@DT p`$ЍIɟ, A A!RA @\e(p WH qH PYW:(PpG 7 TPE0P ?[1 p"`Pp sPP*  U   "0S(@0 TDIPD@ 0(0C\00C zMe$ЍC}q X@ @  D0|0lp H0001@D T `V `uV ``  @|l0 0 Hp@-@Pppp@@0@0p@- P@ ppp@H(6O-0dM@P$0[ Qv pv`PtR P>s0P 0L W00P  040R0000P0@SD9H-@?`0XPP000PEPUG0000PS0401 000 `Pp @R?+40T R80 # 4000C?00HvP`FCvHP` m0P 0@0 0z00 0HP8  #8 S R0 0?P4/ZWЍ0H\8  #8 S R@0刀0pP4/pWtQ" @-@M  R ! R "R pP^ 0 0 @\Ѝ /@-0QM   S S PpP$8R@ @ 2Ѝ8- M 0 ЍܓD0D0 - 0 $M  Ѝ䘓 p@-B\\@0O ^\1  @ % a ,\'\ n{ \"LB!!A0 ,"!! L0 }p % !    >{ \PUC 0 ER:d!@`P    P0 B! {c\ "0  \\:\ '  px @ l %L  + {l {eQO-M  ioPP 0 &  0 S  n u@`\,S 0 @ 0 S -  QS%S+0L GSSQPNMLjiIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! 8 0 S:q# 00PЍ %0i\@0 `f` 00#1.Q0*Q 0S m@0 SP0% p  0  @0d\% 00 @ d @ 0 SP0%  p  0   0 @@%  c  0 SP 0% p    0  G0%  + @  @ c  @0 S}0  0 @0  00 Sj0 0 @0  0TY 0@x0 0 x0  @0  0 00 0 <d000D@0 @W 00T0 S\R [# J00 S $0<  Aq/ 0> 0S0\S 0 S0 000<p@-@P0P`M0S PS   00 0Ph 0 Q00QH  < x0  Ѝp 0dЉPA-M0PSL!00@0@P0S? `f0 #0Ã!1!1"b2c@AL0L  00210Bq0P pW$P@WP 0fSPЍЍ 0ЍpNgA-M0PSL!00@0@p0S> `0 l#0à ‚ @0!0A1 0120BQ`0P pW$P@TP 0nSMPЍЍ"0ЍhkL>C-M0S!0 0@0`0S2 P0 p #p\1G $@0!b!bpG4p r1c1c@0 0#3c`10BqP pЍ0< qW X $`0sSP p`XWT 0S RpPpQPPЍ-?L*S0 O-TM>뀀lalpPQ ,$  R0: 0 @P5 5 e000`P 0: @P} 0S  R 0[ @ #[ =[ =Pb 0000xPX  Y[   RRmpP W,0 0  Po[ o0S` P@ 0 ᤓ1" 3$ 112cAt3L112c B L00)ɒ! C 0#뉑0P0 P0 0$0 B `@H, p@X 0Sp op= @P0P xoyXPp00TЍ m j 0 ((  ! $ 0ƒ00@ B0! 0)⩑ቒ C뉑PQ 00 @> = 0 〱  ! l1$N I$04‚!bƒ1c!b1c N0I 00  ࢐9)1i1c1B 뉑P 0tS0cS0S㴠 0 @00 Z@PV  < 0S pp `mgݵNl>kL<-?L*SB A-p@`0\ %\0PpS sS lS@ 0\TTW 000P1CP0@CV`1D ! 00O-pQ┮qM  PP, 00S0405 `$  l@H 0S1  RS G@T l P  4 @@pT %T@%T400 R,:PkP 400P,H=% , 00,P0 0͟0p0 :T T) `DV%?#"< / XT c`D`Vfz t``` 0`D@lQ0-0 >T0p  Tg@W -@@@C?T@^ >Tp A0D =R=S3t 1CYbevV.`^`0^@ C @0! D 02\* R:0Z'TOP͍ ͍R'RT0   R'R'R@@ppI@[iP 00040}iP, 000p^ Q1`!RX 0BS11`U PB=1&@DQVTywvurrpnmlkjihgfedc_^\[ZYXWVUTSRQPNMLKJIHGFEDCBA?>=<;:987654320/.-,+*)('&%$#y1S 0C-11@ Q 340`0 R,[*P  0ᇌp 40P040`OU:= !1`010@0O1S  0C-11@ST 400 Q,#*P  4 @@8AT @D=AA0@a DQA DR3@D1@ؕ% R ?R ;RK  pR 0%R 0@a0D RA0DS 13 DOS !01000@Sl00l0 0St00t0QU PE@=1QP BOU4=!1010@0@10D R-1!TORP=1=1 @pT!1S 0C110 S@Ra  ?R ;R QeR  pRS 0%R 0 00000 0 B10 OQi͍ 0 0}RR0  R}R}R@@ps!R =1X@ BT! 400 Q!`Q,*P  0up 40040@N, 40,qߍ! 1K 00@QU PE=1@1@QOU=0@-01P @Q %-1 1OS00PiP 400P,V 2iP 400,`V ᤦ``&``VP``P``Ì`@oobP``V `{`@xu`rQ AQ A QU PE=1!T@QOo1BV 2 hPQ 400 ,R@pr00@m 0 oh00 @a00 ' V8x`T00Q&@D0Q0VT&$#"y p ]K5#0@0D!@D0OoB000@00- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/,WA-pQM@P 0S! XB gP `V! 0v0* V U~ ``Ѝ9pP0U0f ``U 㠰. 0 0 R U ᒰUlP0S U8 }( p 0S R 8(C8B((0 000SU00P j  8C8(0P j  8C80T@U@:46= > > `> > ht@PU4> > < < \= 0R@- ME0S@  ЍA-pPP U) |@T`V 0PS |@P0DiV  BP :oO-PRM `Q 00Ѝ@ pPb % [Pb UPc P%O0 ES  fP  P  0P P P~0 S  P  `s0 S  `  h0Sn  a0`S  Y0PS  Q`V$ `P \g$`%!fP !fPfP  .뼰 0$[PP " [ `$@  (B8BBXnS0 sS fSU0/oS" R0000P0`h&h V 0@:  0S  C("(  ` P0  P W0U PpU 00d P`Vl 챟Q`Fh&hVPb   0 SPW   P`U= op嫲  `PEX%X U !   X p *` | p0 00 r PR0W00Pi0X0  a 0P/W  R000Whf  .eP$+ JP0(C-@a!`MPp 0㊇ P 000-0S? PЍa`P  P0 p  R 0S 0PPP  PP004PЍ  0 iP  @``+ P*`PbL6 a@aO-M M0p0:S&0:SS@ 0PS:S``E[ P!* ;0d@0  jP 0P:S ۍ Ѝ@ۍ ЍC-PŸM Mp@`t;P# 0/SB GP/x.P 0 ۍЍC"0P ! p P+ph0P 0S/S pP keX vceY WP ;0 ۍЍC0 PۍЍ  p 0l:e XW P0P 0 $ۍЍ404 0 $_3 3 3 p3 d3 3 ^2 ]1 G-p`@P  _P eU  VP `P@PP @T P  0@010GT-@- M@00 Ѝ@ Ѝ/H Ѝ@ Ѝ/@-@ddd@dd d0d@d 0p@-S@M 0  Ѝp0`P0 0 0 0` 0 Ѝp 0p@-PS@:pS cP!p(bC- M `@V pᬐP0fU@@`V  V W0 nU sU K `V  @0@00 Ѝ R@@@C- M PU# Ѐp`fRPU @ #00P 0 @nR sR PU 0 Ѝ 0S008#8 ЍPA-P# P 00`p`0,SS00 0\,\@CaP   `p`@- z C-p M@`P(P>NpWX*nUO sUF fUH0D Y)RA @ bPK H0D@ pH0@0 H0H0nUp@0 H P4 sUG fU? L00L0 Ѝ@P%  @AP80W D 80400 a 0S00 80 @H0R# ,0 0JH00H0H0@ HH0@ 4008H0@04 H000H04 0H040, R0 0#H00H0( + + 0O-M@0[ ` Z p p(080H0`P0; P0  `00 ` ἀ[`   ` `pZ `   ` ` 0@ 0@Ѝ0 0@- 0 @S* 0\ Q \R 00\ Q  @00 RER\\  :Q  Rx00\̜A-`P0PUM@p"S& aP !P  ᴀZ0V00  pO  00 0ЍPЍ_ p7  O-P@ 04M 00P 8b`Y`4  pHa 0P 0  b`| ? @P @/a0P b 4Ѝ  0 a a,0Y (0 0$0,0% P@ `,, `AR   0S00WPv Y  Tr  `" aLp W@`H @ D L F , `$fV8   0 P+ pW9  BHDhDnVDH sV  "0 S  t ,@  `xa 4Ѝ _ B `$ha$bb@S# x# A-P`0`VM@p(S, k`P$ A`  㶀,000 P#00 0 0 0 0ЍPЍ^0@-P pW M@`R /`P 0 ` 00P 00 0 ЍP Ѝ^O-TMD0 (0D0,$0:080`P ||@P00PP 00SzP|T LPHd:P{P_P|  P" U $0 T $0(,P `= $010#0`,00 0xGxwP 0s 0PI (,P 0S , .S  ROS1 = @P# PPD @ HDHt 0n P LbL00S P PJ$0 F0 0S t 0 0E0TS$0 P0S000040'X0] 0S# ` @0@SR xGxwP00$000 000 f0:PV 0 `@Z 0 Z` 0 Pg  (\Z  RYX%Q^ZQi @T 0&0FS Aw  0P 0 `I0J0 SE0J/SVTSRQPONMLKJIHGFEDCBA@?>=<;:76{3210/k-i+*)tyu0Z@ Z8 50 00@ 00@0t58 0000  0P` P`00^ 64 $ 0P0@f P <P" 0$00 000000 s0lPi C_ o TЍ  00P0` 0 0  0  0  0  0 04 $ 02 0?T 0 #t  0 S00|Ps `

$0P00?//Т@-M@0 ~0C@N $@L0B!b!bN?AA4 1c1cL0P0@$D$C!d!bA@C1cPЍ-?LH*Sp@-0MP0`2@P 0Ѝp^, 0 0S Q20Ѝpط1!0G-@a0PP04 0 4pS 0p02,0BPP0  |Qp`  /WPepEȄQ  $W| 0 ȇ0H00蠆@BA@-@P \\\ \$\,\\,00!R  !@ 001/@001P//@] @--@ \@\ @ 00s@ H PJI HH @꤄tp@-G-(M7@ @`0@PS~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " kU{F{{!00 (ЍpP P # 0U 0 f {Ukka}!00 P ~P T# 0U0  0"{P  0cP0J30{U 0kk iP  0cP0G20U 05{kF{{TPn  0cP0t20U 0x 0"BP;  0cP0x0 0U " 0P;  0cP0|10mU 0 !a1""UJP.  p0cP0%ʘ 0U " R b0cP0$d10U 0T1""P  P0cP0$10U 0 1""P  >0cP0@00U 010""P>  ,0cP0@ʜ00U 0 0"P  G??(t|  T d G x $ 0cP000{ 0kF{U{# P  0cP0uʠ30{U 0kk Pb  0cP0\30{U 0kk3 mP  0cP0n30U 0_3""[PF  0cP0L20U 0=2""IPO  0cP0ʔ20U 0x2""7P  0cP0EP20U 06`2""%P5  |0cP0 20x{U 0{ P  k0cP010g{U 0{ PD  Z0cP0ʌ10U 0`1""P  H0cP0H10uU 0 P<  70cP0k10U 0\1""P_  %0cP0&00U 00""P  0cP0ʀ00U 0t0""P  \  <     T l h   D  G8   0cP0(,00U 0<0""~P  0cP0l00 0U0"- lP  0cP0ʰ00 0U0" ZP  0cP000{*Rk 0F{U{ EPn  0cP0`30U 0q3""3Pd  0cP030U 0<3""!P  x0cP020U 02""P  f0cP0Wʔ20U 0H2""P0  T0cP0HT20 0U0" P  B0cP020 0U0" P  00cP010fkU 0{{y P  0cP0ʈ10U 0d1""PN  0cP0 <10@U 0% Pc  0cP0Z00U 0K0""P  0cP0ʸ 0U "5 ~P  0cP0qt00 0U0" lP   4   G<  |     X ǀ 0cP0_(00U 0P80""DP  0cP0h00 0U0" 2P  ,P  00{kF{U{ "00 t3030vx303 U""00 aH30@303 U""00 Q30\3 U""00 D20{Ukk!00 720202 U"$"00 'x20p20c2 U"!00 @20}t2 U""00 2020L2 U"!00 1010$ 2 U"p!00 10b10101 U"Gn!00 `109X10kh1 U"^!00 (1041 U"Q"00 0000 1 U"BA!00 00400g0 U"1"00 00< H , 4  T  (  D p 8 D t ,0 U"T!00 bP00FX00`00.htp00Nx0 U"!00 I00{Ukk!00 9303 U""00 ,30{Ukk!00 X30vP\3 "ZI aI 3 "U"00 20{Ukk!00 20{Ukk!00 20S{"00 v"00 l" d" A  :PI S @ a"00 \"00 W!00 R!00 kkK!00 F"00 A"00 <!00 7"00 2"00 -"00 (!00 kk!!00 "00 0Si !00 }0S2 !00 u0S !00 m0S !00 eP  _0S !00 W0S !00 O-DT! @4 t $ 0S "00 70S !00 /0SO "00 '0S/ !00 0S "00 0S !00 0S !00 0S !00 0S !00 0S !00 0S) ~!00 0S  v!00 0S n!00 0S f!00 0S ^!00 0S V!00 0S N!00 0S~ F"00 0S >"00 0S 6!00 0S .!00 0S &!00 0S "00 0S !00  3 H "#P !H H 3 "0SI!00 e0S !00 ]x# cp# v"00 R"00 M"00 H"00 C"00 >"00 9"00 4"00 /"00 *"00 %"00 I mI |2""2l0 0 2L0 0 2,0 0@2 0 0\20 0820 020 010 01l0 0"1L0 0K1,0 0H!00 P10 0S,10 0j10 090 @@C0 L0l0 0~? p D H p h ` P @ H h 0 T  8  0H 0P0 0N40p0 0E2X00 0<|00 03`0 @@0 &s0 @@0 100 0u,1P0 0,P1 @@0 o!00 10 0!10 010 0G2 @@(0 82 @@|X0 l2t0 020 0+@!A*?B0CS Ϡ-6S!R#  S Q0 {+C 7G 01046n kȠȠ+S 0+C{6F{7 +S0+C3S S 0A.B B03200P/ /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00(@ ( 8/P8,0S0Q 400 @-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?000CS>0S! 06c@<=0 Q,=00 C/(0 S0(0< 03@`<0U 0PEd@T0S`& <0-T0PEd@TU0 C0 0,0 Sp P<`@@C0S 0,S40 PC0000 00 0 0 00[0"1<@0Q3 tR0 p (RR  4,00 PUSYt+H; 0 40 30D <Ѝ D R S R  P;0 PB 0S  0 0C R 10U 0PEd@T 0 B00 00 000R00S2P  0 Sf8&#4<f4#0R :00:0 00 80B4 R,5@0 0000 D 00R1 P! BD A   B\000D0Sp90l9 UR000 0 pP<`@@ d0)pS ʈ0  P<`@@ ;tTUL 0PEd@00 S  Sg S. 8a@D00@T6c0PEd@TULQlP80 R H0A S00 CR*ʈ+R~ 80070LQcD0ʈ;70\0T U 0PEd@00SQqʈ@6c@D \700 $ R40,0000 700XU  PEd@T  E !RB 60U 0PEd@T: H0!ʈ0H0;6a0@D;Ut 0PEd@T:0D 1ʈ0+D0 6a@D+D$60[ U 01[![V 0 0C 00  002D0 PE 0CD0 p0D`l QT U5 0PEd@00Rl @Da0 T ld0h \X ! 0PU 0PEd@0S^6c@D0l0\ 0x R! / R>400 Q 0SU 0PEd@T 0V  $400300 C R=0 U 0PEd@T30F?o20$0S0a #3$&$B0#22cRV0S  l30T0PEd@TU  0t$ R R& D U1![ $Q P LQ0Q 0 B0 !^0  0D PE B pD Rk0h" D 0$ R@" D C$ R$ " 0+06c@D;D10 R 0 B D  0|10$0S  &$   0K` `@U) 0PEd@T$0D`S` 010`+@U G$ 0R $P (D R2D507S U      0c 0S PE p0X =?>?N?P?5? TM? Q?H?A?L?l J?  C?@ BH 9?:?;?0@\,( @Dʈ+6nc2a@D0 D0B $0S`0  03`@03&8#[ (30Q Q6c@D;D  3 +0l3HL0  300@S3D0y `v0aS3@D0P0;T030 0X00\00 C[PEd@[U6c0D@C c P5l01r0ರ^l4a@D0R!B"0$ 8 S0l0S>0p0P00X0?0X00 p0tmP 500 (Cu @m X50`5@0 0`0n 00`P50y5l 0[pPEd@[jUEF0L0Sk 0 0006c0D@Ca|(1 T*U $((UW PEd1岐@^ $(6c 0DQ6k @CD 7L0 $ R&400  0Z87@`0F 0cQ0`+@GP6c@Db 0ಷ@D&a"@`07l00 0 00pP<`@@0 $(C S>0p0P0 0X0 Xtp0(0$$(0P/ \80( &b0R0 S(08@D0 0cSR: 3@ 0@l08@0390߇d p T  \  \ h VP H90j0 `C^0Sl90Tp@-@JPP80S $ (2/$0(3/00pPA-@`2PP@p0 QR 408 B4 08@ V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000@P`P-@ R2Q <001 00S!B<@0 RE R 0c Pࠓ^ S R6 0 1 R` @ <001 R@ 0 <l0P\p[ G R R 0c P  R S R 00S  0S  pl0Sp0p0Cpp0)x 000 0AP,040p0 p0 0 0 30 Ѝl0S  pl0@@@ ꊆ<S???x:P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-PXPZP 0|!(`3/@PW 8pW8 (  0(3/pPH 8 $!P S>0R:oRS B P T  B T p W0Bp$ (0 #88p@p  BS>00p08 ` P S>0R*pS. 0A p p$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰PX 0C0 0$SQ $C0p`0 sRpW0- p  p0 Ѝ0` R`V40sDJB 0|=J^S3 0b6 08#8^0X 0 0C∀Q\ LX P!P0!01 002T 00(0! T 0SЍ0W0T0S Ѝ 0D?o240%R00S020,0@0000,004@0D?o280 00C$0 (00 00PU?PU@PUAP0UAPR@oPP 0CX2p0;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0l0\000Sn tP LP`,0S P'p00F S#0`0 h0S:l R1#P0 6SL \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 BXl0\000SЍd#O-ldl`,M Pt \l@80H00XT 1#D04 @  QH0@ ,0 DA?C0CR`Pƙ Yp0&0D8#( ƙ#<0ƙ3@0 B0(1I>RP30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tP` l H 07#0H0Xl \0P8 B l0\000S,Ѝ80&6&6!Ɖ909t6l L Qtl \e 7t0 S` R S9 Sl@sX 1`o 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 Hl0\0v0P,Ѝ\P80 B0 5l0\0c00S,ЍO- M ,0PK[@!ܔ0 P0pUpX/o" Xp ypHor 04 0 0B % B 0 0B 0 #40BVU2W0>&* Q!L:l`\A `Fp W P!P1UP! U:XUppU0\ 8`1  {\ 0PE0 000C00U00\  W 0 B0 0 PpU` , 8Ru0A6N,0l0 &\0PpU`l0&R65V`    R\S#` Ѝ R R0 PR \:0S@\!f!glU!1^  RX  p\h$X  p\h, Rl R O- M`ܟ 0P0\QpY 0@SQ QKW0ϟ S  RE R  R( (pQBWR BQPD/S6Qt0S 0S: R R .0 103/0@S0P P0W W 0S0(0 Ѝ0S|>00000 S *S0SWq00Q 0SD0@S>P0 W0Sr S00V0 00#400 0 30  0#400  0 [0S0c0?o20 Ѝ0 0&S+B(l0S<  B0#2 2c0# 0l0S q000) R0f9S ,0 00 t0  R ,00S0Q01Q0$ Q R 12 0 0 0 0#40 0  0 0 S0 S 00R01 0 0  0S 0 0 0#40,0S0 0E000S ! P B R  PE[ P 0 X0 *H 0 ,0 SR0 B00 0 0 0 0 0 S0 S 00R01 00 q00? R}0ES IS< [S7 gS7 /0S0CkWi @8 RC0SS@ S   00#  #800#"0  | ,0 S R 0 0I000S'  0 0S0   0S,0SQ5: R ,0S  R0 0[00$0S,0=  0$ 0S0   0S,0SQ: R0 B000 B000,0S+  Rg00 0 B00,00g  S  0Qq R0000 #40k0q00Y0SZt 6l8&`6&6!ƅ909&tl0I0Qtl0" Yt0SWd :W㴖K 6SW \0l S8  B0 l0\000SEJ\ R8 C0 l0\000S8 xZt0(l 8`R B  ^C 6ƅ6ƅ6!ƅ909&6Rt0l 0C t0l S+t0 SW S Sl 8`0  W 0S0 B00 ^ ^  [ [ [ [ [ [ [P Ko᫲[@ `P``0P&0@&0!0ƅ0 01I>  1001&=  &6`Rt0l 0C `t0l z\0S8 B0 l0\0800S=q#  #800#"0 00^\ LB 00d*W6F &R= \ R80l0 C<0,0}j 10 0 0010 B 0L0DC0C t0S*l0\06\0l S8  B0 l0\000SD10-\ R80l0 C97531/-A-`pPTqP@G Q00V0SI04!S 010: (0sQ Q 1@0@!A00000 |0`]p# 0S%t l00\ R6S S L D0 B C060@! RppTp@-@0PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV0P0pPO- Mp`80S04< 08Q1S00PP 0 0S{ $0Ss wpVjV`F0HSs0FSRo WmZkYFo᫲[dV @!( `4/@Pi  @ X  P "L  BT  A4 * 0`, ` ( P6/, ` 8(6/L ` @(6/j 0 D(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0` (0} Ѝ8  40 000&X-M 0 0 AЍA-P@PUP_8 ` 0l!(3/@PR T!@ 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C006& 0&;> 0$0;/0/O-@QM R0 x  0S " !,"pHP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A $ " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4X RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C  0@S 0 " !T," ЍP ""pBW1C1Pu.83-h-<--,,+ C-PRp ` P  01!0\0 0#@B .P@@1R0  C @$',+ C-PRp ` P  01!0\0 0#@B .P@@1R0  C @$'P* @-@P xpxPp`@` 01ē!0Q0 0#B  ) @-@P xpxPp`@` 01ē!0Q0 0#B  ( 00@-8P^00# @L   0 G-Rx 'xh Q RO SRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#pG7&c20N 1pW|GpG1^NNPV=F10C>@@P  $B0R`R0pR p`0pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p`R0`pR0p0\@0@0C 00 pQ80'7b"c2pGNq&R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/z U/0S0`0//P 3m56@-S k>@@0 #400k.06S0 k΁ς 1O- p:PTU0!`Q` !ᲠZ* V @: U @0ς!\KU V*  p0Q=0^ Q- Q- [ O-@ 00 0p0 S01 ]Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C00 LQ @00^ P0 00Q00S@\ R 800SC00 R0@\<ЍW@  yQ / !02@X1Z Gೠ6;#6pQ^p N  p=A-P@1T`R`QPEP0+~T S#Ό` T000U0 S @S ΌT00 T,`0R V1>0T000` S ʰ0T00 0`0T00 0``0O- M`V00Rʀ@kf W !.⼐ 5b8Z#8$PB 000#406P0cY 8#8V⼐5a8Z#8P000P%TPVAPeY58#8 B("(Q1P8#8000P#406cR!0C 6V V0T@R p` RPF_oRPU RV0W R+AʲpᰐgZ5P8#8000P#406pGp0cY38#8 WvA7Pp8#8k.00P0p#406VPcQ 0C6B0T@ Ѝpᶐ5i8Z#8PPI0 00#4 06P0cWs8#8 UVZ AU0pX%Xk.PPP0p#406VPcQ 0C6 0h0cQ^`弖0ᾠ9`jY8`J #80 00#4 0编0iQ8 #8 R0἖`3006/02PV , B("(5VPk.0V0p B("(7k V0&0a8p#8<ʀ6O-Skn⼖0M $P  #  # #  #  "!A 9@b8 T#8@p000@p#406 B0c^8#80἖&R @ P$ pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಐpi>X8#8000#406I0cWs8#8 0@弖^| `D B("(9@n8 T#8@@p000@p#406N0cR#8R0἖\ 9b8 Q#8 @Pk`0`00@#4PP06 Bc^ 8#8k0&Ѝ0἖10἖-(((((0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&XʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 ;000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@, R 0p&]P+(+0N  q/ ! RF@P j   Q&Q3 "[r&k R0E 2 8#8000 #40&0bP8 B#8k0&N.V }G.0 0S0 0xS0  0LSI>X&&&&0 Ѝ,  \ P+R +R ,RE R  Q ,^ R3 "&][Pj 0q ЍO R \3 "[k 0("( Z:8#80 00#40缦0jR#8 J#8+ ZB!(:ἦ8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦv8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦU8#8kΆ000#4 0缦0jQ J!lMk>⼦ / ! Z! ! 缦jR! J!^ἦ   u Q3 "[8!8#88#8z8#8W!28 #80 0:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  0S A-P 0@ Cp`mOVUV `O'P &/@- M`@p*PP PH  `  jOp - @P  Ѝ 0@0 Ѝ@ Ѝ@-T  Ѝp@-P*@P @00p{ 0 p@-@*0P 000j 00gp@-MP`v*@P P @ 00Op g-PЍpLP_-U FPЍp0A-S ` 0@ CpiPNU/ 0 &0PP%yara0A-S ` 0@ CpEPNU  0 &0PP%tcid0S A- p@0 CP!`NV `/0S A- `@0 CpPqNUW&(0PP/%yara0S A- `@0 CpPNNU4&(0PP/s%tcid0@- M P@ UNp  @P Ѝ0@ Ѝ0@ Ѝ00@- M P@ :Np @ @P Ѝ0m@ Ѝ0h@ Ѝ0yara0@- M P@ Np @ y@P Ѝ0Q@ Ѝ0L@ Ѝ0tcid- M Ѝ- M Ѝtcidp@-@P%0PPptcidp@-@P%$0P p00ploobp@-P`@P  0@$p@-@w@ @-@q@. @-@k@F @-@e@b @-@_@~ @-@Y@ @-@S@ @-@M@ @-@G@ @-@A@ @-@;@@-@5@@-@/@!@-@)@6@-@#@K@-@@[@-@@p@-@@~@-@ @@-@@p@-P` @P  U0@Y$pp@-P` @P  C0@G$pp@-P` @P  10@5$pp@-P` @P  0@#$pp@-P`0P @P   0@$pp@-P` @P  0@#pp@-P`v @P  0@#pp@-P`d @P  0@#pp@-P`R @P  0@#pp@-P`0P> @P  0@#pp@-P`D @P  0@#pp@-P`2 @P  0@#pp@-P` @P  y0@}#pp@-P` @P  g0@k#pp@-P`0P @P  S0@W#pp@-P` @P  A0@E#pp@-P` @P  /0@3#pp@-P` @P  0@!#pp@-P` @P   0@#pp@-P`0P @P  0@"pp@-P@#(0P pF0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@"pp@-`PZ@u#<P pP U patadp@-P`@P  0@"pp@-P`@P  0@"pA-P@:#X0P pb'`P  P `)gntsp@-P@#(0P p0P 0pgntsp@-P`C@P  F0@J"pp@-P`7@P  50@9"p@-@R +0@/"p@-@ P"$0P p00ploobp@-P`@P  !0@ "pp@-P@P K!0@!p@-@ @1 @-@ @I @-@ @a @-@ @} @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @ @-@ @- @-@ @< @-@ @Q @-@y @f @-@s @v @-@m @ @-@g @ @-@a @ @-@[ @ p@-P`@P  v 0@t!p0p@-P@P  0@c!pp@-P`@P  S 0@Q!p0p@-P@P  0@@!pp@-P`@P  0 0@.!p0p@-P@P j 0@!pp@-P`@P   0@ !p0p@-P@P G 0@ pp@-P`0Pq@P  0@ pp@-P0P^@P ! 0@ pp@-P`M@P  0@ p0p@-P;@P 0@ pp@-P`*@P  0@ p0p@-P@P 0@ pp@-P`@P  ~0@| p0p@-P@P 0@k pp@-P`@P  [0@Y p0p@-P@P 0@H pp@-P`0P@P  60@4 pp@-P0P@P o0@" pp@-P`@P  0@ p p@-P@P L0@pp@-P`@P  0@p p@-P~@P )0@pp@-P`m@P  0@p p@-P[@P 0@pp@-P`J@P  0@p p@-P8@P 0@pp@-P`0P%@P  0@pp@-P0P@P 0@ppp@-P`@P  `0@^p p@-P@P 0@Mpp@-P`@P  =0@;p p@-P@P w0@*pp@-P`@P  0@p p@-P@P T0@pp@-P`@P  0@p p@-P@P 10@pp@-P`0Ps@P  0@pp@-P0P`@P  0@pp@-P@m(0P p 0P 0pgntsp@-P`@P  0@pp@-P@P 0@pp@-P`y@P  }0@{pp@-Pi@P 0@lpp@-`P:@<P pP U patadp@-P`7@P  D0@Bpp@-P`G@P  20@0pp@-P @P l0@pp@-P $@P [0@pA-P@X0P Np"`P  eP `0%gntsp@-P@(0P p;0P 0pgntsp@-P`@P  0@pp@-P@P  0@pp@-P`@P  0@pp@-P@P 0@p@-@Q 0@@-@R 0@p@-@0 P $$p@PP#0S #p̲z#0,a@- @@a#ɱ`P 0R @-P Q o//| t| P r0 0 t@-6 6 @-P Q @]@ @0@ 0 f( (0( 0 g߸L 6 6 ( 6 x6 0S p@- X@`@@PPpP p@ P |0A-P`p# !@P  P` `pp"┱P` " $" `##D^p@-P @`PpP p@@- !@P $ ~0 0 0 ȎA-pP m!@P"  k0 0 0 9P\!`P  ᛹` P0 000 ,0< 2`@|t @4 3 /@-@P @ e 0 0X  3 T3 }-A-M `V $P0 PD@P!pP  0PD ;ЍAЍ/ЍAЍ/ 0 0t < 3 2 UT+ @-@P ȳ@  0 0X ɷ 2 2 }p@-@P x0 0 0R0 P 0P Q $ p@pp4v p@-@P `0 0 0R P 0P Q {$ p@pꠋLv P/0 0 0R /(P/<0 0 0R0/P///u 0P p@-  o QP  QQ 6$/ᨊLu P/ 0 0 0R/ @-@P \0 0 0R  > 0P Q  $00t P/00 0 0RP///tXt A-PPM 00 0/o"P R Ѝ R0 p 0 p`P 0 S  R H  C pP` >"  00$(J hs \s A-@PM 0 0 0R ЍQP 0 ៲ 0p`P 0S d  PNC pP` "000( (0( $0 ⊶(PI r - - ; P H0-0 0/o"^ R  R/0P/D0 0 0R /@-P ɳoԆq P/D0 0 0R /@-P ox@q P p00 0/o"\ R RP Q  Q /p p fP 40 0 0RP zw/ጅlp f(0A-SM`.P@U Ѝ0 PP pP 00 0uP* S'P0S0"Q00 @P X 0 0 0 @Ѝ( ]P %!d P 00#0 0 P 0S S R/P/ R0/  @- @h8`RHR0p@-S(M- {@ S  P{ B` `vP P (ЍpX  (ЍpD P { A(0( (0 F|) $) |) ( h $) $@-@ɮ ,Q@-$@@^ŭP @- M`@pwP P 0P!s*0 00 Ѝa0"S@- M@PpV` `%qp 0 00 ЍB0"S 00 S 0 P :\03#/S 0 P \0///A-Pa`S@P (pP  :@P ᄭW@, ,0, (0 {O4D 0& % M 00 S 0 P :\03#/S 0 P \0///0@-M @P  @ Ѝ00@-M @P  @ xЍ00@-M @P  @ jЍ00@-M @P  @ \Ѝ0@-@P ,0 0 0R0} /P/0 0 0R / 00 !S R!* R0:/ - ^0 : 0P0*  R*/@@/ / |}P $0 0 0R //|P $0 0 0R //\|P $0 0 0R //$|P $0 0 0R //{P/d0 0 0R / 0   \*S  0/S[ p,p0 S S0` ` S S/S >S S 0 S S0FU0 RṍP0/S^ 0(00>Sa S1 0S S S   0CS R` 0 S S   CQ RS `0 S S S S 0 S S`FV0S p0 0 㡮 S =S`B`0"S0S   0"R R  "RC$ >R0 W0(00>S` 0  $ 0   G-MX@`pO P V W$ P <P &P@ aR lR gR- qR uR oR  tR ;R@" tR Ѝ mR8 pR oR sR ;R@' ;R@< tR ;R@>P P"P \P@ V  P U WP P pR ;R@  uR[R\ BR񏐮qvhg"R /R@S00S@Ѝ!1 0 ⴭ    0LPp 0 +("( RB*0 Re \Rb  uR^ 5PY +  PS6I %"". 0)" " <,  0   ,0     SPY$ Y  ͕)  )# < 0,!  Y*-"-  }  )&  uX p @ G-@p` W W00 GR0S p W W00 GR0SWL 04<0W0PPF <W0@@k`r``p 00 S S   CQ R<S+  ZP)   TP#  NP.0@S@S -S 0@@-S0>S @ 0@@0S>S0 @>SSS @@ @YP (0SP  R @W' W0S@@a@gPV` /P @P D $P0S ,  4@  9G-`-MǏ@PX ,7ppO s9pO 0PH h``S`Gp0!  ޔPP7u3  ` p `W,9Ѝ& PP7u  >00T0 ઔp9{`7uAo/A-PP .P`p @@PZ@@@P p40,p0P4080<0<]+  @-@ ,+@-$@@ Ud+\@-@i@fO-4@T ,p` P @D¤@@`T P礀Qㅑ@0@ @@0 PZ PZ P@ T  @-R 0P< P 4Q ,  D D0D 0 )R, ,0, (0 Il[    p p@-M@4 00R0SP,0SER 1`V- P` 0 0P 40, 0C40P% L`ЍpS' R}Ѝp 0 0D Zp p0p l0D \ \0\ 0D cD D0D @0D   P \ ( yx P  T  iA-@`,p PP W 0 !$,P0`3,P0`C-`0SM@PpF  PP00Ѝ! 03P ,0SU ! 0(P ,0S(0S00 0P 0S>0S0"S0:S 0}S "S000"S P  P d @@ 0P , ,0, (0\ 6 > =  $0p@-S \  Q @PPp 0  0 TV 0S 40 00$ $0$ 0 @-U < 4 @-R , B04 P @@ @0@ <0 , ,0, (0 ש@ P 80O-M@ Ѝ@Pp `P @ p @rЍȒ  E`P0 004QY  4 R] ,剱1Qw   P 0YIW  B B!,0 ` 04 p<0 04 <0 \`,VN<V8V+zY& 嘡@ u C`  `P) k 0,S<SS> dPh @<0, 0`p4<0x<C! ⾑,0` Y` [{,/x x0x t0F/ d d0d 0,WL L0L 0  #(S! d|2̾ 4\ 8p@-@PP0S L  Q<0  0p@ 0  0K/ͨ4Q p@-@P 0`0VPP p p0 0  0@S<0  0pPp( (0( $0K/➨P$,8 0O-S M@PR z`L40SM x `P@> ЍsP pP 00S 0q 200PX 0S. @0R* P# [` 9P 0P 0S >P' X H` ЍOWP 0  03/P  40R 1#PP 0 0U/ i 00C 0P `T@zh h0h d0U/T T0T 0]/O\O- 0N tM ` d@-@a0,S<SS6 0  0 㼧 @PG-U `p0VRV@P7 404 S ` c aS` D000,0 100,0$ 100, ,0P  @ ?o2\0S0S P`P : . ,404 SS` " `D D0D @0c/S0 000 ,0c/JK ! t7G-PS @- Y`' T 1p 0R  ] [ 004 00R% NP J 0S 0 GT~d d0d `0i/0,S0 000 ,0F/JԶ `1  G-PP' 0 0R"p4`P 4 R @,0儡ᄑ1  ,04 儑@ 0T:80804 `@I0P 4  Q@-P80080/Hp@-P@c80080p@\p@-@P 80 0R@ pPN4@Kp Hp@-@P \0 0R@ p`P900S@#:3p@Gp@-P@&@!pA-PP 0 0R4p`40S @40S ,0 @Pm `GA-@P 0`0VpP0S }P @T @ @0@ 0]/@@xF A-`P 0P0/o"Q@@T @0R p J@P @T @ 0  0]/ۥE, 0P \@- ^ 400\@/ 0  0F/⼥E < 0P @-ox@ T\ @\400\@/ 0  0F/ⓥxD < @-PP M @1 0R Ѝ`@@80  Ѝ@9 P 4 0Rp@ S*,P$0 B!400C40<00<0  h h0h d0s/JT T0T P0s/A@ @0@ <0s/8C tuį Pv ,w0P/4  ?o2\0S/0@ S/PB0P D- ?o2 ^0S 0 Sa /BP/0 0@0R/AP/0 0@0R/A P H0-0@0/o"^ R  R4 /XA 0S /A-`@PpP (0Sp  0P  pA`x@  `7d@O-0S@9 0@S7  ` P. X8qPp x P r P @l P HXP0UU@U !#10< ,$Y ?@PO 0 0 s[X% X0@#r 1@-@0P P 0R R@-P 0S/ւo/@ @0@ 0\ ( (0( 0\ | X G-@\ `Pp<\9 \ $ \%\=\Q W m W&<Q0$R 0 B RQ R <R@ LQ @P Wn=+ Wt<QQ 0`S@U Y100@000`pU YX1000@#30`pU Y1000@#20`pU" Y0p000@10<Q@R 0B RS R <Rw 0 |0p Api=Rj <R Re 0w@ @0@ 0p -@ Ъ L teX $A-`P4 @P h20 U0 0 # pP  bp P0@:QP  Rp@-`PP` @P 00` Pp9PQp@-PP @` PP  1` @P (00P `p@\9QP  Rp@-`PP` @P 00` Pp8@-@P X0 00R00S P 0008P/0 00R /H8P/0 00R/80P h@- o QP  \\Q ṣ/7Pp@- 0 00R P`U V _ @P  ឣpV @pD D0D @0 20 000 ,0 )p7l lH P/0 00R/6 P H0-00/o"^ R  R\/h6P/@-H@T  ?o2^0S开o60S A-@(`MV PP !0 jP $0S6Ѝ/ 0P ` pP 00 0P6 0S3$ MP, V8  @P0 00p `@ ` p` 0$ 0R0"S 0 |0 | Ѝϣ0"S @  @Pp4I 4 /P/<  ?o2\0S /0SP/3p@-4@4P@P] 00Xph30S   0 33@-@<<B T (@@=@@ @l@-@P (0 0R*2P/0 0R/P2P/0 0R/(20P D- ?o2 ^0S 0 S7/20S /(0p@-S@ ``P0 ]P0 VP ll `@@ @@pDDD@ @0000 㢠x p<dA-PP  P`p @ @P @@ @P p<```* 0,p0P4080<00@-@- @*  @-R 0P< P 4Q ,  <0< <<0 G,0, ,,0 ?0| Qt VPG-9 pP0`W:W@ 404 S P S0 2000,0 10,0$ 1P0P : 404 S P PSPL L0L 0( ( (0( 0( ݟ( P p p@-M@400 S+RP, R7S 1CaV( P` 0 02P 400C40`ЍpR S l  Ѝpd d0d 0< k㛟L L0L 0< |㒟4 404 0< l㉟ ̛  XA-@`,p PP W 0 !͠,P0` ,P0`400 p@-SP8@S w4 <0,04Q<0pPp 0 0P >| o@- MpW3 0PS`@$  PW00 Ѝ 0 P ,0S x @0 @P  Ѝ0]S$ $0$ 0` d Rp@-@P 0`0V PP p p0 0 0@S<0  0pPp( (0( $0 ȞH*@ w0G-S@PK Tpw 40SF   P@i P P 00S 0>~P7 0 03/P0  40R 1#P' `P 00C 0aP  @ꀐ + pG \ \0\ 0 [8 808 0 OX)d(4( 4 p40S 0C40/ 0  0 @-5\ 0p@-S \  Q @PPp 0  0 D'ؕ ip@-@P 0`0VP0S R<0  0p@D D0D @0 0 000 ,0 &8 \ 8wG-S p*W`@ V 0P 0R `00 U` yV 0S  Gq@ @0@ <0F/⣝+0,S% X4A-PP 0 0RI4pP 40S @,0a, 40a@T:8 8 402p$@-P80080p@-@P 80 0R@ pP0@p$p@-@P 80 0R@ pP4@p#p@-@P \0 0R@ p`P00S@#:p@p#p@-P@%@pp@-P@80080p@p@-P@8@@@pp@-@P 0 0R`P40S ,0AT p@p@ 0  0O/֜l"ܐ aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@k@=@D D0D @0S/☜0 000 ,0S/⏜! @ 0p@-@P H0 0R@ p`P8@2p A-@P1 0R`P#4P%80,0!qW&  P  P 1 ,0P < 0@ 40< AlAD D0D 0W/0, ,0, (0W/'8 D l D0P D- ?o2 ^0S 0 Sg/0S /p@-`P@bP (0S p p@ L > r00 //@- TP0 0 pқX4 \O-IMP ; @T p `0 R 2/0 S\ P X @ 8/@0 p\PV @T!1 0 㝛003/X@ 8/Z SZ Z X" 000 R 2/0 S' P70S+ 03/P. Z :/ SX 0 0( [ 0 0 RIߍ 0 0( G 0 0( >Z :/[ 0 03/X X0X 0( +h ` < ` h4 P P0/O-MM(p@ ~T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT00 0=P $ 0R000 Mߍ0 000 ,0H ⭚ R00ꨉ # 0/0/@-@@A-PPMp`2 0S/ ~@0U  UP 0/P B 0CU/PU  U0 0/Q B T!0C@T@!  Ί;@04D .00J 0 S* ୛hp@  %V 0P%4'@㗜Pۍ蒜?00@ۍS0%p M&`K&H&p %p u0P@% p@-R 0@S PR :   Pp0P  , 0`0` `0 9L0L L0 :808 80 ;ޙpX h| H|̆ (p@-@Q PPpQp0@-S MP@`PA Qv <Q` >QR &QD Pk\U\P P PU[ /UU^0E'SXUOLTHEQPONMLKJIHGFEDCBA@?><;:9876543214a`Q PP a&`Q CP`&`Q 7PrPfPnPtP ЍbPUt p 0%QQ Px, ,0, 0 \Ѓ <( 0S p@-P@ @Pp 0Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ 0 0@ ⫘ p\#0p@-S+@PPU Q PpQp<{Pp/tP PQ lP Q>p@c 0 0` Qn l0p@-SG@`PU Q Q DP<?Pp PU Q 3P QPU Q &P QpPQ P Q/P >p@  0 0|  cA-PP4 0Q ppXpW`*@P&  P <V`p p0 8/P]PZ`<``Q# PIP P 0S #P P PP@ @ P P 0 ~   p@-P@PP  P0@@p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 80 A\$0$ $0 BTȹ} } @-@^ P ^%QRS  T00NQRS"  TŒ 00 0 0 Z| (ĸG-@R00Q(MP P 0 ` p Pt p `ܰT0?o20S00(Ѝp`0 ȸp@- M`P@00-0 0'0 0! 0     SЍp0@- M0P@   000      S Ѝ0 0p@-Pb"!4Mb4# `@0 "44 0ܗ "44 0ԗ 0     QЍp0@- M0P@ὗ 0b" b! ⲗ "440 㫗0!$$       S Ѝ0p@-@P(MP`/ 0S, R00 $P (Ѝp0-S 0 0 0 0 0  0 0 0 0 W P0V00(Ѝp@ R 0S V00d@- @T00@-@!p00T0!0!0!#"@-@T @-@T000 000S/@-x000 000S/@-\x000 000S/@-ԗx000 000S/@-ėx000 000S/@-㴗x000 000S/@-㤗\x000 000S/@-㔗x000 000S/@-ㄗx000 000S/@-tx000 000S/@-d\x @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^ \#X001/|001/\0 01/@0S@-@1/00/T0T0p@-@ P`\ C Pppx/ 000 000S-/@-ޖ-Dx@-e000 000S/@-˖xAo//p0@-@ MP 8 P! Ѝ0 0 0 ;੔vtLr Lp@-@M P !P pЍ(0( (0 ;㌔wt@خ,r p0@-P M@ T T T  0 Ѝ08 @X! Ѝ0 0 0 :ct4q p@-@ ,@ @! 0 0 8M^t ܭHq Tp@-@PP (P$Pp0 0 78q p@-@PP (Pp0 0 7%갷p p@-@PP $Pp0 0 7dp ح@-@P  Y.<+ < 00 0 ;p @-@P ( 0 0 7(訶o p@-@P $ 0 0 7ѓ$`o PR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@. P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pᛎ8000 0@0 !0#2 /UUUU3333  =p@-PQ@ : Sx R Sd0 X Sb0?0 r - 0!=w- S ] 9SL @Sx00 r - 0 w -   R> R9 Rx 0 Xr- w- R0 R* R2 R x  00pRs  ! Ss0  Ss0  Sw0 Sl0?0 Sp0  Sc0?0-0- S t T S0- A0a0-0$0$ $0 90sD8i O-P4A@:  ἈpPA PA  pP% 00羈` 0@T' 5P0=S AP` AT BX!  ҒᚈD0D D0 > 00Lh ܥhh"h2C-@`M 0PDH L0PT@g X`P ㈐@@@@@œpk pp 㾓p` n{$P  {j{{p[ X0p 0S00R8@<@@@@40040,4,,0,<H1H000D0 00`Jw,X  #꜓0S Vpp@ u q  ЍoЍ @x0 0 W Q MأO-PMp 0GW"S00` 0t@ P-TPe +T@`0> ǿ 0 哌 0 ㋌ " P@00D \a0DSW0DA0DS"70DWUX: QP S \ P"000T7 W. 0 p 0U00S 0pS 0F0 Ѝ0S U 0@ 0`Ւ 0R00  Ѝ p夀夐 p XR A B0A PR W `@H0H H0 ?}RWp ppꙙb 00M 00Ѝ5`2O-PMp 0GW"S00` 0t@<P-TPe +T@`0> ǿ 0 Ƌ 0 㾋 " P@00D \a0DSW0DA0DS"70DWUX: QP S \ 6P"000T7 W. 0 p 0U00S 0pS 0F0 Ѝ0S U 0@ 0` 0R00  Ѝ p夀夐 p XR A B0A PR W `@H0H H0 ?㰏RWp ppꙙX\_ `00M 00Ѝ5,2O-M8@ ~p@-@PP% U 0`1S ,0S 5$0S .Hpp@0@ @0 9(0( (0 8$~= H~4}= $~p@-@P U}00CS00 PS}pK@P0 0 7|,= }--M  pGЍ Ѝ/ -- M0 0F ЍЍ/0P0@-$M Rp P@0S#  S!R0  B0!  0 0$Ѝ00BL0 0 @ P J0S$  {(}`|d{P 4000S$/00//0{\|{(|ŸC-PLR + Sz$xx`x`xDx2 (xd2 w,2 lw2 vxvy1 vLvz1 v v{1 vummvvpvpv0 u0 up0 uP0 u@-PX!X1 0M`P@0009 p 'T T( j/00@!0 0 0 305Ѝ0U000 @@P00P "448#800U0PP P0P 0( /0@*@*d. tr @-@P  @ 0  0< ~- sPrO-GM M '0P7 $00t404 0 $0S 0Sc 0Sl 0SS 8@XP,@(P0 PI@@P@ p P\6`0pp00 H@P!  Pf뼄00S! 0=S0`S"`V`X`V `ሀfPꥄ0#S DPU(  000C00`@ꎄ0 @p00000(5ʄP @P0p00000 4嶄P 4 $ o$ o 0S000C00  040PP0pL$h`0 } V }0X045H@PP.H0 0d Pڶ5 ,0pC s m Y 0q0Se Sc P} $ P}  P}   0 P4 R1( "2 0 t4 30Gލ Ѝ0@ރ! 0@(  @t   0400 40 S   P 0pW 0  (  00004  `Pᡡ Pᝡ PE!1 H 0ax!x1x 0H W0ST!T1T H 0K8!818 0H A$0Sv!1 H 05l]0S   $00p( qq|q0LqqpDon' l@l' llt' `lkL' mk' kkDm mOm(mC-P"`2 0TM@Pppt0L00E UN VW W` ! 4!,8#8  O x00000 0 0  $(kPLQ P,  n0 p@塍 !0 0 L0 306TЍ 0 P 0㐀U 0 P 0ㅀV 0 P 0zW 0 P 0o@\@ P@(X܁<$ Tih\$ 8ih0$ ih$ ixh,a-MYЍO-`x"pt2 0\M@P 儠刐P0T00[ Vd Wm Xv 8#<$"448#8  0000 0  $(,0ÍPc0Q ,  hmIP 0S 0 @H!01 0 T0 30C\Ѝu0  @ 0 \ 0iV 0 \ 0jW 0 \ 0kX 0 \ 0l~@坌@ \Y'븿`<iith! Xff`! P YP3|00h h0h 0@ YhzL L0L 0@ X^z~"PXV]LV@V ,pPTd T(T!1 O-IM0p010vWW PPN x@ `s0 `c@P; 0+S+0S(P   0 P   O0SJ<3 0 0 1 30Iߍ P /wP!3|00< <0< 0P y!\[$T(TĦh n0R0/l 0 0@-PP0M@000' T ⛑0P ""  0S0 0p d0 0 0 30Ѝ0!@P000 00 4yF!( \Q Q!1 @-FM0 M@Pp0d40/ ` PPd@"+ P {0@{ R@h \0 0 d4 30Fލ Ѝ4 404 0 NEy Ԥ` PP@-P 0 0dMpP`0\00 @័ ḐTX P0 0 \0 30 dЍ0 000 0( hy 됣< OO4838@-M8@8@ ]f0 =ЍiO,0`( "4`3Z1S // 0 0@-@P0MP000( U!  @0@  "" 0S0(0p d0 0 0 30Ѝ0)PP000 00 FxZ < N `NG-p!@1M 0砐 040 U$e3P'0G W09pPUo0 ;u0+ @P   8U0 U " z0PzTP z0@z@  nx p0 0 4 30܍ 0pQ$p xP|`- M0 Ѝ@-P 0 0dMpP`0\00 @ .X P0 0 \0 30 dЍ0 000 0 xL KK/?O- M0@Q000} 0S @ TyTX a!@ P@+b"? a+ )pb f!)H@@\M! ` "@ DPnH.lX,%T$D\LlT%nD$g 8ppfa,` ga&-`a,dpmvmzܼNSflp'jep`"` ek`(g|d{dL`P)a[`dk0 P%hnPbk*@`nKbk&[l[<`@'i@lKLD.fi`kjK(@nᏴa`ˌjK$n @%g a, dM`bKh &8bh  j jl͠Ꮴiˌf$n .f!e+i "  adhd  d)h hb-Ꮴg+n,n  )g p苠Tf`! `)f `Dg|Ꮴe{n"l )e PfjLdka( a)d @He]Ꮴn[n'b )n 8X叔nMl`Klˉh& h)` h0a a;f$%f!g `0)ah@ h3eib *b` +g+@bˌ`d ,0ln hf,fkg p$Dixe{`!,*e P`Xm]n[dkdKeˌa(,@dJT`KDb h nˌ (h& L, gi*i ibL 4d+ˠaˌ, f+$a "i  b*e h 8n` g (d+, g "!8p P-ef+h{fk(pa{pl{(p'i[pPP%gyd{hk" P,`&h `H`KeZfmn[lk@lˊ0n@$f @,MHiKhgdb') iah ,( g&) d$lʠ陠`ˌbb+Tli <(e` * ꩠa\f( !0<\ ag{h$gd+ " b)e+e;b[h)!f`b aakl   0d `,@i;'0#0j8h;. @nb+lcK nK " @g!$@,ɠiˌ(@a# !` gc;,-j+lˎ0# 0  j 7d P0j;`] `PtЍG-`pQ ?P10@@e T0 U?W@@P@@PW*TP(@T(pG  G{l  wlPe W*0@-@ 1M?0 P @ cR c B T 0E ",  Q"$  D 80 0 0 30` Ѝ0@kk jQ". 00 R-. xB@-d A@4  R  *4 8/|K x0 S\ R `0S Р@- d@ 4 *8/0vxB /, :#( /$&:0/--M  Ѝ Ѝ/0  0c <cA-@PMb p 0 `P!0 pp ?pZ [{0,pp{ 3pN Q{0,pp{ 'pB G{0,pp{ p' P ?0p  B@RQ 1 ! S'{̠0+{ p`Ѝ[l0 S sD0D D0 <$j  @-P8!81 0M Mp@p0808  `p  \WP3 * 0 0 8 30*ލ Ѝ"`p `Px ;WP* PE0*P;k404 40 BixfHtHfph p@-+,@@PPpk0Ppl,C-@PlMN XQP0SE pP<00PDf` >f 0 ``(7fPPP"P,f`p&f 0``(fP P P @dfflЍlЍ'L(0( (0 HQi$0/@B% @- M P\tqt1p`@PP@@T 0Q P Ѝ$ \P @ Ѝ@ \P"0S- -S?@0 0000 `  V RP +R@@D!0DSX \P0S +S!@?@!@cNh`X ?P L0P00 1 R/@P/!R/ b0@>S 00 00//a@-M `P @jppPU0D>S 0!3100 0jЍ>SH 0!3100j00j00da/-p@-MjP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0( ( `L+(+d*A-@PpP`W =UB 8X ERR14/.-,+*)('&%$#" V&2!0` 0`p00+XPp -X' =X00+0E0VpPppV-00d00+0+0`00@@p00,0, ,0 ]g00 |  p@-PP@`  0RuSpWSRX0CSG5 +p à 0R Q PSPQPQ  0    T0 0+S -Sp0$ $0$ 0 bhgI@  O-LM0xSp 8@0 (P(0,00040CA 0 0pi @ ii@T8 `0p00000.  0a0GSW MD$00+W@ 0-SL=W000 0P @X B R h `ZS  "=W  R!   P:0$`h@ ] h R "@$`0ኡ  m Y" @ T:$`h@ p< h0S" @@D$`@ @T 0X0 X 0  0pW ,WupPVS P Z0$`hP $ h R" P0PE$`P P   P =W Y+0G?o20S" Z$`~h P$ vh0S P"2PE$` P PU 0X0 00X00P PZ$`[h P Sh0Si P"2PE$` P P 0T0 00  HR; I?I00 HRbE0P R@ O-P4M\p@Py WmX0S1 `00 S 5/000 00!S5+0 0 00!WeW0a Y_ X00Ut5Sp50 0 0 0 0@P0` (0`0t5`0$0X] 0S70`lW A,0 ]`W00V0S ,@P(05#[0xQ` 2P X $ 0 8%*&  # #.ğ BPU 3 2#0!/#1##ʂ0# 0_`V4Ѝ3+00 00!k3/0 00!dh30$0H\.Ld0a#0L0|2pST0, P `@!4]`P 0V ^ ,@Px ^}[`"$:600%$0D"%><!!!0C,"0TAP%"$A0O#QX00 0 0$00?S%4 P! (`1T101! T$?01>! R01"_0A`(0x10X00`d(0@t0P`d(0 \  R1 AP5!Q4 0A` X0A0PE$0 `0P 0 `4`4 0 @ 09a 0 @ 08`{`x P GzG,!Q)\(\| SQp  O-PPM@`q Ty V PP0T:R P* $Ÿ P0 P R# 0Qz SQЍR P P PP\@Q @ P @0 @0X^ @ 4^ p0^p 1^ @0T^Pp# W @ 00 0 ``T0 0 V`V}0 0 L`t(@^*?[!]- ` t8 Lp@-@PP U p@KX X0X 0 `U8 808 40 `p@Kꀥ T dEp@-`P@P T U PpPUpH H0H D0 _0 000 0 G_꼤 4q x@-@!1 0M M`Pp040) T P+P* 0@ $03/ 0 0 4 30ۍ Ѝ` `0` \0 _H H0H D0 _G>= Ep xCG-P@K TT P` ``a V00"5SP0 pPO 0SR 0p R 0C à IPP0 RP8 0 Q 0  ! 0`V#*_oRe)pP U !`x x0x t0 ._T\ \0\ X0 #_Ka00[P̡  O-MMM&06 P0T0406D0ep0= WF 0SO UX V* 㰰aUL0U@@ R R 60B?o2$00⃰0S U0S0E0 @0Sy00 000SgV ̠+ L 0@t 0 3/0Ss 0@ L50000,00H(003/P   0S00"*  0.S Z00S X: 0S $0S , P80: S  P (0JQ/030J1 1000 @'P00$ 00S  0xP80: S5 0# $2 MލЍ K0S0S + *P @V` 4/P 0 000z0  ` 0NVD 00SS ̠+ PR  v 0.Ss0S^ 0.SmZ0Ss  @q 03/0  00.SG V P J0 @P6 @s  2/0!1 4 0]!1 , 0]!1 , 0]W!1 0, ]0S!1 |, 0]Ud!d1d `, 0]V P_00 PS$PP-rH 0@ 03/_0S) 0cH_0/ 0 0@ 03/0qRHOH0j$ ::*ؾP7( 0/ `؛ H 4| P XO-`T#pP3 0KMMPؔܤP0409 UB WK YT \[ /\@ 0@ \/\0   T:"2 0 4 30KލЍR_/\8VP/0p0/\V<"<2< @ 0\U"2 @ 0\W"2 @ 0\Y!1 @ 0\@Pp PP 0   R  H 0T/S 0: S* S 0 0 0 0 pX P+P 0@ (03/0S0: ST/03010301:h<0 0 H 0i\^/00ᲰT32 | mP Xn$ ,o SO-M$M L%L5 0PQ`0002 @~\< 0   pH 0S/S;R/ 0B0 4ZS 0H*0 ;P4S 00C PR IR*00S;R X @H p0\  0  *\2 @\ ?\" [\!PI 0^N \@000XS 0H 0< S 7@ 0<@Ⲑ 0 0R  R QR Რ@  +Ph@PU "2 0 0 30ۍ$Ѝ0@S D0\P ]\!PLm @Ÿ]P 0 -P]^ 0]P @ 0< 010t  0BW 0R S0BW 0R S@c 0Q 0{  00P1A0 KY0 !P[00@ E0 p 03P0P0H*0 ; P 0Sꀀp@p@P 0hZd0X Z@S@Q/?**(-[-]0!x A-`QMP+ 0  0 S -0{S @ p0Q @{Q0 #P Ѝ0}S0S ЍAc8 808 0d Z\ 0 ꨏ O-@PMM`p R T  D [^ @P}\ @\ [\ {\PU PE0]\\ \8(PPލЍ ]RRR0C @Q`0[^ ]RR6R` T: `{^0 ,^SV  B00S08( G0 }^S0CV  F B   B[  @ ]RR ]RR zpPpp0PpP d0 YWgL0L 0Y`8 808 $p 0YT 4 A-MMp`@P00P00 0< 0000000 < 0 ; S \00  ލЍ⌀ @R0B \ 0 \\ 0\@9JލЍ$ $0$ | 0Y\@8 Dp@-`P Pp@0T1@D 0CP@DP t000p 0  0 `Yꔊ 0 S. *S8 ?0C\#S 0 P/0S /Q 0S 0 0/p@-@PPV 00 R] "R0#$ S6  BQ    R- @0   0BS0 R 00p\R 0# 00p "R @000 00 X\ pp\t p@-@(a(`$0 QMMS  . 0 0 5 30.QލЍp   P,00 0  ;p x PE_ 0\PD8  0P08L!! $,5C-0$eP`M 500S |E @p#S!~gZ0 plP$ 0S $%P @ 0SMZ0SЍt `p  0@S0 04 0  0Sx t刄刔p 0fS0fS 000#3R0 <$ 0000@SV 0oS 0oS0nS 000#3R0 # 000 TP 000#3R0 x# 000 TP 000#3R0 (# 000 TP( 000#3R05 " 000 0#S 20@ R@@IP00Ѝ0 S Sd TP 000#3R0 (" 0@00q TP  TP4 000#3R0+ ! 0 00T 000#3R0 ! 000EtP ` 0@S0 @  FTP =QuI  0P00 4TP=Q 0 0@0 ̥VI  0P0 0P0|hl4 @|p Lp@-PP |SP e@TLPPP 00p( (0( 0 IVp8 \\@-,@@P00O-`(@8 0M0008P00P pUpVpWT| 4 9Mp007 [Y DWU ((8 0 0 30Ѝ `s?0l0` 㰨 p X Q {UR 0 2c11000 0 0p0S' A0  $0p Pp>X<000S[ 4X00@.X@Z 0= 'X00p YP}ZpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #Sy R BQ #R I BQ #S H BQ #S G BQ #S. L BQ #SI M BQ #S? N BQ #S5 O BQ #S. D BQ #S E BQ #S F BQ #S 0S:U 00S! R B  οP 0 `000  00 D  PS0*Z +p0S vW 00nWW 0 X[ eW00@_W@p, 0V @u  @# 00 $ ^ #   20000"   2000000u\p00,(@ (@(00,0s\ & ƽPk0Sk[y+Ul2"0 _THV00_ Vd  ^ U0`000`0 0SpCx X pG w00;0 V0SpY008[ v0S0 V  p!`00C0G  ppp [V MkJ$T$d@<x \L-0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFR7pP P Ѝp$A-P`@ A@0S)A@Q0,pPpPR =@ P Wp0 @BA QA3M@  Ap0 9p0 ,0, ,0 <Sܾt p@-p`pP`P˽@T T0T0 R@@pP00ᴽȰA-`P@P@pᦽ0S |@@OO R"@`T@P00U0@兽84@-x 0 0 |C-`4MP9I@P 0S|0V ! UpЍ 0P;  =R6 0Q*G B&R&>$#"M = -ߡۡRpY WꘀqꈀvKSБpྡ0X{FHಡ 0h08@l Xp@-P@\ Pp0Sp3O-BMM003S堃#0P 0 0 $ 000 0000+0 dPl 40 4@P# ` @FP 0#S 0000P Y20 $Db@`P 0#S 00P 0xS0xS0S 20 0sS'0wS$0S!10qap`0kP ]rdP Vr!x1 0 4 30QBލЍt10000JP S -RE S0 U@ ∀Ḱ0]S^$0 S w ti - 0Xm  0X/Sge @_2U0/0 0 /ZU0@  0U ∀Ḱ]^^ \^  @S ^U@  ᲀ^% @@  "0\ @ x!  [Q  @D1D!D0 |O,1,!,0 {O P0 @0`pC p 0U0   Z  0 uP/ZY  /AQ /Q[ 000 0 tTPhd (Dd @0PP@-@ P kQ 0 Q 8Q  ?o2c ĭp@-@lP_LP XYLP T00pT 00p8Q 0 pp`O-Mp! 0 "  @3p` P .,10230Y ߍȷPT 0 pI  㼷P: [ ;` 0 0P $P) @@ 0  p@ 0 P0P S P O"> 0 "C 0 p@P -R<XO-Mp! 0 "  @p` P ᩹᧹10230Y ߍCPT 0 pI  7P: [ ;` 0 0P ៸P) @@ 0  vp@ 0 [P0P S P KO"> 0 "C 0 Vp@8P -RDO-Mp! 0 "  @#p` P $"10230Y ߍ辶PT 0 pI  㲶P: [ ;` 0 0P P) @@ 0  p@ 0 P0P S P N"> 0 "C 0 p@O -R20p@-`H@P@ ePpPpPLP [ p@-`H@P@ PpPpP5P l[ p@-`H@P@ APpPpPP [ 0 00 t-H- M0 S0 00 0 0 0 00\100M \0    R8 00 0 0 30KH Ѝ/<-H- M0 S0 00 0 0 0 00\100M \0    R 8 00 0 0 30KH Ѝ/kP -- M0 0n+--M  --M  A-PPp`p Q @Q PD@L0 0000Al$0$ $0 wLW آ0P R   0//ᴓ0'07 O-@P0 0S0 F0@0T9  T04 0R/Q T: T% 0 \/RT0C"0C/QT :0 BPU0P!Tl00p\@@PT IK08@@0/S(@@ @@pXl4Tl@l]A-MP@EL0PB @!0C `0 00   ! 0b0C S/:-,+*/('&/$+`L0 0ᗘ0S@p 0S 0SK0"S $7# Ѝ T1r0:K00ЍT @-@P1 0S* bE@T. 0T)  /Q0C T !@# *0P@/S 0 B@T@!p0 0J  TD@8@0/S @ii [-0DM 000`p 800S DЍp@-`P/p' P@ 5<p V U phUX p` pmjV@PZQ?o 0?oA-@c^?c%^& ^ P@5$&pc`c&0gCh5(5D0c1c  1./ "0;:(0C0 /0 @- /(0  +C0 @ 7+C 0/0E0E0C00 {+C$0 G{6+C{7 Q/0E0E0C /0P!Qo oC-@@`T?`(T) T `P6&`p`3x@y66U`1p1 000? 1?1>4!50;:(@000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C JV@ @-Sp A JK@ @-Hp J@ @-p J @ @-pPP `@-CJ00p@-@PP  (p@v 0 0 1HC 0C,0P(   /"b!!A0,0 W0 00 000XW 0  O0 SP( 0 0 0GWv 0>P(0PW%S(Pg6 ,0 6,-,0 v>C 0CW0P(V 00 0!0W0ML6 0 0P( 0, ,0<!/A!b!b0C 0P( 0 0 B0 S:P(P-W&p 50 ,P(W 0 0 0W =0 P( W\Wp ;0 P 0 0p S 00W((Ph 0 P(]c0 ,0SP( 0$0?2c1, 11,0 02 0 0 000 0 ,, ,0 0C0P(H 00 000 3 ,, m,0 0CW0P( 00 0b c0 ,\P(Z(P000uW 0\ 0 0. 0 DP(0 q  RQ 0s# @p 0 @00v0 `` K0` 0b!/A!b!b C  B00  P PEUS ZSP @  0 0$0 2P0(0 R0Y  R0O P,Z  /#b!!"A0 `XK/"TbQ:L1bS0#03  h 1 01 B00,0DSd0,0*0 40N0 S0(0@0pQ_"pG@I  W@ 0 40N Q@(0VP 0(P0 0)\P(\ ף|> X> = Ql'$Ih8n4o3 Q(PP @ ACLC  \^JS S  00#3P0z z H(/o"PzXiwTQ(P8 pp@+CP("@0pt10 B0,Pp< (' Pp!/"b!C;R, a2ba124MP P(P @ @0C2c2c2P$00( (000 @ 0 @L,0@0S} 00@y0S 0@r r0p,0 0 0P , P(01(000C.$0Y3000c^\0M0c @$`Pf @$`P  0P , qP(00(000C.$00 0/# p  0P& #,   P b((0$ 00M 00Ѝ|1A-0QHPP P M@M Q%L10 P1$8,@@ Pp . R! v Pp `U  Ѝ0 P0  P La@ p `UCT 0 ЍH BC00- - *LzyyygfffyyL@-0M@ 0P 00Ѝ@-0M@0P x00Ѝ@-P@lp@-PH!H1 00Mp`@0,00= U2   P00Q Q Q :C 0 0 0 ,0 30"0Ѝp | l \0\ \0 ;@D0D D0 :@tt,t,t,j* w,`* wp@-@PP U 0DPp P @pD0D D0 7@U(0( (0 8@Dw* DwLw) wG-pP`' X/ Y `<V @P0PES  R  D(0PEV R  SS0@0D@ D0D D0 Hu@X(0( (0 Ik@hv( pvtv( HvR@- 0BAs @Q 0CR 3A@O-PP┡ M pU WC 6@PI 7PI  07p`M ;4101S Y7 Ѝ060P@6P- 0 0P 60 0 3A=00 ,Al0l lD0 ?6B00808 80 C?7пt' tj& ht@-RQM j@PЍTT A@(ЍA 00O-`!p1- ଁ0M Mp@P050H 1PS pK @\DX0 ^00pt噩0E Oԩ00 T> 9qύˠ@,0  (A@P 3 P 0 0 5 30ݍ Ѝh0h h0 D[?A00@~A00|@lZ$ pr$$0 M000 Ѝy긻--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-@P⌒M p` X X00?5200P @ P D00 P ! !  F1XPH 3VP WU V[XPVppPpW` D 0`f0``ἧpPI PLLL1 0 0>W`!00!1 00:5 Ѝ0XPC0 P P00%5 Ѝ0 >`{pP V tpP `@0@ @0 ?}>c$\\" @p`p[8! o@-@ M4(0S2 P20 `(0` 1/qp0Pp)  0 0 PUR <0PU4 ЍPPTp 0S  0CP4[@00Pp4@-P M4(0S: 20 "p(0p 1/qp0@`/  0 0 @ToR <0@To41`V ЍP@T` 0S  0C@o@T00g4 @00`4p@-PPE 4A0S5 @Tp1 Rp0P00  P 0S P0 0c0( 0P0 0 S,P 4P 8P p@ݨT0T T0 M=0Sp000 00 K=eEk kkp kp@-P$@@ጧ5Xp@腧 X@- @@~2X@xWԕp@-,PPq HY@jpWA-@PaM`c 1 P0p00S   0 XR0@ @ SE `@<( \80CS50`H0 S0V^,*`N^(^& N0 0Q\   "V ^ #R.S @` 0A a 0Cb@0@Ѝ "^ #R`$0$ $0 F<Di Di4  R  *4 8/( 0X\S 040:8 R РS /hoxB@-Pp`>P@P@0@D尀 6U  J &T0x_@-P`@>0 IA-`Pxp@P1 T&  0 SSS7 S300 S(v~i#g\*V7'0 O<7'0 F<70000F00d00 [00#R00 00;R c\'W Pd\ 1P01 0S1000S0d\ Q6 0100 R =Rr R 0 0H60000  i 7 B,B,000" p00BS0100C0f R R 00[ 50000  J70B0 0 Jx0000  ? 00B3HIHHb` HG=A-@R`P 0So !#b!b DQqU? 0S$ RV 10 R RQ 2/!U 00010 ( 2/P p $@g&00@10 03/P(!p0 $@u0V0 p00 R (ϡ00 0P3/P" Up   R  SVp 0SˢP00 0U LFĄF@FX`EEG-@P Pi4`P (rp^u F 00\c<!"#b!0CaqV; Y 5pPY` $00100S p %`1003/P00H 0 $0,100S100S& 3/!p 000``0S 000S( 3/000('P`0003/P 0 p 0000S\.P00}00/>3HCC`CC=G-@P P3`P $rp ^t F 00\c<!#b!b0CaqV; Y #5pPY` $00100S p 2%`1003/P00H 0 $0,100S100S& 3/!p 000``0S 000S( 3/000(㉠P`0003/P 0 p 000$0S㐡P0 $0~00t|Al4A8 @@~SR: G-P000pS` 3/0Y @IOP T0 0 0 0 Y @IOP TT0 0 H H0 0p`P   /?}}}d}0?P}SR; G-P000pS` 3/00 Y @IP P T0 0 0 0  Y @IP = TT0 0 H H0 0p` P $  />|||D|>0|O-PPM M Q@ \ /\C  6Py 2P8p/\ @ @. D\m `P /RR.\' B Rm/0 F 0P7 PE00 xPpE 0: S 9S0/\0Sy@/\` FQ .PQZ 0t/S0W0OʨP ! uPO 02  RB  7(/\p @` @ᘡލ Ѝ.00Z 0/ ލ Ѝ @j8 Z 0/ ?    P @XX800 @S8>00 @N8?00 @I800 @D800@800p@-@P Q rPp`\Pd0@P cP`V "80"S 3p800p@p@- PHaM`=  14QP00Ş P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0  7 0 @H xwwp@-@P`P3 V( 0Pp:P @P0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 W5(0( (0 N5R QC Q00/t7p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 5U8 808 0 5p BP 0S00S\S00 RAP 0S7\S5 00S1 :S000 0 S4So A 00S :S|S@0@ A@0S'!1 0 8 30Y ލ Ѝ @P 0 0 C`1 0 Y P @P @@$QP P @ 1 0   07P 5 0 04 }1 0 04 s10 0qP\ @Y\@iiii$i:h`h8gff8 BtBt BLBp@-PP@ T `` P p0 0x0 0p@   T T0T P0@ '1T8 808 0@ 1eheD (3A (A@A-PP@` T V = u@P dPP 0:SS  pd \S @+ Q0P 0:SS ^S0S:S 0Q0@PP@d;P 0P:SSpdQ0@@A0]p0S:S 0C^7B C@2RIFB?5/A)&"! 0@ 0 B^1 0 BR0 0 0 0~0|:0z0xPʚpPᤛ( 0n 0 0L X0M 0 0L N0T@t t0t p0L C06@ @sz@oa2 00 X"= /= ==A-PP@`H TQ V: = PPe d@Pg 0:SSpppdP0:SS   \0@@Ad`PI @pd \D@ATp)NPp@&4 0 0X / 0 0X /T 0 0X / 0 0X F/pP@@@1 00 d ;$ -;" ;;# ;|;p@-`PP@4 U= T& # P? 00S 00XS@<,00A  RaPAU70AA AW0AR^p| |0| x0d b/d d0d `0d X/UH H0H D0d M/p0 ::s +9q 99rO-p# 3AM M0@P`0(0 0 0SH */044 !PPN \P0D 8T  0哺C100CS3%10/.-x+*)(&%$#"! < 8 30:S 84Sr10S 100\"H2 0 (0 30 K0$P* 0B.KS:S B000$ 8T S% 440<4 0 S BKJ ; $0I4$ /04I/<4 $0C 0$CxB>K0CP 04 8 0S:S XE H R0 0  Q!000AM P04@@0/ 0:S 0 00UOPK0 0 Eb.10 S:S008$ 0S:S00< {T,99(z8t7$ 6,0 00 w-H-M0 S0 00 0 0 @0  00^100M ^0@    RL00 倹@ 00 0 0 30KH Ѝ/hwPwv4@-WL$@@00,5TX 5O-P"2 @`0,M0$00d20 R\ 00@`pR 0 LP Z p W P p J ! 0J0PP0 S#: .% U10 r 1$4S1$!@00 P P0S "<100S (!0 0 $0 306 ,Ѝ U r LpP Р kP 5SX0(, VT00#    {*PP P0S$vWW33Vtg @-;(@M@@00?PЍPPTA P{ (0  $@7 |0 0 1 30sߍ`0` `0 G',VD0D D0 H,PpHo <.@. .$$0 M000 ЍnO-M/0? 0pPP030] Ye 00!R !Z P   &P0%%Z * 0S0 R 4/,? 0 3 30N ߍ|P0 &P P0C S !000C 0 `0zS{NP~|{oyxwvus1jhc_^\ `ZEU000P0C `0PE 0SF0 0C0000 000S0  IY 񏐻q;P0 %P 0P0CS0000 @ 0D ST*G0r? R(0 ( 0I, $00 40A@Qbp#zx 0 S0 00 1YK @@0 %P @T0C0@0@  0SWP 0 0 0@0 @0 0CP2 0S0 000$0!$0S0D =. #RR 0 @00T0C0 0 =. #RR 0000CT0 SP P000- 0@C0 H9T@!@r?(0@0 + AMR^\ZYNMLKJIH654321A@?>=<;:987654321f/.-,+*)(! F Y @ 00CS0r000@T@0HS XRn    ( 0L#0     "    0@0 ( 0CP000&   (   S@ @& YʱY  P6P&P0 )Y464&40 )8Pq `3P @0d*P Z$P  0 S0 0C0 S $P 00CS0@K 0 S0  @$ 00S #P40SZu 00CS0400R 0 Sc $ @0 0ESZ S$P 00CS0@T 0Y0 G @0ES$ PSZ R0 00CS0@  0 S000( @+ D   BR @ X2 @ #P 0 0CS0@R000 0XO $+D AQ@ 0 R0 @ NT? 0TiAQ@W 0 R0 $@ XQ[AQ@   R @0 00K0? 0r?(0Y D  p# R?o20SY 00 00C@0@00<000WS0,`01 `00(00DH@0V: Y P 0C =>J( rr)0  p P p  p =>3PSu $0PS0000`FSP Z,`XA $0S0 00 0000W0nm l $ $D # > 9̻ 0 "P 0 0C P0 SP 0^Z``,40(Z`Iy 0&@0,(0=>0( #C0,`-Qj ]QP @0c Q8 ,`0;00<0000000900000 000:0090 00}0:0000t09000m 0  I  0 PC P?  +P7  P2000;000;0B00>jIT  B R, @ 0Z0 @$P 0 R0k @ X<0#  R @#  R2 XX B P R @$$PL 0 SI 0iT nT  B R, @ 0Z0K @ R񏐫D" AR>  BR @ 0X0@ NR-  BR @ 0X0U $@(T  BR @ 0 R0@ )T  BR @ 0 R0 $J$0Y$@Y$Y$ 00(0@T 0<030( @( :p00 500S @0SU 00 0!Z]  P 00CS0@| 0 S0  @]0SHP 0Z 0aP 0Z 00 p0 00> 0#P 0X 0@^@ =. #RRd @R  B   @ 00. @0=>03SS' 0@T0C0000@000 0SP @X A 00 000P8 0 S5 0@@Q$P* 0 S' 0@ P 0 S 0( 0  _T?o20S0 0CS0@ 0 S00000CS0400 0 S @0 ᵑ PU ,0C =>@H0J &r 0ep= P p ᬑP 0Y0CP  00S"0,0p `%  B R, @v 0 R0n00 ( @ o00 P Z 0@006,  $ ]R Z Pp80$0 080P, 4` rO, <`T  P$0 0P(0080<$XP 0X 0$@>PG 0XD 0@!P< 0 S9 0@8PD 0 S@$P P; 9P 0 S1$1I.P 0 S $0 @0 P 0 S$P P wP 0Y 0@0X,` @ t'TT) @tZ"( S C@ S 2IP 0 S 0 @000>P @-8P $.  B R, @ 0 R0. , $P2P 0 S ,[ P 0 S 0$ @ 0S@!0@3ZZ 0BP 0P0 0VZ  (`0$0H0` 0 & PQ => 0 BC$ ?% 0 rُp< P-ZP@D@ 0S*T`Z P) 0 S& 0 @1 @D00P0T0SJ0000xp0SP Y` 0@00XeZP@D`$0$ $0  #00C  A-@P`p%0 P&@-` MHP@p<P  0 P ЍMA-@Q(R`Pr v 200S5 0P1S010n C000P`! pW@0P@ ọPPZ 0 $0 0 C `C0000  Q  Q*RQ0 @<08 0  B`0 P$00P0 P ; B #A ?#@ 0#T0T T0 `# B0 ~`LD D p@-@Ph Pjp0@-P$L MT` 0S pW 0 7/@P  Ѝ808 80 8"0p$@ Ѝl  0 00M 0ЍI0A-P$LMT`p 0S $X 0 8/@P Ѝ< <0< 0 p"0$$@ Ѝ$ 00M 00ЍH0A-P$LMT`p 0S (X 0 8/@P Ѝ< <0< 0, yP"0(v$@ Ѝ@ 400M 00ЍG0A-P$LMT`p 0S 4X 0 8/@P Ѝ< <0< 0D "04=$@ Ѝ\ 00M 00ЍFO-MD@P@Z`p] U? 0ST$ZE 0SB [? 0 ;/0S) $\U 0S H[ 0 ;/@PЍ 0 0 !0H#@Ѝ0$\ 0 0 [!0h h0h 0h J!0D D0D \ 0}!  `p @ (@- @MvЍD0@-P$L MT` 0S 8pW 0 7/@P Ѝ< <0< 0 T!08pz#@ ЍP p0 00M 0ЍC@-Pp`A#t@t0@l@ ĮU  @0 Ꮞ$ Ɱ᪫C0t<0[O-M`@0 0P040 0 0p0ʿP0! B0 b8<B p  UQPE @4B 0L3@0 Sh MTRTWMTTRQPONMEDCBA@?>=<;:987654210.-,+*)('&%$"!  g^0DS13`0 b  P 00D0S0S0 S  \000!#300@ 00@00 @0`PUb*Ѝ@\ M00 ˋ P- R@ ^^? 0 `0  ȋP 0J ZS0 0 0J ZS,1 0000 Ѝ0S0 P1 00000\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `0\  n  `0\  v  `}0\  f  `v0\  r  `o0\  @`iBqA- Q@Pp` hP=0D! D?o2]R0S h0$"0 !@1= 0 V V 0 P0 A|! ! A-P@p`P .T Tl!0D1(0D,TS0 Ae_T (0$"0@ !1% I6 O-`'7WM $0@P0T107儡0 010 ?o2V0S Z Y y PO0P 0 rpG0P0 [00 190 P@  U1 p00PU`p! X U0 1 #؊P00? PP P@6@&@0 PU`p 0pGGq WP1 P! L`pPH 0 800S4 V L0 G0CSa1  5* 0 0  R1  X5' 0 0  R1 001 001 001 "001@\001001 d̔ Uc `倡PU^ 0 p9/P 00Pщω ͉ˉ\$84 0 T1 30Wߍ0SIP/4$0 @vP 13#0 z03#0 W3#0 NZ3#0 Dꈓ 00u$0S 0(0S Y 0P0C,$0Dp<@$0X$0- 0`P400@ pNǠ n:Ȍ>P`O@@@P@T@O 4( Yn*03> @8047@p0 W $0 @2(@0 D0R< #8`᳉[PPYM* 8 ,00S,0Dp P 0SR000  8 ᐉPP2(0 Sp1p!pp0 ` 80 LᏉp a$0S 0S PP@0P~p20(0]Dp00$0h 00P P0Pp0/<<<Ĩ h ԧ L8lt X8   ̥ pP (h@- M @(@   0 @ 80 0P@ 0 30 Ѝ33@- M,(@ @0 0 @ 80 0P@ 0 30 ЍD33p@-@QM`P0 0 `PЍp0@-@RMP0 0( PqЍ0-M 000 aЍ-M $RЍ-M $(CЍ@- M@ @d0 )D 80 0P@ 0 30 Ѝ7D1 0@- M(@ @0 0 D <0 0P@ 0 30 Ѝ p 0@00@-@QMP0  0$  PЍ00@-@RMP0 0$   Ѝ08p@-0@Q0MP`0 0$  `Ѝp-M00  Ѝ-M ( ЍT-M ( $sЍ-$M 0 0>$ЍO-MMn)`< R 9C P p@0 @gp IBTIp`&pT `" P 0  ST U ׆ ܍Ѝ  R U ʆ qPP 00@-p@-PP@ D!!!!@ʅ0P0 @p0 0 Z| yA-`P@P- T6 $0S:0@@T(0   0UA 0S@@! 00[( pS0S$  0 0 T 0 0 ?$0S%*3( p+0S$ ꔙ x|h xX@-PPM@`u T~ ,0PXPI00PY0: S Sr  SЍP P :꒧P 0p喧`PA0` \0`.S0@D`H08< 0L R%0L R!8< \P@D V^0 0U t:0Ѝ]0S \040. SЍp $p[ ЍT T0T 0 :mT4 404 00 bv  A-pP`P& V/ ,0 `5@P0\X0/  q0 0P$05%0@P \0 00X0T T0T P0$ #V8 808 40$ @꼕  |x@-`QM@ pp.  8<0RP@D0RP P00V ЍSpp ̦pP 0@[@ЍPPPЍO-`P ǿ 0 ~ 0 v " P@00D \a0DSW0DA0DS"70DWUX: QP S \ P"000T7 W. 0 p 0U00S 0pS 0F0 Ѝ0S U 0@ 0` 0R00  Ѝ p夀夐 p XR A B0A PR W `@H0H H0 ?hRWp ppꙙ8{ @00M 00Ѝ5 2@-LMp`@$0 P 00*P LЍ`0 LЍC-P!1 0MM`0p0<0 |x! @PV l1 0S {P(1 }  ኟP( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nS P0S  ~~@PPP(|( ~}Pl < xnfs uniop@-`HP$p  @Pp0@,@p`@-@P @(0( (F0 @|dx \@-M @up 0: S  p  IЍ00ЍO-p-$M$@` @ 300;#;SP00W00S00 e00 P@pP0 U0*|0@HPP@ p 0  ᷞp P@PEX0S` PU|0 pH W*P0    U 1 T 0 @[UizPPu W#: 1 0 00 1[ 0f0 @0)P @ 0 S0S[ }@X; 0@D@0@ @`$0$Ѝ0 }000 7 00S0g 0zP  0!(p`z p pP0P P0  @X8ht hp@-P | @T @|T0 0pp@-@PP U  p@ D0D D0 :aU(0( (0 ;Ws |s /O-pP M0@`& X. @T fP[ P@ P  P 8/P  00[W@D:P PU ЍD0D DD0 X,0, ,,0 r r`r sO-PLM`@< X TV2 <000@ $0yP Xg <0Sn 0P@0V00p000F `1#P #Qt PFR'000  0耟 0!,@UPP@P 0&&```00A @itl00A0A100H H0H 0 B p̬,XX hW hpp@-$@@ @@tP R>  "   T0"] \h0000000000 0#0 0#0000`0`000T ^pp@eR1 /o"!T0#00#00!04 000T p`^`  T 0V0pp@6Q `T ` R\ ! O-p`nP% Q@0@PpWQ@Jp `X 0Paao0Op00pG.wTaX@Z_BF 000 D.@-,@@0@P0S@M-`@P@_}P(p0@aao0Oo00ZO.TTaXPB, ,0( 0  p 0p@-05S PpP0SZ sX@ 0CR\op@T P VP@oHy~yx/p@-@P $PpP {p$ypP upp@rp0 0 *ꤘD Mp@-PP@ T $0! 0p@/L L0L 0 T, ,0, 0 C 8<xC @p@-@PM$ $` P0.uP P pp(S00S 3/Ѝp003/( (0( 0( ZB B (4A-@M$P0Sp 0(`0p 0@0p$p3^Pp0(0V,00S 3/@Ѝ H,0 0(p 3/?pP A-PPM@) T2 0S Ѝ$` 0P o00 @5pP fЍ00'pL L0L H0< NT0 000 ,0< C@ 4<x@ lO-pd"yM`\2 0(0102n, PP} +n@Po 2 -n20 RF &n!1 $@  0 400ⲐL0  00 0. $(p,`x PP 80 03/``mP"    !0 0 1 302yߍ         PpnP nnP||Pxpn``PopRS6L$4`H> P> = P00/$w 0@- UM0H`0L10㷫p! 0H1ep@P0P`p  S 0$< ,0 0 L1 30Uߍ6v$p@-PP`M`@& T. tcPЍp vgP bP bP |0000 PL0L L0 GT000 00 H X$< ܐ; O-(p,@PbP/ ` V &S1Z V@ 0S1 0SZ 9/P V@PV lP``o@P V@0SZ V@m00: G-`R p@P8/PPV @!1 G-@Q0MP`000Q UI U .00P!1 0 0 30ZЍ0p )P00 S0 0000 PP 0 PP 0SP~Up!0T  Pqp0p pP Pڎp 0 P@W00 0Pة / B/0  Q B  / 0R % B   %3 %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 P5 00 0p/0S :p@-0C@0 P# 00 0p/0S P@-@b" M0Cb! 0  00 0Ѝ/0S/p@-0C PM @`0 0b"!4Pb4#0 PЍp0 $000  / 00$0ܷp@-PP@ T" cP 0S S pp@caP p@aD0D D0 DT(0( (0 :D4 4 p@-PP@ T cPp >p@[dH H0H 0 X, ,0, 0 WT4 D,4 pp@-PP@, T Pp cP 0S SaP p@ap0p@/H H0H 0( x, ,0, 0( wP3 $(3 l܇p@-@PP U  p@cL L0L 0< gU, ,0, 0< h2 p2 D0@-PP M@ T# DaP Ѝ0,cP 0Sp00 [dP P0P 0L xT0 000 0L mꄴ1 1 Xp@-PP@! T*  0Q  paP bP `P `P p@`L L0L 0\ 6T, ,0, 0\ +0 |0 PG-PP@9 TB  R R  `V V  0 `00 0 `V00 0`V 0| 0FS73.*& 0  0 0l IT夀p pl  0 R Rt 0  ` 00 00 0000 0 `d/ t4/ %  @-i/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`0 V% T ^ 0S^  S 0RR00Ap@@Tpp@0@ @0 ;M(0( (0 :Dꐂ- dq- @C-@!P1 0MpP`030Z TO A< lZPE Y`S {0S d!\1 0 3 30Nߍ(#@? R R  R 6P8 R   n p0S p% 0 0 0 0 p0p p0 P  D 0r됻|+ + ؀O-IM,M`X$@PPJ L4 p0I $000 0S S  $3 I0$ 0 30Iݍ,Ѝ RJ- 岰RW# " "  J=00hc +4p# 4I8#8  'J- 0S 0S> S" UV J=00 v J=00Xe O<  YP 0Sx 0SG0S  0S0s S0S J= UV 0  2b"!4b4#"R #< v<0I8 0J=000 P J- 0S.J=  0LS) S LJ͍0 @1 0000:00G0 ,0 3UP @(& 00SaLP P P J=00X0  XPjJ͍\Pa JTl* h a$}' O-`$@4 0MQ@pDH 00020P0CS,I6)('&%$#"! E QWX00 R04 0S SYl#3 0 0 30Ѝl`30030H 0 D@pЍOyQWX00VTcWX/ "44 "8#8 ᓉpPNTL0S R "44!$$("( |"8#8 DzPTVT008" 0  h X: >P00Sj!0 RT@@O 00~!0 CpiT 1i #pYp \1\\ P0 pY@D 0   T00? YK0pPP0 ppW@D 0`   T00? D P|Typ`X  д̳yyhyyx8xxx|wDwO-`!p1 0IM0107 P@p/ P PW mPWD 0@S0h 0&h00aD 00  0P 0 0 1 30!Iߍ [: &0VX 0S P 0 80ꔣخA-@ 0P`p0 { 0P Hp@-MP`P@@P@T 0S  R0S 9P@PЍp1PPЍpp@-@P  PuX%Xp0 0 @O s0. AAS0C .S .R Q P-S.S S /Q P_S /0@-S0GSC 0RS 0^; @PTU 0S`\ DDp Wa U[ \# DPD`Va S`# @@@0TRR00^00S 0 0 0R0C?o20SL`V0\ S 0R 0^ 001 S0S0^ U \( D@D0T 0U \\U \ D`DPVS` D@D0TS~ 0R0Sd10@- $M#B 0# A S0 0S  R lQ  hQR 0S0T000$Ѝ0 0S S0S'  R  R R R/S /0S S/@-/ 0  00S S/ /0S//0@-@P M 0S PPw 0PH@o0S0S 0S  Ѝ0$0$ $0 n1H n@-PPM@p`- T Q Q Ѝ0SS ЍS PP8#<48#8W R# R!  p0 0 000S SH0 P 0   mm$m\Pp@-PP`@ V T! 0p᪡Ppx x0x t0 V\ \0\ X0 T@ @0@ <0  llp llD \GdlO-MP= I 1 #D 01p $ p8 `  P0 0 000000 8N  P _ 000 1040302؍<Ѝ0  R "448, #80,000(0PU,(Q Z Z Z _00 d d0d `0( dꔠ_00_00_Ĥl @$d Ni A-`(!p$1 0AM@PP0 40/ U 0 P5 P-@  0 0 4 30$Aލb0SP @0.Sl 0 @P P0P L4 0U_002̡Q\h ,Mh @-PXX!0 $MS@  ; S- PU& p,0< S9*` Q 0S @ T S  S0S QRpPUl d0 0 0 30$Ѝ 4 01K Οp|G-`QPp W$  b@P   P  P!$L L0L H0H W0 000 ,0H  fe` IeO-M0`C @80:0 0]pP00  03/P 0@&< 00 SS&< 00  4 S RW $ -$ pWpD`(`Օ(448X#8? Y=:$00P0 P@0H ,0$0C 0t]`P00  03/P @^ ^`^V `t40Se Z &< 00 Sf&< 00SD~@P0J?o2X  RXJoᩒS,0SDp0pY<0C80D\8 Z^4 <0 C00P0 0P00,00,0"S= @$4 04 0 30ݍ<Ѝ]00H0Sf&< 00 Sh 0J'ZS@[ TKd:@00PS,`G Zp DXP0$8@xpp@ 0 aZ5 {$0 0{% % {  E {000000jP + "P!0P R R 0   `R aZVJ 80LE0S. 5]00ZJ ZZZ4 !Z Z4Dᯀ@P!JoᩒX00 S0J?o2/20 0@00S@ya ]00VD (0R _80\ 8(5$%0 5s ,0Sg nD\` ?\<\x00 0L[@P00  @ P ?^`P @ L0R4  4 S Z 4S @00@`~[P~@0@0S 0R $ RZ $R 0`cԜ'O-`SM$04 0P0D10]pP ]P $0  0Y80p00ST Z 0000[ @T 0 .T0@T RqS d! S*0 q DD@Q0000 0000 P*0=S [0S Ss St 0S 0 P0s0S ~[00__%  P 000 P @@PY 0  P__@L"D2 0 D1 30Sߍ @S @Rd! S1*.T 0 Pʵ 0 o@P30* 00S  P` X0 SR dP 0 I@P 0 00S @P _@@ @P 8}QO-S-Mp/ 0? 0020E 08 x0嘀   0 0` W! 0S0S  ` 0 ,$/ "2 ;ߍ0S0SP;0S`V>36 `.> .0 ` Q P X.0 V 0S 0A\?o20 P00S0S  p Y @P` 0S   0?SU C"C 0c6#PY$@ <0 RSS 000 j`P = 00@(0`P`P$pY79 i2 I120Y0 0 S   S  R  R Q ^  ^ \QRSR PSV 0 PsQp +0 0Si QRe 0S %0P,0  P ,  B  0 `0)0PY ,00 X,8` RX R R ^ x0S  YYB@pTP0S 0``,p$`(p@ S R \  PW \D @T( T 64 d2 D52 0S0 S P  ^%S㜐Q^-\*@`T,p7 W 000 P` 0`pVPUT ]Z0P$0N P0X0T0 0``P`]PXP=$z[0S5 0S r[ 0`@ Q/o" SCR㜐  `|PP{0 PL RI 00SB RQ> 00  P 0 P0 P㜐  00SS㜐RpmRo \;R P @0 XP 00[0 0[*0e/0 5%0Y X @8a0@S 56p$`(PX0000XP X@T0 L5p0$`(P`Pp 000 \P@T 0S S00S0000  0 `P @`. TA ]>p$p4p 0h.W 00R?o20S u< zP1x00x0 Yꌕ`P@PP `0V 00`YT0`YO-PLMa Zj  븱Q P@   `P00 PG p0p R R R0 T@0P p R ((0(  1P00 V pW Y 00  YppWV$@LЍTT T0T P0/QZ8 808 40/F '' <@;h L;;i G-XM`@wP pP @ 00   0wP 40S0- XЍ OP MX  0wP V0: A0hS@H"p ` # *70S@@:p`F AjH H0H 0 4, ,0, 0 * *t* L*$!$1 p@-PP0M@0 00( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 T@ @0@ 0 ꌏ4_P ^ 4) )\ŸG-T L2MH"0 P00  `p0 0\ @ 0 XS@@ ,B,R0C# T/ .0N ,B,R0.\'^V*00D!41 0 0 30DЍT   Aa B8 LR\P 0FS0 S S X0n(."4n4#0RP0@^*0^0 8< 4^*0 8<]]\- M\P ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 ?o2T0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0Dꆎ<[Z\  A-P!1 0rM`Pp010: UB @X0^00pAtAP0OP0,1TA Ό 00 LOP5  0 zpP& 0@PP 0 0 1 30 rߍ0 0 <|Uh0h h0 =rP Q00 0P0YBX #h #$$0 M000 ЍX -- M0 0y ЍЍ/-4 -M, 0 0 iЍ Ѝ/W@-$M@| |P|0p  P  @p @X@`V $ЍTULW0XX1 @- 0M`!000rp P@  O rp fq@ 0 0 0 30*ЍXqPpW @@T PU 0SP@RT00@I00eVi@V 0p@-P@0 0p0P(0PP(P,PP 0\0PP 0P 00,,4sP 00p\ <  0@-@ 0 0 0 0 0 坞 0 0 00@-P M @0P 00P 0 C?o2 c0 Ѝ04 00 0p@-@P 0U0 0pp@-@PpP0PPlP(0PiP(P,PpG-P0Pm `'Pf 0@00 S S0 S S tpPU 002 pZ8#<48#808 (@P q0p00S S S@ 0A S  A0 !@P 0S 0000,OP   NP0@~@X8O-P Mp@,0(Sz: (T^  0 T0U 00SQ 0 RK@D@T0`F 00SB000 @D@DS `+ T0W  0!0J@0`H 00S#0AS00  y0S000 o ׊h0S& dp0@sO0ppoO(0plO(p,pS@ ЍNP  (,@I(}0  Ѝ0 00@- M@P  0s P  Ѝ0 0$  0$0 P Ѝ0:p 0$0$ . Ѝ0O-PLMU E`@ @$P0 ``PPT$LpPP 0 ``|PPE$PPU @0`Q QD QR Q3 0U00S| LbP  `00p0 @ p R  R/ RY R  0 @U pN 0J[0J 0 LЍ   @QA@ 0U`   (⼐+띀0 0  ,0m0p   04`0aW G   ``` @`T `@U 0^N00YN `^ \LQ  QA@ \W ^ Q\ @ , p0  S QAR`  R  P@T( Q  A X # X/ X5 p X@  P@U':X X X 0` `p  `  Q@` ``  `p`<0< <0 ]xM&  @-@P @M( (0( 0$ ]@M, /o'QO- Mnp P`Pe<-K00 00@`h c  ^ $$YZ0 X(0,3(``-`P pZ # 3X(00, "(`` -0P p`OQK`a!`Q0#03U0S Q:PQ Y7X ЍX103!0# 0 $M@ Ѝ 000X; S81`3 `#S41`F2s2`Fs1`FS`FP0h M`F`04:0;`0Y S81`3 `#S41`F2s2`Fs1`FS`FP0i .`F`00809``` @-pMlp& @unp) `0v0 0 0 @Plu `00 P Ѝ4nl00lt / p@-\ ,@\ \ Q :\ :Apd00p_00A-@$MPI P0( S 42 p|:pB8@87 N8nj;p$`137<Ǡ  B-0@ NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0  0 0@-S@ 3/@LO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ 3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr `  P 0 p 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z  Z Z 0 00  0S 0 pN 0`Z$Z7 Z3 Z5 0 p= 0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[Pp`@p`D0|0x0t0l0h0dy7D ܳ @-@P  @|M0 0 / x 1p@- 0@P0 00D@1011.T 0@\0 S@ B P p0  00C1000L   00LDL=| ʚ; @-M@!0$!l!L1 !1AL PPU  0R4008 0}i`1S   ;`1S0 j0 0 PJ0 0  P7P P P$0 0 P0 0 P0 0 P0 0 P0 0 P`1SxYz < Pp0pW  0R  0hpW 0pW  0Rx  0hpWf 0pWa  0R0 ,0hpWGpWD 0 PS00 h`1S   10 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 001p0 001p0 001p0 xx1p0 [+HL MhtЍ tЍ 0 >10 70 0 0 )0 " 00 x0  \/H`$H0!@ pDthH( @-`0 AM0M@p 0 40 0 r@PP0S D 80 0 4 30AލЍ.E('0,@- M@ pp PG@`PP 0S@ = Ѝ00S.S 0S Ѝ<p@-Px AM p00 ` $ 0 @P 78 ,0 0 4 30Aލp蔁&\&0p@-S@` P0 @S *dPV 00pV00p@-@ M`pSPU 0PU  0\W 00 Ѝ_00P0 `zW00 Ѝlp@-@MP`*0S 0 @S 0S@V00ЍpO00@0 PRV00Ѝp0@- MP0@0@0@T  0U Ѝ0l00 P/U:H@@ Ѝ08800 P@ Ѝ0@T4*Qp@-`M x00<@P 0PU  0VЍp_40P0 `Ѝp @@`0@- MP0@0@=@T  0U Ѝ0p00 PU:L@@ Ѝ0<00@00 0P Ѝ0X(0@-@ Mq T ' T2T7 0DS3l0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P0( @lT" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPPpHPdHh8$\4xT0@- MP O@P Ѝ0 0( 0P Ѝ0<0@- MPh0h@0@B>@T  0U Ѝ0O,0@0 P Ѝ0lMp@-@ML ` 0 Q0PP@0<00 00. T @D D000T H0 0 <0 30 @Ѝp@Ѝ/.0 T3r`xO-PM@PP s  pb`^0 Q ЍSr RSPP -\0  0+\0 0 t30P0 00L1011 .\ 0 @Ts@ q' Q  S#3@  Q 0R \  S # 3!# 0T$+<0+80+40&<0&4 0'<&( 0'4 0'(0 ` p0R0`a 0 T @ P  S#3@ P 0RQ  S # 3!# 0T4 0 T @ \  S#3@ \ 0RP  S # 3 # 0T0 0N 0L0 000J 00  0;hO-Q dM0 R 8 $ Č(Ȍ , 0̌ 0 0    $  aPS ЍpC-`@P@ MPpOP @U _P@ W @ Ѝ @P@p0 0000 p P #i0S0Y@OoB@# H\C-`@P@ MPpx@P @U z_P@ W @ Ѝ @P@p0 0000 + P"$0S0Y@OoB@#Hp@-@P`00CS0 S  P 0` PWpc`0 0CS0S P 0 /b0@-M@r0 0#00 !R !fP!Ѝ0p@-"  0S0@0Q R  004S IP pl@0QR Q    R {Q Lp@-@@P@0P`0pp 00,p@X0 L0D D0 p@-@`P0pp0,p@LHH0 A-@pP0`p0 AdLC-P0 M0`pqp@ HD@ <80  @Ѝ :LxC-Pp0  M0`pGp@ (0  2@ Ѝ :\L0 0 / L0 0 / L 0 0 M Ѝ LXA-pP0 M0@P` p 0 pЍd L0 00M0Ѝ LxC-Pp0  M0`pp@ (0  y@ Ѝ G: LC-Px0 M0`pp@ 400  @Ѝ #:H L<@- @  $M0 Ѝ LH0H 0p@-@0pP p@:d9pt L,,0 ( M00 0Ѝ L R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp M@` 0T 0C0 ЍL0L 0p0<0<0 7/0 0  O-pM`@PP*W3*00V.:Y `8 @1@0 p pZ,  `0 P P0  0P0`00000Ѝ0 P`Ѝ p `h0 qP0V0`FV0S000 000 > Ф8} O-M 8<0-0 00=0=> 0 >͍0,0= 000=00 0P8 L@ H $0 PJ 0S@ P =04 PH 0 M` 0P000 0Hk=P0= <<0@PU *, > 000<0 ;/ 0`Hk=0PE(PxP q0D0=<;:9876543210/.-,+*)('&%$#"! >Pw R 0S .S 0S 0S00S.S-7@ 0- R' 7d 0 @t0  PI 0D$0 SbD0C\74.800400000$08w 0CSPJ(00p`@0 =Y@`p @D0  P(0S0 }P0 0`P 6000#80p6, 000.0   .00Q0 A TP0$0Z 0D: 0@H+B 0?R0S %5 0  0 30  ݍЍ5Y =00SW-l5 0@Z-X5 0@T=00P040H00,0 P@000 ;0P00$ =4000#80P =04 H 0 P5@5P5 00@D;P42 00 Pf00004 0<8 BoPZ 0H@ 0R0JZ0Sx#3 0T n=00S<j5 @0d D;3 0YP`0  P,4 0<8 BP`7P"H40<8pP`@C 0P`%P0 tP 0 P`P%=00S@!5d 0X00X0 0 DP20 0  MP=00P@CD2 A `Pv V qVp$ P@0 .P0T00 E%P00d0V0@DVt0 PX10d  0 PAp`$P0 1@P 0D0 PYX' 0 $P{=00@C00x0H$ H@$n  %(x0`h lh*@XXHd <c b b ======VUUU T$TP4(XDTL@0@d 0 0>`0  }P0 P00d D; 0+0  lP)40d  0  ]PpWD Q@P0d 0 00  GP 0DK0S3Yy 0 8P D{PUD  $bp`0W@G1 0ES C\=00S3P@3 `@DK {2d 0 `P  0 P P:3 @DK 5 Sd P0 p  0  Px3@DK 0d  0  Pf30d D; 3 00  PT4 0<8 Bp_PJ$0D P@C 4 P`P040$0 $@ 0ZD: T0  P($0 @C40+YZ =00S D0@d 0 06`P0  uP  0 d &0  gP$0@T 0DK*@U$` pPTDK 0d 0 00  IP +@0W 10"3% 00;@0==0;@020!200;@000300;@0<=0;@010 0;@=0;@0  P 0D$0SFvp@`T4 Pd0 U`*  R @ Y$ ^0d  0  Py@T0 +A0W 10"3X' 00;A0==0;A020 0;A7; +@0W 10"3' 00;@0==0;@020!200;@000 0;@(>@ C=0;@ +A0W<(1 000P(;A>A C\8;u4 0<8 B-P 0DK$0SxPp\@ `(PP 0V3  R @0 Y$ 0d   0  UP@T0- l9!?C0 S 0 >PwP`1 0)@DK1p09Y# 0 %P^=00S -: 0@M4 0<8 BP 0Dk$0PCUQ?p@p@U51 W2 b0d  0  P|=00S -: 0@40<8pP`@C 0P`vPaL 0 PY 0 P`ePP 0 PH 0DK$00CS8 @;04 p0<8 BpGP2 0 P* lDK`W1PD[ 0d  ? 0  PE1PD[ 0d  - 0  nP+1P (1` %1<@0d ` DK  0  UPH=@ 0o 0 CP|=00S 00|=d 0 0  .P`V D 4 $ 1R@p`P PPPP =H0 0/% Y@ *, D>D0PPP>P0 5/=0I 0VHD- $0S)@P0 Py@P(00>d 0 0  P f=00S0@0 0?@@02 D t `p0 PG$0 @P?r _@P0 DK P30 P,w @0 DK P"0 P0P? \0D; 0 {P4 0<8 BPpP-0@*0@4@( 0X0 0D=0 `P0 TP- =@B!?C0 Sx 0 APz=00SM-@= 0@i=00S0SOA=00S@ L0@d 0 0 `P0  P0 p00d D; 0 0  P 0 d 0  P0PD[S9qJ'0 $Pu-; 0@=00S/ p0d D;; 0 P`0  PT40<8@C 0 P`[PF0 0 P> 0 P`JP5H=00Sj=@0 0H[0 #,T` *, ; 0p00|:0 7/=P@D `@00H[0H:d 0 ' 0  hP$0YD2*zp`0p@ DPY V 0  HP `0d  @ 0  :P`F@P$ 0Y@ 0 (Pa4 @P0<8 B@PP0 P PDK. 0@.H. 6 =00P@ T9, p 0P0`8<0 5/'@=00S=0(@8 0=00S. 0d D7 0 0  P9T4 0<8 B]PH 0D[$0S\'C100 S@0 P2=@0 0H[0 "0T` *, 70p0060 7/ 0P-@DH[P D[@=@0 0H[0 " T` *, 7L0p00860 7/ 0P-@DH[P D[@0 JP-5 0@w%5 0T (P$0 PU 0D[:h-5 0@]-t5 0@W-`5 0@Q=0H%@D5 0P-45 0@C- 5 0@=5d 0 ` 0  PU `T P0d 0 0 0  PzVDK0 Po PDK 0 Pr0 P_40 dPC 0@`DK@p0 PN0<8 @pZPE 0DK$0S0 P7P `PBVV `spP@.0 P0T00 EP00d0V0@DV0 qP-2 0@P a@PTFT rpP`0 NP0V00 EEP00f0T0`FTw0 6Po-1 0@c=P0 0H0 F! U@1*1,  0P010 5/#h0  Pl=P0 0H0 ! U@ *P1,  0P0080 5/괽 VUUUļȻpl<(( h4l<L8`̳P (ET<$LԲhԱXll0@ĩPȨ`̧LddPH(, ܦائD ĥܙętHHddDD$Уģܗė\@ :,a 0`pD{ 0PdP@1d 0P  0 P UP 0 P 0 EP , 0 P `D8P=0H{` PPV *, 1 000420 9/ p=H{ `Fp``00 `BP0 P+ 0 D PP=H{` 0PPV *, 2 000 30 9/ p=H{ `Fp``00 `Pct0 P[+0 D PPN=H{` 0`PPDV *, 3000 40 9/=`F` `pP0H{ 0 PP$`0 PM+@DK 0 @{P=HkP 0!@PU *, 40p0040 7/ p=`PEPHkP` 00 QP0 P}P`0 AP0 8P=00%@C5 0i-5 0@\=00%@C5 0Z$0%@C5 0S0 PvpE (vpP@᤿ 0 P0T0 0 EP00d0V0@DV&ڠ0 Px0 Ppvp-6 0@@$0@X 0D:7'0 $0,'@C07 0<0 PJXwpwP @`PaVTV wpP@@ 0 P-0T0 0 EP$00d0V0@DV0 P-(8 0@80 rPTxp=00h(@Cl8 0=0(@8 0$0@C8080j0 MPxp8(0 $0(@C8 0y=0(@8 0q+I W0W! ## 9 0  +I W-- +I WW" !"  +I WW  #  +I W,- +I WW! "  +I W 00;I 0PPUD{ p@- R MA L  ,@@0(@;@ Ĝ0` ЍOM- (040 1 2Ѝ/tA-PS`1p@@W0 V:0 $"448#80@PU (PP(00TPD0?T0S,0, ,0 llPPxX> G-0pW :0P 4#$4 W0: 04#$$0W : `  SSSČ,$ $  0W*f(00@0S X T0 $( ,0 }P @QA-Mp$0PS@` 0(010$,0v(`V}0Sy(0S! 0, $P(0, V3100(Pi,0 \, d0U4#4 00,004#40,(0T0PT(0 S0P$0Q0 ( ,0Ѝ0F P6,  (`, Q/:048¾0 $<0 ؔ,\0 A-p`@LWP. T @00V 0Px0PV0 G.`^` P0070 200p0 S037#0W0 ^00 0   0gx. /`o/H///@-DM` @ 0p0 < 2 *0 RP+ 0 0C 0< 00 0 <0 30DЍe , O- MDr 0<婒'`r$B( 0 rgqC0ሀB"RP C@$A i!dP @@C3B*TJXRW/Y  @0 SP7[0S  `  0T0000000S @B0?R0S2  Ѝ @0 MiP Y 0 W ^P@ 0 DTPX @ 0 HHPWY @0@ @0 e㛽 Ѝ艈%I$: T\+ pA-`pPK0S-@ ᮾT 0D0@D0C .R T  S\RT  S0C\R@D @0. 0 @@ꁿ( 0 0p@- M0P @0 80P k`d PGo4 (0 0 8 30ލpd t 0-@- M0@R0  IPP * Ѝ@Ѝ/ $+ Ѝ@Ѝ/dPRp@- `@#P}PRP0 ?p@I@00pPRp@- `@P[P0P0 ?p@zI00pp@-@Q `P;PP0 ?p@TIӾ00pp@-P@DIP  p@ p@p@-@P 0PS <0S P 00p觾00pQP@- 0R R  蔾00p@-PP Q@ @Q Q QT0 D32|00pP T0DS@pP p@-PP @P  T 40,D0S K00p T@pp@-@PTp (0":k0cSp: A pO-0 -lM`80@pX'Pᶷ40S @P0 0040-P-+*)('&%$ 000P00o 00@ S@ 1\00C10\0@C 4 00@ SY EP"0 A 4`4+Q -Q0$00$040PA UP4` 0Q440Q 1PAUPR>000ZiQ IQ NQ<4@oP 400(S x  201 0ZnQ q W `lЍ 00XS 40P P00] W4000S @ lЍ z\ 0gkR0E Rk0 PJRg{[{{0S, 0xS0%bP) 0BS@Qf S0 0 {k{'{i@00 0nP 0 S? B P 0,pv@?A T" ` N ?L\ @, $ Xp pQ0QKpGHSE[S0SsWiXqPPM 8qPH 0 p 0q 0Sc P n J @T D 10jS*k&0B: @IW  L1D R@0s {{7{8ooo owo`P   ! } TL'rP8 RpPP LTQ00pC0 A0,pAR Q6`v $  z 0BS@Q S0 0T(3 @d [k{{DB' T'{`8j`k{'@P{V@ D$ k@aT T74T@Ka@@@7Dj@{@{ 0Q $0@0"00 P@ P 0SAPK \4  0PA U U440PA U(00040Pj 000Q P 4 0Q `1 AR`400A 00100s_0{S4 0PB1G{kW400 >0PA400A SGQP40PE00A SIYXU:$0SPel4@mP oPP 8ioP( 8n([88 :pP8,p 0S55  Y$\ 8nnn n nQp`P,p`o`PP  Wm RWD ۟4ğ [ 0T0j[0S {۴ {:S03:Wg۸M{M{ Qk6 C A@{{ {*30 ST{@0$&0{0G={۴}Z8,pMnKnIn Gn EnßL! $ 긻O{@{7{d۟WD M{M{ Qkf{G > 0W:0:G{G6 @0$01xŸ0 0T@T0 0480` < ij0@ SW PP@0S46Skm{ r۟]s{M ^o۟MM{^MQzQ!#{`@k`@{'QV{D儁5AD{TdAk{' Q{XFDQ@5́Di A5&B@D '{0 { *0S{~0*R:s 0 $0 0~ 0Co0 0UP0{S0 0G{1W 400 '\?A5??? ||N P ` {۴J{۴SR 0,p8$ P `8 LPR 5Ll8Mm< 0@\0kS30 bA!Fk{1W 40{'05&D [  0A$R 0R@R$ 0 0P 0 0RA@40@0C40k P40040h,pPK 0Co0 0 0S,p0S 0SA [8lll l lT  1V{ *0S 8PT  8hPX0T 46$ (@D0[ $ ,pw Q R@0 @'{{7{[@0#S[D 46SV00jS  T R*k&0B:@{8{{5?55?P9x @00,pD 46S400kS0S0S{ mPY  nPrD0 T8 D kRB7R$SlQlOl Ml KljoT D 10jSQ@Q R# L @{@{7@{8 0$@@R @04T@.p! R  d*'6B#::D00@0!W,p0 8$W mP mP"ݯ S |08D@0\jQ pH S80 8$3!knP?0 00M 0ЍV4 SA-@PU `0Sp @ uP 0S U@Dp@-P@}PyP0 S :pSSp 0R:pp808 80 e$0$ $0 fݵr rr rA-P`H@ET*AP/ =P4 pPW 0P P B $$P W 0 P l l0l 0 C㚵T T0T 0 D㑵< <0< 0 E㈵ q|q qXq q4q00 K@-@PDQG-^8 pP@`  0S+00CS&RF#?! * \U0 S  RXV``W`Q`V\pP\\T0 S@\`Q@-P-0r0-w-x000> 009000S wS -S rS  0S /xS /  @-P@20 0 0 P P//0S/ S S/0S/0S/@-@ሰ0@0T S R RT/ ?/PP/ ?PQ/?SQ $0$ $0 p@-i/tm4 m ??SQ $0$ $0 p@-U/$m U  CQ A8 0\/p@-@P00CS0 S  P 0` Pp>`@-@P ߦ 0`00@ަ0 0 6Q"| \]- M? Ѝ 0 0@-PP0 M@000 T$  P ^ 0 0 0 S| t0 0 0 30 Ѝ0T0T TT0 T<0< <<0 W @ h6 \ML6` \\NA-pP@`& V/ 0S 0S0P00 00S0 00000 R` F`Q000L L0L 0 6ǯV, ,0, (0 ༯d [X[8 `[([bO-p#P3 0OM⌳0410@P`1 dh`0 V V 00ñ/00 Z.` P 30 00 [ !!.PQP\.Q Q :0 ϡ 0PH [ 00:[.[<##=[0Q.S7 Y_0IS00X0 0IZ 00 0O / 0 P00J ` `0 0C S:: S0  ` :[ 000(0,$P0Ҫ$$1!0  `@$ P00 0 0 41 30)Oߍ Z[0000<4 qP@Sx x0x t( 0׮5 T.R  :5P u}Vl} H} u XXCz z t&WBO-M M * 0: 0z0D50t50`P5ppxU@$0 0S 0 R0 R R 0$ 0d*X: 0 D5 30zݍ Ѝ8:0(0(l0P,0 0@ T S#XP ,|50 0pP0 (03/P  T: 0CoTSQt P0XPHP(t, t0xᤐX'x 00 T|<0 0L0`= `@ D8040PXP0C 0KP0 (03/P Y `ZV `W TpG,000@0,0<Q  0d0D P0ST Q  RM h <p `B PZO[P0 0 00Pi ! RȠ LȠQo \ V\pp0XP 70(03W <0S B@Gq 0P!^P" SPSP@Qp`0S 0 0X@@ @PC0@P0CSX@ :@p` @尮D0 C0 0CSX: 墮04 R  R Q9 0B'RS] OP  `H 0`%J 0 SRO\5080 p`PC0  `Z<8X00 S58  X P(070P R R < R00Pڨ0P `VX *P D Q* 1<0X`0<0D 0S S $4 0@  0SI#3 @ 0? 0H0300 `P0 9 `ZL @0,1Q:*,P䆨P PXP0 CR00 SY@0,008qPiHpj0XP CR00@S&@PX@(03/P X,0@(C 0L00P , @00,0,륮0   0L%d  0呭0!40 >8!r;S,巙0 PXK 6P 0 p`PC0 , 0Z0;<0S0,P@0,0`V D`,'H 0L%0$L @0,1Q *,@0P,0kPS,0@(`C 0L0j0P  , @0@0,0@0,0}y \y x  ; 4:O :O A-@PMPD 0 S`05 S Ѝ0p 0PP> P9 80 0PлP   00P U 00S S 0p8 808 40|  0 JJG-@"2 0BMPP040 0 000S. SA~ ` @ p0v #0G7P @T *X\\" ቘP2P 0 8" 2 0 4 30Bލ 0    ! 7%@PH zpPC 8 0 0@勹PJp 000 0000 0 0d`^VA 0 @ @IP  900S 0  0@T0   0 0M 0  1 0 0 0 `!4 0 - 00S Sz x#Rl xJ,Jl I HGO-PPM@p 0W0p W0 @ߍ0( 0P 3000 00 ` @ pᢘP 0 p0 0 " P? R R R#[ 0 R@ 0PUI:PE0S [PE h @pꍫ p[PEW R 0 0 w00 R R0 S S `IPP   JoPp mP !Tj*0p@ZU q p0PP`p R R Rp RZ T3*ppP  R` pp ụ U:  PEX( Hq  PE  W  ᡥ  U *(8@D `P@% 0  0Ʃ  00(@D Pc @`0P`- `V`TE` `.PC^@-@l!l1 0LM`P0D00G Lp0PS- @.0 P( U( qp0 0A 0 D4P  0  0 0 D0 30LЍ4Ptpp  @ T@ @0@ <0 EP(e uB,uXd (B\ ALAA-PPM@7 q`p@T) X pp00  03P W 0  Ѝpp I@GT Ѝ3P @, ,0, (0 t,+ T@@ G-M0`p#@P0P0 V 0   0 pP"Ѝ 0 PP 0   0ศ( ?A-M`pP@P ,  ( 0  P0@Ѝ, 00ЍA-@P M@`PpQ UV'0S9 0S0S9 P`8818<  ! PP0 0pP 00 ЍU U, / 0 0 Ѝ0S z 0 00S000s S 04 @P`8 808 4 000x[ >_ ( <O-DM @$0<4 @Ph00<00 (0P tPp`I0 `9PP  P ,0  0P0ß RR RR 0 Q Q 0 R R < $0$0@P s p`  0S S S@ 1Y g*@˕@P 000S 0 R0 ?0I@B Z 0 6 @DQ  1 ͨ  @DY T!:  @Dp༨0 Sr CF P`0  ᮨ@D q [p?`9PT* P`뗩 0  0h!T1 0 <0 30IDЍ(I P ` BP@ڌ P2 0 0 0啩0 J` P`0 0pn  0 b 0000E00 `N`P,_ D\ p@-M@P` 80 00ɠ bЍpLkDk@-M@ ((  9Ѝj k@-M@` pPP0@0 ) <0< 0  0 p@Ѝjj0@- MPP@T x 0 P00 000 T 9 @ Ѝ0@Tn 004jjjC-@PaM`PD UL 10 `00"  p0^# 0 0 N R_0100 N.^3W @ 0Ѝ R0XS 00 9^0 @ 0 0 mBU0 0 n8^ @ pG W QU ( ,$0P c#!$c4" 0F0X (8 6  5O-`#3 0,MPQ@0$00P V Pm P[@0:T000 0p Tr Dß0 P` P`  @0 CP a Z\ @`V pW` @$pTN(",400S T0DD S0 sb\ ܦLLLr p 04 IᢥVC T T^ ŧ/ 0 "1 0 $0 30n,Ѝ!1 0 $0 30c,ЍO@:TP pڗP :V@Z) 0S  $0R8#<40Pq1p04 JRT TU 0 0@ CI0S h 0@ 8>0@ 01@$ph@.T`@$pTP[ʥLTgV   3U T L2t D 8 2 @-P!1 0,M@P`0$00& V.  00  0 p q1P* J 0 0 $0 30,Ѝ 0 X0X X0 hФV<0< <0 iƤxLR 1LR `  \0D  40O-plM$04 Q0@0d00 W P P% Φ/ 0 p$h4 0 d0 30lЍHHdHT`P0 HኤW T~ T0  0 4 $ ( , 0  00h1T@ R@TP  0q0S P q u \P 0SP qI u00 \0S PZAU00@40P@b 00T0` VN*:0TU0O "K0 0YP?@T$ 0U00S 0S "2 0 d0 30x lЍOu0P040@`b 0u PU 0 S *  0CR00:;80 S8: 0 /Z Z9 Z@P(1( R0 K P }P`P0`P0 IᮣT T0S 0 0 㞣: 0 0㓣00@SPl :0U@0t8KQ (Q T P/-N @ + +dO-@PХM Pp* 500SK ޙ([Q U U U  0 ؙЍ0` R 4 ?$0[& + %P&P 0;/qp 00P @ P i00 0 00ᢙЍqp  /0P  * R + L UZ p  0/P 00 0 SM  00 0;/qp 00`PßQ <`V;ῖ0 0P ;/qp0` z 00 0`VßR <0`VßpX0PZ Rg0字0bX0`ZLS  00Qe <`800C`V0&Z  "  RYL`0`f? ` ;/qp? 00  P  @ P 00 0Z 00 \P(0 S%: `F v Z1!0 U0 0C0Ԙ0P`T 0S  0C`ß$1$!$0 G8A`V0 Z 0CJ `J`P @0P \ 0000 00ᘘᔘ7 0 ጘH0H H0 0pL D& &x 0&t% D%p@-PP@` R 0AUD0 qV p<0< <0 HաVp0Ppl $O-P$M`@ T0\000 0 00p#p.0 0`' 0`B0S0 Q; `V00S  F 0S` 0 0 0PP  0庢0  T? X000 P6 0SW@@ RY00S@` 0V00S`V[*` PQ  @RP  _PV 0Q @`ǗH04 QY0 ᠓P, 0 S# H@ P 00S T0S S/ S4 T: P@000S 0 0͜V $Ѝ P `BV 0@`r ^` D0@@ yW TT SSD D0D 0h֠@$U   !p@-@PP` U 00F Gp 00p0 0 6㮠Ud0d d0 7㤠 0@0pŢ0TS00Px  P \ - M0 3/Ѝ/0@-@P MP U( 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0D0D D0 UU(0( (0 K Ph (0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0L L0L 0 U, ,0, 0  ( P p$p@-@PP" U 0S S S pp00p@/00p@/H H0H 0 ݟ, ,0, 0 ӟH p Hp@-@PP" U 0S S S pp00p@/00p@/H H0H 0$ ট, ,0, 0$ l D l0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0L L0L H00 fU0 000 ,00 [l @ h0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0L L0L H0@ #U0 000 ,0@ ` %4 \&0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0L L0L H0P U0 000 ,0P ՞T |E( hPF0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0L L0L 0\ YU, ,0, (0\ H p De0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0L L0L 0l a[U, ,0, (0l P@ h <0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0L L0L H0| U0 000 0| i8 ` 40@-PP M@ T 00vP00 Ѝ0L L0L H0 T0 000 0 qꀯ T <|0@-PP M@ T 00P00 Ѝ0L L0L H0 ཝT0 000 ,0 ಝȮ $ 0@-@P MP$ U- 0S S S Ѝ0003/P 00S00 Ѝ00 0S0 02/ Ѝ0L L0L H0 vU0 000 ,0 kꬭ  0@-@P MP U) 0S S S Ѝ0003/P 00 Ѝ00 0 3/ Ѝ0L L0L 0 3U, ,0, (0 (꠬ t  A-PP`@7 T- V= 0ppgS S&0 03/P" W 0  0A/0 03/P W 0 0A/CoP P0P L0 ڜ8 808 0 #М̫ < d* @A-PPMp@`3 W< T% rP RP P P ЍPX 00R X# ЍAt 0 0&㌜ 0  0W 0  0w } P@ J0SP@@,  0ܩ 4^ _@ p@-@PP U  ;p@|L L0L H0 :U0 000 ,0 /꼨  A-PPp`@. X7 V@ T P  R 0 R 0\A/W 0A/ 0  0 0  0Xl l0l h 0ܛVP P0P 0ћ꘧  p  D Pl  8D A-0M@PP` 0A UJ 0pS SW o dP R`V V V Ѝ00p0SP Ѝ W`# `0SPV 0 0 /nUh h0h d0 c i Pp00#ꌥ  ` H   p@-@PP U X p@}P P0P L0 6U4 404 0 +(#  ? l  0@-@P MP1 U: 0S S S Ѝ00 03/P 003/P 0  Ѝ00 0  3/P 003/ Ѝ0L L0L H0C/U0 000 0C/ך\  W0 p X 0@-@P MP1 U: 0S S S Ѝ00 03/P 003/P 0  Ѝ00 0  3/P 003/ Ѝ0L L0L H0G/U0 000 0G/ l8{ 0  p@-@PP U p@OX X0X 0K/iU8 808 40K/^p@7x L |p@-@PP U p@yX X0X T0N/@U< <0< 80N/5p@aԠ 0 p@-@PP U p@X X0X 0R/U8 808 40R/ p@, T 80p@-@PP U p@&X X0X T0V/U< <0< 80V/p@ꈟ \ @-M@GP0.S00Ѝi@-M@p  B0?R0S Ѝ$0$ $0 㭙0C  R8 ..R01 .Q( -S.S AAQ0B Q S$ .R0 .Q AAQ0B QQ0B ^-R 0 AAQ0B Q S//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /\# L0 0 /<# P0 4# /0 48 8P @Qa -P @Q` "P @`VT* P ``V{ R\Vt .V DA y XwP Q.Pp  P@] Pk  0J`S`P0xSM3000 D P XZ0``/Qi ]QPP 00S1   0 ]R(S  0" P XZnP   R0 F b" R` V` `A ` @R^ .RP @_@ P  0D0C   X0Q(00$ЍK00P  L`  V 0S000PZ X \0Q PS0 T 4*@DT[@ XZ(@ X000…  Q  T 4*@DT[@Z X `T  0G-TAQ@L*0pS% RC @R`P000 0X:  000ܠ   \ 0 S00@NT00W0Sx x0x t0G/zAS 0SPQP!00P0X@(00 T8 hO-`VP3P# M0 VP3U0p\ @X @RI R R5 j(00 ЍQ*@ Ġ[? A @ GRPR@\ 40S4  0@0[0Q0A[0S 0 0K/  Y*@T*0P+0 A\ Rɑ!" 40S 4 00ꀑ - M{ ЍO-S4M@ p00Sh 0S 0S0^P @^Z \S 0( X S B `$ ,PU P0S @Sf   [@ƖU `PU00 S 0W*0 B>^A Z`P 00  K Z0T?\P0` RP SAS"`!0PU`0\0VP`{(00X0S $0 Q*0F S(0S 0 `(  0AU0S ! "  [)@XZ0 p w(  ABQ APAU QpF  p   0B>SE0A S0A`P0S 00((00@4Ѝ R p0S  P\`B0[,? 0,$ @C /Q R!1 0R/Δp000  0R5 P`00j,@J0? Q0S 0 |0R/⩔ sX \Q\ @ @0@ <-0Dꈌ 0J <j ,p@-P0 0M0 10 `00p !@tp < 40 0 1 30ލp@< d A- `0 0M P0 10@0 (q\p 0 pi0 (0 0 1 30ލ;  Q:/R/0S/S:00/@-\@3#* 0^ @R R R >(000S0QA^ R! Q 0Q 0 ARL ?R@- RQ0A  RL ?R00C(00/C/G-`@pTY( V W TbP@TY 0P?S  ӕ00Ε(00 QSp@-`P@ 3P`VP@  0R p/pA-APUQ?UU@A`pP W ځ1AP苕(00膕00ꂕ?00Q A@-?SSRB 0@S Ag00b(00/-- M/ ЍЍ/@-M@ p TЍR/0-S0 \ S ^000O-P M@P 0DT"S ` ؍P-Y` +Y Q0Yb T@ @Q :`paXP:`pXP" [-SQ& K0I P0aIQW0IAIQ70IS| V[SQ;+ Ô꾔0S \0J0 Ѝ`Q0YXP A@0L ^P @ꗔ 0R00   ЍQ{ T@@{0 0 ?QZܧ 00M 00ЍH EA-`,!(1 0rMPPp010, V4 @X0^00pAtA,0Oh0 TAΌ`p0`L PP !&0 @t0 0 1 30rߍX0X X0 FV<0< <0 G9    $$0 M000 ЍL  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/ O-@SM _ YXe 0S000p!R !3  PP E`#3`9P*Q30A 0#1#2#4#8  P;   ଒0 A 0U0 pQ)KP 0@pQ 0S  Ѝ芓T 0 @00Ѝ808 80 @Px 0 0ئ tA-@P`p㸇0 xPṇ$0$ 0 M Ѝp T T0 0p@-00St@@@pdPddP@P@P 0000 08 xSS p@-P@ p@A-Pp`t@t@l0@ vU  1<0 hA  AbT 0x<!@-@P0S  3/000S@` A-P p@` F  y000 @P p@-@PɍPpp@!1@- BMM0P@040PPPPP`8|10PV l!`D0S \!p0 P P8A0@ P< 10 !0 0 4 300BލЍᗒP PP  5/P Q Q 0 0΀p0 00P y0 0 t PV7 | P0 P\0 O-MqQpP A@pf a@0` RD 00]1PI 0SP p Z [ @@P 0[pP 0PU :Y `P`PS@P TP 0@U:W @0@00,HQ|00p@@*ЍPЍ<00 -P  dON(NM 0@-@P$MP U" 0 P' 00 0 @P $Ѝ0`0` ``0 SUH0H HH0 I(M|x ~@w G-@PS  RL `10\0SA HaHHq`pP #)/0PS-00兑 000S 0 000 00 0 00 0 00 hG P00H H0H D0 َ꤫p8` 4v A-pP8 0S@P$0 @S 0`PP0S PU @@P 0U00 w\@ 0@ P 0 000 ,0 ⅎJIt O-RdM 0 H4 刀0 R X ($`000SYD@0S00 000#3 0 0  0/0P Yڰ3s003@0pP0VQ QN  QI P0S_ 3/0 0P U@@ SP00SJ" 00C0T@dЍ B@@@,20\ , 00Sq  R2$ 0 @ $(00 L00LP 0S 0<00@00 0<0P 0 S@$0S( @ ( 0PN 1S@iPQ 00C0 d!d1d 0( &ऍ0S X @0!010 ,0( ┍X!1 0( ≍0$ 0 @ $(0rP @$0S( @ ( 0~@J$  $(0u| xI DHH Gd G PGP `q ( q |ap `bP E  C-@"`<2 8Ÿ0M000P/"b1?2cQ 11QAQ@PϠl R QE00å?8@O3d11 "@(,p0p P$;`-`#"0X-cR:P-c2SD=  PP 0 0C@aa0C0C Cr  \\-N2?#c!!"N ,  ! bQ -5:bQ, !-#c!!2N0 \\ 0 S 0Y%0 `R 0 Y ` 0 `0 S0C0T  B1;Q/0A!b0\P  Y0 `R 0 S 0  B18;Q/0A!b0\P  Y0 `R 0 Y0 `:Q0 0\P  Y0 `R 0 YP0 ` :Q0 0\P  Y0 `R 0 Sd /09 b !QQ0 0\P  Yl0 `R 0e SED9Q0 0\P  vYT0 `R 0M S-0  `;@0 {`28 Q0 0\P  EY#0 `R 0 SQ / b !Q  (0 \P0  %Y0 `R 0 S'Q0 0\P   Y0 `R 0 Y Q @'(0 \P0  Y0 `R 0 YUP&UP"&Q0 0\P  Y0 `R 0 Yl6Q0 0\P  Y0 `R 0 Yp040080 0<00@00D00000 0 P0%\P Yr0 `R 0j YJ 0K0 S0ڜYZ0 `R 0S S3YM0 `R 0D Y$00,%2?2c  1R11Aãd0Sâd0CS0c0|4\P0 ?Y0 `R 0 Y 00   0  00 S0R05`003\P0 Y0 `R 0 Y0 `0\PS00P3 0 Y0 `R 0 SY0 `R 0 S0 ` 0S0 @ 1qp bqp  @Q2  0S! -Rf Sd! 1Q `P\P sYQ0 `R 0J S*(0 !`< 0S8 P  P Y 0Y `Q0׊P 8  4 P)\(\ ףm i h h tg *f f e Le d d d c tx0`tp^ ln|$IQY x0@ D.`0 SI 1hY0 `R 0 Y0SP 1Y0 `R 0 S0S: Y0 `R 0 Y 0UP d! &lQ 5=|o P$(,p0 VRT 0gS 0` `0L! P?A1c$(,p0"?dN2c1 1 @1N0/"b!!Q1C  ã/ d0 S  á/d0CS0c02\P0 bY@0 `R 09 S02Q00\P LY*0 `R 0# S ` o P `p#a O/ \+ A-M@pP`ḉ400 p0000@pT p`ᦉpFЍ蠉"00Ѝ(@- @MЍl C-Pd@d0@ M` pz@@ 0  @  Ѝ, 4C-@`P`0P M` pY<(0 @  Ѝ 4@-0N \0N@ T \;T00\200p@-@0M-S` +S`P0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-@0JS( MS 00C S!00 [?P 0/S 000 0 0P 0.S  0{P 0.S 0 000n@0 d m0@-a((Ÿ,Nl^3f*Sj Sq @R 0Ϡl 1CTa@0 100C\_?L1ceSe aa p@\0 0 @100C L``S0B0S0B\DKHQl`LPQ S@ 0S``Tà%A@002c2cPÌS S L l là l^#3S l là0C l;S l^àʌ͌)\P*Qgfff$I8T S ף0 P /0S/ 0 S/0S/0S0@//O-M00 S X $  \ @ 8 Z%/P"b0"b!Q8 UJ#.""_ ` p*b P!"bA0S/L Lj V ?%P P00 #1? 0B!P/ņZ0S< #"<ɟ_``APP 0Sl/"p ?&Q!Q0037 >R'0Z0S@)@` ϠϬq^Z R pSHp0W h쨟츟p Xp@@ @@"V堘(q Y.x|X5:xxHP %^ ` 3#`POPRU@0p XEW`` ȧ p w@F@Fp pW%GpG@@lGx@'Q_Y$AdWO@P1:X8G.BHWN <T3#`PPS@X0 pV弦P@D0" ,!,`AXR o``&ao@划Ꮂᮝ !R  ԕ (!܅ Y`3#p W0C@ STD05Hp 00c\0SL \8;Q0 0i`@Qqd(8JPn (0, UTA WVH V07(0P@`,0Pp? 00?0S  S   (,  0 9/P(0, SRS@PV0B00u TT00ЍWV `Vpb p-ER  80Ŏ;0R00 0;0800S< 8 0S Q{@#Q!Sz RW0ST 0S ``VJFm F|`1 Shp  [:1S@PTJ#M @A$(0, 0/0S/0  0 9/P P0Sj u@Dk 0PES 0N?7c ƒ c l N0?C?d` `aG`0da2@B#&>b`. c 0|4#+:60 0($0(>! 0#‚+a!!!0C0"[oÏ(" ?00 #2>[?G'PE@@GPD2#"P*"Pr D20,W#10 ?015: 2 0 #"".2Q 1 30 #1`0T!2? B4sppp0/SX0 p c 0|!+:60 0($0(>! 0+Qd!_P!!!0C0D![Ï(" ?00 #2>PVXi`v c 0e| &: 600*$0 *>!!!0C0V&) !"2 >n:E.€Qk9_u"mn? Sc$IųQ\(\ףp= ף: t: Q)\(\9 sc 0 "|8 +:60 0($0T (>+Q!!!0Cl 0[_("Y0%R^PP0 0 cQ@ R0!V BqgqgXpC)1? c 00{0,!):60 0($0!(>X! 0‚!!!0C0t!YÏ1(" ?00 #2>r?D0C00!/A!b!b  S2 B ("502c2c2A" "b1C @S/  0P08P2X!:#0R ό! UZ: 0"#2>"Q0030#0000T @D 0 S0@ 0 0 @$0ЍDv)1?c 0 0S{0x#):60 0($0#(>!!!0C Y38#,"0.s<0P0@<00000@<0P0@깁T 0 @-M00@P T 00t0(0Ѝ 00p049 9 O-@P`M 0S9  V 04[P? z PQ%  .  0 ! P  0 %0R R !P  t^00Ѝ0 S, 01P0% V 0VP? z 0.1#0 P PQ P% V0 R0R㨡!Yh&0P l6m&NSp@0GSHl`P [ 0S0ƒ! ⃡10hh "0|Y OX1000\11001Y <Y20`S0S >S@1S*S0S -S0 C Rp@0GHN<)`h0hlpt G||Ѝ*YY -Y00I S@0IS0  S ,S;SQHAL f ;S,Se SmH^(- Q 019mPhjp@019mo\@ pKph6Pc^p@L 9 bp&k htl&ug> 00 0 0N\hP {00@ @{ @  P 1 00A1 01P00P 0,Sd0(0P 0SHL Ʌ ah& `p& u&g.tl60$p ,`0ട`p $  $cR-:$cR 0#031`002c2c# b?0cYZ  [  R`p K  4$L)P 0 S 2J$`p,`0 380܃ 0,p0`4 cP":cP0#031`002c2c3`?0cPpcs V P  P㞋# 03,3(3,p01c000`[048 02,p0D004`<@p@ `08@Z"28#!BcRd:x"cRD 0#031`002c2c3YTX @R  *PŸ Zcc Q,  \Gce Q!Q*R/ ! !c 0p?0  c@`(0X$ $ ( 1 0 Y  YZ,p04`8<@@g>fΌ00t 0HSl0Ű1p,`0 @$ )\(\ ף{# P3" A-PQ@E 0S ɀ001N  phh6l6/z`n`P 0:S eP `VpFPW N ht0PPT`VLPNLg@P`_p:kPpV=`P d 8A-`PRPpP tP@@WuPqpQUX  P>TI QQ 1!0 t0`000V0 m``P v}=E0C0C P S\P0e/PE9  lPE0P0U0S0  1@W@ࣶ MN  hyT,qp>PP\ \\ p 0 000#t@ @O p ySt M 0@-$0$0!@R !hM `DM @-\F r  @LkD kp@-@P uhP%SPyhp0 0 ;q@) \kp@-P`@m R T0U:T0T:p@rR5Z@-p@-@QP> 00!R ! 00! \ P 0B RQ`0 Q0AP R 0 U00SpeP#eP `eP 0\0\ \0 <~qD0D D0 Wuq 00Bs 00'  ii iA- R` P$@ R0 0,°0aRI 0  a0R00S 00@0A PAp3\ $`<p@ ^110L00 0A pW \00W00S PA0ASP0@# 80p@#1! L0  A 0A迣p@-PP@ P c0000p0 0 p\%gC-@p0T@1W MP`  s qs0S D!q00@ Ѝ00r Xr0S   qr0 @r@O-4Mp@ P q 0` 00SgSe %S0 0BZSZXWUTSQPM'J?>=<;:97310/.,,+)('%#" vrqp! $9 roR V@7VK0 V & a0 Q S  T =4ЍPP؀PP؀010 00C0B Q$ROLP00 x8 0S0V `1!(  x 0SM0V `1!  x 0S60V `1!  x 0S p 00B S0@1 00B 0B Q$R8 x 0S p 0V `1! xO 0S 0V `1!xX 0S0V `1!0 *RS 0B Q@ 00B S@@@ x: 0S0V `1! x  0S0V `1!    x 0S  pD 0V `1!ex) 0S0V `1!X V  x 0S]0V `1!G +  x 0S p (  x 0S px. 0S0V `1!x0 0S0V `1! x 0S0V `1!xs 0S px 0S p 0V `1! py p p xp& qp jp cp"s R 0V0py V@ `1 | x 0S0V `1! | xr 0S 0pT 0V `1!u ; x 0S90V `1!f ; x] 0S  p/ T- 3* p# p$ p7 p#l x 0S0V `1!(P x 0S p[ x 0S0V `1!  xn 0S p 0V `1!$R 0@C p7 x 0S p 0V `1!x 0S0V `1!x 0S ppx& 0S dp@ x  0S Vpz 0V `1!  x 0S Ape 0V `1! PZ aX PU \S PP WN $pG PD KB P? F= P: A8 0B Q@ 0 B  0B Q$Rm x R 00p @0V `1!C P  p P  p pJ p P  P  P  P  P  P  P  P  P  P 0s 0 S p 0V `1@! P $Rt@00 P  P  P  P  P ~ P{ y Pv }t Pq xo Pl sj Pg ne Pb i` P] d[ PX _Vx 0S 'pK 0V `1!l P@ G> P; B9 P6 =4 P1 8/ P, 3*O-oMM@ @.0P0> LH@0060 @0Sv 0L00!R !0s030`00  0S   R @0 ܰ00000, d0 X00 G?@$匰D \0@T `%T @T PFU0pJ00S00P00pT 0Pr010( 0 0EZSjF>aB/7wArFG7/0P~_P    R\00sX @0S P=*X1RRXOTX>TQ.Ck~@QD,TDl(8`G 00<@ L@P@ _P@@0@ 0@00h00E@ `PA@00E S$U% (@D V U4 $:, 04   S ! 0R q0- r R^  @TP@@ 0R00Sr0@m4 _dp,  @TP<4P$0000S 00倀0@0S0000XX  )9 0 6 30 oލЍU_ 0Q}Pr0@T0P0<040!(R PP  R8  儠`@VS 00S0r00001S \0000S000100Z @DT0 +00Sp0I0 (0PCU80Q0@0T$0U0Sz v040 0S@@0S , 1 0,040Sx0| 0t0 6| R1|0P` x 0BD00?R0S 00S 0P00 t0S-0r0|0<0s P0P@$V&p9 0 h@lPp$P@`FVPpP`FVh@lP p :0P`0r0FP$L|P$Ud0Wr0( XT U0ڤjp$`@PEU0S ` 0VPPEU00S0$;0P0;AP400S0l;000000 00 `0000S000Q|`V 0D 0 000]!Sp07P0$ .RH0,0 H0 0S  0r040,S} R@D0 @DUO ,<  , 0d6000NSW `Ur0y|p P @@ T@P@<@2V0}p$p@`FV0Sp 0P'`FV0 ʨ 0S` 000@50  RH0,0 H0H@ D R ,0PD  P 0r0R0@0 L RH0,0 H0f]P0$ uTP0$ wP TPR PshP4P$` Y @L @TTڌ0 @HX\  PrHX@ P0\@PXPP/? 0, cx00CD0_P6P6r0$rV0h@ 4P$P`@K[0S`0P0 1<0 S cB+0S-0C R!1/ΟN2cR10B00P 0`0 0NEQ @H*`N^0 d00S0L>00`0N,.,>, , 0^c~.> , 0TcqGPH000 H0,00,0NR ,0P  01SH , 01H S-0`r0͵ 0SE 0RH0,0H0 4P `0S0=00`05P$-X _0p@T P 4 dPo$F0 <ps0,00,mdXp z40,0pH   S4 ,! 0S, H0! H0?  C0 v RH0,0 H0 ??  ' R{ ,P 0 V RH0,0 H0 ??     S  ,wP$Nz,@p`U*ʸzp0r0X R <A R R R <PXT@_0p4@0zpOP$us , S, p S my_X8<吉PT`P"# . Ah RH `$\ ,\0ZpEE \ R000 \00S0 0T`840d

< $H@P H@?H0PH0.r0S P,@ T P @0BP00E SE@A@00A S$Q0S) 1 0P 0@00  S,H0H000, a 0  0S,H01  0,, H00@ 0p= 0SH0  H0 @@-` MHP@pU<P  0 KPU Ѝ; A-@P`pU0 6PUO-p-@0`ᐊ/ Php` T  O{(0:ʱ [ 44 ?aCoc?`(?yPD?@\7 'pL0  DЍO R   R8C6h0P0U TZ T0 0 DH@J$Q 0S  00P0@ 0P$0; ($0`0P$02 U ,0W   `R`0@0 0 Rul1 01{HK""0 1 0k0KR k0{' [[( R {[OJ:[k{{+S 5A; 0+C 0S31Kd +{0k{*0  G{5Ck6kʫ+K P'{'k&[;*0  C{7{JG[2[Z SPS0:k{k+S 5A{+CG{5{0Fk{J0H[0 2 0 c01k""k(F[k 10{0[% PF[[ P 0@XCZG(0S[ 0SSp$@ `Pd  0PP0S0S. XYV Y `PK $PH0W'  W9RpG   t$#`P3`P-$ 0P$0&?@?$@@TU 0p C 0, 040$@p 0P@P 0Sh(0  PQP 40S(0YXQQ0 R Y Y S@ >`P $yP9U@ 1PP$Z 0SZ  pPp0U 00 G08[ $$NPP01 00 0 0 0$0Sy0P$0 ,0W  aP$0 ! `Q;${0KC[0k*0 F{7@{ k[3{Ck6{4J<0 0R?0S0u0 00\ {'{0; Q {'kkKE{{{7N*N BB*N@{*0   P0y< `  s0R 00P 0mXw,0[P   Y`P 0Z  P0P0 IPr0P00W0SpG .@PP   ! [UP P0CSg  s9R  0   00P0 070b@(u$sPO 00C  0`P 0S40SD G0 4?0000Q[ 4Q0K: 0[%0Ck{00[{ +S 5@~X0SY 9UP p9 0 :$@?@0P$000  1 0Q Y7 Y {7{E{.+ P0x PS EX10S 000* Q%ں0S$&R !**R UP0 P 0wPt$0SkPpl0S0r 01 0 00 M0IDF I0P0 40S G044Q p9Uo X1P, 4   9@- M@P`[ p ZUT 0S*P  zZ@u[p Ѝ @@lZh[p Ѝ$S `[T@p\[@P :#46*0/Q46*0//P@-@00 R@,P@Rp@-@`0P0RP*0PpP  R 0 R VpP !0@O0O- M@SX@DPqapzUVq!`$:0  &^ ^ W0 * 0S  BX:X@D*0S @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ0- UM0,@P.0L10Y  0 0  T 0       dZTZG @-@-@-p@-`P@ TP 0FP R @P  XY00pT P,0, ,0 ?X0Pd|p@-@P S`PP  3Yp0 0 :WD(-M Ѝp@-@ P` !LN3U !@Ap- M- ЍP/L -2M")2b3c1@2`1  00ЍC0@-@PMP 0 00 0 Pmp`Ѝ00 0 ;Wܜ0p@-@Q r  P p0 S 1P p PP   ! X @0O-M`pD=@0D0Q0P95X! @0S S[ @   b 0P15  P T@@  0  "W @TQ 0P02@0  0 W` ЍQf@ 0R AX00@P00  m 0`00R.@0QLW 00000`VBQTQCp0 0"!` b  V0 =T@P@00X"000@000C @~ 0Se0T0 2a PPl"! 0#000 0 ! 0 @ 0~`@P !R/0S 0C0/ 0RA-@P)p`B @1V@ * C BQ   `BW0 pg3701V@ * C BQ   .Wb e PPO-p -|M0<80@0 Q0d0p00`l0-P-+*)('&%$ ah000P0 0 00@ S 00(00iP@!T 0PB!T00@l@0 @ R \ $ EQ"    lp l  +RO -R, ,  l  0B ^lp 0Rlul 0R 1B\lX  d$ JR 0 R* /o"0 ZT@gkXpp XFڐ: 5g01[5[X 0S 0}S} %0hSpHpt0 ,0pH ,hH Pp t0h0 pLWt0* t0 0ht0  A R8 , QpCW& pWp hpw0h000(0, St  800Ss,080000 00$ ۟ 0$ S?˟ B @0p$  0HL0H@8 P{  L ! >Vp0- @Pp p   !2VhPt` E Pa R$0@0P, C0E$@ PP0C PEP`PU00 S 0SPE`FK$0SfEQ<8 0StVl[  P3  PP. 0S0S> ` 00 pSp Pp W 0Sp#a V380, S0d0 p [u0[`q KQ 0Z00SaM<00P00400h 0#Z00St0D0I `\] `P \QRT40pS  !g p Pp 0 S B\K80, Sh 40 B0h  WD0h t00<0CQ?o20S )K{8Ik{ Zɋ%0S    ?@V瞯<? XN`?0Sp|Ѝ 00XS `l`0P P0 0p Ql000Sd00d0R lpm d|Ѝ 0YiR IR NRl@BP 000l00(S0d0 0p 00nR 0p d0lpP)  ^PJ Tl e 0B Q$ Ql  l  0B Q 0pHpWt0,0*W.  @P z000l0Po `00W'"!2|r0{:#:?C0C0  AQ' r!zGpGp4656:RH (30{0  QH 0R l 0R l 1BQ=l0 B`$QP0Bl 0B Z0l 0N0B ZL\#,Qj{p Pp h00h0<l@qP@ l0X0Cl0h Pl00l0 00000p d0s^ 0pHpt0,0pg  4Hk01{p| W'"4t0{ :#:?C0C0  AQ' Pu!zGpGp4656:RH T 50{0  _000d00H  0BPt0,0pHW 501{',PrR  OV 00p S0lppA800p80 t  t  W p!00[ K Pp p800Ct0h Pp~ !T T  TTQʬ$Z<^t0:Sd2 0:6tt0,0`"0 0 5S!{d 00'  H oP. p840S<00:<0P0相00cP040S p0000 P JXPX0 X \$$dX10 300 $ B1kd00 {0G G P {,AOCpl X4 00  h{  A1{'kd00 {'0G GP Y0t0,050`m A%T0000,P0d0S!00pd04Vp_ 0Sv ph0 |tQ0k,0 00C  t0!0h d0VpU!0Zd0 08 ,R0 PP{ EPt0p 0Ct0 0hd0Ppj0Sr @ 0 00p d0Sb p 0p000,0t0P0d0Z!07 d000# [00Sp 0 VZ F0d000 3S 00d0 #Pp  h`1`f`Ph00h0!0d0p80, pSd 0S!0d00S(00(0t0h 0Ct0t@-00}O-@ 0Q@P MP`PV pL@ 0P  "(%(!( Z"8J@ ZpI3q WG N@ "8!8P0LL#8S 0Y  0  0 ЍU@P   ! [P``3ß0O-M 00@Sp 21`C`0 00 0S  0S  S0SB00XS 0Q P@  QZXT#3\Q]WJ:Q0 Y \ 6 Q0R T0#03\0SuWa* G0V*0F@S3 FQ   O0WN 06S ЍW*@DPD@ Q0; Q0Q l l@@ 4 Q:@00XS Q0n MR)AoᨂX " 0^0 n120 00 QP0Q0l1 c 0R:|00Q )Q 0@ O-M<0 兹XHX8@`00Sp 00Pu0P0P0  EB0SG^E@0= PPb @0 Q ES ZH P 0S S SD `Pb@00@0 00Vp@ !NT 0 PeS5 q00@00S Z 0 @\Pc R  BPPb S@0D0CSڣ0SPX 0Sa ]I0 0TX 0p 0 Q T @ T TD^ @LT 0CC10BgP0DSy`0 S0 S C U 0S S S OP@"00ЍRq  BPP+\~ -\  L^ ?L NZ P\ #LPNU PPl '@Ѝ \ 0PP0Q 0S00 LS S80S #000 0 b@0#O"00@C |`P D21 `2 Q` rP  P \ PR  @V 0Sf Sg S @00ЍaF PePf w0 S_ N@"00ЍP@0M@E PL K`"VpK`W  `21 p7  ` PEF@Q@!80Sj80S 000i U U E P 80S800c8080S `T0)  RP!@L#80ST80S P 0 0  B @\ \vj 0`e  BR "@` P3 `2 c"1P 5 @  /A-@0P R#`pn3 ^P 0 W@00 0p `UPEPU 0 BP @p `W`  0 BP0Up980@-@- M Pe@a 0 B 0C2S6cА* Q*KUZKE A@{ Ѝ0@-@0AC^ 0S R0A  S@-A *@\0L0C00T D B @ WL0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/@@t@A-^0000PbA1 !0T2, l!p(  T2,0N10C#10R! T TNNN1^0R P@-@M: Q @ 0R Q ~@ЍA-P a 1`pM0S3 U10AT !0S 000״ 㪳@T0  0S00 0Ѝ@0!0D1S<000᯴S 000᧴ x?l 0p@-@P0p R pPQ`00App@躵D `ሴ0 S,00App@| xh>l,>0  0#10/ P#8 R#4#2#10 0// /A-`P@  1,0@Up00p 0S1pP@P:pP   ! @K`}P081#3S412s2sS/1J //@-@P0@0O-0Z  @SMpPA PaU* F B  J  ^'* 0H0C X000300 ZP@T  ` d` X`Z P` @T@T 06S @ЍG-0܁@pR$A0 QPiV'10SP`P\ 10i1000000S l1| zPP4 @p PU `@00SaPP# 000S 0R0MPU 0C  pPph0;iV0S <00 ,0R0i :xH:qlc8G-`P0R@Tᡢڃ0TP$ Zp !pI0  a !  \2)0L0C\0003R @@GpG  \-0P!1^$23\ *G-P@0p@DTD !1PD*32^ ::P  @aP @0 0S 0SQ 0PAPE%Qp Q!! 3 V@ 0 0S3#V0`F `F` 02NS @0@PpP 0 0QQ!P3 p@- @APD0D ` PR @ *\ l1 0DR56 501 P56 +Cp0R `5<5#11<?@-P- M@@;`P  46!z60:S  W  0 C.G B 50c 0 Ѝ  0P c2# R   W C>C0C012`00S/0 R /@-p`aM@`PB L1P5PP3 9pP-0S  Q6 p 0: S/4BP  8#80 @0 $ 0, ( 0 0ЍI00Ѝ<0T0T T0 EGI00IO00 @Lz^0p@-@P =00CS00 P=pP0 0 =PG~<]@-@P 00CS00 @ 0  0 I3G\d~A-@PpS 0rSL wS aS_` JI 0 \`0S! e C+S ^R)# `0S``0[S0\S0TS0USP`0 0 >F$P[(p@-@P7 0S= ==P00 P! !& 0S 3/PP೼000P @ P 00 00`aa"=d0`` 0pձ|:P404 40 8FH 0P0{@Z0@-@P 00!R !+P 0C 0 0 ;dF({YĿ@-@P 0 0 S @>:0 0 ;LFz`Yp@-@PQPP 100S3 0  US 4000S8 0"$0 3/0:0P6p00P @ P U00< R 800pa@0Pᖰ[Lᑰ9P00:h h0h 0 JE 0 @0 0p H0 @0 0 DW, ? ̋ a!*a*b"0*b$*a!4 *$a*8j(*",j"a(!<", a"j(*@",c#j"!$$Da(!c4*"H0i()O00000 0000.0)P0P 0 yP`0` ``0 <Q  ,<0b1Țt3)@-`@MpPP  .00U( `P% 0S r?(p0 R# 2 p00Ѝ .Ѝ .pЍ>00p 2/QA-@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   (=0  '  P        P  0  V/0 0 0 0 0   0 0  0  0  00   0ЍR 0B8#8P P0#0BR0``      UЍ<0< <0 bV; 0(0S"( S8`-l 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 `|0| |0 8LaP00@ @0@ 08?ȣpĉ"̉"t 0A1Q=11/C- MAT' }TP# `P D9堣 0 団AT R0 X 0V@T Ѝ0`P  000 0 1 01 0/p@-Pp U@ p pE:0@@:@@!1 @-CM0M@P0,40P: L10H!,` @| PB*0 p A A ?4p@ p#  Yp U p % 0 0 ,4 30CލЍl-0P9 0P 99P@9?00e tx O-p@d&P`6 0TMP`0L00  )00 2mU}  900%5 0 L0 30rTЍ0w 0Sq1S6  )P䁄/  0少0 0!00 BR{?Ⱐ0张:1S ZY0 0P 0弰ᰐo(0S !n)( O0P0 (崰0U P0尡 1 0C S^*00 0 P U 20 2(0 0~w R0%6*0R$0: pn 0 0000S0800@0$0<0<04p40 pW 000$0D0D0 ,0H00080 0S,`UV r(P< 0㸱0EJZ㪠* 8#8[* C00C !1 B("01 0"Ȉ  0(0  0RE 1S RK  R[@  (g 2 O 0 wpH (PA ( 0 hKIY㩐G* )I Z0 0P0 +1 S0"1! {0!10CS`*8#80C S 0!{/ⰰ10 0 b%6cM800\0\ \0 b6D0D D0 b6D М hxDTO-(0Mp J @a0iP^0P P FP N*1XJ%8Z1 a@%X0  Q1S@10CS㣰P* 0K8#8S0C8#80 V !S10C1(0 . Ѝ @Q! R b0 `(0p.  0   pPM p P p 0 0R1 S0C1ȁ2"0 bo5Tc Y 0I 1pP(00(0O QPEUP*0EY#:YQVQPEUPk*X%XPEY Vp崑 (00(0G1!X%X0 bPE45Y*0 p1{PQ Y Q &PP  @PAgPA(00 (0?' 1  1@```0 `p崑P h &PPc 1P0CS㣠 *0J 19P(00  '|0| |0 b4(00(0 '@0@ @0 b4|D|{\{hzxz z0zp@-@PQQp S&P 00 &Q F&P 0 0&ppO-P,a V0Fn 1.&@T `Vp0ഀ0  pv 10CS0*S0SX 0Sj!P 1!0 bW4  H 1 Fp(8V㴠( p1  0 S001Qp10CS㣰8*0K8#8S C("(  0Z8#80R10C1 L& R [P 0!10! 0 !P 2& ,&(0( (0 b3dxtxvPvO-pP$M0@S  &00 2T T 500@$Ѝ(  @j @$Ѝ0ķħ07 0 0 `Pf  R d8#8Y *P0 Pb1 "0C @aT㴐: 0 b3갑@I0Y 0*0S0C0z   Yp0xps 0B8R#80010CS0O*SUP@0 %pP 10CS0*SR 1 K10CS0@*S#P p%k k%eT*TP\ 2@0 2$Ѝ`5`%`0 b!3T L%050%00 b3 ?%Y 0)Ioᩒ 1%+` +%0 0 P 0 RF 〔 @`S< 0 0S  %q,Z@  @@DV A$q Wt 0G 1j$P A`W@DT@:#0 b23#0 b2 $t $ F$pPIPe D3D#D0 b20@W1@H $H @01` 1 0@1@`01$ $@P X0*  $  $P 0vl2l"l0 bT2@Tz {$T |p400o` n$ OPb ,p 0R X Z$aV@F S$a0W# @0F 1#PA VR  B1* 崠T0@D1 &!0I*0t`崠1 加1 0` #$ #@DP 10CS㣐:0 0 b1  $ }#Put vs sPs `srT qq0 qX 00 0UXS 00 I;w0. T:+[) P0K/S  000P0: S ^3000S0I ST3?00(1(!(0 C1QP PV# 4- }p!930S X  \0 RK [ b#P"300W ᾽p xώP 3@om Gt (h&0lR Q0P:Q0Q:1@-@-@@՚ $ @H0 p@-@P#`-P$ p@rක/ d0@-0 M @ 0  @OP 0S  Ѝ`H/ O-lM@d0P X$01 d(1dp Dp1d0  ,01d` H`1d 01d 41 d@L@z1d 8t1 d*0SO H$H0D0<5<%0000 @p`0 0 P$ W PP0ES854321/.-,+*)01P0PP0 Wy*0V 0@  `PhU&ht*P 0H$HS0SZ 000pxV'x: P$@0SH$H*1@A(0  0R 1 S0"8!#8!1!V 00C0 1őYP0P 0Ӂ\0C00 p pV* 8S勰p@p V@ HB$HQ񏐻~si501 W00: 0(0"(Si*0Vf W|PU:`0 )01 P0P PP a01P0 PP 0WTP   Ƞ,Ƞ` @ h&h@HV$H0SHp$HH*0 S108#808#81,Ѝ   Ƞ,Ƞ   Ƞ,ȠpGx P$'x6@ 0  0f)0 0  0\) 0 0bR)l l0l  0H)`@p[POhTL(N@0LNLL`LKMC-Mp`=@P' 8PP"  0   Ƞ  ,Ƞ 0 !! 0 04000000 O@PЍЍO-M@ 8pPPc 0 0 ءR 00㲡 1 1`0CS㣠B* 8#8V4 ء ޒ`PF 0 0 Q 00 岡1 hP. 0 0<0 00!Vpp)@PЍ000100p@PD D0D 0b(͓p DIXIO-`0dMS0B⌀p4D H0∐@(804 0* pPUn Xg*1 $0C8 #  #ȅ 0 0(0D0HPS a,ZM )  0  0$ 000F 1pP& `V 0`h0&h0CdS>V;:987 543210/DHp  < P6 2 .TdЍ0 0封10CSL*04 S0000080b `V 0(p,0 000CS@1!0 0 0R0 0  00"0VS00\ HX㨀*(ሀ 0 0 0 T\XP0XP2/ 00R 00 00!0 00 0 겄DX 010<0qpGWpJ*< x'xp0qሀpGx0'x0qqᰁpHX㨀L*0(0,0HpSa (0S  2 0 pP=  z vaZJ P 겄DX 010<0qpGpWx'x*W 0 08#8S:1 <0C8 #8ሀ 11qpGWp*x'xW 0 08#8W00,0HpS (P  " dЍ0!S0 B("8 110 p Z"     : 0D0i  L'L kP 0 0 0X 4@ 00 D G#(@UHX㨀A*8#8V *("( B``F 1`010,0(p2O`"      qpGWp*x'xp10<01qpGWpm*x'xp10<01 0bV&00 [ 2( 0:p00S =P00;l!l1l 0b0&P!P1P 0b&&4!414 0bx&'x !1 0b&p00 0$ b& 0!R 0 $ 0q% 0 0b% 0 0b%qXG\@p@??h??@t??D?X?$?@p@>>\>>O- P`@Pd 0S: 2 Bp0* 봐pY) Q0? S   DPPJ 1P0CS㣀#*8#80C 0 P!0 0RY 00p10CSP8*8#8W 0 0 bh%0 R p崐P U p崐 0R P 00<0< <0 b7% c<<;;O-pP,MP`  O00 VV 06J  (0`FV񏐓fb0FS('00@,Ѝ(0VQ ,0`1V 0`1 0`1 Iⴐ0 1  ~@P a`FV`:'  0b  $ 0 a`FV`:h&h 0b`  $1ᰑ0I`1Y婐: 0 b$1,0@1S 0  @0 /@P 10CS0:5%0 bx$ @崢 @P 0 00(0`00(0r?@帡 H =: 2 @^ 00,Ѝ0SQ 0SN 0 @TI @崢 0 sp@: 0S 2  1] @P) VG !VD V(0&Y\Vi ` CV% @P 10CS`*0F*V @崢  '긡0 (0 @崢y @  @`F* ⴢg(010C S*ᣐ<* 8#8ZV> ` V g@PI *a @`FV`: 0 b# @괒 @, 1 I@P 0VSVa V0F (2("(0 b#,`ⴢ @ 1 '@P Y10C S㣐*%* 8#8Z弑Y0I | ``d1崠አ!0 @ 1 @PQ 1 ! 0 bF#0C 0* ? 0F*90!1 `0崠C 1[ @P' 10CS`:p0p p0 b#X0X X0 b#$:8:8845$D5 404d3Tp3@30P3p@-@`PP 30 00(0`00Q(0pO-,赟M`@ 弡 pPM 1p0C0XS%X9*U1 X*U @H$H @ 0E 8PP 0&0!01@0 @ Z @JH$H o0@$ 0 b" 0p0Ѝ 2 @ TQ^10CSP*8#8TQ 00@p P P  ἐ P 뼑 0 Z08 #80CR v뼑 Z 0I 1pP Q0YPEU0P: 3 # 0 b*" " @QP@ Py 10CS@v*0D@ 0\ PPg 7뼑 0 Z0P +뼑0 Z, P0I 1pP @YT @D1H $H @U0PE101!0 b!1@DH$HU @PE! @10  epPM 10CS@:D1D!D0 b!3 9 0 @0 0 b!0Y!08#80 !P[0:1 0p1pP01 0P0p|2@T1//X.Th.--X-Th-R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/4 @-@P , I"@ (! 0"|O-$M 2p  (@0\0$pp 0 P`0 pP`@  "Ÿ%f#"," 0` ! `! %   X! , pd!d!  0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$Ѝ  C-@P MP' $q`{?pW($7 )0!0(0 `u!2`p` b8"#4b4# 0d! V@h ! Ѝ 08R(@R )@ b! 8  )8 b 0A-1?`@Pp @f(X( P.! 0刁0 0$0@pG0($0p ?W6@`G?`@`` 0$ <@P U 0$ ?pW (! 0$ q0 0$ ?W@`G?`@`(`@   0$ <@P U 0$ `R @-/ L@-@P 0  @ ( 0"R @-/ /@-@P 4@  Pg 0$$4 O-LM(6,Bp0`0,$ 4<8 P P(^_8~?00H@040<`p0 `pP , $,p `pP`( 00 400c X%'%ɠ0nj) "&&ɠnj .,@0 ˠČ,+$ "$0 !'( ( 0! 0( Ϡ' . $̠Ì @ !  ,  , @( 0$0 [3 `0~?00<`p04P0    @ ,  @ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90# ..YW([T0#P P[T(P  P%0 P P P%P 0!$pP00(p/!~,! rp', /!!,(,#p'\ )S   ( "P p P% p PP%0pP4p p0 0PR4P$(P]8` 000 0 00 00 000 000 00000 00 0$0P(0$P0(0,000,0008 40 0 408 <0 0<0LЍȿxp@-@@DQPP` U  0pRPQp bo Q0P0H @ p@HR Q b>p @0A-1`@Pp fPX; @0D 0 #@0D  H00H0L00L0pGPpP3WR`G```@0D ;  SP@0D *H0L 0 H0L UpW P@0D q0 #@0D H0L 0 H0L W`G``P` ~@0D ;  SP@0D *H0L 0 H0L U`R @-|/G-@PM 6PH8 I `p `K U@ Ѝ@-@P 4@ 9 P 0$$@R @-D/yG-@PM PH(  `p ` U@ Ѝ 0` a!, a c,/0@-M0<P0AP@;P񏐾>5>  KGC?;7 UQMIqla]YUQMI 3/whYzP;DPoE@5Pz}|ytsrqponmlkjizjRQfeNm^]\[ZYXWVUTSRQPONMLKJIHGFYs 7P 7P 0P:0@ 00 P%0H p Hߍ0?CP 0P 0@! 0`ߍ0= @02S, DP,ܨ-00   0  00 0H ⢈p D ?b0/00 0H ⇈p h 0 0@!0H tp HP ߍ0 0d 0 F0 G00@ 00P 0p 0 C0H_PZ uHYPT o 0[ 0 0U 0R 0O 0L 0I E0 D0 0 0 0 0 +0 *0 )0 (0 &0( %0 @RPA@  | 0v 00@ 00P 0@ 00P |0@ 00P H0@ 00P  B08 01P 0H 备10pH <0 ,00@ 00P6 X0@ 00P $0@ 00P  0 0 0 0 0 00@ 00zP[ t0@ 00lPM r\ iX|$4`pI{G-8M(pP` {{[0n@U@W@V@To 0S@!Q 0S !Q0S{ Q {0 02{" P0 ! ("(R  #|:W UQ VPw (20  ` " Q!W  U0p& V P`P( U 0 0V 10 @d ؄8ЍV `0Q  V`W U0p V P`000 nP0SQ 0Si Y @h0`0  V @ \ $  0 p@-0@T 03/@T΄PP ʄ00@T 03/@T\up軄H00@T 03/@T$Tp t 0 4 @-M@@P Ѝ  0 p P$0$ $0 A(ꘃPTO-@Rp M ഁУP `B80 S" 0SK: s0  0Z 0!80S7  0Q?0 ] 00 Ѝ 2  Z  0  00 0 P 00  P00 2  P   P  000 0@-P RM@P Q' ! 0 0 Q   0 013/Ѝ0s/ r? ;P100@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP `@(d ```0V#pؑI@ T`1 `! @D O T@ p PU Ѝ ЍipP p`O-Mq  PpG  0" PU  @P U`1`!  E[  0PU0  ЍЍ@- M` @  a P 0 q@pGV @DP @PPT  Ѝ Ѝ wP/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-@R"2 0|M`P0t00[ 00S80S pd"\2 0 t0 30|Ѝ4P  P8 01 0#\ 40`0P 8 0 0ɂ Xp: P8#[> !1ȁ0!` 04 4PU 08  R88P@P`0X A@  1248 Q080!:0 S 808PP8~P 8 ` 0tpP 80008PP8l00pgQ  @X O-M$ ) 09 @,0p020D2(0S PU 0H"4S4S2d90U 400P0h00w P0.0Rd00e0 0h@00S d0P02 0CX 0 ?01Hr0 00p h0S000S1!R00:X Y 0c/d0P0c/K0  00S 0 Yp 0 SRPU 00$ R 00,"00't7 0 2 30ߍH2SP708 R4004 4P\ P0R4040P0눐4`0} 0 @ ᎁp 0`U:` 86(0f6_V04ࠓࠃ8 X00Sr  0\ Y``VP `PP$XY0”2  \8Q(( Q %P`00S 0 SRPU ?00$0S00s8Qr 4Zx ` Z``q XPF 0SU 0 RP ZaY0MX  R*c/v0 0' Y1 0 SRd@T 00$0S ,0S  !\$0(0S (0@TP #  P 0 SR@T 00$0S7?00 ZY0 0c/d0+0 p 8Q 0 SRPU 00$0S00c/dpw@ 6X P2 `0 R(SYPR`VY`P2 08@04~tRP>~P0 S (0(X PC_oRPU``  0S0S~\40 0 48 8 \R \P0` P u` 0 SR@T` h200[@ @ hM`F|(0P`2 ` 8@P@,@ bY$0So00A 0X0 0 SRPU 00$0S.@ @ Ժ   \ A-P`@M@`@`p}000,00(0 00hP}Ѝ 0 ! ƒ1p@-S@P  0P ! "0 2pp@cp@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00[ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/8!81@- 0MQ020' 0S0. /!PR*/ "RR /@ 1@0BQ R QQ*QQ  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@ Xt  t /O-?o2P00#R00,MSPP $[ 0#!  c  0pT UW `0E"U`@ (UP %  ;/ P;/PaW0 0P`PU0d   E BR R  L B@FR !R5 0T0TH SX:`0C 0 000 0pP0pSpU0@ᕘ( T**pPc`@Y* p  Wp ;/P T T  0 X0 W p0p0W:,Ѝ  P;/ 0P 0B  `@U, ;/PW W 0 0R0 0 R0T 0e:W 0  00@DX 0YW  P SW0 00P=  R0P0 S*T 1 PW  RW  0 P  WE  P  B B@FR !R AJ;/P ;/PO `0Q P0  0;/ P ;/P0F $0;/ P;/Pڅ00DP 0;/ Pe;/P ;/PPWAE S ;/P`  R0 PP 0 C 0BYP 0  7"!  R  B B@FR !R A"! Rw0 0ST;/P?P ;/P8;/P}$ ;/P$`u ;/P` ;/P X ;/P0 0O$ ;/P`W 0 R0aP@0@ @0 mj(0( (0 laPd|- M0 00 ЍR Q0P:Q0Q:w{@- 4C-S MP@  $3/t`  0  QP `y4P4S  $3/000 Ѝ>00A-pd 4V:@T@T 0P0S  00 S  0x@P0`0dp@ B ! A-`M pḛ@P0: SxxPP ˅P@ P 0 H tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04 0B0   0R 1  00 0p  0% 0(A0 0 0SL@-   00AS 0y4O-SM{@Ap⇁0PS`*0S'  TP [ P0 00!Q    0    Ѝ P@ $ 0  QP1w$R P0)000000S@p 0 q 0p4 S   $3/Ѝ 0000O000Q 0A00/0@-S@  R   0 x0Sxp@-P@T @T 0 `pp@TP`p  0S S/P/$(0#   @// / ////@-@ RM`P:Q !S@Ѝ0 0p P G @Ѝi0T @0 0O-PP X 0S ' & 0S# p@# ,0aT T 1 !3/PT0p0CS@D0 T,0p@VP ?0T` BB \|  i V`! 0 0C 0`@ 0p0CS0 0T `p@QQ    D R !,03/`PIʼ0@00 "R(  0Y `1`!0PVQgRJ,03/`PY M 0p0CS@D0 T@ 0T p P@0S*V*  000P@DS*`A 0`V:v0P 00``F0 ``i  0Y0C00 00oP  u 0 0C 0Z `k 000YP sd0d d0 G. XH0H H0 H$ L00_H 00[P,wwp@-PP& 0 `V @@D00T`0@T` ,0 3/Pʼ0@00pD0Spp@/0 0 V $ v0p@-@P0 S0 PTp 0P0, @Vv PPvp R0  R/ S/p@-@PQP9 100S 0  R 0   p0 0c 0p&   0R00 P @P v0 0 $0 ,0, ,0 <e pT D, t(@-PP4qMp`@+ V3 T; p   2P0 :CoR  S L 0( 0R Ѝ ; 0 Ѝ;0t0t t0 ! VX0X X0  T<0< <0   s@Dr,rp#p3 @-@PdS0lM0d00PB 0 C 00   #3 0 d0 30lЍ }0`0S, ps0P " W000pS0```p gP0 ```H"H2H 0 | 0S "$p @vPk 1 0FB0/Q/S-,+*)I'&%$#"! 83 )p00 4{ 0 0{0{{ 0SP `v 0W 00 p pp px x0x 0 / g\P۱  P @q8X\oxp@-@0MPt00TauV( 0u0T1S Opt0T1S"u0` u00 UTX!\!R Ѝp@s\!u00Ѝp@s00UX\! X\!0 000S/ x0 0p@- PUp@0s00TQt0`U TQUP spX1P0X1t0T0`X1 xh0h 0 R/@-@0s0 X10CSX1 @sOT1s0 @s0 x0 000S/g x0 0 R/p@-@0PsU00 \AQ\ X! BRX! p@os`t00OT!s00p@ds x\ \0 -4M0 0,008 00 0 ,0 304Ѝ  p@-@QP  (p@ 0 0 9# t,@: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @@-00M>R@ 0 000P001 200 :P0ЍM00T0@@- 0M@>S   "0!,03,0 P0Ѝ)00@-@@0 00/ံ 8(0(0-M 0 0Ѝ` -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ x@-@p@-0@ ,p]pPd0Ppp//////tf //1O-0p,MWP` ~ m1 00 (05/,Ѝ襃@PK 0S PPP S0S3*0! 00S S( #S1 0 0S  0S S * Rp C 0QW0010 0 S0000t0t t0 .0X0X X0 $N@PL,LE$E//O-MD-0@= 00000P0Q0S* X Z7< 0 00< 00 $0 0%SS  JS} 0p  0GZSZXWUTSRQPMJ0~}|?>=<;:9876_43210/.-,+=)('&%#"m ZU {wInW  ,p` P0,@`      P  *  Q [: R R0 Z ˄S0CV Z0Ԅ0˄PU*a 0 `CV`F[ 0 [04`V*U00G p! 00G S[    0 00S r-0 b0p@p*WS 00G S8p00G S1p-p*P @T  `v  B0P 0CV0` c0P0PF {p 0  0$0xp00sj 0SP00`aP@` ``0S 0 S 0 0CS  P $( ( [W* RU  BR BO0 [4 R*IQ v 0 0 000plWp p0  , 0p倐p@ 000 000p 0SP00`P@0 00 ,  q QP`}  0  0 +0p0c0 Rp0\pY0pS 00S5 00< 0 0A 0? 0pS+ @0" 0.!0d00T`@0V0S0PF0C 01@4544 0( r< 0 p0t R0@ % % :T5`0%1L R0T%:P 0 dV0/d* 0  D@D0 V 000  0qS@.10d0Q00 S0 000D0@L0 [  04   BR B  [4 R* R ["*  [* 0Zp˅00W Z  000 0?0 [0K0"2 0 0 30Ѝ0 0 / ,I  0 5 0 P` f0PF 2 000  @ 0 0  0 0<@: (0B(  0O @0("(0 0 @("(z A@`P0 00 0l0 @("(0 0 0 0 00p0T0  0WmԲ tD`D\=|P0 l97@e7pA-P@@ x0`pP@PU J0SPE 8/`uX@pW$0$ $0 :8 |ȝ6Н 0SS S 0R / 0R0@o/ @-oG-` !p1 0CMM@P0440w @ p 0 @0 44 30*CލЍ  00p 0XpP ft 0 p\ආP+  Le  0Fe/Ġ أ 0hSG-`0S+ S'QU$ pW!@0 S00#S0S 0S0S0S% P" YP@ Q@ 0S1S00#S0S S \ O-0 BMMH!dQd2 hԀ&h Pp0 `V' 0 ^P@P Uo_l_0 ZP/;PH <0 0 4 30BލЍ#x  O-H!D1 0AM @ MT0402 0Y/:0`x0(SP05 R%S3 #ttx0'x 0@T "__ 0 }P pW t 0 T^PP D0 0 4 30Aލ Ѝ x (RɟH H O-M Mp /? t0060 @?T000 1S 6 S`1  0 ?|@X@0 y0p t  @0H0 ^0S3 S70PuP`p@ R HP% p ]0 0˄P R!R㇓ 2P PpU`@P0STu `ppp0S`V@ 9 S  R= @0L0=0T0<0d0p0P0 0 @Tc040v?D0 0<0\4 ` 0S1S < 300S S00X01< 021帑YZ0H0St0(0p080400SrATo <0CPn D0PPPyl 0;X8@( JP S@Q0PLPp 4 <0 @4 D 0 T<0D \  R \ H0S @0S .<00p0^ S00H00ST *pt`P|@P 0@9/P3 |T+<; 0 6 30ݍ ЍpW 4@PD0Py !ぃD0P0 w  0 ; X0 ED0y4000SJ0X0K<0`S\0c  ɼ`@pV0G  00P`?<0 $ ,   000 0,000F000 0ʁPP0 U0A(  QO `1  0 9L0X0 @0Z@0  0@0J$0 0 0 SNb0!刐?A9c!@00ᔁP S0S O@M0P c0(@H(H 0⩃ ,@0@0PD Q  (8 0 P0`1  0 8T0X0 @00 00  101, 0@08`(0 0#P( 0 Pj `1 q 0 070X0 @0_000 M 006X PY0&0<  X4NP 00 @q @1W㲐@D0 `Tv?P 0WP G  2‹U 0 0W    ‹v@01粐0u 0 x5H0@X0 0@0$ ὀP 0D b@`0P b0$@$ 0⼂r (0d00@0b0$@`$` 0⦂0 AQRU `1S% 0   H 0H0@0`Tjʌ |P@ A`!!! Q=   30 @| X0Q  0H RC A aV v*P|@p t 0@p6/P񏐰0+S .0CS)@0P PPU a0 2@X0 00`!02 @\X%j S0(\01S< 3`0`00S S000`P1E`0 &P0 `0P10180@PD J[hP p08 00 800Pb00 P 㸠D TP B("(R0D DI PO0d0LPJ0@E@id06S0V. b`؞  T( C|04@Ѝ\XthLdą0<@xT8p0 0Z6Sp[06("(H0 D0 P TP B("(R0D D 'P0d0@0P $a0 @$!$ 0A RV 0R  0`1 d 0 X1x0XP0 '&0R UR`0!@! 0 0 P 0 1 X@0Z0  0_ H0Sa=00Z`0`"0x"x 3& G("( 0R00 P T B("(R D  R,#~Pʍ^0 P| @0 05P`Pl1011S1:00  [0 30X0 '<0d0&d000 3@X@0" &0R 0 3 X04s0000]0d0@0P :`0p$@$ 0W0d000`0 W0+S .0CSB@0P `0%@4%4 0-Wt 0|p0(0d0iP0@ @p05 @X _0%0% P0@ _0,&04&4 / /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@~P$Ѝ0 ~P0͡"c1010$Ѝ00@-$MP@v~P$Ѝ0 ~~P0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-#3 BM M0Pd0$40@1$p000 S00- 0p  P@QP0| T0^ PN0P0A !< S + 0 9~T40 ; P0 0000 ; PPf P0. X x`10$430OBލ ЍS  W 0S0Q4 Q. Q( W      "448#8 $$,  h("(}WWWꎘ, $@ @KDx ~(~}PC-PH AMM 04@`p" R3 } 0@ `0} P,8ĝ0  0 0 4 30!AލЍRX PP 0@ .R` @@L }D D d}WW. P}1@ |H|x|O-!1 夡0AMM  0 40P!}pPLp3PG `~PPB @ t+0?P7 0S4 `  0S+ 00@ p2P00@S 0S0S 00@ K@ @ I\ @G CD ,0 0 4 30AލЍ赗` D |3~ O-p#3 0CMM`0,40PX\@@V0S  .S@0SV:T d10S#0 40 000$0^0R.ST00y 0 "2 0 ,4 30CލЍ0 P0 1$0l$0s $vV000$0D DR @@ 0S+ .S& 0Pʫ0=Sf 1S( S S @0TP0 000SJ0 PA0S0000   R@00S 00 0@ 1( P/d!  0Sx0h 0@$0000\0@P@Tk0!0$  00$0s}0S 0S UV0 gO0  U굖~ } O-p0\M3@0`P'T V  0 #à  #4:U@   440X 0 P\ЍH"0P 0  {VX0 0 F 0TP0x 'xUU0SUPPZ   B RX00 0 BTP }UzU{U PHrU0?T0'0 `F 0S0   aU ]U ^U0 UU0S 0  0PC0T0,U0 S\0\ \0 CvP<0\ЍPH0?T0z Hus tC-@0 M(p`P0@D T@@)U0X  U0  U T @"44`D0(U",4Q0  ЍTH4 404 00 `rrp`rxrG- p崒Ḃ@P`. F0S@`@0WV!< T@T, `@FT00W0S ?T0*G @FTPUPTPU `iT T0T P 0< <0< 80 @q0q4q=pqA(0`( "4`43Z1S//0O-䡐 MP0S5 DdDtD`p @ S S0  P&  }P0 wPI  pP00^ 0  SR 0  SRS ЍT d10P0d10 HyD 0P y  8P  1P060 % 0P y P  P090\ y000<yi0:0  P  P090090| P010r  P020h  0P0Z^ d@?P 1? # X 0 2M$ 0P0ZC @}?P 1? # X 0 (32 P+ @ P010  P010q$qW`PW00V0S@ 0PS1S ` i e `*: O-M0MP@050R0*  OT: 0T`@(,d!0  d! . 0`1111A05<0UPw  0ʏI @yp d10 d1 P `@ W`0SH _D@G S`\  S S00 Q`@0S SP C0SQ0 0CQS000008OxP @0PP 0+ 0a9P 1#S;S 0t(S 0h(Sv 0\(S: 0P(S 0D(S 88R0sS2 S S(  7R2 S S0S0 S S SS@@ ` `0V_AV`P@Q"0A'A+S? `7R2 S S 00R00S @0 S S00 +0S S 50 06Hw0 @,0K Pj< Rf0P 0%< 0R@o0@PP0d!S 0 0 2d1 F AQu| 1 |vAp 0τ`0S V `0`SH@DH` .S`0SV Pp.`FV00W0S  00xP $ *0$00p4 0 5 30܍Ѝ4 RB T T Z|40p00$0l4p0004PP(`, T T@ TT  ;T RO@T $0 ` ;T 0000@@T P 0 0sP  @0劁$ h1P @@T;T P3P0 0000@@T;T   MP @ Zl@(`,0p4Pu 2R2 S S0Sj0 S S SS@@`  ``(U _AXP@`0H SD` \R?* S S00 Q`0S00`07<O P.,P `U1=C` lDQ XaD@`uQ<s0 SQP@* P  @0劁h1P0- qA`>`Pa0 2 SO+|k @k dH(hg domasearnamesortoptionfinEerHe-cxcd listch___!1 p@-Phl@HMP ^  T 000HЍpp Qx#r c!uV p 1 xT0000006uPT $000HЍpA-p RP@0`P  R P  @R0P\ R 0  0 O-0PQM0  P4P0u0P0 P0P0 ` (0P $` `   ?pPx rPZ @& TO0 @ 0- !H#Z0@0 0@P P qP0S Z @P0 0D R"H`0 P[) $@ P@  a Q `U H #Z %[ 厠 0 R~00pQߍ P$@  `0` FR*0 @` @ `$0  mZ b 0p  S` :@CT0:@D`Hⴠ0R G `V@D$` R @D`2U4 ( [ $0 @DaU ` 0  *R0 0  0    0  Rz0 0 rp X@0@ 0@-@P @K6 0 0\tY , (0( 0@-@P՟00PY 00/x @-@P @%6006tD @-@P00p@-@PP  P 0  p 0  0 |e$6Vp@-@PMP. `0 0sPP0 P >Pr 0  ЍpjЍp 0  Ѝp( (0( $0$ $\ 5U@-`PtA M@J h!h1 dQ0 Pp 0 RpGS< `Vp> ЍA@XpP 0RpP 0S@ R Dp@P  A0|S Ѝ   0pS Ѝh0h h0 PP P W DܸL9pU7@UT7TpTltTUl7T0A-0PU" 0U"0PUP!q@@``FOP $OP 0!E`1$(`P 02~P\''$O- Ff@0S` M, 0 4 &V F$0( P@RB 1ؖqY\0i(1<0 BRS %+38< 5 0(< 䅟 1 c0Aş0 p8'(p4< 0P(0 P| t hup40Sf0S L 4 0SlX6S ,% 4 0Sup00S S504 RS 4 ,00,000S4 0ğ0  ( XA3*0210S P10q S^P40( D40 0Sp (4041%40(8(JgP0440^30( p ЍqR 0Q*# 04|3!0(08Q(%401Rw4# 30<!^ ^ ćrp S:p 0(" <!0(0% P^4)|20( p2 0(< \2 0(< H2 0(< 42 0(< 2 0(0 2 0  8 ( 쁟00(0(1 0( 긁(0(10(0 R 00! 0t1t00`10!Up (4p Ѝ8p N3p 0o^4nqpy2  Z 00K eQꌶpT \ ĴQHг0<@̱pX@ȰD|MTML/01O-0 MX A* 1 a001Q0,`P0 ^/^_?+~ 0 0@S@ 00T 00}O R :R,000P R 0Y$00 Ѝ8P8@4(0(0 @-pmK 0DA-@@`V 0 CQPqMP pG PMP 00`묭lJ@-@00 R \\  !$00D0 0@ ($ T@-@PL  0S  T0S@NN@NXP/0d 00 0Q,0/01P/0(00$ 0/p@-@P0`L  0PS(  1T  0 $000`p\p@-`0PhK@P  PcKP 00p/8H A- 0@S  P p00   ($ 8PP(p`P0ꤪt4*O- ,0ZSP4M| 0 *  +~   /` *p@0||ZP^/^_ @   Y@ }@pQ0 :Q , @T  :R^@e 90 pY尉P<``P@0 00 J4 S  !$RK`SATSRYe0Q0,080( RD 800 RC ( 0S  Q (0 0($0 `tHd@(p` 0D80 p4 R B$ȟ  B QP70 `0C' ( ' X 0 G @004`0 -'列  0A0J,0CQ, 01$( $   (,  ^0s* Ri(0B\$0PS6000C?00S4Ѝ60`P4 P 6@p0 00  t& 00D0DS:P6B0`@60006@0 `  p A~N$0S@  00 Q(,0A,Q  AQ", (`P  KP @  AQQ`B$iP(`,0 Q@1J#S  P@ P 0$ @UL (p(P$@~n$ P0$  1\@ [3D@ ( 0$1 [/  T #0 $) T`  000`00@0 # $# 0$@1,$0J$0 Pb A `C@@p9B P (nP6 7 R>3P( 01 (0 mPP$  0P@1@$@P@1@0$P 1@p 0P$1Y,Q$Z  `'10<0Sx1 0^O }σ P +>  P(1(0?:Q@ Q10 p0@`@0fFG ȧxH 0xDdTܤĤ BAh\xTH>=H>`D=@-@P00Q  P     $00<0 0@ ($  ĝp@-l@@`VpPPp;0U1pPE1PSp  (0$ 0p|QA-pA@PT`QV0G@P  0 pPP``p`"@$;A-p`@GPP T  0 000P   ::@-@{@0/ 00(/Ἓ000/ᨛ004/ᔛ00/ရ00/ 00(/X000/D008/0008/A-``PU 0AP ppR0API<0< 0 ,(0 CGHI/< <0 44 -0 M0 K ЍLL D9@-@P 0`00@0 0 5,H49@-@Q P00 2 A 0 G-PtsM@p 0ܥpD T 0S00{000 00 000 0$00-{펟PP 0` 2) "Z &= " 2> 0 000 0Kqp X X 000@徣 Ai@PЍ <R 2"00@ᩣX 2: 2( jP0 0Z 2< 21!001 001 0 0100100|1 00.P 0 R00   0T 0 2 13/pTd00-0PP ` 02 2u00@Z|@y0S{X} 2: 2p kPv 2 @0 2D0018006 8<,C-`@ MpPP  J000ES@P>b<;@8Q 2 ` 0 R0S 2 &13/PP"R0#03R0SH P (0$( p, 2 P;00 ЍP Ѝ00P Ѝ(". $X000X "R0#03(0 $X "X002S13/p  ЍR @-`@ MpPP  00U,0`V( 2S * 2 P13/PPF  `P 0 p 2 P00 Ѝ  Ѝ00P2!O-RPM1: 000 X2*q`I`[ Ŕp@ p W   0 P tZ 2< 2ЍЍvFP 21O-MrX>*0`0Q̡J0P@刔p@ W Ẕ PENFP0# ̱100ES 0 Y 2< 2Ѝ10PE P 0& Pt YЍЍ"1C-S` M2:rBW R"*T$* RU  R00U00SR 0  PpX U"B Ѝ 2< 2 ЍEP"! ЍG-Z RbMp'*Q* U@0U @ RD0  P X U 2< 2Ѝ@EЍЍG-`഑p 0@M PP IP!X%( 0!0x! 0CSa%Xà @D 8#8S0C!  0S001P@10CS㣐7* 8#8 0 BR ("(R B("(  0V8#80R!2 B0C!2pl0l l0 T0T T0 < <0< 0b+,++,+p@- @XP ` qPP  pPp@-`P@0S  00T T  0 p0Q 2S*p(0 2S $APp$00C$0 2:0 2pAPpC-@P4M0`S  00 Vv 2+ RJ 13/p* 0 00" "00  0$04 p`0 9/P 9/P ve0  ^ 4Ѝp$  0qp 0 墒P 2: 24Ѝ?(0p0`,0 09/P  0ഐS0FI S)0 0 B 0V F B 0 0\ Ƞ.,ȠCC0P0000 0@ @@T*80`F0C@J`80000 Y 4)G($ $0$  08$"!G-`M( yPXPpL P;S<03%R @@pzz0 L l3< 0Ap P4,0SJ 2 R ,  0#, ##$\A A0AW@E00X0T(0H8#80ᴀЍP00RhS <0 XM,0S0S ,!Q #$ 000#$ P0A 0S S8#8 C("( 0ܝ@0@֝@0@ 0 0 0Sl T0d d0d `0 X00O00@5̻d#1Sp@-@M PN@aP8 0P,000$P8ЍpB/G-P0"M(2 M0` p0 002Wpx @^ 1 R2Y< *5S0@ZZZ 0/, L. l3.<  0ApE WO\!L1 0  0 30H؍ЍU8 0`J8 !8000S   "4<Ġ"< ̌Q0Z0 "Q Ctp@0@0O00r~  O-P  `?@P H1嫲p0q1  J08 10000N`ⴜA40O-Sp M@`0S0040000 PD $ 0B;110C0 X0M ^ Q @ Q 0 PX!B! 0SR|   R 0S  "  0!2#$ S C$ U@  UX SRRS5X%XfUa 0 ៜPY 000@@℠0ᄐ000ಀXXH0PIᲀ0@ ЍXD  $ U D V RP1 PD D00CD0 0 10CRO Š B Q"P 8#8 0X%XP!@ 0C 0$ 10C0S  "0fUPW Ѝ 1 `00 0  0 { Z@0B YPUڬ0S Š0P!D PD 8#8TPU PHDŠAD$dhXLO-M@`0VP 4pQ3⾐ Yj*WқPP @`V Q0p  V\Q  Y 0ᲛPPЍ0S `0@ 00S#@P 0S 00 000S_ 0P00080080ЍO3 0008(840PЍ0 L0000[ 0p 02 0 0C8#80  08 [8: 00C0+ᰰ ,00 0`` Y000:0 I0ಐ00ര | |0| 00 70X X0X 0 0< <0< 0 0 8Ht(DH 0A-% !@ ::`0$0CQ @3A@D$0@N0qPW T002!@$!ApP 0  < 0K VO-` P6UP0tM @廚0P(0s 0 ᳚ P0 k (X0%X 000 00`0 00SDHp@0@@$0p관WP px'x Es0 0G0 0pP@  Rڴ RpH ED @m0x 'xP @LH $ *P(0<@0P@X%XP` 0,0040X0$0800CSPX%XP0S,<0@0@8#88 PQpUP0:80P@P0, 00#0P,0 \j 40 S)i 48,0400<0 \  )PfP0P0Q0 00 R P ` 000PX%XPE08#80 ᳐Y;00S pB CX TpP\ϔ0S$0Q0 00 R 0P 0[ 0 $0L 00040少S,04008<0 $P9PX40S 48,00`00 00 0 P)d0 0S% `0[$0 h0`S,0 40i 0B8#8 X@0!:0 H 0( `ഀ0000 000tЍ( 0\ \0\ 0TL 0@ @0@ 0X 0D 4 SШ(  O- @T1T@0 pS0P`@D%P = <P( [  8#8R40 0 S(!$10$10 10 0S0P 0 P0S 0P  00S 1$10$100O-M@YP 0 00X00 ``FV(:S 1 !*n `p0 pGx'x0H0垺0pF0F000 B 00p0@000 ``FVB*hY0&hR Vp 1 !pGx'x Iw0`h&h08#8አG0Zp01`*0ಠ0`0p00aPP' Y```0S`00F2"0 y02"0 0 00S`00FЍ``FVh*hX&hQ HHH2 00 00000``FVF*hX&h8 X 1 !8#8X0C8#8 Hp pGx'x`0`h&h8#8ቐG0Yp01`*0ಐ0X0p`00 00PP @Ѝ0 d00 0 Z0 0 Q0 0 eH 00 0 k=0`t0t t0 b2 h T `|<Xp,G-0p`@PR"  0S00 0ᆗU@ T; 0PX BPR RQ00S00ô0000 0A8#8R0 BY001 *("(00 000JUU800C80h 剐BY001*P 5< <0<  00 0R0ಐ̠ O- @`0 T @@DH( $HR(P.X`) 0S %JPP# @0T @@DH( $HTpW  TP  PPPA-`P@ T0@ Tp Q Q\ẖPTG-@P `R  R  Q0ᙖ@PR#  00 SᲀR; 0@S \> R0 |P  0 0(!S$! 10$1\0 hP 0 㼐ᲀ@p 0"p 0 S ;10@Rx ἐG'xP $10 $1(!00O- @1T@0 p0CS0 M@DP`!P : 9P' 0 0 cP 8#8R0  Ѝ0 0S0P 0 0P000@- M@ Pp10 Ѝ0O-@MP 00 PH`pc Ő PO P0SUD0Z0 0 @@  0 pWP0 @ pGW 0L*0@p 0@000S  p0C8p#8W㲀Ḱ0>*0p00ᴀgPP D0ZPPЍ0 P jP 0  0 0 00 pl l0l h 0T T0T 0L 0fhx0@}`G-`"2 0(M0$00w?0 @Rp~2S:0JS 'P P崀2S <p 8 P ZP崀9 Zp1!pp BR>:0CS㣠X* 8#8X*:1!0C8# ∀! #(@賶” 20 „ 2p !1 0 $0 308(Ѝ( 8#80C 00C0 p嗥P202 p    0  ` 0p,0, ,0 bu8  <A-p@MPP`  00 2   Q `:1QB0" B1"000 VI VFEXBAF?0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E0 EP VP V$P 2: 2 0Ѝ00Ѝ0PU Q:(0 $P0PU`PI6P  ;7P 21 s8@--M0  @  Xhh 0 ST000S 3/. sX%ZhS 8 80 $0Q/$$0S/ሤ  p<<0 0R/( 0S/8 xA-@T 0SZRp`/:XP0P@QD D0@qZP0 A/P rhV&O-@$M`FdS9T Bpܴ4$$0Rab    XpVBP b0@SFSCлllllllllllll(8L\4 4:33 $$3 $ $3  3 $$3 $3 ($3 $,$Cd3 $`d `Y$Ѝ $  ( ,  C # PU! vpP "PY@P8`  RVPxB `  p  BR 吅pPG Q]($R0 U tWS UX,$R$ ^2Rp4 I.Rp0 W$RD $pR $R !xY&@ $R $Rp P$R& U Q R  T$\Y&@ @ $8  ` &@ T `   p Up$R UMQp -Qp P  ^Qp U@? PzQ^o^&dO&l-V&hV&U&4]&y.?M#O-pMPb@7봳3#`@ @=#|3pB RP!GP P( Qf@(hPF  H@ P@`xPePXP dP@ 0!C!-\\ R0C0p20pW WT R' X DU~` `Z`r`T cPP   в`Pd 0)̱0V!Xq``pWp @P '~% B Rd 0S U X b0S X  R 7/ P  R j7$ 8  l$ 7  dᔳP0S P}X Uo%l-dO&ܲ2MO-PyM$I` a6p000 00 ?p8 PEU( 0Ra S 00 0 }vPePRP&GPFSf0@S $H0@ SaP0000 0p0 00 p00pp0 0p0p 00 p0$pp(p,pS1 0S 0ppSppU PE0U4U& 0 P Q6P/[  0001x0S}V0Sppp C C0S S/R <tVp0SDUa(0S0S 0 0 SVp !| 0: S UH/[0%| IV0: S0( 0 00J0PU   H0P0 $0P 0)0P @/P050CS"DDDDD$ `6    `008PPR0S \{|0Sr 00 $  B R0\ L` V, `Q& /0 \ 00 P@`; 0P` J/R  S/R/   C  R:  ` 5 3 0S S/R$ 0RS & U0sX/ HL!R\0X\!R\ X00: S h C C `qU0: S P1: S ,T : S!  Sn  Sf O S_ S L0S !QPL,0SK  YUF0(尥 0Z EZ80 S80p1p!pp-Q %UP!P1: S x00Z0S 80 0CS!800 NPR X0|T 0S !Q0S !PְRLb&odO&&[% %8M2dz&0'M.b&0 6ɴ8 ?ԴO-P@x_T4D&9=p8464f@(FQP60` V wR0S0 ${ `8SP 9R4P080540H`YRP0%.(0@RP7{P0X T5T%H`SP8P H04 0, %43/00000P84 zkR4a 0V0!NRP (HRP 000 000 BT@0D 0 TP0; S @,0(D 2#!H8 01/,dP0`$T 2`` `0ISs0 CS 01#SQP0 0( ,S* B "!0 0 5R8PH0U 03/pC0SDfH0803/p(^P`؂G0 d P`0 0 S * X 0 $03/0  0-Q3  R L3S0 0 -1/ 3P0 0 0 0 `0d 0 `0d P0$ ,!Q 0,ؠܐPYZ0     00h0 l 0 h0l   00 R0hR0 0013/t S Q S>QXP\`0O ( Q(0, PU`00 XP\`> ;PodO&h r'y%Ps'Ѹr'Ms'0s'!!\s'8/O-M Mp],2$$H$ y;p 0 Q 0  s0(0G@-P񟗙T` ,8Dhx0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S $yPU RnR oRP0<0,`P  /P8x`P,PPPPt pSPR8S;T5P^qaP<4 1S}H @0R. P`V@0S0H0S 0  %UP P 4R㓥'F M vP3mY`, 0| ,0Sl 8 RS P0SPqP4PD0S $V<+0|P43X(D`娠pXV 0PUc40S0040D0S Rލ Ѝ( ₘZ ▣P <3 ,H.P(T 0`F40P QP TPPT0S10P: S}TPPP401!LP4L  R p P T0STH R 0 T0S$" zpmTP4T0S1 jYT 8SQ # IWpVF  , <# 0+ <# 0+ $ <# 0,(, <# 0,00 40 0 08 <0 0 0@ D0 0 0 H L0 0 3]P# P$ QPo s'l-!phV&dO& KxQ νMJ!s@-0DѿTdP00000Sr0C?o21 I9p0 1000C00S8 000-S3 0R2(0pP EP SP , (qQjNsP xP4 3"3 "3 "3 !00000C0[eP=nk|htX@P4 Pd`gT$32S D#D.QSQ\YPBa1S bVRgg0PL2S$ 2" Q0BUh2 0S 000S 03aP 0jXPPN000!S 0  嫰0S 000S PgPS:Ua`0:E100S S  g!0`0001~\ Pa P _[ P{r r r&@2STP@`aHf᩹PW2Sw㢹P0"lP X}PL@p,㏹P= 2S <0"D\pu'dO& hV&l-Udv'tx'L8w'MV&U&A-P@M`/ P@@P2 xxBp 7p=X2Q0=q E  -P f Ri Rk R3 0!BSQg \OPb0: S^00 u!7p10 ER!NpSuwPePLP PPp FP kf@P\\\\\\\\\\\p000p0 0p0p0pp pQ |kL N@P0: SpGP sk@^y'dO&Mom oO-M`Y|.MlrlPp@ =7pH20!1S U``$ NPj. `[A PmP pPP uAgZP uY@ -` |pὴl000 00S uNP"0 0gNP 00 f.[` ]NP/  Q  T: PMp [L0S T* `[`:Mp1. `o, dO&Ml-ܲ|h O-JM MPX -rb@ 6p1 PEU A0S U  buKiP fP hP tvP00@000 00 0@E MpP0: S(! j P` ! Ut0P 0Y/S J>00/ `$CȰPE@D᰼0p/SP/8P堼0 S: p  :tPPUoz'dO&A-`@MP$D;X 4 0庑 MP  L MP  L wMP  L mMP  Lpdl30h3PPP P$P( @30P+( P3( }P7( wP;( qP?P(  PiP( cP اP8$@Ѝ(P (UPkT"(0S (FP(0S (<P(0S (2P(0S ((Pq0S wKP3!0S0S ~p Xֵ`PPa D1R`ᵻPU 0E /R (P(>PU  00,0/00,00CS\P0$0u00S tsр0s00^u~'(hV&P'(W%m " h{'Hz'.A-@PW),p` 4p 00S VsPrLP PP f``kP B$咳 0@IoJdO&V&U&O-MPV+Fp` 4p 6@X/ʼ60S ЍfP WP! PP ` pRP dP dvP iP00` prPxP ``0`0`$`a [1ES ᾵WBu弅PU K$0P S0Sx+ ᷺@[*0/S />P0.S0S .S0SZ 4  0  R @  0P0S$0PpS 0S@ 㝦`P X`ủPP0S <8q50C SV,|p0$S P P+ b 00$ @+ 0q0S $ ?RR00R0SW3 $ +  @0SX  嗦P Ũ 0!0 0C0 kJP 0S'  +0S 5S 0S 0SJP0 0~ zX ^PtIL0SmP h0S ?0Sa ;0?S] 70SH/0S +0?S '0SS d+ d 000: S0S@ 0S 0: SkIP1 0S! S /o" R P SI 0SJ ZP ܿ0S ؿ0?S Կ0S0S oo((dO&hM2G-P@UH*@ap 2p 1 R1 0C @`P HpP vP0p*IP 3*`0S +WP /᪽P 0S 0S0`cIP4*00S  odO&((Mp@-PM  7 $ 0uH IP I@JUITD0 00HP00 Z``: 9nRPGPP! H@ PHHHHHHH`hP dP fPvP$@``j1 0T0 00; R4 : P @A0S #S!d2 00 0 s`PXL 0Pp#>. Ժ P , ́ p Łp  1Gp m0S<0 0@0050C SR[ ᮤO@Pi0S? 0m$ p'p  0 R qX  Pp P    3/P00 S &$ p}' tpZh000S Dox7(Ĺ%dO&l- 7(2MO-M MPXJ^n X50 0 5X5005X<:00( 塯P  圯pP  pVPQ lA@6P񟗹(       p d   h                          ( 4    <  D  P ` 0WS }055050p .pQ Q 0X(tȟS SSy `l050505484 {P  uP 7:ط pM0"S ulꐷ p 90"S hL p*0"S P 06lp0z0500~00v01w 00 0s0g0e0c ^ ^  ^ QS00 00055e46V0 oDCWPE2%R U%RpUQp0%0;\P%5S 0wEP80: S0550GSh T\( U%R 2' WUz05KUr84$04P0D♆p`%`qpPP D\$iB%d*nqTD0000 00~C몞PP#2 vCDC D Dc0P` 0S #Pjp@$S10#S OC$D SM0E?o2?  lKl-\8}%dO&T9(" ]Q M7(U&jXy qY..xV&md67(PC-0 P !`p@X@PC PK"`00CS`0 +E@T ЍX0 X @4"](U&ܩ jO-`脟蔟褟dM@pP0$`(`,`0`4` ` 0,0p$@DTlUU!Z  y"tPcPSPPPPd @"nP tP0 aP` rUdU 0B0p#idU4 RU SU" QU040  ipUY [/lUT B"  $Σ@$ UCp0 dЍ $$ GCpi 8ⳣ8 :Cp( 8) 8⣣V  H❣T@D!PPp`t  ]`TEP8 Cp@P,",`E!0 " 0` V!  .P Q !Fi0P0DiTH 0S@xBtB#!xX8 Y P P% lPP%!`V08]8 p?P0ZS !  } AC 0ꀰ倐`3Ql-dO&3K4~D+3D83{DF3S3|D(b3o3~333}D33334M|h "4hV&yaratcidO-0-OaMp$22242222322 pp.$ *pb>4 $0QPCn2 0000U1dR0 U%L0 PP"p L)P L0 PP!pd2SPAPX0: S0d2232d2oPPS0 |=YP70SX GT czPGRP 3P@/PA1@P>S@'P6dp4|P XA@Ps"00H000k0 ,2t,00SP g;.0d2+042(02%02"0202l[lk@ @fATaߍ02 20202;/`֦P 0S "p; 000P00S !p- 00/Ṧ`P Q !p 0 0/ ᧦P   R  !p p0S !p0 0xg)0i2000 0B BtP 000S 3 S;3ŝ)di00 0x tP 000SX"\2R@RX2i/UP P@PX0 : S8 q `P /?P t( 0P#g[.?`Pt @p X:x\10D  X40* ? X r  ?0>!14'S?̂03P7  `703P7(7 P 0@ tQ S`2S S 2S 2S0 0s  ; >p d2SL ;@pV X!\1 \1X! 0 \D 02T7,2P700PU%W>pP c>P@P% P "4U L+Hh PG+Xx 3023,2 3(24T\2S(",2QX"\2 !14!8!4P@0+ ^0 \  ` v $!୮p  ZY0d2S*'0\ ᖮ ᔮP[|PL008 <04oP 40 S8 *"<02#L SXD0 U[#0R,b(H"L2R0;\2QP 0a(L%AdO&d(Bl- A &A/Ad(LAWAc(tA~AQ d(;MAAk(UAABDBaBBBc(Bh(rdABedABa(@j(vc(?`C>9CCc(L%zDD1 SR Q  RQ!R!RS !14!8!04P`CQښ. .a0C 2 0b(l-'UdO&edA8UI M UhV& (T(ph%To(D`k,T>U_U((zd@؋(pUUUUO-`؁ؑQ@p #p%W㰑 0S 0S bp10`VA <P h70S P1H`V.Z ЍyPmPPP fP ;,n0@ S|4844h38484848484844400000000000000p9W 0 :P ~,Pz,P 9X Xl-()XdO&BXO-M4$` :P! :DP㔔唴H9p000PPPt$H#p3W00S 0S 0S 4Pp(4 a X' 0S00P 㙯0S 㓯㐯PY30S ЍzPOPBP4 FPo PP@*P 96666(966h966666666778|8686666668868966666689@9X900 ƪP2  P20{00 0bPpV:o0` 0婪P00e D ᢪP00^ , 0 cePPV /Q000M00J00G 0mNP1 P :`000001000-00*000&000"p 00000000P0SafTP0fW00S 0 0{P:`I%DfPZ n8 PZԢ(TК(l-P(ZoqodO&T|آ(\8lnnnnoĻ%'o:ooBXO-@MP8@FD̮`(PUPE10ŴʱvPlP,HP8 TP3@ ` r9p@-Ϯ  Eqp@!î0 S < R<0Z@y _m@ P<X=::h=`=p=::=`@" !p,2 R Q!  R 1,0Q ᗩ,0P0S  (  0@ P@C00-SF 800$0@ p0@P?Ѝ$0pw1 4?$040P ?000R0Sp c```8㉏pW0S70S } 00 0@@`p @$@ P@\ m 0 3/p TᛌZ l-a|dO& y H%@-,@,@@갥(d%PO-@M -,@夬F8 0⟬f`P8p^ ^p Yp _6 R0 8 l,/0P0T 4PP\80D4pHP88F U1 vXF0G(G0``0 `IPHPU0  pp 5pO005S 0(0,00(00 0HP=PPx%x^JPzW`WNWU 3AWF CW4eP p  aWe CWe LWf aG Qk,CABABBBABBBABBBBBBBB4B i׶Q iui m@-P )]@ `(p@-D@DЩPթ@(ͩ ̩ީp@h(%@,p@-D@DḩPὩ@(嵩 崩Ʃp@̩ꄫ(@%"H A-|@|p `(Pᝩ,ᚩᠩ0`ᝩ8P@啩@@4叩0ᐩᢩᗩA覩ꜫ(%)")G-`Mm5P8UP26P0 ُp) P5\5@P L 6HH2<"0@<2P 44 { :6 H*p HQ 5P  a@1  p0巽0 @ p孽0 @姽 㣽080<0@0D00 0000P0 0 80$@0P ݾ 8@4 HL@P@T@X@\@HP H`4^4\4 0400,0( ,00@@0PpPPUPh0PP 0/`ЍK (:(?CZT%hBA@@$@(O-0Mp㬖F(00P6`p0 pt6Z0PE `V0SPvPP@`@0V|P 0SЍuPfPFP RPg g@PLLLLLPLMLLLLMLL$M塿0P0 [0#S P00 $$00S $ $$00S @pP [0#S (voP $$0(0Sy  $$0(0Sl00i0P ?P4q 4q 4 4` @fE[w a3C30 @ RI0cS pS< bSBJJPEU ]0P 0U8U U,P 8 80,3/8 RP cW ?@3Zg S3Pԩ R00C?o20S^ qXUJ "Z뼩0 $0 0U,0$00S XU 0H 'ꧩ0S 0P0 00010Ss1 0S 0堤0 P 0 0 Q0s  1000,0 0g384P7Z @0 $  32&SR @0 #  3 0F3  @0 R T 2Pq(00s  2pt0 @0 3Z l-FdO&(M}ܲ C4]&0VO-P'M$$ M@`p$PP "p*6춟p0@DT00SfT T!qoD@P XkƔP㈦e2p`Rۨ0S* \ AP? a@PP񟗦8TUUSUSUUUUUUUUSUUSUST T T5pP50S $PX Y눥PX%000P00 0CT 0p ᖣP ᑣP ጣP*P% ʽP p |P 厽P( Y}p qCPpq/Y00 000#0 00$000 ԽP @(QPPd gY (iP(ిY@X o2 PCP(!|<P( (T@P `H0 0P(`p` q}CP 00 00$00 0}@PaT@P #T@PYT@P T@P hP XP HޢP!Pf@ ֢P Z P( (p` ڼP( +ޒ /ΥPm``6 0V@ ҍr0 00p` T!TF2P00S4ؠ00 000$00 0 ( -2p000Pa0SJ+S'- 29S!S@ 1Z)Y x\jS`P'ݍ Ѝ dO&(@>_Ul-`k,TM (zd@(edA; p@-P@<hp@-P@x<)p@-P@p<@-0p@-P@f<&p@-P@^<p@p@-P@U<p@O-nMM0000`4PͦjP 0~0 P PG  >R~p> 0 p@7x>p?a0SH>D$RT$r R  $t kt00<4A @0<4x00 <$00p N <4 L!H R1.`PEB@D4TG]T]T]T]cX]T]$cT]T]T]T]t]]T]T]T]]@^T]T^T]T]T]]T]T]T]T]T]T]^^T]^4_l__4`l`T]T]T]``abaT],bT]dbb00<@fPt< $y]Pt  d@< l0< $$r $d8LHFP; $0 00  0 %<M0K0(0 0,;0@= 5W; \;$40t0 0 0 $;&0<0!0 P 0 : 00(0  0*:$ 00!0 0 |:(00!0 0 D:,0\0(0 0 :0(:@90S P8: 000$  !00 0 :00!0 0 x:0\0!0 0 x 940$0c 0 ` 0 j: 00!0 , 0 \888匈@0S C.0 ]@PvVN@qUP0@4j NP@d 8([V$8@@PD40 t9PD40D4LT G 0P 0A (000 1 1 7C0h7@P00(7 000  7F:P%P/ P lV0S\ 0T40000PEU UZ ~ zz0pPQ 4S<4Z H4L$0 O/ph?HL4P4SH$L4R0pl& -p\P C Q/pD = 4S@00\S $EH?HHLX00 $?ݝ5XLH ?P? Uk FPp%;P2FPPT%T~U /p X1: S(%,5 $R-@P%,MP$  70IPXZs4S04z?080$p!x$ ,p = l$0P$0 r04 P  P$,03}p,p40S0X44S@04S x2S 2"0# rP 0T40S P 3T#0S T4S`؞P P3 2"Fx2ŸS H$L4P*pT0 L4H/0#! 0YpH2 C  T0, tpĞt+  L 0P0P+ 3!L4HϠ0# 4S 0".?X y 뼀04$$ST RQ  X  0l,0p XR001R04Qf ;R040 Q$ Qq8*m(bdO&(Ugl-\8hV& j,Of9 4]& 1HkNP%(_vy  Wh(zC2 (8U%( '{" F !h=@%K |h '5HL4 Q} QQ040S[R0[ 4S$fP 44崐S04144 0S @4S 0 Z0@4,4S $4R#1ѣ1,400 0Uu +t +0S ؆p@) P+ 0!dt,>0]sHsP=. XR04ʃ1$4Q :$4#+ T4S  -4"d0t,$,+++`j,\4$H1H4<$L1x000@ .,p4tBP Z > /P6P  4~p  T4 w U .8 0D (O-IM⤹i M0p4, pP_h9`4pGs04WZ h❠  ᙠYa) 4S<44S $$4R0( +p  h,p  4 SP,0S x$0 $tZ0 0q $0 P$H 1Sh  $$4Pa*`RZUCUcDPEUq8ps8p8ps8p8p8p8pxqq8p8p8pq8p8pr8p8p8ppvbPEUUHr8p8p8pxr8p8pr8p8p8pr s8p8p8p8p0!.0u 028PZP ̌p ZPUȌp 刀ppPt +@ VMUpeAdO&o,)) 4]&_X)%))cx) )%R%)) 0@ x0@  0PUhPj 0C Sg0400000,00(00$00 0000000000 000000 00mZ 0p4RE PPH|&<PWE 4&l(8; 00 L0&pQ8; 00|L0 &pC8; 00L0 &p 58; 00L0 %p@' pHR  |0 x; E0 y;z+x0;0; ; '0cy;0z;(0x;+2(bP_PL0 %PU;"0#10@00 0`K`QH  `   `0 %P|1K0S PPK0 %P$ 0  003 %Pd 0Ss %``0 r%P4$`j%$㌚P0d!2 (100`[[[[,Q0Q4QPPPPʚs1d<;SʜTK%>@ KPz䛟{ k A::˟c8%@ 39PVz{ k A9I:`"2RgdD' { @`30S 0 C' @MHIN2 X0弅#pU00 {@+0@W0 00D,%PT2 ppW O P(2 $PG^AQKW$Ppjc1{CA{7ZA (H{G@@8HINT{X({*m#@T7 *0S3 <%0T0xPT00P0p+tL#P 0S |$t;<000[ Y0 0 |  $d2"SS% 0 " $@-C6?8~A@@0)))V&%X)x)/o`)hV&ȿ)%< pI1 @S= 2R`" B8#<48#8Q``0!TR?LTXd%X0 0 0 d20ҋ "  5  `⠘`0l0hd?ph{2{7@{{{{{ {  M 䂟 3P ŠU h2Y0Ph2d@ g P   hhh 0Y 3# |)0H #$$<0(0"(00\2 0BS2 (S:; 4 0;#U@P4P0đ#1!(0H0C8C8S ! 0H 8(#8L"(# 0 $1币;    0; # 0@0 0 U|0H #$$<0(00"(@0P0W 0 l0 JD0WuD0P#<0[^U G ȿ)%[ 6V&X))0)ig>y =4  QZU|0H #$$<0(00"(@0 0 H0D T#P崀崐0ZPH#0  D#0CSꠔ̕PPlPx,0 CPz Q=  (0lt|# 0#!#E0닟P@0f|x0 P/ X0 P& Q,HPX""0 P 0#$$0(#"(!"0 P "0 Ph 0 P Q Q 0,q(o0 P s0 P 0 P 0 {P 0 rP 0 iPh 0 `P D0 WP  8" 04 600Sk ES S U|:0H #$$<0(00"(@0Pl"Hbv(BTy4Le{.AtS)[0)jioSIZ0KUI7P!DDD0J0ZD0 I)0K 9+ 0K2 ~ QJY0KUD03 +Y msP UD0 !D0J C 4 ḛ Ug\!PDDzD0I0YD0 0J#1 K#+ ! 7Uw!7O-M`PᔖT0@-S@P.44 @ $t   p+40SP a`F0pP[PNȳPQNpKGN!PN  G卑P@`3 pC d0@S<<<<<<<d< <,l<<<<L<T<\L@20SK@HGG 0Տ 0p0 -Y \[GZ'>@`PP`0b 2 R u 0 S i dU+ 0 z!00!0X ᄕさ~{x u%p40 pҕ0SwXw`  p0S2\붕@P0p@ 0F VpSw`-*dO&/P M-2o/ -CI YO-PAM M@`,xxWP l%d7P000-S% @)P #PF0@K p0\Z f`F00S@DDA@D`v bp .6p0StbLPt63 Q\  徎P -00 `@Z-00  D0B5S񟗊|pppppppppppppppppppppppppppppУpppppppDp W00S EP}E0 0w꤄&4P E00i00f`400bd4 ^0S LE V44  R00O P H ܃ 300S P60$010(0.0,0+ t0C?o2R0S0$0P\P@ Yu@Da0(+T3@00`FrS; RS iS/ tS xS8j똒弢+0p 0@00@00S a 0@TI0S )@# BR0(0/S 0M(0S  0@ r0S (0S p|10l 0TQS 4Lz(0S ( 0@>ajy`P+%l 0 P@T[L: *" EdO&]Xl-z`*%0"P8hV&_%9p=V&m K49PO-LM)|@pPp/p\?.,#@DRQ0I < @@0SR DvP cP SP- TP0(3 LP :d0@S갩LLLLLLLLԩLLLL0D003030800H00 30$30,3 00# st  ?U  h  z      Ǐ0S 0S 0S  Q 0   upx@T a8 30(#0<   TڰE@m+ dO&1 { 'o(<(Z(%@++ +(+0+8++[ ''za ''P+/ } (++&r((((((8'G-`XMP$*P C 0C0U U0@0 B "00 00A 1#P10C0 00A00C 1#P 0 00A00C 1#P0 00 B 00C2#044qpy 0P 0PQT)'?떇JZp3V 4t`(os`F P% 0SU030#:U %5P|| P l2 X'P&T6K/r003PvTS0 0S0# G@oSPEOX: Po 0 0<6SR46SR 0&2RRPh2 01o76S |2P W0`W  0P to!EK/r0,6S m/`P 0!QPV,YPo<6S:46S: d1Q0@6D&S|1 0 00Rl! H& R\! $&TRP! 8&RD! 0&@R4! Q,!   @ p  @@|0PU- +dO&-l--~4-.H+ + +-.2O.4]&..U&A.^./ --r......P+ /-/-M/P/S/i-V/2zzY/n/-A-PHMp`I p10PEU* HP h0@ S SPPPPPPPHHIIl1嫪d1T1 P1 `q< ᠇P p 1 !  qPP = Lp$@@@(@ @s IP 1Pm0S &PxV @P X=0 0000 s/dO&l-%8UI +Myt /Ct //G-0HM`p0!,S,C, Sp3C1 `FS 1S 0$ ] !RSX V0S042" \xP`PAP MP2 Da0@S@DDDDDDDD DD0@DDDDP 00 04044041! 00101@30@3101101101101@3S40S0V0S 0S04P+PTqP <V ДY 000 0Y HЍP PPp  <0S  h0 `PBPV qh V O`F8+l-dO&%V&P8.+MC-Mp`<mPPF! VF qpSPU 6 `V V 60S aP& tP8p6 R h&   Qp<6U@,V`F V"@T 4P /PPV 0S A@D )P`Vk l htP9@PA@3P񟗹(4<PXdpzP0S<0S{00\0Su00Sp00Sk00Sf00Sa 000@00=00:00SQ@0000.00+0 03 $0S=<0S800S3<3P{P0$0:(U 0S# 0S 0S`V Q PF x;0S 0S 0S`V UUpIP `DP \?PPEU\\\\ U3 UUU  U4 @U U00`0  > UQa6PJ00000  )P   C$0S   p yqpq*tZ@T g 0"600"$0p$P @P ỄP`\?&@+dO&l-Ƌ??hV&@; M; >@<@V@i@y@@G-MbM@Pp p10S QđȡPE R ލЍRP fP74p$Pd :WOJGPP1 JP/0: S2  S)J P0 JN@n` 04S00`X,0S p J PJ @PJ0@B+dO&MBpBBC-GMM \0MH=P<8 =8X@8DX||=`{`XdXhXpXtXXXXXXXPXXHhLhPhThXh\hxxxP0D80l8"=C0 8p|PP   sP:? 095UL  [|P < <U|@P PL< T(Xyd@᪃0P$,TX8D ?| <P  0S;+,Kh8S <PU +hX (|P@ 冃OoB;p ||+;8(p |P P[`T`hGPdh@,;p[`L  oppT[0 F4+ 0 0C 001T0܌ ||  \8T0>0P XP嬓0Pl Sh#f0 jP4:Ty P: h(q`P9 T(X(g< c0P9 h(e40GDS4||||l||||@|||||||||||||8||||||||||||||D(dt||||| Ld|8 (VXSl8 X(T(NX8 ,J8 !8P 00S= 8 88, ,, ,07 ,,7 H((S$8pT7, |7 L(w+r P:?@ 0H7 P(74wSpfP78x7 7<(6 T( X(L7 6P 00S 70 6 t(6 x6P 00S 6 6@p Lr68pS묖08p0 P 0SL6t pW 8"p(]D+5 ,00p5 L(5zS`P5 `(d(<5 uP$5P հ@ y5?Q40DGލЍx5|t ,ꀑD0\<+' |b' tbbb" bObbba cU&V&cdO&$du (; bc$cl-%PcF+2hV&ecxc(Tccl-ccc|h Pd-OAZd$O7OBONOfdHldavdWOd _O 8 Bd:dK+  dG-P`0EhCP03e]p2S ln PL6U`yPH t处 9PB/PE0@ *  $pd40pEWQU H4 000`~P$ L,pPE0S#34# 3 5Pmjgd^P 5vP303 r`pp hdgx`3P04dPb4S @SaP  ,5dU P 4SqRxaPl l  PnR,y,`p1<01 1> 11bG01/΅01$1v`4#(2R$$hp`g Pd Q18C8S HfVq܁ܑ`+`V00l  B/o" R qaP  \`=S` 0 0000l ;a18C8S+`#RS S=?o20 S Sl  a18C8S 0 S ` S S S_hbx+WwvvvdO&4]&w,/we tuV&5w% %p1F0[X18X1}`刕0  F1|!1hQda宧0  ?@Pw\1j >0[ >00.+ X18X1=0YSpVPMP 6PR ?PI 4PꨍpN@P񟗯d ,fP j@PP񟗞X=0P1`<!`F@،p}\1F3\1Kw0000q0\1lH o@ftpclp`0  PP \1P V0#P\ O0[ 40 ⣤@P 0  Pݫ 684'0 00X1 jpxx j  1S P ~2  T ֔ :0P x\A@ @0 Lp  rp :( \ X1 Q 0P819:\!p*X1 d ]pDT P)(< $X11Z tPPY* 9Y) 9+ ) 0j\1 ⲒP { P S z 0 09~z⎑pHx  W 0S L 屓 ,PQ z0S(  xX!\10\1808"/0  ؄X!2sP8"/0 ʄ2X!s"/ p= X1`t  ̄P%DVX!\1 0\1 008 㭐p 137 S ⃆zPtwht 007 Mprz0S $UX0pGWdz0STS]z0S Yz0 S X1\!8 0\!' zpIz0S &|+p\10L1_ 00L6 ڎpwls0L1N 00L5 Ɏp(֒p 9^p P \10\1Q|ƒ)Xd划\1 @0\1pP @ ԴX1 X40  tp` X!\1 $  $$ 43 @p   vKp兒 004 lp@y|!RX14X11  ⊔P+p0v!0P!  R!c00|!R00SR\1֑ X1 ꐃ吓0 Q01X:  BX1  Ɇ1PU3X1\!( ; W A? =囑 ⮆ ⬡1R@T 0S 0 @%@ 0S  S 0S ᭄ᦒPpP P ( RW  R   0010 S   03PUQR唑\1@0@k("`\j\1$ *d 1d uc L!g h "h ?& c c N!dO&oWh a l-a a a 3h Fh M!k l_ @|h qh ~h Mcm M!7h h Sh h i h k i (#*i ;i Qi `i ni ~i i i i j P9v_ i Y.i j 'j d \d #d 9j Lj ?Xj j j j hj j 4.*k V&  Q/0@-0t h P ^0E.b@1 0 0$010`^`]1O-0!bM Mb  [ !1 b0 0 30]bݍ Ѝ"m` t(  Hp \ $Gv+ 40;x80G`00 80G( G p x8_S0쀟00 0000 @G P0 rP x8#`@#[*rP0l8 40G gPU P0l8 40G YPKwvDJv8J0ƒ S"*0@- R P@ 0\ R^D00"@80 0 0^ 00"@0/uutup@-``A``1M@0``H! D1 0 0 0!  0  QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp7 0Ȥdd7 h6 T8 6 @-M @ Ѝh  Q/X-M  0 p 0 S 0 0 Ѝxd /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/):*/=7*/4*/1*/".*/+*/(*/%*/"*/////^*/*/*/<*/ */ */*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/0 */*/ */*/*/*/K}*/Wz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/4T*/@-@u@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %sRouting tablessysctl of routing table%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpTYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORSTOUAPPElocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sLogin failed. Password: PASS %sAccount: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %shttp://parse_url: invoked with NULL argument!ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:LESSMETACHARS; *? '"()<>[]|&^`#\$%=~{},LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number is required after %sNumber too large in '%s'The %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread command%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 11.0_BETA This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.0_BETA is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.0_BETA is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.0_BETA is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.0_BETA Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.0_BETA UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.0_BETAxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-11/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.c/tmp/entr.%06xrndctl -S /tmp/entropy-file %s dd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/certctl rehash/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32gamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd %s cd to %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid IP address: %sinvalid CIDR: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLnrt != NULLkeepingaddingchangingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressnot ACK or OFFERdeclined duplicate addressignoring offer ofignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d ˰$ z tѰ\԰ڰlݰGOPG4|: 8PPv $|$3HE <-L3F P5Z :>( HKq. (RY*YF Z7 ZD(Z>HZPlZ\ZbZ: Tn; xv 8~--m\l\]/Ըu&l~" L' ppp^ <<<$$HD Yi rpushdnepopdne'׷p Nh@@D'@@@4tL P &`,@@@@24unblock and -DNO_CONV?x|!p!`100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] abcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink  )3?L]E?L]EbvEZ# _^F<>%?8KPATH=  t* !f6ds!cmlr h aplnv [b    EOF reading here (<<) documentE|.< '/5:AEIPW'+8/3 Y-K] }-+?=c: @: ]flrx~@S~ ZZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'6(0D6(106(16(86(06(0 6(0 6(0 p6(0( S y~ ,i yvan|9q~~ Z C 4 .  .G ]T/O H  r!! 82 ~PS                  /q;m < +h qdۧ  ԑzGT PL 7J  K "D DC $ $ D 7E `va HOD  5 5_M@XS\ .ODby L ~ { pTPY 4  k " SN E 7WC  |j/ :? =?==p="F<=4> t>?` $@c<=}Q $@D?`@Hu@dz ?> p=5l?? $@y}#3#3233#YB J@_@Qajji @xr +C$*C0C$/C97CIAJPWPy;_g@X@p ` 5-@ %$%,4 @ " * @@0 @8 @? @G @P @U @Z @a @i @p @n @t @} @ @                  @ @! !!!$!+!1!7!=!E!J!Q!X!b!h! n!u!}!!!@E!+MZx r"v"{"N"""""" """Y $u"4""["P"P!!!!!!!! !!EJ!O!!"Y """"""*"."4"8"C"R"^"n"M!  '07@EJQZbjpt{    r"v"{"N"""""" """Y $u"4""["P"P!!!!!!!! !!EJ!O!!"Y """"""*"."4"8"C"R"^"n" r"v"{"N"""""" """Y $u"4""["P"P!!!!!!!! !!EJ!O!!"Y """"""*"."4"8"C"R"^"n"T1,C.;1FMF`FvFFFFF RG qG G G GGHGH5HHHHHHHHHI 6I!r#r$FI&r1r2NI3r4r5jI6r8uI9{I9I:I;I<I=I@IAJBJJCvJDJEJFJGJHJJJLJM KNKO#KP3KQEKRZKStKT}KUKVKWK\KaKcKd!LeCLfWLgjLhjLijLpqLqrsrtruLvrwLxLLLLM$M9MHMZM{MMMMM N$N>N\NnNNNNNNOO"O;O;O;O[O{OO"tOOOOOOOrrrrOP'P@P3RWPjPwPPPPPPPP Q(Q?RGQ_QtQQQQQQR8RLRlRRRRSrr7S*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read_ (RԻ%@(0Wܻ%p\%Y^%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-(?Zatߘ ?%)T%@Pm{ɜלX ` l 8 L p , @ T h | L к P"P!!!!!!!! !!EJ!O!!"Y """"""*"."4"8"C"R"^"n"%@;1FMF`FvFFFFF RG qG G G GGHGH5HHHHHHHHHI 6I!r#r$FI&r1r2NI3r4r5jI6r8uI9{I9I:I;I<I=I@IAJBJJCvJDJEJFJGJHJJJLJM KNKO#KP3KQEKRZKStKT}KUKVKWK\KaKcKd!LeCLfWLgjLhjLijLpqLqrsrtruLvrwLxLLLLM$M9MHMZM{MMMMM N$N>N\NnNNNNNNOO"O;O;O;O[O{OO"tOOOOOOOrrrrOP'P@P3RWPjPwPPPPPPPP Q(Q?RGQ_QtQQQQQQR8RLRlRRRRSrr7S;I |nQn- q+|nQn- q+|nQn- q+ɧҧ|nQn- q+|nQn- q+n"=rGy=iG} ;Mt?!mWC 3KOO,7yD<#*=(BL3Dh&V^\ M}-q@Mjy֬-чH "-чH4"ʨZIчHF IчHA IчH2IчH"PL6 %?a).S'@ )Ѹ;B*1@ )Ѹ\R"1x )ѸakP4%@8<%backupstore_gptstore_tblm@%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps /setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatus =a printallmaindo_setifpreferencedo_setifcapszi%Yyi   %%  %y %| %%̶$8%~h%%l%% %% $%$%1<GS_ kw@ 0@ʸӸظ:s =ݸ  @=a init_current_mediasetmediamodesetmediaoptsetmediasetmediainstºGͺºغu ͺu ºu `ߺ@ߺͺu غmedia_statusmedia_constructor'x%'x%''$%@%'\%%paddr_matchd h 8P8settunnelh%%print_link_addressessetvlansetvlanifݼ%l%!osetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrts%H/%%/%%$?* %l (%x%,%.%v %v ?* %m x%ܽH% >H=jj=\\8%invalid major numberinvalid minor numbertoo many fields for formatffs@CP \e qya ; ; @< < <  D n* 9@EVd{@; F A #: F ; KU`k,; 4. +< `n y PK f@gns| bnorripbgensbextattbnojolietbnocasetransbrrcaseinsKU`k,; 4. +< `n y P: @: K Pf@< @KU`k,; 4. +< `n y P\ e: @: K < @Pa f@q KU`k,; 4. +< `n y Pf@KU`k,; 4. +< `n y P: @: K f@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorKU`k,; 4. +< `n y PPK f@ t  @ $ ( MP@^ . @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvK KU`k,; 4. +< `n y Pf@JqIFZz 3Xx&Kp%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@BCFILNOSa,b<cGe[fmhikmnor su+@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h p"p &p*p y` .3@ 8 $1м|^t0 Non-system disk Press any key to reboot oooo oo oonDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY(((,)D)m)))))*K*}****+E+UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefPFPF0* XXX,,x<<bitmask_printX9h9t9~99999999999::):3:F:K:a:00{:<:::::::::::;:;!;);A;H;g;k;;;;;;;;<;)<;D<;[<s<x<<<<<<<44<= ==bitmask_scanmyma 8889hw.disknamesfetch_urlp___sendrequestrecvrequestoeeeeff***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20240203  " $#!%Z^\`[_]a  : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for datao. X\ ). *- IgJ!,4- =- ,J- o,R- oT,^- g- ,(/ x- ,- - ,- - 4,- - ,- ' ,. o, . o,. oZ,. $. ,1. ,8. ?. h,I. o,S. F <,\. ). ,f. w. ,. ,. ,. i- 4,. z- 3,. . 2,. . 3,. ' 1,/ oO, / oN,/ i- \,!/ z- [,2/ oZ,=/ K/ \,]/ ' Y,i/ ow,u/ ov,collects1 9 o1 B9 ' ' 9 P"P!!!!!!!! !!EJ!O!!"Y """"""*"."4"8"C"R"^"n"NAME=: A ; mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cdsP"P!!!!!!!! !!EJ!O!!"Y """"""*"."4"8"C"R"^"n" edit_fs_type_extc < 0 L K L _ ` n n 1L0L eL upL edit_and_check_label P"P!!!!!!!! !!EJ!O!!"Y """"""*"."4"8"C"R"^"n"disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzH  $  X T ض H ܵ @ 8  д ( disklabel_change_geom;I |nQn- q+|nQn- q+|nQn- q+ɧҧ|nQn- q+|nQn- q+n"=rGy=iG} ;Mt?!mWC 3KOO,7yD<#*=(BL3Dh&V^\ M}-q@Mjy֬-чH "-чH4"ʨZIчHF IчHA IчH2IчH"PL6 %?a).S'@ )Ѹ;B*1@ )Ѹ\R"1x )ѸaktO \ ] ] {OM7-] "A=] MQG] W] g] z] ] mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_news BKs Ck DRs E\s Fas Gks H(o IJus K|s LRMs Ns Os Ps Q#Sn% Ts Us Vs Ws Xs Z0` 1s 4s 6Pds r |C~t }t  t t %t 7t Et Ct Lt Jt Qt Yt ^t dt jt pt 4. ; p t t z p t t t t t t t t t t t Ou t t t t u Kr u r "u .u Au Nu \u hu default_configread_configrt_compare_proto$$rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt\\rt_buildrt_deleteddsa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init%y mh y y y ҭm y script_buftoenvt ~s !$t y make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osl| | | | | !| if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcp … ΅ ݅ dhcp_bound    {   ~ dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifavvvvvvVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B Xx  (؛  l8 Xxʼn  BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ <]& $i!,q!‰ $m!4q!   (  l @ʼn 9"7"5"cs_pathXˉ  bc_base_maxo bc_dim_maxo bc_scale_maxo bc_string_maxo coll_weights_maxo expr_nest_max o line_maxo  re_dup_maxo  posix2_version o  posix2_c_bindo  posix2_c_devo  posix2_char_termo posix2_fort_devo posix2_fort_runo posix2_localedefo posix2_sw_devo posix2_upeo stream_maxo tzname_maxo atexit_maxo L ` (x  l 4ʼn  L !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU makech #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef5MS7) %p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      !1Aa  0@`@@ #+3;CScsM inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equals_prop_data_internalize_decodeprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_timesaddcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareg_Ctocg_lstatglobextendglob3g_opendirglob2g_statglob0globtildeglobexp1globexp2_glob_globfreeskip_getttyent_getttynam_getpassfd_getmntinfo: _getfsspec_getfsfilefnmatchxgettype_getdiskbynamecreatTLS allocation failed, terminating ;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedirkhwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rip6_parsenumeric_filenostr2numberget_portget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchN_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi d'@Bʚ;__dn_count_labelscharstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton_inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl54ؗҜ<3#I9=D2[%Cod(h_posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internalgetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddr_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseekoisescaped_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04dmn-00Etc/UTC _strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf__sprint0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentQ_strndup_strdup_gethostname !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG_getpagesizeqsort_r__sfvwrite__sflush__swsetup__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocsdl_iterate_phdr_setup0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddr_nsaddsrctomap ]:[=                       DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerr__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitNEXTINDEXL>X>lFFGpG# %%N%`'&<&&& & $%`%% % (%0% 8% | @% D% L% T% \% d% l% t% |% % % % % %  %  %  %  %  %  %  %  %<; <j xl^ `  ,T; h L # ? X\  L1  ( @6 L# l2 \ P? \s  # # Y l% 0t p# # # # ## <, x# # ## #g ,#,# h#h# #$ $$  $$ X$X$ X$ XlH $$ ,$ 0$ 4$ <$D$ H$L$ P$T$ X$ L/ .\$ `$ | d$ h$ \l$  t$  |$ $ $  $  $  $ $ $ $$$ $ $$$ $ 0$ 0$0$ 0h# &,&4&<&@&H&P&X& d& l& t& & &&&&&&&&&&&&&&%&&' 't### # 666666666666666666`8!5h!9h8!p8X!x8!8ķ!U      \?l?Px??????P"|!h"d"`"( 2XIXIgnts pXADrbmn Dtcid @8EJ0N`>==P>@> ЀXIXIyekdMD=4BDD,Batadx\pZ\loobg4hg\ "\ "d "d "yarams r8lPk`AHBQQQQR R\uHPuHTXu?\uDG4"4"4"1PPPPPPPPPP(]&܈-"% d-c-N&c-l- -@$0]&V&h .Z&К[&X-@%c-|l-V&d-hO&ilYc- Y0|4.!|{Z&4X.P&x-,"0- .X .T .c-c-x.|!lX-0,]&%N&c-c-pc-dO&c-l-D-l-Բ-DhZ&N&X-.c-- d-XQ&`|X-pZ&4]&c-c-c-$\&O&.c--(]&X-5" i-c-h-"PW&}x%X0]&4yd!|pX&d-c-U&c-%4-(l-ķ0]&k]& %r&" t'HP@%.~ bjljc* fhkl mo'o3pDppYqcrK ul tjvvwrwxEx^ zzB CJOPSTg V1 VXZZ  " * 7G(t-Dv,t-x tLt8 tuE(l|\|<},td|p tLt8 xG   A7/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin*(}-+?=###%%%}x0(|0(aEVeY.FIviLp-lmC< nfpbu"qys'3hjvaVV<x2(@=%|%d 1 Lr(0`t(v)϶t)yJ)~tc)s)Xs)iNr),s)]1f1`11L11 ,or,od1o11C.oW ot11PT11411̍&F\%Flx V ... ...Nhyy؎1aoF^o0@gAg٥ dz0*7 xpL }%3 %AabCdhlNsuvW:w:zм%ؼ%%%%D Q %%< (%'< ?+'d d < K%'d ׷D aĽ%%D %%D %%%D <<% %L F t%L )$` %L @ҭ%3 ̾%L % %%8% %L .%!(0%L 5d%!(\%D nx%%%%%%%Ծ%%P%%\%8%8%d% %%|%ؽ%\ l%l4 %̯4 %̯$̯4 %$$L U%!(%\ $ % 4 %4 h%̯T ̶% ̶T ~% ~T | % | T y % y L  %\ D'%'\ %\ %T % \ X%XL  %4 /%/4 6%6L ݼ d%< !%T !% L % %L X %\ $)%\ ('%T &ܽ% ܽ\ %m %m T $?%* T ?v %* v T /% L %l h L%hBKtHtHJGIGtHtHMFI lGH tHHItHtHHItHlx V  '@@KU`k,; 4. +< `n y P: @K f@...... ...... lost+founddA.##.D _ #?$*)$3${(# j/ O ( E / #?+%((*7 #ip #| #~ #!#"##u $#%#&$'$(ԥ) $*#+$,$-$/'$11$1=$2I$3R$4 5bT6%/hV&T9XC 9999"9(90979=9C9L9. (prog_root)`]z 0DEO϶D~+$O-O7OBONOHWO_O] lS 4 Hu kO ,^ c p5 ]z 84 ɝ C D 4 sO ] - ` " I wO g ˰ `[ / @]  ` = xH  K Z- N |O @] v D O d O  (H OD D Е  O l\ E 4 O J  xo O Tn O W \ N O i O ,L  P O > ԰  X H P P N O t  4 O l  xo O ,7 E > O ,7 O n H N O a O a  - O xo O c P N S$ N P N  PH  @F  F bT ^ O p5 O V N ] P Z w g u p P p> E D> P t P M %P  +P `h 3P \  X 9P m AP e Y p5 IP F Pr RP Z 5 l M p 7 B 75 (5 WP d  Ti D h4 _P g = pD  p2   \  r hP   4U j E M p 1  @$!Op- 9 kOIg Om,| { ,~ <<9oo!? <oT >pU t4pT pOpPV |gpF $xpK CpXM +pXM cp@ .pA pA pQ pQ s qO ?qTi #*qhQ Е+ ExFP6ucMPaEls0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ%%%%%%%%""%%%% e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<   is a directory is not a regular file (use -f to see it)P%P% (/$<FV6bn"z>=((; ڜ7  ǎ Վ#28  '(/9E!QZ9lvЕ&8f)5e:%ŏϏ6N؏4͎ +,-!.4*AJ?ZE7a/m/{'F% ō( @xӍ 8fq])=a   $WmkRkRkYcWbkCkc kG ky wb YMYrWca&B,xb&@pB,| ߘB&tB,Cc&B,nd&B,ۙ&AB, D&( "e&B,/I]f&hB,}F&B,ۚg&A,Ih&B,{ix&|B, כjp&P %Jh&!@B,2Pk`&HD X&H KP&8B,hLH&m ?$m N 0N LN TQ 4Q Q ] \ o $o M Sl R Q Q Q P^ ] Q W M TM ZxM iM M g'r<K~.`~~Jc,9JWV)>KwNNA1JSkG>D]j~$:IVdp|I >2~ #EOWaykt 4HUaUs &A`|@j -4AQj|&38AGXay^A !.=LZiCu( % C U r *w   0 ] z      1 F o ; S $ ; 5 [ z  o  3 a q sa ;      G   "P% r v    d     ( Q X f s { E 5(O9  & G >a r }  ] K f   ϣJ         v    B]  J     ; j z      ,,e    / Q    # ( .    8   u  ) ]R ]    / ^  V o      8 ^     3 I ^ q ~           3 ֻV d p v }             - > M _ f p J          ' 2 D P [ d q ! ! -! J  6>D # ? 7@ Q AL ` BL ` CL ` D P E L ` F 4"` G H` H  ` I oY o od (  1u 1e| u Q Q Q Q Q R R #R 0R >R KR XR gR ]\h;]\<8k [| x m oooooooooCT X \ ` d h { Bl r u  &  x { / NuJ         Ċ ?Ȋ '"̊ Њ Ԋ  ؊ ! " # $ % &' '2 (C )U *^ +h ,n -u - . ./' /^0R 1 2 3 4 5$6 7 8 9 : ;‹ <ы =݋ > ? @ [\ \/ ]D ^O ^a _l _u ` { { | } }~Ό   -dd-ddTdd:dd:dd (1 41@<1@H1`P1X1d18(D(L(T(#\(#d(#l(#p(#x($($($($($(%(%(%,%(%(&(&(&('('(')( )()( )),))8))@)*P)*\)*d)+p)+|)+),),),),)-)-)-)-).).).)/)/*/ *6*;(*;4*0@*0L*0T*1`*1l*<t*<*=*=*>*>*?*2*2*2*3*3*3*9+7 +8+:0+4<+4H+4P+5\+5h+ p+! +" +# +$ +% +& +' +( +) +* +. ++ ,, ,- ,/ $,0 4,1 @,2 L,3 \,4 h,5 t,6 ,7 ,8 ,9 ,: ,; ,< ,= ,> ,? , @,!@-"@-#@-$@(-%@4-&@@-'@L-)@X-*@d-+@p-&`|-'`-,@--@-.@-/@-0@-(`-1@-2@.3@.)`$.4@0.5@@.6@P.7@`.8@p.9@.:@.*`.;@.<@.=@.>@.?@. `/!`/+` /,`0/"`@/#`P/-``/$`p/.`//`/%`/C/C/D/D/E/E/F/F/c0c 0d0d0el(e 0#(0#40&D0&T00d0t0x0|0000000000000000011 1$18(D(l1p1t1x1|1114'@' D' P'@T'@PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[SžP&P&P&Q& % 33UU33UU33UUU&0Q&V&0R& hV&0PT&V&U&ؔ-LT\dh_t_50l`10ptx   @ 333333333333333333333333333333333333 33 33lZ& )")" 0000000000000000 .33333333X33[&[&[& (root)`330%C4"4"4"4"4"4"4"$e!%%%ԩ%%5"7"9";"x]&\ lp4dt Dt`Service unavailable@uA,aeabi"5TE  ; T7xܭoAYr+\`u(4$!!AUE"P8 ܼ$;o>V^r])e\A)hk8)*[])Kym}툼r;EOsn{xv:xy VsLj~7b1^jXڞm? FE|#># ͕Z?o^#,jF3׶ ziZFwmǑ߬#YӮ^퐦uEQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+\!.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf / B8!H8"8")P%M!V%M!$b%N!g%N!tt%l!\y%n!]&"]&"(."p"-" "MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5771 5805 6488 6776 7484 7540 7614 7710 7885 7908 7931 7937 7946 7968 7972 7976 7979 7982 8087 8290 8529 8970 9408 9443 9458 9470 9476 9488 9537 9557 9597 9614 9631 9646 9693 9731 9779 9861 9985 10121 10162 10200 10237 10272 10282 10331 10481 10487 10492 10496 10516 10626 10646 10652 10666 10678 10689 10726 10760 10784 10886 10923 10945 11044 11099 11157 11168 11184 11236 11404 11611 11782 11846 11898 12171 12722 13252 13685 14023 14356 14469 14484 14493 14653 14824 14974 15138 15161 15185 15200 15275 15415 15592 15747 15759 15839 15940 15986 16012 16082 16093 16102 16115 16141 16156 16172 16185 16240 16251 16266 16470 16703 16732 16747 16816 16890 16963 16993 17031 17085 17539 17565 17594 17698 17804 17989 18101 18216 18320 19007 19266 19406 19442 19612 19653 19789 19812 19849 19894 20145 20241 20295 20394 20405 20442 20479 20506 20515 20549 20556 20581 20608 20643 20657 20671 20700 20714 20731 20740 20762 20780 20797 20808 20827 20853 20871 20894 20911 20926 20941 20959 20986 21013 21035 21074 21092 21124 21352 21426 21469 21515 21662 21818 21862 22141 22168 22527 22711 22863 23044 23191 23349 23370 23418 23428 23436 23447 23458 23468 23475 23490 23502 23541 23571 23610 23663 23721 23742 23749 23768 23789 23796 23820 23842 23862 23884 23915 23952 23974 23988 24034 24063 24097 24137 24172 24200 24248 24257 24266 24271 24280 24289 24306 24310 24315 24321 24325 24363 24372 24399 24419 24442 24461 24488 24510 24542 24558 24563 24573 24596 24618 24635 24652 24665 24674 24683 24689 24716 24723 24747 24768 24792 24805 24824 24849 24872 24888 24894 24906 24936 24944 24984 24995 25006 25017 25034 25051 25065 25082 25298 25602 26050 26266 26530 26802 26854 26890 26926 26977 26994 27032 27046 27053 27070 27073 27078 27087 27099 27110 27119 27140 27182 27220 27236 27267 27292 27327 27383 27423 27444 27464 27505 27534 27582 27815 27850 28057 28076 28113 28174 28212 28251 28407 28422 28468 28516 28539 28575 28585 28595 28606 28611 28674 28722 28766 28827 28860 28961 28979 29118 29140 29263 29277 29287 29310 29415 29471 29587 29618 29623 29649 29688 29698 29741 29751 29767 29782 29800 29823 29853 29874 29900 30097 30140 30144 30150 30156 30161 30172 30186 30215 30247 30259 30306 30356 30396 30423 30439 30448 30491 30497 30505 30509 30529 30546 30558 30589 30845 30894 31470 31497 31529 31557 31609 31615 31621 31626 31647 31663 31685 31714 31855 31989 32002 32138 32140 32142 32144 32161 32174 32192 32219 32223 32229 32234 32242 32248 32288 32290 32300 32315 32332 32366 32398 32436 32465 32494 32516 32559 32585 32629 32765 32767 32847 32893 32941 33046 33148 33187 33254 33261 33322 33386 33390 33397 33519 33588 33876 34014 34155 34236 34283 34289 34312 34358 34361 34387 34430 34495 34557 34627 34695 34788 35007 35032 35036 35072 35090 35118 35160 35204 35268 35318 35394 35416 35468 35512 35551 35585 35615 35646 35671 35680 35692 35700 35711 35723 35742 35766 35815 35832 35856 35899 36221 36224 36238 36251 36263 36270 36281 36288 36295 36304 36314 36331 36347 36397 36405 36413 36423 36434 36452 36469 36490 36512 36521 36531 36558 36564 36574 36593 36609 36627 36647 36656 36667 36674 36691 36710 36731 36741 36758 36764 36780 36795 36810 36831 36853 36872 36882 36887 36892 36910 36929 36948 36954 36973 36993 37013 37031 37036 37042 37059 37075 37096 37109 37117 37137 37161 37178 37186 37197 37218 37224 37236 37258 37272 37281 37302 37320 37329 37363 37386 37413 37445 37468 37488 37499 37531 37547 37558 37571 37594 37616 38124 38154 38185 38213 38227 38428 38650 38817 38904 38921 38939 38956 38985 39032 39043 39062 39084 39163 39355 39383 39501 39523 39664 39683 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.0_BETA. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.0_BETA ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.0_BETA ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.0_BETA ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Die Installation wird abgebrochen. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.0_BETA InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.0_BETA ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5768 5795 6361 6661 7302 7349 7462 7555 7589 7608 7626 7634 7643 7668 7672 7676 7679 7682 7804 7989 8217 8737 9088 9117 9130 9143 9148 9168 9187 9208 9267 9284 9298 9320 9365 9391 9432 9510 9628 9742 9796 9825 9857 9896 9902 9935 10058 10065 10069 10077 10101 10183 10189 10196 10208 10222 10231 10264 10283 10295 10405 10467 10486 10605 10656 10708 10720 10739 10791 10995 11203 11394 11454 11503 11771 12231 12898 13322 13644 14069 14201 14233 14245 14423 14620 14781 14915 14935 14968 14982 15051 15164 15336 15471 15491 15603 15695 15718 15741 15800 15815 15836 15851 15872 15892 15917 15931 15955 15967 15985 16195 16445 16466 16482 16535 16603 16676 16713 16739 16815 17310 17336 17358 17465 17572 17773 17846 17930 18030 18525 18763 18914 18948 19083 19127 19266 19307 19352 19399 19643 19776 19838 19932 19937 19971 20005 20020 20048 20081 20088 20113 20131 20157 20164 20179 20194 20214 20254 20271 20291 20312 20334 20349 20369 20391 20406 20419 20433 20445 20457 20471 20494 20517 20535 20578 20629 20666 20851 20914 20950 20999 21090 21220 21273 21533 21580 21941 22091 22260 22400 22520 22652 22692 22739 22749 22757 22767 22775 22786 22797 22811 22836 22879 22912 22945 22980 23034 23059 23078 23100 23105 23111 23142 23159 23186 23204 23225 23247 23266 23276 23306 23332 23359 23408 23436 23463 23516 23526 23536 23542 23552 23561 23581 23585 23590 23596 23600 23635 23644 23675 23692 23719 23740 23760 23779 23805 23818 23826 23842 23873 23904 23925 23951 23964 23972 23983 23989 24013 24023 24035 24053 24064 24084 24100 24126 24148 24164 24176 24196 24222 24228 24258 24272 24286 24309 24328 24347 24365 24383 24606 24912 25330 25531 25771 25955 26033 26088 26155 26195 26218 26252 26263 26271 26294 26297 26300 26306 26317 26329 26342 26372 26416 26429 26442 26479 26493 26504 26515 26526 26543 26554 26601 26624 26673 26914 26947 27202 27223 27256 27309 27335 27362 27518 27524 27567 27587 27606 27635 27642 27649 27656 27661 27710 27748 27782 27839 27867 27912 27929 28030 28035 28112 28126 28136 28160 28283 28364 28474 28502 28507 28523 28552 28560 28601 28608 28622 28635 28643 28662 28695 28715 28735 28951 28982 28987 28994 29001 29005 29019 29031 29046 29079 29092 29147 29205 29241 29259 29277 29295 29332 29338 29346 29350 29371 29388 29399 29421 29599 29643 30345 30369 30403 30422 30467 30474 30481 30485 30509 30520 30525 30588 30709 30832 30845 30979 30981 30983 30985 30995 31004 31017 31044 31048 31054 31059 31068 31073 31100 31102 31115 31127 31142 31170 31214 31261 31277 31299 31310 31343 31363 31412 31512 31514 31579 31628 31677 31781 31879 31920 32011 32018 32079 32143 32148 32154 32263 32322 32573 32714 32841 32909 32946 32953 32980 33026 33029 33050 33095 33146 33205 33274 33321 33426 33569 33594 33598 33632 33649 33673 33725 33776 33848 33914 34012 34029 34060 34096 34130 34154 34178 34211 34231 34241 34249 34257 34267 34278 34292 34318 34366 34389 34409 34450 34749 34752 34766 34778 34785 34804 34818 34825 34832 34841 34851 34868 34884 34932 34940 34948 34958 34969 34987 35004 35023 35043 35050 35067 35084 35091 35104 35139 35156 35175 35195 35205 35221 35234 35252 35272 35293 35303 35323 35343 35356 35375 35388 35412 35435 35448 35459 35464 35471 35489 35508 35527 35535 35554 35574 35599 35617 35624 35631 35644 35653 35674 35687 35695 35715 35743 35760 35766 35777 35808 35816 35829 35851 35873 35882 35903 35921 35928 35951 35970 35997 36015 36035 36048 36063 36084 36098 36105 36119 36134 36153 36698 36731 36759 36788 36796 36833 37145 37322 37399 37416 37434 37449 37471 37521 37531 37548 37570 37629 37787 37811 37941 37966 38092 38110 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.0_BETA. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.0_BETA ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.0_BETA ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.0_BETA completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.0_BETA. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. La instalacin ha sido interrumpida. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.0_BETASalir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.0_BETAEjecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.diterGroupe umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5656 5683 6259 6619 7304 7365 7443 7538 7578 7600 7618 7624 7633 7659 7663 7667 7670 7673 7795 7980 8208 8737 9155 9184 9197 9210 9217 9237 9256 9279 9322 9342 9361 9384 9428 9457 9498 9564 9676 9790 9844 9873 9905 9944 9950 9983 10061 10067 10071 10076 10117 10254 10264 10272 10291 10305 10314 10346 10387 10400 10525 10583 10602 10721 10777 10829 10840 10856 10895 11145 11317 11489 11544 11579 11830 12235 12535 12804 13165 13345 13664 13684 13697 13886 14030 14226 14360 14380 14413 14432 14533 14688 14876 15063 15083 15162 15260 15298 15321 15411 15432 15455 15474 15498 15528 15572 15605 15628 15640 15658 15926 16245 16276 16311 16375 16450 16520 16551 16581 16673 17164 17194 17211 17351 17492 17689 17808 17955 18122 18680 18976 19157 19202 19365 19419 19554 19590 19650 19700 19991 20100 20157 20254 20259 20294 20329 20344 20368 20401 20406 20431 20447 20470 20477 20494 20509 20528 20560 20564 20584 20602 20614 20627 20645 20669 20687 20706 20733 20760 20772 20793 20823 20853 20878 20911 20946 20984 21237 21306 21361 21422 21540 21699 21753 22014 22065 22441 22596 22740 22880 22988 23173 23203 23246 23256 23264 23274 23286 23307 23316 23322 23354 23396 23432 23470 23507 23555 23579 23591 23605 23613 23621 23650 23667 23696 23717 23740 23749 23768 23780 23824 23862 23889 23933 23961 23988 24041 24052 24063 24070 24080 24089 24123 24127 24132 24138 24142 24177 24187 24217 24240 24269 24291 24313 24335 24362 24374 24386 24405 24439 24472 24493 24517 24530 24542 24555 24561 24587 24597 24608 24632 24642 24662 24682 24699 24725 24749 24762 24782 24816 24823 24852 24875 24898 24914 24929 24944 24959 24973 25161 25466 25897 26088 26323 26511 26553 26603 26657 26705 26727 26768 26779 26787 26811 26815 26819 26828 26839 26850 26865 26896 26942 26955 26968 26998 27012 27024 27036 27048 27066 27089 27134 27157 27217 27469 27496 27758 27776 27803 27852 27882 27913 28045 28052 28101 28124 28148 28177 28185 28195 28203 28208 28261 28310 28350 28416 28449 28493 28516 28617 28622 28699 28713 28723 28747 28870 28951 29061 29089 29094 29110 29139 29147 29188 29196 29210 29223 29231 29250 29283 29303 29323 29539 29570 29590 29596 29603 29607 29622 29641 29667 29676 29688 29742 29800 29835 29854 29871 29883 29918 29924 29932 29936 29957 29974 29985 30010 30188 30242 30933 30952 30987 31017 31063 31069 31076 31080 31104 31120 31126 31201 31351 31470 31483 31551 31553 31555 31557 31567 31580 31597 31624 31628 31634 31639 31648 31653 31680 31682 31695 31707 31722 31750 31794 31841 31857 31879 31890 31923 31943 31992 32092 32094 32170 32225 32275 32374 32469 32517 32607 32614 32675 32739 32744 32750 32853 32905 33151 33312 33467 33538 33591 33598 33625 33675 33678 33699 33745 33800 33859 33928 33975 34080 34223 34248 34252 34286 34303 34341 34394 34434 34510 34575 34669 34690 34728 34768 34804 34828 34851 34890 34920 34927 34936 34944 34952 34966 34982 35010 35062 35079 35100 35144 35486 35490 35505 35516 35524 35543 35555 35562 35569 35578 35588 35605 35621 35675 35683 35691 35701 35712 35730 35747 35763 35781 35788 35806 35823 35830 35840 35871 35890 35909 35929 35939 35958 35971 35991 36011 36032 36042 36061 36080 36090 36107 36121 36144 36168 36181 36191 36196 36200 36218 36237 36256 36261 36280 36300 36325 36340 36344 36351 36361 36370 36391 36405 36413 36433 36459 36476 36484 36495 36526 36531 36544 36566 36581 36590 36611 36629 36638 36682 36706 36733 36748 36765 36779 36810 36834 36865 36872 36886 36901 36920 37465 37498 37526 37555 37563 37600 37912 38089 38166 38183 38201 38216 38238 38288 38298 38315 38337 38396 38554 38578 38708 38733 38859 38877 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.0_BETA. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.0_BETA est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.0_BETA est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.0_BETA est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.0_BETA Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.0_BETAExcuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5750 5782 6274 6563 7108 7154 7258 7344 7380 7395 7413 7421 7429 7456 7460 7464 7467 7470 7581 7766 7994 8470 8804 8833 8848 8863 8871 8885 8903 8924 8975 8991 9001 9021 9067 9097 9150 9207 9318 9439 9483 9516 9555 9589 9596 9629 9706 9712 9719 9726 9755 9867 9873 9884 9901 9918 9927 9956 9968 9978 10079 10141 10161 10281 10318 10374 10388 10409 10446 10656 10831 10980 11015 11067 11285 11600 12125 12488 12778 13171 13306 13319 13330 13476 13655 13786 13920 13940 13973 13992 14075 14190 14331 14456 14470 14578 14671 14700 14720 14796 14813 14831 14847 14866 14886 14903 14915 14941 14953 14971 15172 15411 15438 15455 15511 15573 15633 15664 15688 15747 16123 16153 16170 16278 16388 16528 16602 16678 16756 17248 17468 17579 17610 17737 17773 17901 17928 17968 18014 18230 18354 18422 18522 18527 18563 18599 18613 18636 18669 18673 18698 18717 18743 18748 18763 18778 18797 18822 18834 18856 18873 18886 18898 18916 18940 18955 18972 18985 18996 19007 19027 19056 19085 19109 19144 19179 19206 19393 19442 19474 19522 19619 19752 19798 19990 20020 20342 20471 20611 20751 20868 21003 21047 21090 21098 21108 21120 21132 21140 21151 21178 21212 21249 21280 21315 21351 21398 21418 21435 21453 21458 21465 21492 21508 21529 21546 21563 21581 21598 21611 21642 21667 21698 21729 21764 21791 21844 21854 21864 21870 21879 21887 21902 21906 21911 21917 21921 21956 21966 21995 22011 22037 22054 22073 22094 22110 22123 22128 22136 22151 22177 22196 22224 22242 22253 22259 22265 22286 22296 22307 22325 22347 22364 22377 22398 22418 22438 22449 22462 22484 22491 22516 22531 22551 22563 22580 22597 22617 22636 22813 23097 23407 23587 23798 23986 24052 24099 24154 24198 24218 24247 24259 24265 24281 24285 24289 24297 24307 24319 24334 24353 24389 24400 24411 24450 24462 24472 24482 24492 24508 24526 24575 24596 24641 24885 24911 25165 25180 25206 25263 25297 25332 25474 25491 25540 25561 25577 25606 25611 25616 25622 25627 25666 25701 25731 25786 25819 25865 25879 25958 25963 26017 26031 26041 26065 26151 26199 26305 26339 26346 26361 26388 26397 26436 26443 26465 26484 26500 26518 26550 26569 26586 26743 26774 26781 26790 26798 26805 26819 26837 26856 26866 26878 26919 26964 26993 27014 27037 27056 27094 27100 27108 27112 27133 27150 27159 27178 27324 27366 27876 27884 27908 27926 27970 27975 27980 27984 28015 28028 28037 28083 28209 28300 28312 28376 28378 28380 28382 28392 28406 28421 28448 28452 28458 28463 28472 28477 28504 28506 28521 28532 28547 28575 28619 28666 28682 28704 28715 28748 28768 28817 28917 28919 28987 29027 29072 29147 29213 29248 29329 29336 29397 29461 29468 29474 29573 29629 29905 30029 30140 30202 30240 30248 30270 30319 30322 30343 30388 30443 30502 30571 30618 30723 30866 30891 30895 30929 30945 30970 31018 31054 31115 31169 31250 31272 31311 31348 31380 31404 31431 31457 31471 31479 31489 31497 31511 31524 31536 31560 31601 31627 31644 31673 31997 32000 32014 32026 32032 32048 32060 32067 32074 32083 32093 32110 32126 32169 32177 32185 32195 32206 32224 32241 32254 32280 32287 32295 32312 32320 32337 32361 32380 32399 32418 32428 32439 32453 32471 32491 32511 32520 32543 32563 32574 32589 32601 32620 32639 32650 32660 32665 32671 32689 32708 32727 32734 32753 32773 32798 32815 32821 32829 32839 32851 32872 32888 32896 32916 32936 32958 32966 32977 33000 33007 33021 33043 33060 33069 33090 33108 33117 33148 33164 33191 33210 33230 33248 33269 33283 33303 33310 33329 33344 33363 33908 33941 33969 33998 34006 34043 34355 34532 34609 34626 34644 34659 34681 34731 34741 34758 34780 34839 34997 35021 35151 35176 35302 35320 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.0_BETA. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.0_BETA zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.0_BETA zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.0_BETA zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.0_BETA zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Instalacja zostala przerwana. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.0_BETAWyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.0_BETAUruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..