08P+i'&<  '+iP''`'G. G.+i'&P@@<@T 08P+i'&<  '+iP''`'G. G.+i'&P@@<@TU +i`'G.yA+i+i+iQA+i+i+iGA+i+i+i\A+i+i+iA+i+i+iA+i+i+iA+i+i+iA+i+i+iA+i+i+iA+i+i+iC+i+i+iA+i+i+iA+i+i+i$f +i+i+iRmKC#+i+i+iX`hpx$Ƞ+i+i+i (08@HPXQ$v+i+i+i`hpxYR$P+i+i+i[I$+i+i+i (08@OmI+i+i+iHPX`hpx][$+i+i+i$>+i+i+i$+i+i+i$s+i+i+i$+i+i+i$+i+i+iA+i+i+im+i+i+i$+i+i+i $+i+i+iA+i+i+iA+i+i+iA+i+i+iA+i+i+i$Q+i+i+i (08@H$+i+i+i $+i+i+i$+i+i+i$+i+i+i$+i+i+i$+i+i+i$+i+i+iA+i+i+iA+i+i+iA+i+i+iA+i+i+iA+i+i+iA+i+i+iXnF;@57|vHW'Q\D\^K%!H)vn-_6blKThI  wbfQ/Vɝb]],x0P.C! faAphzZfD6G. . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF4@#4 (HO"HO"W"7+7+ ԀԀ,,W"7+7+NetBSD@ ;PaXUXSRffffUVSX&7+9s 9r[^]UWVSXǦ&}P PLt,1t&tuAt[^_]Yuڅtft 9s1u+r 9vu׃ 9wtt_ t1uC tuS u9rh39[Jt*tQ"UWVSbW&E9s{*c;9r[^_]UWVS!WH&}u ,0;6EF `+t/uut<$fT7+E9s ;}r !$7+E9s ;}r $[mED$D$F$$ `+QD$zD$ D$$D$J$^,$SW&Iu1ƃItЃtp${_[SWÖ&HuYƃHt(|$p<$_{t?t<$B{tЃ_[UWVSh h h0, 1t:PYxOvh0,j MXZ3h$h0, h0,j Mj"UEU MsMU HE]UVS1ۋ@ tVPZYu D C܍e[^]USķPh( h0,h0,h_ n  CtsPh~ h0,jlUWVSE tuh +IURhc@5@,l t5D,h jBuX"2"MX"2"EX"2"WVSQRP5D,h JE tX"2"RPh % u5D,h 1e[^_]U5@,XUjhc 5@, t5D,h jr1USRj EPSS xU:t Sh j]UPEU Ph$  JtPh: GEEEPhc5@, t5D,hQ j1UWVSSuE H1ۃv>PW1ZYtC uދ$ Eh WZYuE FEEPhc5@,m t5D,ha jC1e[^_]USu Shu j]UVS1 tSP~ZYtFSh j e[^]UWVS ]u} Sh$  } ~Sh: YF1}{EFE} t!vtt>uh- BEEEEEE먉t9WuhH jM9MuB}t }uEEE_ESEEDEEċ]9]}t#}tEЃ}t}uEEEԅu.u9uCE4 5D,hk g )}t}uuu EEUU9~uuuh jk]lSE^u h j1}EEuĉu܋uuUUuuMMPh c5@, uEX@EUu5D,h j>EEPE4 h wCE rh prYElU9U|,h,h<#XZCtCPh$#_Xj ^CtCPCPh  CtC"PSh  Cts؋C4 h+ g C$Ph9 NZYuBXEm1e[^_]UEd,]UE$,]Uh, jUhB juUhY jfUho jWUE E EE]Uhjjjuh x,|,Uhjjjuh ,,0,Uhjjjuh yl,p,Ujjjjuh Q,,Ujjjjuht#),,X,\,Ujjjjuh P`+uj UShjjjuh Ӊ‰؉,, uj ],u(Ujjjjuh ,,,u(Ujjjjuh MX,\,UWVSu,,X,\,>WXuWh j=SnY_u Sh* jxxuSh= ]hjjh EP uu뺋,#H t uhW  P,WPZ_,t/#=t ,,tt h ]<X,ƒt!uh QBu^,Lt>!t.t ,,^*,,Bh j,we[^_]UVSp,uXD,,H,L,, ,;,,rgj,D,, ,H,L,X=5P,uT,E D,)EU}t 13A}uke[^]ËH,L, t , ,Uh h<#jUUh h<#jUUSË@4URs(PZYts$h<#jS4K(E%= u!HPhm8@QR @ C !jjjQR Bu@ue8uK ]USQП9v SZSPEPBƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h j4C4WPs(Xe[^_]UWVS]uVh`,jC4uu s(P(8jVj$8؍e[^_]UWVS,}t , , ,,EUEUEU}u*, t!11;E} yt㡀,, t(jRP5(,4,P Bu@u 5$,h$ IuSh,Ɖ 19|4 u5$,hH 18t5$,h<#j11,E , tQE, ,5,5,QP豻,,,,,,5,=,9}uA9uu jdSS$$Sj9$,, tFDž|% t Dž|0g"|RPhW jdShS$Sj$,, tFDž|% t Dž|0g"|RPhj jdSSv$Sj$,,|UiM|WVRPضRPjhWVԹPjhWV,Pu|h jd]S$S$Sj e[^_]NUFu莏jUWVSX,\,l, p,`,u1jRP5h,t,P B@?1 `,uBNS5@,5h,t,P$ t',u<5d,h<#j)uX,벡P`+vHP`+h jLu5d,h<#LXZpe[^_]UWV ,,, 0,u?j ,,%,RP5(,4,P B@4tAfEEEPhm5(,4,P tS5$,h<#j11;5,,0,5,5,5(,4,P$ ~fEEEPhm5(,4,P @t;5,,0,s:5,5,h, ;,G;,;붍e^_]UWVSƉ׉ˡ,҃Pj h2"WVRuVɑVShB#(e[^_]UWVSljӃ=,t%tPh h Vhh PV =,wwVPh ww$w wwwwh [0wxw4w0w NyV_ H =`!,9d d!,X#,؁}U|WQgZYU=`!,d!, X#,uD#,tjbtj=d!,u d#,C9F `l{ `!,9X#,؁}ULQM5d!,ZYMUuN_0Ph"h0,hk& 2X#,HX#,u}D#,;tl= `!,d!, X#,uD#, u d!, QF @t00 Ph"h0,(h ~1 $",+E e[^_]UWVSu] }9tSC=l#,t=VPZYy0Ph"h0,h 6. VP1e[^_]UWVSQu Vv[=l#,t1;uVtRW{ZuZW95 ",u=d#,t =\!,u BRUPu! xËUF?륃=l#,tuX؍e[^_]UWVSPu]>!uhB!FPjY_Vu PMƒ u$j0PVh&h0,h1 KuSRUǃ xq>!Uu7R mZy40VPVh&h0,qhI ,2Rǃ=L#,uWhU h0,A tE)؍X؍e[^_]UWVSW11 ,yh, ^(,P,s=t#,9 x#,X#,؁}U|WQZYUu`10jPh"h0,hk&+X#,HX#,D#,tjo jA =t#,x#, X#,u D#,uɨu١x#,u d#, t1f,9tlމ߉",x#,0x#,p#,f,@tV0Phb h0,hm +f%,p#,t x#,x#,p#,e[^_]UWVSWp#,C{ u)ÃEp#,FTRP Y^tEl!,9}\h!,X#,ށ}VR_Zi5l!,h!, X#,uD#,tjtj h!,5p#,ljD s} usnExtx#,M| thm )Y1vEl!,9~Vh!,X#,߁}WR YZ=l!,h!, X#,uD#,@Ch!,25x#,NjM}t/s2PR_Zth!,D } )s!l!,9 h!,X#,؁}tVQoZYuV 0CPh"h0,_hk&(X#,HX#,D#,jh5l!,h!, X#,uD#,=@h!,Me[^_]UWVSQ]utuh XZ} 9EF95\`+}h,h$ ^XP^vs\;t.ˆUPh HZYUtF-   /B000CQ<\t빸 1e[^_]UEH!D#,EPhht@j x$Efv``+Efv\`+U= ",uE",E ",",",9~ 1; ",~h)%&XUWVS$",}t~} t 9 ",~[C ~K ",tISPZYtF=d#,tj jvPjjjWu<u19$",uh &X؍e[^_]UWVSP]U u h)%%XS19 ",~BPJESAY_!{$",uSvPqx6;utV6Zuϸ1e[^_]UE ,DBuh o%XP< ,u!,E!,1UE,DBt ,EPh %XUWVS$",,p#,EDJ@t t E@p#,޹p#,0U?& } $ }^@p#, ,p#,8f|y@t t@p#,܃tSj hp#,5p#,rǍ v`8"uh A^t-u16UBQ@u^t -uօuh)%#[j hp#,5p#,"rÍ v8"ult@p#, ",.h$",]tP%1Ƀ/QPZYrp#,M:)@p#,DPp#,@PX,t(@p#, ",;u $", ", ",9Et9 ",}؍e[^_]U ",$",",",x) ",",",",p#, ;t(,t# ",у~ ", ",JuJ p#,:;u$",9t ",t1]UVS!,11Å t]9!,u!,J@ԉt!,[^]UVSujgZu+0 Ph"h0,<hk&!FV CS FC؍e[^]UMU 19tz\uBPQZYUWVS=@#,ujEH!D#, ",PjhB!h ykh W^tZP[=wJ@ PvYt:WPIXZ|3/t 3/D3h S謜5 ",jhB!SjcUM=X#,tI D#,QU=@#,uj+EH!D#,jh#,GUWVSE$",1=`#,u3t x#,| t>f%,p#,;u1p#,Bp#,: u)؃u ;.u{ tԍ<X#,S|Zu# X#,uoD#,tj7t[j$",t PFXPPj0ƃ t9u\#, X#,D#,u른e[^_]UWVSQu",X; ",|1ۋ",zX#,9t9u%SFEW=á",$",XZUSWjc/ u X#,t$195 ",~FPVj4/ u)ϋD#,tj jSX95",M~WVVWYXMXABy ",19~",)@$",=`#,t R3XZ\#, X#,uD#,FM1e[^_]UWVS}5",ơ",",)C=$",Y9~9 )C)EE1X#,VjYu' X#,D#,tjt|jPEZtEG$",PPj-ǃ t\#, X#,u D#,uu6l$",@PX]EF1e[^_]UWVSQ] X#,Suj!- u3 X#,D#,tjj19 ",~CPNjEpVYZ=`#,tW0EDXZE8G+]C) ",5$",\#, X#,uD#,t{1e[^_]UWVSu 195 ",~@PEuXZ1;]US_UCЋ=#,9 #,X#,=}UWQZYUu[K0Ph"h0,hk&X#,HX#,FD#,tj.j`=#,#, X#,u D#,uΨu١#,ЋKS #,B9|^5#,X#,Ё}U\SV^_U*#,#, X#,uD#,OV#,f u u~Y[xhEH$",X#,5#,Zu X#,$",PPj|* t\#, X#,uD#,t1e[^_]UWVSu=#,~ #,y#,1X#,W5#,XZuSk0Ph"h0,hk&X#,HX#,ucD#,tjtOj=#,#, X#,_D#,uͨNΊ<\uFFBDtF9D ؍e[^_]UWVSET#, H#,t h `jEP£p#,XYJE #,95#,X#,=}U\SV^_Uu[C0|Ph"h0,hk&X#,HX#,D#,tjjX#,#, X#,u D#,uΨu١#,!L<% s=#,9}u #,p#,p#,x=p#,8\ux=p#,@1s p#,< uD#,) #,9^=#,X#,؁}UtVWY_UE5#,#, X#,uD#,jqp#,H p#,s#, x|#,؋5#,9~S#,X#,=}VRc_Z5#,#, X#,uD#,#,@ #,ދ|#,#,9@FPT1=@",u h Sh@",P:E؋5#,ZY9~RX#,=}V5#,ZY5#,#, X#,uD#,'.#,)ߋEHMt FD7D2p#,Bp#,y #,9^=#,X#,؁}UtVWZYUe5#,#, X#,uD#,5#,=#,|#,#,Ѓ˃=`#,u",HP8$",PRPX^_B1p#, Bnt#ptltp#,: tp#,Ã=`#,u9",",9 RP3Y[Pp#,X=",1 p#,Ant4pt%lt%p#,9 NWSPNp#,벡$",PPi_ZS1 p#,Qnt+ptltp#,9 p#,뺡$",PP [^5",=",6= ",u h ",; ",5",=",9}9| h 1 p#,Ant#ptltp#,9 t%p#,Ã=`#,uS0$",PP9ZY#1 p#,Qnt'ptltp#,9 t^p#,뾡$",PP^_1 p#,Qnt8pt)lt)p#,9 ZP5",5",5 p#,뭃= ",\1p#, Bnt#ptltp#,: tp#,1=",ul5ud`+",= ",p#,Plp#,w u݀8 =\#,=L#,zqq@DA@= ",u ",",Åk1 p#,Ant#ptltp#,9 tp#,Ã=`#,ub=@",u;!thSh@",  @",",u@",RSeY[9 ",\#,1ۡp#,gt[B tL0 辱j hp#,5p#,U#, vO*ptruR@p#,c8"uh  #, %#,߃t #,p#,8 tx u h 5#,X#,tt6ƅu+ X#,D#,tjLj##,9t'tP5#,5XZ5#,", X#,u D#,uut#,Ѓ=`#,u!Ѓh#,h#,Y Y^yt#,t#,#,p#,nt5ptlt"$",PP_Z1y3 #, #, #,@p#,밀pup#,p#, Bnultp#,: tЃ˃=`#,u5#,5#,5#,f $",PP'[^=",5",R= ",",!; ",=",5",1 p#,Ant#ptltp#,9 tYp#,Ã=`#,uSO= ",U1p#, Bnt,ptltp#,: p#,뺊X]ڃ1Qu p#,p#,DA@?Å ", ",u",",PjZY p#,Qtaj5,%,(%, X#,u D#,uѨu؋(%,5p#,ߋMEp#,=d#,tj jPS萿Ã؍e[^_]USp#,< uh X< u=0%,u$h3 XJ p#,R t8u Ӌ0%,P8X0%,t=",u P!Y9j.0%,Zu(諧0Ph"h0,hk&VO",5P#,S50%,, 0%,t+h'h$,SP輯50%,޺0%,1ۉ؋]UWVSVp#,Pp#,M1ۀx%u8Huzp#,=D%,h [s9}ep#,Pp#,D%, p#,\Pp#,D%,2< @%,p#,M8 uD%,X#,ف}|WR詶ZY=@%,D%, X#,TD#,tje[^_]e[^_]UPEEjEP5T%,g[ U<h Ph h0,ܢjUWVSÉThW3P\ Å-1ۃ8#)tSWVZ ؍e[^_]USfX8u1ɀt []{[]UWVS} 5T%,\fDž<X蝖uJhPj[ uk8]8thg"-ÍjjPn[ @u.8th javf8utSVWY y8#Oh%)?jW]jfDž=X%,t fDž9DžjRjY fDž9fDž9T%,jSVZ @uQ8fu ftR(@ufDž=X%,uK"T%,@uՃfDžft@u KfDžIe[^_]UWVSQ}u VW3[ZÅuzjjУXZu h2 jt;s jEPW8ƃ ?tE8thh jRt48"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}XHpz}z9zu};zu 9u{;Mtt9u ;MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEU HZ@9BD[]UWVS Ɖ׋EEE EE1;U}9xu90u,]9XuM9HtyB܋EEE9]}!9xu90uU9P uU9PtEE,Ck,RUQ^ZYt&UTԉ2zur}z uE1ɉȍe[^_]Êt"tUWRP Y_}ËBt1Uj藓L$qUWSQ`%,-%,wh%,ڞw ]]5t%,5p%,h j5|%,5x%,h jة 5%,5%,h j轩5%,5%,h j襩 5d%,5`%,h& j芩5l%,5h%,h< jrE$hR j]EPP$hk jI =%,t>u`%,1 ujEeY[_]aÃ=%,tUE Puj苨 UWVS}u cPh jƨ3t%,B9tT%,e[^_]UWVS$ ]5%,t(VL$V20Y^uuh j0Pu  ƒ Wp4$谚0ZtWVP軇 uWh j 5 jj0։( y 0h jju ։ƃ R Wh V ƒ -jjW ‰  V h ޙ_Xuh j<[^=jh h R( y R踡Y߉R衡Z=t7w=bt%=bu;%=u&*! u h1 t u h= hjYu VRZƅ/ t jZV8 jZVP%Z KjjP@& %,tS SQPR( &,kPUƉ4P=8t t10hU 9vBFu h{ j\ 1e[^_]UWVS\]ƍ}ZE5 (,&x&0誟4蟟8蔟EPS9e[^_]UWVSĀ]p$tV:V:Y^㋃p tV:V:XZ㍅xP4k1RPuuHJt5`+9Ήt}"Q95`+VPh e[^_]UWVSP] -E41RPuu[EƉ׊tC|1ׄtuju1RP=tuPh j}1EtZ WVuuC7VZ vWVuulCkWVuuWCk ËEe[^_]UWVSTE‹EJu E=EHEE EE1ҊM t1҉Ƌ] ڋUӉe ƉߋEE$EЋEt\׸ 1ҊM t1҉9ƉЉuԉ}sMԉUEUE}t EșŰU9Uu‹E9uM] E} uWVE,# E =%,EEIu EE1 t1҉ËM ʋUщe ʋ}t}\RPE,r$h`%5%,Ãt#ESjPVQUHt h ~YSyZ%,%,E1p%,t%,E<EEtEUE\EEEԋU+EUE܉UEs‹EmJu EE1 t1WVuuA9E 5E01҉ t1ҋMԋ]+M]WVRPLA9E EEEEuuԋE,"EЃ Et8ELۃ0EЋPatEhaRuuPh 3GPEЃP53‹EЋXX9t%ERQuuPh/ juЉu]Љ]EԋU؃E܉UEEEEE]$tSS;Ut ]K}O;MFt }_] 19](9Muu܋E,!EujP2EȃEEE$t }]Sd9Us"<瀁}}E= u+}}EE€KEFEMQRPuEPE]tXpXjub6XZ9u9]EE@]k,Pu軔^XEk,tԉExVEk,tFF E܋UFVE$EċEtP4@0P,@(FV}tGPGltȉF Ek,Dԉx(}҃ P$]E}ĉ8EPEXE1 t1u}]DEw;UnE];Et\]ԋu)։]uE‹EJu E?EJ1 t1WVuu"=Puuh j蜛EtP @@1ҍMQRPuEPYE0juL41ۋE;pEEE9vhI9uEtpp EAuu܋E,PujP.EȋEe1 t1u}C<҃<DEE}k,Pu EZYu E]ĉ1ۋEEEĉƒE9 k,E}wt 10x}t7t |44px u܋}px}Єtw04w(,px}wp I9utGE@ E}k,}D$uu܋E,ujPw-EȋEk,Ur(Er$ t1u}Cȋ]E<҃<]DEEEN]ЄtKK9M}1ۄt_9]u 9M>Et\uԋ})׋EEIu EE EÉ1 t1RPWV9PuuSho jRE}ĉ8GEЋP9Ut,EuRuuPh jE}8E]ĉE Eu%,%,EE܋UEԉU/Ee[^_]UWVS uEPF VM]_9EEr )ӉM܉]Fƒu >uFFFuEmE9v*Wu h j>NFF1ۋE1)ډEUF@]t[ ][]E1ҋM])ӉM]E;Ev 1)EU1;EEFUUEEEeM1SQRPs<FVe[^_]UWVS]E 8wEE 9MUS}HPH EU,hj,QW1h}EEPhE ƒyEqRPh!jӕhj,3Wg}t EECEEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ0΋QRPh"! EEǃ<EPURvSE܉EUjEPURSIMM܋E؉ẼEE19~k,ŰD$EUGm<EEm`%,`%,h%,h%,EЋUx%,|%,ẺEMEPh ǃ yNQWPh3!0FPh ǃ yNjQWPhY!j˓1eY[^_]aÍL$qUWVSQ9q%,%,,%,%,?%,%,%,%,1h!VWp ta#DtNJCl5%,뷃b$ %,%,C%,C%,u5l5j%,e5l5Nr%,R5l5E%,@%,/5l5$%,%,5l5%,Yl5%,h0,h!#(XZ ,)lj80h0,h!'^_=%,x8th!5%,t hD!jXtjj)h K!Ch+jjeZY@u h!jj h K!hjM00h!@P@ uh!t|j/SD[_Åu@`%,׉hjyMhjmMj'%8%,Ps%,1uph!jːjy%,؉8hDj 803PyP3h!jxW5%,OG9=%,=%,tl95%,~]%,4^FY烽 tgDž Dž,,9%, %,4=%,tjy%,xtP%,0j%,dhDžldPh %, à t&v8:h;!jVDž1ۃ=%, 3,%,,4@TGXRjPjj($tPh<!XB 0XHt&X HX8<@($H 8<@h RV'1p%,t%,0YZ9t4VZyPhQ!jPhj!j  ‰Ju MYtH‰;R0<8Ph|!x tH;01 t1ҋ+8<9ȉ|;8<}3 ;8<Y08Dž<߭8ݝ8y11RPSQ21ډ߭ !ܝ8=%,pݝt{\PS S ݅y+؉Ph!j) YjPh! \`+EU5%,9Ɖ 9jSL6[_@݅u؉]Ph!%,ܝp (!ܝ8 ء%,40%,<0YDžDž8985pt_|OlLRjP811RP$8DžtGlL9 ;vukQ k4 JHJZH XH J HPW4 T0 T0VjQ'#XZtGl8hjP8%\8P Pu|Ph![^DžDLJ<%,8%,0H8ȉ9w9rÉDž0Ph!70Ph!j 4Dž0Dž8Dž;U09048Zrى 89 +4im۶Ɖ2SQVPhR!'DPh%,VW(~Q8D\`HP\Ph%,Wi\DH0S, Y9Ѻ}uDž0Ph!@19w=D\`j\Ph%,W\D898}8SK t+4i۷m۶DQRSPh!DPh%,SW$~8E,]ZF(D0t#%,1DžDž8Ph!/90~k,D$Aۉ<Dž ߭߭`%,`%,h%,h%,x%,|%,DžXDžTDž1DžDž90ttk,N9Hu;V tyt_|TRXR01RP&1RP1FV 9|,PQpQRPjWI(k,Dž;P}VTQXQ0)Q t pb멋T=%,t1p%,k,D;$p+$9~t$DPSh!0pPh Ã)j0j1SPh!j0#tVf0:t&0Ph?!j躂,_PhQ!j蚂,?$ʋ$(($(0411ۃ8t="k4dd081SQRP'd1)Ӌ$(+$(SQ840($PhW!j98G8904|Ph!j jh , ,jGX 9%,/ Ph!j~ 5%,=%,th!h4 hh!ސ{ SPhJ!j5,5%,;K؍eY[^_]aUE UMQ1]US]C Cs4SqjS1]UWVSPj RrZ1ۅ'ƃ}kEP1rÉF X1;}}lAAA AMuqËMXu,kF t 48yYPyVyXZG@ EEFFE FVEFVj8q_u/1~ tF ;}}k4yGYP|yZVuyX+P 1EsC4CH1C 31؍e[^_]UWVS]s$tVVnXZs tVVW^_{G 9w~k4xFYPxWx1XZe[^_]UE@H]UE@@]UWVSEXC9C@CPhc!j}kCPs 1uush!j}FC ksFFF FspZush!jb}K kKK E UAQMCSEUCSEURPuu#E UMA Q}} EENjEe RPu13 yEsh!j| EC1e[^_]UWVSQExGE19E~4kw N^9M U|V 9U UV} E )G@1Z[^_]UWVS]K4q{C,S0EU%EuuuQMg Mt)Es vEC C C[EEF}~NjEfRPss 1 E9CuaCCV}~EFNjEfRPss 1 uh!zYEC$Cs4SXZEe[^_]t@Ë@ tËÊtBRtUWRPQY_}ËBht1UWVS ]L 1󫍅xPpAY^$,tSh[uЋ}ԉ t,t)ƀ,tC|)ƉDžDž 9 Dž4DP S8tGpBu#eE&,`+Xe[^_]ÍL$qUQ %,%,5%,5`+$!EM MuQQ$RPh!YMɍaUS]CtS P S tSPSCr s xdZSqd %,X]USEPsH) %,%, %,H1҅u0&,Z[9t &,u&,u h !j0X4CXtYZ@]UWVSu EEE#`+&,%, %,M11ɅtJA9~ʳ9M}#t%,h, !hX hh; !Vy}9x4u }9x(u9p$t버t%,e[^_]UWVS]uuu SO trNj@th] !hP h1GGWX9w&~6Gthu !hP hh; !xwVw ,G [^WY%,`+;%,V=&,tGWu&,P= &,t+GWu&,WGtG4WPZWX%,j@j+Vj+G _4E UG$W(G,W0wE #`+G8&,tz8GC GtWP { _ Ge[^_]USEM Puh !hH h4h; !~wP ʉPHPPP s E]XPs4H %,%,%,@ &,H&,0@t &,H&, &,H&,P4JH8&,9t!tXYX tAP]UWVS Mu }uWVQa‹EZMt %,1ZU%,EEEPWVQQ EMUJ,B0xB BB4RPX r J1؍e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=`+Y,A0Éa,ڋyY I4 s RPWSQ  RPWSQ e[^_]US]C%CSjSN1]UE UMQ1]Uj (UU P,&,PYtHJ ,&,@ ,&,UWVS] (&,C0tS4P4S4C(tS,P,S,s$tBFtV P V V VY^׋FtV P V VVXZs uًCpd5^C'^${s^ ]e[^_]^UWVS]E EEEE@&,Etp9XH0udxu9w,uDu9w(uYY Ct1N9Uu9Eu1ۉ؍e[^_]UWVS u}j8jËEECCCDPCPC XC C$hjEhjM쉁j`juMAdKAHA 19Et EXEMQjR t1WVEPEPPPuu uiƃ(u9juEGQEpdPFPZY9뗁~atuuhl !tF 9t/ Fp9t(1SQ1RPuuh !艤F(V,F V$;EUruPuuh !Wuuh !? }t2tF(V,F V$9Uu9EtPuh ! EUjuuuuVSǃujuY[}t%tF(F Puuh" !蠣h9 !h hht ! ]LEEE1ҊM t1EUEUĉEԉU؊$EtẺU\EEЋEU+EUЉEUIu r1ҊM t1҉EUEU+EUuuRP&uuuu9uOE1ҊM t1҉EUEUă+EUEUuuRP9t"}tFVEԉUF EE }tFFuԋ}؉u} u}uEuEԋU؉EUEjuXZE9EEEEE Et EUEUEUeY[^_]UWVS ] }t$bƉ׋EVWVRPh@ !^EbuE‰9u+ztE։9u 9u Tv9sE]Ã}thQ !9h,ZYtCpStCHuRPuuEU}t hz !pXEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh !D6,6EtM}`d)RPh ! tCpStCH9Uu9Et]1ۉ؍e[^_]UWVS u }^j8j E@EMAdLALA LA A$Y[}thj ËE쉃PXZ u =`+ƉEE} t h !˗X`+EPjh WVuhj ËEp E쉃PEP P jP^_ts s@5`+} tURjh  t1WVu$hj` EEp }E}쉸PEP P jP}ZYutCHSLC419|} tMh* !X@E?t} t#h_ !`Xu uuS9u u0AX S'AX]tSAX1zSt ǃ ǃL7tX\+1tǃ`dǃt}uWj Ɖ_tCtPa ^tCtP; FY} }u tCHSLEU#C4EEEt UCHSLC4uuE0jjS;thlSXZ؍e[^_]UE Puj`+ UWVS]FHlj1RPuu EU슋tC|1EUEUtURjW1EURPVtPu h !F u|1t$QPuu 1F P@EUE~ vQRuu kQRuu k NjGEEjV{XZ1;EE$Et\u})׉u}E‰@Ju 1 t1WVuuq€}tKt19suu苃0uu Se[^_]UWVSE@E@0Et EEu } tu}}t EEETƉ׋E t1 9;uE|LEE Ɖ׋Es|| t19EMWVUE&ZY‹E9sE}u1PWVE| 6E|E||RPʋEuEH_X}t EP4PR^ ;EE:#] ]Et E!ËEU| t19r^EGމ}t(SuuuE}@,@0E@dpx E3uuUEZY9|C}t.EPjRuuu|E}Dž|E}u1PuuًE| }u뼍EPEPEPuuuuB|[EA}u}t1U9~|u@EiE@dpx }u}t<}uuUE~ZYPuuueE}s}~,EME uEMEM}~EMEtxuDžpp9EPEPvvuÉE~uP H1E@,@0I@u?ENjtx t1C,S0C CC4SP_N]{ E u$EtDNEtxC4SP[@p]M}tE@,@0Etu2EMEEMEXEURjPt5t5utt5t5h ! LEP }tDP4PRF}xUB%|aE|;EZ,J0tB BB4RPX||e[^_]UWVS u_EUEU t1҉E܉UURPuuW EU1EURPKt1ҋM܋])ӉtF|1)ӉM]]eEU]8vfBH4MQjPjjRt Ph !$Y[MA tP@F(V,@F jQXZtF(V,EԉU؋EUF(V,F 1҉EԉU؋EF vkBHMQjPjjRPt Ph !~[_EP tM]JZ}zP4PR:Ylj1M]M܉]‰1 t1҉щ‰UtVR Ћ]9]]]}-@@EUM]HX Mԋ]؉L:\:sR v:]9]]]} @EU]XkEԉD:8]9]]]} @EU]X k EԉD:BHMQjPjjRt Ph !XZEP M܋]tJ Z$JP4PR:EP4PR1e[^_]UWVS}cvfBH_MQjPjjR!t Ph !O^XEP tJZO(_,RW jPY[$EtG(W,G 1҉EU苷FHE܉%1RPuuӀ}tG|1Ӏ}tURju1RPVJtPuh !u 1Ep tSQuu]ƋF FtZ< vSQuu2kSQuuk ƃ~t*uuh ! tFVG(W,FG vkBHMQjPjjR\t Ph !XZEP tN^JZNJP4PR:Xju ^XtG(W,G 1҉ W[Et UG(W,G 1BHMQjPjjRt Ph !ZYEP ]t uZrZP4PR:X17D6,t G0W4G(jjP0uu Wde[^_]UVSUE 9| 19[^]USPPh<!h0,D'h0,hs!`+CtsPh!h0,'jUSSE] tt %E!h!s0ZYu EeEPhvd5d:, @u35`:,h!jm]UWVSQ}u t~^h!SYZu ELhH!SYZu E2hB!SYZu Eh!Sq[ZuEuhu#vRZYvMEPhud5d:,  @u65`:,h!je[^_]US}t?,Shzd@5d:,o  @u5`:,h!jF @u5`:,h!+tXl%NjX󥋽`8X K`t!Tj ZTujjhp`hj"T^_t̋`DžXDž\11t(X\H X+HXߋWV\X5`:,h!xhxd 5d:,% @5`:,h!NY[``pp pp5`:,h!`px`@`9q j RP5d:,Bu@uWV5`:,h!OWV5`:,h!hT5d:,=th#hgE$zXh,ZR`e[^_]UWVS] }ths4P_ v jh !j sEP@ vjh4!jiKj PsGƉ׃ 8t shf!8"u8;sh~!ryh!gj Ps  8t s h!;8"u!@u h!jvuĉ}ȉM̉UЍ$Vhyd5d:, @u35`:,h!jdVh!XZe[^_]UWVSlj֋ 1҉`+tUPQMZYtUBMQh jjhh`6,`+s 5`:,&d:,@u5`:,h<#j`:,`6,VWS5d:,e[^_]U05`:,h!jUSS}tJE Xh0"SZYth}!SZYuEEPhwd5d:,K @uE ]UQ}tEPhd@5d:, @uE O5`:,h!:XZUS :,:,t :,1Ӊȉ[]UWVSSEӋ}a,ua,Eu'B%rBB?B)B%rBB?BBHu  3u9tPk?Ћ] ;Z[^_]1a,x@uUVSӉ΋ _, _,115_,~ B? ыE[^]U_,?_,jh>RPu `,=w`, `,UWVS5_,Ctt* t%Pσaw<w u;w]KAfw"k 1i 19u5 ,{$1TtDQt!@ u 9t1 [^_]UMU 9|]UWVSƉ׉M_,_,ÉEE1RPWVE)Ɖ1UQhMD%`XZ}Ut_,H9u_,H9u u9wBRWh!* e[^_]U塸a+=_,tvPh!5 `,5`,5`,5`,5`,h! 5_,5_,5_,5_,5`,h!5:,h ! Ph!h"!s`,`,5a+5 `,5`,QRP5`,hB!N,h!Ss_,_,5_,5_,QRP5`,h! 5_,5_,h! UWVSQƉL jEPVv >u#ËE8u 8"u w܉1e[^_]USP $2"Ph2"Ph2"Ph2"PShQ!h0,0,j UWVSEM a+9uh!5a+ h!jMыEEUMj؉EE܉]]#]؋]#]SPWBuAtTa+a+=PuR" 1P5>,R 9a+uN#u5>,}e[^_]UWVSEUϋE E컌 !tp7!EUuESh!脩XZU&ff=Ut1=_,t fuuSh5!A?ff=u+2…hi! ?fLJ_J1f=U=:,u Sh!>Y^:,tSh!>XZ1bEj(VPq ۋUx.pōH 2`,tLfLJᵃЍe[^_]UWVS9:,u:,5:,1Xƃa,e[^_]UWVS@}EỦMЋEGWEĉUȋG WEUE!EEtEL(!11}=a+E_,_,UEEEEM]ЋERPSQ2PE܋UEUuuRPRPuűE܋UEUuuRPRPE܋UEUuuRPRPuh!,"uuuuuuuh* !f h,jdhc,< u hJ !jEc,hA"hc,kY[c,Uc,< <$u z Ћ ,DQu<-5j EPhc,;Ɖ׋EEhx&PEԃEPhN !ut tuh/"u] t L =a+Ήʋ5_,11WVRPsƉuhQ !u ug _,ω%_,Ɖω uEt5_,1Et _,1Et _,1)Et _,1)׋EEԉE]hA"SiYZÉ]; t,hc,Zƀc,uhc,hU !w  9uE| ;uĉE}.uuuuWVhs !C ű}u}e[^_]USE Pu3h ! ,H, yh,Y,P,؃ t7@t( ,y h,Z㡀,P,hJ !j1Y]UWVSEM a+u h !ja+u֋EEUu؉E䙉E܉UE#EƋE#EjPVQBu @ua+a+uhuP  lR5>,PN 9a+uTjWV5a+Bu@t>,C#EйNju5a+R5a+ 9a+ue[^_]UWVSRá:,u ƀA Mz΍:, S}8PRD :, e[^_]UWVSEu} u1Ӏ _,1ۉ)ډEUE;:,E:, !u}u}E9:,:,E !=_,t Es:,Kf9]t 5:,tʅu+_,9UE}1;ME}t%}t}u Ɔ낸 !!![^_]UWVS EӋEEh:,@Ph:,E =:,t h)!!j1EG9E|E9}|础:,] +} WRPv:,ڹ1󫡀:,<fLJU }u> _,5:,΋E)M艊CKSCsV{KSC CHSe:,Ee[^_]UWVSEUE E M] M]9 `, `, `,19EtTtK}E9ϋU}29}} }!!!=_,}@uE2`,]Ã}!ډ˃|:, :,t#=_,2}X:,| }Bhj :,[^u hA!jfǀUE죘:,EU :,:,EU:,:,:,t_}t E:,Hu:,=_,h!!Y4!!z6`,=:,d;:,X:,EU EUEUKx[ 5:,t;EU |9EE}=_,}t뢃}:,E 9:,u ;]:,H:,1+]9~ Fu%ud PPR躟 :, H_,1RPEU :,+E:,XZr!!9!!2L!!+!!$EU :,:,EU:,:,1҉Ѝe[^_]UWVSË@S t15`,= `,9u9th>"!2Ysǹ󥉍1󫍍u0S ! St4"!Qhm"!跛XZߋe[^_]Ã=_,u x t1UWVS|Éס`,tPYj/S^ZuS5a+h$h`,b S`,Y`,u hA!j_jPhXZy5`,h<#^XxPSZY@tϋuи 9E} 5`,h"!5`,h"!0Y^Xh h>,S袾 9t5`,h<#nf=@,Ut 5`,h"!S苿ZStXtjIe[^_]UWVSÃ=>,u1Ҹ];#>,f=a,u1f=@,I؁=>,t#>, `,>,󤡜@,fa,fb,Uta,1b,u[^_]UWVS áa,fE_,_,`, `,11t#f}u&a,t9r $uɡ:,E :,19E~+f:uzti 9t@Ћ _,t_,uf}u=a,! 9'=_,t u)h"!~.Y >,uh"!h %XZ=>,t_f=@,uq@,!9`,=_,tPh"!!.Y_Ph2#!_Zt >, =>,uL];#t2$1d>,trq@,!9tSP5`,h#!-=_,t1f=a,u3 q@,5`,h#!ZYua, D$te[^_]UWVS(ÉEU EUE؉u=_,E$!e[^_]^11ɉt<u ȉh'jhh!Po&tPQRh!$! fu1k t Ph2"h0$!WVh2"hE$! =a+RPSQiPhb$!$Y[=_,u" _,9u1ۉ)11ɉ:j-j)XZttAM]EĉUȋEUM];EĉE|F1EUȋN1G묡:,:,)9E}|h&!`M]y;u 1ɉ uT1a,a,FuE;`,E `,|/=_,u&h'!rT^E@(u}=_,}uEEjhjjjщ¸'!_E _,u,EEEEEE}t#:,:,EU:,:,`, `,EU11ҹuuRPQUM$EĉU+EU;E}EE}]u)։]u}tc:,E:,E}9}}9}t&>t!9Eċ}}e;E}}EUE븹 `,19]t0t'19Eċ}ȃ;E}}EUCu(N1ڋN19Eċ}}EċUȉEUEU+EUȉƉ׉ u h%'!E9ƉE|E Euu}_,_,1RPuuߦu 9u ۃ}u ;]uWVjjPUM2#&EUEPuhD'!hM'!h,jdhc,/ u hJ !jhc,[vSHƀc,t'c, t;E|EHPhc,hi'!S uhc,EP脵 EUEĉUȃ}tjuuuuċUEjuuuuċUEn_,t'uu=_,}t Ph<#jYPPY$uN}tjuuuuċUEjuuuuċUEt Ph<#j}uk}E EU U u }̋EEfukE } 1E}t }te}tE} _,1 :,:,;]u1;MtuuEċU_Z :,UׁǾ}`EU}̊EG]ĉ+EG}Ẻx HPP2E̍HPD;}̍_S[^E}t fǀ fu uEPkE }PT 2=_,t h'!YuEft=_,=_,h'!Z`E̊@EċE̊XE%}WЙ=`,w1WVjjjщ¸'!1ҋ5_,N1SQjjjщ¸ (!ƃ(Eă?1ҋ _,1SQjjjщ¸(!eM̉YY? AAEĊYE%QЙ=`,w1WVjjjщ¸)(!ǃ(1ҋ5_,N1SQjjjщ¸9(!ƋEă?1ҋ _,1SQjjjщ¸E(!M̉YY? A(}u E=_,:,tKx :,u19EċuUw}E9:,~: :,EE̋EEUE$E1$E$E1$EEEEEE$E1$EEEE}a,t2a,1҉EĉU;uĉ|a,1EU9Ɖ}112a,1ҋI19M}39EE$M]11Ee[^_]UVSá_,u hS(!~KX1ۃ=_,u Sh UY^jjڸ `,CXZu҃=_,u=:,thd(!1KX1P=:,h(!u Sh(!Y^ :,RP1҉jXZ=_,tC_,9:,=_,A=_,~h(!^5:,j5:,5:,RPwf=a,th(!\J^h(!:[a,t=hNU"&a,Y=uh(!"k Ph(!XZ h";!Xh`%IX=_,nPh(!Y[=_,a,PPh)! j=_,t>u Sh8)!XZ9:,} hQ)!IX;/ :,RP1҉u Sh[)!EY^jjڸ `,XZe[^]UWVS ˋDž ! t Dž4"!@uhj)!!XZߍDžjh)!S! t 1/9Cu苅9Cus Pj ;Cuă=_,t.{ t(s$s sh)!e[^_]UVSPEa+;a+u*=_,u!URhmdP y h"/^ `,119@uh)!B=>,u111H>,~ ف>,@uh)![E:,01C;:,}. :,:,:,@uSh)!ZYEa+;a+u*=_,u!URhmdP y h"JXe[^]ËU]Ph@!h0,j>UWVS|E|xhd,wShA!h0,^jSY EZuhA!(|ƉjRPu39u9th.A!& jSuu諢 9t"|th9A!hfA! XjEEfU}EEEEPЃ<]1E ÉEE|ƉuR~EEE_}t V PSE4>!hqA!Ed,fEEE@d,@d,19E~WtL9u.;u&}3PaRd,4>!hA!tuu u@뤃1\3 9vR@E9E~Wt}9rϋU9sэPaRd,4>!hA!h }9sf}fE@fd,}}tGaPE4>!h,B! } t}t}u$EEfEEEfEEd,uEE;EE@ƒt<u+ExمuuEEZEE;Euuj XE4>!hB!OY[끋Ee[^_] ,yUh,j XZá,P, UEU 19s f3P]UERPZYUSBHBy;B| X RQ XZ]UWVSQ]u uhC!SaF fw4`@!h!PhC!S: FPjhC!S&FPjhD!S Shu&肈XZFXt ShD!oY_FXt ShD!\XZFXt Sh!D!IY_Sj v(h*D!Sv,htCpStC`Sd CHC@h茹 _u jjH@1󫋃@ƒ<ftf<%GXf<%GdytDtSP1G4Y^tT$1RPiƒXZDžDžtpxpx t WV;Y^Ɖ׉ t19sB‹@@dT Xj袷 Ɖ_P職 _Pf FYBHqQjPjjRt Ph !>XZ@ fGt~O@@~J@Ht G G$GC8S 5F t)C8S< p)C$F FFFF F <@4PG^jjXjjS(Nj@tK KS1P1ZYƒ<f%Tf-fGHdAf@jtK K11Ҋ t1ҋAQ jhWfBjtffFBdp pXZ1ɉƍ19vG@dtA uى=v4ts sG@d1ƋD tC CRjPjjW@ DžM!Dž1p/_<҃| ;vhZ!5 f,h!E Ft)P$t8tGpBu Ej,a+Xe[^_]ÍL$qUQ j,j,5j,5a+$!EM MuQQ$RPh!薚MɍaUS]CtS P S tSPSCr s S ZSL j,X]USEPsH) j,j, xj,H1҅u0j,Z[9t j,uj,u h !j[qX4CXtYZ@]UWVSu EEE#a+j,j, j,M11ɅtJA9~ʳ9M}#tj,h, !hHT!hh; !1}9x4u }9x(u9p$t버tj,e[^_]UWVS]uuu SO trNj@th] !h@T!h1GGWX9w&~6Gthu !h@T!hh; !蒹wVw mG [^WYxj,a+;j,V=j,tGWuj,P=j,t+GWuj,WGtG4WPZWXj,j@jlVjlG _4E UG$W(G,W0wE #a+G8j,tz8GC GtWP { _ Ge[^_]USEM Puh !h8T!h4h; !YP ʉPHPPP s E]XPs4H j,j,xj,@ j,Hj,0@t j,Hj, j,Hj,P4JH8j,9t!tXYX tAP]UWVS Mu }uWVQa‹EZMt j,1ZUj,EEEPWVQQ EMUJ,B0xB BB4RPX r J1؍e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMq=a+Y,A0Éa,ڋyY I4 s RPWSQpU! RPWSQtU!e[^_]US]C%CSjSN1]UE UMQ1]UjhUU Pj,PYtHJ j,@ j,UWVS] j,C0tS4P4S4C(tS,P,S,s$tBFtV P V V VY^׋FtV P V VVXZs uًCpd C ${s ]e[^_]ܞ UWVS]E EEEEj,Etp9XH0udxu9w,uDu9w(uPFPZY9뗁~atuuhl !tF 9t/ Fp9t(1SQ1RPuuh !F(V,F V$;EUruPuuh !uuh ! }t2tF(V,F V$9Uu9EtPuh ! EUjuuuuVSǃujuY[}t%tF(F Puuh" !1h9 !hT!hht !LEEE1ҊM t1EUEUĉEԉU؊$EtẺU\EEЋEU+EUЉEUIu r1ҊM t1҉EUEU+EUuuRP.uuuu-9uOE1ҊM t1҉EUEUă+EUEUuuRP-9t"}tFVEԉUF EE }tFFuԋ}؉u} u}uEuEԋU؉EUEjuXZE9EEEEE Et EUEUEUeY[^_]UWVS ] }t$bƉ׋EVWVRPh@ !EbuE‰9u+ztE։9u 9u Tv9sE]Ã}thQ !zh,FZYtCpStCHuRPuuEU}t hz !KXEEt};{tua};{p`dKH9}u@9Mu;}Et `d)RPh !z,6EtM}`d)RPh !r tCpStCH9Uu9Et]1ۉ؍e[^_]UWVS u }^j8jME@EMA A A A A$Y[}thjbMËE쉃PXZ u =a+ƉEE} t h !Xa+EPjh WVuhjLËEp E쉃PEP P jP^_ts s@5a+} tURjh  t1WVu$hj;LEEp }E}쉸PEP P jP}ZYutCHSLC419|} tMh* !ZX@E?t} t#h_ !;Xu uuS9u u X S X]tS X1zSt ǃ ǃL7tX\+1tǃ`dǃt}uWjbJƉ_tCtPE@ uuSh`!+b ]BD1H)EC뽉tpE@ EDžta+ttHt_kh1ҍ 9E~ىlE0u4xux[$9^$wBʋx0u4h)ly1ҋE9UE@lDžxDž|Džtht9l~Mux|N$^(uv4ht Ɖ\ @ptx|BS]D@Ht!@uNtAA EHllSE@ $Et_pwtwHi t1ۉZ,r0Bx}t !! 8l+h U!h`!ja7ÃpkTtDpt RP\Y[Bf]p]ptSQp[XEЃ_tuuYYEUEUDpTtM]19N ;EErEPdEx4X]G\)Ɖxx%x\9wxxXE@4t"p]uuF4GpWtEU UUuF4GHEEEXCEEPEPEPuuSWtuuPh U!h`!jq5UM9}#ƉЉʉ t1҉EUhxhtEtuEp h[ !hT!hL(șșE@d]S1Ҋh t1҉Ëp*Mpt)ىRPuEtȉD(UEvh% !hT!h h6 !}ƃtt%RP,Y^DXpt pșBu3u.ډnutSQ[^]Evh% !hT!h"SЃt0tuuYYEUEUEtȉDXHpURjPpT5ht5t5Shtr2h U!h`!j2T5E@ t ЋRBu:u5E@utRPUY[pLEP t]uʉtu4P4PRZ!)ӉM] ‰Ju 1 t1VSuu+ pE ;EErE@duVtFHÉE1URjS1SQVOt0Pp`Dždd`hZ![‹MnJY u N#u E1kӋ+tA r:s uC <uA4QPX#E@ le[^_]UWVS$}FHnEtO`_dO@<)ӉM]% Iu gÉ1 t1RPuu; 1JURju1RPVƃtO`_dO@)ӉM]xsIu V1 t1RPuu 1RPhZ!guHV UtO`_d G@EU‰eE؉rEЉ)E+M]M]ЊM1ҊM t1RPuu]K!]~tO`_d G@`EUQ‰EԉE+M]M]1ҊM t1RPuui1uk]CC EC <EtO`_dO@)ӉM؉]܉‰Ju &1 t1RPuuU]F4VPBHIMQjPjjR%t Ph !S[^EEp H]VB}Vt4G8WuЃuűuF <u v0E@4uPu|EE pEHEXZEE}t=1ɋ9H~@ UE|P¯AAMX뽉Ez,z,Iu"ha!hT!hXh6 !jt5G0W4G(W,G 3G(W,PTPTG W$pGE @0E @BBEPuK G>PGP1^ZuS 5‰E1 t1҉Ɖ׉1 t1Yt)C8S<)C$}u ha!j E p}9}tpE MAP9y4uz,z, y(x{, {, {,{,A%AQwE@{,{,EY눋Ez,SZ} 1e[^_]UWVS4E@(E؃} G,uEE xEE xE} 9G(rG,}t/wu u^_EtEPt@pE؉UvыE@HEE܋EtƋE%1 t1EEDE }P} _swQu؋}܉ t1WVR藭‰E PBB1ɋE:9vHEEЉÃB tǀǀ@A묋E @ EƋE<1 t1E$EЋEt)p@xD)p,EI] )C(}Ƀ)K,{ E€}\EfƋE @$1)ߋE؀}t U܉WEEz,z,EUE@(EЃ} G,u0E@(EċE@,EEEЉEă EudE@ tčEPPPugE @t9}t@ ljE]KdQ1E X]C ÈEЃeЀEE @$EȋEFƋE1UЋEЋ}t@ ljER}OdQEăM uEE1UŰE P}tZCr{<uxj,Cj,j,C@CC sha!hLU!hChia!djS8Y[E P EE؉ÀtfBfB@tfBfBE @$E؍PE P$E+1u E @EP,@(E؉U܋E؃ E܋Eu\tPL@HEЉU @4EEԋEPUr,z0 t1EtpHxLp4z,[AM̃HEVEЋE1RPuuƉ׋E1׋EۋMtURju1RPQtPuh ! EEЃE̋]E1ɀ}t&QPuuS ‹rzuЉ}FEvs vQRuukQRuu{k BEEԋEMq,y0 t1}trzrC4SPZ1ۋE EE]Ћu)։]ЉuԋE‹EJu ELEW1 t1WVuuljEЋECHEEƉ1ƋEURjQ1RPSAtP1RWhZ!kEƋME|Nq u P#U E1kEẼ<ۃ、)؉u؃1ۋ} uq r]:z ur E<}}Љ4A4QPX؍e[^_]UWVS(]EE @EEZED1EԋE<E9C,rE;C(~tSCxSuSE z$KqN(v,Jtr K tQQBtfQfQ<)C,E @} GCPS8EEEE}9}CEHM}tu}M} U؋MW$O(ỦMЀ}uT>9Ewha!hh<uWV/(h=uWVh=uWVW  t%<<ۃӉ_މw4.<҃W,}tWWJEtfPfPe[^_]UWVS] t@ U f P8jǃ jDƉ<WFZYuWha!1=@j,PE fF8FF<S^X1e[^_]UWVS5z,1ۅtb~ uTF%}uu@u<~G!u~$t*O( O,tVu u( Wu u C v(뚉؍e[^_]UWVSuE UEU z,z,IutFPt `dV诗Z1;]E|hb!hT!hhia!ZPh EU t1RPP¹x @ Ue[^_]0UWVSu {;{tp‰1 t1t)FpVt)FH?W2G"GG$Gw4WXGGjW褠 h#b!58Ys/C S)C dždž4XZtRPV" tRPV dž u h?b!j)H e[^_]UWVSP]E PSjVS'jVSV tBBtfBfB:AEy$utCHSLC419| QVS: uVSVShNJ:uS1e[^_]t@P@0UWVS}w0GEE P]芎]ttMRPY[M]C S$ tȋ]CE @}ttȋUBDtȋUB~VE@H}tFFEO(_,}tFh1RPSQӀ}tF|1Ӏ}tURju1RPutPw(h ! EE@ EG(W,]t1SQRP.~NhvSQRPkSQRPk EU ] K}tPH P U R}tPPE@4uP:XEuOGE / EP]芎]ttMRP Y[M]C(S, tȋUBE@UttȋUB@ tȋUBG@WDE tiEPރ]ttMRP脺Y[MA0Q4 tȉA E@}t tȉAH tȉA$EtEuG0OG suG0Oge[^_]UWVSu]tV XuVhPb!j `DžPhd@u !: usRhedAu ƃ u *8tuhgb!_X$B<CB(CB,C B0CB4CJ8KCB@C BBC$BDC({hݎ$述ƹ ߋShb!V=CPhb!V? C Phb!V?CPhb!V?CPhb!V{?$tPq^}=uhzd@u a @RhedAu C @uuhb!j 41}󫍅Pu跞ZY@4ȋ9|"9t8Ћ}LJLJ(Eǀǀ [Eƀ*Pj PEP1e[^_]UWVS,}jhPjW8tGjPjVWVu$U ʋMQ؍e[^_]UE ǀoǀo1]Ê u@ t utUWVSSÉ։WhV)^ tX1҉jh"PE Muʊt< tA1҉ESp&$SURc ue[^_]UWVSSÉ׉WhS] t?1҉7< u<#tS &Y9t3PH u ttEVh<#]XZE1e[^_]UWVS0Ef!UMúhH!P1XZuRhf!VhW\ uRhg!j\V9PPPPPPhAg!W6 u DžthSg!\V4[^tNg!URt VYPy$ZvjWhg!ƅM oP/ YuVZ #E o1ҋЉt B߸)Љ1Ɂ11€tjhhg!ZVGGG GGPhw1"VU% Hu GGV+XE ;ot$PWhh!&Z ؍e[^_]UWVS 1} hH!u.ZYuuhWh!Y_X]ڸxv!^t uhqh!h!WVPh$S3tWVh$S3t hh!} G1} Ƅa2=u] &Yu\E ao1ɋ?u61ҍjh"Pn tj2WS2 9u\E ]hh4i!PTE ƀa0w!;tWuh9i!5X 1ɋu׍PSh{i!Vo2uS Z;v1Phhi!WE aPWhi!W?AE ƀa} a9tRPShi!WE ƀa[v!KXu E Juhj!6VhV uVShj!W Ph!j2PWC2 E 9~1ɋVtShBj!Zv!_E ZtC@fVhP^ uVShk!xV j2PWRC2 E 9X~$1ɋtShj!2BZڸv!^t uh`k!1ɋgthk!xE ]PPPPhk!S-0M \\\\\]t hk!kU[jE ]@c!tH8tp u Pà ^Yy/Rhl!UXZÉ؍e[^_]UWVS]CjP,- ^_1uh c!h,l!踾Y[ F9~?{jW, YZu Vh c!hIl!:19~DBhH!u 9)XZuu h c!hil!B zl!WW_t uƄshl!hP:$shl!hP!$ %Rh$RWX …uƋ{{9VhQS u WRhl!CPPPPh$Q-BtWRh-m!S ; ȋC AEV [6V X19s~4N/ FY?/ ZDže[^_]USRÍEPjhjjj jS(U tShLn!Rj:]UScPh\n!h0,&Shn!h0,&Shn!h0,&$Shn!h0,l&Sho!h0,\&Sh2o!h0,L&$ShUo!h0,9&Shvo!h0,)&Sho!h0,&$Sho!h0,&Sho!h0,%Sho!h0,%$Sh p!h0,%Sh:p!h0,%ShQp!h0,%$Shhp!h0,%Shp!h0,%Shp!h0,%$Shp!h0,m%Shp!h0,]%Shp!h0,M%$Shq!h0,:%Sh*q!h0,*%jUSRhPj u Sh<#j]Uuu u  @uuhAq!jUWVS(`؟ԟhSq!Rh*rPEܟП119П~7̟hW؟  ̟u ԟ0F`ܟv1ܟܟ9}J̟hW؟  ̟u ПԟEܟF`벅u؟hfq!jee[^_]UWVSlj։EEjhk$Q\ t(jhq!SH tjh!S4 u Ejhq!S uEjh0"S t}~Ehq!EPhrWhq!EPhrW ={,t=q!}uq!PVhq! }uE4f!Vhq! e[^_]UWVSÉ֍hPdzb1l󫋅dhx|hq!lPhrSVhr!,|xh,r! 0tplhcr!q!tq!RPhr!hr!DRPhr!0Phs!nXZq!4uq!Ph%s!N84f!h8s!4,G$=,uuu V`ǃfO=t{,WTNjEWVPhx!h,Z{t{,twVPh!h,11Uuu Vh!h0,5EaVPh9!h0,ECVPhV!U e[^_]UWVS=p{,th,hq!*^_1;5H{,L{,sxWVY[uۀxtVT{, s؋X tf{u0=t{,tS"Ph!h,4SYSXZ[5,t[^ tO{uDf{t h!SUY_=t{,tSPh!h,S?YS/XZ[뭋v$롍e[^_]UWVS=p{,th,h!^_,1,t#{ t{$C$SCXSFY[مuȋ,th!SGU[$XZe[^_]UWVSPp{,=`{,Rut6h,h!舣#th,h!s^_5\{,uY[jjQƉס\{,EXZH{,9,,L{,WVNQƉXZ,,9ƉsIWVYXuWVh3!]S SMPhC!h0,_fcWVPƉ׃9u9tRPWVhZ!h0,/CRWVOXZu h{!RYCu h!SSXZCt S`WfcXSPCfcY[\{,;EPusCe[^_]UWVS=p{,th,h!Y[f,j,.C jjPEUH{,L{,RP3PEU5,5,OƉXZuuOEUuuOEUE9EEEZE;,E,sff,j+Bq [E;,E,rj9\{,u1B95,,rBB1 \{,S9u\{,9(,,9։sQWV|XYuUh!h0,,tP4Y#h b+SEZu hO!>FXe[^_]á, ,uU塤,%=@u6, ,u]UWVSu^ ~u:hS6褫F #=t{,h0,hn!P[^F;F| FSft)9~=t{,tnRh!h0, YF;uChw%PƠZYt:;=H{,L{,r'=t{,4Wh!h0,5 1ۉ؍e[^_]UWVS]u }EuEu }]e[^_]jWVSЃjShu$hVV^NjP ѡ,5,_ƃt$@h`%P軟ZYu5,7YSh͋!h0,< t$Fh!P耟YZu5,ZSh!h0, ,Ƅ=FVvhPSh!h0,:hPSs1RPSmH ,p5,Mơ,8Xae[^_]UWVSuS_X8/u @1Ҿ1hw%PXZۋtm;thgu1WP ѡ,S^5,Yt@9uVSBP uȋ2lЍe[^_]UVSuIAY1ۉ tÅtnƋS 4؍e[^]US]3X]]B UWVST=p{,th,h;!m[^`{,hhuEƃ yBuh!h0,Ah0,至0 Ph!h0, 1S ѡ,,0Nj[Yځ~RQWn @u55,5,5,h΍!h0,!0Z Ph!J=d{,uURQV֡ @uG5,5,5,h΍!h0,F0 Ph#!h0,*$j%WأVңXZe[^_]UEU ]U=@b+#tjjh@b+lh@b+=@f+#tjjh@f+Hh@f+UWVSƉ׉ˉ t;5H{,L{,rWVh!G< ,RPWV Ġ,s{ S$=t{,t [$t9{ u9suh!S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh,!P<XZUWVu} 1 tC;5H{,L{,s.,RPWVQĠ,t;x u;pt@$e^_]UWVu} t;5H{,L{,rWVhM!*; ,RPWVĠ,t&H$9x u9pu@@ P$WVhj!: e^_]UWVSujj[_Åt>NJ/t tF@PW3ZYt [u1 Ft[ 밉؍e[^_]UVSSj/PX^Zu1,SeY/txtESh!:XZEe[^]UVSu,F,9v%)P6SU~jj$9tC/vKSh!9XZ؍e[^]UWVS}u h!9[uYƉ<,uE50{, Zu h!d9X)0{, ,9w ,,,uS&؍e[^_]UWVSu=,uF50{, Xu h׎!8X0{,Lء,19w C$؃(t,,C$, 1ECCDžuPE  EujjY_t Vh!l8XZVV_C[ٸ1Xj/VM^Z@PPC{G C_ Y^Et5uu RZYƅu h!7_E UCS FC^1E E t)uu ZYt h-!7XًE U6؍e[^_]US]SZ,,]UWVS]f{t h>!S~8Y^{u&{t hQ!Se8XZ{ t hn!SR8^_s{ t]WVkZYuh!S,8Y^49uWVKXZt-x"t‹@9uCB h!S7XZ3,C$,e[^_]UWVS]} >ƅu h!S7XZ9stsF C^ j/WsZYx3WƉWC$q8VP襑fCu fCe[^_]UWVSd=p{,th,h!臅_Xd{,E2hB!uVY^u,t0 Ph!h0,uh֏!5fc EEE9H{,L{,ErFuu^Zƅt)GE~SFPj61v}ӃEU1EEE9H{,L{,EuuGZYDžttj$GPEPXyuGƋG@EG t@EGt@EG t@EċG$t@ESjj(EPv눃EUUĠ,Mt@ESjjEP>E ,;M̋E E̡H{,L{,EUMԉuС@{,D{,E؉Uܡ8{,<{,EUX{,ESjj(EPءC @t,0 Ph!h0,uh!3SXe[^_]UWVS}=p{,th,h=!XZuXjj5L{,5H{,h,jPQ Ġ,[^u hW!>3Yjjjh`%fHjjWƃ y*0 Ph!h0, Whr!2xPV*[Zy*z0 Ph!h0,Wh!2EЍXjS LZYu h!2YSLV8 y,0P Ph!h0,lWh!F2j(PPV xV `{,Zltɋ~2KSCX?h0,h!p_X*e[^_]UWVSRơ,, ,9| =X{,1P,h P9~ DBu=, 1ۡ,؃=,t WP*YXWP5Xj+蒅ƒ =,u;X{,9,}.~*=t{,tUh,h!*oXZUX{,, ,ut ~^X{, 9t)ׅN]>t#=p{,tPRUh!h,7U ,]Ӆh0,h!n,ZYftCftfHth0,h! h0,h!Pn[_85,h'!h0, 5,5,h5!h0,=l{,uh!Yuj$X{, 1=,=,t1jS*_Zy>ݾ0 PhN!h0,2jjؙRS5Xj+"Bu@t…]=p{,th,hg!hmZY=,u&\{,@\{,,PXNtX{, PSh! hh,,Sa ,h5,Vaܥ,إ, e[^_]UWVSÃ=x{,FC=TtP=ltIʁlt=Tt1$=,u$=p{,th,h!Zl^_,pt=,3ȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRP;L_ZChs,s(+LY^C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉC=t{,t5ܥ,5,hx!h,ϻ5,h!XZ={,t {,V,!,t19@|,~ҍCe[^_]Uf,h=h=h= á{,ttU{,tt]UWVSx],f,,,EU ,M5,=,u}5,u=,}=,} }tEUMEEEE,Eċ=,EEu,E,E,E,EE%=`w= =@tp===t+=uShĚ!h0,=p{,tShߚ!h,۹ jX=b+t SYt@tSh! XZ̓=p{,tSh !h,茹 5,5,Sƃ ,|,|hhh =|,u%=p{,Sh!h, ={,tSXjSh, ƃ pE Et EPS+YXEPSs+uuS~uuSu~jW|Sj9= {,tuuuuh&SuSiuXZ=p{,tShF!h,@ 5d{,W={,tS)XE%`|,RP| PS0y0 PSh_!uuSvuS,vuN,h=hh= jWVSj1 E Et EPS)Y^EPS)XZ= {,"%|`t;"uuuuP=p{,tSh!h, 5d{,2={,tSXhSXsZYyx0 PSh! uuSuuS%uuG,h=hh=jWVSj* E Et EPS(Y^EPS(XZ= {,tuuuuh4i!SuSt_X=p{,tSh !h, ={,tS^5d{,uFhhSo, y*g0 PSh!h0,軵MA=h{,th ,,PYuu5,su5,!shhh ~jWVS5,=h{,u=d{,tNEPh ,,P S.ƃ tVURP,0h̛!h,vӋE EtEP5,rXZEP5,r^_= {,tuuuuhQ Su5,MrZY5,@oX1e[^_]UVS E{,EEEf,={,t={,Tt h,![hA!Y=,uh,%Z4,EP ËEXE8t185,hڛ!Y^Uv"6E-EF@|,9ӋU9uu{,0HtW5,h!MXZ݃={,u:@|, EEUPE0+ M]ËUEЉEY^BH{,L{, uEH{,L{,$M u9t5,h!XZ,e[^]US|=p{,th,h!V[X=,tjjh, #=,t Xj+Ejjh,GlXj+ =Xj+y&ܦ0 Ph,h&h0,,\{,LX{,B,, |{, ,9~ D@, =,t RQZYRQ5Xj+Zk 90r Ph>!Yt!hhS!Phx!h0,rj X{,,=p{,tPh!h,E {,uF , ܥ, إ,x{,{,uh0,h!vh0,hȜ!kT[X=,tB=x{,%Sk,,11,=uI)У,=p{,u =`{,tu(,,,@{,D{, ,$,8{,<{,EPh`%ZYy#ۤ0 Ph!h0,0jӦE荐w\j+\j+PtPh!h0,j蚦={,t h0,h!R{,u,=t{,t5ܥ,h!h,误 h7!X={,th0,hU!Rj'P{,T{,=,uT{,]UE Puh0,  UVS]u =d{,u0VSHkZYy#訣0 PVSh!h0,=p{,tVSh!h,ܮe[^]UVSud{,u8jjhVy"90r PVh!h0,荮!=p{,tVh!h,j ؍e[^]UWVQM1y;5H{,L{,s!WVjZYt xt@uωeY^_]UWVQM1y9s!WVZYt xt@uωeY^_]US]h!h ,蛣 ,XZCth!h ,sYXC th!h ,sXZCth!h ,sYXCth!h ,sXZCth!h ,sYXC@th!h ,sXZ!,]UWVSQMS輽Zt$1tH T{,r11Sh%!h0,Ƭ eY[^_]USuhh!Dh,^_Y[1ۍ>1ʍuEfEEE'E0VhQ`5`,} @u h!jjE<u 5@,h!<u5@,h0!h0,r ~<tP5@,hC!h0,S_Pu󥀽_y-`9 !CShd!Ah,[^ j !RZ<hl!Xe[^_]UWVSEu h” Zu h!jViù1󪍕 1;}T jQh !| u jQh!| uGu;}OZYuE]Vhv!>ZYuEFVh$=ZYuE/jEPV蟴 U:u=v3h!j cEG|EEjh0uhuj EP5`,TET=vhP5@,h!)E1;ut^FE \ˉɉʉMЉىf1 ω} EЉEuu5@,h!車띋EEe[^_]駕 UWVSEEu EBU܉EPL XۋUu hǭ!ja1ߋMEfEfS1j EP6# U:t6h!jaTTdDG9}ujh0uuSjEP5`,]e[^_]Ŕ USUBBPJ R Ph!茉 uE!]Shƨ!iXZ]UWVSE}EEU`!stE8uE8Ct;uڀ}@tSVh!蜆 S C h#VhX!zC t Phk!dXZhpPjSmƃt Ph!:_Xj RY}i;} }0<;t'Vh!XZujhŰ!YXGtVhŰ!ՅXZ>);U }Q~MuRlhŰ!襅ZY1ɋlhlPh#者hAlBXXh!vXe[^_]UWVS] }uh̰!B^X1C9~D3Ph!&FZYj ;X}CYE (]e[^_]UWVS`u U1Ev]׉EEEEEEEE EE0ShQ`u]o @u h!j:\EtU@,<uRh! <uRh!h0,4 #<u jSRPRh!h0,j}e[^_]UWVSUu]1}EE E EUjh'RujVue[^_]UUMEEE EUjh'RujQuUWVSUu]1} EUjh'Ru jVuXe[^_]UWVSUE]0{u@tK uugtƊ{_v3m tO\0Z0Z0Z\um tf\\M tB@9u[^_]UPh`!h0,Vj{Uh!ȰUWVSÉ֡,P,uhh,XZ,h!h!hWƀhB!W Y_u{h!Ph!j1 6,2" u!h,RPh!肄1X9ډ}Dh,xp $h!P ,tPjh,Fg;9}4ڃw2jPRUA Utj@uVRPoV3h!WGjEPjh,RU UuE Eu1}u+E9Eu#1tj@uVRPoV3h!jGGSEEe[^_]UWVSVUu=L,ˋ H, @,u'`, 4,h,h!jY[=P,u %tDh,jSu3u5k+Ph$n u Ph!nXZ=@,~tj mXڋEe[^_] 1vs9}E8Ph!{nGYXt Vh!gnXZE e[^_]smN@e[^_]US]EjjEPURuuX@u f}t Sh !jwE@, H,tUjYY2=P,u Sh!mXZuuuuuh&!m]UWVS]uEEE U$U`, 4,=T,H@, H,t}jjEPjuVw@tdMt]QMp XtMMMjjEPWuVB@tM;Mt Ww _j,aY}e[^_]w }tuh,hb! = t)tu*Sh! uSh!Sh!Sh!XZe[^_]UVS]E jjEPuVuu@u} t Sh !jCEUEU @, H,tj tXP P,u EPZP5k+ShP&k&IuRPh3#k uRPh+!ke[^]US ]EjjEPURuu@u}t Sh !jB@, H,tUjC=P,u5k+Sh$k =P, h uu轴 t PXuuh8!j ]UWVS(EE̋}uu@=`,t7EjjEPEPh@!yE@Ek(EEE(URU3m XۋUuxU1}H(jjURPVWY@uU1H(M);Mtuh !j`AuߋuE 1C(9~؋0x3{px s{ pxs{pxs{p x$s {$A(뼃}t EHPhk+uhH!juVh@, H,t7j(Y(}tEЋE;E@t]e[^_] t =P,u Vh!hXZw$w wwwww ww7hO!h,똍e[^_]UWVS]EhEpEl}󥃽puBDžtjjtP|Ph@!G|tDž|DžttWj XuCxjjxPVph!@uht9xt Sh !j5?l%EpujjڍE _X=`,t=19|Whk+ShH!jURf jjUEG ŋ=@, =H,t jL=P,u4Sh! gY[%t h}G"fZt4Wh!fG9|j eXue[^_]q e[^_]ÍL$qUSQ A IEjjURURQP@u }t Sh !j=@, H,tUjYd=P,u Sh!+fXZEE1҉E܉Um\$E1҉E܉Um\$E1҉E܉Um$h!eeY[]aUWVS@u]=8,t Dž SXuh!h<#j&=1htc%RH/Y_t}\jPS3ǃ t 9u \8"uSh!8uv Sh!j{< htc%jv 1PSPWuu@u11t =L,1҅¡H, @,tR Z4Pi[$PE7W3o tTH, @,tj X0NP[$PىESn e[^_]UWVStx|h,Zp,$`,ZYl`,+l+p`,u,u|uF1;xt苅t`%u2"RPh %PP1C} t~|Pk+xw2"RPh$PP|P`%xw2"RPh %PP Dž|l+|l+Ã=T,=P,th`,h!5bXZh`,h,h!b EPw#wd!Ph!a_X}uC|@0|?hsPh!aY^P|p4h!a |p@h!a|0,XZpu hh2"h,hh !0pt 2"6hh2"h,hh!h,tc%ƀt2hWh,hh!h,tc%s2hWh,qhh(!h,]tc% s2hWh,9hh0!h,%tc% s2hWh,hh:!h,tc% s2hWh,hhB!h,tc% s2hWh,hhL!h,}tc% s2hWh,Yhh!h,Etc%s2hWh,!hhP!h, tc%s2hWh,hhZ!h,tc%s2hWh,hh!%h,tc%t7VhpJ"j V]hWh,ghVh,W(h,|h%Pha!^|@H t Phr!o^_X|p(h|!Z^j t] }N=X,=`,u }y|xXDž1DžtxThj`SPPWt @hu\t|@9uߋ|@(9uΉdQh.` ^dtNjh󤋅|@XPwPh Y|XX=`,uE t|@XhHw9=P,uh,h!\XZ|@XPvh!P¼X}|hs E UEÃ}tm@uj-l Ph,h!jUs u|xtjh`,h,Ћlƀ`,pƀ, |x@u^jjPjxt @u<`, 4,=T,h,h!|@@EH|$`!|xt|@8d uq=X,;t.s j|xtjh`,h,S `, 4,=T,h,h!Ztx`=X,X|@4h`U] _jjPRhx@Pt@hu!R:e ^KQ8 ]똋|u Re YЉ\|@4XDžhh9Xtkh`|X89\vV9Ct FHt F9C(u:Nu*PQTW\ ZPtރ NjTCXhw4,d1|9p4<C`s`, 4,t%xWuujPًt$F`jjPQxt@jj+jjPQxt@YjjDžjjVSxt@uIO8 u3[ XjjVSxtC@u jٺ,|^_9Sb [DžjjPQxt@tejj,|u@Z Yuh,h!5k+Z KjjPSxtc@u jڸ,Sa XZlƀ`,pƀ,e[^_]UWVSÉLH4,j=PgY^ƅPt9sx?u @ƅPGh/"S ^Z°.tk+k+8 8C tG=sjhm#VSA T C<=t:k+  4=D,u h! 41Dž8Džh DžtDžpƅYDžDžj,VBY[DžtGDžLDžPDžHDž<1ۅ\j=W[ZÅu Džl@llhA"W;ZYDtj,SZYDt @Dh+%WZYLLjlPS}jPW Bu@uf>8"u \>0V9t8t Wht!t_Hwj"=V PWh& DžN ZDž[ZDžU11PVPRDP7@u$Pu 1xB=8utRt+jj,%jj?jj[,jjZjjM,jj,WZ<^@TC@t9TvWh!MY[PG Zuh,h!*ji>TWPVDP@u%Pu 1H <8uVO Xqj,jT,tVpO :HLjjًDxH_=e[^_]UE u@ t]US1]  t=U}tuZv!Zw t Yw 9u@뻃[]US]y,,,j`48X=,t=,t 诵jS<Uu uJ ZYujhD"rjvUVSuVA:$@PVP;؍e[^]U,E]UVSh"T^tu5h,8tjtSvZYuFp6j jRSsFS9$P1FSh$Ph,5h,F h "uV;SV V_Te[^]USBtP4=,uS"Z]UVSÉu=,u VSNZYe[^]UWVS׉΋]Uu E E!UuU$t2"[^_]USt01!1=,uSZ]U=,thj5, hj5,} UWVSÉ֊;uuY,MtI,h]5,S|}=,,h]5,V[}9=,؍e[^_]UWVS,E9,^$,]S5$-Y^=,u, ,Sh Z=X=&wAKw2iff\5[nRff\5D=,w$==!ff\5=Xff\5=KwJ=w$==` ff\5 =%ff\5 ===ff\5wff\5lff\5aff\5Vff\5Kff\5@ff\5 5ff\5 *ff\5 ff\5ff\5 ff\5Eۣ(,Eݣ ,Eܣ,eẼEfEEE, 5$-oSj5$-Q@E,e[^_]USEPhht@j( 1ۅu E]u+h" PZtP,Ya$~,=, ,t,Eh"OZtP觷,X"L~,=, ,P]UPUE@, 1~}BUw$!1(udf@, T%"(" F+"."1"4"ݸ7"ָ:"ϸ="uf@,@,USh%N[uo&,PP荁ZYHt ,@"t ,B脶!0,C",,F",^&,-!, x, ,,, ,,,,,,~ |,Dž@,V$td\54g"t, ,2"*"`t, ,2"=,t>=,u5I"),0{&,=,u ,,2"=,u ,2"t#,t8u,,2"Cu&,=,tt8u,,2"%1"`,t8u,,_R$L".,t8u,2", ,Ph2"h2"h,,e$O"P5,5,h,,&! P5,5,h,,$1$P5,5,h,,$/"z ""*uRFWZPÃ$ !%VF%  V?F % ~? VvF% ~? ~  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=@,tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE ]U:=@,u~ 9sQGK9vGGO@~P^49w'WyY 9vG%OtW[Z1M9e[^_]U幈 {+E]bUm+E]LUE=@,t],]US]uh"h`,Y[wDS@Zt9؃@P0Yu@Sh"S5,j h`,uSYZt S5,؅x>v>v1v$v ƀ`,u`,5J)`,Htڃ?ʀ`,`,`,]Ul+E]UU 1}DuЃ=%" ]UWVSE֋}] IuREPY^+RiEVYZutVx $W8hw"Vh$WP1؍e[^_]UVSƉh"q-Yud PSZtV19~z u2RAF tPh"S6 e[^]Ut ts!Rh,"2 Rh,M2ZYUWVSÉ׋0V$jS‹ )jWe[^_]UWVSSÉ׉΋Eh ,jS‹M)VWe[^_]U,9,~/MU,EPU~SE),ġ, ,,á,= ,UVSEMUEJE } ,w,;,~d, ,E1ۋM,+,9} ,v1ɍUE]́ , ,,E E1E,E),EPU~g1[^]1US{,8t^EUE:U,;,}?U,PAE,Z뼉EUE}U,PX,8u9,v]US, ,tPt,)Êt@+,),t1=, ,u 1= ,[]UVS, ,E1ۋE,+,9~.t*UE ]ЉEUE }EEE8uދE- ,,,EPEw[^]á,8USEUEËU,,9|2H9u ,xuE,E,S蒊X,8t!UEU}PpE,1]1á,8tUSR1]1UVSÉh , Z0 , ,v 79w0H,09s CCA+Q1e[^]UVSP Yuu>t,SjEP_U)U tىEPE1e[^]À= ,t8U,,+,,]ø, , ,,,,,+,,,+UWVS]S ^؉E1;tw]ujEPRƃ 9]vCCPÇY=@,u,,3VZu(VWY_uVZ,,넍e[^_]UVSPE ,h , Z ,1ۋE8tVjEPC ؍e[^]UE,U ,t@]UWVSu} ?tB^9tWs ZYt'jjWC 3FCF^ Fe[^_]á,tUh ,P,@XZUWVS}=@,u,,uW,,ǀu,%=uf%=tXW_,^1<%uH ,A,,19h,[u-,<,#A5,,,t , uu,e[^_],t1+PW'EZYHH>$4!}e<(,,/,,t},8 h,,= ,vx ux ,= ,w,,K,pt,,8\,F,,.Ã{,,,= ,v6x u0,= ,x M߀x <,= ,w,f,,8 u,8 td,Vs,@,,=+y,- ,+r +v} t9U~ QMWh ,/ MUuɉrCWh ,, ,^_,8 =,t },tP ,YC0EPZE,u , , ,uH׀? u G9w+E+E1E ,9v~ub}t6E9v-U؉MuuV+ M܋UuEt1}t8EE18Et < u~ 1EF눅ω=,,tP Xj,)@P4,,)RWP,M+8tWwV/XuV4,YW4,W2 XZ,M,}t6,Ph,z$1ҋE,^_,E,,9,v,u),,#tk,Z u5,6YtA,= ,v +8Huh"bZuw%,`؍e[^_]UWVSQMEE ,EEEX8OЀ w%k} e׉u}]ʋ}]8.uEPjEPvz}܉ EUeY[^_]ø ,á,t @@@ UWVS|aƍxPVy[_%=hH!VhV& ShV: jh"V  1u{ShVf: tht t u@h"VڽZYt/h"VɽZYt%"utPWZY듿+댿܁+SXe[^_]1=+ +UVS|*ƅhB!P^V fSft|RP^Zx,E%=ufSfthP>ZYh"h"S h"h"Ss ڸ+!h"h"SW $ڸ܁+SXe[^]UX, s \,7t \, \,Y,t h"XY,t h"XY,t h"sXX,t h"_XY,t h"KXX, sh"thw%hs!#Xj5!ZYUWVS<,ƃ@࿉ÿ"u%\,/WX=8,tW_t h"^t uh5$hB;!YjjrXZe[^_]UVS։ˣ\,vFViuSA e[^]UWVSQEc ơX,ǁt#tf&&ur%X,Su5X,AáX,ƒX, t;x- st j%j&Ztjh"l}XZtVg&VYe[^_]U莎]GzUS`á\,#1 te tR |/$%9Z7QX,X,PSP,؋]<+u C< u,tPF X;u,S,X5<,S5@,5D,lrD,5P,jCP5P,jPCP=,S]%X]];!t`,tP XS7*`,Y=,uJ`,uh"h2"|^XZ.h"P=,uS(,Pmajh"r{]UVSt/,,u ujjj5,RP= I,t@5,,,,u @%@j@5,,e[^]UWVS&t enY@Ɖׅu‰,,,=-u0t;5,,}Fjjj3 ,-ia8e[^_]Ë\,1!UE+EPh "yZYUVS= ,t2 ,t(@~t\,tCtEu >$,u e[^]鰡X05$,PL X1 , g e[^]UjjUP$,$, ,XZUVSuVZ\9r PKXe[^]UWVSX,,@,e\,rP,T,D,=-t藖=,tj]i=$, j{0,4,q_u) .t u5,2Yuj9=,t"+.tmu5,2Zt΃=,uG,=d,t"jh0"ud,@]t hO"uXt?u j:tXjWWu_X=-eu"xj1ɺY"Ye=-[e\,t!/t`7$CЃ ".jSZYdhH,XP,T,\,I_=D,uezu\<,ƒu_uK8,s +tt#!u+1D-1@@<,7 =8,D,  t);(, ;$,; ,SYHEa<@,jEPEPoD, SrEEE5=@,u Pw P-Z{EʅuwEEPhN" 8,`;(,O;$,C; ,7=D,*SnD,_uSfEEPhf"t <,Ht+5<,h2"CP5D,j5D,fYt5D,fj1ɸ/+ F~~C wv$!]*t@t%!tIR=,uS=\,7t@.=,u:=\,7t'=\,7t1X,Q t0 t+SZH\,#^ HR R=\,t"SK_H[ ]EEEURPƋEZYtP_ Fc $!P,19T,},1;P,T,|cP,T,=,t54,50,4Y^jP,19T,},1;P,T,|cP,T,$j1;P,T,|P,T,=,u+;P,T,}54,50,94XZjj1;P,T,|P,T,jj1;P,T,|P,T,\=,u+;P,T,}54,50,3_Xjj5P,1;P,T,|P,T,jj5P,1;P,T,|bP,T,=,uq1P,19T,},|=,u54,50,2Y^jj5,*P,19T,},1jj5,*tZM35h1;P,T,|P,T,5T,5P,P,T,y P,d9Ѻ}P,dT,H,n5H,5P,96SP,T,19| +5RP14%=T,yP,T,5,5T,5P,m5eQC|EEPh<#"=,uE܅P3t,,,jiZX, X,1;P,T,| P,T, X, , X,1;P,T,|P,T,P,1"F5X,Ѓt'Ѓ 5X,ЃtЃX,1;P,T,|P,T,bP,15X,e),,,,h"!t=,vj !" =,Rue:5,)h"P u jh"z=x,tjh"l^_j !5$Lbj5,MtjPwO[t jh";P,T,|P,T,5P,Yelet!t ;P,T,("|2"EEPh"'蹓t jh";P,T,|P,T,5P,QZe;P,T,("|2"EEPh"1;P,T,|P,T,5P,g_uLjh""d1;P,T,|P,T,5P,y^u jh."$PYeɐu 5,RPh- 1;P,T,|P,T,5P,OZejh>"jj_Xey=,W4%Yu ^P Zt W,?W%4<, <,8,/j1ɺB;! =,j !5$wej1ɺP"X_9(,9$,9 , ue w nPP]j1ɺK"A^e9(,:9$,.9 ," t SQY=,tjh|"hXZj1ɺW"%u_9(,9$,9 , t u.SP^(,j !5$% j1ɺ_"NP,19T,},#, ,P,T,,;P, T,} P,=T,+P,,FP,19T,},#, ,P,T,P,,,=\,t ?j1ɺ$SXZW=,td,@6UE=@,t@]UWS]Sj\XY1ɅxЍe[_]UWVSu} }t M W[E}uEE܋EE;EEEujEPEƒ EtEu@9uv;EPU9@%=uՉ%=trEt*$u!EE;EsXPUP2YuBEtRU ZUt R^ YREPoXZ}tE)U)ME9 Et 9v{ uK}t)Ee[^_]UWVSÉU΅CEC}9Evv8u&uUP@uBgtLt>B$7tKuxgt3@xu@tyA9uEx@G떃dt fud dZY[^_]USJ ZB[]UWVSEUMj j E[^]EE9ߊWtL< tC?CP蝱SӉUYtPZU9}j"1 t @C19w)ЉC{y@xunu}~FEE0EEEe[^_]UM Ut,yE El"]|c]UM Up,yE E"]Oc]UM Ut,]UM Up,]UQMUl,Ht,ulEZt8uMUh,s1JuEUWVS5,t uCjP4ESq }xuljUX9}jW YXu uϪYjjjuBu@uS u訪XZ*WSuwEu茪Mș9Uu9t S X;u{Mu {+u{Gt |;t |;WS1_X|;E|;n|;d]l,} th,EPU\S S X]UWVSE9,蚺pƃ=,t1HÃ=,ttVX_H V5,[}u VKquP>DžllPhPSl dDžuW`Ylh"WBYZu,hh"WYZuDžhch"WYZuDžh>WZpZpPh<#Zp dt lSd dY u`C S= 9uujmVcXj`ʡhY_y0SAVppPh<#Zp U=,tOuWZuh _t܉ppPh"ZZYYthXt\5,V$_\\E,dx,l,uh,5,,\Pdhdui,t=,tP^xP`+QZYu(EU,,x|,,,tPX`x 5,U,X=,tC`\5]kS5!_Xu"=,~ppPh<#LXZYS X1e[^_]UEu E5,PZYEU5, Ztjh"Wjh"UWVSSÉ։M}uSySYNxuSZu-uƸe[^_]UU,]U,jUU,]nU,jUVSu1SYtP6Z9u]e[^]e[^]UWVS}W{WWWt5uu$1҉u1҉tj裝e[^_]UWVSuEPY[11VEP`^ZƅtYVTEPEP 1REP6ZY…t$RUZ ؋Uu5,%XUu Y땅uWY/5,SP^Z9,u Wf[1WSZYe[^_]USÃ=,t>SX]Ã=,u*Uh?"ZZt, ,M",á,US1j%RңZYtPxsuC؋]UWVS jjd舜ZYEdNyVXu ]P tN)EH9|=MMMju5WPECW URU׋M Ce[^_]Uhf"\Zu UWVS]SI$@PÛ_X+8u"CtZ +8u:KuKCBBCPZ;t*tUQMWS MUuBBCe[^_]UWVSu9EP[E1EtJC8+t8+uMUURPZYMt}t]EG밃}tEurV)YXjS襚E_Zǃ}tI+PV+Phu"SW1nSP股Y[tuWs}XZFFGuEe[^_]UWVSRh"Ytuƀ8tnWXtaVlj$vT$RUSh|"Vh#%URP S' hH!WgEW E hH!WgZYe[^_]UWVSh Yu1vƀ8tP[u|$Wh XZtuhw%VhP&WSFSPjPA$y Sz Y1P ZVh X؍e[^_]UWVS}1ۊtEP݀u9;}v8Gt/8Gt+<%t <#u",,tPZ P+Y^CGjCS蠘XZutQH݀uC;uv8Ft98Ft7<%t ,<#u& ,tQ PSkSÃCFe[^_]UWVS]S8^u1jjjS>Bu@thVS× 19sUSjW* =,u+€u!SjW 9sPMYuP螼Z1e[^_]UWVS u`Y=,BPfEEZ8u"PXh"Xt:u"RUyƉ$oYPakL$QMҖW+P+PURh"MQV$W XUVZUtRh"PuV u Y^uu So XZ؍e[^_]UWVS}1ۃ=,u\WaX$SٕWh"SPVTPǃ VP8ZYu S Y1W V XZ؍e[^_]UWVS=,P,Bjh"Y^'4|uC-uFh"u诊_ZLH~jh"MY[VrZugL$QM۔uVMQPW tufFftjEPWi Ht/V*e_u]KtZEE h"芔^;EPE0E 8h"gZYVdX;u1ۉ؍e[^_]UWVS}E EE=,tPd[h"MY~E"e[^_]JLS*ZEuƉ<$UL2$QM胓WuSMQP1V t]e[^_]ce[^_]USĀuSÍEPSCƒ 1xE%=@|S^ |]UVS|uX=,u1V[t&V@$P踒VPh +\|PVcCZYy V0GXG1ۃ=,u,H9~:WVmƉXZut#C;uE|jjuuSE|#=,ux&,WV ?jjWV,HPe[^_]UWVEU EURPƉXYBut1WV*ZYu$=,t WV/YX5,WV f;EE|8u/5,ԘVRPr E E%"e^_]:EUEUEPhF":XZe^_]U EP ?J>uuuUWVštjhd"E:^_g(">9ƉRPYY ,uuIQjj +IQRP,HP =9u9t e^_]Te^_]UWVSu} ]WVʘYZu臚 t3@u謗Ɖ׃=,t WVXZ]u} e[^_]'貗UWVSQEE] ZBu@ujh":贙XZ<Ɖ׃uuE E"e[^_]9SuWV59| 5,RP e[^_]UP茎Yt,t ,t,t,UPSYt,t,t,t,UWVSÉϡ@,u"uQ Zփvu,P4_uSڥ[ۃ(,~K1|SRYuSWƥ_ZV0,DP蜎ZYu0,(,DVk_t,(,u V0,DPNZYt݉؍e[^_]UWVS ,UEjP Eju Ã}tTUtT4,}ƉEߋ50,50, EP E4,0,E,ZY1t Su Xe[^_]Uh",Yt8u ,!h"},Zt8u ,"jh}4,jh}0,,U1}](,$,,, ,,,,,,=,t ,UWVS8u} EE=,uWVHEԉUXZ=,tY(,4, pl+MЋ tl+0,‹]!Ct;uЉ|;5hl+=ll+}@@(,$,=,uluVuu3VÃ}VSh#(,4,P4]S(,50,1Ӊ(,$,,,Eԡ4,E̋(,=0,5$,uȋE)EE9u|EЋE؍UU̍ M9U9u#؉)ىMЋM;M}7U @1}M }M1M9M}Eȉ19u|Mčt (, $,e[^_]UU1wR5,mZYUS]1w%SZ1uS5,8ZY]UWVS‹5, (,)$,)9~ȉE9~U܉uEE (,]9]-9d4,3=,ustuiE=0,VUE79MEMM EEuD7EEDPYMuyv=@,RUEZ;(,t4,P(EP؞ËE+EEYXuduuuZƅ1=,u=}uZEEEEEU=,HE$:1=$,O;=,~EP蹗EY (,E,9})4,E0,E܉E}U؋U)ʉUMGMt딋U)…~U}}܈@Eދ}y1π}t=(,5$,1^u[»(,4,EU54,jEPE4, Ut9w)أ(,Ѝe[^_]UVSUMPPկ^$,N1ɋ`+ eơ`+X;5,~ "uu1ɺ ZYuCu1e[^]UWVSƉ19,~ ,Zt ,)C1[^_]UWVSƉU,(,,9~;$,} 0,D0tUM uu u11ҸX 4,ȉERj}W菘ƃ (, ,9}f; $,}^0,D0uQ4,U)‰(,PjWK0,(,M)$, M뒸1 , ,1=@,أ ,(,4,P裕Nj(,0,Y9u._u$t, ӅI> _u4,UM_uH@t>PZt,+(,4,PVPDà u , ,x 1=$,,,+,L+ ,~9|5H+)ș);,}s4,)1ɉڸ a|7lj;=,~6Nou u$ڸ Y_t΃=@,tv=,\PnZtA,tu$uu uM1҉UM =@,t|Wt^toW蟖PګZ$,N1ɋ`+ jơ`+Y;5,|u u1ɺ ^_Cu uMډZY1ۅÉ؍e[^_]UWVSEEu },t*5 ,5,1ZYt ,} uX=,uO=,, 5,= ,,,X@,,뺃=@,Mt ,up,E,xWV1҉=^_%=u(%=tQ ,5,=,Y7%uv,C,M,9~1h,,Z5,=,th,芑WV,à Dã,,2M,,Í@,,ۋM ,,; ,}0,;$,}4,(,,)-=@,,e[^_]Ã=,~U,,,]1UWVSW},tt< t5 ,5,1z[^,,,9})54,0,=,uAjm5,uZYt.(,E" t B@E}t(,,9$,(,|=0,tt =,,u =,u @(,*=,,t!} t DP(,D(,e[^_]UU4,0,@]UEU =,t+=,tu ~'H  0,  4,],,,UWVSQSMQyq uu RP8ZYu]ƒt1ۃt t -t8,H9UpUt 4,C뮋 4,tteY[^_]UWVSQMQyq 19| RP|ZYu,X4,D&E t(-u}tbP,UUt #@4,ED,M\9Ew HK,)K4,U11҅t 4,ىt ,eY[^_]=,t&,tUSJZ P+JZ HX[]U=,u ,,jh"U#XZáD,xH@dD,USD,@,X9}jh "#D,XZ]ø`, @= ,u ,`,`,H,@,,,,,,,,,,,UWVS ME E}EE,,t C 9{E}E9Cu 9K؋s`,t `,H,H,px}x HMHC@92H,ue,puXEM,t(xp9}} Ћ}E‰}Eˀ}tH,H,HJ@ [^_]UWVSQMQEU=,*E#E@1;EE=,,tG U9WE}?E;G uE;Gu O_@,,wt:GW M]+N^ M]+M]M؉]܋]9]]]v v[_ujD,N^~ vtVM] M];uE}-uF"Xsh5$Vh! REj#pjfjb:jahEjejhU!+dy uh ~8t>u Pc_EV[t̋URU,É<$"L$QMcWPURh#%MQS臥 Wϱ YusVcZStS谱 jCdu{gu3djf9je}t&uh#"dj  o,uXEe[^_]8UWVS}EEEEuu OzZYt jh4"hB!W0YXujhR"XZUqh5$ Wh!2njdjq8jj Lr}uV}uPxǃu8V2jj rj48jdn,j7W@uAE UM;M MM|'E U뎃 twxǃt@{uq؍e[^_]UWVS] uEUX}u }t]jƉXu u11jY}.uRP&;uM| RPuuBu @ujjuuWVS(e[^_]Ƀaw ,ÍBw P,Ujhe"NXZ1U.t|$t5,'z^uu,,,-jyt jhd"av,,,H,,,,>h,P,,Y$txuxujhy"XZ11ǀ,ǀ,=PuUE]UWVS EtÍuV{󥡼,Xe[^_]UWV ]|u.uVX}u}t,󥡼,,e^_]UWVSExtl,=,u8=,u/=,u&,,, , ,pxX 9u SWV P.Zte[^_]USQM˅t&¡,9tjh"XZJZȉڍeY[]UU19,uǀ,ǀ,=Pu]USE] =,tE E"tmt,ztE E"S=`l+xE E":S\PI,P ]n=`l+yE E"],EEPh"XZ],+x,@B,USEtzE 8.MU u4@E Qh8&R%+ }t jh "Qh8&R }t jh "i,+_+y,EEPh4 "~EUu7uxLà U~_E ȃ߃A<vM-tH}u;]t);]~27jZ9E]uEEEFt}t Es\$H}tE}t'EEEM} t tE Ee[^_]Uh@,Zt@ ,EEEEjEPj K  ,uu uK =,u+t $, $,Q$,~jNK ,ya8AS8#3Ujh@,UEPI'EUWVS0P u軅É4$豅|$W(KVuh!WP#؍e[^_]Um $!m !|$fD$ fD$ l$ |$l$D$USEi]'dt>mL$L$5d{! !|$fD$ fD$ l$ |$l$D$T$11ҋ]USL+,t6=,Sh,PH 9t ,L+,]U=,t,X=L+,rL+PL+M,E]UVSP-t ,H,EPScXZt'uXE,XuXVVYC#We[^]US]t CP1X]UWVS M ]1މ1ˉ)E]Mԉ]Kjj WV*A0jj WVBƉ׉ Mu˅y C-E؍XSuXZe[^_]zUWVS]1)EM I0uyA-OQu 苄XZe[^_]UWVS 1%t@ER,VYHM؊@0֋EWe[^_]USQ(à Hw Ѓt tS諆X]UWVSu} ,,t0,t&=,uTVjU,Zƃ=,t =,uE e[^_]h+T,\*CSoTX9, ,e[^_]GUbTUjTU E"h0+%9EtA@9Mut>:G131} PEPjWu 1ɅuEUe$s )ȉȍe[^_]UEt$tu ,H,,H,‹R]UVS5,,1~PCPSl"EU DT e[^]US,H,~DTˉTIEU S[]UW ,y1=,_]UWVSM] ,; B|#5,9~; ‰|}H@[^_]UWVSE,1;E  ‹\9Ήr @޸1[^_]U,HPjZYUWVSU=, ,19~4\@utB2Z B[^_]US EEE,9,~o,tEP{S諐 ZYEEj5,.B£,,,]MXXutE‰L]UE,yЅ9|BH]USXH:t! t%.t?t \uXBJuÉ[]UWVSP{ZË=,=-r-)SVWH, e[^_]øs!US]SRPk ]UEPROEyXZUWSPYu"ux,H9~CSލe[_]URe[_]UVSӊPtbƀwhDtYpPjt6Bt'bu::mt tu(( 5,[XƉe[^]Uh"S@,X"=x,t"P4@,h "%@,h"@X+h`"@T+h<"?P+UWVS,u} ,,2">L<:^]<%<.uY;uM}+9EM|!@uWV膪SpB| E]똃}t e[^_]Ae[^_]U-ujhY/"ZY1=--jXUVS]t 0P' X--- -e[^]Uhp+XUh\+XUVS]u GQ\+ut;ru;Zt1[^]UWVS<Ɖ׋EEE EEERV/EԉU[XEE-E#E@t ;uE}u}to~MEUEt*RPWVE܉Uủ}ЋE Et2EU(RPWV{E܉UẺUЋE EtEU}u}u} 1E 0x$=,t%E)1)=~uuuu6uuZYt u܋} -,ut $u t t=,uRUu'Pj2W*EċUREPuuSA(EEti-:t[5-jEPEPuS5-5-. t/jj.2‹ű}Љpxu܋}p x\+Y^_-ujEPEPuS5-5- }tuuuuًE̋Un`Mȃ}W=|,u!uuuuًE̋U9S u Y[E}t,ME̋UЉQS u XZ"EEȍe[^_]UWVSEEu UM}t=,u@pl+Etl+u}t(];hl+ll+}9U|!@uWp+t8];X X}ut9PX|ׅt=|,u1}u1=-ZY[^_]Ã=-u ,-U-tP~ Z-h-XUUt:u'-tPO~ Z-h-X M -,ULu -]|1]UWVS(u}- -E܉U-EС-E̸->t$EE}x>EU EU1~u;]tjjuuWEUC-Eء -E@u}t&;u؉E}!@u--;E] },BMu k,׋EU Zu #9.k ,ߋ]9]] ]}9|ы]9]M Mk}9}} }ԋu؋}e[^_]U EPVX}u}t jjRPuufj:Uh-=|,u]]UWVS}U ut :@-uLj5!b[dcY[t)-|x=|,u=-u. jhY/"-1 sjhx/"XZ=|,ujfX=|,u=-t--B-=|,t%j-@[=|,uEt411҃}(=2)D =,u E؃#u%@u }u,MMPGPYYMtjjRPS}t2u2u-C;,|SY݃uKxSYtEUuu rojh/"ojMQjVWjjsƃt=|,u>~:"u5,uu蹥 =|,ujX 1ve[^_]UhJ3jU: -XZ= ,tUhs3j,: -XZ= ,t|Ud7h3j9 -XZ= ,tNU}t(h3j9hs3j9hJ3j9jjj9jj9jj9jj9 UWVS--tkjj^9'85j+jj?9jj69jPk)$hs3j9j+5, tH=,5,W/9=,u95,t',@,RX,t=,tj!(e[^_]UWVSSE։jje(ub$@PM(CuPYds {E C}u C%ub$@P (CuPd؍e[^_]U塄+=+tPQ P3v X-- -UWVS5+貋hH!Pnu n -a[ÍVhW Y!tSWU ů< t< u#&Y8tPt u%Z8gPjP u DžoPx^u 8tt\u@1ɀx$uH11Qщ‹s++P+ -ZYVQX= -t+--1e[^_]UWVS ÉJt5 -u+ ,Eh/"z_84"SʉYuQm_Z[_lj4$Q_$|9P$VQh/"Ph9tVr XhH!WyWr :f;?SYSjjщ‰++P+ - VhP tn=-t,lV}X`P>^_t uƄ t Ve[u,u ,uAYDP@ubVZt(-- -+=+--1tfTP@tCu* fLHt@u C@tC fLHuDP6)yDP@u DP@tGDP@Ae[^_]US+h/"SZYuwh/"SZY¸t_h/"SZY¸tGh/"SZY¸t/h"S{ZY¸tjS!ZYxP"X1]UZu E ‹EttHu jh/"jh/"jh0"XZUWVSQ - p x tWV診ƉjjbE܉UXZ-jEPWVNEUE EtEU}u}ujh0"yY[u}=,tuuuuԶ-KQM#[E؋U$RUԋMQ O t u}Q{UuWV蛷C SXZE؊< tu߃eY[^_]UWVS- -]11~1t2+t AFKމt - -[^_]UWVS- -]11~1tr+t IFK݉t - -[^_]á -á-Ë-tUrZøUjhU!ZYx$- $-UPjEP5$- tyj}uEHuEUju/jh@-UE=t-t&uf=+tE0"],bx-@]]UVS -Dž= -u -1 h>j.[^h>j.XZh@-YtVjjh.^Xjj].XZh0"Yx-u +=t-t j[P ԋ5 -+tPVuZYt1ۉx-0"g8@8t|8t8,t@ۋ8tH5 -Rx-PZYt-@S IXhH!5 -c^Xuc5 -h!W`Y[0"SbW$S5 -y& FP5+P7^ZtbShV Nhx&P$^Zu @׀8 uS:HY0"hA"P#ZYt @׀8 u SGX8t%8,t8 t@Ћ8tH5 -Rx-PY^t-t SGZ@x-P "uY9"e[^]U -jj_+XZUhSBjL+ -XZU! -jh- ,Q,y ;,| t,J ,Uh,PcXZUWVSPEƈEj}W5 -D$ f=L+tn -5+ AjW5 -Dj@= -t.V"Ph0"] Ktjh-5 -# 뜍e[^_]USQh1"聽jj!*jj* Åt4EPIZ9um h1"6jj)jj)]jj)jj),+j/SZڅtPjRS誢h0,hQ"h1"ji4h0,hQ"h(1"jN4USQjh8d#5 - f=+t#ܑ+;tSS$S5 - jh!5 -jEP5 -}nu5ܑ+h31"\XZ]USPjP]ShE1"l t= -u)<+SFZy ShK1"[ZYh1"ۻX]US]j5 -SS t Sh_1"[XZhd1"蝻jTUS\+t$;tSR$S5 -jjUS,+j/SYZYPujuh|"RS]UVSUu 1ۊt< uB< tЊt( t t@9tCt@8ủ[^]9uW|$wUWVSE؋O_̍+uVRPSQD M܉M Ѝ+VSQRP& u܉u ԍ+SQRPÉEuh<#4ZXZrCLuu us 1HsP4+UQhm1"YU1"e[^_]g_UWVS]SP$S5 -  -jh 5 - jh -5 - ƅ jP5 - jP5 - = -!Ѓ uh -jj[ h-V$pBj%XZjjY1= -u?jP5 -1ƒ = -H"= -u)uPY_uՊ< t{J< uf=+tFVhv1"!XXZ)9=|+4WPu 8 9thz1"_ -VPu  9t hz1"ŷ^f=+t$j++$Ph1" h -jjY jh -5 - Sj$XZu Ye[^_]UVS hVh1" PB[th1";Åyh1"YhVh1"9 t&YNj S3hpBj E#5+Vjj *# PqZ~<9u6j@j8Vh1"8jOe[^]UWVS]ujh 5 -4 -h9Bj"Eh -jjW jh -5 -8 t@t PFX -f=L+tjURP P j,^_jEUY1E1Ky S0?Z PE= -$u f=+t\EI+ ufu9E 0 u&fu&f= +tj XGuE ft EPY} tf=+Pf=+tFVhv1"TXZf=L+( -5+7XjEP5 - = -= -t jy7X,= -#E+9ujP7_} tf=+uj Y} u*jwƉSp<uj f=+u>E tPE Z+u}f=+t WVh2"WVh1" jh -5 -h -jjyUe[^_]h2"lX UWVSEhVh1" 'jh 5 -Ijjjjh -jjT(jh -5 -Tà yh1"ѲX11ft#j9ƉXPY~G9uAj5 -3=j4jj1jj(V! Vh-2"YRjKf=+tj)RPh?2"{jh -5 -Y h -jjTjj jjXZe[^_]UWVSEuhVh1"/ 4jh 5 - jjYjjPh -jjS(jh -5 - à yh1"lX11st#jƉXPJY~T9uNj5 -;j5 -;j]3jjjj$VVh-2"Pj^Jf=+tjY)RPh?2" jh -5 - h -jjRjjN jjBXZe[^_]US,]S5 -'h u -u M e -Sj5 -2Rh -jj$R]US,]S5 -&'h uEu %ESj5 -Q ]UShShI2" S+[t+jht#5 -  +t+Ց+tՑ+Ց+tՑ+f=+t|e+t$e+f=l+th h"uYŒ+tŒ+̒+ -Ւ+tՒ+jZ+t$+f=+th h"X]Ujh{t 5 -19j#jhzt 5 -9US]1ujP3 XZ]jUS]CStu R^ZYt1]UVSEhP2"P^ZtP8[yh"YPh[2"hPAL8ƅun,+u;p$ $ X,Z $ $Ph|"SSj0u*h!dX X X1v $h-? à O XPY9u tth0,hc2"XZ댅yhg"xuPhr2"uPh2"h0, O Cƃ--8 u =-vH@-e[^]USEjPh -h2"I uxh -hhPz -yh -h2"KZY?hSh1" t h -TX5+5 -S ]UVSjPh -h2" h-h -PY[vE2"e[^]Hu --5-hhPÃy5-h2"JXZ+5-h2"hVYIh2"SVe[^]UE jPh` -h2" uXh` -ehH!PM uh` -h2"BJXZ)j5,+P f=L+u -EUVSjPh -h 3"b h-h -PY[vE3"e[^]ө-Hu-RhH!PLà uVh2"IXZ@-f=L+tPh*3"Ph23"hV HVhO3"S2 e[^]Uh0,h4"}jBUWVS}F - - -%E~1Ejh+h 8"u u.=-uh0,h4"jBt%`'FtqD95/ kU DЉE죸 -뉃a$$0"1oEtPt=l5WJ?YvhW7"Z?:5l5jhq!V"3 jhq!V 3 h!V^Zƅhy7"j@l5hi%SZYlh"SZYMh!SY[Åh7"뫡l5 -l5 -En= -t h7"sl5j/RU YZUt  -6Rhc$h -ߦ EPjhjjjj5l5 -U P5l5h7"R虻 -tfh7"tN - - -=-vldZR ,E)t8HuR}t h.8"JE h/$RU)YZUt -" - - -hcjxhcjlhcj`hcjT 5 -hS8"j h-1Dh-5u hX8"@u hg8"jh,Z:XZtKthi% h"h!V [tNu+l++)=-u l+ l++=L++= -t ̒+= -t5 -H Yu.}t h8"j= -u"5 - Zt5 -hq8"je[^_]U -jh@-ݸU4h\jEXZu5EZt -= -u!ujYX= -h@-8Zu(j '= -$urZY -j&Y -yuh<#XZ -V= -IjP XY -tPY -URPjXZ= -uM@EPj5 -'E jh t 5 -- jjYX1}UWVSS]=x-uh8"dYu h8"j5h8"GZt8/t P X++8"Sh+EP. ƃ 1= -t9 - - - - -= -u' -%;/u% -jSRGY_t -t t u!h 9"Sh8"7pXZ h8")pXjE;+9u QRP6  +Euڃ= -u h -h^;#Pb @u  -%h -hq$u@ @u  -= -y  -j:h:9"u/  - -uSh=9"&= -t$= -u -= -u ShU9"jej:hz$u  -= -u3 -t -tR5 -^_ - -j:h7u&uq t +j:h &uQ t L+j:h"!u1 t +j:h~"u t +j:hn#u t +j:hF"u t  +j:h""u t +j:h)%u t +j:h%uq t l+j:h$uQ t l+j:h!u1 t +j:hz$u t +j:hf"u t -j:h"u t += -u  -+= -u  -+ -t Phq!Y[ -t Ph6i!XZ -t Ph&{_X -t Ph}$e[^h -hS&u @u  -h -h%1"u @u  -h -h!u @u  - -t-x-t-t/j,S}ZYu -t- -@t-؍e[^_]US Phw9"h0,H@Sh9"h0,8@j6U= -th -htj' jS U ,yh,&Zuj,P,= -҃ !Ujj  -h!ߜjh` -^Uh -jj> Uh` -jj> U E E -hdj. EYXjj EXZuh<#N<YXh` -蟰ZtlE qujYXujXZ= -uVE ;EHh,%ZtU < tU EE9sE @E ,xˡ,P,UE Mtt @8u1]UWVSu - -FVtI)~@9" 8u\Qu ^@P u f^?봈@ -[^_]UEP^v -^?<tP@ - - - - -]UVSEPh9":XZ+;t[Ct = -uGL+PPh9":sC <Ƀ*PZVQPh9"m: 렍e[^]UVS,u]S5 -qVSVSEԀ€Uԃ= -t̃Ef=+tMẼeewfEf=l+t %‰USj5 -;e[^]UVSuU ]= -tSRV y@19t  - @08u h9"E%e[^]e[^]UVSPL+EÉ -+t68u-Fu#EPPh<# 9SV1%tك 8]tjEP5 - Íe[^]UVSܒ+t8u# -tPC [u -ܒ+Yܒ+h!S^Zu - -h"SZY…t]h"SxY^tXh?$Sg^ZtPhi%SVZY1҅tBSh9"h0,:h0,+1Ҿ11Ҿ 1Ɋ+1 ! -Aue[^]Uf=+t -tP' Xj1Ujh -5 -jh -5 -UWVSjW5 - ފ< uf=+u"0U)څ~CCjW5 - ǡ -tP_9u+ƅy0h!V : -ZYu ƅnƅy+jP5 - e[^_]1f=++UWVSjjjjh=ij h=ij -fDž -fDž 1jjP ~Ft=jh -5 -a ~$ -!S 9]<u^8C Q{ tUVWZYUt@PuW> YVC Zu h:"蕓Xc9s ts tC Ke[^_]É¡,H,y;,|,H ,Uh,R8XZUVSá -H!vB3V(*Y - -Swt^t2 -P -" Uf{ u@ -!<3h<#2XZ{Vh"2 -C [^taP; -s Vh:"S2>Vh"F2 -C ZYt'PPC) -$h<#2 = -"~ -h!Xe[^]UWVSUu EЍX]:MB\t!^Ht E@yB^vx}HyЉwˊX{ЉwP&:"n8u@B98u( x0vE E ψJEB8t1ZY[^_]UWVSS]h$S^_ug+; CtE$ƅUB@t,fuURhht@P Pu fEfth?"sW ?"[ ~&tIt>UQM Y9MU~ ?"QRh$h0,+Ã}G"h0,j ZXZe[^_]U"PPPh?"h0,^+w$-t@th -Xj!Uh@"h="hqh@"&IUWVSSt Éֺ ?""hA"h="hh@"Hu :u!USP%ZYUu=$-e[^_]VShA"/VjjG!UEuh F"h="hh@"H@0hF"U1UEuh F"h="hh@"TH@0hFF"U1UEuh F"ht="hh@"H@0hmF"U1UMuhF"h>"jThF"G11f3A@=uUVSEu ]uh F"h>"j`uhF"h>"jahF"Gt0ffPhG"&fPh$G"&fe[^]UWVSSljUQ9) ^tcu uSuWÃt,WSu uSVW%9uSuV? u V 1 ZV1 dX؍e[^_]À8uUJRPRPa? 1UWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4@?"JZYtdG (uhG"[ShV$h;#h0,'4@?"h!h0,'C uh0,j V_XLD?"EsR@8t54V"|@W$WV=|VEP}MU1e#sj@HEP| susuhGG"$uh]G"$uhjG"#uhuG"#uhG"#U$19D?"t@ uRhG" 4@?"hG"#XZ}tEPhG"#[^h+0ut#0uhG"QY,01e[^_]UWVSMuh F"h0?"hyuhAH"h0?"hhH"C11y uhTH"h0?"hWVhPqMMuq hoH"=tq h|H"P[^-=߶xt! uhH"PX1wȉMÅMutRWVhPqMMuq hH"xZY=thPq hH"TP؍e[^_]UWVS@]uh F"h ?"h8suhAH"h ?"h9hH"B{ uhTH"h ?"h:߃uhH"h ?"h;ŋuhI"h ?"h<몋1ɿ 9lj} PRh%I"%9|- tPRh`I"^O Džjjh PV= tS h fUt#ts hI" ^_1jjPo;u;t/uRhoH"茸Y[$PRhI" @ u hI"u h$J"m󥍵ѶxԶx9t PRhHJ"Q2VhiS@u hO"j1e[^]UWVSDu hO"j/jjjPH @uhL&0jDSShiH(@u hO"juɋDH<1DžDž?ڋD1DžL`jDV\hO"h, Vh:iHT @u+Kt(j.h,j,  8t.Ph!GXZVhM"XZ먍e[^_]Ë ,Q,y ;,|< t,J ,Uh,PZYUWVSu E1NeUVYU\ =-t u'1=-tk=-t t&EuhHV"h,v ,@t< =-h2"hMV"h,? ,@t u$ =-$@u| u=-ti^@t|IW=-tLvM@tZ-s@tM,DXt^W@t1?t ؃@<@tHF @t!5-h<#-ff XZ,@t h j e[^_]UWVSVu-2$,tfh"RUVY[~tAQ`"=-UuH!PR@XZu!6h<#O-Y^.,-SZ,t SIXf%,>ke[^_]UWVS|5,ftz=-u8=-tt-=-u---5-5-uà 1S-PVT yah jxPVZYuE=g-]S -_xShRV";Y[I)u[t5-h<#-XZe[^_]UWVSĀuf,fu-2$h"Rth[_~tu,fp=-tTjjRà xTxPSZY@u SX9E%=tFSg6hkV": !jjRlà y6h<#Y^-:-y h2$jS,Zft9tSX>e[^_]U轧PPh@W"h0, j-W|$wUWSˉ-U]m $!h}fU fUm]mURp pSQp0hZ"h0, $e[_]g_UWVS]E }܍p(}p4EPSY^tShZ"躢XZe[^_]UWVSP]u CM% CSCt RPVs RPh+ 1t)]18th+hZ"?_XcCt5PV@ZYh+hZ" _X}uPh+GZYuˁ}tk=-u^SlUUtRVZY@uc8-tRh+ZY@u"{lth+hZ"{_Xu%Sh+gZYt }pe[^_]UWVS=-t.h+Bh+Ep/à oh+!jjEpL\ @Euph<#Ӡ[^1xP=(-t,- 0-t 1ۃ=$-Ã}  =-h+hZ"h0, ,H, yh,Y,P,0 t+@t( ,y h,Z㡀,P,Ѓ߃Yt\=_jۍxt6Ph+uuY^@u8h+h $ԟ\ E *Ph+t^Z@uȋE%=t[jh] GPhh+ƃ uT  -u"h+h<#T\ h+@GPhh+~ƃtOGXW\`dt;`dE@hDžl+`dpt;`d‹` d)`Tjj\jjPjsXjwXPK `Dž`DždځvRPT)XPV P9th+h<#ʝY[:)Ӊ1`d=-t`dhvTXrYZEph<#\XZDž`Dždu61Й`d=-t`dhhh`$-\ ƒ ~&RXh`$-V诿 X9th+tEph<#謜YX=-t#V\YZth+hZ"耜XZ\Xu VY-tVW[Z1ۅÃ=-uh} tbG tY4-9GuOxPVZYth+h<#Y[$E9Gu-#G%PVYZuV Zth+h<#輛[^=-tWh+ZYt؍e[^_]UVS]hVsg u sh ["'Ƅ} t'h+<Zth+h-[",[^.h+V5ZYtVh8["١-t jsPLZYe[^]US]} th+T<Yt h+h-["sh+YZth+hD["褚XZ-tE ]]]US]} th+;Yt h+h-["$s$s sh+th+hO[")XZ-tE ]]Y]UPPhY["h0,ZjUPPh(\"h0,:jUWVS|Ӊ΃=l$.ua=p$.u`R|Y_u%=@u'i|h<#KXZ>t#h|V =vQZVSnY_u%=@t=x$.u^VSm_ZuQ%=@u?V^u?SPSh$hS=΃=l$.=d$.|8/uVPgmZYti|h\"UhSWWt=|Ph$hW]VWmt|h\"_XVSqmpY^ l$.iS|葱_ZuS|h]"- \j/|Y^|tpj/S_Zxt@xxV/ZY+|x)؉t=9|u fDž.Nj|ƄPRk^_u~;xuf.׉ދt󤋅tƄxPRkZYu<|9u(;xu 9 u ;p=$.t=t$.h,Sh.]"h0,,H,yh,~X,P,0t- t( ,y h,J_ᡀ,P,΃߃Yth0,h;]"菣P=|$.t%=@uSS6^ul$.tS|uZYt*S=p$.uPSj|j*ҡh$.t|`$.PShI]"1e[^_]UE TET]鵮UE MQTU TE]隮UWVS EEU ZPs4s8MIPy4}y8}}9Nj}|1NjE9u|,A<9C<|"TU ETE [^_]. [^_]UWVS UE EXPs4s8JPy4}y8}}9Nj}|1NjE9u|*A<9C<| TU ETE [^_]鳭 [^_]UWVS EEU ZPs(s,MIPy(}y,}}9Nj}|1NjE9u|,A09C0|"TU ETE [^_]5 [^_]UWVS UE EXPs(s,JPy(}y,}}9Nj}|1NjE9u|*A09C0| TU ETE [^_]麬 [^_]UWVS EEU ZPs@sDMIPy@}yD}}9Nj}|1NjE9u|,AH9CH|"TU ETE [^_]< [^_]UWVS UE EXPs@sDJPy@}yD}}9Nj}|1NjE9u|*AH9CH| TU ETE [^_] [^_]UWVSSEEU JPyXI\XPsX[\9|9| TU ETEY[^_]fZ[^_]UWVSSUE EHPyXI\ZPsX[\9|9|TU ETEY[^_] Z[^_]USU EAHtWSHtL t u u? uA] M[]9t=$.uyDutJt] M[]%%.1 []UWVSUv$. $. $.0DžTDž4Dž8Dž<Dž@DžDDžDžHDžLDžPDžxDž|DžXDž\Dž`DždDž Dž$Dž(Dž,GHf tfu7w  PGTPh!%G G$.u fHu+=$. T.u=$.uG GG,98s80wPF`Vdptp9X\t}ptX\V F9x|s x|F9HsHFXV\hlh9`dl}hl`dN uDN 9P}P  9L}LDžpt(,hl $=$.g=$.tvhyl&j ]SpjvYpY[t̃=$.tvhyl&j ]SjvXZtp Yh94}4SZ9<}<$.t6h"vlg TP 9@}@hDPI Xu jj F pP hD FSP=$.t'DFTPT wDD$EEDEȋ8Ẽ0(,EU $EUă=$.t E` %.AX\SQRP蜩RPh j]SSgEЃ=$.t@ȉEЋ@EԋK % 1RPEp<%RPEp8h__"jSXK\=$.t6jj h2"QRj}Wbr@WEp0h# %Ex0'_"=$.u/_"QRWPc=$.tC(S,=$.tC@SDC4S8h$. $.t9=$.tdlC=$.u=$.t@uqC%=uX v2e[^_]UWVS]C=$.tS(D=$.t=$.tS0SD$. $.;+(C;+~:P5%. ZYujyX]e[^_]-S+%. %.1tP  PtF@衸+E졸+}E}ETE}9}~h}EM9M}*=$.tK0KS(%.z}9 E9U~Uܸ UBE뢍e[^_]UWVS ]C=$.tS(D=$.t=$.tS0SD$. $.5+9~] [^_]E}EQ31tWF  FtG;}| 1=$.tK0KS(z9U~U UBGv른 [^_]UWVSQ}$.tG(X=$.t=$.tG0G\=$.7EtoF  Ft_}~;,1EEF,;+| E =$.tO0OW(Ev델 Z[^_]UVS RPuV u1WVSkSh<#S e[^_]UWVS ]SYD1 󫍕t 1;)ڍPRSP ǃutAu$t?vC 1닃u9,vLt?ECQ Zu?t2'e[^_]UxPh|_"h0,/j(%.UxPPh_"h0,jU EUIuK_"=0%.u_"juuh8&Ph h_"!h_"h<#6tYXjjURPW @uh_"h_" tXZEth_"mtRh_"zu+juh8&hP`"h hT`"-!hT`"njURP=W @u hT`"|UthT`"h`"u jƀtPhT`"h'`"X  LW|$wUWVSDӃ=<%.tSD轙_XxjRZYuՃ=4%.t;jD^_tDh\`"ShZ"h0,9 =,%.tjSZYvtPSG^__jD[ZYuMP|3juju2"V t$SVPRNPhf`"h0, ,yh,X*,P,0  ,yh,N_u,P, uЃy~Yu=0%.SDh-! y8tSDhw"[q tVSFZYu4|%=@uSp_tSh`"q[^SVDFZYu.|%=jjD-ƃ y D|hS@ ySh<#pVW=$%.tDž8Dž<Eܣ$%.P %._ujOp$%.V|@q8<=(%.tv(%.߭8 $!mٽJfJ fH٭H۝4٭J4Puu<8SDhZ"h0,$5$%.5 %.V謓ǃ ~ W5 %.@Q 9:St@Dh<#ToXZSYt Sh`"jSVV蔪y h0f"ie[^_]UWVS ~Dž=Ț+u,h~P5К+Ő ~fDžDžVhm5К+ƾ fDžDžVhm5К+藾 y6hf"h~W5К+*à  hf"[h~W5К+ t h?f"5fDžDžVhm5К+  yh_f"0j} tȚ+tdthf"jPXZDfDžVhm5К+蜽 y 5Sh g"0j؍e[^_]HyUPj XZËJ UWVSH]К+tP^К+`%.&.&.\%.&.J.,+F;T%.Ԛ+ uК+T%.ܚ+0hjS臎К+ y!Sh7g"0jК+P%.1ɅuwuК+T%.+?hhSК+ yShQg"0j臤 \%.К+t`P%.tVJuК+T%.+0hjS襍К+ y?Shlg"0j=К+}.uWh%.5К+謧Y[yPT%.Shg"0jȣ5К+К+\%.PZ@u%.%=@u95T%.hg"js5К+踍К+\%.= u'EPhm8@5К+衺 @&.M=`u &.:jjj5К+芺Bu@u8u &. &.&.,+uA%. %.,+|\%.uP.9tB%tP.~IuP.t P.%.H}wt P.J+~m%.%.EUu/5P.t%RVuu. u5P.5+{P.~~1E tlMWVuu ‹MtEπ}t P.HP.+P.+Ț+1 P.(뽍e[^_]Ã=&.u =Ț+U~h~P5К+ Ț+Ě+=&.uNUjjj5К+$yhg"0jv RP5К+ x11U=&.uhg"j?XZ$`%.t5D.5P.h!h"jUWVS] }1WSu* ~ )ƅuƉe[^_]UWVS] }1WSu诇 ~ )ƅuƉe[^_]UVSUM Ț+К+=&.u;QRP蝈à ~G&.9P.tsP.tg`%.[QRPbà ~ &.>Ț+t5̚+#Vh_h"0j5̚+hh"j ؍e[^]UVS] 5Ț+Su5К+ƃ 9uĚ+&.~1Ț+&.tH~Zjjj5К+ӵ)RP5К+賱 Ț+18uȚ+1 8t8EuR8 uhh"j輜Ț+Y[18t8z8u!kxt Ě+&.=Ě+u Chh"_u5̚+hh"j< My̚+EShi"0j,.Ht u h#i"jhYi"jXZe[^]Ã=%.A=Ț+4UWV,+w hi"&.t &.&. Pt &.(fEEEPhm5К+賳 xyȚ+&.5%.~tjjj5К+菳x5jWVRPh})WV5К+d&.=Ț+hi"j讚Y^hi"j蛚XZ1e^_]UWVSu} E@19Ț+&.jjj5К+ŲӃx׃=&.u%.E%.9u}uljM]jWV5К+}ҋM]y%hj"0jɚȚ+ )ڋ]S1 =&.ue[^_]ÍL$qUWVQ1yȚ+m&.u9?hNj"9+jjj5К+輱y ;h}j"C)y11҃=̚+~ hj"jRP5К+{hj"0jəȚ+ Ț+P.19MQRPWVxU Uthf"jmȚ+XZHfEEEPhm5К+貰 y)uNVhj"0j Ț+ Ț+1eY^_]aUWVS0,=,+u,P ^+H%.L%.Y tDžDž=.=,+[hZI"WV5P.5P.;{RPVhk"hW5P.5P.h,k"hVx0WVh7k"hV]}}t^=$&.tU5J.5J.h,k"hV Vh$&.hYk"hV(Vf$Vj{ =,+ubh$J.1WVRPHzRPVhk"hVV5J.hok"hP0hZI"P.P.P.P.WVRPyRPVhk"hR55P.5P.h,k"htW05P.5P.h,k"hVRWV5J.̚+HP.0hk"hP8}uV5D.h!S%V$Vj~ }*e[^_]Ã=К+yJ.&.&.UP. |.t@=&.u7=l.t 0.5D.hk"50.50.d=\%.tJh%.5К+1ZYu4%.%=u#%. %.u5T%.\%.Y=,+w=.t+~ jP~XZ5К+W+Y~jURP= . |.t1=&.u(50.ht!gl.50.芍 К+&. &.uJ.&.&.=.t̚+. |.t=l.t0.Ll.=.tg5D.hk"sYZuQP.P. tjhRPvjh5P.5P.vRPhk"50.Wj50.蒌J.XZUVS Sh4.j{ y螷hk"0jq jjSj{ yrh l"0jE %.=Ě+ @%.=.u5D.h+l"菑^X5T%.h+VqZY=hܚ+VqZY(&.̚+uPVh[l"5hl"PVhl""hl",+whl"h!Y5D.hm"hhLo"j XZ^RShN.hN.V)؍N. 9e[^_]UWVS E.pFE1۸N.RUPZYU9tVuu hqo"'xt1뻃=,+uho"{ho"jG[_1hN.h &..P$XYҡ.xtt'LURShN.P8 u~Hu܉>=,+uho"jь^_[hp"jY[uhN.hN.UEN. xtUh &.P.tE y,50>.mVhp"0j?h &.g1jh &.[XZy EPh &.E/h &.yg =$&./u([<uh$&.豮$h%&.h$&.R t EPh &..h &.$g =T.tuh &. /ZYxċ.t50.J~Puuh &.6Ph$&.O8l.Y^J.h &.EZuyVh &.`.^_t8=.t=l.t0.al.Vh &.&.Y[EPuh &..PDVh &.-=.t=l.t0.l.y.P4MEU19|J.J.19}RP_^ZyRPPY[xCujh4.jq) =.tl|11e[^_]UhhJ.YZu hp"0j݈ hJ.蟬ZJ.1UuaZ@tɬhp"0j蜈 US]S Z@u蝬Shp"0jo][UWVS|uu V"_Z@uSatE tNu3A8xPV7"ZY@tE%=@t 81ۉ؍e[^_]UWVy .PHx꡸.P xjLƉX)J.Pw8URPh &..P@ uˋEUJ.J.RPLYXh &.yWZh &.E\Yh &.'VZjh &.WZYuE=$&./u(d8uh$&.躪$h%&.h$&.N h,WVh &. 3,@tΪh q"0j衆 'J.J.J.J.RPmZYH.P(jh4.jn[U 1e^_]UWVSy .PHx꡸.P xixjCKƉ[=.t-5(+rYth!q"0jх =.tdcy[|DžlJ.PwMpRPh &..P@ u!ptJ.J.RPKY[th &.lUZtJ.J.J.J.h &.#ZZu؃=.txPh$&.Y[t. .tkxPh$&.u[ZuT.=.t/t/tJ.9EExJ.|/J.9EEJ.|WutJ.9EExJ.h &.qSYjh &.6U[Zt0h &.`J.J.J.J.RP =$&./u(~5uh$&.ԧ$h%&.h$&.K t. p.tgxPh$&.qZYuP=t.t4=p.ttJ.9EExJ.|+J.9EEJ.|StJ.9EExJ..t10.J~PWVh &./Ph$&.B1l.[X% 1lth &.6YYSPh &.|O xסt. p.u+=.50.h$&.o*l.XZ}tPh$&.YZu=t.t;=p.ttJ.9xJ.|J.9J.tJ.9xJ.]J.=.t h &. h &.Y+J.tE t@wpPh &.YZ h &.%Zh &.WXjj50>.dl y80>.d_dRhp"0j+{h &.W jh &.YXy#lPh &..h &.bW Rdlh &.l dy Rh &. Rh &.YXlPh &.XZ=.x=l.k0.l.Re[^_]U Q. S.=P.u .@P.P.=~~ h~Phr"thPhJr"jySP.+5T%.Zx0P.P. Q.P.‰Q.Q.1 yǃU Q. S.=,+u;P.t2=~~ h~Ph{r"thPhr"j\xF5T%.pZx-P. Q.Q.Q.P.P.1 hyʃ Q. S.+~P.~UWVSX.t hr"jpP.=P.+uP.ZRQ.+Q.EU EU=+}EuuuuY[׋MщƉ;EE}u}WVZY+u} Q.+19}dQ.Q.Q.;Q.s5P.PYZYQ.+ Q.RP=Y_xj Q.Ɖ5Q.+Q. Q.Q.+P.EU)P.P.P.P.x,+hs"jYvXZ؍e[^_]Ã=+US=,+uh:s"j$v[X7y=+~pC9}kPhos"ju Bx]P.P.15+5 Q.(ZY~ Q.Q.‰Q.P.P.1u빃]ÃUWVuM Q.)ȣQ.^_]UWVS ]CDž$$ x$|$x $=.u15xPu yY^y狳Vhg"0juPufy_Zu d#誙hs"0jwuDžDž5+5 Q.u u^ƒ  Q.9|RPu2 (WQQRPu=9ugy(̘Vhs"0jt9|$u9x$ths"XPu xZYy`Vh t"0j2t.E49}u;0tht"js9}3t)1;x$|$}Pu ye[^_]US1ۃ=Q.u~5+5 Q.XZ~" Q.Q.أQ.ؙP.P.Cu4=.u Q.,xP.P.X.؋]ÍL$qUWVSQQEE u15Q.=Q.)9}Ή5Q.)ډ tƋP.]؉}܍uVuuRPQu}ӋEЉE؉]ӍEPSQM؉] M؋]ywEU)P.P.195Q.+Q.ؙ9|Zx t%u؉}9}E؉U܋EQ.+u}머eY[^_]aUWVSU Ӆ~HQ.+Q.U U  )څ$ 9~؋5Q.}5Q.)É}봉[^_]UWVSEx$|$hDžpDžl } xJxPu tZYuEl(hhs"0jpDžlltE@Džd19 Q.+ Q.ș9Ή}hlpPtPQ5Q.u  E0xQ.=T.\t7ƅc;\tdAƅc€ctQ. \Q.)&} x7pt%1ҋ];x$|$}Phu v 19|=T.t t1L} yEP] u41}d9$t!lhhBt"jIn le[^_]UWVSVP.P.19| Ef;P.P.}hlt"jmIY[P.P.$+ Q.‰Q.;E~1}])É]15+5 Q.XZ95+uL5P.P. Q.}t&5Q.NjM=Q.+;E)E롣Q.~@5P.P. Q.E)։׉=Q..Jtbt[LP.P.:x/+ Q. Q.;E})lj}X.؍e[^_]ËQ.; Q.v.UWSQ.)1Q.5+1Xe[_]UWVSu] ~>Q.+Q.5+Xx 9~Ћ=Q.=Q.)1e[^_]UWVS1;EE }PQ.+Q.5+Zx5É9EE }]u 1=Q.=Q.)]u 1e[^_]UWVS]x$|$ $=.Pu o_ZyzHVhg"0jl[Q.+Q.~^9}P5Q.u U )Q.1;|,5+i^y}W t ht"UxPu oZYy`Shg"0j2k+0}94u;Etht"j j }W1vSht"떍e[^_]UVS]E $usPTYy踎Vht"0jj$tHP Zy$膎Vhu"0jXj$ ǃ$ .Xe[^]UVSĀ]s|PVXYx_.uM $M9$$u@;|u8,$M90$u';Uu"xVh0u"jh x 1e[^]US|]EPS0ZYy1=.E%=@uBh`%S9HZYuZS~Yy} tQSh_u"0j#i-SZy50.a"Shu"0jh]UVS]EUdhDžlE UptDžx}=$+t = +|PS^ZuZ=$+u#EUdhEl= +uuhxx"j Xuhx"jQWY[HV|ZH~ 8/u3E ؉CC=D.uD.@.X@.1e[^]á<.t@=.t 4.=.u4=.t+UE$u8.tjP5T.+ US=.t8D.1t6{u+uhx"jfVXZ3h"h0,چ [Ƌ]UWVS]=4.u =T.u&4.yx5T.%8.ZtHHQf $./x.  +=,+uz~"O`..=.u `.d.$+c.C5l5VZ}1.e.V +=P%.$.`.l5.. EP9~5UxPu{ EZYUuh5z"jLFjvmEMȋ l5 .HUP%.#\..|.r5l5DP%."ST%.t+DT%.h+5T%.\+&T%.P+T%.D+T%.8+$+l5P%.$.+.5l5CY4..z ,E,+uUu 0,}u, 0.Hw6}u 9Uuj kLƀ+5..t HuP.Ejh~"jPDeEh~"P$_ZEh$"S#^_E@E.`.}tE8XEMth"W#Y^E,t&hH!WtE^ZuWh"jCEEE5ƅ}tES| [h$"V,#ZYu`.V{ XEjh'"V[ u=`.t EtS{ XFP V{ ^XEERjSV E2EE}t EtSN{ [h"Wl"ZYt uXX=.~W?Ej5.S oEOExtE.O}.E@EMEh$"S!_ZBE@@EjPA[^}uEh~"P|!ZYuEXEh"SY!ZY,ud1҉UDžUuhsh"S&!_ZtVzWY=.rSh+"ztjP^_y,hH!Sq_XuSEtj.h$"W ZYt2jh'"WY ujjW2Y_=0EjS+}1T%.t 8h!GT%.Yt 8T%.[ D. 11jh+h "SuSz$lc"p+Ã뾃l5P.5l5h^~"..wl5T%.e. SP%.t~"D.@2.΀.l5l5t*tF[tpt=.ttjbZtF}QtuPU!uX1C<]tIoEz-u)BE<]ttE9E|E9EZ뼋U9Uu1}!9A8Qt e[^_]UWVSS։M:NjUÀ8/uXJ) ~Suh,"jB7C։9r HNHNs19rЋM}t;ur NH^X1e[^_]UWVS 5D.hF"V6[_Vshy"D6h":6h˂"06h WI6h!WdZYuhԂ"WA[[= u h"5Y덊uh"5ZX<.uuh%"5X1u8L@%uߋL@LtFCC9r<9u(>t#LRDh"jB3tNL@tBuDh"h0,c RDhʃ"h0,xc<th RDM, 1e[^_]UWVS}tExu hԃ"%<\u FFu"8ujb Xu*h"jW2[^uhl"jD2 ]CjWP ǃ t4hVP_uVh"j1 Sj Y릍VE֊t<\uF8t+F4mSlj uhl"j1^RyZu%lS4j h"jr1)NCtXuh"jBa Xuh"j0Y[G3CVZUZC CECE C= .u ..X.1e[^]US .1t6Cu+uh̄"j%0XZ3h"h0,` [Ƌ]UWVSPu .1$.Ku Kȃ=.Ku $upFPn_u!h"jx/CY^t/CcCt /C;WTZC Hǀ?/uC C$% .׋R9t Ouh"j/ZY1ESg dž$XEe[^_]UVSudž$ .u=.tA=.u8zCtEC |/u&PFP3ZG u$=.u-1C[u1=..KVPYVAZxdž$e[^]UWVS]=+tjs{.u{.u Ct:u h "j/VRZYÅtCFEEPtOzЉ vB,u}u@EE'}u.tVh8"j/& EE@jV Xu h\"(t;u GKGt=tyVh"&O}teE8t]Wyuh‡"jN%W] aGƒWt(G 9OG}Vuhއ"j%W] 8G=.u=..x=.1h"j$XZe[^_]UWVS M.tmƉ׹=1EӅt9{t[93u@U1ۃ}t5jU YUuh8"j^$XZ0x@ PE؍e[^_]Ã=.u1Ujh X .YZt1hW"j $XZ1UWVS}.N1$?4$E1}*,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[ujS YtGGP,Zt0 $$$CSEC ECECEC1~S[ Yh"j"XZdUh 3 P= 1$$CHKUwEK 3U[ SO[ [^Ee[^_]UWVSM.4$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3Z X]e[^_]Z e[^_]UWVSQ=.t71ۋ4t%v0EcZ EPZZ XZuC uˍe[^_]UWVS1ۃ=.jhGU .^_uh"jU!Y[Wˈ"=(.5,.ã0+Zu5,.4FVhو"0j"5,.芈X1ۉ؍e[^_]Ã=.u1Ujh?U .YZt1h"j XZ1Ã=.u1Ujh=U .YZt1h1"j} XZ1UE$$ $]UWVS]E=. $$$,$!Ήu샻0$u9t!ȉEEEEEE1ɉUƅUt!@ xu }98M@E !1 ЉE} P $$$ƅ}uM}tGjO _@ $$$AQ F AN 1Rt$.... u'.U !ƒ=.u`9u\1tL.=. t:Uj?O Zt+MMHUPx N HF $$$3Sha"jph"jd%P @ $$$E쉃,$ǃ0$1e[^_]Ã=.u1Ujh=R .YZt1h҉"jXZ1Ã=.tDUVS1.0tjjs sss3ӵ[$݃uʍe[^]UWVS$EE} EEEƋEEEU E܉UE$U(EԉU؋ .=1Et#؋M9Hu9p u M9Hu9xt@$uj(M X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!R{U XE "Ee[^_]e[^_]UWVSEEE EM}.tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3T ST XZ1e[^_]1UWVS]}E=`.t,;/t'PSbp^ZuSh<"j |j$6L Yu#ShS"j tXue[^_]3T SZZtGFG4W8F VG(W,FVGlFF .F5.e[^_]US.tvC.=d.u{ t s3蚴XZ$+  +tjjssss 3=+t s3YX3nS ShS .XZ놋]UWVSQME @~ L@119}@4tEE1ɉrU1uZ[^_]UWVS u=.1FhGSPf <9tjww 50+b2;Wu;G t >h"*SR50+z 9؍t>h"0j SR>2 yjI Xjjj50+1G WxPS50+Ez 9u+T$X$GW.W81d>h" =hԊ"0j WxQ X9h"jZY&T$X$w9_}_We[^_]UWVSP.uh"ja_Xqhu u E߅t7uY^ƅtcj H ^t;uƉYt#uGZt _E81QVP XWP _h]"j[^0_SuZYtSeP uG_ZuhB"‰e[^_]UWVSu} .t=h7V t&3V8ZYuusV;2 [֍e[^_]UWVSSljӉȋU t 1MLtt JuQ 9Q1 QA%QA Jك0J t9s'x19r)AE9r)ЉEU01 ىZ[^_]UVS1ɺ4Au񍈜9s AY[^]UWVS| uB¡,Ɖ 19tSP*u Ƅ.'?u Ƅ. fD~u Ƅ\ˆBƄ9/u Vh"h SASyEVh"h SASy=Vh"h SASyVh"h SASqe[^_]USSˋ t)RQP/E3M UEeveRu P/ ]URPh"jUjh葨ø1҃=.u1UME.1Ҁ<u Bu5} u*J=.t.8]UVS]} ~z;tujh&"P, u&4+u 4+Ehڋ"jXZ 4+jjPƺ 9؍e[^]UWVS5Å3h"VA_Zt+sVh"jKh~"h"hI"j5 2{h~"WZYu,+vWVhw"j.m1e[^_]UWVS]u hVZYyn- 1Cǃ4$WvAVh.. i Rh.. F jjFdP%($jjFlP8$jjFtPq<$$jj F|PEUUEщx$|$ @uAjj P$T$X$H$L$`$d$Hǃ$ǃ$ǃ$ǃ$ 2t~,1ǃ$ǃ4$($Qw^1ҀKƒ $x$|$ށ$ǃ$$$ǃ$($y($|/t5uǃ$@($ǃ4$Hǃ$΀($x$|$%$ǃ$$$11Ҁ|/uDЍe[^_]UWVS u$Pwo$e"=.t_h"hƌ"h"h " d~ Ph'"HuCVc~ RhE"1jdRPr*dž$dž$$ u#EƄ/jj o11 Y[1u9E2jd PEP*jj o11wE1Ex$|$ƅz ӍyHσ0P uSo1ɍn9r)ڍJn9r)ɰ0󪋅%$dž$n9uhc"+. .t .. T$X$($1jjW_Z8$1jj_ZY<$1jjgtY_jj {O_Zud1jjM/ZYuDhS[_yHjh6ZYx鋖$  Ѓh"j e[^_]11UWVS}} ?jh&"V% Åulh"VY^¡. . u.h"j} XZjjPʻƺ 9tPVh"jH ؍e[^_]UWVS]u hV/_Zy - 1{ǃ4$EYt"h YPW&z/@E K<vI +UVh..E Rh.. f jjFdP輺%($jj F|PEUUEщx$|$@uAjj PmT$X$H$L$`$d$ƆH<$P)PZyjjFtP<$ Ɔ(8$P PeXZYyjjFlP8$ ǃ$ǃ$ǃ$ǃ$ǃ@$ǃD$<6tL<5t_<2Pπ3@$%jjI^_tO"W"@$ % 1jjQZYujj |11^_ƅ6jj |11vZYyW"wu ƅ2 u ƅKƅ1jd PPK .jj |`" u\ƅL5.%$$1ƅ{H0H tm9u H7x$|$%$ǃ$ƅ{H0H u(|19r)A9r)ljư09uhi"DžustafDžr=.t fDž fDž00($1jjd^_t;#8$1jjlZYtz%<$1jjtR^_t"W. .t .. T$X$jj ZYt" j8$Lj<$Nƃu2"j W P u2"j V)PF1jj|t"hP&^_yjj lZYx .u$  ЃY5.Pؕ¡. ..^_x)ЙRPZYyxe[^_]UWVS$É֍@- 1uh hf"DP@ @t . C .@.RpXe[^_]USP]S%&Z=vESh"j; U؋]UWVSu>-u~t2hH!V1_Xu$&0O> PVh"jY,1EPS褠ZYt/G}vEVWh"jEU`t1,t SXe[^_]á.t UU RuP贍5..UVS]u F1.tRPSh\ tD3j SZY1҅tЍe[^]US]}t X.|. .t!=l.th0,j q_l.XZ5D.h!h0,-0Su h0,h0,j 6_ ]USjhU!Y[xEhB!P.YZt&hH!S.YZt135.qZSzX=.thU!h"j ]UVS] u}t X.|. .t!=l.th,j q^l.YX5D.h!h0,-/Vuh0,~S; Ph$#h0,/h0,j ^XZe[^]UPh"h0,.ju% .UnPh<"h0,.jO%UWVSƋ=8.tPhc"h0,. =0.u ˋA%=tjR0YZt"8t͍EPsXZ=4.tVhq"Y^XjsRIjsJG2"} t$VWPREPh"h0,-h0,,H,[yh,Y,P,؃ t+@t( ,y h,Z㡀,P,Ѓ1Ylje[^_]UWVSAօu"VPA[_tDžF%=t1jh @txPZY{x~9|u,;u(^9u;F u%=t!.bq_jjjS  ׉NX^\19ȉ}{9Dž Dž| P8 ;x+{[Bjjj & NX^\19ȉ}{9Dž Dž| Pg ;+{ Yqjjj UNX^\19ȉ}{9Dž Dž| P ;+{'<Zjjj NX^\19ȉ9Dž Dž| W ;PPW? +^;P_jjj ~\vX19}o1m u9 |QP 9u#)[@I&@.h<#躽ZYt X؍e[^_]UE @E E@E]BUVSutYSC t } uC0.@0.R/ s/ S/ 0.H0. u,.te[^]UVSu0.@0.`.؃8t VPjZY.u 0.u,.t e[^]Ge[^]UWVS`..1tJ9tGjP ZY9u؉e[^_]UWVS0.@0.ƍP螨Y11ɋ`.tx?tBA'u9t h" 0.u,.th{ jVS19}Vph"N p<T+HQP yP T+H Z J GS萨Xe[^_]UMtA'1`.]UWVSu^Nj7t#vuY[Åu jWXZ ׻؍e[^_]USh!莿ZtaujY1"1.tP{ Ã.X؋]UWVSP}U UWRW"ơ0.@0.$zW讦CC UR蛦C0.H0.u,.t e[^_]e[^_]UVSuV[t#sVZYu} tC t1ى؍e[^]Uju ZYt@UWVSS] 1}uFYj=GPZYjWnZYu$Wh"5P+ ;ubEWh"Ep T+HQP yP(T+H Y뮋J @PW^XZ듉e[^_]UWVS5 . ,DAt]jEPV..E b"t%MAEIb"uV)PRh" .!b"tQ..Cb"u)BUP贤.NjU. .Xu,ƸN ~|tH9= V~-t >޸(%)&#Ƹ ƸN .e[^_]U5.Ph*"`UWVSR5...PmÉ5.Y=+t J"uMt;u&jEPSÉ 8uE8t+8t["^b" tBUUu؉e[^_]UWVS}։ϋ [M]Pw$ԑ"" ] ]u "U#UBu u" uuuWV uuWV ENj]ÉeEU+EUM? t1M? t1;u] 19u] 19u]|f1;u}}U1#U1E1 U1E1 1*]!؋]!]1؋]1 ] ؋] ڍe[^_]UWVS }Ӌ7V+_=.%us Љ UU_EU=.&t "JE..S1 }VڋExYtEUe[^_]UWVS(Ɖӡ..EЉU:tSUЉt@ vSUиƉX^MƉׅuGMIt!EM̍YWVщ‰=Y[ƉWVh j]SjSu  e[^_]US7=.)u []UWVS,}É׉MԋEEEH7..W ]ԉE뭃$" "tCك9UЋE4Éָ"=.#|Eԣ.}tw PÉ֋Eԃ'wI.}1҃}'tRPh jURjUR7Eԣ...W]ȃU]..WuЉEiY1 1..WuЉE6Љ҉Xz}t ŧ"A.}twS.4Ɖ׸1҃'tÉRPh j}WjW5.L  "둋M΋EEʍe[^_]UWVS}EUϋEsá..EUVUL.Kw\ "8 "}GVQ.YYuRPUMY_Kw# "9M~߉EUouȅtče[^_]UWVS}USƉ׋ .AZwSj ƉXZ=.uJE..MQ1  SUEY 1ۅÉ!1e[^_]UWVS}U?WNƉX=.uKE..MQ  fWUE Y 1ۉڍe[^_]UWVSQMq}Wg5.XjLPvZYt5xIu,xNu&1҉Uj PUZYUtB@)։5.@뽉. .1=.t "PEԉUW耛EԋU؍eY[^_]UWVSRE} 2"_4+0+.5.NW;t+ .sx)e@׉ċ7 .tx @U6@ Uυy P+4+R5X5.SƉRPh3#9 e[^_]Ë.Ѕt#/tt@. @.US]u1Z;/uPh`%WZY@tEPSHZY@tҋM9u;Eu3U3E ]UWVS}VDVP9 tS .Y]e[^_]ʘSĘ Z8"u뺅u 0" Ph" e[^_]UVSu= .uG=+t0+h%"PZYtSv .Xue[^]1e[^]UVSu2t = ..tP Y0.@0. .. .jM0.H0.Zu,.tI = .t.j5.h""j5 .h%"jh%"[^1V! @$赖.VP 4+0+. >/t[5 .>t'.H.FxFCBXVԀ~/u#.Kh!VZYu$4+9r 0ƅuh.K;/u>th`%V~ZYt .x/4̘X/ 还XV>t.H.FxފFC94+u .x/C X/=.uk.0.@0..tP X ..54++ .j5.h""j5 .h%"0.H0.u,.tB؍e[^]UWVSSuE E}0.@0.VZy$ 0.uu,.tkEE^j*á0.H0.Yu,.t}t)=+u =+tt5 .Vh"XZ!Íe[^_]UWVS5n+ƅoh)"bYt ^t>hM #WKZYEthA!W7ZYEuEEEEFHπ\ug}taxP0tB<wI$$"AH1.62 . * & " ƒ0wG\9uӡT+HyPT+H X JS>1e[^_]UWVS]u }+t+9tx u h+KX(.X.u貦Ph!hl+ $.t$.Ph!hl+ t&WVhl+q x0h$hl+ZYxSl Ph<#hl+zP+HyPP+H X J El+e[^_]te[^_]U8.u*U4.jPt}UU ,.0.@0.tuRj u0.t ,.U,.EEEEjEPj] =.t=+tj;jjVj U=.u .E Puj$UEPu uUE.jUS]Su 0uUuu 0uUEPu juUuu jguUS] 5Su0H ]Uu u0+ UE Puj Uu uj UM"ft9uPU t@Qh8k&j h<.0<.áL.UWVSP(YuOƋjjP=ǃ t 3;ZC jjPǃ t se{Xe[^_]USj袣Y.8tN++oT.thB sZXZH.XjjSP5.##1]W|$wUWVS ƉӃ=t.uj'Dk=+u5tU.VUt E܃PuRXZ=l.u VX?\VWXu P.tje[^_]UWVSSE} _4+0+.5.NW;t+ .sx).@׉ċ7 .tx @U@ UυyP+4+RY`.PSxXZ P.P.e[^_]UVS]h.1jsEYX=+=l.tUl.up.Hp.yl.빃up.Hp.Yl.MwE5P.=P.; ut-t)E Ps5P.XZ=l.Qn h.5P.e[^]UWVSu=P.=+u1EP跂E؉E܋^Zt$hPS!L =l.h[E؋Eh.]؅:F.=6+P .P?Ph!v P+xWPyPP+H =X J=sP+xWP_yPP+H Y J 5P+Zjsv iE Pv<=P.=+uNl.t>up.Hp.1l.Hu"p.Hp.l. h.=P.EP踁Xe[^_]UWVS]uVE؉E܋S .jPshJ[tt=l.uk{t_G.EpWPZYt@1=l.uA=+u81; u{C.u s *P.ZYt‹띋[1P.VXe[^_]UWVS]} 31Es(X=6+{5. .PPhZ"Stj RU5P+UR hn"Xu h}"XP+HyPHP+H Y J 5P+Z0.@0.ujSDeuSPE:ytUtVuduu 0.u,.tdjsWs Uu P. RoP.X 0.u,.ttJ=6+tA{t;5. .P荛Pfh"\P+Ee[^_]e[^_]US@8.EEEEp:X=6+tlExtc5. .PZYEP$Z"[EXtj S5P+ [h"Y5P+/[EP/lZtiE8.4.VEąuKt&:EPf$"ZY5P+XԋEtP.j58.k0.@0.Eȣ8.j EpXZE 0.t2u EpY[0.@0.E8. 0.t,.t6뾡,.t&Eąt"EP$"X5P+Z]UWVS}] CCC =+EPZ|0.@0.EYy h" jWbjWPvu50.,.t\ujujWuE؉s 0.H0.Zu,.tEPN|Xe[^_]UWVSE 4DžHH.`.0.,DžhH.EPI{YL.E@.txEXt7u!C.htPS~D 1 s荔Ztҋ[ŋxEp X|EEXtC.sH_uEDž<tj|PSC [뵅tt+P+HyPjXP+H  JvX6 뾋Ep P+tRVP t vHyP XP+H J 5P+_y|sjh"V u `ԁ}ę hh8<1(Huw)<)<88t#`EA htfE=.u Ext,AEftfwE= t=} txˋE@ft50.@0.juy\[^DE@@4t14t>Dž@Ey h"=+sf}hExt x U.P.H.Ãt t7 0.tS $h",.t ݍEPdYt.4.uH.j.uP.P8.HE8.h!|XZ@D5H.RuP\4H8.P.=H.H.ujjSFk @DSRuPn@DRuPn 440.,.J@=H.t*ub$uV_X440.,.t~뼋Eft%f}9 84t lPEp Y[}.f.HftftfuEEu E u=̟+yƀx u1ETtE u =̟+yuZYDž5Dž\t̟+f~tF\DžXDž`juEP]` W`.Zu?/ug`9\|Y@Ph"EmZYtuYDžt5.h"mYZuz`9\hxPWkHYZy.[8BM84?X"E%==.tlEWLȉ`+4+$>_WB^ju3ƃt fx`tWuh"QW`bXZ0.@0.dTujuY_f~udfF`FDžX BtEt$jXYPuh&5P+f`z0.@0.dTujuEXZf~udfF~ 0.u,.tIF FfF CfF fCFCe[^_]UWVS$E1EE1EEh"uEZtQEbw$"E1EE뽾EE뤻띅uutjY1҃}u3}u-}u'}u!EEEE.81.tWFft'ftfu=}fu1} }u#}tуufuUSVuXZUЋ6륃|u5T+载^T+@h"[EjVJZYt]@ft<.fu}u>.P.0ufHu*}"fu}}t˃=̟+x tH.PuЍEPVt f}u/6tf}tjVY^t jPXZfu]]u}NEe[^_]UVSu 0.@0.juTË@ZYft&fHu sXfCFC fFC FC 0.u,.t e[^]9e[^]U 0.@0.fEEE+fEu EEPuN0.H0. u,.tUjuZYtfxupgX1UWVS E11h "rZt&ptvtVuEҾˋE ctM t Ph"t h "E .9u^"ct2"QPhC"}uSa_"uFjSXZ1ۅtHwh"謼Y_ur.P.u* 8uSPІZYhm"j w= th{"λXh"輻X{.8tT+HyP胺T+H {J P}u#jSXZdGfEGE PjEPS1EfftfHfj/S[ZYu]EEԡH.}tEjSEP3EPXMyu"u2"Ph"[_udjSpZYuuQh#XDuq{0 Phn!޺ 0uh"u~t}7F>uD}tt\JCt0Pxv"/u utFtFua .EZxvtuGXtG;Mu5._txP5.#1[^yW9tt3;ts+JxvtuxE]C͡.;EtP9Uu8/tMA `%w%P^vYE9.t@/>tF1tJxw@tu@p,.tSakYF/|SևZtx .u p.uȍP jRlt; tltRuº5., 뇋EB@JHu@/VPXZfe[^_]UWVS}P v Gu+EHEt7_rxv"tpu uߍ_Ɖ+E[^_]UWVS]{FFu$.si$.Xu11@.+4+EuE=++<@!<*}tE<WE)HPh"迯1}E%}}tnUJ~@.H.Fx@.H @.N։U?H @.NU뻋EH1҃}~׋U)@Eu uPW1} G@.+ 4++Eu)@..} u1< @}Š" <w2 .x@.H @.U>H @.U .x@.H @.Uu>H @.UЈFƒ v! .xM@.H @.FuJ .x@.H @.ĈU>H @.U뫈U=H @.U1uut?@u=.uM @1 1E @΀} M$"5@.P@._X u  E PuhY[E؀x1 .@.y5=P@.=@.+=4+uuuuWu=u#@.+4+)ʉ@.@.uuZEu=uuuWu\euEX~1tuС@.+4+Pu }uduڋM}u EMEtr|wt<.<.׃uy}Qt@뿃uHuEe[^_]UWVS]E %EEE tE씡+.u .E@.+4+E;~uE t u SXZE 1Es}B~< ^$":=L{s{u{y{@u{=uzD.E} t .@.y:P@.1e   .@.y:P@. .@.y:P@. m=D.t*@.+4+;U~xuH@.E xuE E % .@.y:P@.}u C< w .@.y9P@.s[ .@.y9P@. .E#E PVu R<.pZ<.<.VXU .x@.H @.U>9H @.U߈E {~=u}Eu V[X u. .x@.H @.U8H @.U߈EE RutZY@.+4+jPHP uމe[^_]UWVSEu ]=Ơ+tD.P <.4+@.0+.,.(.P.Sp XZu&@.=.u7@.. .@.y7P@.@.+4+P4$. .XtCh .W+$.$. ._XÀtS5 .q+5 .eYWjp4x$.$.XZh$. .tNFe[^_]Ujju54+@E 4UWVS$EPEߋ5@.+54+hREС.H.ZYx@.6P@.=4+V W]S|4@.+4+P35.WݘEԉUS44+@.)Љ@... u6@.uuh j5@.c@.׉Gu}"tj)PV[ @.)O@.)=.EЍe[^_]UWVS] =,+5<.,+1}DPuXZ@.=.uk5@..=,+5<.u54+}t }tGvwE8tVh"hl+Rj"Eu"PSE)HPh"ӤjVS连+@.5@.).e[^_]UWVSu=,+<.,+EvvE%HPu~XZ@.=.uf4@..=,+<. 4+}M }} }t=9s@UVWQM MUt <CÍY9s16UVWQMM MUS9st{u8u@@9wsS맍Y9rVSQM SMt9s{u8u@@9wsS뼉A9WVSQM u;Mt;uCCӈ)ȉ+@.@.).I9tKCCG+@.@..x C@.2P@. @..e[^_]UVSu]S0F <.4+@.0+.(.jvX.H. x@.72P@.@.+4+PA/ju PES0Ee[^]UWVS} EHPhw1".T+pVP[^yP}T+H Y J1;]}4#ZCVh"ґT+pVP^YyP!T+H [?J4T+pVPYyP܏T+H XC;]| J1e[^_]Uh+"ˠUh+"辠UUM П+t 9PuH]Ë .1-П+B t xt 1z1. .UWVS}u ]0.@0.П+z tj-П+J B ZB$B .P.P.P XtK =.5. 0.u,.t e[^_]Fe[^_]UWVSQ5П+^ 0.@0.{t-WRU:ZtUD< t< u H+Hg C.C.C .F $9tSղ X 0.u,.t e[^_]駞e[^_]UVSPП+B .tAu x6 .xzh+Uhl+K[^=.П+X.hSП+pc yu..BT8tП+xu?8#ujjjd xtPjjc xhM"Ym.П+@П+B..BÊ5П+V@t tBV+ . .1ɅtPCË5.V.+.H.u=&+tE5.M5P+ыXZE.P.~e[^] .x.P.U=~u! .x.P.]]UП+.P .P.Pԟ+Pj8~)П+@@ @$@П+XUVSu] 0.@0.h VqjjVbtjП+@~PqZП+s{uh(CX..ԟ+ 0.u,.t e[^]Oe[^]UWVSĀu0.@0.jV`Y[y Vhj"薛ÍxPS#{_ZuE%=upjjjSҎ u]jtWS\` u"jhx"WW uSZaVh}"jjjS膎 tS9aVh"So^9uSah"u Pp0.H0.ZYu,.tAe[^_]UVSu]0.@0.} t5.V6Z..ԟ+ 0.u,.t e[^]ߙe[^]USП+0.@0.CxPoXCtP踭 Y{ t^П+S蝭 П+P .P.P.@ԟ+0.H0.Zu,.t ]C]áП+UП+;Et!=.tG}.t h̭"舙Á=П+.uU=П+.u]U}u$П+@~PnП+@XUE9 +uE +]UWVSU.)i5rO9$+t=.}1$+!߁9CtF9u }t}tVǁ[$+t?iӀu.tiրu$+$+XZ[^_]UVSu95.=.0 +tPmYjhU!C] +[Z@u$1SvYuCuAS>a +Z@t5 +l +h0 Pm5 +g.yh"萇+X4`;.t jj肄[Xjjzjjzjjz_¡.9t Pj讇ZY@u0X hd5.5 +&gY[@0+ hPh5"k_¡.9t&PjH[Z@u蹖0 hPh"5.5 +fZY@u芖0î h5 +k +jjyjjyjjy5.e[^]UWVS]u+.i5rOCSh]"0.@0.19~Qi@tǃu=uFjRۂZY@u谕tP Ph"袕9+.i5rOCSh"}r+J΃utBƃ 0.u,.t e[^_]鬔e[^_]UQE0.B0.9tER荨 EZǀƀ1 0.u,.tDUWVSTÉ։Mt&uPhx!S KE:EtM }~EtEtPBEMB;EtMt'Et!ǃt=tt t tM IuE0u#E@VYEEHEuE9u]=.)i5rO $++9t# ti1;J-R@Ph"jEPhݯ!jEPЃ URZEUt%‹E0hȮ"jRU衃UR辒ǃE@T=uhͮ"R?YXu*tQhծ"jRUfhE%jRCTu =t̉UQ j URP,E@Ut$R.Ǹ@)$D=Phޮ", U:Plj$UR܁XZKySP Y P G~SEP襁XZEtP}KySˀP _ P KyS詀P|YFP|:}M}tGPh_d#S iEM0EKySKP Z P EEE~SX?e[^_]UVSMt$t 119}/ivtC䋉1tJiD} u&ƒuu=tă[^]UWVS utJ>%~W+[tW&+XY "6Ft~uL<-tF<+t<,t><%u:$+"$+i."..E1MxdtS~JH~?u(UFPQMBYZMUt UQW1*YZUu뗅 "V*ZtV#*..XJxӀt~i90tF΅x+9.~#i.t""1ۃ} uVP؍e[^_]UVSh2"j4X=.tYh*"rT+HP}T+H YSb.Z8P.xj.0Y^u h:"`:P+.i5rO@Ph\"~ 9DiPh_d#m~FXZՋJ ;1e[^]UWVSS111Uhd"L3YUt$jtptguܿպξǍ7H~hh" .tyt h"sUjPXZUt 1t+.i5rO@Ph"t$Phx!}[^1tHi019i0h8":}T+BHBGYYy0R{X9H T+ MAT+ M9EMeE AEre[^_]USE.t Ph ">jPZYtۉ؋]á.u!. .Jxu 1øUWVS=.t15..NxtS_...J0.B0.uhc.\iPMË..i߉^19~i9uFP贞 .Z.i.1ɾNtBBt. 0.u$,.tFt 0.@0.fǃ=+Ѓǃǃ.?} ~iE P,X 0.u,.t襉؍e[^_]UWVSu]=.u.8..SSsXZu .}=+tpt u -8Wjz^X}u-W5 +YZY@uk0褡 hPh5"]SjlSjl*}u$SjsSjstAt8t$=+tSjlSjlSjxluI.=[ujOjhE$N thE$hj"踈}uke[^_]US]U M=+u1tЃuEM E[] UWVS}t EEPu EPǃ u8.t0.@0..E1i.E9i‰U܋UUEE9Et}9uOH%ʃu9t1}@ƃރ}tuދHtʃutEEi}t$E@9t}t 1҉t]u tK=.t =+Ƀ;u u EttPEuP+ 0.u(,.t߅}upe[^_]UWVSjjjà ~ jjj=+tQCtN5 +PV *^9t7*P5 +UZY@uƅ0 hjPh5"踅1.95.|btPu=.u>S`X5E t t&tt M ڋEF떍e[^_]US1h"*Zt$ltptZu⻀ۻԻ͡.u t8t Ph<#E cj< Y[=+u =+u@t4j.0‰١T+.P.YZxuS5T+?XZ1]UWVS,1Ehկ")_t)ntput h"6.Eȅt2jjS|x uShٯ"jS[Y^t Sh".EЅt'}uE.8E. .=.Ix0}t ?uǀ1jPXZtpu}t@u7jVZYE؅t j7S} =+VXu EЃu܃n.8t}E E؉E؃e1E. .ME1Mx2t"t uE2uE̱ɄtẺE܋E܅U܊9t}tPjRUY_E؋Űt3u/1҅tHi4hw1"j}WE܀uPZ}u}Mt}jWS{ o}RIXtHEEPjj @u l耉EE܅r`E؍e[^_]UVS]Iơ0.@0.ujSj 耻t-V5 +PZY@u贀0 hDPh5"覀u%+.i5rO;$+t \jS>Y^ƃ=…uutt tjVZuSX 0.u,.te[^]UVS=.th*"jP-XZu h:"Ph<#pY^9~iPh_d#oFXZ١T+HyPInT+H Y J r5 +^O^Z@u.0g hPh5" 0.@0.SSá0.H0.ZYu,.tj~؍e[^]Uh2"T$X.US] h2"5$X]. .uPUS..9|:t%uh"hn.X A1Ë]UWVS]fE =..E1E}sF~<}%<T~<w=$ؔ"$-"9<=<' Pހ<\sC1s[؉] t" t"0 wF&" t*"Ӄ8t "B1ti&E}{ uwsr)m~&t"g}taE+UeuB+<}uU:E@{u)EP@/E\U"3" $;"1GGMt tBBujt }t"MGE.=.[^_]UWVS]=.;$"J"^sh" shM"[XZshR"hW"XhW"[Xust4vZX>t hZ"c_6jsejs [{FE~".h#'sY[Em~&[h^"shb"s{ thj"s XZEr"h!hw"Xsh~"sw E$~h!ws oh1"ejslh~"Qs0h":Cp/h1"%s t9vh" v ; uh"h"_vE"sYE"CEA"1D"%13"1G"1>" 3$S9tRhw1"j}W)jW[VRZw,C y E"4Phw1"j]SiS $[ E"Ew#e[^_]e[^_]UVS]u t0u h$YSZt{t h$X[̍e[^]UVSEp5.=+u=+ۀj.u QX=. D....e[^]UWVS}]5.t/1}t3=+tޅttVShYX}u(+t?Hi@@} t u P XZ؍e[^_]UWVSP]u }tu,EjWVSE#w0 Ph"wPWVSe[^_]UWVS}t P. =P.dPXX.u \. p.`Dž\\9P.~jh"`P[à u\P.dP_OP^;4@8ux/t!I@xPSZYyEE\.\u94.E} .u"e1t:t@u=.hǰ"SG^_190+XX4+5.߉SeP+xWPYyPdP+H X J EЋUԋ\..\je[^_]UWVS}uVY1ۡ.t=`=+u3t/j5P+jhl+c+1PkFZ=H+u?1{=+urXu=+t`=+tWhְ"dXC+t'=+u1҃=.‰.jPzY[1V評Z(u̕VTXe[^_]UVSU:0.@0.jR9Y^x jPXZ 0.u,.tsx=+t01=6+t 6+1ۀ=&+t&+11j薕j\j舕 =+tt6+t&+e[^]^e[^]US]0.@0.jS8ZYxjP0.H0.ZYt Shj"gs,.trjX]Uu}~E p P`^1Uu|~ Zu h"sUu uC ZYu h"rUVSuV~r@$VP t؍e[^]UVSEX90+}]ށ}0.@0.FPb8+P4+50+8+0.H0.Zu,.tq0.@0.54+4+)0+ 0.u,.tqe[^]UEuj h+"j5JD4+)0+4+UE8+4+P0+P.P .P.]US]0.@0.8+9t8+P XC4+C0+C . 0.u,.t ]p]UU0.@0.B.R~0.H0.Zu,.t|pUWVSW 0+\ k0.@0.=8+54+G9ui.ta8+CPW¡8+8+J 4++0+.0+.^^t5;8u1H+pp X@MSNjM4+0+X 0.u,.t e[^_]oe[^_]UE0.B0.4+)0+ 0.u,.t]bo]US0+,+x&~S54+P]K.4+ 0+.4+؋]US0++.x0+)أ.4+[]UU4+)0+0+4++U У.]UWVS,ME 11˅t MPnZMwDGƋ܃}tE0v h6"nFPE0u _E1t0wLG VWnYMVuoMM̋3XZ̋EЍe[^_]UWVS81EE hS"EZt/}pt}rt}duܡ.EЋ.E뿋5.>u hY"ntjL_t S^5a[jh2!ekEZYuEx&EP4+0+._EEEjMQj2 HU߀\Mu3}\}u,jQjz2 H} tU߄tA:UtwtʈUQMu9ZYt֋MQhx&r9ZYU}] .xC XU߈+4+E16E=.u2.#;Wu9ZYt*Whx&8ZYtKE4+9s}~}tjuh2!ef j54+6Sf jh"Pt} . .~u&EI .xC_&XU߈MMh2!6&ZYMu0I .xC @+4+PE[)u.j54+6~e 4+0+.EO2EPEԍe[^_]UWVS1h8d#E^t0.@0.jZPZ0.H0.Y[u,.tgj.1rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPh"ZVh"ZXZ ,DHtI11 MqЉvSh"$MDЩtB:uυt Shɱ"iPq0.@0.SXtҁRWW} 0.u,.thu\i0蕁 PSh"RiҁRXY5T+WZT+@th"#YXEEe[^_]UWVS$f1Eh"nEZt*}St}at}HuMփMлɋ}ľ"F9t >uWh"h.8}ԅuxt h> th}uEhL!u#[_}EEGO/~998;Eظ ErRk] eڃ0ӉM؉]뽅t uh8"L^ 1RShj$";EUs uh%" }E}uE"11EPC P sCP3hG"WEEEt u}eEt u}euu hL!WY%C 1RPWVb!ƉRPh]"nW } Ph$TWXZ}u ;I11ۉM؉]܍}WF P ZY@M؋]uf0~ Phc"EE}tREtM]tM]WF PV[_yMf0~ Ph|"Df~ uajd./tM] EtM]uu h"mVY!F 1RPSQ< RPh3#LV 5T+dTZT+@th"UXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]E0 w9j EPS`M t#9t9uƉׁvSh"Sh "de[^_]UE0 w @8u1]Ét2USe+t1:e+uf+@uf+[]Èf+U+P#P+P9XZ=`.tM=֠+uDySPST~SP+`.\SXY("t%jPh6"^ UWVS}] Fh:"S_$1ۃ<`+u,d+Rf+"RPhR",T}G"CuġT+HyPwRT+H ^ J 1ۋ`+t# ^tjs>Yt + =+u=+u+=+u ++.=+ut 8-u+1B.X.P..jP.X.XZ=.t6빋u h"^H ..Pt......1ۉ։B9tt 5. .e[^]UWVSQ}~h"#uE pZ.9} hҳ"]0.B0.)أ..ljNx=.tE7Wq XEy1ۍ .1u. 0.u,.t]1e[^_]U}ujjjjITF0.@0.j.Z8tPgX 0.u,.t\1UU0 w!j jR) Hu..UWVSuEt;uLu+E@1ۿ?A8-uލXxtՃx-uxtE8tduNE8:uUEjEPh"Và !Rh"hl+Ljh"[1۱?Hx:u뚉떍Kx:uk8{u=u=E:u$MUEjEPh"OVà M^Rh"|9uUjQh"Và 1MUjh2"h"Uà MU+E@1ʸ11ɈUU Phw1"j MQKhMQh"U ÊUUEjMQu U( t E,NjZe[^_]UME  h!"ZP u.=.u...h.h.RppUVSM.t8u;.t+8-u&xt Z.x-uxt @u.1gtp8tuRhD"8Yy:u܀y:u-xu.H .0u RhW"Y5.15.Ѝe[^]ËH+z8U .x@ @H+J8H+z8]ÃxuUSt Pl XK]HÃ8uU@8u]UVSƋXCF~h@0XAf@ fZfXfZfXZfXZXRfPȍe[^]Uj@H+JHR P UPUSUJtXxv-u~u C $t h+"H+B0+B8PCXe[^_]UWVSԟ+E3=uE8t h"154+0+.} t u Eu K9E@EŊt 9u uԟ+H+PP GӁt uu -j+}Wu, .H}t .R\uG.x\F tp\.à u! .x F Op ԟ+9 .xF /p uԟ+߸=ȸ=T F>ԟ+H+PP .xF @4+)PfH+Xԟ++Ee[^_]UWVS@} H+B ]urVTY wVh9"VhQ" 4 "hl"j"SESTZ؅tWhz"}xM4 "h"jPkESUWVS]S50+M EZY94+ulPIT_H=`.9s<wDu 9wMW5\.d ZYt%\.=`.M܋=\.5\. ""Se[^_]ø2"H+ztLUS`.tt"u*2"#4. .5ԟ+P`.ZY]UE`.jZECU茶\uH肶 u"ԟ+H+@8xtjjX jjh  ?UVSH+Xt@XCx tj`H+@ ZH+@8ԟ+P0 .x.P.0ʳƃ)c t,~tŁF $@" ԟ+H+PP @\ |td;\=t < u?&uH+@3轱H+@Y|uH+@肱H+@&t;u,H+@ H+@ ,H+@H+@tH+@a6=t0 u9ԟ+@ԟ+H+B0ztjjUXH+@衰jh"Và ؍e[^]UWVSQáH+@tul =H+,uyGEt7"t,O8uQP@ YZu"^_8Et2jw7XZt ^SO4$PS Rt H+@؍e[^_]UVSH+p$ t jjH+udX(x,u{ upV8Zuhٵ"P: uBPVpH+BCYt‹(wjpV P0+P8RF Xe[^]UiH+B]US]R9tjS]UWVS/t u%mj >8XpZʡH+@؍e[^_]UWVSVH+@}t11NY"t19}}H+@};uEuPw C'uj yX@[Åt^uj WxXY\j :VPXFZƉ9 }uKd[Ew9}tt8H+@6"}t jj H+@؍e[^_]UWVSdEӉMH+@EE8.EuE+4+]EPZt>uY_Et EP` ^EH+@E8.jP0.@0.EE}~uE[E54+NjME8. 0.t }u,.tK5ԟ+=4+0+.H+x tjYH+@ Ã`u8 .G+4+~PY4$jPN ] \t=H+p0h "豮à uԟ+H+PP \ta`t\$tW.HMIMMDt"t/.x\G%x\ԟ+H+PP " .xGWxH@tjQZH+up1t x@ԟ+EjXԟ+E}tdt jjHH+xjYYp}t:H+@0+;E}4+.}tMߋuME).0.@0.u] E0.H0.Zu,.tIH+MHE8.E@EE5.Vfxu@tE.xC @]+]Kx< .x@@.xC @e[^_]UWVS]U DžlDžptH+ ԟ+H0fDžz "t fDž~ fDž~DžhfDž|fDžx@8EfE=4+0+.lDž`F|"u ǃ=.NjFP< $h""fx"u fx .Gdԟ+H+xtjjZXdFf@f(Ãx[T."jO tn@=(@#$"Džd'0dPЃvD\ԟ+H+     \PЃw \讦@;w`u hN"\u'dƩ\du ӃLhe"ϻ?u6Džd Džd11ۉ\v@Ѓ \w \)Bw \Bw \ A;dud(=w h}"#=. ǁw? .?ˀC< vG .GG .xwj . ?ȀP vW .WG .?ˀCJ< w .JB .y}w= . ?ȀP vW .WG wn .?ʀB< vG .GG . ?ɀQ vP .P@ .  .?ʀB< vG .GG .?ʀJ vH .H@ . ?ȀP vQ .QA .?ȀH vJ .JB .?ˀCQ< w .QA .zh" ?À u .tM t)='% \u*=uh+">ԟ+H+xtjjMX븊" <w .G .fxt @ .G豥=u ._\N u%ԟ+H+@8xt j[jVHtu[y>ud|ud&du y1yt|&dd@H+j+C(H+@(dHԟ+PZ-H+@(u @ (@ dddxH+dH$ H+@ eH+`H,hP d H+xH+@ [ N(\u5. .FDB .B"dGjhd5.H\G{t b".\+=4+X .X@Džd{Džd#Tdǃ}Ttqb"us,DzuftC7}TupKTcd.e.jjhd.T T7TDžd Džd b"t5 .x C\{X\b"uuQЃ w= .x C\>X\_dt:@Ѓ v0t .\XH/{h" .x{=\x=\duh%t8:t#u3DždQh"ZYÅt럗"X\\9uC4͙-d u}t h"#讙dDždFfxufxt dCwd@d ؋4+X rƋ@f@f@@"@'uAV|"u1.\Ƌ@@"f@R.\$还M .B Ƌ@@"@f@e[^_]UWVSRH+1ۅtXC1H+0x tjH+@ XF8Pv vS‹FP U8tSjH+p蝝6jh "PH+HUJ@ B ӝ[e[^_]U'Hu)]UWlTX8.ph6+d(.`}1H+\DžtEP-YE8.(.EH+Xjl褜 :jh "P H+B t$Tt=+ lttDžxDž|RUX}E6+jjxPx 4+tn\H+d6+hZp8.`(.4.u jp%Džt2"u^jz5Džt"\H+d6+hsXp8.`(.tu ltt}UWVS H+@E} H+u@$x@@$4"jjCj5jCu;jF EjrUBjj^UB뻡H+xu j?F Y F @jkj BáH+x $CjjCjtH+@M uH+x,u p+Zu h3"|j H+PS @0C>H+^x ubx,u\h%pZYuIu@ H+up0OpXUS@PvjjlHuE >j+@@+@ @H+J0HCBHYvBH+@ttjjjCV%H+@^Xj H+B0+B8C j H+p0_C5H+ ~ uh%vZYt h%CEFH+xjƋE0FEXH+xuH+x  jj p0‰EEUH+@Yu UBE밡H+xt jj@0FjdF H+@>Zt-Pv jj u H+@ FEM@}j jCCZYtNjjX=+tt3jHH+@X&}tH+@uWhY^Xjjl H+u@$x%@}t"t;tj gXZËEC؍e[^_]UWVSS} uE EE1]H+x H+u*p0ƉXYtաH+ptZu1뿋H up$E0FEh뢋}O9u} uyjH+ ԟ+H4^SZYuhI"Svj/vx t hh" H+ԟ++A8F FH+@4S@u} u jjnEj @EFE F H+@0FXe[^_]UWVSPH+@1u=+tt hz"[GܡH+@YZuYj 聼@EjjËUBp^XUjQC YUt֡H+@tj)pZƉe[^_]UUH+@@PtjjXH+@ t/Ht3H+@jH+Ytrrh"G.H+1U11ҋE]'UU Et 9Pt]UMt.tPt9JuB]US]j SCU PUPX]UWVSuEPI![y h"-~WA-Z=wPWu ]jjj膵 uKu jjjjjjjj$jj |SvubjuC Ee[^_]1=p.UUE M~t E@]) E U] UWVSu] 9t:S SV 9t,8V WD PShi",V X؍e[^_]UWVS]{t97Gu p.} tWy Pw X PRpZYW? XCe[^_]USt.0.@0.jSt.S? 0.H0. u,.t ]Y+]UVSt.t/}u jS8ZYstFxP X6͍e[^]USL+ @L+ L+ ~!CPjj& x Py Xڹؙ } l.]UVSul. ~;d.|y5l.j V à x 9t )$E%=W (Y&whh whh V ǃ w xfV[Zu VYtj 8  E <0t:1EPSVa y"K(0@ PSw h">(Sd Z 0.,.'WLXe~Euy=+up9tZPSW y@'0W V? PSh"'.'j0(PVhϸ"WUjjWT I19u>e[^_]UWVSÉP_u S>Yt uhj jS XZut'0V? PSh"'jS ZYut&0+? PSh"%pt @e[^_]UWVSSljWÃ}tWh 5T+ E2"tEB;!@"T+td#GtQuh$RW҃!t#)t7Qh""R u1ۃ u u1htc%5T+tYX 됅ttSh#"RY h!5T+FXZe[^_]US]5l.j S ucl.CPj S tCPj Sk u0j j SW ujj SE u h)"g%]UVS]t4l.9C|sXƋCZ9tVPSsT s e[^]UWVSuU 1E E1E Et}jȱ@t.=t.[]^9d.[vaSYES[$4X}up.u EPVK vu9h.}h.9^ uSYu S+Ztj jjS y$0P< PShx" $S UZ9US XISwZYO0.@0.=l. 4l.h.9}@PjSr ƒ uyE#Ht UtvE5l.jS9 ƒ yEV#8ujjS ƒ y( 7#8t-#0f; PSh{"xjjRU URSW0.H0. c,.V^"L}t T+X+}t P+X+e[^_]UWVS ]EEp5 ,EEh}"u S tl5EС ,E)É]}"htc%u ZYu}^hQ""E뉍x+t-tPh"EE؍] EE؍]Wt!^¾@"N9r-RUPWO UuF ЋM!htc%j] 9d.}u}ƒEE܋ptWVػ_>0V YvVh"!Wh"}uSE9h.|jM1ҋEEX5T+kXT+@u1h "XE M܍EW~mF^9h.bs%@Hsru,1UPjS @Uu. 0g8 PSh˹"> !9t'WjS @u0'8 PSh"}j 1}PMZie[^_]UVS]u M1P1<"t#KyS:PMX P"<u~tvhw1"Su S4"ZYt vQuLSh!HSh,"@F y$KyS P-Y(P-Phw1"S Sv1XZe[^]UVS]{0u&=.u .u0.t]=.uTY=.uZ.tO.8tCt>..@.=+tu0.u ,.0[^]US]h"t%SNZuShw1"j h.$.]UVS]} t"KySk P ^ P VPh<#S  t?uSh! ZY"KyS P X P F@ue[^]US0.@0..t8tP0 X.u. 0.u,.t ]@]Ë.u.t9u=.r 1UWVS}u =.u.t 8=.…tlugtQ t'tE^uE=+ۃ4=+u0=.u'=+=+ۃ u.uTEPjW @}ty tB18=+t Gvt=+<u 9uvPWYZ@tju.u jW؞XZEEEEO>v  DjEPj e[^_]UWVS ] {}uh8&sr^Zt K}esh#VRZYEhh"m j5T+ FEsh. #VZYth VZYu81~pEE{M}u$}udhm" [EEh8&7ZYÅLM}t }@ }1}ub11ۍCtA.u6u h" XSPh$ G ~ h!] X1C@ut h!F X11.tB.8u6u h" _V>Ph$ C ~ h![1F@ut h!Y1ۋ.t7.8t+h".P&SPhD" C@uEw}a}t 1EJ=.}Qs}}.t.Ph"Y^QM.ZMt Q踲X)h%QM/ ZYƅtMQ}Xu?rwh"5P+ h".Zu h" .P XVPhD" AFuui0.@0.t SvX.t.P* X.t jV^X 0.,.E7[[;-u{u1ۃ}E5h"VoZYE<1ۋ.tH0.@0..P* .Xt jS^_ 0.u,.tC@u.}EEe[^_]UWVSuu .?.tJ8tC0.@0.1P-.PB0.H0.ZYu,.t*Ouu e[^_]te[^_]UVS]u .u VSYX.<vjSXZuƃ.e[^]áP.=.u t8u1UWVS...u@@u .e[^_].=.u.t.}W55P.SӡjP~S5( 5t }sW55P.Xa@Ht .tUS]9.t$jjjjjj.]USXE=.u'=.t.t EEP...P..tEPj[u Eȣ8.EPOYt0.@0.EP6ZuR;Eȣ8.=.uԋ.tʀ;tm.jS1[X몍Eȣ8.j{Y]؃EEEEEPj<YXjS@XZEEEEK>v  DjEPj ʶSP# XZ5.6U.E.HUWVSh"PwZYj'V_Zu <)19ˉe[^_]á0.@0.+t4UP% ++X 0.u ,.t 0.u,.tGUWVS} ]1~SWut ~)ÅE u F ~ԋE) u8tÃe[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu.CfKS u>0.@0.s͝C CC0.H0.^uV,.tMBFfu9s0.@0.6CPR蝝C S)S0.H0.ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9P+u]e[^]e[^]U5T+uXZU5P+u~XZUPuu EPwE u h1"uPJuB# UEPu u UE Pu5T+ UWVSu] Eu]EPu}WfEHE yWEXEEtDe[^_]UWVS u] j'VM_Ztt~tnh\"VZY<u[KySP"X P"SVKCHC^_yS{P"[P">t%h"VsZY<tBEt9KyS'P'X P'E E1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\_ P\KyS`P'Y P'1}D>;,KyESJ 'ZE J 't"KySP'X P'9P+u]e[^_]ue[^_]U5P+uXZUh+Khl+AXZU8ruPha"Ph" UWVSSEXE p84+U0+.j=SZYj=VZY)߉)U9~߉t/xBC .I .<=u)Pڅxu ]e[^_]UUM1Au,.+.Rqq h"jh..UVSu]t t;E u1Ʌt911b"Ft;U tb"u1@t)[^]UWVSS11 .FtYuƋ uPGEY1 .t5Nȃu$Ft sVЉZt F6ǃuEe[^_]UVS];uE "e[^]h"S-ZYS Z9u;Sh<#j'SY^ƅu+Shb$XZ/<'uhƻ"sXuS)Phɻ"} e[^]UWVS]} sSt$CtS҉XuEsEt Whq#(Y_}t5uhq#XZ$T+Jy Rg T+z9 _F>=u y:Cu}th#"FPZYT+HyPT+H X J e[^_]UWVS=.u. h֕.Y11ۋ .tJG} tE t8tEt..9P5.讕.%.XZ.(u;)uF C<He[^]UWVSƉ׉ˉ+fx @f$4"SV跲Y[SV觲_ZYSV蚲[^SV色ZYƉ׉11 lj։11 ylj։91lj։9slj։h9(Ulj։J9PVm^_xPSlZY04]E9uc9u_E98PVl^_uWxPSlZYuD04MU9u9uE98f9]PVWl^_t1PxPS@lZYu鋅|9u;xu͋3U 3E b>~u5!uډx!(u;)u{u ?e[^_]UWVSu] h)4$3Z_Zu#NuxtP*zUWrtYu UR,DPtÅt SuZ@tM}th8&6YZYuMtEE8%u$PfX6hZ"PY_Lj EPu ljыE 9Euy<8u t-u u2"9uЉM8Mt!뾸Σ#uPhi" EGSWV YZ@u'"|=K!RPhj%^ Etu jW XZMuUVS@y....w5;6tj=S舽YZt j"SXZ辴 Phw1"j@]SRjSh޾"j h+h2!(j h3#h"ƒ ("t%j Ph6"j,h"h"j h3#h"$e[^]U=4.t..VH+ .4.<. .=t.t T++P+l+d+tP d+XUjP.XV(+.`+Yxt@j0.@0.j~XZ1.uƀ.@@u 0.u,.t$UEt]UVS]u tVs XZe[^]UVS]u "$ "Vs [u CEe[^]s }VDF4$VsJVs Vs[Vs Gs=VDF[ ]VsVs C[XZD[*uFEEh#8"VHKY_EEEE8.u)px*uEEh#8"V K_ZEEu Sh"H}f?f}ʋ}G}"$w"wtt;/G"uF"v޸N"twu #M"U"uT"w t$\"u["wt>d"(uc"Ywtk"(uj"7w"wt s"ur"%=t)wt=u&1"=u9" -"5"z" ry"w rs9/" r"v޸"sqwr !"縑"r"Hw s" r"(ws"r"ws"r"ws"r"uS%"";t3C P3h,"jd,VF 1F1:1ɾ"$t VF8t ($h5"j ,(PFmPh5"j E(P A u,P6EP6YX1Ƀ Yt,P6EP6XZe[^_]UsPh:"h0,]jU0.ϣ#=4.t"PRPh"h0,)jUWVSQÉ;#uCj EPS 8t Sh<#j趭E8tWShi"jue[^_]USÊt%<#uϣ#S葬Zt@8.]UE E EE]ȇUWVSÉU}utj VSo @t E 9v 8"u"3O;t)t:Et,fDB@fO1e[^_]USÃ=x/t =d/t?|/9t6t2"t"!"=t"!QRh`"! |/x/d/]UVSƻ"t[PV蹆ZYuICƒ//C/CD.C 1f‰x/te[^]" Vh|"j謫e[^]UVSÉ֋t8uVh"jURM1ZYZtVh">h/XZ1EEe[^]UWVS11Dž=/~ Vh"XZ1 RPhSf =t=/Vh"k f}Ut=/Vh"[^1ۋ"'h/XZ1e[^_]UWVSRÃPjh["h,qCfw4`"h,"Ph"h,F s(h"h,1s,h"h,s0h"h, $s8h"h,s4h"h,Kh,hV"7tEa6Wh"h,vWh"h,F (to"SsYZu,jW11ҋ_Zr/$hK"SksZYu0hW11ҋY_2f/hu^!S*sYZu0hW11ҋG_Zf /hO"SrZYu0hW11ҋY_f /ahY"SrYZu,hW11ҋ_Zusf/$hf"SkrZYu(jW11ҋY_u9/hq"S2rYZu7jW11ҋR_ZtSVh"X/a<w{t SVh";=D.rSVh"vjSVh"HT/h/X/h/hA"SZYÉ;uVh"P[^Dž"RY ߋt uvPSR. u["`/R葵ZÉ;thA"SHZYÉ;DžH"Co,DPt2hP11҉TZYtVh"8YX Dž"!v#SVh"h"Dž`/ /Ct<H$"2{ //C h/h/17CfCt//C h/tYvh/t217CWK/h/1&h/,Ze[^_]UWVSS1۾"<"tCtiEjSEPm th?"<Y1@E h? jSPo1E4FZ9uuXe[^_]U=+t]@]USÃ=/=/u1҉t%Ph/}XZr eu=/t =/tr $u ~EPVAMXZ9uÔ8t/jlk} tu Sh"5 ShtL&5_X뿃} tu /Ph"m5 벍/PhtL&W5[^띋$t $PYPӧZ}tEajPS yh`"5X;ƒu)t"=tR;$u h! 1e[^_]UE/E /]á/á/UE Puh0,h0,j j荕UWVS]i8ށu=/t5/h!ܛYX=` /t%=/u5/h"踛` /XZuu Ï ZYyW=Ph$#芛 t7=/t.j 蔚X=/t7P5/h"Sjʔe[^_]UE Puj$ UE Puj UE Puh UE PujjeUWVSxu/Phw%*_Zyh5"[khWVV t Ƅ1҉|PSZY|ySw%=` 9u;u/Shh / ǃ uShT"Y[xPWZ[ZyWhD"ً%= Whn"뻃= u+t'ShWW t úSh"놈|Se\Yt?|t50hWd u|h /h<#0XZ|랉e[^_]UEP ZtPRPh" u uh"hh /誗 /Ud /tjXj fUS5j0h@"jS h /jjee ]USj?(jj;ejj2eڏ]UWVSÉ֋x CPww wwփt= /~j 'X /e[^_]UWVS/// // /Dž DžDžU[u/h"h"[^Dž SUYuXYÅuN3hVb ǃ uVh<#/XZ PlXEtVh"9 Eu {u{wu"Wh"h0,Ι DžQCC jhPjV謂 Ãt%$Phzd@S_ @tS-T YW覍ZD ,9wDYt)PH /t4KRWQ` u <tXȉjLj Wi CC C CC/C//Y_{ t%VwGYZuVh " XZ?ji V7i G)i G i GGCG8{DžEtDžH /Eu/} u:E 5j ^tsh'"s _Xtvh$ʔ6M 9~= / 1;}1U% tE 9}?CNj P_ Yt5 /9F6냽 tr/q8d#:u2"hm"Ph"h0,Ɩ/<}G";u!Ps ssh"h0,荖W jsVsUE #9  Ph"XZ ԉg^ EtPs ssh0"ȃƒt.t&Ps sshI"h0,莕Dž StPVSt$/C/ ses]SW F /H /~ ut /;;/ /?uǃ tuU E t19uUDž e[^_]UWVS]fU ffCffBCffBfCffBs sY^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss)Y^} GWssY^GWs$s Y^G W$CDȉGDs,s(Y^G(W,C@ȉG@s4s0YYG0W4CHȉGHst ^F)ٸ;MF)fFދGfN=/tww@FXZFEFE@Pw5D/5@/ Z[@@fAG5D/5@/f@5D/5@/u uwu uh"S$}u}tuuh"k =/uj jX؍e[^_]UWVS}u w wUXZCfEE9uc/t=/t =/tj jjjw wu/jh"Wo w wNXZWD/9G u ̢+;@/thf%¸!f@tg."Ph"/w wE)Puh"j=/uu=/tRyNj ih"р_X=/t2h"wY=/tfE)fCe[^_]b h&"XZHt/x뮍e[^_]UWSá4/p8薿SY t& 4/q0RP¡4/H01z 1҉Ѝe[_]Ƀ=/tf‰Ã=/tÃ=/tUWRP8Y_}UWVS0u} }- p/t/9]K]);E4/@8]]M9/P]!ыU!M]M];E]}=/tuH!PWVh8"h4/MĉEȉMuuWV EM܉mẺUЉEԉU؁\TtC#ECEUЉEԉU؋CEU؉E܉UEUEU;u܉ECEU;EE=/uuWVh`"g 4/\Tumq#uqmqWVuuhx"gTEċUEU;EE}>=/t0uuWVh"`g4/uuh"Eg$e[^_]ÍL$qUWVSQ0QEU;EEsE9`/d/Esuuh"F|//4/sx1uЉ}ԉ t9E}rEU9E} 1ҍMQRPuuE u}uĉ}ȉŰEƉE؉Uu܁\Tt-CЉ!U!CЉEUuuuu K` t1Ɖ׋CEU܋ 8/tas0RP8/4/px1WVuuk ʣ//4/@x1RPuu  8/R=/tЍeY[^_]aÍL$qUWVSQ8QEUx/|/Ӄ x/|/;Uu;EuE9h/l/Esuuh"Lzp/t/E؉U܋E9EEE`/@Ẹ`/4/1ҍMQRPuuT u}u}UċEƉEЉUuԁ\Tt-CЉ!U!CЉEUԋCx1RPuu K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋE̙=\/u L/P/ T/X/EUܣp/t/Suu5H/5/蝩=/p/+EE5H/=/1;}VV|f%ZYf=u Gvdv`YYF`VdvlvhYYFhVl1tttpMYYM؉DpTtA u1MpYYM؉Auv4/(=x/t<EẺ}ĉEȋU9USuu5H/5/ЩrVVf%ZYf=u+=/u"}uFV y9NjErE؃1T(ʉT(@ uFXȉFXF\ȉF\F`ȉF`̡H///=//ЍeY[^_]aUWVSS4/Eu1WVu u  tu uh"vu} 5h/=l///EU x/|/p/t/`/=H/8#KH T/=/ۃ、1ƣX/E1\/P/ډL/t@\/ 5P/ L/QhqH/ZYu h>"ue[^_]áH/tUPnkXH/H/UWVS u=/tFVFV EU4/H0AEUSQRP<  w EtE4Pb_< /RPuu G /CCM 11 MuE UCSCC E UC SEC$EC( /1E v 9vt DpTtD(D,T0Gу} w/9/ug11tDXGuP5/fZY=/u he"t//d/P//e[^_]UWVu} /RPWV /t9xu9p tWVh"se^_]Ã=/tYUS//\9/w 3iY5/i5/h//XZ]á8/@ UWVS$Éx@t@SЉ_uDž' s ss 4/p0sszNjH4/P0@t 1;}=ƋA뻋EU RPi Ɖ9r=/td/tD1;}&G q1YYQFG W5/̥XZ;}W ʉ@{e 4/9Ht΋G=/t  T<uds sh"hRsZRS褦t*G=/tDG  /F4/9ptmW5/^XC /GtI T„uA{@)EU 9|F<븅ɋtT>CS"CCuSЉYu uXZ_gE E J/CS RPRPhV裦Vh"p h"aXs sZY=/t@Si+EU ^CS@S K+EU @CS h"/gX ge[^_]UWVS$uE 8tE @0@4/tFVFV } G$W(ff%f= 4/funE H$x((9f=x/t;9ʺIu!=/t F Fu/~hu)$=/t@󥋅 󥋅s0NډWVRP 1/ t b54/#8tk@DNL##NT t4/@8M A t`d E x@/P @RPRPhSbSh"_m h" ZHE p p^X=/4/tH0ωș!CSp0 CS h"豶/[BM AQ] CCE x@tPPu 4Y G 4/C8} G =/t f{0k )ډƉ׋=/t$ݸݼ tHM AQDt-M AAWVڋE YZIE x@9/E P @RPRPhPwPh"nk h"/ZHurE p pZY=/t@S<)3CS@S )CS h"轴/Xi4/Htș‹Љቅ+CT됍e[^_]UWVUr8azu;Bu;B0B4|B0R4B<NA^_]UWVSu^8;uUCvRY^=/tgPh!#R^_=/tCSCS aRPh'"Q =/tC(C01RP@jZYE E2"e[^_]Qe[^_]UWVSP]u }s sgEZYOu6f%!f=@tg."RVhj%gs s_=/t h<"]XhG"c_H=/u؃H/L/{@tjjjjsHsDs s蔪 SuIY^=/t /@ / }s s蘜XZe[^_]/e[^_]UWVu} WVuuuhM"fj OWVG$<t <uPv Ph\"ee^_]ÍL$qUWVSQ81yAEġ,/EЉ u1u؉}E0WVśZY8tuu讛E[^8tEUE;`/Ed/rϋE9d/uE9`/Q4/1҉M]SRQuu5 EȉEE=/Nj719uE؋M6 s 9vjSUXYuShs"e[^VwRU1 ȋU9s@tUwYYŰE/Puu蘚EXZ 4/EƉׁ\TtA#EASA RPh/5/4/}=/t =/t =/t54/u5/ EЁxU tU tuh"Xd_X=/th/p/^EЍxU uEЋX\á4/1RPuu= ƉEH 4/ELHh R5/5(/5/=/t/PPY[5/rg /E%Z=t =t)=@EE@E4/p8 Eh/J/uuà =/V1EЉUԋUЋEԉSpCt_ EfCXEPEUC S$C0S4C(S,4/HT t1{CS eCSV荡CC(Zu EEfCdEPNE CC C4/HT t1CS  ChXH/L/=/tE }̈GEEE؋U܍eY[^_]aUWVSX,/E4/1RPu u EEƉׁ\TtC#ECQC RPh/Y5/4/}=/t =/t =/t54/u5/ ExU t"U tuh"`_XEU1E EU EURPY^=/t@@pDE=/tCCt+E=/tCXCd EEPSXZ=/t /@ / u uJ^_}tjjjjuuuu H/L/}ExU uEX\á4/1RPu u Ɖ E@ 4/EL@h R5/5(/5/0=/t/PPlY[5/b /h//XZe[^_]ÍL$qUWVSQ8qyA E̡4/@PEWf%fEء/EЅtCSCS P4/R0Uă}҉UeEUf}t1/MىU!M؋U!U܉EU9EE}ΊM t 9|P}tFTFD1҉ t 4/q0RPS}̉4/@0 E1uEEu}9EE|M1)M}Ɖ9EE|B)uUEƋ}9EE|(uuh"\uċ}EEE}tE؋E؋DT1҉  4/q0RPaà uuWVj Ɖס/EЋKMEPRVuu UMUM}MtTEEЉU)EEE Ec 4/q0uuǏà M]Ẻ4/@0eY[^_]aÍL$qUWVSQH5/tCSCS EU4/@0E؅CSEȉU̺4/HPu} t1 9|aEEЅu E\4/@0 EŰEU=/tNˉTVDE؉1EE9Ɖ+u}E؉U;u؉E+u}܋EEԋEE؉U܋EE;u؉E|uuh"zY4/@0EU]=/tCSEȋUCCSCS E!ChEEUE؉UEEEEHEЃ=/tEċ EċDTtZECEԅf4/@0 EŰEU=/tMЉU_MЉDXG4/@0EԋEЃ=/t8 DX!1uRPEԃ uuuu E؉Uܡ/EЋEԋHMEPuuWVC NjEUEU}MtT 1҉ uiE.EЅQ4/@0 EŰEU=/tnuԋNTNuԋVE@ `EЉE$}ԃg 4/q0RPEԃ Eu}M}h"WChEE]EЍeY[^_]aUPhZ"h0,,Dj:UWVSSƉ׉uEPQU 9t:tWVh"je[^_]UWVS É5/P:VXZ=/t=/t h"EWXVS^d^_u)=/$h"V[$/=/u64/Ph"VUZYt h"VXh2"V_=$/t8=/t hW"V^=/t hu"tV[h"V.Y=/u h"fVZ\)=/u h"MVX1=/u h"4VX8=/u h "VX:=/t=/u h?"UXR4/ $( @8ˋ $(RP5T/5P/5L/5H/hZ"jU4/@Di($ʉ1WVRP jj RPv RPk(dd$WVRP RP ($h|"`>@=/H/L/+`/d/ 4/H/L/ 54/NF)ڋ~,f,P/T/Ӌ~4DӋF8 $(+p/t/P/T/ t/RPh"i= RPh"X= =/#=/uxhM#wxYHujË5/XZ4/@4t,CS CS 4/@4f 4/H0AWQRP| Ɖׅy%=/ RPh\#f%f= ufu=/=/:;{h/C(R4/Jd1RPS5/yt ht#/I=/t1Sh#3JPC(P=/tCCChd4/(/xj9rE=x/t;;s$t C Ct{ht$t 9}~FDžDž~B@tȋ뵋 Ɖס/ 9}A t?Dt Dpt=/u&D(WVPQh#1|(‹DpTtuWVRPQh#U1U=4/119}rOtRP9 FNjRPh#0 t uF~8|X=/uDXPh#0_XSs^uH/L/CAfGf]j 3Yu2/h-#~Fh"Bs_Zu-j{j)PH//@u< SZD/  G=/=/tzCSf@t`@3?CpfCCCtfC-Y^ Cf@up/t/x/|/GW =/tCCpGD=/tCCtGH=/tCXCdb G@WSXZ=/=/t =/C\u"C`Sd uChSl hG#6Dhf#pu/>y@\@`@d@h@ljf!_X=/u^4/@4 J4ȉR0׋ыg0ʉG0W4=/ACS;C\t@@C\4/J0D1Dž1 C\54/#8tk@DNL##NT t4/@8B D`Td uO/FVVV^tqCh1ҋO0_49u9SQRPh#B=/t h#蝋Yh#nZ/^_=/tP4@0QCS @05ChSx@jjp4p0pHpD葄 wh#9AhG"mHvZY=/t /@ / e[^_]UWVS,/E1ۋ 4/9Y,EUu\TtA!A1EUAEUEU11Au}|E|Uh/UUy2EUtDžxtxUMM;uEjCHLY4DEU;uElDžplph/UUy2EUdDžhdhUMMbU1Ee P/T/H/L/E4/}9x,OuuEuui 4/E_X\Tu]e+Q#UQ1E]]]euI RPh/@q5/4/}=/t =/t =/t54/u5/ =/tE@x 4/1҉EU=@/t94/p,kEd1`<SVuPh#h0,)@/=/=/ExU t1U u E#uh#<[^ExU uۋ}G\M]E EtIu EUJu}1uEU9}u9uuu}Et/ËE} u C<}%?}u;Et uuu(|Yuuh>#<j%1|M󪋅|CEUEUlpu}9r WVXZ Ms;pu;luËu} h/l/ȉڃEUh/l/4/u}11 9E}e9E]ӹr"\Dž`M]+\`t5/ȉ uv}//tD[y9]u9Mto<%?u9tSQh(#:jM]W|+XYҋM]u Wuhb#9MEs+}]1VEa/e[^_]UWVSEP@EUE@ E}juu t/t`}9xuPu9puHEuuh#Ep p /qyEpxu}qy /9 /u /u덋=/98tEUMK؍e[^_]UWVSTU1EE'} $//11E4/H,;M=@/t7kEd1M7SMQuPh#h0,8%@/E4/U99swWVXZthu}=/tCCp=/tE=/tCCt=/tEWVmZY8tEPSZYuEWEe[^_]UEU @,+B,]Ƀ=/tf‰Ã=/tÃ=/tUWRPY_}UWVS( ]s8=/t DžO=/tt1;`/d/sNj}1RPl@FY_DžC4 C0J>Fh`%PYZ-CS u9ttFPhR#5XZ#Pbb_FfPVD h#*bY<Fh+ZfFNPVW8fPV͹C0S4s sbjfH Dž;C0C4|s sп@XZ=/Ѓƅhh!PT  / /ufC4 C0FxF:99F)ffFC0S41RP@ifH1󪋅fFY_>tyFh!P]YZueAA =/~hy#s s+Fhw#`H/CS P@ u h#RPVFD9s~#>tFPh#2XZ#P^__tcuC0S4=/t h#"|YH@ FfPh#^Zu@@ uC0S4=/t h#{XH@ F>ufWV舶 d+fFPVR_fWVEtC0S41RPffH^_Dž)VS0K4w\~.uV;}>uh# ~ .u(h#s s赤hw#]S0K419`/d/s h#=/uDž/HuT~tNh #1RPs s`=/%Fhw#\[HS9Ht~u렍P;S0S4<!=/=/#R1RPs s転h#W\Hx1RPݱ_Xf%f=@AefGh1RPdZY<<p<t <Q;C0C4h#1RPs sh#[/#1RP讹XZG G;C0C4CS RPRPhPEd‹x1RP1RQhPd0Ph#PhF#.=/t hP#wYh#ZZH;C0C4} CS GW=/t_V@9tMh[#1RPs s裠@Fhw#3ZHt / DžfHqPPhj#/,u Dž  e[^_]UWVS`jjWb^_P$"h#,h]"xYY[u /ahjjjj螡 h#|+h#d,h["(Y_ZuE/h"Y^jDgjPh#,h["XY[t#jjhjjjj ihw#XZ5jjD_X%@f} Ph#*=/tjjaf[^h\ j5/5/W1ƅDž //9W=@/tD+5/=/k)VWSPh#h0,X@/C$w5h'#ss 莞 X/A1C$hw#WW5X/VC SRPRPhWM`=/C$t5X/RPWhB#h;#)*5X/RPWhB#h;#%*=/t h"sY X/C$D1C$=/t2ss AXZ=/C$u,GW v'h&"jV^Ht/ GWҍ@1=/@uufC$1C(ƒ v 9}L,G HLP fC$1S(у v 19}t,|0`d@ vHC SCS=/t`H=/td&PPзY[=|/u 5/T5/|/;s݋{$@1@=/unfC$1S(19tL,@C SCS=/tLJ#fC$12{(19tD,T0`dA㋅`=/tdPPuXZ>O_ u;r$tGW 1‰1ډ t#@tSQ[YXG GuLGWGW =/tha#ww RPh!wwww MfKPh{#ww wwhw#]Ru/w wZf@fKGWGW RPh!ww J//49s*;ww ZGG_Z8uҋ=/9s0CS tK  KtRPPSXY[jj.XZe[^_]Ã=/tUWVSX//D/;=@/tC=/))KkdN#VWSPh#h0,@/ss YZYS  S7S St t%5/tC=/t8=/t/u*CS 9RP&Yf@1C SCS t(RPXY_8u95D/|Css~FXZ95D/|)js s+]Ah##h"O 3ssj1ƅs{DžL ^_=/tBBp=/tBBtVRSZYu h#E"_PsstQDžM ss~VPtiWf@Y[5D/5@/RWfHXZ8e[^_]UWVSHEP@EU,/E4/RVuu^ EԉEЋmԉƉׁ\TtC#ECQC RPh/T5/4/}=/t =/t =/t54/u5/0~ ExU t"U tuh# [^EEx EEEjuu诠 EEEEċUEUh/EЊuuuuy&EuuEUMUMMtG5$/E9BuE9BtN^JZ$/VwYEEUO}tr}tl4/E{89x u[E@EL@jRPEppӽ K` tPuSeh 54/5/5(/5/VY=/Q/PPyXZ>!ӋEЈ}ExU uEp`ơ4/RPuu MEM]ΉÃ]؉%Ey&EE؃EEEUE؉U܊MظP/T/Ex@t+jj4/@4 ؙRPEpHpDp p6a 4/]p89s !}uF$ ]LC 5/! /h/R/Eԍe[^_]Ã=/tUWVSXU1E E4/X,;]'=@/t1kEd1-VSuPh)#h0, @/4/u1EEE/MU99WV-WV.Ru}=/tCCp E=/tCCtE=/tCXCd EP$"YftbWV蝊YZt=/WVhQ#!WV^YZt!=/WVh{# SEPיXZ/Ѕ9xu39pu.JZHX/RDjh"EPzQjh")=/tC CC Cu jh#jh#EP6[WVPh#@ExxPDžTPTx|xDDžx{,;x=@/t7kxd1VWxPh#h0,:@/xpDžt𙋅x‰dxƋdׁ\TtC#xC1QC RPh/G5/=/t =/t #=/t54/5//q =/u-xU tU txh#^_=/th/H/Y=/t = /u/ / / 4/AhdptЉPpƋPׁ\TtA#xA1dAId t1RP5/5/C 4/ptЉdpƋdׁ\TtA#xA1qhARPh/E5/txh#AXZ1X4/ph5/50/ =/t50/5/lY_0/\8 uǀ\T5(/54/LXZ=/th#POF^_u)50/54/,ZYu95/u 4/AhdptЉPpƋPׁ\TtA#xA1dAId t1RP5/5/Bj54/H^_Ήp׋tЉdpቅptdtpt8D<4;D4} D45/u y|@xD+pupdC,H;xu4xdf"șdD1dffDžh$~ 1s8dDž DžDžQ(9w1҉Q,9w1҉ W09w1҉$u DžlWx9sll(1󫍕HU u H1׋l󪍕U u P1׋LuxLu DžU x1Dždd9WVCZY< <<t|<<tU U u PdPd⋍P9s WVPh # dIxuPU u PU u PDždD9pt4h/ ptPTDž<1{8;<T,Dž0,0PT P\T`y>\\$Dž($(\`\uBU u T <d 2@  /^ /=/tP}XP4  uTPTxU u PTHU u HlRP  h#\P+<ZYtwXVJ HU uH򋅀xU tT GTlRPh/N</ /=/u)xU P\19@U u P0U u W\ 2!8uF룉p<1ɋptUxU t B\0u*xȉdPh#(YXdAu1@;8=U t  G`0U u T 2!8uF띉p<1ɋptUxU t B\0u*xȉdPh#KXZdAu녍U u PLRP/ txh#Pz9^_taU u PxU t G\LRPdh/9/xpj PV =/tm h #Dhx#P_8ZYtkƃƃh 54/5/k5(/5/==/t/PP^ZY5/X /X /e[^_]UVS1;] s8Sht&^X1E0PhY #FZYuj XÍe[^]á4/!uUVS1ۡ4/srT =/t4Т+h #LXZ"^ #tu #PY/Yt=/uɡ4/t44/Dh P5/5(/5/x<=/t/PP\XZ5/  /^ /Kt 4/=/t h #K[h #.Yti=/uۡ4/ h P5/f5(/5/;=/t/PP[XZ5/S /X /jXXjOXYXuj^Zuj]Xe[^]UEH/E @/]áH/áD/UE Puh0,&Jh0,j rjUWVS]8ށu=@/t5H/h!AYX=/t%=@/u5H/h"/XZuu ( ZYyWPh$# t7=@/t.j X=@/tOP5H/h"j/e[^_]UE Puj$ UE Puj UE Puh UE PujjUWVSxuD/Phw%V_Zyh5"[khWVW t Ƅ1҉|PS>VZY|ySw%=` 9u;uD/Shh@/tǃ uShT"Y[xPWU[ZyWhD"ً%= Whn"뻃= u+t'ShW t úSh"놈|Sʪ Yt?|t50hW u|h@/h<#0XZ|랉e[^_]UEPqZtPRPh" u uh"hh//U塤/tjXj XUSj0h"j_ /jjʳr]US_jvjj蠳jj藳?]Åt3USӃ=/tPh!YXSh #XZ]Áu=T=Tu =Tt=8 t=TuH/=tu /`/|///1f=T=Tu = 8uH=/t*/|////{UE/ /t,\Tu ǀ\8 Tu ǀ\ 8=/t,\8 u ǀ\T 8u ǀ\T]UWVS]U CBC B 󥋃CXBXCXZ/@/D/ // //////h h'/ h h ǣ4/h h/h h0/   ʅ ʅʈt h #tVSaY_t-/ujVԖ _ZyVhj"fr/=/u/R RjPV8@t(////t7/ / /PLPj5/SF8@u Sh #Y^TuSh #XZh$tVEY_t%h #V4_ZtVSh #L }T uShA #렋duShd #눋5/V4uSh #.uSh #uSh #[^X1 Dž11҉B~t /}Tu!H׋RPWV" Dž\Ӄ~ ƅtBtѥXD1D1É1P1RPWV荍 OډSWRPj h #EY19vjPʁ}Tt!1ڋڊ t1/1u3Fh, #hJ #hg #h #h #h #h #{9v5/h #XZKu Dž4/\Tu Z[t Dž4/!/=/t!th#GXu h<#3_Y4/ h P5/p5(/5/(&=/t/PPdF[^5/ /YDž=/t4/Phl#8XZ/t Dž4/tTt8=/u "=/ug #Phx#Q^_Džc /u h#.[ 4/8<p/t/A,`/d/A0k NYt뉅׋YtӋatQtӋat=/=/=/=/t h# Yh#Z4/ǀXǀPǀh P5/xn5(/5/#=/t/PPD_X5/e /^=/24/=/t h#C[h*#Y.4/PPF#4/ǂLǂXǂPǂ\h(/Ru h 54/5/sm5(/5/"$=/t/PP CXZ5/` /X4/ tyPhM#BhG" Hu^4/  h P5/l5(/5/C"=/t/PPB_X5/ /^4/vwhp#h#Y[Hu^4/ǀh P5/cl5(/5/!=/t/PPAXZ5/P /X4/@#Q4/B4؉BLY[=/uhw#ZHuqh#-_=/th 54/5/h5(/5/=/t/PPU>[^5/ //Yx/54/\ 1ɋ tc{S\9tt@Bt92"u!RPha#F\ @KCu=/uhw#ZHuqh#,_=/th 54/5/g5(/5/=/t/PP-=[^5/ //Y4/=/u ,q40;u ;RPh#J4/04 =/uhw#ZHuqh#+X=/th 54/5/f5(/5/=/t/PP><_X5/ //^4/(=/tx<Ph#uY[=/ăx4/(=/uhw# ZHuqh#*_=/th 54/5/e5(/5/0=/t/PPl;[^5/ //Y 4/8<qH։9u9RPh#4/BHЉ8< =/uhw#$ ZHuqh#*_=/th 54/5/d5(/5/W=/t/PP:[^5/ //Y 4/@DqL։9u9RPh#4/BLЉ@D =/uhw#K ZHuqh#()X=/th 54/5/#d5(/5/~=/t/PP9^_5/ //[/=/2PH҉8<PL҉@D/=/=/N4/,=/t h!#YhA#> Z~ /4/ǀ,04ǀ(<PH҉8<PL҉@Dh P5/b5(/5/(=/t/PPd8_X5/ //^=/P4/L5=/t h]#[h#< Y| /4/ǃLǃPǃT\ǃX`B,F $1҅~K`F@ #CLh S5/va5(/5/=/t/PP 7XZ5/c //X =/tv=/umh 54/5/a5(/5/b=/t/PP6_X4/ph5/5/`h/5/54/Sh‰LY^u Sh#1׉DžDžDž 54/;+^09~ËLSF8HLNd t1RPW5/ t@ t Dž +h#h"^Zu/j=/tHSWW4 4/SA8HLId t1RPW5/ =/t SWW4 4/@0 p/t/11Qh £h/XYҋu Qh#1^,jS3/Y_uSh#=~/ / `/d/=/ȉڃ9sA// // /jPã/j5//…ˆt/Ph7#"Sh,/_Zu$ShZ#[^/jX4/ /=/u*t!h #PPtZYu x/ />hSP5\/5/ƃ H/L/P/\/=LBALt[=x/h#hw#Y_jjjjjS8=\/fGW7fG`/CJtejPh# =/uh#'Zu9h#!X=/tC=\/fGW6fG`/_fCff=v]h#Y=/uh#Zu8h# X=/tfC=\/fGW36fG`/_fCffuih #Y=/uhw#QZuDh#- _=/tjjjjjS6=\/fGW5fG`/f{f9}zD3<:uƃu}EEUEURP5/u u({ /9u/E ;}|t/EUtH9tDRPؙUEЉEeUEUSQRPn RPh#賸RPh"袸 F{j 賷Xe[^_]UWVSEEE Eu}EE}/ؙΉEUMuuuuuy 9Eu/!nh#X19]~NؙEURP5/uuy /9tؙRPh"谷 /EE e[^_]鯶e[^_]UWVSQƉӋJt,B=/2"9t#s sRh#C Css ssV/E14/9)r09~ƋL=/t VSSF' 4/VEA8HLId t1RPS5/=/t VSS& 4/x0Ede[^_]UEU z t]]UWVS]4/Hdu } t1`/9{ u9st7S5/d/uWVs5/Cs{ ECe[^_]UWVP@/4/=@/t+Jdu}  t19x u9pt@t@=@/uh#uu uPE#EHJ@@/@/@/B@/He^_]UWVLU1u} uĉ}ȋEER赩Xe^_]US]E tywt1t1tmRh>#H{@uPs s? Ph<#.XZ=/th*#Yh6#Zu ]UWVE5,/4/x=/t54/p5,/' e^_]@/ÍL$qUWVSQQ9`/ d/s RPhZ#[5/ 4/1ۍ}WSQRPb U Ƹآ+9vAeY[^_]aUWVS\]u EUEUEUEUU3UE3E uUE u uE w%,uu+ZY=p/u <vuE s!]e[^_]kp/U1EEƃE9Eu E9EEUEUEUEUEUEUEUEL ]uuqKURPXtuS謩)lj$SWMwG/ 9rMEUEUE Et6EUEUE&M E!RPKURPXGp/EM tF?N)Eu ]e[^_]MUWVS]\TYL} FE 8uh`{} ^E u h}#h`SPL =/t h#vY=/1҃LJ =/uE PP"XZE \=/uPP!_X1fEfffE@9uރ=/tE PP!Y^E \Ǎ=/tE PPZ!XZ C0\C 04C$8<C(@DHLǃ ǃ Lu*ǃPǃǃe[^_]UEU \T 0H   Lu5PPQ\R\PI UWVS}u=/ //y /h/P[^=/=/=/t h#Yh#=Z=/u׋4/ /=/ux șRQc / /h S5/H5(/5/0=/t/PPl_X5/ ///^h@/5/5\/Ch/5/5/(D/1t-@/t%FS5/{sSϡP/9t )Ph#8</8/=/4/=/t h.#[hI#Yu/=/4/ƀǀPǀTǀXh P5/QG5(/5/=/t/PPXZ5/> ///RX=/u h`# X=/twh# /h 54/5/F5(/5/=/t/PPT_X5/ ///^=/twh#B /h 54/5/=F5(/5/=/t/PPY[5/* ///>Z=/t"d/ `/kdPQSh#蛪/5/%h X/Ee[^_]h e[^_]UWVSQ(ME11҃}54/~8;} p/t/)ӉMЉ]ԡh/E1҉+EEȉ;UЉEE]9]}EЉEEM]H;Mt*EȉEËE]̃rAMEE䋎E؉U܁\TtF#EFEU܋,/QF EURPh/5/4/=/t =/t =/t54/S5/ {U tU tuh#XZ=4/EUؿEЋMMh/{U tEC`؋Uu؍  0EU9Uuu5P/=T/4/MLU9P8u+KIjH`URSP U)S$) )Q h 54/5/B5(/5/Q=/t/PP^_5/ /h//EY[EwV11ҍeY[^_]UWVSu /!Ut 9rt8R}t-jXu h#v1rBЍe[^_]USM /#AUY9u ЋR9uX[]US]M 4/1!t4^Fu(9u 9t331 ‰[]UWVSu} ]9WV+ZYWVrZY/l/t9ZtjSPl/ l/M]XM ]$HX h/t}9xtju5/fh/ h/UMHU M$PH e[^_]ÅtUWVS E uV8"<}EEH89~gًEtV"E4"ߋE#E9u(EUEU~U߉eUUGE9x8}C돃 [^_]US] EUR`t(t7uS /u<<+  !8]RhX"h#UU ME@`t+tDuTɃu:< %ЃPhH"h#zUSE MUR`t't2uCɃ)u-7  Rh8"h#]USE MUR`t't2uAɃ)u+5 Rh("h#菹]UWVSu E$ EÁFl&EFhEEE}~ E@E}$EFp;Ew FpEEEp8MU;U}tуu >FB߉+}EpE$E+EEyEEPE9M}Etu EJI)΍T7E9~ЋU ڋEtE +EtE ڋ+EE$E4~FuI[^_]UWVSu]tVuy XuVhPb!jbx `DžPhd@u Χ usRhedAu 7ƃ u͗8tuhgb!8_X$B<CB(CB,C B0CB4CJ8KCB@C BBC$BDC({hݎ$l ƹ ߋShb!Vf CPhb!VX C Phb!VF CPhb!V7 CPhb!V( $tP ^}=uhzd@u  @RhedAu  @uuhb!jv 41}󫍅Pud ZY@4ȋ9)9t8Ћ}LJLJ(Eǀǀ [Eƀ*P{vj PEPo1e[^_]UWVS,}jhPjWtGjPjVWVo[ u$U ʋMQ؍e[^_]UWVSu] DžPVa Y_TDž%= j/V_ZxrPRV)Ph#h0R›jP`U  10; }SRPOZY0u$PV Y^yG =@uu`uÉDž PS XZuk%=@u4h#h0W跚WÉF= jX ^_1!hh pX à 1PSrZYwtSY Yylc9u 9tԍ0P ^Z+8T8PRPS yu Dž  Dž Dž h'#j$V肙jjVW ÃPhFSd y8S)X Y뚃}tV5MZt8PhF|@S yhF S_X12tP6^}tJMQ41tPYt ZxSW X؍e[^_]Ƀ=/tf‰Ã=/tÍL$qUWVSQ0EċqAQ EUAEԊ/4/x0}؉E܍EPuuuuH UMUȉM̉E9}EEsp1Mȋ])jj`SQJ щEt/]Ћ}<u h3#O[`!ˆEԋy1FX /!9tEԋFXRPhI#t/UЋ}< =/t h#~Yhw#Zu /!FPVT]ĉSFPFTeY[^_]aÃ=/tUWRPY_}UWVS EԉUMQƉ׋]  4/H0ș9Ή}EE5EPWVu_O4/;B0u Exthl#X4/@0RPWVCL UBEuWVPuU tUB EPE܉UM9E9u9t5MC E܋UƉ׋M9M }a ;]t }tcM܋EPEEPT@PƉ׋M܉1;]t ce[^_]UWVS0] CXƹ1}jVEp }܅tPEpdXZCS(EԉU؋WẺUЋE9E؋C8SEPuuu$K4/;B0u Exth#X4/@0RPuuC UBEPT@PChSls}EA}GXEUGWEU G8W<5/#uTGPWTEUTUB E @ 1;U tbe[^_]UWVS4]uE{$ # Eϣ# #4/x /E؍CrE‹R RPYXJ4/wE$$"1Ut4Vh)#T}t4VhL#:1%Rut4hl#j%Mt4c*XZf%f=t+4/ڔڐVPh#̧EPjjQH4/;B0u Ext*{rt4E4/D_XP=/%JXF^9t*4/ؔؐVh#=E`&B9uΠ/8BufJEf9ur=/t h<"Y#hG"Zu/t4/ؔؐ!EY_4/DŽؐDŽؔ4/{rT uDVh#}XZ=/t h" ^h"YlS54/kXZ4/t4(EEPjjucG4/Z09u Extuh#j@EE=/tP@P @u؍4pu3SQRPA EPƣt/EX};}}g4/@01҅uU)й`1j@@P觕_X1U9} MĉыU @BUEEHhh; EPUE[^EE;E}*uLph; EPUE]ZYEEM;Mc4/@01҅uU)й`1E1EEE;u  t/h#HX=/t h#[hw#Yu/M1uEԙEUȉE؉U܅uEEBEP4/H0șRQuE4/;B0u Extuh)#蚣XZZ]ECMQhIlPPHT4/@0EEUMAhQlC E@ 9tcFE`UEE`lje[^_]UWVSMu {$ # ϣ# #4/L/E}/u/Eʔʐ&%ÍEPjjSC4/;B0u ExtVh#耢j蠅MUHp1;u})hU EPMUMZZFEU9UEU4tpv vv6vWhD#=/t hy#Yh#Zu /4v vv6vuSuvEoE`1e[^_]Ë4/!U偺^Ft.h#aX=/t1{h"Yujdt u h#-Z14/t u h#X1=/u tøÅtUWRPY_}UWVSuuuu: É֋EU)jj`RP; Nju 1ۃ`9}.EPl@hFVk`1EUM MAhQlCˍe[^_]UWVSP]UpEM1}%JXF^ECS}tffsCCCC : 1҃}t1 :C(S,C8C ؙt,h#hP"h? h#`U Mu)u؍e[^_]UWVS}]O,uhy#h<"hO ؙt7h#h<"hQ h#UMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}y/t5/WVSh#|SWVu5/1e[^_]UWVS] u}y/t5/WVSh#=|SWVu5/>1e[^_]US=/t h#u?j5|/r[Zt!hH#@h"ZYujPu5|/dX1ۡ|/9XL~$y/t@Pp0hh#{ Cҋ]á|/t(Ux,tPZ5|/{|/XË|/1t z,tUu uuuRUWVu} WVZY=/t@X@d=/t1s(4/f`u1򋈄1 ҉Ѝe^_]UWVS/tH x/ x/4/!`t'Rh#ϐh"蓽 "jsatuhlpx1Rh#xh"< th#s4/ ǀdƀah P5/5(/5/]=/t/PP^_5/ /[1111 4/!PRWVjh|/h#詏h"mZYh#褏4/ ǀdh P5/:5(/5/=/t/PP^_5/' /[1ۡ4/dJw*atP Ph#Rh!#͎h"葻 h #Ď4/ǀdƀah P5/]5(/5/=/t/PPZY5/J /X؍e[^_]Ujh@,#P` UWVS] DžLDžPDžTDžXDž\Dž`DžDDžH@,#d󥍵dho,#uSd < @t|/#uu Z ǃ tFft1At1PuMẼpu?EPSFZY@ukE렃}uEE 9 ,th+jEESEUjSM, tuhD/#Q@jS,,YXjjjjS\, uhZ/#jjjSƒu ho/#S`ljfǂUuuuUPjURjjjjjS%#0PS7XZuh/#S[^GuuuuSBu@S=Y@1}uSAZ@؉lje[^_]UWVS ]u UEhI;"RUVX ǃ Utft߃ruE95 ,tE (+Ee[^_]qjS*EjS*jS*EUuh/#}tu h/#$1z RSYXuh/#a}t1it$$1~ VSXZuh/#/}t΋E@ Nj$1uSY^uh0#S XZ}u뛉e[^_]Ujh@,#Pv UWVSPUu }]t uU:Ph!h0,xl UtRh!h0,^l WVh0, t]E hk"E0,e[^_]+lE 0,E e[^_]4e[^_]UWVS 1;:B}zj EP5l5ږу 9}݋}t߀Suu#$$-Bu uK EP5l5I ZYxEUS1e[^_]USU] Ӄ9tBJ13#[]UWVSuEE;E tEUfuu h<0#WO%sPsT1$lPsLsHWpu/}tsLsHh`0#WVpY^;CXt.tsLsHh0#WpmnZ~~*U 40# Ut80#uu Ph0#Wpu  ujSPjjuu Wj TjpPl1RPsLsHW8 "t Džll9CPvዕlSTp4F(V,+F V$dh~>Vh<#htQChdv$v tQh0#Wd,jVjhdv$v Wf PlQPl/SlX1e[^_]UWVS(ƉUMjQRPuh0#VY[QfUt&tuuh0#VStlZv11҉ tu@ tBuuL]tY} }u>Hjjh1#VjSjjjjjVa 1uuh.1#V~uuhU1#VjSjjjuuV E܃ GE؋E E EԊGE<G 1O1ӉM]G1O 1ӋE ȋU uuuhK1#V~+SQM̉]uuEPPhg1#V& M̋]ЊGƒt:<t6jujSQEUEURPVƒ tZEB@]2EUE UM ]}uSQuщ‰ @t9}_STjX!(jjh1#Vke[^_]UWVSu} hjeZYuVh1#KY^EEU(,E$E U$04%jhSPVxJuhVSKh1#S{T8RP_5_Z@uh1#B$@%=u?$Phd@H @uh1#SY^$uh1#M, ((Phd@{H @uh1#뭋, (h2#S딋ȃu ǃ$, (uFM苳$1RPWV  ‹MtT (,(,EU싋$1҉MRQuu# Ɖ׸9ЋM|RVh2#StRVQuuh:2#SWVSO @EjjEP11ɉ @t`jjjStLEt+jS!YZtT@ P$@ tR9MsGQ jRPS@u*tP ZSfX1 $ ؍e[^_]USQ]teƒBBuCu'EPhd@`F @u%hc2#SXZuSh2#S E] ]USS]jS*ZYu Eh2#jS  ZYuEh2#SY[EFjSjStuh3#SXZ1 @ ]UWVSVu}E X CPCTPw ZYCXCs SZYCu V[Zu Eh43#WVY[uEhJ3#VhXZE1e[^_]UEPdUE PJUEM }҃ @@@ }~ @ H ]UEP EBTU B ]UEH E ATB ]UE H E ATB ]UWVS] {C E1}PhPE$$Vh ZYt 2"b3# b3#2"QM73RUVhl3#h0,[UM;usRQM43RUh2"uh3#h0,[F MU;ut43uhy"h0,x[Fރe[^_]USQM$1SQ,( eY[]UWVS u} W l5M19É}uRPh3#V;IEPu8 ZYy 5l5hLn!!UEG9ø|5l5h3#V e[^_]UWVSxu >1;FN|#~$u~,u;FF |F1҅8tOu[tu_Y-{CV$9tVN19};K;VN 19};K ;SHEPu1_Zǃ~,uVЉ||t(6jmEPj$W8RJEPv,tijWR$p uYjuWUu<@uuZYjuPUu.@v0sh3#uv[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0h3#S 1e[^_]ÍL$qUWVSQ qyAQEUy uh3#S~XZ:$E܉EEuuWV,  tuWVh3#SCDEPuuuu lj֋EU tuuuh*4#;MM}eY[^_]aUWVSu Fhtc%5l5 _X1ti1SщU@#MYZMt/UBuSh^4#u| htc%jY XZ뫋 D#F H#F։e[^_]US1L#@#uhz4#(T`u܋]UWVSP]EE}u h2"S9A 1E#D#H#! t+}G";u2"u PSku @#S\`u؍e[^_]UWVS]EEEE}EE} tE U U uh4#SZY[YSZtN@P;E sPu h4#S42E HEPSkY^E#ƅUtu h4#S c׋EЉEJ0!#B4 MJ0 EB4SZ@tuS2ZY#x0U#P4 }x0 UP4S_@tu h4#S e[^_]USP] ;u=j EP5l5f{ U:u1҅u5l5hLn!u] Ћ]UEUitstau+u P uPZYU@Rh4#P US] ƒt+S5l5%4ZYt5l5h5#u ]US] ;u&5l5Y1҅uh65#uXZЋ]USEU MitWat&bt?L,RP@st?ttHs:~hH5#P'Y[n1gRP $RP_[Z@&Zƒt,S5l5!3ZYQhZ5#P ]UWVSu }jj h2"WVj]S1 yEWVuhs5#ZP}t Sh$#FPZYj ^OXe[^_]UWVSQ]M tu E4"!E !Qh{5#S'M $jVXZM uWh5#S 9jVQjjuuS E 1uWh5#SVZe[^_]UWVSQ MAQEUA E܋AEjS)ZYth5#2jS^_ujjjjSJEUE Eu h6#SY[EE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUSxZxt h6#PP @9E}}EU u h96#'EUjjjS@ $uTY_u hS6#jPjuujjS? uVXhx6#S p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEԉU؃F0V4F8PS51_Z@)QFHVL}$E$;EvE܉FPFTy 19VPvUWS0ZY@UB߃}uujS~@jp juuuuS u h6#a @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]UVSĀ]E 9 ,tE @+Ee[^]i,(h7#3$h7#K$1RP,( RPh7# h7#藫jSV uh8#~XrX CRPh8#NKs,s(h78#s4s0hK8#$C8Phw1"hxV,Vh^8#KsPhp8#J 1e[^]UU E$E8E U]bUWVSPEPV @'Et M 9 ,uPhV EPVzhX+ju2T e[^_]UWVƉj(jOZYt:0xu} px @@UP@@ @$e^_]Åt!USÃx$t p SZSSX]UWVS}uE}t;EPEUEP @E؉U܋EUEU9E ]|'E@h29#W,Y[~M ]M]M];EE}?ENuuuu uuuuhA9#W(#E@U3U M3M u[U3UM3M uKt-ut#uuuuu h9#WvEpE ]C E$C$tKut7(9#w !#(9#w!#QRh9#WfE@VuuE Uƃ )E F E$F$EP]K[ M];UuK;E uFE@FUVtpEpEU}WEU+EUGW QM]ӉM؉]܋]9]u>]9]u6E@F}~tpEpEU+EU}GW u{]sM ])SQ t@FV AQ ]S)CS CANs^qAtH룉뛉h9#WXZEEe[^_]ÍL$qUWVSQ@EAQE؉U܋A QEUqy19WVuu  t/E؋UWVRPn щΉE؉UMWVuu  t/EUWVRP+ щΉEUMEE E؉EE EEi{USEЉUԸ;EиE4}tE9E؋EE$E؋UX9uEE؋U܉EU}NWVuu EUċE Et0EЋUWVRPZ ։+EUԉEUċCS +EUĉEȉŨ}tE9EȋEE9uȋE||E Eu?9}EEPWVuus ÉыU Ut%ΉщEȉUM EUEȉUjjjuuȋEЋUEURPuà [1ۉ؍eY[^_]aUWVSQM]ԋyYq ]uQAEUw}x}y h9#TE Eu h9#:~t h":#*GW E؉U܋FV ] ]uM؋]ӉM]O_ EUuuRP UMˍ eEUME9Eu E9EE9EEE}!uuuuhC:#u$EUGW +EUVN^ )ӉN^ FGFtxuuuu  t;M]M]uuSQ UMˍ eEUMGW EUE9EEEE}rUGW EUt~tIWjM]+M]SQ uh9#u1GxpF)VFV 9EEEuh]:#4~th:#'FV M]+M]M];E]}h:#uXZEET+EUFV M]+O_ ^ uFGFtxEUGW E؋U܉EUEUeY[^_]UU Et 9Pt@]UE]UEt Pt]UWVSEtd1yAQ $T$D$T$ D$9E ED$ |I11҃yu#jS(jS jS jS u u h&>#Zu hY>#)R u9r$u9r u0EU+AQ RPY^@d jSHXZ4jjjjSx hZ/#S:cljfǂUjuu썂UPjURjjjjjSZ0PSl^Xh/#SY[TPh>#S .jjuu& jjZY@2jjjS:ƒ ho/#h>#SmXZ1e[^_]UWVS4u ] 1E"h>#uV! tPSu @u95 ,th+jMZYjhLm Sue[^_]UWV@,#}^_]UWVSH]u EEEEEEEEh9?#uV Eԃ @t=}buEPSXZՃ}qtuԍEPEPEPS@uE95 ,th+jjE1;EE}1SMu_t xuPt9pu 9uU@uuuuuSƉ׃u E܋UẺUЋE؉ESZEHEPSEjh@,#PKuuh4#S e$1RPuu< EUSXt E;AtIh?#SXZAQ EĉU19}T;}uO;uuJU Ut&;EE}:MuuuuY  ‹Mu}hC?#Sh[^uuWVQMSẺUЃ}Mu }E9EuE9Etű}1yMăEp(x,SY@tLup(x,S@t&uűMq1uhd?#SEEԍe[^_]UWVSP]u }(,EUEh?#WV E @t4}qt(}su0jsEPjjS@uEE95 ,thأ+jEuujjjSOE؉U܃}u}tu؋}܃u}E Euuuh?#$1RP,( Ɖ׃uЉ};E؉E}WVuuh @#S|jSJEZYtPE؉U܋E Et hH@#E@ EjSjSu h\@#H A EA$MȉEjS jS MtuMh~@#S^_MȋE9Eu'E9Eu}u h@#SY[EEȋP APATЉEE؉EM;Us;Mjh@,#RUG UMtB(ƋB,9u}uEȋP @EȉŰEU+EU9E|uuh@#SvEЋU+EU9E| h@#A}9}EE} EUE؉U܋EU;EU}9}}}„tE9EЋEE|EUE؉U 1;EE}P tGt>}u hA#SXZ u؋}܉0x+EỦQ}u h4A#SA_X1;EE| EЋUԉEUuujS@jp juuȋEU+EURPS  uhVA#S @ r $󤋃p PF V$FPF0V4j\VFS H PAQPA Q$PƉ׃q0y4AHQLS@EthwA#-}~1EǀuSEY^@hA#SXZE}Љ΋Ee[^_]UWVS]EEEEE11hA#uu  btENtoat%itClh~&Y1EPS&EPSdEPSZY@ky҉Љ։X1;EE}=SzMM܋UUZt&xuPtM9Hu M9uU@օtE 9 ,uEU t th+jZYWVRPuSme[^_]UWVS֋UU $)#EB# t hB#)XEV/#hEB#\E(B#PE7B#DEEB#8A t hB#^)XhSB#S)C SX1O11;u ;FuEwB#h]B#(_tjmWj$8SM1tttShw1"ShgB#hW Wh"w(ZYzhj/#i(Xufu]EA#E EkB#e[^_]7(e[^_]+(A#t2"PPh$' e[^_]UVSÉjj h2"U MeRPjuV} yEu uShB#'}t Vh$#'ZYj &Xe[^]UWVStƉP]Zt 9St[RhB#V= ({ RhB#)'$1s3щ¸B#$1s sщ¸7#Wh<#hVo(Whw1"htSUSVuhho&V SVhB#&GPhw1"hSShC#u&$jmSj$G8PShC#S&hC#I&G0W4 u hB#BXRPhPP&1e[^_]Ë ,Q,y ;,| t,J ,Uh,P$+XZUWVSxh$ hB#%h2# hB#%hB#蓅Vsà Gs3 hB#Y%s s hB#C% / %CPhC#%K Cs31 { Wh<#hPt Whw1"htRZtRPuhho&P PhC#$tRh1C#q$GPhw1"htR tRh^C#C$hC#9$jj h2"$K $cRPjRȳ (y&$K $cRPhM !# Rh<##ZY jmPj$W8RBPhC##hC##G0W4 u hB#苃XGRPhPKPo)hܯ!N#K Cs31: + [1e[^_]UWVS}] uEEEEh D#VS tSl`~Qa wI$)#uu=MȃMƒM뼍EPW EPW7ZY@uM9 ,th+j_X_jW<[^u hD#eY]t I;]E}1W)uMZt xuPt9Hu 90uU@܋Utyh$ hB#!h2# hB#!hB#ρWƃ v6 hB#!v v hB#! k aFtPh>D#V!XZ hޯ!H!Y 6 ,N Fv6U vXZZ؍e[^_]UWVSD] 1}@,#}EZD#uhgD#uu ` tGTtlu&h~&3Y1tukVS_Z@ut6PEPS @u#tjh@,#V9 t E 9 ,th(+jZYVhπ EPSae[^_]UWVu }^_]UWVS]u EEEEEhD#uVm tfitLat%bt0lh~&VY1txEPSthEPStXEPS_Z@uG1;EE}1SHM}Zt xuPt9xu 9uU@܅t95 ,thH+jZYuujjuSVe[^_]US HfJfHfJHJH J 1Ɋ\ \ Au[]USYSYSY SY SY SY SY SYSYSYS1hE#RP#]UWVSEUPUfPfUP Uf@fEExsu>1ۍujVk*#W7 uu wuL  u]CuEExlu<1ۍujVk*#We7 uu wu  uCuɍMU Ee[^_]UWVSuU t>u1}]U EPEPEPEPEPEPEPEPEPEPEPh1E#V& 4 U u$Eyt#uu  ttPVSm @ut E 9 ,thh+j3ZY-jh VSuEtjh VSYe[^_]UWV}uh/jVXZ/Ex8e^_]UWV}uh/j$XZ/Exe^_]UWVSE] uDž"hM!VS} @toul59 ,tE +Ee[^_]!觔 9$yhG#hh,#hPhG#( 4[@@ǃu‹p vhH#PY+ F8Phw1"htW=WhH#S. XFP[hH#h\,#hhG#R9{ p hVh &/ ƾ1Dž~" ÅnhD#P& KPh!Sf* 1FPhG#SK* FPhH#S0* FPhH#S* FPh~&S) FPhH#S) FPh&H#S) FPh1H#S) txFPh>H#S) taF PhLH#S{) tJF Ph[H#Sd) t3FPhhH#SM) tu Džt SWnJ ZYuS?k YhvH#胱[^'LuhV/#)WhH#/ uSPh,#S'' tShH#J  p Dž@$A 9T軐 Å-uhH#hP,#hhD#P3$ Vhw1"htWWh~&S/+ FPhw1"hWWhH#S+ v$v h$S,* |v,v(hcF$S* `v4v0h=!S) DjmWj$F8P7u$Su ZYWh4#SU* uhH#- hH#- ܚ Xh h" ,t9hB!Y_u!h3.#輮SCVSXZ,tV_S^Dž$ h Xh Zg [e[^_]UWVS]} U"Dž,hI#R$W  @$t&Ftiu5l5Dž,9= ,tE +Ee[^_]7(,$($jScZYt,uhI#*jSEZYujS7ZYt ,uh>#S? @h"VZZYuH#V YuhI#hG# s XZuhvH#롋$1RPQ{ uh?I#SĬ df  hH#  YXthH#V YZtjhP| u$haI#SiVf f  4Ph,#V~ F41$1$8PhH#V& TP8B^Z*1RW($ $(,Dž01ҋ$()׉ hH# 軎 ZYFhH#P覎 ^_+PO Yujh@,#R) ubVj X8Ph~&Wg% dR8YZdt8h|I#S蕪 aDPh$W LPhcF$W i,9DH0}hI#S1XZDž,p;L PVi $@P, u hI#jjjBu @u hI#1$9vP,Q ;$uH#W ,D0PhLH#Wg ~,|u/(~ǁA,$*,D0Ph[H#W ,D0PhhH#W "f ,fǀUjjj*Bu@uhJ#SM$,Z ;$u? ^u$H$,t ke _Y4t 1󫍽@Wh~&V& tuhvH#SvR@ZYu(WhH#V tˍEP@ZYt@h|I#S& nEPh$V tEPhcF$V mEPh=!V SWh4#V` tj$EP@I sV襲ZYu+C xu"t s s^FYXj iZupXe[^_]UWVSuE @80ƅ77Phd#V t 7uQ7V Y&Vu Zt hd#_j0 PhL&. Ttg81ƅ9L&@󥍅8Ph4d#jPSUz0Ph4d#jPuV;z VSh:d#j S4i[t hs#j T˅S zuR$(WsZY(u1$zu%B sV"ZYu+C xu"t s s>YXj ZuiXe[^_]UWVqJ9vr^_]UWVS]u(ZuP+8E_@u hL#hc#u/^uhL#hc#j sP3ms WsahgX$uv t.P Eh#unv E tZuȉ EYLEPhɾ"u }Chs@Pu] @qhse#uu XZt V[ Yh{e#uu XZt Q= XMEPhɾ"u E Mu {hE EEEM؍CU`EPu u @MuhL#he#fEftft5fu6t2C t Whe#j4 }tC(Uhe#C0ut3he#j t C0sHtS4KL9vщ}t:s@shu us@s`u @u;481t/sl`}t$CU[s@s`u @uEsd6CptSuZY@u s\he#s8sXu @u s\h<#te[^_]UWVSPuq Zu1hu r _tPVP Yt8W{ EWu Gt Mu SI [1PQSlt uVO XtSbq Z؍e[^_]UPEPh#u ƒ 1tEUWVSu\Phe#V t\Mfnj4Zu\VXtd$1jRVGVhiS:@tt}f1RPhe#u 1e[^_]US]uu S? @t ]]1]UWVSu ur [^u lP豅 Y;EvO?V軅 }ƉM)1Ze[^_]UWVSu u!r [^u PJ Y;Er?VT }ƉM)1Ze[^_]UEPhV!u ƒ EuUWVS8uEPhe#V uh}$hL#hhe#h7f#VRq _ZtP貄 }ĉ[J]ShiVt5}ĉjS͂ Ph7f#u q ƃ S&G YuaEUu؅yكۉM]! EjEPq XZt!Vh7f#u Nq VF ؃e[^_]UWVS1Rhiu4 @t|j7RPhAf#hS.ހ>tVhwf#Vt j7RPhAf#hS;tShf#_Sv\ e[^_]UWVS]h7f#So Y^tVP Zthf#hL#jVhe#V Uܹ׉RhiS3@u hf#j e[^_]UWh%1󫍅hPhiRe3 t|}UWVS\Phf#u uh}$htN#h0hf#1dShiu2 tW\`tyƉރ߉\`! ftShiu2 @؍e[^_]UVSuVoZtÍEPh#V5 uh}$hN#hhf#iuS1^Xu h8g#j CPS ZYu hN#hJg#Phse#u bn uhN#hdg#j S1e[^]UVSSu] EPSV @uhN#he#j h|g#VSm ZYuhg#hN#hhf##Etse#PRSm ؍e[^]UVSSu] EPSV @uhN#he#j Eu he#j h{e#Vl ZYuhg#hN#hhf#Ph{e#SFm ؍e[^]UWVS}ho#Wnl [^uRP pY@vhg#VZu hg#jY VPho#W@u hg#j xtdPhiW50 thg#뮉`SYX`e[^_]UWVS}h m#Wk [^utP~ pVZYuhg#FVPh m#W6@u hg#j^ Eu]EPhiW/ @u hh#j[ SX1e[^_]UVSÉЉʉƃ ιX"u2"QuRPShh#oe[^]UWVSu1j ,Vhxi P@uh)h# UЉUPXۋUu hBh#j U]Vhxi W @uhhh#ڋE9E~E19u~tj YWh<#FXZj SjUVSPuVqZt"ÍEPu V @u Shh#j @PUVSuV[thgX$Vi ZYuhg#hN#hhf# P| ^fx PS-ZYu h8g#j PX1e[^]Uhh#J1US]dPh%S5 uh}$hN#hhf#i d|lPhiS,- @u hh#跂X1]US]dPhv"%S uh}$hN#hhf# d|lPhiS, @u hh#BX1]UEEpPhiut, t hg#jH 1Uh|g#uh ZYuhg#hN#hhf#M Phse#u h Ƀ0 v+BwBÍBwBU]UWU1ERhiu+ @u hh#j 1}UWVS$ƉUЉh#l#P6g [ZtPz Y1D]Shvi VY+j Sx Ph#l#ug à V= Ze[^_]UWVS,uEPhh#V uh}$hN#hfhf# ]ԉًU 5@utE̋UЋM}}ȅy#Ɖރ߉ủ}Ѓ!Mu! Mu ։uj Sw XZtVh#l#u f VB< ؃e[^_]W|$wUWSÉЄtGjj h2"QPj]Sw SN z2"tX"PShh#, hë!¸}G"xXe[_]g_US ]EPhh#S uM.juS) uEhdN#h<#XZE1]UWVS"a uhTN#hi#j, jLh+/_Zh#u2"jmh+ZY¸i#u2"WPSh#i#h0,=h+t VW?Xjmh+ͩZY¸i#u2"SSSSSPShi#h0,$V: jVUEU P]UEU P]UEU P]UEU P]UET+T+1]UE\+\+1]UEd+d+1]UEl+l+1]UE@t+t+1]US]Sh+趨YZt V=CЃ v؃߃Av 4h+Z>u +1]UE;1҃t`/]áp+uUP;Ut@u]UWVS4EEE䀖5 / /EPj YZ@u hCk#EU׉uȉ}̋MMāɚ;~EU6eĉ}ċ5 /EEtNމ׉uЉ}ԉ΁ɚ;~3EUʚ;#EEEEEEPzMZ@t E EԉE{hs#j u8GustwC t@P_Džt@tCt΃}tċMU;Uu-;Mu(9u}SYtjEP˟ XZ= /u(];MU}S_tu$Sj9EPj] ZY@UE;Eu;Uu E9E~ 9Uȋ]}h&!j UWVSÉHP _tP^D DžD1Q!LY@u hN#hc#&RPHSƃ uhN#h]k#j蝹 R1RPhkk#hWUWVhk# jVWpWhiL^@u Whk#yt Ph l#yXZjVW&Wh~iL@tt Phl#<Y_j TpHHZ@uhN#hl# u =`+j:RPh*l#hWS?tWhl#W| j:h*l#hW ?tWhl#}W| tHSW?YXjVW Dž@WhiLuhl# XZjSa#jVTW貲DždDžhDžlWhiL @t~hXu hl#l@DždWhiL9 @@u hl#@lhm#P@RG =/t%d!w$N#Rh#m#Y_HS XZ=/u0=/u'DjHSDP jV`V{ =/-zk?VPL\ @uQk#=/uq#Pj* hJ%3m# /X ths#}G"X th!}G"iX thZYUu ,"9ER ]E É /X1e[^_]UVSP]U Eh)q#SW ZYu WPk S>k VPsÃt7EPS5 /hƣ /S/1Fu"U /e[^]UVSP]U h?r#ScW ZYuh!%hX#hhp#Pj Sj VPasÃt7EPS5 /ʞƣ /S1Fu"U /e[^]UWVS]U hq$SV ^_uh!%hX#hhp#Nj /%EWi Wi VPrt5PEu踝ZYUu 4q#EK É /1e[^_]US]U fEPh @uhp#HЗPhq#^h$HH9Tt$h#3h$Tj)=j 3P4Z,H%(hq#L[#_1ҋ0t^Z#xtM(9u;0t⋍4#HɋL }G"u2"QPh$w ,떅u ho&[^j tYjmZti 119X~M%9u>uW膖Phq# h r#hr#4j F뫃 u]e[^_]e[^_]UWVSSӉϋuu M  0M Xt8tVWPQ u3'' Y1t$EV' ZEV'  Xe[^_]UWVSu]Et,DžpVRpRtWjP2u dpWb Y_uE %NPڋE ZtEC sF C1e[^_]UWVSW]EtGs$URPƉ׉‰ 9иr E8t 8"uF9;sC| C 9s} "WV1 Y^uu 'K(PUE -Z@tE}G _C G1e[^_]UWSËtPf% X1e[_]UWVSÉUMUEE;E t]ztOUj8VZtbNjUx4uup4x u}x xuupK(C(E81 S$uS$S(PXC$ue[^_]UWVSDž@}uHoE@u E@ u+PE 0-N ZYuCPE 0N ^_.LPhV!E 0 u Dž0 L0t 1󫃽0 00`0uAj[Hhtc%HPH,ZYu Dž,&EXtj/V [_ÅtC`1DžT0XDž\@PTP,Viǃu@xuPqRTt/0u#xPVW(ZYHufDžtt,Ttt_1T[Dž,tN(j DPS`i,D (t8t1ҁ,v "1҉(Vz^(v0 Dž,1ۍ A$(P0Z$ tW0,f8ljB$@tPL Y(0[ 0p uEHVUE Z@tEx$,V1 Y_u,Vhl[#h~r#j謢 @PS$[ S u hl[#hJg#*VEpE0I Vd uhl[#hdg#jR E}G }xG }G1e[^_]UWVSu]}t WZv W Yu %NPڋE gZtEC sF C1e[^_]UWVSU1EXEECu5}Ej1ɋUE E@upup Z\uu}Wu Pu4Eu }uEEXExtHu E؋ExuY}t 1}t,ESy}e[^_]UWVSQu}uLSEX$:Cu S{0u3PE 0'G YZun?-uGPRUzYZUu{(WRzYZuA{ Cu Cu5PE 0F YZtPE 0F YZu^Cv Phr#j蝟 $T[#PG_ -w7' XZ w79( 1t7 _t8ȋK 11PE Zt7EF EFC4FCF1 e[^_]UVSu]}t;.j^ NPڋE ZYtEC sC1e[^]Ujj$ZYt$[#U PUPUP UPUPUjjZYt[#U PUPUP UPUWVSu] FtVuVVPY1;}t&j^Zt2TPFNG1 VuVVPMXFue[^_]UVSuj(jZYt;[#ECCCCuu S> @u SX1C؍e[^]USj,jZYtAx[#U PECC$C$C(uuuM @u SX1ۉ؋]UWVSPu]E1+Ei;}|1bt:M9w証GM 4WSuVuEsG]15t1jWSuVus]+Mi̋U; r+]i̋UU:e[^_]UWVSP]11;}tCSRuSt,Uu 3u PU҉EV EtG븍e[^_]UExu@Rt]1]UEP 1tRZ@US]C$u C$[Ps S= @uCuu P{Z@u1]US]C u C [$(KSs Ps @uڃC4uu P Z@u1]UVS]u j:Zt$pSuCCC]e[^]e[^]UWVShr#uA hr#u|A tÅu'j`h[#hr#?H VT ST Y[@8Fthr#\F1󫍝NvJvrt󤀽uIE9 t hr#j̙ |t uh s#jS jtP PhJiuƒ 1Buh)s#KZXe[^_]Uh0,h9s#hXZUWVS, =/ ƅƅF1RhKiuF @ PXujP Y_VjWhQRP qpujPW XZpVjRhVpQP h&Ws$Ѓ,h&RrZYЃ,w#tRVRSPhqs#qe[^_]UjhIiu} @u hs#j 1US]D+9t tu< /C@t5< /} X ujjS[< / u D+D+]UWVS ]E1}t;0uK,f|Jxu}}E} tˆUPu 1ZYUtCt!,DHt KDHuhs#}9}rths#hs#}X1EtR ,ҍBu ,W{G09u ,f8W Ћ}G/CEP#U+UE9~ )1}E؍e[^_]UWVS]u ~;0t =,11)S,f|Pxu> fLOt0@t@9|u"tt SVhs#SPhi!! %hȼ#Y19};Ph!GXZe[^_]UWVS ] uع1}t}u+EU EUܸMMمx9s1LuÍKكt :M؍AMP1Zt fP׋Me[^_]UWVSQUU} uj[Uuhc#RZu hc#j褔 jPV譏 u} ]e[^_]锧UWl$1E|Ru ul}UWVS4] ufYu hP\#hc#j)Z@uhP\#hc#j PM&_@u hP\#hs#ݍF1jRS Dž&t6Džt#*pn[^ÅtuP zu yljDžBPhi @uhP\#h t#SZYs:[=/u@ SjjhSRP Sh!̺ +Xe[^_]UWVSu FPYZu8+u1hL&j \`%1juSt \vSh iR @u胱81ty8/th!t#bRXpe[^_]UEU =/uRP*ZYE E1t#ǹUVS] t4sVukZYtC P;UuPVZYft1e[^]Uh0,h@t#_XZUWVSSƉӉM1V(_t@jht#PP u*W,DPtSh:iV9 @}u hdt#jn e[^_]UVS]u1ɉf@uh\#ht#jd EPht#S9 u)EfEVh9iSƒ 1Bu ht#j e[^]UVS ]u1ɉ@uh\#hc#j EPht#S t,juVV E؀8t-EPht#S uV)EfEVh9iSƒ 1Bu ht#jf e[^]UUE7@t0UMfu t E Eut#PRht#m ËPtB t#Pt8s!Pu+t#øt#Pts!Pu t#øt#ËtO-t#tEt#t8s!u+t#øt#ts!u t#øt#UWVSljӋuFEE9vU19ta ^w@vzMShȼ#W谣S 1M;us?v:1MFPh!)ЉUPSU MuQWg u9utD7...}e[^_] 1e[^_]UVS ]uVhiS @u ht#jy EPh u#S蛾 uh}$hX^#hhu#E߉EVhiSP uEh\u#MXE1e[^]UWVS$]uӹ!1j EPhk%Suh4^#hlu#j褌 EVhiS= @u h~u#j讌 1e[^_]UVS ]EPhu#Sn uh}$h ^#hhu#uVhiSt @uht#E؉EVhiSU @u h\u#j* 1e[^]UWVSxhShz#u@uh^#hu#j躋 DžDžDžDžDžDžShu#(ZYuADžDžDžDžDžDžjShu#C ‰؅uDž8 ,DytRx:uL҃0jWVhtc%P;t49u8tShu#jp jRVjPu9HDžDžDž|Phi8uYƒ 1Bu hu#j* e[^_]UVS0]juVhz#S衾@u h^#hu#Vm Zu Vhv#j豉 Uf@fEލEPhiS @u hv#j讉 1e[^]Uh0,h'v#6XXZUWVS] 1}EPh8i(S~ @t&E1r r%1ʹ|󫍕[!RhiSt @[< v Phv#j誈 hw#[P\P| <fDžLVhiS @t%fNthw#=/t hw#躰_fDžLVhiSi @t%fNthw#=/t h$w#zYfDžL VhiS) @t0Nf=) Ph/w#FXZ=/t h7w#/XfDžLIVhiS @t0Nf=) Ph=w#_X=/t hFw#^1|󫍅|Phi8S @t}u(j Ю$PhiSb@UhMw#脯EEEEĉEEEԉEEEEE|Phi8S@uh#.YruuKE E Eu:}~IE,DJtx:t~+jPhu#豏 uVhUw#ʮXZDž|}Fy hu#褮Y Pv XZ9j,蘭XhYw#jY4t8hew#PXZ h"BXj [_PhiS @PhiS @jh^#P{ u ftePhuw#ϭ[^Vf"fPb Phw#蚭 ft Phw#ZYj 藬Xe[^_]U8EEEEEEEEEEEPhi8u @u hu#j誄 1UWU1Rhiu @u hv#jq 1}UVS]EPhz#S uh}$hh^#hNhu#huVhiS: @u hw#j 1e[^]UWVSVƉ׉Ph<#BVY)ƍ 9})j<>E[7)؅~%Ph!CZY9]uj>e[^_]j-XUWVSƍt1fDžfDžRhiVX y hix#j h'^ Džl)֍H(@!P _9l}l' Džl hx#hn%hx#hx#h)x#h!v#hx#llhx#ߪ(ppx(@!P!pP Y` /t ` /Ea /tI@tc@tC@tP@ tS@@tB@yA@pX@dp@`pp19~pL9}B\pfP@u uw%k pfx p@tp d#z= tt= w-g [=wOft'k 11?1p%1=$v-- 1p-1Ƌp P h` /Sd`\VPPllhx#p@"Xp@!ǃ0X*w'Mwt4tou2tW0 Y=/OGPSPhx#hx#7=/Gdw#tw#Ph<#XZ3"9dv ΃t#x2"VRPhH!ŧCtc%ʀ=/cGPGPGPhy#h y#菧G1d_19d&j>胦^=/GPhx#RKStRTRPhy#"RPhy# F뗀=/GPh&y#Y[Gd<G=PuZh1y#h<#軦XZ=/bGPh6y#蝦G.Ph;y#芦_ f`Wֹw#d8t-\PQh$AK B;!\`f\TddTw#tHw#Ptw#Pts!Put#PQh$踥K B;!\T`\d<K=PuFu:hNy#h<#W^X=/GPGPhSy#4 t#=/dy#hNy#h<#Y[=/GPhly#֤XZ1t D ҃L dd`w#du2"VRP`Q4^#hzy#wCu_hy#h<#W^X=/GPh6y#9GPh;y#&wW ÉTӹw#\t-dPQh$N B;!dϋ\fd`T T`w#tHw#tw#ts!ut#PQh$aK B;!d`\kTPhBy#ZY=/O)w1w#'w$`]#Ux#w#{^x#tqw#ugcx#`w#Yw#Rw#Kx#D x#=x#6x#/$x#(.x#!3x#v D![^]USQjj]Sjjh +Fthe!uf /Zu h2 j r jjSPjh +Fu‹E /]US6Ph}#h0,h0,h}#p@Sh~#h0, j腓UE E ]#LUVSE M}uP0X%  %9t}## % 9t|}#`}#1҉1[^]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t}#/ $ 9L$t|}# `}#11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]}# $09tu|}# E`}#11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t}# $9L$t|}# `}#11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]}# $9tu|}# E`}#11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]}# $9tu|}# E`}#11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]}# $9tu|}# E`}#11Y[^_]UWVS UM EuT9|$y|$L$ ʉ1щ9L$t}#9T$|}#uwy|$y|$L$ ˋL$ ˉ$4$19t}#9L$t#$9T$t# `}#11 [^_]Uh jjh@+uR1҅tPUWVS jEPM E}^X1;u}2}SPGZYt#SPGZY t FEEe[^_]UVSQË0tRVh#EPkVERhZe[^]UWVSQ1:nuzouPyhXEhtc%P^ ZYt98nuxouSP ZYu}SPZYuE1V耟Ee[^_]U0PPPh#h0,,jύUWVSlju],PQ ZY u Qh"#zDžt } t-U hH!u 让Y^Džu!hu4hw%,PE^ZuH!su MjPK ZYtDžoh#+_ jh0#P#~ uOjZP,P} t) 9|] 믋RSW} Åu=!/h7# j VhG#[Et!Et"Et!Et6-$|#u0P,P [^@tjj@OfZY,t#jh0#W| uh_#SRY^0H!tWhk#Wh#hS,@htc%,P XYG9 PVeXZ tK <-u"j=RTZYt)@ t" m b ,tD=!/t}t =!/t/hs#8Y14h$"GXZ9j 5_}t$P{ [@u hR"S(Y.# t t8h!/(ZtPXP贚X(=!/tj}t0$"M jM j(z @u hy#'_+,W3h$h,RP,Rd 茆8tV,Rh"j' ;ub8uWVWh#H'j\tPљ[PęY}u, Ex]((L jj =[ WS$J ~)t}u2h,,P4XZj P$J ~j,P  @uh`"\&F,ƒu t(bt!=tR蓝PVh! }u4=!/t+0SVV Y_@uVh#%XZ 1ۉ؍e[^_]UWVSj Ph#*311tc#tN#t =!/t2#P#t}G"QRh$ !փ 덍NX"u2"x#t}G"VRQhʃ#yƃtGF#t}G"Rh߃#Oh t 0h<# hw1"$XZ=!/KtSp#t}G"QRPh#=!/h}G"h<#Ջsds`sTsPh#迋slshs\sXh#詋0=!/~chSjjhH!ju.t%j SO^_tSh:#= hm~&B Y" #u ! #Ph<# XZe[^_]US] 1t-tPu=ZYu!/1=!/]UWVS];nu{ou !/S%X1uh!"X1[,u@B uP=Xuh2 "VM^_&3{j,VMZYt p7؍e[^_]U&PhG!h0,ҌjuUWVSRu ]1}Ep5 ,h#VuNw tXe wc$`#MՃMσMɍEPSh#5l5Ru hH!j a PARX똃M뒋 ,E)ȃt!ru2uVrE}8EUBpe[^_]UWVSxSV|PWu ujtW|Sh0 q ,@uSVhM!jI` ~@t(RPh#hSqS jUVS]u VS: YZu] EH!e[^] ;/t"ShH!肶XZu EI!e[^]ke[^]U$PhG!h0,ƊjiUWVS EEu EE}]EEEp5 ,hM!Vu5u t4ouBjWh#5l5Pu hH!j_ PFPY붋 ,4E)Ѓt8S6EXZEE FEe[^_]UVSSPPVu ujVSh$o ,@uL2~tOH!t"~0UZ H!u`H!PShvH!j^ jUVS]u VSQ YZu] EH!e[^];/t"ShH!虴XZu EI!e[^]邴e[^]U"Ph#h0,݈jUWVS]E#1Džd11DžhDžlh&#u uLs 'u+fM'9t=G K|뷃g$#UK| 땃K|돃K|뉃K|5l5CpXDžhe5l5CtXDžlG5l5CxX.5l5Xjuh#5l5Mu hH!jS\ PMX5l5 YDžd ,P;UtGtuSx t SxM tu4guV^Ehhhlll ЃtTxPVCYZ@u Vh $jp[ htECpltECttE%CxdupVVo@$XZK|ǃe[^_]UWVS SVdPhWu uhWdShV$k ,@uSVhM!jZ f@tKRPh#hSRlSh8#褂0j|USP]jEPS*U :9uySu hEM!jY ]US]SYZt@ hϣ#SZY]US]S^Zt@ h{$SsZY]USP]jEPSU 9t :uy ShWM!jSY ]UVS]u VS袨 YZu] EH!e[^];/t"ShH!XZu EI!e[^]ӯe[^]UhI#jX Uhe#hv#h#hʒ#h#Ph0#h0, jzUVSQÉj EPS U:uVShJ#jvX e[^]UWVSuEE@t"!/ 1VFe[^_]P_u h!jMX VP ZYuj z]e[^_]運UWVSQ]EE1+h#u um 2F$#=H"/tD"/뷃=D"/uH"/c뛁K뒺al5C8K t L"/hK\cPDl5dC@K@2K&gl5:Pzp s4K #Il5C(KK@KEPuh#5l5(Hƃu hH!jV Et L"/tctKtK@tK t=H"/D"/ s=D"/tH"/c@tKt ,+sc sKsC  sC sh#VF@"/XZEth$VEC$KY_Ethl#VEC KXZEthr#VEC$KY_Eth{#VECe[^]US]CEEiEPjEP5 ƒ Jujuu s諆 ]UVSu spuuuVu~C9 "/u7VJu/^˅t)v ,p0%p0Sh,#h#xe[^]UEH؋U PEf]UU ot|ȉEEȉEEEjxPjEPjjhuA w/o0ÇPh #h! xnoHxUWVS]u uu uO fMACCS1CCCċ "/Q "/ʉSCCU ʉSЋUʉSԋUʉS؍~M$QRWh' ])SPh& uYtFv Vʅt {nH)V)t!Rh4#h #vSnH e[^_]UWVSjQEU_11Ҿ1EE19É9}m<uuuU EU ;E}EEu4j+EU[;EE} h.^11ҋu}`;Ms.uQh@#h0#uu}Ɖ׋E܋UEUWVu uuUÃu;m8u1j5E܉U+M])YM܋]M]o؍e[^_]UWVS0։1RclZ=vʉ׉jD30\+h,4h0,*30 40XXZe[^_]W|$wUWSøth41hT#XZ5X40hq#5P40h#H61t Ph#y_XX40t?P409} h#Z[()$!MMEuQQ$hԸ#2 j IP40Z1<61H61EE(40ۃH~- 40]PP$8 #RR$S040QQ$SEWW$S h+PP$Sh#z<<613030]3030Ezu#ٞzu#=P40\$=X40$h#e[_]g_1UjjXZ1=P40P)U=`+u =P40ujh u=X40ZY9`40~`40<61ueUSá3030xFأ303030#w#r\+y1]W]W|$wUWVS40X40ff5040=409=40u ; 4040T40f50f40Yf40Ej]Sjj5(61 yhT#[jh51jjh405(61 y<61t hu#舐^EjSjj5(61 y h#j h40j Y[40T40f50<61 s$ 40ɡ40ȉ 5050s50 4051}Xf40=f40404fpjh61jVP5,61 Ã9t:y h#胏ZSVh41h#i%h0,&X`+X40ؙ%ك `61CX4030 403030 30u30 40 40 4030v.}fE fEm]mE3030#5840=<40@40 ]u}fE fEm]mu30މ3030301Ӄɚ;~ ʚ; 3030530 4030(#؉30303030 30ى 30ɚ;~3030ʚ; 30H40rW 840<40 3030 3030@403030=ɚ;~ 3030-ʚ;30<61t 8<61te[^_]g_UWVS<ÉUM<61tUUEčs}u}MăA;E}lE؍t E;T40uP4040u8}t2<61u)?EPuhϹ# UЍe[^_]W|$wUWVSEU܉MwG]<61MQURuh#nt h#]XVh#Q<61Y^t,%E #RR$Ph#=61t"uG0,e[^_]g_$e[^_]g_US2"=d>1t&JSPhD#h0,j*UWVSƉPl ¡A1_tEtPhi#E A19U|} Vh#j tt-v 1{[ft )уȉCKEsf1}~CpMуt[}D;19Ue[^_]USӃ A11҅w =w"=w:=w?=w W=w=v=w 3=w "tft ЃҀJȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPs+ PVh# Su! PVh#BhPSjRPVh#wSPCPVh#[h,rXe[^]Ãt"¸#7t#tURZø#USљRPQhS|h,S; ] ,yUh,j *XZá,P, UWVSDuh,迻e[^_]ÉÉh#@#aYE1ɉt1\Ѓtu }uCEtHPDA u1ۋtЅ}t1}uI1}ʍ}j.hA1EPjAQ91}ʍ}u) VPh<#j.hA1GhA1h$XZ5A1VPh$hC :=A1UWVS @<tPh#+Y[C#tRh!Ph?#^_PhE#XZCH<$@#h2"C PhN#C # Sasshb#C! #<t#<u#C[S C !CPh#YCZYPfwi$#h#h#/XXh#h#h#hz^! _3h#^!h#Y Ph#XZ1ɍQ9vh#L EԍsfCfhw:ffEPEPEPEPEPEPh#sjfEPEPEPEPEPEPEPEPEPEPEPEPEPEPh#Et(}A1u1ɋU[Et$"1uu ^_1ۃ}uj/u ZYÅtuԍU1EEEEPVh&u  t3Et/EPVh&u 1ۅtuh#t/Exuxtuh#j/ p}uY ju= }tCU1}uExux uxuxu x0E@E< u2UĹ1jEPUR ¸P_!uE耉E 1}E@111M YЀ w)YwW Yw7 uEw$#@ @11@ 9Ew+E}u}j/uY[Ã}txEpVuI? Y[u XuYu.AEZP}Wp @0V t=A1uu,A Zt/u ^tMUCUe[^_]/3}u =A19EXS ZuF X 91}u/MUG & A1UFEe[^_]US+tuPZYtC]UPu*fxu#@Ph#hhD18D1 Htu DP" P' ZU}u U Ƀ'h#hV#PPh]D%QRh# UEtt#t #t##Rh^"Ph#XZUVS$@#E׉Íu 9stMtJ@Sh#vXZe[^]UVSJ$}tJE t1@jjEPB>à tj.0Y^ƅthC1@PKYZuUuR ZhPhD17D1e[^]UUE PjjhhD1PRn thhF%hD1 D1UVSE UZ1t@ȅt1 @!)ˉ t Eu7t3jSpZYt%tJ$hPhD1k VRh#hhD1mVPRh#hhD1DσVQPRh #hhD1eVSQPRh#hhD1D D1e[^]UWVS$u} .E ~y11Dž119Ft } |7uiM L1tMw tLxw tHuGC@u?6ttxtu#" @ @u 5cƄ5V)э1u- uhJ$hD1[^zth# YEtPjjhVPP t hF%VXZSVhJ%hhD1D1e[^_]UVSMQB1QB1يۊ #BZ #XÃ@.)օ~=B1uCB1[^]UWVSu] =4+tN4+hhC1z_Zu(j.hC1סZYth@PhC1E C1uhhJ$hD1 F<tW<t<u]] FEe[^_]D1}ʍ}fEu jEP ^_SEPZY6e[^_]VPFPh)#hhD1D1e[^_]US]U MC<t#<t <u&]}MU ]]؋]FS3PCPh1#hhD1D1]UWVS(uE MMԋ]U~u)ẺUЍ}عjuV _XUЅҋEtuu SVZY SPV) }yE E<#e[^_]CtEEԉE Ey"e[^_]"EEԉEE E e[^_]UWVSXEEE EEEEEEE"EEEEEjjuVjj]Syh#Et@PeE_u jj$ jjVujS襇yh;#ۋEEEEEhS#I; Y]r;]WCU!;U<}t Sy;U)sxEt  Cy;8+t8+PuCyPm S 1ɉttЊtOGDA uϋuЅ~uE'uPsuV~uEuPjju^E#CPih"h"hb#,H,$yh,j GXZ,P, EEe[^_]e[^_]UUMzuȃ'QPuu RUU} uЃRPjjuUWVS u} EE11һk#~kMUD8-u^@P1ZMt$Ut:u?DX,t*DX\}uCNv t}tEEEe[^_]UjjEPEPu u-h?uuu](UStPhQ#h0,Sh#h0,Sh#h0,$Sh#h0,Sh#h0,Sh#h0,$Sh #h0,Sh+#h0,ShR#h0,$j.UVSƃ=E1u L#2 2u!B!tVWjVjpjhRS ySXe[^_]U"}t ]U}uX2'h#h#h#502صX2UWVSE]uu1҅‰uVruEE xh W ZYu u2Jh"WZYut/"^ u븋 PVh#5025e[^_]Uh#h2u uGX2U}uX2=2t02E E#]IX ]Uh #h2u uX2UVSE] u'"1҃=2‰2 trX2sh VZYtTh"VZYu2"AV`^"sh#502X2 t22fPh=#502ҳ =2t52hS#502谳 502hz#W 2ZYt ,2X2e[^]Uhi#h2u uX2Uhv#h2u uyX2Uh#h,2u uWX2=,2t 2Uh#h2u u"X2UVSE] t~ѓX2 1=x2x2~u=sh V YZu x2Yh"V^Zux2<usl2Yhsh`I1訜t2`I1x2 x2t2t't8u502h#vU x2XZ4l28uFA" u"SPRh#502輱x2X2e[^]Uh#h2u uX2Uh #h\2u uX2UVSE] uTX2ujsh V軽YZu 2[h"V螽YZu 2>V6Zy.sh)#502ܰX2 ]1=22 2 1t  " 1QRhC#502脰1=2X2e[^]UEu^X2Huh]#E PEP tЋE ph#`YZu9=X2uM=2t502hn#iS XZE ph#`ZYu 222USUE X2u q1Pt ]鏐pXtgSj Y@u Sh#DBA=2t$h2h#502=X2 502h#R XZ]]?]UEt~X2=Huh#E PEPi tӋE ph#_ZYu  2USPEu褏X2 HuhO#E PEP t1h jӜEXZjhJ1 Y[U tnE ;u!1jju گà uu=1tڋtSh#^Y[u  2=1u=2t221ҋE t12tujXZ1]UEuxX2}Ht}6h#E PEPپ uh#E PEP达 t}E ph #]ZYu!E ph#]ZYu  2UWVSu] ;E~X2E Xh S觩ZYu P2h"S芩ZYuP2L2^h$ScZYuP2L2  =P2u"PRh#502荜P2X2"ŋ]U1=2t#Ph 2u uX2 2U1=2t##Ph 2u uMX2 2UVS]u VS~XZu ]e[^]Uh5#hp2u uX2UhB#hl2u uX2UWVS ]} a}t~Qwh$VZYtJh_#VZYtBhs#VڧY^uEtFwpZy+|EE̓uw =X1ɿ11jjPEjjDEEtOu 5 2 2}t =2t0 2 2 u"QRPhQ#502sEtOu 5 2 2}t =2t0 2 2 u"QRPh#502uj芈uj耈1e[^_]Uju uNX2 U}uzX2bh#JZu2=X2uF=2t502h# = YXh#eJZu 222USPE] uRzX2= 2u02E E#fu@j EPs xM9tsh#502 2222 02 uM E#],< RPh7#Q褘]US}uyX2!22hg#GI2X]USEuTyX2=1u502hl#{H~}~h#E PEP虩 u뭃=2t502h#_; [Xj E pk11P61 u ́1q1kPkЁ1B́1ḱ1,H1,y h,u~Yu!502h#,P,< u@1k19́1u@1 {u@1KZX2Ch,P,8 t ,yh,}Z t@ ,y.h,}Z u502h#: X2Y[,P,8 ͋]UWVEupwX2mHuh#E PEP٧ tjE p}ƉXZutWVE ph0#502 9X2e^_]UEt~vX2xHuh#E PEPB tjE pEUYYBu@t)EP9P輜PE ph9#502gM;MUX2UEU uAvX2]Hu E?#]EBE ED#]EUS] hB!jSutsshL#502Ք]UWVSQEuu.Huh#E PEP1 t݋E p԰Zu X2}hV#8|Xt:u RU螈É4$蔈|<$iWURP~Wh$SDWVSD(S'_ X2S4V. e[^_]UWVSEt~tX2Huh#E PEPI thV#n{Zt8u SׇǍ@$諩|GWS@P}=222EU22222jjhL#M qVhG#c=2EU222(VXe[^_]UWVS]u tsX2>h}#WBZYt.hX%W1ZYth#W Y[t밻v趝Zt02u6h#RW t1t15151h#R'X2e[^_]UWVSSU} uRUyZUuUE #02Ee[^_]ӑË@tPCYWECZ=2ttP3h#502蒑e[^_]USEU X2tIt ]gr+Hu.t8Cu2"PRj h#5020jrr X2]UVSu X2}t e[^]qvxZuvh#502Đ1@tPCX3h #502蛐X2 e[^]US}uqX2B= 2u02E E#]3 22hG#A2X]USEU HvqX2V= 2u02E EL#]\3 22Hu hy#@Yrh~#@XZ2]USMU AvpX2_= 2u02E E#]2 22BuPh# @XZrPh#@ 2]USZKJy ;J| t Y RP|XZ]UWVS @Eu} toX2Hh#E PEP= tЋ51} 19~j k1Pwv t*Cu%wh#502bX2 h@h`1Px DžܿDžk1X ؿ9X,DP@tC`1<$t<\CFC=,KDOtQ1KԿSDOtk DЋԿڋMQ9~ox`2)PE 4VwE 4AiuHCDžܿ9E~5`2)PE ؿ4VwE ؿ4UƃF;!r10o_u 502hJ#u!502h_#30 X2Y^x t=2u 502h#΃=2t"502h`1/ 02 BXZj 6Wv18P51V =2t~t02h@Ph`1svq1E1E 9XCܿt9Ee[^_]USËt P͓YCtP蹓CZCtP褓CX]USdi1jyX=2t>$Ph #jd]S~!02fJftPSRtC jhL1 USdj*yX=2t>$Ph'#jd]S謆~!02fJftPSRC jhL1 UWVSƉӋ:j:WoKYZuWhA#V> :WPϚYZtj%WyFE8 u@EuhU#* XZ,HEHwtE1e[^_]Å8UWVSH%Pt{=,ufTwfUtaPtZftwftK0Euf]fۃW})0ufۃW)ڈQ@YAaAXZ[^_]UWVSUu u hn#j-\ ljjh#Ppe uWC fCPjh#WGe uWC fCjh#W!e u WC _t36葝v臝Cv|CF C FfC (Wuh#N Ed:j/RUG^ZEUu R8)ЉUHQM蝜ƋMQURPp{ uEuޜCXj@V,GZYta{ u  2Mq@P謜j:EpF t@P茜MAYE@E@tu>[urVj]RUFYZEtH:UttWuVh#)PERVMVu WuVh#fEPx:t1j:VFFYZtP>t3tJj EPRUZ U:tM9u HvWuRh#萰 =fC*C ttp2ut2t2"R[CZ{uw%{ ux%P;CX1e[^_]USZKJy ;J| t Y RPXZ]UWVSDDžDžDžDžfDžDžDžDžjh#Pb jPU#;ZY@tt8tt8uVh#2 C8j;P~ [_Åh/#PZYtCh7#SY_t>h?#S_ZuhG#Ů [VSht#Dž DžzDžV茙j@PC t' 2@PWYj:C_Zt@P3^DžG8>1ۅtK>tBj/V\} Y[9u"uFjhw%Sl tC11ۃu t=2Džt^1uNt;th#S1_ZDžt >th#V1ZY 2=2tjjYX 2"hPRkDž tDž 22RP胛 22YZuu0s!)Hu?h uPh# DtuRjnRj艾XZujhD#h#jT 1u2j/S AZY…tBu 1Ҁ;hhCu&Q@jDž 2Pj5= 2u/;E=X25h0,h#" ^_*>!t3hSSihhw%S/hVS/$hh_#S[iDž tN522=`2t hh\# hh`#Sh Wj 52Id2uj/V^y Y[‰tBDž=`2t WjiWjXZX2-1҃c‰XЍe[^_]UWVS\<Dž@DžDžDžDžDž0Dž4Dž8DžDž Dž(Dž$DžDž DžDžDžDžDžDžfDžDžDžDžDžfDžEDžDžDžDžDž,jhL1 _Z_u PU#[^@6ђ_迒Z譒Yfu-t#8th#PqY^t h#0t8u+nu =d2uhF# PZ,,d2t <,j/PTv ^_t@,PՑY P‘[d2 t 8uhl#_2222DžtDžx=`2t0 tRP<_Zu222#,hH!PĘ[^44u ,x4PZt$P_NZYu/tx2252=2 t34P$WVPay,Ph#=2u=1u`1 T,Ph#502wy 22 02 u502j s ^_RPh#Q?yDžDžDžDžDžDžuhhK1Rc  2K1 = 4#u#PR_Xh#h#h#V1u4}G"u#t>=2t!Wh#502o CQh#苌 t2=2tWh#502o CVh#U u>4hQ"P=Y[4P蟍^@u8h#$] =2t502h # XZj^]_<4Dž5+$`h$ +Xj /[^t9@`j lRPj ltS,DB@uFDžDžDžDžDžDžQ`资Y(DžDžDžDžDžDžDž1ۍ\P +ZP\ d#drt>j `PdM 22`8r(#d ƅ#ZI"dd8*u@xj pVPԗ p8-v@dj VP螗 O99pdd8/Pdx*u,j pPR3 pdd82 2:h7#`#dtXH ׉dR%s^_Džh8HRZYtxo#dwtd2y#dTtVR#d@th#謖 Xi#du jh#@7#dt#dƅu#dutPrDžXV_t<'ਯu 2 2h#t;u h;#8L1P8L1~ hf#21u>u$PڋY^'Sh#502i ƅuf >Sh#502mi Ճth#Ք XZ h#ǔ XtcU DžDžDžDžDžDž1DžpXt p_tSpYuh#{ 9d2 h"P_Zu Dž8,c 8|uXjj VZY hB!@P [^88u @Phv# ^_Dž0=.8*22 #At;}1uLuC 229!A=2K502h# Y[4u t=2=2;u;t Ph#芒  h! hB!PJg_Z88u Ph3.#Dž0hj!UZYh_j U[^1h:#hP#hhJ#z ;J1v&J1tPnX1J1Pl|_J1 2$22@tPjvT[^DžjTY4P5J15J1 u hg#AZjP5J1c ƃ J19u h#Z8"ty-Y"J1R)Ph# % u @;t,hQ"j_Zt$h#2 t@uƅ= 2u 2șuJ11jPY[؉|tL𙋍|9Ή| ||=2F|19=J1|19||Nj4PWj5J10ǃu4PZ1 2$2|)ډ|8J1@DžftS uWtڃ#u)uË9 PhH"=,2029 2$2|#@2R,Xd)h= 2tYjP _X++y @B19|@B)R[맋e]1u2V4P5J15J1R uj/P$#hQ"5J13ZYt h#P |ft=2u4P_tch#+ Q=,2uڋ5 2$219}Nj29|02 뤋02#^/jP8$*[0=xu tjS4 ^_txDž08RDž8 $PD ZY@u*tPSJ$g$h"#502` 1; 2$2|2 2y )jHY22 2$29؉| 2$2Dž@u @u"PjnNXZ㋅Pj \N^_@tPjCNY[@tPj*NXZ4t4P~@t PK X0t8t08R_ ;d2t! t PhgDž ^sh,t,PgDž,[tPfDžY$t$PfDž$Z(tg(PfDž(XNSDžDžDžDžDžDže[^_]UWVSÉjh#P < jh#S; toh#Sp ZYDžt$jh#S; tS)WhG#j`2 t F t-t(h#bE_t18t,jh#S; uVj11҉ZYe[^_]É؍e[^_]USEEjh2 ZYt-=2uEE@Ejj)Y[h#jnKY[hrj `KXZEE;EEj:M 4[Zt{8L1= 2u  2EU 1kEd2t'h"S ZYt;|tSdd2YE~E@EE@EX=2uE]ËE@tjjAXZUWVS$u j hr#]SkF]EEEunrljEPPD<:j>j>=X2t ujPY|i1I!ȅ!Ѓ„tt jZxi1J!ȅ!Ѓ„tt jX0$Re[^_]UVSu=i1uh#z X2[1|i1hIjV=ÍE PV5i1薫5i1hQ"6 5i11 h<#V^ZPƋ|i1Y!ȅ„t tjYSj<XZe[^]UWVSDžXP2d1d1jjd1Pi1 yh=#{ X 1tjXRjhPH d1<t <= 2= 252=2u 2h3#TÉ52_~St6=2t-X2-wD502he#  2Y[9hi1h"502M =2u 2h#Z=2= 2= 252=2u 2h3#yÉ52_~St6=2t-X2-wD502he#  2Y[5hi1h"502d11fd1d1@ulp ffd1jhd1hd19Y 502h2#502h#e[^_]UWVSD}i1=P2tWPHjjP ƃ HPj5i1j @-i1EfEjEP M]ġ2ZZ<ډEUjEP M+M̋EZ[+Ey@Biy1PjEPJW 58t58#th-#d1EEPEP5i1 à ty5i1 i1VjSx @t?}uEjEPjjS; W5i1#Y[Quh#Ql X5i1 i1Z1(?58\158#Nh# 뽍e[^_]UWVS]|i1hVIj.EZYt#=22@P1Y1!=2^2Y1@P122 2thPBUPV* UBC 2 d1d1 󥍺d1d1󥡌i1<<i1i1@@i1 2DD 2 2HH 21LL1p2PPp2l2TTl2h2XXh2d2\\d2jh42`UP)j`Ph42 )jh 2U썂qP($jqPh 2(`2U쉂`2hh 2P(hPh 2($hh 2UˆR~(hÈSh 2h(uji,|i1 t|i1EEe[^_]e[^_]UWVSQ}j/W8 [^Ƹ`%t9uw%jP?XZt/y WhN# khWh@L1'AL1ƀ@L1. d1+F9t=BUjh@L1?XZۊUx&0t(uOu502h`#~ Y[10@L1F<.u1F@Fōe[^_]UWVSui1u1h#;h X=$i1t X2Ee[^_]9=fDžƅfPftjjWPVt h# Xhh#5i15<5i1z i1)Ã(t h# X=$i1t X2j<Xt(t#fVfthWPl jYu=X2(ujZjXe[^_]US EEhG#u[Zt EG##=l2u#E 2u= 2t= 2ۃ9 2u%h#Yt!502h#p ZjSHxXZj]X=2u)502h#> [Xj:XX29 2uh e1h#sZYt}jSw[Xjh@i1 ZY'hnJj(Y[E22 uuuhj% Hu.RPh!# tԋEPj(XZjXlj $mXE@E22 u{Eu Phj% Hu| i1j$$$E$j([XjX i1uu h+#502a9RPh!#- mjhd1Ω ZYhJj'XZ i1hG#u_Y[¡2tt =1tSjtj[XEt1=2P?[=1t(MEu Phj% Hu\jY뼋Eu(Eu Phj%U Hu/=1tjZ1=2PX=1tEjX=1tsjQi 1ҡi1%~j$ X=2u06u=$i1tX2 hA#] Xjr8Xj=Yj5[=$i1t X2EPj&XZ]UWVS2pt2Rh!Dž` 2$222,2P=2t}u=2tTuu uy E 8-u}tuh5#5026 u h^#5026 ʡ 29 2u<DždDžhDžlDžXB!jhd1 Y[u#jPsXZ븃=1jcXhj$XZh4Kj$Y[hh"u |^_uDž\,,2 E 8|uijj l$ZYlE XhH!S蘽 ^_\\uShv#I _XX2,2Džd=.hH!u 5[^\\u u h3.#Džd\fzt \@xRPr ZYxE%=tu hi#5025 NEЋUԣ220jhd1x ^_E52=2 h#u ZYth#uZY 2twC\fxu \jWVP@ \@jWVPNyu h# _X(5252h!# DžXL#}tEuuhj% H 2X~^``u%uh<#ZY뽡1h#hh#h+h#Q ;tc1v&pc1tP;X1tc1PI_pc1j"^l@ujj !ZYl52t=,2t ރ=2y52 2 2tc1T pc1`fxt `P\ft \@VSTo uu hoH" ^_'8 x 2$2o\PKY ` 2$2\J볋pt9 2$2|B02#x502[pt2ډptu`@ @tu:c` $ 2$2B\H 8$pt9 2$2|02 \@ @t#02#u hoH" XZ`@ @tzh#q Xxj_dtd\R^Dž\`P`Dž`$[thPjZYDžh=1i1xP! Xi1`t`PXDž`j3XX21; 2$2}jCXh@u l@u"hPjY_X㋅lPj G[^i1xP Yi1du `u)\tꋅd\RZ؋`P-XP,222 2$2e[^_]UWVSDž0Dž42PT2$ 2$2DžL22,2(\2$hG#uY[DDu =2uVu=2t}t}u&E 8-u}tuh5#502L. 뺋E Ph^#5023. ɋDtE uPu Dž8Dž<Dž@1=T2uDHjhd1] _Zt=1tzj^hjXZh4Kj Y[<}tWE jP/Y[E j/P\( _Z!8tN!8 tDE PhN# [^X2$ E h"Pw^_E 8|utU w%9t `%tE jPI/Y^t/x=l2t Y!8 uW@M!8 u"E hP _ZyE Ph#P=l2t 뽃=l2tE PYE .D 2uJutW jjiXZ 29u(jus0^_22X2=ujPbiY[@ujhd1胜 XZvDu}u-k22 tRPh!# ͋E8t8Puhj%k HyhH!,_44uuh<#4Y^ȃ}E h"P_Zu#Dž0,,2\2E 8|u^jj w_Z@E hB!@P襲 Y^00u E @Phv#G,2\2Dž8=.=E uP+Y^00uE Ph3.# XZDž80fzt 0@xRP~^_@t#E%=t,2\21h:#h\#h3h# H ;lc1v&hc1tP2Y1lc1P?Zhc1j_52t=,2t ރ=2y52 2Dt@22 t/0f{t 0IjRPQQ 2lc1, hc10fxt 0P4ft 4@VS, u0l8 u 2$2h#< ^ڃD2 2{0jjjPO 11ۅyUE Ph# Y[F0JyG 0P4Z t t*; 22|0x:уԋ0jjjP贊 `PT9ȉ|M02#A502XPT2ډPT 2$2u 2$24J4P?X 0@ @uL0 t|u<4Jy4P Xt uL@L7ue O#4H vHq00 2$2v4H 냋PT95 2$2|02 4@ @tA02#8 u 2$2 h#耻 X݋0@ @tE PhH"c _Xj^8t80R[Dž04PV Dž4$YLu 2$2y3`LPh#502Q% 502h# XZ뾋D$ u=\2ujS _苅8=juA*[^X\Bu@j`S ^_X\lpDžtE SP ZY@XPA$+U $RhB#502m$`jhd1 Y[t$X21; 2$2}4ju X*hJjXZ=14P4X벋<@u @@u"th#WZYEue[^_]2ø#=2u%"Ph#502\ +t$=2t~ tP2PS2 S%YE ]e[^_]o8 QMZƒMuQWh#502KSu QWh#ދ}u#Uj PMQ"MMEPjUR rPj h#502릍e[^_]á@1 1!t$uCd2tJu6d2H2%d2P@1+8!t+UVS t t u@d2tJt d21&d2H2 tGtBB@"u\uXu@!@B؀"@tՈBut B1 1@1u.d2tHu d2H2 d21ɉ[^]US@1`1 1@1d21@1}P51T0XZt1ߋ]UVS =2t202SP1 "[^8tPhq#502 502jh@h`1h,C*y}u2502h#t=2t02 w=1O10YÃu 502hJ#+u 502h_#x t =2u502h#H XZ2j 3uV10P51S =2t{t02b{ h#jhrj e[^]UEt]1]US]u h#j SZu Sh9#j @]U=+u  +02fPftP Z9+ÍL$qUWVSQ02 ,2 ]jP + |22Z^+2y @Bd{!ڽ߭ݕ 2$219ؾ}^؞vK߭ٽf f٭߽٭ ؉Ήء2ȃ¸2" tX"PSQhj#hP>ٽf f݅٭۝٭Q~DQ2"tX"RPh}#)PPÃt Phǰ!)PPÃ<RPh#)PPX؉19}t @u4#%%y) ڃkdd%1 Q1 RPh#+PPGà 2$21;݅22o52=29C)߭߭ٽf f٭۝٭׉h#)PPà t!Vhǰ!)PPÃ<RPh#)PPË+p2t2Ɖ׃x29y9},h#)PPkà h!)PP>à u02f@ftSVR eY[^_]aUS1; 2$2}6=2t%02fPftjh!PD jX_]UWVEE왉UE}ujEPj e^_]U0E EEEEEEEPEPuƒ xEÍL$qUWVSQ@@u5jh|2B p2|222h2l2XZjP 22 2$2+p2t2^_x29y29=h2l2sHp2󥋵5h2=l2DžDžx~t;}l蛩Ph#hS 02fJftPSR jjjjh2x =,2uhjjujjj =,2`6Sh!P2Y[tPh<#hP X2219߭yh{!ݝ݅ $!߭ٽf f٭۝٭y1d~dWh#)PP" Ë5(2~-2t PcZ)ƅ~:ƹdh2")Vh#Ph#)PP Ã11ɺ9st @u4#WVh #)PP^ ؉+|22+ 2y @Bd{!ڽ߭ 2$219ظw ȉ߭$s9ٽf f٭߽٭?ٽf f٭߽٭ʿ 9ƾs tGȉݝ4#%1d PSQh#+PPá22; 2$2)ލ ;݅9;}h:#VQà +22߭߭ٽf f٭۝٭?~~h-#rtPhǰ!VQTÃh$VQAà <ЙRPhG#)PPÃuh!)PPà 02fPftSVPG eY[^_]aUSZjLX]á2@ `t1US2HyPYu1ZJ, uɍPv"u|22HyPNZuJ"\u%2HyPZuJCC2uhm#m4 Y222HyPZu ZJ, „t@Pv8\u"2HyPYu JCC2uq+=2th2P蕷ZYuC ߸ ]UWVSQƉUh2P[_tHj.V[_1ۅt6uPwZYÅu#)Wh2V u1ۀ21ۉ؍e[^_]À=m1UWVShH!hm12^_u$ 8hm1h# Y[hS _ZyƅEj.S[^ƅ2"}en tnRU ut36 t&t!K~\=252^[1y1뒉 2kuE]Ån1뉻낃t tP]E uh2M h2PxZY- E th#PUY_tB2fPfttRP _Zx|?th#A1 h#wE8h2MY2fPfttRP_Zx"|?th#0 h#0 ~5E8)h2}zPYt) u 2Hy t J܃ u>502h"$Gh2hq$20 _X@52LYf1u502hl# XZk11Ɂ1p2HyPIZuJ,DB@u GG;pu t$2HyPYuJJס1uÉ1q1ḱ112Hy4PZu2502hA$$kPkЁ1B́1뭋J< u61k19́1u@1 u@1OzUGj502h$e[^_]1US],uh$SZYu 2DB@tCjhy#S u  2Uh$SEZYu  28hlj%S(ZYu  2h$S ZYu  2]USZKJy ;J| t Y RPXZ]UVS2=2u 2hg#^tGh$hi1DZY9ƹ} i1.uhi1Ph$502jh$hi1 52tjh#hi1 uVt  2  2 2j hR#h 2 tbh 2h#502, Ht  2  2t*j h$hi1A u502h$\ Y^ 2 2 2 2 2 2i1hG#oZu)1< 2u  2@u 2  2i12e[^]U塈i1tPZi12 2 2= 2u  2i1 2 2|2tPX|2=2u 1Ui1jX=2t%02fPftjh!Pͷ jh2>p UVS]0j{Y=2tli1t0fPftjPݺ 5i1i1 i1x jP贺 5i1詹 i1 2jBZ=2tCi1t0fPftjP` 5i1Ei1 2|2j Xt ShI$j 0e[^]UWVS]2=1t =2u6u d#2=`#2<W`#2Y1$u9=d#2uEd#2d#2Pd#2xd#2=`#2h5 2V /thhw%V7 hhc$V$Vt4yVhq$Œ XZsP =2Xأ252,22,2} t1=2PRXB!EEt!jjRPPh#p!ҡX2-cvti1} t1=2PX=252,2hH!V `#2V=3=`#2 uu h$' ;$P5`#2hh`2' ǃ u5`#2`#2[j h`2趼ZY`2te[^_]UVSQSMq2=2u 2= 2u502h$ Ph$)؋u N9CT"=2t 2u")ڋE Htn<.u}mtd9voCD"=2t|2)؋u Nt79vBCTE H9v3C%U JU9v"S% 9UvMA%[^_]UWS$]؍U1EEEEPSh&u} ƒ1uu+ Xe[_]UWVSu] }VuS u/N tt$ t$fN nS&YHˀ; uLUJ9uD ,yh,Z t@,H ,8 u҅t $ff te[^_]UVSPuh`1Zá02?vPh#$躑 juh?$P* Cƃ`1 EUR@)Ra1Ph,yhE$uhO$502 j21191 U e[^]UWVSHuVbj j ShWuu U t hhs!Wj hs!Sh2M I9Ot uwwV à ucjjjhVww thhs!VC aVh`$F XZVjjV ǃ u(PPhu#hs$ PjVԦ à uPPh$fDž=2~"jP\ 2[Xuu V謦 à 8$}up8AvPPh#G VjPޖ +‹YY+y@Biy1fDžPjP uf8u=2~s8#tDWjVw à u%PPh hs$s 1~uf<tQDžPPhhVo @h ؍e[^_]UVS]u S Xu ]e[^]y UVSu ]h3#VnYZt'h&V]YZt>tuh$x XZ 1ۉ؍e[^]US]SZu Sh$j菾 ]U u h $jr US] Sud ZY@u ShI$jN ]UEu hj$j P豁Zu h$j UWVSduE ]EEEEt PE_t SE[= 2tMEtPEYh#bEEZtPEXh#yP9E_XEPEPEPVy$X25q1E[Eq102t^RVh$PA EEPjP]Sh,yh!uhO$502 X21Vh$P Sh=x2tPPÉ4$ |<$WuPWh#SoWVSgE(tPY]uh#SXZu[}u-h#S _u]SES1[^uh# ËuVh1 tts;}u-h# Yu]SwES(1XZE8uh$I XPh#蒗ËuV1 EtPh#e^_uu|252[219~Lk1Ph#芕ZYu0h@h#h`11051WF22EtPEXutV_1EtPEYutVZ1EtPX؍e[^_]UEuiX2=2t%5 2h$5022 X2fHh#E PEP UBw x2t l2u t2u)E @tt2t:u h $jh PRPE pZY=x2t"=2t5t2h*$502y 2j hG %h 2 2 2j hQ$h 2` 2j h[$h@ 2 2$j hQ h 2k 2j h\&h 2P 2=2tjjE p{ UWVS0u=2u e[^_]&]ȹ 1SjhVߋ u}uVh# S 1E0ES͌ XZEče[^_]UWVS,EPu EP? Uȃ u ỦEЋE0ufEjEP 2EUXZ1ۃ=2~wjEP E+E‹EY_+Ey@Biy1PjEPS u 8t8#tu<TjEPV胚 u  y8E8#7ËU9| u$X )‰UE؍e[^_]UE]UE@(]UPEx$tEjURjj0Z 1UVSjut [^1ۅx%j0j[ZYu V3 X 0@$؍e[^]UVSPuEj0jZYt,0@$jjV芛 jEPhhV ؍e[^]US]t&S(3谛 ssS1]UWVS(]=2~jEP 2EUY^EE E̋C t ;EvẺEЋs})C C)E2}E&uW3 t}R)EEЃ}u488#tyC(8uE;Cw">uC,t8#us_ZCEЉC{uMEЉC CUԃD@fE؃=2~;jEP衊 E+E‹EY^+Ey@Biy1VjEP u'8t8#tC(1@E;x52Ph#502 ]<C(<뼍e[^_]UWVSS]{uhƉCYC{(t1{,uC 9Cts C);E E HCC CSjjEPbu{(u{,t{uKSBCEC9Cu0xWsXZuh C($s{} us}UC ։e[^_]UWVSQu] }VuS u-~,tt$ t$F(]SZHˀ; u;UJ9u3VjjEPTt} utb$F( te[^_]UE Puz XZ=h#2u h#2UE Puz jQ UE PuE XZ=h#2u h#2UWVSSƉ׉ˉʁv )…tRUWV蹔 tUu:؍e[^_]UWVSx}E|ˋ7GEGEh EYu h$4hEZtUĹ 1u]EEEȉuEEEEEEE1E11U}11ɅMEEUEEu+}uh8$~Y^i$$U:t41;EE}uhS$LXZKhp$;h#2`BUHEjjj諵E ]3U t th$BUHE U:th$[BUHEU MBUHEE}EU]BUHE|U  MBUHE^}uxNEu >U:u$ Eu U:u BU2EEtE }u MEHEj8h$jEP:u h$jEPG<EZYwI$$}tK}uEEmh$h$2Y#h$h$uh.$XZ+ẺEtM9u71MUEEE}t:jEP轏EZYvh$1h%UYEEEPXZt h$e~PPPPPPPSh $hu ,UEth%XEUuu]EUSe[^_]UWVSÉUM=+t h $l1 Z+jjjS Bu11@tCjEPS觍 uu hM $ thM $*X1u1WVuuhg $ E1EU)ӉM܉]E ËU 1 tL}xA19}M܋]M܉]1 tiE1-Phv $j]S LLD.Sh} $h, uhD"# $e[^_]UVS|Pj ZYyh+!pU1uEԃ=l#2t1h $щ1CSpSVj( tpt)u߸)؃u h $nt h $Xh $tPj1 e[^]UWVSÀ8-u2xu,=p#2t e[^_]1_xDžtPxK<^_=p#2t8uvx+Dhl$atYlhu h2 {txJ5+󤋅txJDžtSh $s%=@uxh $F=0=p#2jx蛊 XZy xhQ!_XPS趤Y^tS: xh $~ %Džl=u TlhxW舺W]ơ+9~&)V5+OYZu5+V XZt#2 l#2u xh $?:XȲ?v.X?v"?tP?uP ?uPɉ[]UWVSljU΋C2vX>2Ee[^_]UVS/t*$@t{+t9~o\@1ɍÅu552552h $x1Ҁ8IuCu F9FJ@>uj RP F 552552h&$j ؍e[^]UWVS ÉU;]C2{u C10t @Ѓ432t2;Vu)UNqMWuZYMUu F 6ʉsuW552552hH$j WX!e[^_]UWVS0DžDž#2jhh+2.à uN552552hf$DA@tCuG;t,tDJ@tiC<,Cj‰GQY, ,552552h$j <#<;*jdNj8gG Ph$ tmj-‰G^{ ,t2DJ@CDB@DB@t0Cu&G#GG1WDž+tT8ti 狅>CDq@u<}U<;CAR552552h$j蟘 @9}VPR552552h$jw x @$ $DA@tCuG҃ ЈGO'552552h$R552552h$SCtDq@[u<\t#R552552h8$$DA@ Cu DA@I Cu C DQ@ @C DQ@ @DA@tCuF%ƉG;u552552hg$(1څt @ 32tJ;YuAApVqZYuV552552h|$ 벉j0 32Xx@ 32YsC<\tu552552h$aj$j4G1ɍeXZu552552h$(wu F1ҍFwDžhCF52FhHX1DžDž؉h<\t uuBhh<9  e[^_]UWVS1ҡ#2132t2;{ uCp552552h$ S.YFu\>2tk P`>2ZX>2@PT>2Xe[^_]UVSƉj pX`+`+Xe[^]USj@\+\+X]UVS5H>2vtQhH!6誶 YXtKyS7Zt# PSP" Sț  S踛X1e[^]UWVSu]862^L>2u52PtJtHhH!p 462_ZL>2uph<#j? @52862iphE"jh62 vh$h,62 ZY5262L>2@62862{5462u V tI=52W52Ju>#u~nu 52462R fL>2L>25462;862X62=52u8#uxnu 52M 1M I"t6252tnt @uMf 62/t62862=L>29G L>252tBJM l1e[^_]U62@ t=<62t/=@>2t@HyP聚YtJ562P XZ1UWVS|u=62uQH>28u==<62t h$j蹇 62,522$52,52  6262tQHyPϙ[t@ J562P1 562h62h62b ÃeN62=,uF1PY=@:2tdh@:2Mh@:2552n t2@H>2  62H>252=<62xRP<ZY52uh&$h>$PhT$j衅 <62:t/hPh@:2Gh5<62h@:2a=wmh552Rh552SS/ HIÍR芍 WSPh^$hh@625 =v552h6Y"j h@62:52_t=,tPӕ[hB!h@62s 52ZYfPftSQP`m %52fJ ftPRUm 52@62_X=@>2u%5252,52 hH!552˯ 62Y[y552h<#D D>2XZX552h<#j t62| u F KWF u S562V52e[^_]US]SˮZu Shj$j艃 ]USE] u ]]SP|ZYu Shv$jS ]UVS]u VSGZYuVSh$j( e[^]UWVSR]u P>2tP\XjEPVS! PGP>2WPVS P>2e[^_]UWVS 19p>2v}k `>2tJtc552pjpoKhH!p ZYt6Vh jW2 t552PjWOoV)XC{52@ @t1¸:tܡPP552h!jځ p>2h>2e[^_]USu=d>2uh$j衁 d>2T>2CE CC 1}uX>2@QSPR5d>2 t 1҃t5d>2PLPh $j5 Ћ]UWVSE>2>2z *&\u3rE,Dpt zu0yd<&8<\0>25>2V9r0M>2P5>2?ã>2>2>2XZM >2C1T>2xutyPx utk>2)ʋ >2L 9r2U>2P5>2ã>2>2>2YXURUT>2M 0QSCU>2 >2=>2W9r*>2P5>2Yã>2>2>2XZe[^_]GUVS]uCP9SsCPs CXZ}uCVu CPBss0 e[^]UWVS52Dž8jh>2 ZYP>2#2;l>2CSu u K u52);B`uB5>2j1ɋ>2_Zu529BC8 529HC u1u*@5>2j1ɋ>2AY^tԋCu(u 529Hu׋ 529Hv uxul>2H52C u@5>2j1ɋ>2_Zu 529H Ct t  C=<> $< $\>29p>2r\>2kP5`>2`>2Y^=p>2k 5`>2CFP胜ZFG=p>20 >2>2{u552s}K Y[ =l>2uCu =>2 >2t5>2CPj Vs u>2 @))Ӊ>2SPV? Lj5>25>2h>2;jjh!h>2j5>25>2h>2Fj5>25>2h>2U1 jjh!h>2:j5>25>2h>2" 552seJ >2<>2@=52,uX=d+u[h"y}Zt8tP d+X9TPhht@jn uVftd+d+<=d+u d+t 11<tR<@PP貯Ht%tv$@P 1DžHP u?F;5d+r552h$(I ^_552j$ 552j 1-W貮YtJWZ;d+r552h$H Y^1552Hj@gtfWZtZPh8 $fY_Njd+tAF9w552h$mH XZ18 $$Ph$552Ф  nH<>;d+r552h$H Y^1@HЉ0,Ph$552n ,B 90uH@)< F;5d+r552h$G XZ552j$> 552j 1 52@ @苘¸:tzP貰P552h!jxx 52 >2u45525>2j5>2ye=>2t552j _Xjh>26Y^>2f_jjh!h>2jjh>27@=>2%5525>2j5>2d=>2552j XZ=>2>2=>2BHPj Wn ƅt*>24)>2>2H85525>2jWDd=>2t552j z Y_S8>24>2852 >2u45525>2j5>2c=>2t552j  XZj菘 \>29p>2r\>2kP5`>2`>2^_=p>2k 5`>2CFPYFGp>2=>2CH@u. d>2t$P;Qv@52R552Ph$ju 5>2j1ɉ@^Z&>2>21҉HLC0t[uT>2H 9Hu;Pt$jT>20Wh>2CP 4T>2pP @9u9t)HL1H;HL}jjQh>2T>2PHσ)HLL(Hj@ZY!L HjHWh>29Q tUAQ )HLLHj@ZY T>2QNu9AuAQ 똋 >2j)ȋ5T>2PQh>2rCP T>2P @@DjH+@P@4Vh>2+ t>2󥸤>2>2>2>2>2t󥡜>2>2Cxt45525>2j5>2k`=>2t552j _XsF uq=>2u~uhh P5X F @t"5>25>2CpV ;>2t Cp jh!CpmV Ht1 h>2=h>2h>2[=>2{uhh sW C @t5>25>2sU ;>2tsh<#jLr jh!sU Haփ=>2ujjh2"h>2_\>2󥸤>2>2>2>2>2\=>2>2H{5>2=,u>2>29Fx>2Tu@1,jjTPJkH<‹;HvA;@u,PB0PV 0,uk552hU 552 52 >2u45525>2j5>2]=>2t552j [^Ljr$B(Pht>2<)Ht>2󥸤>2>2t>2>2t>2t󥡄>2t>2)jjVht>26뇄bC e[^_]U塀#2txt@ x{u@jjh2"h>2US];] ttCtE8tcS1:"u#C@؍e[^]USPmYt@Ut‹EBu Sh*$jn ]UWVS Ek< +E@ÉE19E~GuVp9< u01;u)QLQPa1kE/UVSu] h)/C Zwt @t2E0f~ufFsHPh$h.e[^]Ee[^].UWVSÉQ-W-VPh>1$s}e[^_]UEU t2t Ju62'u%ģ2`2 `2]]UEU wS$$X2:2.`2"2`2 ģ2]]UEU t2t Ju92'u(ģ2(2 `2]]UEU t=t+JuD @21u2=22 `2 ]o]UEU wG$$ 2.`2"2`2 ģ2]]UVSuU E$$1if2Z Kh$P;ZYt u hW+X   e[^]he[^]US]E U $$1Ƀ:i2~22`2{ģ2o}2 ch$h}2.:ZY2t=2t h*X ,2  `2 =2؋]v]USE h$P9ZYudhRh2"h .1]U@2ƀxjjPUS] @2ƀxj3P@2 )t P4Xjj3P]UE 05@2US] @2)thej9XZ9ƀxj3PHjj35@2j35@2(]US] @2ƀx3j35@2]Uju #Uju zUju UVSu jVZYtVjSPte[^]UVSu jVZYtVSP9 e[^]USRu ÍEPjSiu ugX jjS ]Uu /US]E $$1Ƀ=<2i 22J2 xh$h26YZ;2t=;2t h<'Z A:2 5`2 )=25<2=`X ؋]]US]E U$($1Ƀ=2i22w2.k2 _h$h25YZ2t=2t hQ&Z (2  *1$52k_X ؋]I]Uh覷21U ?2j _1U ?2j^ c1UhhJ1$h2PpE Uhh_1$h2)pE Uhht1$h2pE Uhh|1$h2oE UE.tgzEEPjjpҺ UE.tgzEEPjjo诺 UE.tgzEEPjjf茺 UE 0]Ph1$jjckUE.tgzEEPjjhb UE jUE jרUE j轨UE j裨艮UoU ]U輬U ]U衫U ]U`U ]UjK_U Uj5_U U轾U ]U@2,P1RP(U@2,P@1RPl(U@2,jhK(U@2,jh@*(Ujj1Ujj1UjjҰ1Ujj°1,Uh1$M Uh1$M 1Uh1$M U@1]UT2j#1Uӱ1]Uj`.1U=21]U^01]U+1]UEU ttu(X22 2] ]UEU ttu( 2`2 2]]UVSE 0ڸ uh#dK h#ZK XZjSh# jSh#ւ 1e[^]U:2 =:2uh#K h#J XZ%jh:2h#聂 jh:2h#p 1U2 .=2uh#J h#J XZ%jh2h# jh2h# 1U2 =2uh#DJ h#:J XZ%jh2h#迁 jh2h#讁 1Uh$h2/ZYu;2dWhh;2h2"h $1Uh$h27/ZYu2d hh2h2"h t$1Uh$h}2.ZYu2dhh2h2"h &$1U5@2Zujj5@2" US] @2)thejйXZ0ƀxj3Pjj35@2S ]UE ]UE ]UE ]UE ]UWVS É֋EEE ECfƒC19~Cfx fCEC9uh3$RQuWsd.h$RQu;CuDSu0Kx9tF( Fat~UCuBEs4+EECES _9~Mf{ufKf9|A)fKsu)K9M|9~fs)y1fssf9|MS;M},9~(CPuyRuFYXCu;M}ys(uzXZ1C9uf{th1$uQs Cujjs} uCES)Psϣs~e[^_]UE ]UE @]UE @]UE @]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE @]Y"U ?2jR1U ?2jQ1U251]U`2 1]Uh321UX2e1]U2q1]U21]UE uU]Uģ21]U`2e1]Uģ2J1]U2/1]U`21]U21]U`21]U 21]U`21]U`2 1]Uh覨21Uģ2\1]US] @2)thej軱XZ*ƀxj3Pjj35@2]UWVS ]u t/{u)PfvP t6vWϩC EC;E~Y}C48"Zt>vPzZYt/{u&MVU7MQURPkGE랍e[^_]FUS]CtBPwC YtsPHEs C sTs CXZ]UWVS +1AfEE1;E}DQF @tf~u;E}֍~@k2le芍t' jjjhҘhu5[5f,>25[5a,>2j5[5k>2@jj@x>2t* +1҉ B<.u>21 ؋]UWVS$]E؅t' 9>2 >2 fCC!f ufCbKt[fCfsCf9}ID t<@fC=4sCf;ssfF tMUC,t{uu SXZC0tu S^_{NC E{CE܋CuE 1EuECutlP^EYt^8tYUEj RUZ3YZNMUt)9M}MԍPuRfZE;E}MԉMtFEuEE)"CЉƃEԅy #9}Sf{ ufs K fMҡ>2)+u9~%f}~CDu +u)y1+M)fK K U9|C@tNf)Nuu5>2WuCPC Ph2$E)+E9~fC }}E}t'E܉E;USBu2^uEC9E|PQeY9E}Euu>29~*u5>2uuh~2$h0,p jng }u)UUU9})EK u>2+E)ȿuWVMQ%?Cu32uuWuuuC Ph2$h0,Ip $jf jPg2YZths豓hs CtsuWVC EP>C *RC tOP5[5D?^_?sCƒF99fsK C9|)FfsU #sV_#P$L$D==t'3=R6S<sσf}׍b$$C*h0,j XZE{G  HSB ufCf;CfCs$uh0,j褝 5[5&5[5v&jjWP=EtPu5[5=5[5V ƃ1Et9}} < uEF5[5oh2$jj5[5"Vjj5[5$jj5[55[5p5[5Z=,DBxt;xdr<^+=>2quu7Lu\5[5oaOCf0S K)y1fK)y1fCWCfEECfEЍP9UK ω)y1s9~fSM}9 E}|8f{spnXxu f}tfCLz `~x~Ha (mS9aSB OfC?> =t\*=S=V Yv1,DBkh0,jך Vn |scmC Zt sP:_Xs[JY-t%F t!u S_Z(t Cz~ftbF uQslC YtsP{:s !C sIsC>2XZu W_XF zslC Yt sP:XZsIXCt6PrCX&uCD0tPrCD0XEC9E|ыC4tu S_XsVCC ^P=C Y>u3>t.>2|=tP=t܍jh0,j XZ9}s$ YqOu =Rt=S벍e[^_]UU>2U fP]UU1x9>2~>2]UWVSP.5>29B  MP5>2n_XҋMu1 1>26>2>24uj2~(>2CtCtP@X1e[_]UWVS uu 5 ?25?2c E?2}u|S5?2?2?2?2>2Y[;DN@uGu ?2 ?2 ?2u;?2?25,fDFf@{uQ,Ztj 5?2X^X=?2tj 5?2@Y[?2>2z u_=?2tQZtj 5?2^Xj 5?2?2?2?2>2Y[*?2Љ?2f)؉E1=>2u=?2uuQ>EE5?2WYZ9E|*5?2EZ;E~j 5?2<Y^1?2t Nj P&XZuSP-GH߃ w @t ?2 ?2>2@=?2t35?2Ytj 5?2XZ?2>25?2YhEe[^_]UWVS(]E EԋEEEEEEu}tuEEuej5?2\VSj}tNE8tFEtuPWAO 1h(4$5?2u5?2h"5?2h$5?2WX[5?2_E5?2\E5?2z+EHEEEEԃE+ECE9u+EE;u~}yES9~Љ+U;U~+EE+UE9~PEPuu5?25?2}thB;!uu5?2E+EPu5?2谋5?2nf5?2蘻Y stO txu11E'=t%==t,@}u)PPKP7N ELDH@t JJt LDH@t)PPUPU))ރ =5K/ u(}uuWLWVƃ9CEH9~6,DPt*U̍ )PQMCPfMЋÜF h0,j XZ}t0j E+EPu5?2?2>2}t1Eԃ t 7uW}tM9MtuQuK }e[^_]iUWVS}5?2tc=?2WkWXCY_; ?2v-S:aZu?2tPGiX=?2 ?2?2>2e[^_]UVSu@+t5>2PXZ@+1ۅtjjV à tWjjjPH>2jjSjjPj@+,SB 5@+Xth+4$VY[Åt jfZVv >2X؍e[^]US]w>@+t-t)9>2r!DP8 Zt9>2v @+`+؋]U5?2a?2>2XU5?2XU5?20XUS]uQu PmSPj`]US]u(u PmSPj7]UE Puj UDuPh<# UuPh<# US]uuPTmSuuu jPm$]Uh2"uuu uUWVS}5?25?2EXZup},u0u(PlWPjjY ǃ}t%E8tE$9}uoR^|E$|9}@u6/}t$~ E8tP,RYU$D9} u)@E }y$uxZEj PY[tE@M}}E)ȻEE;E~E)ȉEu uWQM5?2V)ÃMu)u uWQh34$5?2*ME1MD?S1+EZMtP5[5W,ZYMM5?2jPSd5?2ZPSjjS^$S_E @PE@PWMQ5?2(PS P5?2SP5?2%xuu(PjU,Ru$u uVP$t =D2t:SPhȫ$5D2VZ 5D2#5D2?D2=2t:S計Phګ$52Z 52X#52?2=?2uh0,h$S XZ]UWVS hH!P!Z _ZuohkRjPPh"h0,Y Sa jP hA"S} _Z؉PhP"5Y[$tCVhS uWfM$Wo t ;u뵋Ct{ tዕhA"R޲ ZY€:=uZhA"S ZYh$SAZYWSB =V1>Xe[^_]UEPE 4mUWVS B P Y Zp j h $Vn uՃ{ uC WM hw%W7 VW0 Wuj~Ƌ;7P yC9C u=CPWs\_Zu YaCPsN\_ZtۉC{ CP GC V| Y^e[^_]Ã=2u U塤2t uP8 XZjM Uh -YtP> Zt hw%> Yhjxh~YZ hyZjqXUWVS$E}1T2jjׇY[]߉jjP N =T2u:SZxEPj _X}ejh訐[^T2^WhYj@2PgZY~>jhcj@2Pgyjh@^_=2;SEYujhXZS#_u@2ǀ$HuVX@2Ph<#jXnj蓆@2)t]SV^/}EEjPXY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEPf_1;}s7klE@0 t(Pdt!ztHhr2p8p4xkG19t4EPiZYvGV[_}kSZZ^u`S;[Ohj]jYjGu8j]S+ZYu'%S;S4jj^EPXe[^_]UWVShPVs=hhH$VhVWQ=$hh $WV6tOW)Zt/SSSSSSSSSSSh!h4jj[Y[WV-XZe[^_]UVShPV<hhH$VhVS<$hh $SSt VSXZe[^]UWVS}1ET2jj[^_ zj|VPI e]@2$*u u^)uYjh\.Y[,u>tPZt@2$PX@2$S蕙^_EScSaZYS9^_O$Z$S$^5[5Sjj5[5x5[5tR5[5SEPj }tChj_jZj=u,jS$ZYuO$Z$S Xe[^_]UWVS}1ET25jj胁ZYHxjSPG xpu@2*u$tPV_XEV\[u4EPj ZY}t!hj`jj>u  V-Xe[^_]UWVSDžDD;E E8u EDDžLLUEL8< t tLu$CY$}Dž889E4SBZ9$ PuS6 _uDžH<%sC0VPh"h$j[M#q>0VPhʰ$h0,I ji@ 1]UVSƉ5[5}Kj5[5+5[5=3MhHPjjR Kh,PdhPjj!Vh<#9 Yh_R$)CPj;L5[5@jPSR)R5[5$uh0,h$O jw? jP7aZYt'5[5>mPS8l5[5.PS[jjSpSyK؍e[^]UWVSӉVjVj(P$PuNjE$ 2h2hpt$/ =+h+hbt(/ uf=+u]jhYP&j h+hf@$/=+t$+h+hbt(V/ +D2tPX2tP_ǃt 2JE,$j j jjhE$ jj. 蠶$ 󥁍 Pj(E (D2t&u h:$PwF 5D2%,D22t&u h"PHF 52+2hCu&3}Y^uhI$sj_Zu s ^e s h`2YEt28t(P ZtSPhL$F S3y 3h^$- j2281󫋍$88DžDž EtYDžDž C981jj Pv9-X8󥋅 ,0Dž4,PjjXPha 0uE 1uh]~% [=D2080PPhh$5D2D  hVS 3t hg"u YC#XtƄuPV$ u'뱊t@t 대?tzD2tPW 5D2  8uE shQ"PV ^Zt f W0>0E x|$ D2xt SPB ^_Sj^ ƒt=$N(CD2Y[tP Z2轼 ƒuh M $=t thu X1e[^_]UShhjhXjjjjj jjh+hy4y.h0,h$2 D2Y[t Ph$ XZjB8 jPS1 ]UWVSEPuhS< }uExPS߫ZYtE BthH!SA Y_uC"hH!S XZDžtu6D2tSh $h$P@ 덿tt txW@‹E X1ۅtllV; pZ@lG9w9w ttRHE X"WR=E‹E YXt pC딃}uV%V Xu#D2tRh $hֱ$P? 뺍e[^_] UWVS0u EEEPVEP^ ] EEuiVh$E܍t0SE)Phi!V胜 h$SzR E؀8'uE؋E؀x*h$uZ Y[]EԊm<'uMCj'S ^_E؃}u SX3Y؉E؋Eԍ4VuCE_ZTSh$j j 벍H9Ef%u@Q)IP*@6j/V9 ZYDžtVW EXuЅt GE/}u2_HEu M܋}ԍYtqUĀx .tx uuW{& uˋU;2tEԋEԍRUuBEZYUWVE)Ph$E܍DP y;2tVE_u ^rE܋M贷uVhht@j% f}ufEf}ufEPEt|e s+[5EjP5[5e5[5C@6Et55[5?j5[55[5ѻ@[5EELEfmEPuuU܍Ekh,6 tE@ Eu EEE$PuXZ[59EthPPjjZE[5t-t9u h!b^3uTuY 9thP.OXZ}?tE@t t}EujE;[5tPjPc t h!^hPg?,H,ZYy h,", =?jl _EtG;[5tP^}ter+5[5/=5[5j5[5>u]CYu܃Ft PICZu>CXt EtS1 ؍e[^_]UVShV [ZuYtPEj.VZYÅuhVhF2% 'hVhF2$hCShG2$e[^]UWVSIM;]sg>t^}t1E t/t&,DxuUWuZYUtCE)؃~Wh$$PS5 FE ؍e[^_]UWVSƉUMjjj à @t5$1UVjhH2V$VuS!S]؍e[^_]USPhH2h+$EPjh!ui [Xh!j[ ZYttjhO$Sy! u؃hW$S$L ZYuha$SL ZYujhl$S@! t؊t t@hSh`@2:# u@X]UVShF2,$G2,$hF2h@?2" =G2tR)~F2.uF2PhG2DZYt+hh`%h@?2hhG2h@?2@?2e[^]UWVS1ɺ!idu$xtxp jPhF2G"1ɺ%idu$xtxo jPhF2 "jjjj à < 1jhH2V!Vh8i(SBSugL8PhPhD2!r#8PXt*hVhD2hShD2tc%Íe[^_]W|$wUWVS-Th$(Pj+ y,D2t Ph$ [^h0,hղ$ j"- hv6Ƌ(Y1ۋ(?RX*ZX9hƎ$WYZPWV7 hƎ$Wm|,PDžX+XtIQH)*$LHQV uLPDAu&XhViPC iƄV=(=_Xujrjp[^TDž$Hjj$V(Wh$- @u"Dž$ jjVWh$ @u/z ;Tsh$jPZYt,뱸 ;x|s5h2$jPY^u#heZt ?2V jSL8T^_u52Y. T‰f@ @ #9uhojjjjjjjjjSTjuL4DžXDžPDžhjthPLؿh uL@T;XZ1h  ?2hiPhH2jhr$hH2t(jhv$hH2| v$r$1DžPhR$j@$W. jjPpVW $@t pue48$hH2h$h'jdÃlDžpjVjj$V 1@CVhd$^^_DžX=H2su'=H2luH2,fDPfX(Phw%| Y[u7h#Pb_ZÅurDžP1ۃXEjv$X󫍽p!1󪍍pi^@_hhi$WY[FhhC2hC2j=C2 hhB2hB2hh!hU$1 ÃPh$j ]h$S]h$S\h$S\$hɳ$S\hC2hԳ$S\=B2thB2h$S\ h$S\XZh$S\h $S\S(h $jw\hH2h$ho(u)hH2h&$h$S , SBDž$hhD2hD2j~uhz$hD2It~hJ$hD23^_tihn$hD2Y[tThw$hD2 _Zt?ht#hD2[^t*h!hD2ZYth$hD2^_u D2b=D2tYhD2hH2h~$jct[^t=G2t `A2hhF2 ZYu=F2t `A2RhP$VihhF2hF2jx[hhG2hG2jwE, PV^_t%`A2PqjhF2hF2jyXtjhF2hF2jz_hF2藣 Y=F2u=w jh$"P?w jh$-wjh*$hF2 jhF2hF2j{hhE2hE2j}h`A2u<DžllPjXZluhh2h2j|#t#X=E2tE2DžHt#=F2t DžHF2t#=F2tF2t#=F2tF2z$=D2tD2t#=2t2WHVQRhH2PhF2hG2h!h,=E2tE2t#=F2tF2t#=F2tF2z$=D2tD2t#=2t2WVQRhH2PhF2hG2h!hW(jjj9 $x PX`@2Rh<#h! h[_JLT;2h5$j tjB ?2=2hB!hR$0* Y^u>=D2thw5D2P h^h0,P j+ hc$jUpV VWPh$h$SfU =G2thG2h$SJU =2th2hŷ$S.U h $jUjTS=F2"XhF2hF2hH2hԷ$jh$hA2 hhA2hA2jjFj jh<u`h $$Sb hA2Sdh$dP^K _Zt 8tVj [^^jj`RPHPuB=F2t hF2hF2hH2h$j hF2hH2hA$j=F2thF2$hF2 ZYPuh=E2t&h[$hhE2hv$hh[h$hy  ?2j ?2X ?2䃽X؍e[^_]g_UE= ?2u]]UU2"w($]UWVS] }Rh$^Zuu ƅ=jh$p:jjf@jh$MZY9t x/t/@?/uGjh$MXY1iR4$SRPh$hu! e[^_]UWVSƉˍPh$ZY2"uuʸ$VRPSS`2uģ2PVSWhθ$hke[^_]U 2E]ZUS]SWZй2؋]9USPEEPj EZYt=2~a2=`2/t`2褳SPh$hh2 1]US]= ?2ujwXE]EPj 葰EZYtt2~2a2=`2/t`2"SPh$hh2 a2=`2/t`2SPh$hh2 1]US 8Ph2m ZYuIh#PY[Åu0hh2h2 hh`2h2 Dž44Pj 茯XZ4u^h`2h 2h$jaÃu2h2h$hh2 h`2h$hh2 ؋]Ã= ?2UVSh?T[y`A2u!h<%fYuPh!$NXZ=2t hR$X=C2t hU$ XhH2h.$hS8 hB!S˳ƃtK'SPh?$jGNh#V_Y}E@ǹN1jSEpS}WSuVt ~u hPR;_[^tEPPRݡZYtbN 8tD 8uE@҈$t$QP^^_$h$EPY[thEX| x$t(p,hl04t:$VS>^_Zt'EPV4Ph.$hS EpFjh9$$ZY@ۋhE$hT$S&Vhc$W&Who$SǏ$W$2 C_4EG8EċUȉG[2)hp赥 ZteP ;hx .th PVDxPh@Z2^M@tO2t +9|qP5O2_Zup趈 YO21P5O2J_ZtãO2 1ۉ +E%=utO2@ h;=@tO2@ R+lPhw%V譒 O2O2<$Z2@Z2Pz O2CO2Ylƀ@Z2O2uFO2fVh9jRP֒e[^_]UWVShX"_ujV [^P~y ÉY1hY"P ZYthhPWT =whhw%W蟑 =whVW艑 =wjW _ZuS[ SX1e[^_]UWVShwtVSh V¿à +];]th$h$hh$^ Ee[^_]UWVS EUMujQ Y[tIËE URjSuPNƃtPEVXZ]e[^_]e[^_]USj$u觋ZYtFEXEPjhjjj EPS‹M Vt9U wj$S믋]UEPM UDXUEPM UDXUWVS ljDž<Piƅb PhQ$Vzd <PjY$t$Ph`$pjXZ$uF$Ph2 Wj&U  Hvw= ?2uj>_1\+Dž@+Džjhh_R$iPj(Uu1 h2h@+W 2"=\+u.h=+h$xZY2"u=[+uʸ$WVRhk$h衈VSa = ?2ujNXDžjhh_R$hWj'OT-= 2+=`2=2h$Wͽ WW h2Wh$SVb Wh`2h 2h$jˇ$VShV$j貇Wh$j蟇WR VSX Y^DžWj)ySXZX=X2tZ=2tQ=2tHh$W W莹 h2Wh$Sa WhX2h2h$2;e[^_]USڸtjS ZYuSh$j軆 ]US1AtjS ZYuSh$j{ ]USSF9tuRfEEPj%DREZYtt`Huƃuj h`%fX t&jR h`%fYXKuh$jTׅXZ1]Ã=O2uiUO2 (2 $į2$ 2z$2$2r ȯ2]USE] tPeYSj=Q4eXZ2E]UWVSDž8DžZ^1Dž@DžDDž<jjFjlPe‰FXYt(1}9{4ukl4 @l9]uް1e[^_]1UVS@]xu1EEEEu1EURURSЃ t1;EE}juuS:URVSPL uF9s wEtEȋỦEUEЋUԉEU؍e[^]UWSPU] 1׉US)ZUtÍBٍe[_]YUS]s qs$iXZCE]XUWVS]193v8klCxdF@0 ttW X9vklS9zduBd@193v>klCx4uFtWZF 9vklS9z4uB4@sžXCEe[^_]鲾UVSjhPjuxÃ1t4uu S1 @uѪ0SpĪ0Z1 SpXe[^]UWS] 1Sh|duu t#S;S t%iSR3ƺZYt3X1e[_]Uu hzd@u'UVSujhPjV蜞Ã1t(ju jSVV,S+py 01e[^]Uu hedAuUU EHJ Ju BklsM9N@uLM9NJ2P豞ZY92}2jJJ2P萞ZY92}2h}I2PlZY92}2h~I2PHZY92}2hI2P$ZY92}21ҋ9Q$v+k UA(0zIPZY92U}2Bʃ2F@ t_u {4 H fE#U~'EUt(/t h2"52h$v0 t85Ě2P21RPs$s C\RP5 2S4C8u%uh u huH_hPRY[P525Ě2P21RPss[RP52.5Ě2C S$CS P21SQRP[RP5252h$v+P uC(PGP52u CH@L؃PGP52uCH@LPxGP52l] u'CHpX5252h$v腗  uCHp\52ρ-CHP`u&h GP5252h$v-OEERhyl&jP hFURjPJà P5252h$vScfx5252h$v谖CH@Hth$v藖XZCH@Hth$vY_CH@Hth$vgXZCH@Hth$vOY_CH@Hth$v7XZCH@H th$vY_CH@H@th$vXZCH@HE $FEe[^_]ߕhuCHP5252h$-+{jPMQKQWsPRdk B(0OE}WP52h$vt0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4I8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhH SPXZ1e[^]UWVSu jFHP]S诎jSSjjjjj HH,E܃,11t]DS@uu@tA^Ht҈Uth"W7SZYUu CcL'/t C/jWjWS FHHL1e[^_]UVS u vDhyl&j ]SZ j SSjjjjhG0SRFDVHB`1e[^]UWVS jj%[^8hBC hBCChBC C, E1҅t_tZ $tOE4F }Ou/UDEjh}EZYUMB"t}$vuh0BF X}$th$h$hh$L jjjjhZhjj jjj%SjM8ƃ4xu P).V9S)e[^_]UWVSQE @4uE x8u-u uyXZttt =t ujj |XZ{ 1҉j4$UȊG YUBYXu؍{sh Ah@Ch@C h@ǃ|jjjjhhjjjjj SjM7ƃDxu P,Vu8S1e[^_]UWVS] ;G(S119tuklKI0@戍jj h2"GwwgRPj!V9- jj h2";G1҉SW׋cRPj'P, 8ɍ}th?jPPW[E@ tP?jPPWP2"u hz?Xpk?0Z?'QVMQWRPpjjAĚ2,jB'?SPhD#j -P% Ě2jC?SPhD#j :P Ě20j->SPhD#j GPޚ jD>h> YÃs2Z£2~ް-T1~CVƄ5T -߉TPh:$jPh2: j. >h2P5252GP:P-Phu$hh 2 Dh_R$CXe[^_]UWVS] @2$DVZY7V,(C8@4jP聡@ x 1;4}aGNu CP@@<098v SklLT<R+A<Q@+QP$@ ;,(}fF뗋8@} EhojjhejjjAjjj4@hr3E4URP(uW4@Ҥ}j8Hl4^_j z$YDPRH8.Ã4xVS#S / 1e[^_]UE @E]UWVS] CS9t0u+QP u,p[1k lCx4KS 19t;@8 QPWRL Q裗e[^_]UWVS ]u F@klPv4_Zu1FJ MklV)tklR8RD8lPk' ~1C@PsXYtM< }C+EPWD UP'}1E@ #USV$fCEfCFfC SVSe[^_]UWVS]Dž{ u'1u$RSPL uC H9rˋ,0 t4u׋$(  @ƋD;{ s$RWSPL ,0 4$(; |>9 |B9 99 QVu5P21P5Ě2WV ?RPWV ?RPh$jPTS5 ,D@u5P21P5Ě2WV?RPWVl?RPh$jPuV҇ ,VSjhvGe[^_]UWVS] EEPR\E^1t1Ƀϋp EDEjP[C$ZY1҅p9tD #B 0T02fA }tAkfAAbQ 1BB uBfBB  B BofBB )9Uth$hh$hjh$跨 jEjjhehhrjJjjjuPh 2(!C(4ys$虒C$XdE<}@C,Ss(a^_{,3CE1E}9}tLk}l{G0u:8t4GLt.MUGhw%PB9ZYUMuBy GD tO@E묅u}u6VLYtk]yvpk)Nj0`)WPjhpK)Nj0@)WPjhVZu(V_uujVY^ƃu1s$IC$s( C(XZ11e[^_]US]t*hw%S28ZYtj/Să ZYt xu]UWVS]u}tE)GWEURPh hb2urG= uʋWO uEueEtMUjh$hb2ɞ UMutt2"E U EUH$V="c2)uMUjhz0!h2c2a UMjQb2 t2c2tƀb2HFu޺'c23c23),T@DDžXDž\S ^@u.DžXDž\48@DS<<j1RP<@1RPXPS@D DyjVz<<X \[  t@ D@ ڋKWVRP0ٍ4@DD49@D8}48+@D6@948D}D@D+48Ή; }48@D@9D}0t'j8aYw$(@DL蚄,菄XZ@DeY[^_]UWVSu vv0N ^$ t(N^9ȉ} )ӉN ^$F F$FV1e[^_]UWVSQMLqyA Q48AQDHLP@LCS$(WVSP|+48׉PT P2 uPT1ۋ48DHSQ<@RPx.Ɖ׋<@SQ84R.)׋H9T<@u<@D9Pt"SQTP.<@PT,0P9DHT}DH,0<@ ;<@}  @Yu #hPV$Y jSq ZY}t1BtVShh$j.e[^]US] uZ] E]n UWVSRubƃ$QnY tLSN׋uuPu uht$j5.tES4vXE 2 2e[^_]á 2t98u4UPh$j- u5 2u 2Xƒ VWY_t1Ҁ{uh$bXЍe[^_]UVS019tklYCLu@u19t klY{,t@klA[^]T[^]UWVS<Ɖӡ@2t*)t!jhw%h$r DžjjPPjh+@t=ƒ u'@l+Pj]=_Z@t p+h`+j* @2Ph<#h6 =l+@1hw%h$ ZY@2t )uV{XutWP Wp tىߋNA4jjjjhVq8PSx 5p+l+4$h$hSc WVSh$j((WpYh3$jXZe[^_]UWVS|jP!_ZxIǍxPW;Y^x- uhVW! =t W "ZKW"Xf}u1fIҁ󤉃EfǃU1e[^_]UShEdjjEP]ShZ$ @t2h@3$S"ZYu L2hm$SZYuL2]U$E]]UWVS8EEE@2f(j@2$u}jjjPPÃu1 @2jjHDjjPƒt͡@2$KS19};DH} DH5@2$Eȃ=H2ufjj]Sjjh+y EueH2_uh0,hr$ [^jjSPjh+E=H2EċEE;E}k]T EPVrZYt E@Eut@2840h$h?EPEPEPuDx!}tuuuh$h1P2EPEPEPuD}5H2 LMhhO s{jheWVPVsss sh$h(hMЉ P2hP2j, P2u1EEԋEE؋EE܃}t+EPEPEPuBPUԋPU؋@ Eܡ@2$tuuuR@2,jhP@2$tKytEf(u;PHZHt)@2$P@2ǀ$XhhE^XkEEEE;}SEučL H2AEe1Puqqq quh$hVE$럍EPj-}EY[kUDH2DP2De[^_]_UWVS5L2t/uOujPVd SjthjXZe[^_]UVSPE X(uRpsƋ0hVPsjhS uƈEhBjj Ee[^]ðUE1Ҁ=L2t]M]UE} t=L2t(q1]U ݍh$%h$j!EjjEPEPjh+8 $@tE Eth$j XZøøUWVS,]EEH2L2uCSEUCSEUURURSЃ tԡP2@EU @2;\`|.}t1hjzY^uCP@sK t9։}ȉH2L2 5H2 L2EEЋEE̋E E1E}E,EE,U}FhjǏY^UuE${ v t($u:$у E u7fUu)8t$EU=@2;\`|ɀ}tU uRIE (Ѓ Ѕu uuth hh?XjӎZuVh<#hP$Se[^_]UWS0]}ȹ 1EEEE =L2ujjS@ jP4E܍EPjS@e[_]1@2f(u_UWVSQE E1Ƀ1} uAu@uFI t }DZ[^_]1US0]U t/MQRSPL tsuuh^$j<]UWVS4}=L2PklUVE 0`XZE UlVSClP 1CC,C0CLCPCT @2$F( t19~ vJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC ǃgSh$jJjPh$W8jvXv\v`h$W$j,Pvdh$WjvTh$WiDž;aS 4@$PsP3Ph$WiC P u"KQPS RPh2$WxiH;~h$h!WSiZY^h $j7iW" PPVhA$hQ$jÃ(Vs Xe[^_]UVSÃ=2u 2KS19Ή} ǃ*@89| {v ǃ@ ǃǃ[^]UWVSE Eu}hj@ZYǀǀjhPju %@HC,PhedA# x.u=;|1ҋ9}SCR[^~1E u CCCs {$s{ECTCmYDž;G u ?C <t+<yWǃPPPG1RPtA8thojjhkvjjjAjjjRVh袼E4URP u臽V.}/1Dž4Dž89uv<`RVSPL t$hl`d48FjHE)0F ZYw1<@(,9H%D8`RpWQL`R7}WS jj84@hjH^_u%D2UPhK$蓺 Y[UjSѹZujhQ_X1J5jS[^&sjhs@2@u ǀ@>U1]EEPV臢XZ}y1N1҉Hùxt%| q1@ 4S-|GEE;xrB;Us E11ۃ}t E;]sP,C_PYVt5p2XZ}1Ѝe[^_]UWVS0EDž}uEf2jSC^_UjS+ZYu`X0jS^_u;0Y[ƅDžDž922} tE 9WuE(u)tURZu#;s{ E, UHD9Ɖ}djj h2" WVjWΠhj観ƃ 3蚳WVPh~$VO V ƅ3eP ^_00@ Ds8cw؉1@uײhh˲jj h2"E,MH},DRPjV覟E$hiiRjPESYƉ<$T1 ‰$YSP1 S[Xf S $ff <$S W3VG9r$h$h$hh$/ u藱Z1hjjjjjjjjjPLÃ4tPS謝_X1;s <1;t4z@YڅttV]ZQF; t S觨X1e[^_]UWVSljfDžv/ƅujh`%Y^yhh`%S p脟t0{8t&qWPh$hSW Džp!shWS =vhQW Ƅ/QPh$hS j/S _Zt-xv9tH9s8/t@QYykߍxPWz YZu^%=u0p:>(hQS n=@uWQZuhWP =hSW2 Y_Džp;/u1{pt}S0l<$ZplT =w9puhhw%Sp =whWSZ =v ?VC _y VYV ZVX1e[^_]Ujh$Hj UVSÍ|PSx Y^1xeEt\jSXZxJj \PSt t SY,S}\Ztf u Ⱦx1e[^]UWVSEUP: [ƃ}t1EV Zt{fx vX jhK$S{ uSuh$EP j @u hw"蕢 3Et}tESWuh$juYzV XEEe[^_]UWVS h$11tY+ڸ$xuڸ$nu#WSv XZuWSv Y^1yah$腛hPS WS0w 1u h$_PSh$jSh$j7hSv h$SȚhPP$ WPv u'h$S藚PPh$jh$̚hPS Sh4$jxt!Ph$h$jTuh$S"hPW~ h$SPWh$j,h1$ShPWK h$SҙPWh$j,h$S趙Ph#$jMh˽$S蓙Ph#$j*h0$̙hPW h1$SZPWh$jl(h$蒙hPW h$S thA$S Ph#$j h@$7hPW> hA$SŘp14+Ph$hWt ztpWh$jC utjh%%DXZte[^_]UEt2fP]USE@k @ $t!@ $ShWE 0 Cx2 ]UWVSh誨ƍPhW@j @1jh$_ZRhW@Pj 1Dž w\k @ $@ $u Dž"BVPx ZYu=t2DŽGjjjjh{jjjjjj!Sh肞Ã4tj蘨PSۓS[mXe[^_]Uy¡x2tRRPPPh$jUE @1]UE @1]UE @1]UE @1]UE @1]UWVS(Nj@E̋Mȋw1Ή}1lj)áP21RPSQERPhB#j]S ]СĚ2Eԃu6V{URjP9jPPh2 S e[^_]UWVSĀE@kl} GNjE @] CuG u G08uw0EEEPj :[^}|E MQw8P uEUPuYIG8EE u9pwk]lE X{8tIC] []19Mtklu ^c0AO0u uu ]u]u t;Uu}UEG0uW+EU] CS}t ]U]EUWE ~ 2"1e[^_]UWVSlu} E 9FEklNA0tEpxP@EUH2L219| EU)AQ1@tA!$SwE@u9ukUlЃx8uP@P ExE4FVEU1;EE}wV9E]}hM9MvUM]+EUuuRP详UUMNk]lMMUeʉT EUVEP$@ ]+CS EU11ҋM9MvV]9]v klTu9uv klDT ]u)։]u19Mt-;Mt";Mt8uW t G0u)EUAl΃}}9} 9swkulEpu6xEU+EUuuRP耥UMeʉu}9}EUM]M])ڋ}WE}9xvsLM] uuRPMʋUeʉ;M}|;E]}ӋuEFX)M]ExuFVEU1;EE VEUF<V@9E]|F0EU9E]E@;Ew`;EkElNjEU+EUW19|WG 9|1GEUVF0trF0O0fEUӋEU+EUuuRPȣM]^k]lUыUeʉT EUVVFV e[^_]Ëu9ueEx8XpPX t 94X*UWVS4PEU 8gWr|Bwu@2LPdhTXlpC(PlVdVPу PuSX8StPl!SPHjjjjRPjjjEPSDžlDžpDždDžh8HSEUdhEUlpEU$lpPTdh u T;KuP;Ku SX?tTPWVSЃ{ th%$h "$hh$Q TPWVڍtWVtEatuMdhplWVډCtQtWVʉSQ[^x|19tlAD t y119~.u2FN<uF EuPEXZC΅ju[ÉY_E1MQ}~ E;UڹUfB EB h5jjujjj(jjjuSjfƃ4uP\VgSEEE܍e[^_]hj XZe[^_]UVSuE ]wi$$$h>eo A[4h?2[Nj@js,s(u(WYh`‹@Rjj1ɍ?;shy$R[ { uh,$`@Qjj12K t1h-_Ë@Sjjl@j  ;{@u-h=_ZEE <#@Ee[^_]鰯s2ǀ,ǀ<jWPМ hW2"P輜 =2u12ǀ2h,2alj_ txL2tByu/29u2ы9u􋐀뺃a2OHk<˹1󫋅F@ =BB )t B8#$t6B8DžDž$u1G9x vRPVL tLFj$t}_[Bk<W󫋅G@ =$CCC C89X RSPL uCuu惽t݋rI__k<ι󫋅F@ =BBB B8g?1fD @9v=2t1%$󥍅P[%$󥍅PY=2teDžDžDž2Dž&$󥍅PDZ=2t1$&$󥍅P XpxÍ1 B T B 2xHfF Dže[^_]UU J E]UWVS0ljUĉ1ۋE9}oFE̋FE11ҋM̃<tN9tKBE;UuSuh %jUR脨 2Uօt1AMRP[ YZt MЋChj2XZe[^_]UWVSPtIMMQt>TPRL Mt.ẺEEЉEt E9EU} UUM|>XuC,@utVF$t#u0ˋEwCe EF(N,ʉF(V,FP2F#~ye[^_]UWVS 1ۃ=2u1yl2th$jW hB!W萫 ƃQWh$j!l2ppp h$V h$V_XDžl2k,<P,0uh $V_XDžl2k,<P0uСl2p$p pph$VWh5$VL h $j=V܏ jls l2tPhM$hj pCl2PxZt{Wh$h0,贩 D2 Wh$P蓩 XR0PRR GPZYtUOTtM8jjjjhRQPWxl2؋QP :jjjjjPqTRWx Ph"V :XwJ0PR踞 GPZYtUOTtM8jjjjhRQPWxl2؋QP :jjjjjPqTRWx Ph"Vs l2t蜇VPhb$hXh;l2thw$h5h l2th$hh l2D؍e[^_]US]1{u6{ t; |C2@F!{x[]Ã=į2+UWVS`1Dž1Dž02PzZ2Dž$9H QPRL 8PV蓜 V /t hw%VlY^502 RV{ YZ9uJt(tR蜚 Y莚 Z9v}tt$;H s41V D 02$Vh$hPv 502G!u2"PPV XZt02PtYVWPh#$hNe0288  RPVh$h"e$tt;,($ PRPh$hd$!PRPh$hdu&02@40|81e[^_]1US]1{u({@uC42z${x[]UWVS22xtl$u ƃxYPYt0$xt=jjjRt)PZuD2Sh$xÅtD2ySh3$e1=2 2P_2pt::t/}9z@u'} 9zDu}B@B AH뽃=2EËl21ۃtP}tJEJP1}t(;1u$} 9yu}k,DPx@,0uCp뫃=2EË21tL}tF:J<1t']9u ] 9Y$u}t#k8D<@8=uF1ۉ؍e[^_]US2;@2t92t329u2ы9u􉙀[]UVS0]u$MQu PRL t!21:uJ Jt;@ =uiMȋu1k 92u92u92t(Bu;k 2]ȋủ22ǀ2ǀ2ǀ2e[^]UVSMU192u2r92u;t = u1[^]UWVSGDž2Dž|?1$%$9p WVPRL } t} t!} tWVS jVSOx k|<$tjjjjjtVRPx|ǹx󫋅tfDŽDŽ#| Fhojjjjjj |}@Pjj|Ph/Ã4u1}=PSm$S/ 9|vΣ2k<}Ee[^_]US<] EjP2ZxD1k8|<u$MȉHPCdž$X!uCjjjjjMQ3PRx } t E#} t&O$URPh$hHSjjVe[^]UWVS ]u Exb$jjjjj}WVPRx WhY$hR u-t4t|Z~H|e[^_]UVS]sjhz$Vz u*Vhk$hR P@?jh@F!Vz u3Vh{$hFR 0|1jhF#V?z u&Vh$hQ ugtX@Ojh2;&Vz u$t9VRh$hQVh$hQ u ƃy1e[^]UWVSt1=+t=2u!hpjl2Y^u 2=į2t!h8jԔ02_Zu į2=2ujHj覔2Y^u 2=2u!hju2_Zu 2l2X2P2T2p\2`2Pd2h2022228 2$2P(2,22<24282H@2D2PH2L22212222B 282p2t2tx2|28222+1󫍵Mڍhjhh hgjRjKjjj@PVh%ƃ4u 2y2MWSVVG& =2uL@2$t>2t5xt$hZ;/jпY^tjjDXZǃ=2 ؍e[^_]Uw=ȯ2tuh$jP)N UVSuu1r$ugjjjVExÃtjjHDjjFPt$@2KS;DH} DHe[^]UEx8th"hx&$hm h$f @UWVSQ} E@E19u~aEX=mu8u?G8.=lu8u/Gx=guWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$%/$zuubPrYtWWZtNjE@ u WV0_XWPV_ tjVS_E@ t VPZYVXjjSƃx2 e[^_]UWVSu uUYP}Ĺ 1󫃽PuPZt苅P$S_xt2jjjSǃtSYt P$SPHHLd 1Zw jt&$RjP8x u0h"h&$h h$ R_X茈S耈ZYvrXue[^_]bUS]shK$j=@ ]]_UWVS} EX,1t)C@WPH/ ZYtCWP8/ ZYt FӃe[^_]UWVS,u}E E th&h'$hh$裝 EPu[Z1ۄtbjDjYZYtQ`($u CC4C8"C1t4Q,1t9E t @11tt:[]UVSQMp@19|h$h'$hh$J 9ù|@89¹@|1ۉȉڍeY[^]UVS]1C49C s6SrY;C K$}%jjjjRPRPU Ɖe[^]UWVSÃ=2u1t9;t42E21;}tSB UP% ZYh}G"EP0 XZt(*$>ttVPX$ YZuG C<e[^_]USPQRh$EPjL3~vh!u;Ejh'$P\ t0u|[GhA"EP蚗 XY:tjME-[h!j{;EZYuu|X1]UVSDžPTRPRP( "TuPj(PXSg^ P|@uKhmSPhD#jxuVo VSSd$ uhHn#hh'$hh$襑 e[^]USEP]S\+XZ1}u!]UVSu EP]Su) tEHw q11}ue[^]UWVSÃ=2uEt9;t22E=21;ut}Sw/" ZYE @ uC F4V8)C S$E+C,t9tVpXe[^_]UWVS EEM EEEEE@,1҅9t B닓uF t t9t}{09~u;S,tShjkY^u}2Mu6lj󥃣E0jMZuLuVK89N u;S4t EP @+C4S8u)F V$U؍e[^_]71e[^_]UWVSuM~ t-^,11;E t9vt@ڋut8$1IuF,tF0j:Zu S oXN C4S8F V$e[^_]US]{ tjjST u]UWVS\E E th}$h'$h=2uh$h'$hh$R uh$jPS& 2uh$Pj$jDjiY[h!,XZƅ1Džh!j,ZYwƅDžDžhA"P YX>tރuNtjXj jV7  t t/j jVc7Kj jVK7 u7thh$P hVP   wh7B#V4 YZuDG8PW<G4hEB#V YZu)+h(B#V YZu)j h'$VLK uhjfXZu,k[1;WjXj`VC@PM C,S0C4S8 u2t)CQ RP ZYuƅu_, G 1*E uW GGGO_O _$UWG@jhRjPJƋ_,tnP4tKRPPs0s,Vt'8t"P PaYX@8u ǃC4S8)G W$mDžDžSh|dVH iR`ZuhYSh|dVsH u܋19v̋G,tpH,9H0u0;u"H49H8u;t밉jSPsJ BuVZ1e[^_]U$2t 1=ȯ2]USYSYSY SY SY SY SY SYSYSYS1hE#RPN[ ]UWVSEUPUfPfUP Uf@fEExsu>1ۍujVk*$Wu uu wuwI u]CuEExlu<1ۍujVk*$Wu uu wu0I uCuɍMU Ee[^_]UWVSu] t>u1}WEPEPEPEPEPEPEPEPEPEPEPh1E#V3d4 uy 2CFU,U9u 2@Ce[^]UWVSƉӉϋ@VEUFV EUEUEUv1}tF2]:U)SEC KF t h9!kE UP< XZe[^_]USE PMk K( : uBu'@ ;Et0j RkU P 1]UWVSUE}u NtGtRutGtvpS GPhyl&vSB FD64t(vtvPSg0 e[^_]USR] = 2uj EPuk =w uU:tt*hjX1kD2ľ2ucÉ؋]U U1vEEUEP[U EZÅt*UVS14^MFZuSQMXe[^]UWVSu>pX19|hr$h.$hxhB$b 9} ǀ!@89} ǀ@ ǀe[^_]UWVS0]u=@2U։@E =~Mȉ\LJ`}@8;CC| CP1RPv{ tfURjSPL tSEċUȉúu@ǃ9|Ɖ׃!! t9׃}sjhse[^_]UWVS]`t0`󫍓0 Se[^_]UWVS,E E th}$hx.$hhB$a hjF_X/$u' CEU^~1CCCSƉ׃s {$Cǃ?ǃjh>RP@ǃEPu裌ZYt!EԉE؉E܉EЉC1҉؍e[^_]UWVSSÉ։ʍNF(E19t<v u1(G 9Muߍ uZ[^_]US]= 2uv19 2v(1Ҹ9tkD2B=v1kD2[]Ã=2u ^<2UWVSƉ $41󫋅 EU RPVhZ$h4P< E jhPjV)x5ShydP( @u VcXVZjSu* 1e[^_]UWVSluU E EE$EEPRV U EPYJXE8t%E8h$h.$h hB$^ 1~,u3FuuuUM~ uxMQWPRL u GF,9x wËEċM9Mu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà j}w}t }t#1R}tPhc$uPu) 3}tPh$uu: ]PhѼ$uu: ؍e[^_]UWVS@Ɖ˹1jhPjV'4DžDž1DžDžDžƋ!DžuD1 RPhS"=fU=_tP9u9uI!ֹ󥉅R~E^99:ƒ<<„t <{n0dž0Džff=Ut f=uP(,DDž1Hu1xȃ<u*UuF,U-w RXЃtt uQPP,1RW蠲P PXx 8t<t+@,dDž $tf;,vPu1hjo>ZYt'DžDžDž Džx Xu1fǃUe[^_]US0E E th}$hd.$hhB$W hj=XZE u CEUY~1CCCSǃ?ǃjh>RP@ECǃ1҉,K0SSEEZ@uS[AM{ uCC$9K }2URjSPL tEt%=u SX1ۉ؋]UWVSSӉMt]0uƀǀǀ6,0Mt,ƀ)߉)X[^_]UWVS uM}] MWЃ<E‹Ut&`t[t hZEW,SC { Ct{UǂǂƂ}DtP?DX}1`t05ǀ`1ɉU슔׃ttAuEEU‹}싊M9`uƆdždž{019t0DžuC$q00e09u+0t!0uu;LJ0MM`UE0 Ee[^_]UWVSdE}Ĺ }0}@S€t E1}t ߃tu‹}9} uE@u9t$t}hj}[E1C1EUWSRP9؉σ}1ɉEĉM11҉utfك 9E ty@tI`t?1 Mtt΃t}t 9E t-@Guˋ0Bu}E$1;]׉u0ƒt ]<*EċUȉEUE`EUEUЉEUEEEtR}tƒtO<tK,]CEEK1M];EEE9MEEE}u0u]su< MtBuh"h$.$hTNE9EċEȃ}}tth4}Y%UĉUẺE4,M9sMjPEpuMUy}t E&$EEEEE1ҋM9MM}ẺUЋE,uWSE*E tE tEUEU9u ǀM܅t,DU9ttP:u UDXZEtDEtT9]u.E9hGjjEPb E̋UЉEUEċUȉEU1҉}ttBuh"h.$hlZEM]M]։uE9΋u})щE"}REDhB$IO Ee[^_]UWVSE0E}Ĺ u }t EE @uhk$h4.$hhB$N u}E$}EEEEE u v ut tu!]\JMEJ1ۉM]E}u] ]t3] ] €tu$}EE EE PEUE;EEEEUEUEUE9EEEE P @|UEU|UEUE9EEE}}uEgE`ut,1EUEUE;EEE}ދ0Љ/E9EEE|t1EUEU,EtDžx1tx;EE|,9t(9ME|}E1hj_2EZYEfǀUƀElDžpplxt9uE|N1+u}ủ}ЋE},ujPMEXU܃ t$4t9tP5u 4Y^E0^F1EUplRP։щEUEM9}E,E+u1u}u}uĉ}ȋ|U9E}}EU+EUẺUЋEujPEkU܃ t$4t9tP4u 4XZ;]ue0u\E,9EE}Hhjq0Y^uE82}usvu,fǀUƀ0Ë0u00MME`US] v$}tM M}E] ];] [}ME @EjQEpQMUE<EE1ҋ]M ;YA EEEEEUEĉUȋA€tuJE]EC1EUuuRPӉ9؉ʃ}1ɉEĉMȋMċ]ȋEEEEEȉEUЉEUU9UEE}EU)ډẺUЋE\^UTuVuEU܃ t,ƌED4t9tP2u MD4XZEDFEhGjjEP U1?t9Wu} @u1Em1EE1Jtd9@˃tuLu0u}t:u1KMttt}t9tv@Fu֋u뷃;Uu1[,ujSEU܃ 49Pb1u 4^Xe[^_]UWVSL]E EEEut,C,uC0EMċUPX{,5ωu1)U̹ 1󫋳1E;E}u}uĉ}jjjj1RPWVjEPS,tEUEĉUȋEUẺUEؤ2jMQSMċUEG uaZuVh@$suuuus$C,u*E̋U19}'SjRPuus$C, X({,tˋC,tPC,e[^_]UWVS0ÉDž1@jhRPSRyPhd@ @tۋf=tf=Uƀfu fǀf< 󥀼t!,;duB $u͋0u< E EDžh1󫋅,t20t"uh"hD.$hhB$C  u/ƁƁƁƁƁƁ} }t~1É1uvB? ӈD>1É1uvB? ӈ49 fDžU1 WVщ#DžuAWVhPx301#^uPƙ9uI9uAH#؍SUƃS+Y9m9a)X؍e[^_]UWVS]Euh$hP.$h ,1uEEE1Ʌuh8&hP.$hhB$@ s{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVS]uh $h.$hk hB$[@ Es0hE?t SE<;}u拶0u͋EtP^C,t PY`1d*FZus)X]e[^_])UWVS}G,t PXjhPjw Ãt7WjRF%YXtRVSVv)SZWXe[^_]UWVS\E4h[E0hw1"jP]S jPSSj^ S Ǎ@Y>w̋E0hw1"jP]S jPSSj* Sݗ ƍ@Z=wʡ@2EHDEU}~EERWuuSVRPމؙ9Uu9]tAˁ~ƉЋM\ǁ`@EWVSuE E0E8e[^_]UWVS]E E܋EE؋u@20}481ɉUM싐HDEU}~EE}u?;E}9jh>uuE=~EE?EE܋ME؉8EtuU؉UU܉U ]e[^_]e[^_]UWVS ]@2480h$h}WuVEPS$xuuuh$hWVEPS.tuuuSЃSe[^_]Ujj j j P9US贷 PC $2"PSh$h0, j U=+u +3fPftPZ9+UWVEE왉UE}ujEPj e^_]U0E EEEEEEEPEPu ƒ xEÍL$qUWVSQ@@u5jh3 333333XZjP 3333+33^_39y933s=3󥋅33DžDž=3uhjoj+(tv!j jj> =3uSh!Pc 3Y[tPh<#hP1 X3319߭yh{!ݝ݅ $!߭ٽf f٭۝٭y1d~dWh#)PP Ë53~-3t P Z)ƅ~:ƹdh2")Vh$Ph#)PP Ã11ɺ9st @u4$WVh #)PP ؉+33+ 3y @Bd{!ڽ߭ 3319ظw ȉ߭$s9ٽf f٭߽٭?ٽf f٭߽٭ʿ 9ƾs tGȉݝ4$%1d PSQh#+PP á33;33)ލ ;݅9;}h:#VQW à +33߭߭ٽf f٭۝٭?~~h-#rtPhǰ!VQ Ãh$VQ à <ЙRPhG#)PPe Ãuh!)PP; à 3fPftSVP eY[^_]aUS j X]UWVSu tT}tNv;Ev 79u]}9s$;}t:CGGPh%jS E1e[^_]UWVSuE E1H-tt:to tjUx}HM=,DWtDOu 1>uxu 'tjjEP  FCEyr؍e[^_]UWVSujuZY@t)Vu SzS9uO 7؍e[^_]UVSu hu|à @tuuSS@؍e[^]U|EPu~ ZYtM EUQ1UWVSPu} RUj S UuRjS tw)؉@))ʉ u C u  Ȁ# Ȁ;uڊ t%\uB"u#u uB1ۉ؍e[^_]U 1XV ShG%0 e[^]UWVSWPE褰ZUt r$t@s΁ǁ u K tJDz u/ t+ <@uu RUR^UujB@ft Ks CAB><vD&0r UV YUw{t)1BȉCXuY t~z txj<TZu h$/XYǃXf@STP1.19Xv$kTрyus1TD@Du e[^_]UWVSSƉ׋|tQ9t3{ t- ufujQMP Mt[ S Vhi%. e[^_]UVSÉ1u%PSʥSYjS>"u%PSXZe[^]UWVSÉ֋8 Ph%(.YXu%VSzSjj&C <uj$'XZe[^_]Á@|tcUWVS։ϋ@@tH{ t=  t1҉C[^_]UWVSSƉ tB׉M6iXۋMu h$H-K   Y t6'Z@uh$-Xe[^_]UVSÃPt3PT~t` PXPQ ǃTXXt3X\~t$ XXP ǃ\^ht3hl~t hYP ǃlZt1tV;C,X ǃXt1tVC,Xc ǃXt1tVB,X( ǃYpt1ttVB,tZp ǃpXe[^]UVSFjjjV>jt}LHPjVfg<@@t@s s t<@SVgXZe[^]US]jP藼 t@tkr ^y \ 7H ZYt&ǃShw6!h$*j$# ]USË>uQh%SXZ{LtS,YtFtSHt<"Jt%PSϐXZ]USÃtt1u?hvPxtPh%)RP{XZtu]Ãx t_USËu1S%Y t=uS`Z S+YuS)X]US]jP轺 t*@t h$(j! 0u jP!XZShPn]UShSE02 u 86t"h$(YƄh0,Sң XZ]UVS])RPй uh$'Y;t D8t@h, H 1tG ,yh,j  XZ,P, Sh$j V e[^]UWVSu~ t %% Eu s&`u!VY}t u\1ɉ%@Eu s`uMV&Z}Mtutj`aY1e[^_]UWVSE<@ف` |8tf%ځ tWQYt ߉%ځ@ tW"&Zt 翉%ځ` t1r rr%e[^_]UWVSS]%Nj<smuf|0t0V=Y%t1҃w $R Vh%$OvSZ%tw4 $Vh%[$ZYCth%m$j Shj+<ǀu!-t腕 Ph%h0, EjEP4 @u h%$X<j4P4!ǃ4W$e[^_]UVS]h&!#<Zr:|0t~ u h%VъYXvjXZe[^] <]e[^]UWVSD]u Cpt,PCMPhj@EP裔@uh$"#E_E{ VEPW3bƒuVWh5%" ut#Ej@VCtP VWhG%"UCtU3_UXYt&MLHRWP^YMȍe[^_]UWVSÉUt0x11MjSYZMu C cS QuPRU3j^ t(;xUu;0tRh_%!1҉XZ{ t11ɉ؍e[^_]Ke[^_]ËLH{ t0Eh<"S2SB>S0]e[^_]/e[^_]US]C P|y)ZYt!SH9PHts$RP ]]]UVSS]31҃{Hy-tC$tUjjS U1>tutEC$u?tSP Y@u hl$ZjjASW @u hl$X]e[^]4US]][]9UWVSUMu { ;u}E4WT ZYu{ ubFuE;E tx}tChV%S葃MUWVSS#S/SA &;ut"C MUSuX[De[^_]UWVS] @?@tjE1t6HjEP4u @h$h %c:h8%h%hr% H|+`RL]!h%h%hr%| _hb%hk%hr% hb%h%hr%h 1h%h%hr%J 1gD[h%h%hr%D8@uPh%=YCjjjk /Ph%1 >u 1ɉV$XZe[^_]USS]jEP4 uh$EY!wjPh$h%EE@tPSPXZ]US]E U{ u0C щ‰{ tG][][]UWVS ]]} u|SE|$XZu { tC Ph-%mD%K^_CStP }|QSS[E fEPjEPuXEuhT$tYE 3Su!$XZuM E ~ WE|#YXt5{ tC PhM%XZF$C$N>K>~>tgC**[FVtPMQVFE|PV2VP~ tWhc%7^_} ~EPuu# { tSYE Et#PHtJ}OHPZuXE e[^_]UWVS]DžPPhh.@uh@$hw%Dž_Xh%Y^1hP貨F1׃ u Vh%eXZug 87t] 8 tt Vh%7^_d`PSƃuh@$[|tlPx WV!ZYu WjS ϋGOt=HOG P|!ZYt%Whjj >u5NG|HO9OH t҉WhV|XP|Sn!|be[^_]US]SޠZ@u: 87u ]] 8 t 8VtE$]]UWVSD]} uMMtFMPVZYt3Mv/ 7S UE ,$E!e[^_]xEC(f9t { tQPC Ph%f{(K>:Mu#M}tyEPVC*PK Mt_{ tEj<}WQC*PdK PQMh %jt S*ȉe[^_]UWVS$}E EEEEEhG %SN Y^uEE Q %+hW %S- ^Zu,E@8S Y@E] EEe[^_]hg %S ^ZE܅u ,Ehw %Sƚ Y[Åu EH1;]}E4 ZtCV<E[E1;U}>E UQMR É4$MQuf ]܍CE UB 뽋E@uh %u ,E E1E1EEPh@$h %uutrktA'NtP4tS6uE뾃Uu@뱃ptxtnuE뙃딁댁M냻yEm!<@EEE|tb{ tW ,UK u;u}$UԋE4QM ZYtFuUԋM;UuuSjv E[jEPEp ʡ uw|t\{ u[ ,UK u;u}$UԋE4QMu ZYtFuUԋM;UuuSu1v @u<D<E@t\ U܁  ,;EuM܉7jD [^mEE;E}bM4|ZYt;x t5 ] t14E롉EE;E|*1ntC ,;Eu㋇|tV[u4|0Y[t5E뭉|= ,WRuMUuXZ؍e[^_]UWVS] U1{>tNf}fC(ffGfJuj} ȋuFZK>s*S>+Ee[^_]UWVSu} t.h%dPV҈à t$=h%hh% @[ 8th%h<#KYXhdZuhD$*_dpu^Džh%jjhPnWh%i@t2h%u)Wh%莕 ZYtfWS~[_ud;Y1 dtt>u?G Ph%[ |XZ{>u[C PhW%. XZ1pDPWdhnRPddnR =nwHƄn ƄoPRhh%V@u-hD$hA% YXptjWdlà xpth%b Xϋxe[^_]á3tU3P3U3]UWVSM Ep}y1yy9s)}_+Yy tʚ;1Ƀ}t}[^_]UWVSǍ]SjEPGPShEU؋G$uʚ;)U܃tBP1;U]s @+UPH 9su @ JPM)H 뺃ue[^_]UWVSU} uh~%h$huh%h$hh%j }ʚ;vh%h$h܉É΋P$t$9zuM9Ju Ju K(݉HS,tJuK0JjXtdUUrEB zEBEBC$t%9pw u}9x vHJHPC(BS(1e[^_]UE@]UWVS}] uuh~%h$hI Euh%h$hJh%; u t 9XG@;GHv jPwDB uGDGHG tHtJOH j ZtNjtBGxGXp MHupMHt p ]X}t upUP@G1ۉ؍e[^_]Ujjuuu uUuujju uUSU] uh~%h$hh% u v at 9XtZ B}t)x t#@@@t`@JB؋]UWVS]U Eu}xx xʚ;v [^_]É}u M[^_]USEU M]]]] E[]cUVS]u E1EEEE i@BU[^])UWVSUuuh~%h$h#h% B$1ۅtK} t} 9xu7}9xu/t9pu&xtyz(xz0xB0C뱉؍e[^_]UEuh~%h$h7h%* U PP@LUE@L]UEuh~%hp$hJh% U P4UP8UPv  DFu EPj @u?EEEE19s8vjEPC44y @tF1e[^_]USjTjZYtR@PjZY@u SX17[C C CC$C$C(C,C,C0CP؋]US]CC4C8t7HtJKHPHXۋHtJHP.XC uKHtJHPYC$uK(HtJHPZC,uK0sDCDCHX]US]SX]]UWVS]uCh~%hP$hh%U 3t,3H33C _,1s1~€u~ @tVSh0,h+,1,tVSW e[^_]UEPu u" UVS uu hV SPVh!u$ e[^]UEPu u UE Puj UE Puj UE Puj] UE Pujd UE Puj1 UE Puj8 UE Puj UE Puj á,UE,]U hPu赑 t[~ t <,Rh<#S, á,UE,@E]UD hjh+h0, q j,PRR}t V0US]tBS'S=S xS$jSSDM3;$]]]US]tP耑YtPnZtS~XE]]UEE]Q UWS]h$1jC PhW Whi t xC$1e[_]UWVSu] E`d$1jF PdW= Whi襽 t>t Ӌ`!ft1f9thWhi6@؍e[^_]UU1B$t0zHu%1t]UWVS\}_>u Vv 7EEEE1uMu EMQUE UJHKuԊEEjPV苾PG Ph%G>PVW|(u W*O>e[^_]USEtSXjST[ ]USEtSS\[XZ]UVSEu Ʊ9tt ut1t 1@1[^]UWVS}] ?jWS! s jWV wmj:Vt ZYDžt?EPjhjjj jGPi C8 }t UC8jVCP蟽 ,  DJu <:tFu}Wjhjjj EPV C0E t0it.u$Wjhjjj j@P踨 C4E t C41e[^_]UWVSp] F1DžjqZ@S~9 _@u&hs#[[^Džh}VE@:hjXZfh$`X@ t"xtuPpZYuËtC VP诀 Y_t[}~D1ۍVE4芀 _ZtC9]uDžY19]A}uPE0C ZY1E@% 1ۋE9X~9jPE\4谘 tCыE9X~ Dž1ۋE9`~!jPEd4j uE`t9uDžC1ۋE9P~!jPET4 uEP9utDžC봍Suy^_HSh.%LCEPh9SEl4~ ZYGӋEC jP踹 @C$@ jR~ p  ɍyDž@RhiE蠶 @t @u SX@C@C*RtE<@u1t(StY@uh% SL SwfC@CCDS4w_Z@t CLCDC pSvCHC@CX[^HSu3vZYt&ShZ%Y[DžDžDže[^_]UWVS<}u tAu}*EPV[Z1@u0tC WP{ ZYt[u{ 1ۉ؍e[^_]UWVSS} E{ sWkZYSs F<t<t+nKCtjRPQVsWjuBC~uN ufF UPjURPVsWju$SE09 EXe[^_]UEU tt ;Pt@Կ 1]UE|t @$u@]UWVSuU `d$1jF PSP `‰t fthShi6<hSh~i舲 tte[^_]UWVS4U 1z BXu#xu[vV v p }u>)u9X.t/t* u%p }u}t uH }8O\ zz9wqE|t 9st[U ؃4[^_]b US]SpZ@u:jhj @tjhj @؋]˭US4t6r$B4Ƅ4ttu ux []UWVSljQ` Zuh$ÉEh}G"EPQ ZYtfP` Xuh$SK[_LUj@PV\ Uuh$SUR q7SXe[^_]UWVSSƉϋ]jh%RU UuUMd} hM} M@u ð`jh%R聯 uRUl} pMuU} ðDM\u `UC}C0MCPu pE$e[^_]UWVSÉUQ _E>"ux"MF-Vj賰Ǎ@ZYw;}VS藰ZY1}u>t tCE9uuHMt 9MrN\<~Vnt>0bt!  tt:xtBrt  C E ,MNMߋUDJt!M߈M~MDyu~~U}EjjEP]  E1ҊM΃0wGMLBu}t?jjEP] t.S=~t%tCEE}u0@t+9Es 71}M;e[^_]Åu À tt @ u1Åt8t u@ t1UWVSljӅt΀9uj/Q΄ ZY…tH@EEPjj jjj ju辙 }t uh%-t SP#ZYuUUWV ZYUuVh%%^_tB/1t72[e[^_]USÍEPjjjjjjRU{U ҋMuȉ1j{Z~CC1HuCЋ]UWVSE׉M܋ER[ Zuh$Lj=P莃 Y^EuWh$h%:S+ES軶 Z1F}t^EEEEtHRUSu芪 Uũ}tDWZ _uGE0^S;XS/WVZ Y_uf/uFuu' lj4$ EBU$uZYUMt:u8 D8NjuEDzjFPu uh$SXZDMe[^_]UWVS]s i{X19s v WF,XsIC C{$Y19s(v WF,Zs$C(C$Xe[^_]UWVS*EPjjjjjjW };Wh%*XZ3)‰U썄5j_uh%Y34D3:j,Wz ^ZƅtxuWh%Y[N9uHO5j5Zuh!KX4s%ƃ4EPjhjjjjWX , }th%_N4)‰U̍EPQMv Y^HMЋUu-蓭 774U䉔7'47j9Zi4ɉ 5 6D44t4u Ѐ ?6t 6@AEPjjjjjjWI }Wh3%r[^BoEЋTP-MЉTj,WDx ZYt W蓫 P U$UAXUuh$[WhO%RV 1ɉ!V)_}uEƀp3h%Wf ZYuEƀph]%We [^uEƀphO#We ZYuEƀpWj訠E[^PEtEZYuh$XMЉtWP^MЉx_X]Iuƃ14h!We Y^uƃhx&Wd ^Zuƃ ha%Wd ZYthf%Wd Y^uƃWhn%XZƁt,j0d_uh%x[L1 $ ECEPEPEPEPQEPEPEPMԉE^ jWuuuuuVIjWuuuuu4IjWuECjEPEPEPEPQEPEPEPMԉE jWuuuuuHajWuuuuuH?jWuuuuu~HjWuKCj=Ws ZYuh%Xa@Ej h%W' uG1҃uMtj h%W̚ ujh%W谚 uM12ujh%W~ t@jh%Wj t,jh%WV tjh%WB Eƅuh%X@EȋM̍UE@u vM1ҍE@t uH#XtTEPV2EPFP2EPF8P1uVP&%$t1ɉajh %Wj M1ҍE@Nu"X;EEPVp1EPFPc1EPF8PV1uVP$$]1ɉjh%W̘ tjh%W踘 uHEPjhjh\jju蛉 }uh#%[^j h2%W\ j/up ZYDžtGEPuj ƃ uOt?EPjhjjjjW }t'uh?%I^_ƃt GN*uh`%1}Y[bUE nj/Wp _ZuEj@PDI D@J@M @J@M #UEj/W}o Y^uEj8P<ñ 6<8J8M 8J8M VEЋ\XMЉ\`L߃0  ߾% ƁQP 󪍓 fCPfCSfCVfC^fǃƃdƁSƅtF1ҍEjH@PL mLHJHM @Džu#EC EPEPEPEPQEPEPEPMԉEk jWPuuuu_A蓠 8Whu%XZS PW$D P^_lh$\[ E>tuh%,Y CƃuWh%XZ    w @c O ; uh%>^_$ EM>tuth%/[  t @t;j/W2k ZYEЅt@EЉEƃuWh%_X EXEȊEEĊEEEEEET19MtCkPu*t,Uf9Pu#U8uU8PuU8Pu U8PUAjE@PV WTXQXkËEfCCt)EECECECC}t }uC1C j/ui Y^ƅtFWuj6 Htuh`%1XZf{zEPjjxjjjjVC }TVh?%CC^_    \Eč`1dEčh lEčpEčEȋEEu< }tEHMă Eȅ h%f[! }EÅuWhK%8XZ EPjjjjjjW踀ƃ }tWh^%^_ CDžtuho%[ EEЅt@Ej:Wg ZYtCURjhjjjj@P+E E}t2h~%k_& j=Wg [^EEt@Eh#WZYu6EBuh%_HM4hm %Wղ[^1u!EtHMh%W衲ZYu5 Euh%[OHMhD#W[ZYu5E{Xuh%N[ HMhxv!WZYu5E5uh%[PUh %WϱZYu ΀3h* %W賱Y[u @hն"W藱[Zu hë!W{ZYt-h6 %WjY[u h%WN[Zuh%W5ZYuh %WY[uh %W[Zujh %WZYu Qh %WѰY[u@8h!W踰[Zu hN %W蜰ZYu hG %W耰Y[u h3X$Wd[Zu @h@ %WHZYu @hS %W,Y[u h%W[Zuwh(%WZYu^h[ %WޯY[uEhd %Wů[Zu,h"W謯ZY tWh%Y[k}tuWh%bXZE s!t@uh+%9Xs,}u&hF%X}u#Wha%6[^}urI݋E. thG#SZYtS: E_uEEċ}u9j,EȋE@PQ\ _h$u[^TEˋEȋE9vU9t{t@E,ޅt9tS^Y4Ef}t }tEEƅtFEPjjjjjjWzEЃ }Džt^j11yXUB=vh%XMRUڠXjỦ+Y E1j|@Px uh$V谨XZxUЉt|J|ЋUpoh%_"vb N:Ws^u%EЃlWh%EY[@UЉlƅt @hH/%WN YZEЋEt+hB/%W^N YZth$WMN _Z}Ёu }ЁẺyh%VN ZYth%VN ZYSE @ tV6j_u h%Yl5_QCuuh%nXZ+1'EH$MčH(Mȅh.%@Ye[^_]UWVSEu} EEEE1ۉE싀@$tM܉UVPL ZYUMtCguFE샸D$uu u E"@EEEE} L$EEe[^_]ECuu E%e[^_]we[^_]UVSuhj萠ZYu h,$3^ǀǀ@ hh$P~ <ZY@t s s ؍e[^]UWVS ] }} ,t\%E싇%`E>URh@$Puut9jj5l5PڋEƃu %MCu %몾t' ]쉟 E艇e[^_]UWVSSEE] 1t 8t R%YPZ1t 8t RXPXE|u7jVu LǢ<輢P豢\%8tjjVg txTuxTjP僻`tV,`X\[dXhtV,hd/lXptV,plx_|tv|xաYtVE,詡T螡XZ]e[^_]鍡e[^_]UWVS(uVZ,3 (3up(3@,3jjj1 tPS (3 ,3Xjjj1 tPS (3 ,3!D_ (3 ,3hF+PP =v1dž} 7C*j,j$\ZYu h $ÿ_ ǃ`j,jdZYu h $藿_ ǃhj,j̛lZYu h $k_ ǃphh$W =vh $h%?Y^PP3_ZhA"Pb _Zt u-PP1҉xW? YD9t t ux\tH@ߋ\`ǃ\ǃ`dhlpǃdǃhǃlǃpptǃǃhP8V7u8h $h!} St=w@ƄS8V_7DžDž 1} 1DžDžPPYZchA"P@ ZYt u t:`R9 YD9t֊ t uʀx\tH@߅t$䟁1hT#C YZuy} tu jh@Pl託 t+lh, Zuh $豻YGhhk%PC YZu;}uP)C _ZTh"B ZYuA}uPB Y_utDž}tuh!%B YZtOPPًU DžDžzu}tSVU XZ1+u8؍e[^_]UM U9w]UU19U t]UWVSlj΍BEGE ˍEMfUfV ZuM8ˋUvu9usC+M}u4 89v "  @G19r)SU9Uv M)1e[^_]UWVS} uWTuhk%h4$h^Tuh%h4$hh%o JHCH9t)]Au'RU;ES ;ZYM8Ut u3F|G|u t tBD+CDu9we[^_]UVSjjVu à tSV/v S ۍe[^]UWVS8}1}عEX}ى‰:E pE؉U 'EPW _ZuUBtt U Btu VS ZYe[^_]UE UU E]rUS]hx$Pq hH$àSq ]US]Sz Y1t Sh Z]UWVSĀuh%h$h h%蹭 Ɖj<|RSk CP x{8jEt*SPh ZYtbHT9KTuZ8PC8P3Y_tE1ɉt8SEPk SEPi 9t { h$SXZ]OVP9_@uz 8Vt h%ѭ[jjW(k à jSWk EC S9;U tSWLk SEPg uqCTt <@% s=t8ڸ"%Sj0ZY@uz 8t z 8t h$XSY]4;E NSVj SWjh 9ty h$躬SXZjjuV j à uUEuh+%h$j;h6% Ptt Wy /1UEuh+%h$jQh6%詢 Ptt y /1UUuh+%h$j}h6%c Jttt8x /1)z 1zuz uzu 1zUEuh+%h$hh6% Ptt1t-_x /1xjh $Pd UUuh+%h$hh6%莡 Jtt!1t>w /1/z#1zuz uzu 1zUWVSu] }uha%h$hmuhm%h$hnh6% FuY<u9FuFPh#WS~ @u84WSPFDPlÃVWSPFP) Ã1ۉ؍e[^_]UVS]u uhu%h$huh%h$hh6%L {t~tSN8t#)kSZtVX1tO 8vt t1&vvPVSo e[^]UWVS(uuh+%h$hFE<t<F~}1JF1 G!)JO9tuu au G@u1>1ɉUк#]tAutU@;Es 8t1qXu /\1ۀ=03uQ}ع1E׈E03S}W8WV th%h$h'h6%t 03؍e[^_]UWVSW]C<t<uEE t /S؉ǹE ^y1ɰE tE )ѸFE+E y111=03u303SZ;E th%h$h`h6%菝 03e[^_]UEU uh+%h$huh%h$hh6%C fPUWVEu uh+%h$huh%h$hh6% fe^_]US$tPh%{ XZ]UWVSDE]S,Zj0S$EEEE}WSd195$v/$H>v r  DF195$v/$H>v r  DFWSnr u uSjE0EPfaƃ SXEt 9r 0e[^_]UVSuEPu VN tVj蔬 ZY@u؍e[^]Åt3UWVSƉ׉ˋtPWh%Vu 1Íe[^_]UWVSU} u19s$@u9v8uh%hl$hC؀xth%hl$hh%Қ u1Y9s*jCPU tًUGJ:N9s@uЍe[^_]UWVS`։ϊB _`u1P`PlXZ`S荫 X?@t _t^FhX"R Yu1%PhO%S" @t PhW%S @ujWhc%S @Tdhlh^%W* YZuNltDžplxDjVYZDžpDžphm%WI* YZW)o Z|6hu%W"* ZYth%W* ZYh<"W) ZYh%W) ZYjh%W) ZYUht!W) ZY@hD%W) ZY+h%W) ZYpDžp Džp_t@F Ph%Sb @p|$tPh%S; @@<t pL%du"Ph%S @GVHo&t >%Jt1$Ph%S @vDh%S @FLPh%S @v$h%Sj @jV٭Ph%SL@~Lt?vpFMPhhtR@ttRh%S @k~tu8?@ǀhX$tP'Z |XY#FtPh%S @uz u RuARTXQXtPZYX9Tth%Sw ZY@jjtP\ ƒ ttqXjjP\ X9u-BTX Ph<#Sw @XKjR뛉Xh$h<#SZw @XujPSj\ @h%W}& ZYu"dL%"h^%WJ& ZYh%W5& ZYh<"W & ZYht!W & ZYh%W% ZYth%W% Y_twpuhehxOpu VZ;ptp/jVY_llxD"L%"Ph %SX @Wh%SB @VvZ%u6?w_%u*Ph!%S @ut|:u%u"d t>(W3vY%uPh1%S @u(h?%S_Z@pu^h/h@hq PVh $SaP@d $@urpll@LlqPPVh $S@]pt puRdhtqh@tdhqPVh)%SO@d)%#ptH2pu)Vh)%SY @1dufwpuVS _Zҋtσ8tVYtlpHpDVh)%SPh<#S @tXd0uS< S}Y^u h`$Z#_tFP`P u,h`$踚X_Džpc؍e[^_]UVSË2tPSg e[^]UWVS}u }t}utSPu ZYtgEPjjjjjjSQC }u9uBu1;} t>Sv 7 ZYt)EPjjjjjjSC }u9tG,Ëuuq0^ } u,FuFuq^ [TuqX1G];M IwE!e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]E;U5EEErE,@x\ Vu<9utBE%?B ȃ}uz}E؁}E9Ew E;Uv X\ "q}?v E\ ^E}DEt,O;Mv \ 78ߋM_.MI+MM;U"}v[ G}}9]ttC }Ut;]tC } t}E[^_]UWVS} EEE]1E9E0EEPes2$$CesxEu$y ‹ ,DAuZ Et\t(x$B ,DAtesx t/unUZ U\utvif\\t0vM\0C0C0SttOCFt:u(Z 7(esUEu EZY[^_]UWVSÉ׉UƍPS_YZ@Wh<#S e @}uSj= _Z@u$p h!Sd @un@ s;Vu hVT6PI sVu S: 8 s Vu S9s.Vu PhV=@Vh<#Ssh3#SsZYsE1)D0<0tu FuU tSP Y_@uyu } ;K;} u@tPhyl&Sj 蟒 ^Z@u2tPhw1"S_c @G륨tffPhyl&t&ffPhw1"S$c @e t Phyl&@tPhw1"Sb t%7Ph<#Sb @sWj.VWjF tbVh<#Sb @tP?tGuUWVC*P#s Uts[փVSk_Zu VS-lY[tDXLR/ZtP|^_/VSZYtXP / P 1ۉ؍e[^_]UWVS(E̋A tӉ΀ytuQP xVx}WZ$1FCtUЉ F tCU{uCCF t#UԀzu ztK|@FtC8F t CXUF0CxFftPE|褏CT_X#F tU tUUЋECT{Tt14~t[O h$E|CTZYuҍe[^_]UWVS É։ Et A@E}E)ȉE9s'UW|5_ZYtp|UzuvRUY^U苃| lj}t21ME1ɀzuMjR褈XZMȍe[^_]UWVSƉjjj à @thWVSA S[؍e[^_]UWVS8tK F1Dž@jE PRA fDž ˉ󤍕i6MI>u*󤍕i ؍e[^_]UVS1ƅ@ CtDžC8PYCP ƋƒZu9F_u)CT@fCXPRYu tЃtЀC| t Cxt(Dž,usT1fDž Ffp׉މ;tHH trt󥃅 QfuCTpV}XZtHHt'CstHHt󥃅  t'CXsXtHH)fSP>  @؍eY[^_]aUWVSDžLDžP"DžTEXDž\Dž`jjHVjjLS @uH1 R?QDZtjjVPjS u@D4YX@DH@D;@9@w WE pC u]dىEuGuXu h$x_5$RuSU ^_u1XPhfB@s, @tXCP)DC YuCtPZS3LX1ۉ؍e[^_]UWVS ]c{u)ss s|@ SCSC ЉEԍENjuEEEE؋EEЃ;Cw:uu؋U;UvUUV3ZYCUuC} E܋M؍DCC;CrCCK-Ѝe[^_]UEEE EEPhgBu* UWVS`fy(u}$@$Xҍ4uV$DžLDžPDžPhBS>* ;6 .$DžLDžPjRS e[^_]UVS ME fz(u2]EfEr*ufR.fUffE]EEEEEEEjEPqe[^]US]sOs IXZ]]IUS]x@u$1҉g@th~B s%) ZY@؋]UWVSM}]utDw 5 .E C[UU +29vp5 "101U 19t9u} A,[^_]UWVSS1tލ<}})v ~׃kJufЅt‰Z[^_]USS\t$jr^s\nC\]USS`t"jR^s`C`]US]PSCXZ]]EUVSËtBC><v:D&FT|tL9t(tNT9JTuu " Ë@ˀ{>v P ShT"%f e[^]UWVSÉ։h,jBZYt:PǀcScufǀ,1e[^_]UWVS0ÉjRGs^_@u Phl"%:[5h\sZYDž\@u Phz"%e_Xth, PjAY^ @dtVWv<u?(9x u1Wt cScuGhu @G @(FH>A<wNw*󤋅 t&x utmtdf@ tStJSjFjPSX9Ѻrf‹fP@TȋF,|D0㉅ǀcSc_$1҅tkDcScubtuPOdt Ghu;Yt>)ƒfǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃYf@6Vt9)؃gf2CtGt2)؃f3ȉCC+f7Dž9vprfуuL>t2L7Pu uJƃv;#C,m\Dž9`9s 8 ttBprfуuL>t2L7Pu uJƃv;cC,VP)HFt0GWu*)؃f9ffC3tHGY u<)9CM3A3󤋽3\ tC)9C= A󤋽 \t tk@WuMtB)9C<A󤋵\tuK<>u+@t@Zu)؃vfPhPqƃ tjt jV_ZH)9QC t CfCt\SVY^Ot/t+V) ZP)9 SKtu@u7Ft#@^u)؃DftC5t<)9C5A55\|@_)؃f|tȉCsx19|v\ ‹)9ws{|9v Rh"%a~t <‹KL9K@떉S+)Ё+wDB% Rh"%[ < e[^_]UWVS EcSct2( V EE1EEEEtIeBlE؍E];] {GE܄t;}u)' /EeB,E؍Bl뮍CE{ECE;Ew}}4EMt}u [؃ȀEE9Ea}tqE}9sE1ۃ}t])ÉUuPo7ZYU艂}؉EU}u E苀EM}}uԊEE} tE ]}tM}E苰u& 1e[^_]USSӉʍMQM QMZYt }t1҉Ћ]UWVS$Ɖiu7h"%Xf,Xfth$QPà +_iS@ Ph"%hXh$PS6Ãu2% Dž8iW Vh!X wh$ Vh#%{X I?@u j5SY^@uƅS0Zuh$XXDž lj󤋅e[^_]USSӉʍMQM QMpZYt }v1҉Ћ]USSӉʍMQM QM:ZYt}vȉ1҉Ћ]UWVSS}uh#%hh$h{Ӊ΋S IuN Ut`t#Cty KsjSP> uhU#%hh$hh(#%WM P S@tCP-Ztlj1e[^_]UWVS$ϋEE Ehm#%R ZYu}[ƅP! $'-Xۋuh4$T[uQVhRSV5<@t-PdP ZYuh4$GTXe[^_]1j60j4@uƅw x,!j@,Ph@hWu#dWPh! dWPh!SVh#%\R$v!tr$u)cPWVh#%R(cPWSVhr#%Q ]e[^_]j3UWVS] $tPhD"H( XZE1E9v31;Et k, 9t@v 6h#%( PV蘽G,1;uts 3h#%' PSrF,܍e[^_]UWVSEvvE E] VEtEubSPhJ%uX* @E^PhbPh$u2* @tk;]sP;] us v Iuj #Y ^_@u8CT9Ubs "ujX XYBue[^_]UWVSuE ]xKt tPSWhS@t-Sh<#Vȫ @u07yaPh<#VE) @uLt 5uuVj1X ZYVj %X ZY@u 1e[^_]USS]u:t0ASu*JREPjZYu1 }vff]UWVS,E E@hx}ԋ@E܋E E@_tE@o'EPjyMԋU܋E RXZtE2"(EPhMԋU܋E (^_E̪#%t7Ev$؉EE9]s K E@Tt EEPj!MԋU܋E XZt֋}uE9ECEtu 輙Xu EEU9t M;At;A uEEIʸy,%=tс1utȉE@uFtEPVFEPFP9EPF8P,Vu誚 ]E@PEPjMԋU܋E ZYuEE9u 蘘XEEPW虦EPGP茦EPG8PWu ]뤍{D9EsV "Mu YEtENjM )كȉEEE^;Et u;Ft;F uEE}uBtEPRU迥EPUȍBP该EPUȍB8P蟥URu "EEu3E @hu$űE Ph#%KE؁ Ee[^_]UWVS$}ƅj4uMY[@uƅEXuX uExlS\\Pu h#%u苦@ujuM^Z@t'^2Pu h#%uD@u-S2P[Pu h#%u@ujuM;ZY@t2E@#P[Pu h$%uԥ@@ ÉSo[Pu h$%u螥@ut Ex,u@GhElPhhSSu h4$%uL$@ut 1;j@E,Ph@hS讻Su hC$%u$@ul9v VC,X鋇\1ۋ9`v VC,Xp1ۋ9tv V`C,X鋀Dž\9Ή⋍T1Pum`19t k,; tYBRPMUXZt5_ VhbSu u7 8},.Dž9`vhΉ⋍T1Put'CH^%h^%V蒫jEo=${HuJCt.Chu(SJ9Hu{<t;t CH+%CH%%;u CH%%CH%%{0uC8C4bVhs4jESiRUWh%%BsshUR6. @Uu Rh%% C_X{hEu/sHVD6juVz*CdCh=V3Yu2ECh%yBjE; E>uxEulCtSJ9Hu tQCdPC`Zuh$CBXe[^_]g_VhPE<9e[^_]g_UWVSu} tuVjj:9thrb  CiP6׻VD t;{t5{<t/s$RPF Ph%%3AB1ɺVjj9VTs !C Cs!CCCC CC{Ht V2_CdChWVZYsd!CC C$Xe[^_]W|$wUWVStEUM]EEuZPSCYEHT&%u$Pt :tQRE Ph &%?EE@Lu E@L@w}GL E@L@EixLh[` EuB_ZEEEm5#EHT&%u$Pt :tSS$QRE Ph'&%>MUEE@%E@htEEExdtj$Pu& tϋE@$Et‹E@XZEE@uEEPjLY_uE Phi&%=XZ@NjMC EC ECCDCEffCfCUofCEh,^ fCC@EffC1ɺ:_fufC fC uShEp\SFu$E Ph&%*=! [^441~4uX}teuuujEW5E7t̋E>uh5v&uZYujjES5E댍e[^_]g_UȎE]UWVS]3Sjj4Ghu'PtSh djc4{ tLPWh&%;&%r/9%PWh&%; ]e[^_]*U幞E]UVS]tXwNShj4v$LPC Ph&%: 'FL]e[^]뀍e[^]U'E]UWVS]{ Wh&%:F0+F8PWh'%:Shj|3F<FL$]e[^_]fUE]UWVSQ]v F FXuHjjS! C Ph)'%9_Z>FH['%h['%SJ7EPWSy! ut>t Shd'%9[^jWSI! t jP (ZYF MFuWS! uhU#%h\$h1 h(#%/  FdH PF Ft''N V$vX]e[^_]e[^_]U4E]UWVS ÉU싰V Et9Bt E9F$E;E0XIPC Ph'%8FiP3Eu~@u1ɺjuS EtjP&XZESjj1EtBFH%h%S}<%@Y^ u-j>1XZShގjj;0Ee[^_]UWVS(Ë>Sjjd0V BuB EjEPS! t@tdu,N }vuu܍EPEPWS'5@t P3#uGP Sh'%6SXe[^_]UVSËuPˆP@P  ZP \W(P O>w*󤋅X s3 t)h`RR@PP\ Ph'%:\@>tZh`RP\*PP\ Ph'%2$h $V3_\ Ph'%A3\XPj^X@Lp X@ @TT t\e[^_]XP \VXGG tx@`j`P\XV cSctTt @RX@ @^XH p$p\lX@@[x(PV\P HtmXHQP XGYt?w NjP󤋅X@XGHWdOhj\0XZ h$Q1_X@ cSct PX@ @^TXx0`PXiP\0 j [ut_Xw0P`dP@DžD)HLH9PDL}B\ Ph'%/Xp X@ @@$ )NjPXH0x4x8X@ u\Ee[^_]^cScuߋT uЋ\;CLt&P2Yu\ Ph%*/XZRs5s$?P\ Ph(%.\Ee[^_]C cScs$|?P\ Ph*(%.\C<\jj\L' t{@t \hTr)\hj\&\Ee[^_]cSc%Te[^_]UVS]C PhD(%-NhFLXZ]e[^]LUVS]C tPh}(%-NhXZ$Ph(%-h%SxFiP3諧FL]e[^]USE] tB:t=tRdt9ZtE %E[][]UWVShd`\Džp:d BX9CTtu`dh h@><w!Ph*PdP uhx  E\@\u8WD1ҋ|!9u$hN)%hgCiPh0蔣hhގsPjh!CPu CPu4\Gt(jjP`d_Zt 1u`dh)% `9Cs s `C Y^`C{ d󤋅h>tispCCCC C CCCC CCH^%h^%hڋjhC\HhhȎjnt"hhRn<u$u`dh)%<t!u`dh)%[;uc\@t+jjP`dh=_Zt,u`dh)%7 \r)u`dh *% \CPuQ`9Cs0s `eC ZYuh@$"CXw`C{ dC@hjjhEhE03Ph Ph*%_"be[^_]UWVSEˋuw62PSE Phc*%$v%62PSE Ph*%"e[^_]ÍEw )ىM1MMىuEe[^_]UWVSƉ׉MBȉE|ta9tXtN8tIU9PTuAC><wPC*PGP u$C PF Ph*% uM6[뛍e[^_]UWVS(EEԋ] uEEu莳Zt99v&uEԃ EE P$E*%e[^_] )VPS葑 PЃ<@A{ 7fCf9$9EЋ8@fff9f=DfC}1EC EKME1ɉطfuHEuaEЋptTfuEf@MܺE蟷f֋E萷f9tuH0PEԃ Ph*%-fKf)эTEPEXe[^_]UWVS$}^\cCubh$RS詳 u#>t=G Ph$h!WsPRWt^\ue[^_]UVSE pjPu, uE$$e[^]uN]e[^]z\uN]e[^]e[^]UWS`(ÍDž( 1DžDžDžDž,t @`jWP{ u ht$YWSXZe[_]UE‹]#U1ҋE]UVSuV|Yt,sss S|t}tt:uh@苃t&jPR#ǃtPǃZUǃXe[^]W|$wUWVS tu PZK>vur s(Vfu  s ure[^_]g_Jhm< ljEEm5#PP$C Ph+%>Sh˔Wj(e[^_]g_UVS]Sh˔jt~ht j3 kXZe[^]UWVS E} _uD9~dG PuC Ph8+%SFdh%SSF Gu\utF tm@;GueP8+PC PhY+%+t SX5SgYtߨtWC1E샸sSZvFFO WFIFX~C$E}tnUҊMM섄tLGEFȀ8t PD)ʃ@v p M@MH@E}uFHt$%j3hvHSue[^_]UE1҅tB]UWUBv 2E JI} ډу¸)Ј1_]UEt9ʸy,сt1H%]USU MEttt9Xut9X []UEttPf1ҁ]USE|tju S u[1]USE|t$ttP] 3#P uI1[]USE|t$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVS\E|E}FEx .Eu1E@$hX$EP jju ÃE8uǀxhtxduh+%hp%h*h+% hX$uV4 E@dZYx tYu`Xu E1K|EPdB#B E}WSnE@d@ EWCPnC9SV'bjjEEP jjEP E }E8P>i_uqE0Y_^B$NjuuP_C| SEPajuEPX EuEPZY@E@$txtiu_XEuVSmVCPmE@dEPC8PqmE@dEPCXP[m SEP`^_u[jj}W à SW sxC|ZY uC|E@dEPCXPlSu 9tS_SM\X떀{tjSu 3 à ukSg_tߍC8EPgE^ujju ƃ t9tGuVniZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EEZEuF$tDu4Ghu. juvHSt3Q e[^_]UEt tH]UWVS]E EEU}uM MM$MM(Mu|u+ _RPE[ZKPwYu 0EjWum Ã}Ut}uQUj4,XۋUuE0%e[^_] ECCC CBCZ t4;C t/C 647VPhJ%jC P }t ECCECc%tOt;C uDKtHJSHwuSuà }u]e[^_]\e[^_]UWVSut=t7;Ct+| PjCPC PSF P|jR$ōe[^_]USEt6t,ttHJHPX]]]UWp0Mg Y_}UWVSQÉ ذtZָH%ljU@%9M9 u*X%ljUP%99u!Z[^_]UWVSPL}fJ}xv` ÃtCEH@hEEhPdfGd9h,%PS:Ɖ  8th%h,% YX?w,j@+Zuh% YIǃ@h& h2@uhVV =wPƄ ƄPPhh,%Su,hh%h -%ǃXZh~dwdhXETE`\fu `\\@+hDY 7E \@󤍵V3L dPV1T VlR@T PLhDdhlt NjD}@ugPtXE Lh󤋽Xu M󤋽TuMfJ`fJf1e[^_]USQR{c YYS]UVS]CTƃ CTCPtCXPC Ph'% tFuBC Ph"-%vY^KtPT s((t hm%QmXZe[^]UVSËFt t=zQw/hX' FXShi{Q+FPje[^]USSËu>jjZYuEh%"XE@@PP ]UVS]1u>jWZt)@ǃǃǃe[^]USPE]UURP@RppPMRP>RP*RuM UuU]UWSU vD -1}}1t %M[_]UWVSt΀yv  y ׋QTs1t|B$uRPuOXtȅtGpCxF PS]FPURURCP]FTt KthK&u WC8P~]_XC9@VCXPi]ZYEh@-%XEo؍e[^_]UWVSSEϋt<u[98up|t1҉tH|Pu=PXZ61e[^_]UWVSQMAE1t u@191ɾtAut1uB;Us :t14Z[^_]UWVSE Eu}MEHfw Afv f9M1ۉ tf@u ¸ u u u u xKEU)ЉE9}o " u}uEEftbf@~:f}?M t1҉EU+M t1"t@+M t1u}11EEӋE E ֋U UM ًEVEUF1[^_]UWVS}E uuGT((*1ۃ t%jPG@Pt ut #wTۉ؍e[^_]UWVSu }WVu&WVuhttSHID9JDs؍e[^_]UVS]CtPjVSjjVO7]e[^]&UWVSuFXPF Pho-%/Vj=@u3Z 81t)P 8tF 8t< 8t h%1XF@tEPV$ZYt$C@u NtHUJNV^‰؍e[^_]UWVS EEEE;} t!CtGUBC8} CTS%t =} uKtHuNKjC@P2ƃ tC9FtSzYCu+t'E Eu}u EPjXZEPVZYSX} ue[^_]UWVS} E|0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UWVS] uENj@t)9Xu9p tXp W PG 1jRZuh%Ye[^_]UExuP u U ffP @]UU1zuJ u fB f]UWVS8u EE]rBtEPVu#E jVu E}tExP EhjLXY8EBzPt"ZTEBǂ<BTtQz Z@}J tu@UPEPQuSU@uu sz tz j.EPB Hz@UEP]SY^@Ur@tXz 1  L @uj.EPB@UPj. Ut!JQPhJ%j.BXUP UUh%UR>XZ1҉Ѝe[^_]UWVSEEE EEU}uM MM$M܅uE䋀| RPEZYEuQE؋EXtjWC@P3 }jVWurP'@uC$C {4s(E@CEXECPCTEt CT{@u CACu<~*Sh(%WQ tSh %W> u  VE]1Ejj@EPVHÃ@$@ Et;EPVCPC PC@Pǃu SZWE䉃C SC@SDf~(uXF><u,F*CHF+CIF,CJfCKF-CMF.CNF/CO%<uF*V.CHSLS V;CHtSnν !CHE{@2SK諽 1XjA@MPW Mt uJyPttEAXPA PhW.%8S? 2j.CXPWj/( E@CEXjSD1e[^_]UWVS]} FtHtJN HPNXڃЃjPV t!t;E Ee[^_]4?V ǃSjje[^_]US]XE]UWVSQE 81EjG@PE@P tGT(1}tS}usGTtGXPuG Phv.%gTGT@tHOtHU JOWZ&E@PGP uGT uFtWXOT }@tÍe[^_]UWVSRu E@EhE@PE PuÃǀ@4uUr4{(s41ҋE'CEH$Q+B9vȉC$}O : v: K vu;F v臺 SX1BCZ؍e[^_]UVSÉփXPC Ph.%VSt VPeZY h%Xe[^]U URjFUEXZUWVS Et_*uVj XZ؅t_t @ FUMvjXZYUt0Mt&@}wFH r*NjM;jC CUe[^_]UU t,t9PuƀRhijjUEP`у1t0wt*tRh%h0%D UWVS EEE stqpCuKF@D9ADwgt tUt tC{du~du7u~hu(SEVZY9E~FC3^Z6|Ut&HJUPEC]&e[^_]UWVS0}EPjTZYEEEE9{EnCTE܃{dtojPEPw‹Cd 9v t/uECPG Ph0%pCd EE)9E}шMtEEsxF @u jF4PEPN 9v trVTtRNXgX$u%QPF Ph40%Vje@uǩ 81t轩 8t h%XF$F fTE)}9MˆUtME6#ju܍EP&E̋CPE܋CLE؃ }Ef΍4u9us" KuĉуuĄ@u[tuQ}vKE؋ptAu(t.9us!+u9u}шMtuU EEEE)E7}uƃEЃ}v1ɺ%]c}tWh5uj}}t3G PhF0% Oj7*hu%W?Be[^_]UUt&t9PutƀU]]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EZEPQdžZYtU9pu 1ɺOGE|tu6@t&jPwlǃe[^_]US]t9XuPxtJT8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj葺E _XEE 9CEuhq0%j uVI CPVhw0%u2 @uksXsTVh0%u2@tuuVh0%u2@tCtPVh0%ul2@tS$C`^E uE2"Y !t #At2"! u2"7#@u2"y"x2"uRWVQuVh0%u1 @*sdVh0%u1@C1C9v WsPF,Z拀d1C9hv WGPF,XCPECLE}EfE9Esn SM@ukdh1}9t 98t(A, 1}9t398tA,}čOQ}OQhPB PEPu2L UU)U0sx1t8FT%u'~ t!GFXPWEPh0%ub0@6ċCe[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09Xuƀلt@j3w$%Y^t=t hu%S;XZe[^]UWVS] 3EC@EFEj.}WPjU }wWh0%EPSuE u h%nEx f  M CS <E! }wWh1%9E=tWPh#1%c~u F Gh^%u8XZEE>j^_E}xx j.EPEP$ E@xxuF|Ɔ ƅ~ƅExPu~uFL^h%[<uv[.MQRPh3%EpLU;PPuuSVʿ tV3E@P_ƅ~ƅ~ƅRljދME}xPE~ElE ElPh1%WETdPjMCuF`VdfCfFdŠtuluh1% Cu@uFtCt=6wFhE@h E@h0uC tuFldžƆFphuE@xZYHTtff`hu uh1%h9xs uh1%upۉ℔`t^E}1p9t 9t B,tlp uh2%FlpWuh32%+@<<x<`t uhU2%!ENjtEtj覻XZE΍e[^_]UWVSRƋ19XkTKfu{u#{u{ u {u{t_fuCUhPCPVUt3ǀ, KfHGYe[^_]UWVShEw蓎 EnEEEE@|tXT@uXTBEAEEE}rEf;EwH;Mv# E Ph4% _X1u<}M)AEffEftftfu f9v#蠍 E Ph4%[^LʍEĉu)f]MX1ۉ9t,kMTfMf9HujRPb Ut@CЅuE?@u+j EPjEPlPE Ph4%葿f}tHuΉuȋ]ˉ]̅tB9v>j EPjEP"uSVPE Ph4%蚿(nEEEEPM1ҋEEYtE3Eƀ>$f}uEȅWfEEEPjuWƃUЍ M))Ufw# E Ph 5%XZUܹUʉUEȉE9v'躋 uuE Ph@5%衾qEX|ۍEjPS uCTuCTcT{4u EC$U9S tKTS C E}}uuE Phe5% f}t4}W`9ruuF`E̅t}Wdt9suFdE}E؉EjhPu!ǀ,fEfEĉ{(u ECE};};GhGhEe[^_]UWVSljUMu w@ Ph5%։ u1ɋUY賉 EChCdC`ǃu uVjŞXZƃ>VuMUZYu];t}tG Ph5%a[^=SDtKHuh5%hP%h h5%蘲ƃ>VuaZYe[^_]USUE MvɉME BE[]ˈ 1[]W|$wUWVS4E؉UЋEu#@u5C|t @Tu!Eu@EEƃ@}t'QuЋE؃ Ph!6%u2ǃ8 ǃ896%ujjE؋觳EPj9$%8u ǃ8B6%EPj sHsDtf}t C`Q=WvC`C`XCdChǃV8u ǃ8J6%8u ǃ8Q6%8u ǃ8X6%8u ǃ8`6%{`t|s|C`t>FTu4N !Bt(9…tFXPE؃ Phh6%ǹ 16뻉t%PE؃ Ph6%褹CdC` u;t0EEm !}fEހ fEm}mދEȉC`{duGtsL舙CDCLCHCPCth^%P1;Dƃ?K`qw$ /t7+uVQjACdPwuh-PjE؋ChtuhW1PjE؋E؋C|PNX}s|NjFT rHV t%tFXPF Phe3%ܶ F$uvFXPF Ph6% VT s(F$F VjjF蚯-NtHN sV=XVڵY>E؍p C`;u PVh6%MuVh6%,KdSh tRQPVh7%u{)uVh<7%ud RVh'%uPjE0XZEȄuA}t;WVh%%賵sHsDhWE00 @u Wh%%_XE؋_|t{CTƒ t ujC@Ps胶 tKT CT uVhL7%;XZE؋<r}؋t4r.j蜮Y[8uE0 멍e[^_]g_UVSËt jR|PS t j3XZe[^]UWVSƋu5h"%qf,XfthWPF 8PV Rh"%+hWP6d.f?@=RRPO. @{TWj^j4" u +)CTSXWjZY@Kht_Dž+9}+uF Ph'%_XDžDsDܓ誋CDZYu h%'XNj󤋅CHK1҉P6$-sD聓CDCHh 1؉e[^_]W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@H@@u DXDpHDž8 wk t]HuNNPj VS8t1@>u @ Ph7%[^Dž8WËDX4Yx8<8DPltfNu׋8 L&󥋅@@@><@D&׈S<ƆfC@|tv9@tFtv P PhT"%2 DP4B@>u-H@t@u<@x Hx@NjHu@NjD@4<4tf',t4 t41u G GG_S0, ,@fӀ'fGXZϋHuC5t8fpf ЉH5tGH61/H2f Ye[^_]UVS]t{wqSh7+j蛘FFF F XF}@u Sh%h!讟 ]e[^]e[^]USPhnj@@@@ @ @$2@u Sh<%h!# SX]UWVSƋx Wh)8%贞 CCCC CC$41uZY@uWhd%h!語 VXe[^_]UWVSV]CTƃ CTCPtCXPC Ph'%M s  W|t=JT(t~CPt(ffEf"MtCTu{ tȋ뿈EV RhO8%vXZEt?ue[^_]8VY[Ee[^_]]xe[^_]UWVSuVhj'~ ;u Whh8%Q Wh8%XZCCCC C X@uWh(%h! e[^_]Éue[^_]UWVSu{Du ?~ Wh8%PśCCCC(C CVjj0sD}CDCH "@uWh%h!Y e[^_]Éue[^_]NUWVSu@u{Du ?~ Wh8%PCCCC,C CVjjfq@uWhx%h!襛 VVh1j jƓe[^_]UVSËsS^jSZYus S[jS|ZYue[^]UVSËƆ?~DtLt=C Ph8%֚F|YZtHT @$@ 11҉WmvL@{FDFLVHVPFDFHZt h%SYXP3XZu)C Ph 9%7Sjjْe[^]UPEP ERh49%)ZYEUS]Sh*j萒C Phf9%؋]US]?S Rh9%P褘 ؋]tUS]?S Rh9%Pk ؋];US]?S Rh9%P2 ؋]UWVS] E1E9v31;Et k,9 t@v 6h9%wn PVG,1;uts 3h9%Qn PSF,܍e[^_]xUE@|tPT(t1]USEu1X|tuu SƖ u؋]UVSE|0t-uvX|tuu S~ u1ۉ؍e[^]1UWVS} 7G@4j.DSFPj4wSh:%軗}tE@<"jWu`< u h%iG8@Pj48FNj< tjgHDP< Phk;%芒<);ZBPjR48tKfBuA0΋jjZYuE%e[^_]RWhG<Pa@uu-@t1uv@= uE@%EtETt'TPu!EfHfE벀u t?u]e[^_]3GhLJXE1E1;UtkTf~tEB>IU;.u:X 8X 8LjWh%h!謋  P|tFBPtfftft BTuz uԍC Ph<%\^_؍e[^_]$@@@@ @s Vh<%轊ZY@uVh%h! 0SSh1j j؍e[^_]6e[^_]UWVSu} wt`P1Gu;t7ƃ@.H'jVw_ZV uk1t1hDjfÉZYC(C,C|C|1;fǃ<fǃ?VjhÈSjjV uF Ph<%ɈVh=VVkX1e[^_]UEtfǂ<:u]P]s]UM E]UWVS ÉUϋt <@UMtSjjP+ u }EU S.Z8m @@@@ @@$@u Sh%h!軇 SV^h =%SY[P3XZU(vLgFDFLVHVPFDFHYt.Et(E%e s=tu=%WSWXZvLgv4gvuQtBuC@PvXZtShU<PC|tuS|PW%e[^_]UWVS]}wR EEEE싰1E9v V{G,XEl1E9pv VLG,XE싰p1E9tv V)G,Xu h)=%EP c{EpDv"GE܍FE؉fȉM;Mv+Q  ffكM䄔1lpE;Ut 9t&E,fufvGuP|ZY1UM9pu"U싲19t79t B,t)EuuhVEP Ruu0N Et+]SRWRhPE PuuE0 }}u+uucXe[^_]UVSÉыS t%[+Y#$<$+Q$T$,$e[^]UWVSÉ׉1uMJ~D>Ph4?%#X YX؃t w t u F1G1ɸ )E9M~ u"u!UM7Phxl&W XZUMA΃^Ѝe[^_]Uh0,h8?%jP 33t9W|$wUWVS31B3,у @5f@(5 s f3.s f3P s1f3f p3f 335 1s33 ut133 33 3f3,Of33ff3f3=3tjV& Eȣ3Eȣ3ZY,XT3 5X3U1E3]5\3`3jhT355ƃ x9u h7%XVS53h @%U @(5Hujh ,j 33󥸤33 3u3󥺼335,=,u؉}mrq,E؉ 33 33E33=ɚ;~ 33-ʚ;333 #we[^_]g_UWVS4ƉU)'h/@%fT Y>F h3@%RFfVRVRPWSPhM@%T j.]SFPjnuj.hs!S+A Sho@%S j.SFPj>uj.hs!S@ S³F^(ZU)ڃ<,wJ<w1tR<CSPSPh@%<+h@%"<:tI< XT@uWhD%yWhD%Wh"D%g? _XtSj,{> h)D%P? T@ZY98sj,R> 8T@Ph:D%? I\9H7j,> h2D%> _XA(58PWhϹ#> T <x2<w><tG<T@PPhD%P $=%<{T@<w*$>%hQD%AhiD%:hD%3h #,hJ#%PhD%.T@t <uh#hD%^Ph E%= Y[THDh*E%= T@Z<t%w uh>E%<uhyE%hPE%= _hdE%PhE%t= [^T@PPhE%V= THrhE%hE%hE%hE%hE%h/%hF%hF%vh.F%lhEF%j.STPj0uj.hs!S) ShNF%< j.STPjuj.hs!S) Sh^F%hnF%]< h}G"S< T@fPfZYfw2$0>%hF%hF%hF%hF%hC%hF%}9HuhF%nhF%hF%; S1ɋHL t Sh%#hF%&uj.SVjhF%r; [hG%b; h}G"X; T@fHfZYfw-$D>%hC%!hF%hF%hF% hF%hC%; XA(5t2T@<n4?%h! PhY#: ^_@(5 A(5uh, [g v狝t݃{)!C2t!#t1 hG%3th'G%I: C Yh7G%1: C HC SRRPC PhCG%: H=?ǃxPhhG%9 XZ hvG%9 XCPhG%9 Y^19~gVH?YZuVhG%9 XZCj.RPjuj.hs!R& PVhG%a9 F땋L 9؋33t9~B(5 ,t,93 =3PR2 hG%$g&UWVS]u)p(5tPCYp(5t(5S/ t(5@$W;p(5Zu/ Vl(55,t;C@P;:uS tD~@tB\u JDN@uȀ:uÉ1e[^_]UWVS}EtNA<:u11] 318uFtuՀ@t&:u:tu:t9uPx@t1[^_]UE ,]USE] u:À|u%u@C8t;EvHt:t @|u1[]UWVS0}!}u_=p(5tUu Wi[^u@5t(5P9YcWP/ D3XZh|9XDžu*Etw3}jjju! Dž1ދ9@Ѐ  ]:3aV;)ډ)ށVSO=ZY.S@^t u[, jh@P E DžhQuƒ ?tuXiJ, 0S?=, 07ȉtrVDžDž\Dž  1 0‰뛋1<# u SZYF ,Džj=h/u&S ƅÊt C<:uCE@PVuUǃ tN}#t u^i>[ tGuC:KDžhDžtB<:u):x:t:G))+9++++Q`:ZYu)=Xt u XÉ >)PSQQ WRVC =Yt ut_)؍P9s(PSp9Y^uS<) Z:Ë(Sz<X1:Dže[^_]UPjujM UEUh(5tP h(5X`(5l(5d(51UWVSDž=`(5uE `(5=h(5u[h$`(503 h(5ZYu?pbP5h(5譢^_tADud(5p(5t=l(5ul(5h(5u@ @uP h(5`(5P`(5@[u 1Xh$P<ڋ ,f\Yf:u#t =d(5t|0\Gd(5B|0\u d(5K1ɍt:uf:\\tAߍP5h(5mZYu*h(5t B @R h(5XD댁NJ|Äu :t@PFjWjM E}Í@ wwCe[^_]UVS]u \u ][^]UWVSj=u ue ojd-1^EduO% $Mu5])CdPV5ZYuV9[4uEdEx}:^uS:{{\S:JЀw1GOT9t`0vT{T JA~DJw:$ M%   :E)x}tPV4XYEe[^_]UWVSVj=u u jd/[ÿdu $ =:ӿdŠBt/:t*F Ou)؉Ǎ@dPS/4XYuSb7Y')؍POtUPS4XZɋUtЋEЍe[^_]UWVSj#u u ƒth :0uB ZY1e[^_]U=45t(hh/5h35111 t35 ]u1UVSu]=45t&uu V111s u¸u31e[^]Ut E35]UjX3545tUP 45XUWVSu ]¸t9uuVM1ǃ =35uu 31e[^_]UPEPhh/5h35uƒ1uEUWVSu ]¸t9uuV1ɋU7ǃ =35u u 31e[^_]UPEPhh/5h35uƒ1uEÍP Љ Љ ‰ ‰ @UWVSQBJ Mؙ#8"߉1I wEZ[^_]UWVS$EыpB1xƉ)O1؉EUE;Ew֡45EԡP45E=vEiEЉMMԍA1X]Ɖ)M1E]؉E܉]܍9w9Mr#}v k=9vEE܉E}땋E؋MA yEAEAE؃$[^_]UWVSPU} u]RU $URjW $WjV $Vj$S ZE] Ee[^_]UWVSÉU@xt t71 AIȋUBEڋEPU1Ɖt T@MI9vGtt<1 AIϋUz}ڋ}WU1tC@1҉ZY[^_]UVS@ÉjjjQjRPŎ u1P9tLtHVP* ZY@u j@]S0h h!Sh]%P$,1=#45t. e[^]UWVSSÃ=D45tZ1t `45<!jlơ`45!d45)Y9sRUvlD45Z9Uu58454451@uu(45!1ɉ1t845أ4451e[^_]USX?8459445r845É845 -t1[]ËPt ЋuËPt9t‹@t;PtÉÀ= 45UVSh2"h2"h2"h]%$,h2"h!h";!h^%$,$, !=!45uY !d%="45u8&!=#45u!QRPh^%Ӌ5$,]%=45u$M$=45u6e#8C!=45uz!Y&=45u]%SQRP֋$,U㡔45h2"h!Ph)^%Ӌ$, U(45h2"h!Ph0^%Ӌ$,Uh2"h!Ph=^%Ӌ$, Ul45h2"h!PhL^%Ӌ$,Up45th2"h!Ph[^%Ӌ$, Ud45Lh2"h2"Phl^%Ӌ$,U(,'h2"h #Phy^%Ӄ h2"h2"h2"h~^%$,e[^]á045u d045UWVSQƉӡ`45! 45)Ɖ| })ߍ41Ƀ9t ^NAt!\ @0,3,,%H,, 45I9@,,4545454545454545ƅ< h!Qh^%P$,eF 8= 45t hb Y0,9,,},,Ɗ ,,5p45 45 45z=455|45545+ ,,I x45l45Ph45tPt45 (,d45P`45 \45‰X45< T45#=45tBT45T45)УP45=45t4DžDžDžj Ph2 k L45jcH45D45@45<45104545Zv45(45 45~.9s(45d45=(459v-(45#t!9v(45=(45u (45$45(45£,45u.(45 11,458t451ۉ؍e[^_]À=45u1UVS$45,454e41945v-$45,45<uO$45@15(45$45Cˋu,45[^]etuxUWVSË11Ʌt9s8xx݉JBB t FuDQ?;x ,H19qt)~ u#F @ A ʋBu9Pu+2ptFprt ;uVP@ A p1tNqpt ;uFH{t ~ e09u/VtBPVt ;u2r3Fp‰@ A A0qtNqpt ;uFA@ [^_]UWVS EӋRUuEP@u~ }tBtu;0u P}u;^u}Kt;u}9uq}u7 }yKtyt3Iu(‹C{ }tBt ;u Pu}@t z )u99Pz u> B @ HtAHJt ;u QuPP ɋZty ut{ u B t{ uCtA B YtSZYt ;u K}QJPH J @ RtB P HtAHJt ;u Quy u>A @ QtBPQt ;u J}AHt{ ugQtz uA H‰et{ u=B A YtKYZt ; u Su QP Q @ tB JtAHJt ;u Q}BPEu A [^_]UWVSË11Ʌt)x9zr9r xӉJ BBBt FuQEQ@Kuq Ktq t5I u*‹C sutB t;XuP P}}\t zE}92H9PzuBJB@HtA H J t;AuQ Q}BP PJɋZtyut{u B t{uFtABYZtS Z Y t;SuK KuQJ PHJ@RtBPJHtA H J t;AuQ Q}B yuBA@QPtB P Q t;BuJ JuAH HYt{ulQtzuAH ‰St{uBBAZYtK Y Z t;KuS S}JQ HPQ@QtBPJHtA H J t;AuQ QuBP Eu A [^_]UWVS EӋRUuEP@u~ }tBtu;0u P}u;^u}Kt;u}9uq}u7 }yKtyt3Iu(‹C{ }tBt ;u Pu}@t z )u99Pz u> B @ HtAHJt ;u QuPP ɋZty ut{ u B t{ uCtA B YtSZYt ;u K}QJPH J @ RtB P HtAHJt ;u Quy u>A @ QtBPQt ;u J}AHt{ ugQtz uA H‰et{ u=B A YtKYZt ; u Su QP Q @ tB JtAHJt ;u Q}BPEu A [^_]UWVSË11Ʌt#x9zs8xxىJBB t FuDQ?;x ,H19qt)~ u#F @ A ʋBu9Pu+2ptFprt ;uVP@ A p1tNqpt ;uFH{t ~ e09u/VtBPVt ;u2r3Fp‰@ A A0qtNqpt ;uFA@ [^_]UWVSDÉ9H459@45jS @45Z9u739u0PR_;@45u;D45)D45@45jVS 19&…;B d45JM<45MVSs ZY@u:x j@}W0脢 h!Wh]%P$,=#45t 95d45u'…tXd45B<45e[^_]1e[^_]UWVS EЉʋ`45!Ë 45)){ MA$L>D=!45tMjRP M95T45sxu@)lj| <ˍ>;X45NsP|$u<Ӊ<ËC9v&MEډEMˉSڋE9svs{uF=!45uE@ t d45EX d45؍e[^_]e[^_]UWVSÉ։ʋ} 19t yA@ 45[^_]¡L45tH9JsuË@UWVSá`45!9t; 45)z}؋|u 9t )D@}؋]E@[^_]UWVS$E؋`45ӋE!؊ "45M9EN0uЋ 45])ÉWtu9])ËsF€}t Z}؉E)+FIu*w N%w)N%wtN%1;SsS |C@C;Fu ;u Ht FN UH9t9vztF}Fڃ$[^_]}t Z}؉ыU؋EЃ$[^_]E؉EEɸL45f}t KZ{SC 045045$[^_]UWVSS9d45t d459vzc<451tHNj_0E<45045=0459H45v1ɉÅux}u9@45va \451uÅuP=D45@u1jMNj`45!‰)Y9tPMD45Z9uō3@45t=<451tO9s?9u@84G9r8 39s1KE<45 045=045}u릉؍e[^_]UWVSÉU45EЊMES1t}9ztJrs‰Љtt¡X45EB}}1;Es9x |u(9Mw M49s;Es E9BvBCUEUrEes t C Jd45ƅt]@X45T45)NF D DC 45T45ƋUL[^_]UWVSlj94559t45vE1 @U459p45r h45!M 0,ED'~E ,,1 @|45Dkt$tytȉMËMIF1ۅtËt Fo[V Åu pFE SFƒt )у}TCCKÅu17 45!MʉXܰ="45u =45t 1ߋMZY[^_]UWVSQ`45!u1WyEtƅUu045045,BZL45="45u =45t1Z[^_]US9P45ro[][]dUVS uuu=45uÅu6=45t i h2"h2"h_%P$, + 1ۀ=45t Eu]j EPh2 貺 ؍e[^]UWVS0] 8Cuw2E=45̘ h2"h2"hE_%Et!9\459v 9w;5P45w=`45!E!ȉE9E؉EE;]wE)ЉE؋E9P45Eԋ 45EE܋U؋EE`45!s 45!u&)9ut }܉| FE܋]+]Sf)]]})EЃEE9Et]܋EЉX]̉XE])SUЋE]+]ZދUt}܋ 45VEaX="45u=451}M=d459wEE`45u!;]w )2E)U:DžEnEu045=045yK#MuU)&)ʉM؉U܋EBUUU)ڋMt E$EGwL45k="45t }F1=45u}u5E =45t*- h2"h2"h~_%P$,^ Eu01ۀ=45t&EEEEEj EPh2 s ؍e[^_]UWVS }] u=45utttj ةt19uU;5P45w#Åu(2Åt%="45u9H45wJ9@45vB1߉81=45t  h2"h2"h_%P$,P 1ۀ=45t Eu]j EPh2 h ؍e[^_]UWVS } u!=45t1ۃ}E }~EEءP459E t459U s=9UE m1 AEU1 @9Mp459E w-9Ur@9Ew;h45Ӌ 0,U !E!99Ev45U !9EtU Å="45tE9E rKE9E =45X`459Ev^E ؋u؍1ЅuM="45t9u s+M UU Z%=45E9E M )U1jE!9EE9H45w 9@45u !EEE/‰EԸL45\45PVj]!WuÃUu L45YrBL45="45tE9E s+u U ڰZ$=45E9E M )1zE Åt9`45EuE؉ߋu9E s M ߋuMETAt)=45t0 h2"h2"h_%P$,& E Åt 1]=45t"EE܋E E]j EPh2 ' ؍e[^_]US ]=45t$]EEj EPh2  t ؋]]UE]ø@,ø@,UU,fDP]UU,fDP]UU,fDP%]UU,fDP]UU,fDP]UU,fDP]UU,fDP]UU,fDP%]UU,fDP ]UU,fDP@]UU,fDP%]UU,fDP%]USM] 1tt1;[]UEU ]UEU ]UE]UE]UE]UE]UU1;E t <t@]1UWVSuE 81ujPVZt C9]s؍e[^_]USUE 1 t @B9Es[]ڡ,UEE]{$UVSME ًpVPy;P| uE ][^]r0 [^]pUS4݀O%uR ZYuC u1]UE H w ńO%]1]UU1t <t@]UUM 1t't!@,1t ft@]UEt,fDBf%f]UEtt ;U t1]UWVEu U ^_]UU,DP]UU,DP]UVS]t2";t$2"Z 0PVSh-`%h0,e[^]UU 1}w,t:t1]U"}3t2"]US1ɋE]  Xw Zw 8u tA18H[]UUK`%9&v,]UU``%9@Z&v,]øUS] uSh0,O h!StR 0Ph$#h0,h0,j !XZE0,]ֻ UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UEuE ]USPEtPt +wu PEPà uE 1]UWVSQpu5,11ҋ;Ms$9D~tk y8 T CՁ~xu@ u45@45Z[^_]UWVSQUB$X011`xwG0w(XtVWh.t0tww HupW9}1M‰&tY3`txu*uσ@t39}NjEZ[^_]UQEEUEEPEPjÃxuUSӉʋ@ щ[]ÃxuP45@45UWVSSMxuRÉ֋@9Cr4P C< e[^_]UWVS É։E!ЈECEEEt URSXZS9sYKu{tt/t$H9wEPSS|EEр8\u!x|u(8|u!u9H9v9u@9ut URSZY{ u"E9Cu{uC45C45{t CuE׋SE}t9v(H9v!8\ux|u 9v 8|u@Ẽ}}u }t9wI{tm}u$Eܹ)KPxE܉EEXK+MKAEU)щCE1ɺER}~!UK)щK+Me[^_]UWVSSlj1=,H9}?MjB,@Pr( Mu e[^_]7C(S,z{,f P{<t[F,01=,H9} ,29}e[^_]UWVSË0@E;Es'H9Mw f8f9ux]u)E,FuVQM t uMQ Z;EufG}uf )1e[^_]UVSË@9r{uC45C45KP9s-9v)8[u$x.u. ‹K9r !f3p9v8.u x]u{uC45C45[^]èu'B ,fAf'f` ЃðUWVSË@E)tT։ʋC<9s,MjWs Uu  C{{C 4SEe[^_]UWVSWÉ։ϋEEK{~1U~҃ЃK$\%sOA)Vx u 1ɺjh}`%V! u1ɺiS j@B@Pr  u ؍e[^_]fS B JqrȉE1}C @t E@<S9s8^u @E@89]u @]-@-U>]Wp-u90-[9H:9<]<-3K,9)LC9@S9R{uC45C45S93=@{uC45C45O{uC45C45D8DzK@9U׉DR}^f.E11=,H9}"uQMpZYMt UGjE@$E@PEp  u }G W$JO$f4P{uC45C45H98:x]9w{uC45C45<]t<-u{uC45C45=ȋUC9r{uC45C45S9sH9v8=ux]u {CK9ȉurM8-uP9vx]tx-t  -f9tÃ=,f9~+{uC 45C459}-UG1=,Hf9}3f9*jE@4E@PEp0 u MA0Q4f8fpBQ4E~{uC 45C451Er UGu ox]u3-U;Cr{uC P8]u 45C45{Ex8tC @tEH1=,HfE19}#u4у9tfEfUBf}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉zC P U܋pEp(Ep0Ep 1}U܍D2 9Eu'C HC M+H 0؍e[^_]@e[^_]UVS(P BteVҋ,ftQÀt, t?,ff9t00XUՉMfE]U׉PEEЉ0X([^]É([^]UWVS ]CEB2\u?;Cr{uC45C45PƁ)/[*.th(>.90D<1ɺi {C @t.U{EECE^ ]U{1ɺ(~1ɺpwS B@xz@ wML(hES9s#H9v 8\ux)t)\W wCDLpS9sH9v8\ux)u {uC45C45xЉ}<t1M8OdBM@p KC @DbE xt{uC 45C451{PsCxU|Ut K9cUP}*u]CH+MuHK+MPCH+MuX^K+M`[^9}\x{F{9sO:,uJr39v<r,Drt+M M9~{uC 45C45PUSY9s$H9v8\ux}u1LH9w 9w 8\ux}u{uC 45C45 o붃$e[^_]UWVS]H {?SB< $]%^[v\y{|;Kr{uC45C45S B@pr@ w|(h;Cs8)t~) wCDLp;Cr{uCP18)uA45C45 -11ɺ/C H @$1ɺ C H @(뽺 믉MC pt&sEECE^ ]M s1ɺ(c;Kr{uC45C45Pu1ɺ1ɺ]CxUtUsCE9jHրvL<{t SUUw&@@EjP |EZYuS<[ ]lpDžtEEU1DžxEEeEtEE?EEEE EMEC ChCC C$C(C,C0C4C8C<C@CD1ɺlEHCEt\p9lr'tu DžtDžl45Džp45l;ps.Pll]ٹl1ɺllEPSCjP|C u l!|CtXC0C\11Džh1\d\`%=0ywC=Fw=9=w= =(9\=ppw/=Xw=H=`=hD =w =xtY=w`= H{u \hFd8‹\d`%dd`%=`txt K  =u;sZۡ,uࡨ, Y[^]Z[^]UWVSljM֋E9E SEHE%=wG=(w== =ti]=0=`=w=*=ts===>9uu14fFf9;9utF\9utF]C ЉN9wuG 9wuG9wu G 9w s9wv~ 9wts> jE@D9wvZ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w_,DJu _F9wu G9w ,NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN,DJu/_t*ED%EEu1]C]u؉E9u`@E]%=Xuruuu uMOuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}dnM)M9\uG PV D@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ `SUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUMLc% e[^_]UWVSEUME ǾM]EM9ME@EEM %=pz=8iwL= 3w$==Lf=|=(4=05#=Xw =H=P<=@=`=h=wE=w=xA=D==fzk=tlw=t#=t1s=hfwWf98f=|MEsf7E]fyNf <f%fUB ȋU?E!! ؉ʁU! ˅UJ+UUM{! É!2tiEȋUt %܉!A5! ÁEȋU%=t! ! ED؃[^_]UWVS0ljUMȋEEEEӋG(E܋G0EԸMjPh{PM U}tEfEu9w t9wuGt u^f]uԉù}t]܉]Eu9wt6fuE fEE;Eu }tuuf} uRփuf}uGur$u~ E1f} uBu$YE1f}DG:f~u|}J(M1f}u1GuEf}u GuE}t!ˉMVPuPM UqMuf~t)f}U ,DQu9f}_t2f}tU ,DQuf}_uzf}t>,MDJuf}_u&f}tf}tMDJu f}_tyfwVPSPM U,f}t:f}tLMDJf}_ ]DZf}_ 8uF,MDJuf}_f}u*MDJuf}_tVPhwPM U%ŠM t }uF]]M9Mt2;Et-VuURPM UUUfufuP}tPEGEt?E@E6f}s1f}f} 1$Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWU+ju uM‰9EtNGjuWU RuWUljuWUju uM‰9EtNGEEjuWU tMM9tEuWMUY_juWUUEju uM‰>9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVSljM֋E9E NEHE%=wC=(w== =teY=0t=`=w=)=tr====9uu13Ff9;9utF\9utF]C Љ9wuG 9wuG9wu G 9w s9wv~ 9wtt> kE@D9wvZ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w`,DJu _G9wu G9w -NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN,DJu/_t*ED%EEu1]C]u؉E9ua@E]%=Xuruuu uMTuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}doM)M9]uG PV+ E@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ aSUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUMLc% e[^_]UWVSEUM܋}uE fEӉE؋M9ME@EME%=p=8wN= Bw&==fEf=|*=(F=0H_=XKw =H=PL=@=`=h=wF=w=x^=f==f}zw=txw=t(=t8=f}wdMf9M?fEf=|~E}fEfffEefEff}yJSfEff6?')f}'f}EMA UE%E)E ȉ‹EUJ+UU LE%tEtzMMсt ڍDM C LE%EMȋMI tE؊DEC [^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉fEE9C t9CuCt E@fEEE9CtffEE fEE}t!puRU UuEEf} u@Euf}uCu p$~11f} u@u11f}Cf~u|}p(Ef}uECuFEf}u CuMFt#ljEuRuRM UƒNuf~t)f}E ,DAu9f}_t2f}tE ,DAuf}_uzf}t=,MDHuf}_u&f}tf}tMDHu f}_tyfwuRPRM U[ƒ,f}tBf}tTMDHf}_ uDpf}_Ɖ 8uJ,MDHuf}_f}u.MDHu#f}_tuRhwRM Uƒu ր>t}EEHQMuRU' U9UtYtU}̋U֋M}HtuuuREPűM UD‹uufEfE}tVECE>tDE@E;f} @f}Ef} 01Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWUju uM‰9EtNGjuWU RuWUljuWU]ju uM‰G9EtNGEEjuWU! tMM9tEuWMUY_juWUEju uM‰9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹ƒ}t H}܉fEE9C t9CuCt E@fEEE9CtfEE fEE}t!puRU UuEEf} u@Euf}uCu p$~11f} u@u11f}Cf~u|}p(Ef}uECuFEf}u CuMFt#ljEuRuRM U0ƒNuf~t)f}E ,DAu9f}_t2f}tE ,DAuf}_uzf}t=,MDHuf}_u&f}tf}tMDHu f}_tyfwuRPRM Ulƒ,f}tBf}tTMDHf}_ uDpf}_Ɖ 8uJ,MDHuf}_f}u.MDHu#f}_tuRhwRM Uƒu ր>t}EEHQMuRU8 U9UtYtU}̋U֋M}HtuuuREPűM UU‹uufEfE}tVECE>tDE@E;f} @f}Ef} 01Ee[^_]UWVSÉM}U;} @EE܋E4Xt}xtHu1%E#EMt %E݋E@EXw30tqwtg(t_ MHpMx h{E+C WEMjuWUju uM‰9EtNGjuWU RuWUljuWU^ju uM‰H9EtNGEEjuWU" tMM9tEuWMUY_juWUEju uM‰9EtMIˍGE@u܋0%tjVuMU 9Et+VFE@4֋%=uNVuMUbXZEE {E+C GW u}DEe[^_]UWVSljM֋E9E NEHE%=wC=(w== =teY=0t=`=w=)=tr====9uu13Ff9;9utF\9utF]C Љ9wuG 9wuG9wu G 9w s9wv~ 9wtt> kE@D9wvZ,E‹]fDCÀ_t f^9wu G9w s'NMEDHu}_tz u E@_f ,9wuDQu _.FfDA9wu_t f _f DA_ 89w`,DJu _G9wu G9w -NDJ_9wu Gt6< u ]CuЋ ,DQ<_9wN,DJu/_t*ED%EEu1]C]u؉E9ua@E]%=Xuruuu uMTuL]E=Pu^GM90tL0uuu E)PMt" =HuEG]4M=8GPx u )MuMA}doM)M9]uG PV E@EME9uuEE=pucG؋PH UM+W PP uuu uMƃGUMTL =xuuE\uuSuM@ aSUT\%=uK=huYG؋HUM+W Puuu uMƃu'GUMLc% e[^_]UWVSdEUE8e p >E F E ЃEF@EFEF=,-tEt}E EE GEu o ZE EE E}9}l ~,N4tMF8EtCF <$z& Ĥ[^_]Ëpo uՋduq`lh p@ pE $& Ĥ[^_]D$tD$<$S> D$@D$<$9> `4D$tD$<$> D$AD$<$= \D$@D$t<$= \D$tD$<$= aUWVS HM t E Ut EEErEEE썃@E䍃WEED$E$^tTUtހnt1҃aw4ɋxxo@N [^_]ùƋ}O7EtEE TE IAEt EE  E ADVUtEE E uGEtE} |E qU܍@L$$: U܅uu tE M5E *~uB_Et EE E H 3령<`AtD_Mt EU 3E %Ƌ}@t_0utEM E E t E EE E tE EiE ^} t E uCE 5E tE }E U tE EE E t E EE LT gfffffUWVS ؽ CME} D8Exw@X$| /ĸ [^_]ÉMD$ED$<$q EDžDžDžDžjDžMDžDžDžuu ωƍOWt#%3F9wۉωƍOWu݉+E;U ĸ [^_]ËE@fEEDžDžMD$ D$D$D$ |$D$E$ψ DžDžDžDžDžMME@fE@ff}WT$D$ *D$D$<$&t$ wD$D$ 4$EDžDžDžMEx@EP Ɖ( Љ s Dž ME$yD$D$<$n D$:<$U DEED$ED$$0ƃ}ĉ|$UT$E$B ƃtdE$1B ƃt'D$ED$$/1Ƀىxk UD$|$E$aB Wk UMk 8D$ED$$e/+k 8t[^_]k UWVSP z á2Dž/devDž/XtyfDžXXƅD$`$0t-ƍD$D$FtH4$] 4$0D$D$ D$D$Z3$I@DžPpl0ƅpD$D$$%/ƃƅtXL$D$$R3uT$$V3te4$/lCJi P [^_]-i 8u+wً$0uD$D$$=.b‹/M1M utD$E$iMt#ED$D$$sEt&ED$D$gt$[ 1P [^_]1P [^_]\WDžUVS胩 ê/ED$ED$ E D$ED$E$ƃt# ƃttEUE$-[^]ËE$-E$3[^]UVS / ;` D$D$$V tB` $藩 ǃ` $?-ǃƃ` 1 [^]f 0ǃ` $-ǃƃ` tf 0ǃ` $,ǃƃ` wf uUWVS<ԧ -uD$/4$2 D$@4$r+ƃD$T$$+e 4$,Ƅ=D$D$D$D$ D$D$ D$$F ƋtVu~8 us<[^_]À` uRg Ɖt$D$ D$D$4$cl= e ?똍` d vUVSH o,u@ 3D$/4$0 "t$` $:  ` D$D$$S BD$ D$D$$W !Ѓ` D$AD$$j1[^]FRD$D$%@4$(D$t$` $XY  Ɖt$D$ D$D$4$j=4c ?)$htƃ@ Yc 8#t'b 0gb 04$mƃb UE$؉]fffffffUWVS "*E@ E։υEE y ]]U ] ED$D$ $D$rЉMʹ;MM }#UM T$L$ M $D$:Љ9rgMϋE eƉϋMڋMщeʃ}u؃ڋ} } ]YpAhQl [^_]1 [^_]ރEUWVSLĢ (D$T$|$ |$D$$VD$(H*)R)L$L$|$}<$qVteEU +D$T$D$T$ \$(K)R)ƉD$T$)iD$T$ L[^_]øUWVS< (E؉Uȋ,8}TWK@<-R<+VESTWE@Y‹}DG11]a 5 ‰EtvEЙ׃ЃE؉0xE܃Hʋ]DKEܸ9 }STW0)Ӹ9ȸdx<-t8<+E]܃}tmEȉ} <[^_]E<@tq<(u|1Ґ<)u~EAt<(uAu1<[^_]ËEPXEȉ <[^_]TWWEȉ_}ȉR}}܉}}ЃCM̃QЋ}DWu.u ;]rډMދ}Eȉ8Et)¬,U܋Mԍ|DAt;uf}am}a.m.f}pmb}p.m.8E܉$&] 1҃)D$D$E܉$P Ut(t]UЅuЉD$E܉$ Uu؋GW ]؉SG}PE}t%EȉǍEЉD$E܉$i tu⍆nD$E܉$G \D$E܉$" Nuލ EĉǍẺD$E܉$ uދ}܉<$[ T:s D$E܉$ uހ}u<E}DGt.`qD$E܉$d u1ۋE܉ .u}.E}EV}t A}ċẺỦD$E܉$ Uust(}ȋEЉD$E܉$ u޸UWVS 9"Ƌ'<'wwEVN)щȉMEED$$jt_FMȉFD$F$tjt:F]؉F>FDF 1[^_]ÿ'E {UWVSF i!EEEEMM11rEEEUU1EEE}tZustU=qw 9 }uEEU nEyEtU4q{9 nE;ErEEPUXMčAEċEUAQ EtEEYE M)ȋUč‹REUF3 EuuU1 ]]Etqwu<~9ErEE$*kE$kEĤ[^_]EEOME)ЉEM)ىMċzPU@AEċEUAQ }E&MċAQD$ D$<Y $\$щ‹E*FEĉEME)ЉE])ˉ]ċtсqw 9 @9EwEEPUXMčAEċEUAQ EH EĉEP@ I] ApAhQl,MċAQD$ D$E@$@@(ME)ЉEM)ىMċCMĉMYЋAԺx9ڻpQȋY;l9ѺPH<h9иUxB4EEE݉ EEEEU E?EEEutEU9EwEn{EPUXMčAEċEUAQ EUĉURMAt M 1uUT$$"JtFu̿[^_]UWVSws Þt:>t M1uU T$$ItFu̿[^_]UWVSs 7t:>t M1uU T$$TItFu̿[^_]UWVS r E $EE%EEEtUUT$$dEtRt:>t M1uUT$$Ht.FuEEu-E$DE [^_]Ãt׉ U1ku}9t<$/ D$|$4$ EUE먃}tEEEUWVSuq Üu Ex}u 2t)D$4$Gu+UE@ [^_]Ëd t 1[^_]Ét$l&D$$UWVSp E D$E$RH/ D$ED$4$gNjE8tB/ 8"tntxd uOt$ E D$P&D$$щ[^_]. 8"u썇vx뱋d t[^_]Íw녋E D$<&D$$UVSo uF$AF $A4$A[^]UWVSo uE 81҃uU$w9Ef4$NjExD$E$=MA ^EM H0tEED$<$Dž?nED$=<$ HME u D$<$4Eu+E UJ UV tUN}9~t!ȉ1OUN}9~u oSEKEE ed t4}G$<@<$4@EE[^_]El|$l&D$$z <$?E$?EfffffUWVS8m u, D$&D$4$guD$:4$; DžD$8`D$4$/lF$X+ $ 7D$$OD$D$|$ D$D$&4$ $6)D$D$|$ D$D$4$ r|$$Hƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $  $bD$$ |$$ƅOD$E D$ ED$D$$K$xD$E$HPD$$*}$=$=c) 8[^_]À>/uEt$D$<$!t'D$<$pa ) 8E D$t$E$ }8[^_]ËE D$yD$E$ E D$D$D$ ED$D$&$Q EE D$t$E$ }gM( E D$&D$E$ Dž1D$ &D$E D$E$ED$D$ED$ ED$D$E$ x E([]øUS(@g gD$ D$$?D$D$D$D$D$ D$D$D$D$ $E x D$([]øUSf ED$D$ ED$ED$&$x E[]øUSmf ÔE$&UPf {UЬt Ь]Í`Ь]UWVSf A}|$E D$E$W 9v [^_]h$ ?|$ t$'D$$Ь[^_]UWVSe }|$E D$E$K 9v [^_]# ?|$ t$8'D$$Ь[^_]US :e aE$st []ÉE\(T$$ЬEUS d E D$E$t []ÉE\(T$$ЬEUVSd u4$.t[^]ÅtEt$o(T$$ЬEUWVSUd |u} |$4$2t[^_]ÅttE|$ t$p'T$$ЬEUVSc u t$E$2t[^]ÅtEt$(T$$ЬEUWVSc }|$E D$E$ u[^_]É! 0|$ E D$'D$$Ь[^_]UVS2c YuE D$4$q-t[^]ÉEt$(T$$ЬE[^]USb ED$E D$E$PuE(T$$ЬE[]USb ïED$E D$E$uE(T$$ЬE[]UWVS,3b Zu} D$(D$EUD$T$EUD$ T$|$D$4$ щ‹D$(u Љʃ,[^_]ÉT$ L$$L L$(EUD$T$EUD$T$|$ t$'D$$ЬT$ L$$Љʃ,[^_]UWVS,ga Îu} D$(D$EUD$T$EUD$ T$|$D$4$bщ‹D$(u Љʃ,[^_]ÉT$ L$$ L$(EUD$T$EUD$T$|$ t$ (D$$ЬT$ L$$Љʃ,[^_]U` U!w (ፀ]Í]]Í]Íz]Íi]Í]Í]Í]Í]ÍK&]Í]Íh]]ÍC&]Íc]Í ]Í]Í]Í]Í]Í\]Í:&]Í]Í5&]Ív]Í0{]Í]Í]Íb]ÍV]]Íg]Í]Í]Í]Í]ÍG&]ffffUWVS\W_ EЋE0t8x t:t:] EE\[^_]Íx@ uƋEЍME EЍY)Eȃ}U EUD$ T$EȉD$E D$E$]$Ex;E vEEE EEEEEO‰E̅uuEEE<EEEEEG:~=u*V]6ȍx8LO‰E̅ GEGE܀F~bEUM t1҉ME;E_U +E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]"UU]EÉ]PUԍt;u s EEUE@E\[^_]t̋uEE<EE1ҋ]];E++E)Ƌ}EF;E s>;u s7SM]L$ \$EȉD$E )D$$U]!UӋMˉ]At;u s <]1ۋU WUUMM:;u sUM؈ UU  }9E+E)Ƌ}ܺF;E s>;u sBUMKEUD$ T$EȉD$E )D$M $] ]UMEÉ]tUUE<1;u s2}OM׍WO 5EE,׋E;u sD] ]1뺃}<Eԉ}܋]O ;}]11끋E] DE~EЍT)E%UzJ ;f-GEG t1ЉEӉ]EUM t1҉E!ȉEE!ЉEM E;EU+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]UU]EÉ]PUԍt;u s E;u sBUEHEUD$ T$EȉD$E )D$ $M]MMUEƋ]ËMH;u ZEGEd}/;u s ̉ȃ}E;u sHMUEXEUD$ T$EȉD$E )D$]$]:]]MUEƋ]ÅH;u REGm}5;u s Ӊω]EEEEE<E]|ED$ ED$L$ME )D$}<$]wsE;u Mjlj}EtEM]EEE<EU]MԉEA]CS]M9M}+M)΋}F;E s E>E;u sHMUEXEUD$ T$EȉD$E )D$]$]x]]MUEƋ]ÅuLH;u EG}9;u s ӉωM]EEEE<E ]}]E9EM++E)ƋEEEF;E s E>E;u s5ExEUD$ T$EȉD$E )D$<$]^}]ދE؉EU]ԃ;u =EEE;u E=EEE]1 ]1=u8ExE]MԉNjEE9EM+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]$UUEƋ]É]UE;u -=CEEEԃE;u s E=EED$ ED$EȉD$E )D$E$]ƋMM;u sE]E;E]98M+E)Ƌ}EF;E s E>E;u s;EPM]L$ \$EȉD$E )D$$U]UU]ދE؉EU]ԃ;u m#EEE,EEEE,]MԉEE,MEE}%EE}E}EE,E;u vE#EEEE,$EEEhE}EEEE<E<}EbEEEE,EEEEEE,EpEUD$EUD$ T$ED$E D$E$]fffffffUVS O 3uED$ ED$E D$4$tD$ED$4$U[^]UWVS4N UEzljaED$/<$N t8|$ [50E D$ED$4$0t%}̉|$E$ED$|$4$4[^_]UVS s> ÚUB8} t B8[5@:t1 [^]%B81 [^]>D$D$a5@<$AH81 [^]UE@:]UVS = [5t^ ,€,T$XT$$2[5tE$0[5$g $C[5 [^]Í$ u뎍)$E$UWVS0+= RuwLjExEڋNMEE܉MM E,Eԉω4$^ƒ   UUFD$ D$FD$4$JU9Ut{E9uN=?E܅ҋEԋDPEmED$L$4$;.4$4^ƒ6X;} M8Mtt}ED$ FD$FD$4$gdD$ FD$FD$4$FdEP9FU뗋F;EED$FD$4$h-EEXUD$ ED$FD$4$cEH;EUE9FM;} D$ ED$FD$4$cEnT$UFD$4$,U:10[^_]D$ D$FD$4$DcD$ ED$L$4$$cED$FD$4$f,\FD$FD$4$bD$ FD$FD$4$bFD$FD$4$,}tE9} uD$ FD$FD$4$bFD$FD$4$+D$ ED$L$4$JbNAD$ ED$L$4$'bN)UL$MFD$4$^+UM5UD$ L$MFD$4$aUMU D$E D$E$]U 8 D$UT$[5$~]UWVS 8 ̾u}ED$E D$4$*tE} u [^_], [^_]UMU E~tEU M]]UWVS 8 Cu[58E D$ED$<$*tEu } [^_] [^_]U 7 E [5~)tD$ED$$Y]ËEUWVSl7 Ó}EEuED$E D$<$a)t'~#tuEE }[^_]E[^_]UWVS6 $EEu[58E D$ED$<$(t'~#tuEE }[^_]qE[^_]UWVS(6 E}WDU[598GH%EW,OM܋M11ۋM;Orى}}}:R][<}49%yu/}O,} 9+Y<[ω<]fV% EFt$E@|$]fF9uvJVF]9ulÁ;][^ Pf~E9uwtVE@,UʉM+PÍ@‰ЉЍD$ |$E܉D$E$]MEE܋U9B~ R,1}<$]1([^_]ËGcE:U4 [5$]UVSh4 Ï[5p 4$u N8@[^]øUVS,4 Su4$u N8@[^]øUS$3 E UD$ D$D$D$T$T$ D$D$E$$[]US$3 ǹE UD$ D$D$D$T$T$ D$D$E$$[]UWVSB3 i}M uUtA$M U :5tUF$U :5tBU$_U :5,048<@DHLPEtE@$W :5  $(EtE@$&8 :5TX\`dhlptxE tE @$ :5|UUUUUUUUEE$tE$@$  :5U UUUUU U$U(Uċ,EȋE(tE(@$ :5ŰUЋUԋU؋U܋UU䋐U苐U싀EG@t ʋwHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉ`T|t ʉt ʉ\|Mt ʉt ʉXUUt% Щt TE̋G|GlDž|fh}$# E@,@1fB;<‹fbBz t$)uE@,@B tfB\$V PF ;uϋ;42f|2yW}$G,HfD11f|1y.ODfHD$G|$Duİ[^_]Ë$UE@,@|+d|p9ihf+fG9@)fL09@4 ȋf`Hp tv$uEP,@D 9YE@,HfAAxωt$RRO HG ;uϋxt9pe9l<}\h$Vy DžEd$1xy DžxEP$ y DžEԉL$y Dž4$y Dž|+t+p}9Qp9pE@,@Dž4fF9ffF~ t$euE@,@F rfF0X!4N HF ;0$uDž!pdE@,PЉdU/UB,@NjJHOfG93<JDfHD$B|U$[uDž5AAA AAAAA A$FFF FFFFF F$O,B0B4B 8Bu=p9c}|+9yG,@.G,@‹OHJfB;4ЉODfHD$G|$us}[59GAG,HDž-fB94hfb`Br tv$uG,HB pfBXd-\J HB ;0$9u8t9|?O,|f+f}C9@f+fT094PЋPf`\Px t$uEH,@D0 bE@,PfBEb$TW PG 95$u}x!G,HDž-fB9x4dfbXBr tv$duG,HB ixfBE`*LJ HB ;/$u9|_O,|f+f}J9@f+fT094PЋLf`TPx y$uEH,@D0 IE@,PfBEЉI$TԉW PG ;$9u8}D$<$ud1#[59GG800UWVS| Uu}} :5M  M:5 :5  $( Q:5,048<@DHLP ,,}:5TX\`dhlptxE% TT} V:5|UUUUUUUUEE % ||}$€:5M MMMMM M$M(Mċ,UȋU$ UU}(:5]̋]Ћ]ԋ]؋]܋]]䋙]苙]싉MM( M̍M̉L$ T$D$|$t$D$ D$D$E$|[^_]ÍD$E $ksUD$$Hs1D$4$&s,t$<$ s}-T|$E$r} |D$E $r}$UT$E$$r}(EM̉L$E($^ryU$ U$T$ U T$UT$UT$UT$UT$ U T$UT$[5$w]U$b U$T$ U T$UT$UT$UT$UT$ U T$UT$[5$]US 3E[5 ÁtYD`\5tuX\5 %AH[]US UE ÁtZD`\5tuX\5 %BH[]UWVSn Eu] %tFD}`\5t ^HFE~TFEE1E~4F,@M@tVDP ډPf@9uڃ;}uD$4$]\1[^_]X\5 oU ȗUT$[5$]UWVSv ÝUJH΁`\5tρX\5;8t BD [^_]ÁBD [^_]UWVS@ ?]ȋ}E pu@[^_]Ë@$fGDE̋GHEfEGLfEEẺED$G|$]W|UċE @$UE @GDыE @Eăvs}׋U D;utLuU M$]55@MɋU *AxD;uu}$]E %`\5 t GHGLWDUEfEfEEuut$G|$]t$E$rEW~bG,]ċ 1G~D}ϋM9q~0WDtM\$E$]M9qЉσEE9GD$<$]NY@[^_]Ë]C|tыRE @MX\5 U$]@G|UU UT$[5$P]UWVSd Ë}[50Gt6G$&|$4$ D$4$nX1[^_]øUWVS (}u Ft6F$Z&t$<$D$<$X1[^_]øUVS ΓE] PHց3`\56tցX\5;1tFPDSC@|t tL@uS1[^]C1[^]ÁU <UT$[5$H] ǀh UWVS8 u[5E8 ,…2\5E̋2[5E؋2[5EЋ2[5EG [5EG$[5E܋GT[5EȋGX[5EԋG\[5EG`[5Gh[5EGi[5EGjE0Ћ2E̋2E؋2EЋ2EV EV$E܋VTEȋVXEԋV\EV`FhNiEĈVjE4$T!F[51ҋ2‰T$$ӛV [5V[54$4$ 8[^_]\5E[5E[5E[5E[5E[5E[5E[5E[5E[5[5E[5EUWVS ̐}D$4$QƅEdž3E Fdž2dž2dž2dž2dž2h 3ǃh džd2džh2F`dž2dž3F FFFdž3dž3dž3 $3dž34$5t$<$[o|2PJpdž2D$D$D$D$ D$D$4$5FD$D$D$D$ D$D$4$F4$'`4$跌D$D$D$D$ D$D$4$荞F tjD$$Ә4$-#4$x4$4$,FCG[5t 3t4$)4$^@[^_]Ë|2t$]2$f29tDžu拆3$4$1[^_]ËRhD맍$= DžUWVSl Ó}|2t$]2$Ff29tƅu拇2$ <$_3$(3$[598t<$[^_]<$[^_]ffUWVS u +9uǃ, >ǃ0 <ǃ4 ^ǃ8 vǃ@ #ǃ :ǃ 'ǃ #ǃ #ǃ$ #ǃD -ǃ< -ǃL _ǃ` |ǃx oǃ@ -ǃH -ǃd <ǃh >ǃl *ǃp !ǃt f|2E@EuTAtcҐx uEt(VT$¤T$ D$D$E$1 Tl=u[^_]US( OM1Tl =u[]UWVS,  EƍME$+FF(9u݋uD$$8CuxuD$$$3T$$ǃ@ !ǃ, +ǃh !ǃ0 ,ǃ !ǃ4 -ǃ !ǃ8 .ǃ %ǃ@ 0ǃ %ǃ `ǃ %ǃ aǃx ǃ fǃ ǃ gǃ %ǃ hǃ &ǃ$ iǃ %ǃ( jǃ@ %ǃ, kǃh %ǃ0 lǃ %ǃ4 mǃ <%ǃ8 nǃ0 %ǃD qǃ #ǃ< oǃ #ǃL sǃ %ǃP tǃ $%ǃT uǃ 4%ǃX vǃ ,%ǃ\ wǃH %ǃ` xǃ8 ǃx ~ǃ #ǃ@ pǃX #ǃH rǃp d"ǃd yǃ e"ǃh zǃ ǃl {ǃ `"ǃp |ǃ ǃt }E|2E@E Et@u(x<uD>E tAuЃ,[^_]Ëu܋E䋀t+MQT$¤T$ D$D$E$El }Wl}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$>@ $<h $^ $vq $#_ $:M $';x $#) $# $# $-0 $- $_ $|H $o8 $p $rX $yup $zc ${Q $|? $}- ^US( S ]l JHJHJ H JHJHJHJHJ H J$H$((9u[]fUWVS8 E܉U؉M[5E02EE荆4E [5MfEtE$0E$hǃ=EA 4U  4%y  444fǃ EDxfxzMf8@E f>f,4M<%y 4; 4ufǃ EDxfyEE4D$ D$D$$44 49)NjM Mԍ4T$ |$ED$E܉$ƒD4%449 41fǃ P5f18[^_]ÿ)hfE.}؅E$kǃWE@ @OM Mt{/tE@ 4  MfA 947fǃ 8/fT 449}Pdž4υu1N$uF$`| MUtpPuE[^_]Ë}UWVSQ xw¹tI)t1$UE vU:t :t#:u1[^_]ÿ[^_]Z[uJmt݄tރB0tqωvE;tzu봄tVUWVS0 -vUu :u|2tU$EUF@fu|2ML$ MD$T$<$|2M{EPJ(N$JN 3a)$ 5D$D$$RFT)$ D$D$$QFXF N$[5 [5VT[5VX[5|2P3B0zp12džl2E䋺M싊TMtUUdžl2ELɉMEEM܉UtrD$Eԉ$UE܋U؉$Mԉ $E܅tH1IH 1$薿p2džt2EtEdžt2džx2tdžx2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(Ft#U܉|$E$e Uu džl2EU܉D$E$e Uu l2MU܋ED$E$e Ul2EtD$<$[e u džx2EtD$<$:e u x2ED$<$e x2t|$E$d u džt2EtD$E$d u t2E$D$E$d  t2|2@@FXFT,F@ftfL$ D$D$<$i|2EK1"4L$듋E>džp2džt28FXadžp2džt25U= hp[5D$E$]US []Uv oM[5tJX[51]ø]fffUWVSLjMEE_ɉME9tBfx ft0fu9QuԀ}tEAE 9u[^_]ËAM L$M $MUkUUWVS nƉMDPfx 4[^_]Ëf=t|fDVƒ4EftL$<E@f9uǁNF[^_]ËEFF[^_]fLVuMED$<$詶ljUU$ 衱UtZf@f@@ f@@f@@MLMH MM;Eu)$;$ȧ,D$ D$D$)$r $菧*$$uUWVS lƉ׉M$ tDLMt5$LVp9uϋ}E$TF [^_]UWVS 0 [lEu^9t)fxf8u@$9u׋~#1E$]E9߉ $]ѷ4$ɷ [^_]UWVS X9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS 2k}fǃ $@f9uǁ2ǃ ǃ ǃ d*F|2RtK$苢 =w3D$T$$膘 2:;u[^_]Í*$$US jE E[5t+2UT$$UTE []ø []U} iUM ~*[5t2t z1]É1]ø]UWVS 3 Zi[5te3339}}<31 [^_]à D$$躱‹t!3333뱸빋33D$BD$$D 33]\331o%U W hE[5t%2UT$$1ɋUE]ø]U 4hM[5tJT[51]ø]UWVS g}<$ƃuOG @tI4 8u?[53t-[5D$[5$oǀ3[^_]UWVS V }gEU[52E[5EEtE$oE$ ǃ=E5 <%y  fǃ L~fq 1fq fKfLfEMyUU$E$HNjE@ @aimE@ t} <%y  L~f  X yt싓 9Jf y [^_]Ã}fG 9 < 9fǃ  [^_]Ë <%y  ; ?fǃ 1EuEE$NjE@ @UfB  [^_]ËEQ). 9'fǃ [^_]1Ef` [^_]Ë ,D$ D$ D$<*$i $zUWVS cu[5MV8у$Jq33 ,M MEt[5:E F8V<tf11‹Ft[5XE؉D$D$ $Uԋ@t A:|Uԋ}؉|$D$$k|$D$Uԋ@X$I@$Q D$ D$D$@$賎ǀ303@fuT$D$$X؃4[^_] a5@|>ME܉D$D$$dS 9Eǃ [5M듸  D$$gQ ǃ  14[^_]>MtUԋM؉L$D$8$Uԋ@WD$ D$$R ǃ UWVS, CEEEE uԉt$}|$$i?EEEED$|$$0?D$$|@[53tD$t$$>,[^_]% PB[53tZUS 'B[53u33@fuT$$ Z ؃[]øUS 袻 A[53@fuT$D$$萄؃ []USM tA[503@fuT$$cY ؃[] US "Aa5@} tI|t7>T$D$$o[5ǀ3@$M 1 []Ëxt>T$D$$&[5ǀ3@$M 1 []UVS E l@a5@[53tB|t1>T$D$$譽ǀ3@$%M [^]Ëxt>T$D$$kǀ3@$L [^]UWVS 萹 ÷?E[52tt_ [^_]a5@tǂ2>T$D$$μ@$PL [^_]a5@@ttǂ2a5@jǂ2U趸 >[52$]UUE 9B| R,]1]UWVS}U MxZG9}SxO)9E9}5O,EO(G\p;}@ ;~9Uu1[^_]É뷸UWVS}U MxZG9}SxO)9E9}5O,EO(G\p;}@ ;~9Uu1[^_]É뷸USEH~X,19t t[]1UWVS}G~tuE4EEEEE+E$ӆU9UMM)π>t5UE܉D$ |$t$E؉$资Ey8[^_]1EEԋ@t[u׋EԃEMEEEЀ4uŨ8[^_]UEԋ@u})29ǃEԃEtUt$D$ lj$dc E)uUMwMȋ}uԋ6sOtft}})UEQut$D$ }<$c E+u)auuEfUWVS,詯 5EU܅E܅ϋM93}D°,@t DB@u<$tm ?M4MMM}؉E$-Ut7)׀>t.ED$ |$t$E$wEyĸ,[^_]Ë})t$<$…t܋E܍HD@u4]Xʉ1,[^_]ø1USh Ï4Ew"ج}D$$1[]øUS% L4[5t3tUT$$[]øUS 4[5t&3tU T$UT$$k []øUS薭 ý3[5t3tUT$$[]øUS R y3[5t&3tU T$UT$$ []øUS .3[5t3tUT$$[]øUSì 2U [5t*3t ML$ T$UT$$[]øUVSo Ö2[50toƆ43u'3tU$z3$y[^]Ë|2Ppt%T$$%D$|2$[^]øUS ۫ 2U[5t$3tD$T$$ []øU莫 1U[5t~;3TR4]1]USQ x1[5t3t$T[]øUS ;1[5t"3t$St W[]øUWVS ˪ 0[50Ɔ43uj33~BE14uJuE;3|Ճ}tO3$'w [^_]Ë|2Ptt&T$$8D$|2$ [^_]øU 0U[5MMM ]USƩ /[5t3t$A[]øUWVS 臩 î/[50E E4ED$ D$MML$$}tiP$U#sDžtUU UED$ UT$ML$<$Y}t&E$U6Ɖ<${ [^_]þUS迨 .Et3t$zQ[]øUWVS腨 ì.}3t$q3~#1v4$ez;3|ߋ4$Lzج3ǃجLJ3D$0$u4th|2PtD@@X~:Ƈ3}$-|2@PX3@$31[^_]Ƈ31[^_]øUWVSb É-}3t$N3~#1v4$By93ߋ4$)y[^_]UWVS]3e3WE Q3433U U׉UU+UUVU11]]9t0p9uu9u]1]39114uu;3|ى[^_]@,3WP\4u u )׉<)} t7։L|A1[^_]ǃ3UVSO v+utNFX3|2@@T%D$4$ E D$FX$1[^]øUWVS ߤ +EExD$D$<$Nzƅt.)‹M tMMtyu' [^_]ËE tsEt_utXEM`\5 u/1MfT$|$E $yE 01 [^_]f%ʸ [^_]øtUWVS *u EE}4$xEw`}E(1M19rEtfEtЪE1[^_]Ë$xHu } 9uuE$xt؉EPE 15EE1 ;ErEtfEtȪE%M`\5 tMft ȋMEMH]1  9rEPE 1u\EE1 ;ErEtfEtȪE MEB[^_]ÉЪE'Bfm뚉fm7fmȪEȪEZEEEPUVS| ã'EU tt%B B[^]4:5XZXZX Z XZXZXZXZX Z @$B$ [^]UWVS 'utv4$'rVȉ‹9u F0$rF,$r[59pt]9p tJ9pt2t$%P$r4$r1[^_]@u@ 9pu@9p uUF4$>r>9UtU?$9Uu~X24H90t…#ȋH90utJ$q2UWVS譟 %lj֋@X|2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$|UtB8tt<$bu 1[^_]ËGX|2W@W@@@8t ։w@и[^_]UWVSÝ #lj֋@X|2@Ttg@ tg@tg@@tg@tg@tg@tg@tg@ tg@@tg@tg@u<u@uH%ta5@@8t g@1[^_]Ãg@t<$-t<$6뮸[^_]US耜 "MU [5t*t X@t@@f%f1[]1[]ø[]U/ Z"U[5M u][]U ."U[5M u]]UVS՛ "] [50Eu/ځ] ډ1[^]ø[^]US} !U[5t-HX|2H@H@[[8t ʉP@1[]U/ Z![5U]bU  eutFFX|2@Ttf@4$4$a5@@8tf@U &1[^]Ϙ a5PT%t t t@t̀t(t t8t ttLt 1 :a5PT%t t t@t̀tt4tt t@t@t(t t8t ttLt 1봐UVS #u4$"U D$t$[5$ [^]UVS 迖 u 4$T D$t$E$ [^]UWVS 膖 íuU [58x1u 9t <u‰T$t$<$w [^_]É4$lT UWVS % L}[50E D$ED$4$t<$(T D$|$4$ [^_]UWVS ˕ u}ED$E D$4$Ƈt<$S D$|$4$ [^_]UWVSv Ý}u[5E D$ED$$Uft/Ux0u 9t<uƉt$|$$G [^_]ÉU<$9S ƋUt$|$$ UWVS ݔ u}ED$E D$E$Նt1x5u 9t <fulj|$t$E$ [^_]É4$R UVS c Êu Ux2u 9t<u‰T$t$E$Z [^]É4$PR fffffffUWVSD "}E0uċEG,@4E@U }4 ?E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$BuD[^_]à E1D[^_]É$hFE@E1҅t4}$\tMTO HG ;uu֋}E  G(MJ9~R 9}ED$ D$ED$<$.RE@f=$gGE tPM E;GTMW,M M Mč@44MEEFEȅVE@$LgEyEGM+;EE W(M@9~F t$bF E@ffW@EE ЉE% GH% ȉFEfFE@Eȃv?}$[MLO HG ;uu҉}NEčPEE~f}ωƋEW tEMȉ$aG EMȋURQWWfWfwu}G9MwT91PO(LE @ 9}GPT$ EĉD$ED$<$EEGT9tBMW,M P GG(<$1D[^_]ËE;GT*G8 r<$<$ EE 1D[^_]ËMčQMĉy19Nu)MAHFALfFuEy19E0A,4v4ADfFt$A|M$N_uEOT9tE  EEG(B9G;EM+GHFGLfFfFMPG9MGDt$G|$^u6t GH ${MMċu6W,4R49EJMȋGDfFt$G|$[^GHFGLfFMȍA9G~ f~xW(ʋE @ 9}L$ EĉD$ED$<$oEEG8 .E MG19)ȃEG8 ([58u E<$GG8 <$jEEċuϋE UW(@9*#M O(LR 9 } GD$ EĉD$ED$<$EEGT9tBMW,pM E<$EG8 5<$uUWVSY 8uE0E,EP@,Dt@ 1Dž<H4pHTDžPELED$LD$,D$ 0D$DD$E$<] )~_@D$ t$E D$4$8^ÉDž[E H @1?<[^_]U ,D$D$ U T$UT$[5$d]UD$D$ ED$E D$E$1]UWVS荊 ôu}U } v}} utFXHX?)щMEVT9EK1ܬ 9}5D$D$ D$\$4$u˸E N@U ʁE% ЉEE$_V(E EH9~EH 9}NDȋUR t} tE fdVHMu5 UPFP9t:4$^1[^_]É%W ʉPFP9uƋEÃ} 1[^_]É4$ E  E;FTt,UV,U } 봋x1F8 4$EF8 .E vFU9)EUWVS+ RuEE}ED$E D$4$ zt&EE}EE u[^_]j[^_]UD$ED$ ED$E D$E$/]UVS茇 ó [50E D$ED$4$yt&D$D$ ED$ED$4$[^]- X [5a5@8tt J@Ëu߆   a5Rt[5`@U訆  Ua5@8ttJ@]Ëu]Uj … E a5Rt`@]) T [5PX|2R(tt H@Ëuڅ  [5@@UEPX|2R(ttH@]Ëu]UE@@]UWVS] Ä Ɖ׉$E4$ED$FPD$4$Cw߉|$4$#ED$ML$4$w[5;0t 1[^_]$ Gu[58uFUE@8 t ]L]U贄 E[5 A8 tu]ɉ]]US聄 EU [5 x;Q})Å~ APQT1[]øUME A8 tu]ɉ]]USME Ux9Q~)Å~ APQT1[]øۃ  a5@t 1譃  a5@t 1UWVS,z á ƉE`\58}t[590FHE%Eu~}FP 9IE@)u9~U܃E؋E؉+U9EU}CIE@RωփtftE@EmEm;E|4}G,U4"E!umEm;E}̋}E܍D8E9}WEE1҉fF;yA,U4v4ADEFFfFt$A|M$1RMu,[^_]ËFTE9E؃)E9UX8ϋAmU9"9}|,u؋}GD$ D$t$<$;w}ڋE@t$^E$j1,[^_]9|E@T9E@E)9U)‰U9~xE:RE@I׉΃tftEEE;Et4}G,U4"E!uEEE;Eű}9}uFEE1 ;wG,U IODUPHfHf@D$G|$@Pu E)9EE9EB}w9uRGD$ D$t$<$29uu'E%ffa BU :Ut[5]q1]UEU t]Z1]UWVSE89tX@EO+Mw~>EP,G(UW,u4}y߉:O9u}?9}u[^_]UEtPt@+B]ø]UEtPt@ +B ]ø]UE@]UE@]UE@]UE@ ]UE@]UE@]UWVS$} }GDE[598GH%EGEw, UukOM PG44u4 9uw{fF9uvjffEF% EFt$G|$vMuƃ$[^_]ËW;U~iUEEGGD1EoGD$ ED$ED$<$<$1$[^_]E1$[^_]U| [5$]US| ¨E] @ /t+t"` A@ d 1[]1[]øUWVS]} K(1~&1 ~փ9tT,y)փ9u[^_]UWVS0{ E,E[5E@ ` E1[5EED$D$D$D$ D$T$UE$t!UB UUB(ɋU~CUMT$$Vt=9@ ~#tyڅlE)e)Uǃ@ 10[^_]UWVSz uF$EF(E~r19~(~fD,tN L$y؉D$D0$KuED,yD$ED$D0$ tT,U9~(E[^_]E{UWVS&z M}G(~"1D0$D0$"9w([^_]UWVSy u@ 1~019t% 9d uDŽ` 9uۉ[^_]ffffffUWVS {y âƉ׉UM$J~ }VF +B F(EEFFUVUVFT4$E ENF,UExF~c1fGM9N~EMGfGFD$LG |$F|$Hu [^_]ËExED$<$JUBEE9FbVn1 [^_]ËEED$F,$GtF,U)D$F0$FnF0VN +J N( MN,~+zR,9W O^F9~ HOF؍ 9f~dUEO$G ^V 9~ ЃG ^ ڍ9$~"U?9u1 1ɉ)1)UWVS1v \E],CKPp9~ NKP֋U 9U }u S xH 9~ QS x E9]}K} E C EC$E[591[^_]1)w1)э<C:}[5[59[59[59K9U 9U u S E[589E9E E)}u E[5] X ]X$1[^_]Ë} Eu 9"E[58;}CU 11)ȍ4#1VC E1/U Us E~M ~[59B$t ]1]ËE 9B ]UWVS s UE [5Ex$9}h[5P H4 9unfH$p <19} JBo[5P H4 9u80H$p <19}  S%D$E$u)[5P H< 9H$p <19} E}x$} x [5}:[5} :2u #vt@:u$cvuE$*؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )9)UWVSq E[5ǁ3~fU ~_;A$tRU T$$D$[5$u/E D$$,$[[^_]ËQ 9U u1[^_]fffffffUWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]øUWVSjp Ñ}M OGXU ;P$UWUU;P Gu )ƉuW u)։uwt]E 9F{M;NsE9F kEE;F`E GEG <$|$4$jD$<$1[^_]ÉFV EFUV 4$69uUUB8} t @B81]Ã࿉B81]UWVS Io tE} O E+H O(w0G~a1҉׋U J(B,4B]+C[,H NX^F BU D$ $]@FU 9z [^_]UWVSEPX|2uH8ˁX8p x;z t[^_]ÁuكH8Hz$P9tC9uՋMQ ztɋQuut duH8 uX8UWVS n 5E׉UM$7ƅǀǀǀE$7EF,D$E$g;ljF0MF4EFXFF]^EF^ F$EFE F F8F[^_]1[^_]ËK K+M щMS+U<2USE] MEP UU PUU[]USE] MEP UU PUU[]cUSEU ME]] ]][]EHD뜋M[5)+E E ÉEE~ZM1$[^_]Ëu$[^_]D$E$] E D$E$ƋUy[5~)EDž}1딋E[5E)ЉNjE EUWVSg ][59D$D$C D$CD$ CD$CD$[5$ƅtD$$[^_]UZg D$D$UT$UT$ U T$UT$[5$B]Ug 5EU ~@~9u?9 G:uGE~G,E111҉}]tË}_+^~, t]C+F^,"щ;U|}EE̋@SPSfPSfPSfHfP$f@fuFD9FLfGfG|$F|$]n/EЋ@E]F:EE̋@VDVLfPSfPD$F|$]/tAEЋ@E]:EfEE fEEfE~SEL[^_]9=$I8@F8EAsAUWVSM^ t@[5#B@Ơa5~tD@Tt5MU>L$D$$aP5!A@U!‹MtD@t5MU>L$D$$WaP5!A@U!‹MtD@t5MU>L$D$$aP5!A@U!‹Mtc@LtTM>T$D$$``@M`\5t-QMT$$[KM`\5uӋP@#Q@tA(t7t.U>D$D$ $>`H@@UtA8t7t.U>D$D$ $_H@@UTt3t)U>L$D$$_H@U t8@t)U>L$D$$p_H@ Ut8@t)U>L$D$$3_H@U@t8@ t)U>L$D$$^H@@Uƀt8@t)U>L$D$$^H@Ut8@t)U>L$D$$|^H@Ut5@4t&U>L$D$$?^H@Ut5@t&U>L$D$$^H@U t5@t&U>L$D$$]H@ U@t5@t&U>L$D$$]H@@Ut5@t&U>L$D$$W]H@UuLt<@t-Lt#>D$D$$]H@[^_]Ë@@tU>L$D$$\H@UzUVS Y .Ơa5Rt @u [^]$5I>D$D$@$Z\ [^]UWVS X ýljօ$[5@ufUGFGfFt$G $(OfNfU~(FɋVPfHf@uUf~NGuHW#d2u `\58tr$IW tu֋$Hvuut1 [^_][5Oxu f~Gtf~GvvÅt$HW u륁T$[5$E$_HW YxUEPT$ PT$P T$P$11]UWVS EM]Uuuu uu y1y1ɉ]yEUyE+U]\+U}T:Uԋx}x)׉}9~]؋X x)߉}܋U9~U܋}9}x5}9}x-uU܉UU؉U] UUU [^_] [^_]UWVS V 1[5H@U7Ǡa5P zt*1`\5tM[^_]~Ǡa5>T$D$@T$YH@ŒP5# H@z>D$D$a5@L$X`@A>T$UD$Ǡa5@$XP5P@#щP@~U8Ǡa5>T$D$@$2XH@„P5# H@$lB[^_]UWVSRT uƉӉM$V,4;]Mu;M t:E D$E D$ ED$L$$,5[^_]èufUWVSS E[5Eԋ3 u[5uZJp XHUE@8@u B8@3 B@ ]>|$D$a5E@@D$VEԋ@@@] D$}<$]Ig8E@xhtXEԋruju^E[58[ N,1119| Eԋr2Epg Eԋru E@| EH,BEEfEE1ۍ= }}䍇 E\\5E`\5E[5E>x[5|E<} 9MM]YH,]u^M I, 9Y|EuFD}]FHDfDED$F|$!uFL}]fD~HEԋu؅~E@,uD0[MA,u0EЋ@0;q#EЋ@ M̅E@9|HM̋Z]MR,M I M܋MЋISBuU]Z[L]ȅU]J]\R zO;uh}Eu GuE܉D$<$] ]ԋHPt$E؉$EM؉HpuEHuȅt]9]Eu092_y1ۋE49|E@EčP;U;UU܉NjMԋJuE܋M9u|:uEgMċE܉D$<$]6MGEԋuM;rtGEM9HrE9M I yB9uEԋEH1xE@EX };G}G(9~E 3tEuBuNxXuN x99fE]]؋rM;YI,^E܉D$<$]*@GƋMԋJuE;u~'}xLuȉG%9Eu)G)ƍ)Dž~ED$<$]tʉuȉ}yEE@@LE9EԋHt E@8!aMuE@8| ;} wEP z@tP WU^]̅_0+ẺED$D$ E؉D$L$Mĉ$]-U܉MD$ȉM܋M)ȉD$ }؉|$EȉD$<$]-E@M܋M؅g ẺD$$]sqx}܉|$D$$OM؉M1҉eNjE@ɋM M܉M܃Eu;pcEԋuFEBFBE0tE]D9GEP;U؉UMMȉ $] EMЉÉ؉؍][ )+E;EUw;_y1ۋE49RU܉R[Đ[^_]ËEMuFuVX@#d2M苅xD$D$Eȉ$]8NEMx ϋEԋxEP,u2 R4UT]DFfFt$D U$o|$D$$@D$D$ D$M܉L$M $|$D$M@@p$?D$D$ ED$D$$@M@mt$$a|$D$$t?EЋ@D$D$u@@0$]`|$D$$3?D$D$ D$D$E$|$D$@@p$>D$E܉D$ ED$D$$Xt ]bD$D$ ED$E܉D$E$]1>U؉|$D$E@$]6>U؃9u1҉U|$D$E@H$]=U9uzD$D$ ED$E܉D$E$]Xt$E@$7_>|$D$$=E)ED$D$ D$D$E$]E@t$$^|$D$$#=D$E܉D$ ED$D$E؉$]0Hr }h D$D$ ED$E܉D$E$]J1>U؉|$D$E@H$]<U؃9u 1E@U|$D$$];<U9u HzHZxpvu;t#t}}O}Ћ;JZLLED$ED$$]#]>|$D$$z;D$D$ D$M܉L$M $|$D$M@@p$1;D$D$ ED$D$$M@ủt$$]m\|$D$$:EЋ@D$D$u@@0$],\|$D$$:D$D$ D$D$EQ}D7ED$D$ D$E܉D$E$]E@t MЋ ;ytẺD$$][>|$D$$9D$D$ ED$D$E؉$]AE@ẺD$$[>T$D$$l9D$E܉D$ ED$D$EDYE>UЉ|$D$E@$]8UЃul pE>|$D$E@$]8u8L EЋ};x E>UЉ|$D$E@L$]K8UЃufD$D$ ED$E܉D$E$]t$E@K)|$D$E@L$]7u"u9u\fuNu5f _f1}䍿 E䋀 E@uЋrt)1upt$$]89}u܋EĉD$E܋@$]2UWVS3 3][519X‰Pt0C:ud11ɋCD$ CD$C D$C$Yu)C9u[5 Q+Sx.SQ+S xSB[^_]ËKxSt1҉S1҉SQ+S yUW2 [5$,]UWVS82 [u] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$t[^_]F9u[5 Y+]^y1ۉ^IM+MNy1ɉN[^_]UVS1 ñut$"vu[^]UWVSW1 ~}GDE[598GH%EEwG,MpGE9r?lMfF UVt$G|$twfF9uv/FVM9utс;MuN uf~xɃEE9GfD$<$zD$D$<$x"1[^_]EU60 a[5$]ffffUUE 9 u9H9Ju1Jf3Hu$R @ tuR@tt9 t1]Å]UWVS/ ܵU} w to1t6~RutF$u1[^_]ÉU$Gt8U F@RuDžtÉv$?uG 멃UEU  HJHfJHfJ@ E]UVS. utv$u[^]UWVS . ȴEP~`EE@,MpE@~1E~ t$suEEU9BփEEM9A [^_]US] t.UӋE ȉt %1ȃ9u[]ËE[]UWVS]E 111 ȉt %1ȃu1Lȉt %1ȃuڋK t.1<ǁt %1uۋIu҃9u m[^_]1[^_]US'- NE@ t$D$ $ox)D 1[]É$M1[]øUWVS4, U@ D T E苃P Ea5EHApEЅ[5EE싳L tbyFEԉЉUy E܋EE9u9}yU)E܉+EE%9uu})}9mx}ԉE܋H U)y+}Uԋ}94}ԅ}ЅH[5}}܍|9,~ EԅLD$D$EЉ$ /ǃT E̋P EEEH1ҋL }u[5E8P ;H )EԋA}܃;}9P E;H BW[5EEU苳L }d%Ey EyFEE[5E8=\5-)EԋA?P E;H E܃9E9@ D$ $k)D LT$D$$\-E@pP ǃT 9H OuJ \5lLT$D$$,D E8uuE@@l8 P ;H MJP Alu@ 2D$ <$j…yD )ЉD m@ t}艻T M䉋P 4[^_]ǃT P ;H iT L 9 ǍL"t$D$$+T ;L ~aD jT E@@xu@ \D$<$iy)D T ;L P EЍLU?P t$D$E@$4+D P ;H T u؀>L u)ʃ[5E܍ EԍLEgșǍry );uE@M؉L$D$${*T L EE܋89~1$ D M$QE܉EP [5u܋R,r@LE؍ E.@ D D M쉋T `9L E܋P,P 4v4~}}uE@}؉|$D$$Y)T D {;ELD$D$EЉ$")ǃP ǃT UN;H@uRFuLf~-$XT D$P D$F $yVD fPT E@$ 5T D @ tD$ Eԉ$f…yD )ЉD 늋@lLT$D$$(P P E9H UUԉE?$ i=@ t'D$ Eԉ$ey)D $ 4ǃD @ D$ $ey)D D E)ȃ9E@LD$D$$&T 9L  ǍL"t$D$$&T ;L ~bT E@@xuƋ@ t2D$<$dy)D $ /$됉ƋP @ t*D$ $Wdy)D $ L 1EUWVS " 1E苃L [5U29|H L T P 9H [5EǠa59H 9XL \5u@@hqUMEQML EU9k>Eu)$ Eu ǃT E98.@@ltˋM t‹ML$D$$$뵉H P pFh9}dL L$T$$EƅtDE;T t4$U >D$D$4$ $uU1H P L T [^_]ÍGEP T Ǡa5P :U\5>MuML$D$$#tMUt'@@ML$D$$S#@@lu$ uP ǃT [5EH 9p))ʉH P 9:H \5$ 넋H 'ǃL U UL UH U T UP 11]U ڤUL UH U T UP Ej1]ffUWVSw ’%[52E[5E[5EE09u9uN~sF,EEE]F~JCH1 9F~59uuS9~S 9}͉9F˃EE9FE@E^[^_]ËuF~݋^]v,EEU~&XC]с9u9u9uuɋE@E  4a5BH8~NHD~GBlthtËuu拐tt 1 Ǣa5@ xUWVS(v ƉEYka5EBH8sˁ'}[5u@D=u[5džX [5Y\A`Bt%]>D$D$ $pEBt8]>D$D$ $A[5l2!P@EBlxhjǁh2ǁd2BxT|2@@Tt ǁd2t d2t d2t d2t d2 t d2 @t d2@t d2t d2EA\~fǁnǁp ~fǁzǁ|~fǁǁ~fǁǁ~fǁǁ~fǁǁti~fǁǁtL~fǁǁ~/Rnff@f@@ 9uǁl"ǁp"~&l"l"ff@@9u}䋇X %ȋl"p"LJ` LJ\ 2E[5E[5EE@EE8E98tE98t܋E䋘X _HG~MOw,EE}؉ϋ~HQM% ؉9u9uuԋ}D$<$]bE@Ei1([^_]ø[5ˋtǁh2[5Ћtǁh2^tttǁh29UWVSz áEU MfUfMf{[5;7jf [59N9C[5h2tsp"уt:]f9l"p"fl"}fn"U1[^_]Ép"ufl"ufn"1[^_]f:ftlfufEf*ftCfRfEGfufEf/fE$1[^_]fEfE}f9n"Cp"fn" fEfE_/UVS EM ]f[5;B`Lt f1Dfh2t1[^]ftU4ftifufftL(ft;fvuf1fuffuf1ff1f1f뛸nUWVS$ U} uEEEƉEljEf[5;B\ @ fnfpufra5 I ytX|2RtE}|$}|$ ut$D$$y9>T$D$$1$[^_]øU /Efx?[5;B\}1@nU f pUf rEf1]ø] ֙[5 ǀǀ[5t%X ǂl"ǂp"` u1U勀X %1]UWVS' R}M [5h2t^ffǀ[5 t)X fl"fn"ǂp"` ug1[^_]f3fthfufto'ftVfmcfuؾfLBX %1[^_]þ뜻닻 3[5d2US  [5h2tu=a5@t(>T$D$$NP5M!A@ []UWVS} ä[5\ tM 3H@ȩt?u f[5h2t Q@E % ЉA@[^_]LL f8f|,UL$|2@$ 6>L$D$$dUTfrT$|2@tLL ff|UL$|2@l$5>L$D$$UTfT$|2@h$?5>T$D$$U$UL fxZU$UL fUWVS ôE[5rNQVy ;V|"< tJ4$荢[^_]Ét$$UWVS' NEu NQVy ;V|"< tJ4$/[^_]Ét$$RUWVS [5x|$E$/Ɖ<$ݡ[^_]UWVS î} |$E$Ɖ<$裡[^_]UWVSI tMU [5xLxHX9Ap9}:x}x,;u!<79u7PH1[^_]Ëu4&ԸUWVSEM UxLxHX9|Ap9~:x}x,;u!<79u7PH1[^_]Ëu4&ԸUWVS UJtvB Ez]Zq uBy))xDx@qu96Y9}/quq,;]~ ]#4;UuQAAʅu [^_]UWVS< } E E ElG$!EE@EE@E؋G ]m8 t&ut[5E}}+E)9L$ED$E$ ؃<[^_]Es uE@1<[^_]ËE@,M؋EȋPMU܍։UЋUDEE̋E@‹M);UeUȃ uN(R9 ~ FM܍tE )B$f9Uw)MЋBFBFB F BF9vڋMA GEԉ%AEfAGE܃v;}ЉM $M TW PG 9uuϋEЃMQ}~,MMzuԉ0)fp@ fH9u݋EPBMI(L }ȋW 9 D$ ẺD$E؉D$E$UE$U1<[^_]ÉMy1ɋEH1<[^_]ËE$)EM9HTu@8 E$%1|$E$4 E@ETUȉE E96Uԉ} 6E@Dt$E@|$t8E@HFfF;uv+~ tÉ$iuF 멸Uԋ} U FUT$[5$]UWVS  u}ED$E D$4$t} u [^_] [^_]UWVS  Ďu[58E D$ED$<$tu } [^_]v [^_]ffffUWVSĀ; bƉUM$E~$EUUFEȋFEEċE@MyMM[5M ta%4 fT$ yE‹EĉU}E)MMĉMċt& uE9FTu F8 Eȋuڋ~FE+};}EEċFEȋE}E[5U}MMEW tx $ yE‹EĉU}E)MEȉEME Et W uU}ċF,EMȉM BEUBLyύ EEH F(R;}EȉEV}9eME@|E )B$f{9Uw)MBGBGB G BG9vڋEȉEEEċEE}ẺEEĉEEȉEEEEEȋO,EEEG@ED$ED$ED$ ED$ED$<$pmuEMEEEăEċG$y)E$ymEU] urEEEEEEăEămyE}G$0Uy)EE9E>E3$yO}mEE}zMEj E9qU&FHGGfGfG;}FD|$F|$(uEE$E[^_]EfNMVUEĉFEȉF4$跄MNUVE9FTtHEȃE}U}<$4$M1[^_]E34$o}봋E$MQU EUt[5]1]U UM t[5]1]UWVS  }[50E D$ED$4$tt [^_]61 [^_]UWVSg Î}MM[50E D$ED$4$WttM[^_]1[^_]UWVS  -u}ED$E D$4$tt [^_]}1 [^_]UWVS Նu}MMED$E D$4$ttM[^_]!1[^_]UEU t ]1]UEU Mt]1]ÐUWVS# BÉUM,ljEDWp1҉]]3 VTJ>v]D{u܋]4.tF<*t*Ѓ}‰ DOu녉1uUWVS(# JEUM؋ufUވM݋U1ɋU EEԋ},Et$$UEx}P$u܀G$VUt}EMU E3M Mt~MލQf sSL/DžPE݉Et$E$Uu2Eu1([^_]À}. I}ԅ~Mȃf wCL/Dž~]؉t$$UuUWVSuE ]UUMt{~9G tU9tMV z$uYVRp҉U싿t:?v(MMM] EE[^_]Eu1E1[^_]UVS UE tzJ;A t[;tSZ {$u]Z[pۋtA R(D$ t$D$$G[^]ûu111[^]UB md f D$ ED$E D$E$]U %d f D$ D$D$E$]UWVS ցU:GEG<\5<^tKЍtǰ,}Z%}2t}<,P{44GuGPҋ1~9%ð,%Z<\w<:{8LZ{f؍[)f )ډ׍ۉ)ډ֍^0E(MMTSu<.t<*u QUAщMԄ=1RC=}u-EPU%EPUpEPU}W0EPU%M܀dtEPUEPUdEEC=AE%p0%@p0%{@2}%*f@ %-EMHEHEEEC=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+EMHEHEEECC=}hEPU%EPUpEPU}W0EHM%EHMc\EEsC =}EPU%EPUpEPU}W0UE0\;EHM%EHM+EHM%EHMcӋEEE%p0%@p0%?EMHEHEUMU܉ȉMNjE%>%tEU܋M\; U%+%;EËEE161D<\{C=EPU\\UVS zƠa5tp t~9t $Ip EED$D$E $uIp tG@t  d\5 l @xh [^]É댋E[^]Ép @uUWVS( GyUEtBEEa5E}<$UT$ D$D$<$01M辵N))@7U܉e)‹u)@7uܺg݉ҍ)ƍ43 ED$<$kEtTH tCp$1҉}܉ 9t-~fuUE܉D$$XkUuF([^_]1([^_]ËP 3$E([^_]UWVS( wUEtBEEa5E܋}<$˯UT$ D$D$<$/ukLЍB)6UeЍBM)6M>Љ)43DD$<$EjE܋tRH t>p$1҉}܉ 9t(~nuME܉D$$jMuՋFy([^_]Ë3D@x([^_]UWVS(| ãvUEtBEEa5E܋}<$wUT$ D$D$}<$.u-?L) RЍ)Ѝ0)43DD$E$c2EOMEu4$蘨UĉT$ D$D$4$(-?LeċE) @E)ЋUBEeȋE) @E)ЋU BM*SRЍ)7UD$4$bUti}tu~cu ~u?GZEE3$E$:E13D$J;7$.<뜃}t EE$*fffffffUWVS oE1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~;E tىUUƍp@Hπw09}맋E D똉UUUWVS( Gn84z4y@04G4<11 $rD$ \$$(‰0,1ҋ(tC,1,}Q90t<u90u狕,P)1B t[8ư,(׀%#Nj4P4H0@,Z9t`J4K4Gu4V,F4F,[^_]EO81[^_]Ë8t 4m0$8A4t t@0@400$84G,rG00 wW%uI%选L$0$8蕴%4C,0K0S4ƅ`%( Dž,aDžDž$10:~Jwɋ8hFʋ DOu80,B<]38Fዽ0ʍ|YЉ0'V`)ك?w:QJ fɋ8LH狽$V-.,uy0Dž0Dž,xDž$i0lHP,90Ha1B<]]:CEPEC0EP&Vҋ8HEEP, s G04P4H0@,\:9g,|$ `L$0|$Љ$8謨K4G4510O0PD]}}P!n~uЃOPD}cA<vRŤŠEOp~PTENEPUT$089ϋ0sȍx4K4[0D924@,T$ `T$|$ȉ$8-4G4EEPkN1.V?;epPF%tʉEEPu4P4H0@,Z9J4K41%V? ; pP}F%tӉA<A<4T8EOsPDEF~EOBPDENO<'u}5D$$<D$t$$iE$/Ut`uE[^_]Í$~zƅVEE[^_]Ë}ut$}w}  ft(XHuu҃f8pxE;x L@$X|$D$$]Ex tpE@$E11EV HnsefwrRPMu v@@@ 9wND$$]A}G 11fCvuF F$t$]EF$uyf fE@$$]Ex D$<$]苟]C$i$ffsuVT@@rRt5p @}t6JrHUsMu,@ lJrǪ7f9@ @'UfWUWVS, VE׉MT$ iLD$D$ E$O=v(8,[^_]D$E$ ƅtʋE$gUU܉T$}|$ D$ED$4$ t6Mt/U:t+E$Ejǃt<4$ ,[^_]1E܉D$ |$BD$4$ uދMU믋EPEGǃuE䉃 D$|$E$ÃE=D$E$ ƅUWVS։Dž)t Hv8s<:ut<:t؃u)u΋[^_]É׃rtftƄE$t ɋuDžfDž{UWVS = dT։ǃ qL$n48/$B0…tSDžD$$Nj$ߟtOi\<$ $L$sfJH΋BD96t$B@U$GUtB@rDJH]fBHxzHz@utftEBHJ@XZHun&sOf.BL[^_]ËB@u1[^_]ËED$B@D$$UuE(E tȋED$ D$kpJH΋BD9vE$tJH΋BD9v1z tFJH΋BD9`U4$2UED$ D$kD$E($BHB@z tzu0BHJ@BHXZH]J@BHu$f4BHxzHE$z@u stftE$BHuhuOыM~fBHJfEfE$UWVS JE 04$EE @E$EE @E܅$сEE @(} GW8DGH}EE$aEE @ fyQU׃?UMf BEut%ˉǃEEMfUz}u܅tȃuduWEEE PE] S u V0] S@EM+[^_]äQfGft懶t&^fSU뷨uhu,u8ECEAyEffzEDf<Jz]>UWVS: eGUM M,82uDG@ƉكD_@uut+H8]t \t'^t]XtȍH8]u E[^_]Xtp}:tYuE[^_]ÀEu2>t؀xtEE[^_]ÉZUWVSE lFuNE|F9vSt_|$$tC~NU fFF}t7]fFF [^_]Ëu1[^_]É<$趉륋}<FUWVS<褿 EE@ EE@ 0t$$iU4$聑E@E܋uFI1D$|<$ Jt~HM|$E@ $$EB}ExDED$E@$ȍUttMA 0ωփsztft$ېu}n|$E@ $$E|Ǎ@ED>D$E@$TUu;$膐EE<[^_]"eMAOMփEtfEtǤ$E܉$E@ Eu~,F F(F$F, uuFSPpx3My ɍL L$ T$D$E$6t}uPpEE$vEx@}܋@LEuF@FHFDFLuefx{111D$ T$L$t$D$ED$ ED$D$E$tYmtZ7GED7MntsuHP|1둃}t>px111zx@11jEE܉$zE<[^_]px111;frEu/u;Ml$lE r}fm볍 l$0E0ECUWVS藻 þAUJEtB9vwt$U$@Ut]rJ] fBB ]fBxzE:us>u.u'EBB [^_]Ëu1[^_]äftЍt&u%u0t׉4$踄UYEfUWVS舺 ï@uVzF9vHtT|$$Dy@u뼉EĉU܋ED$ ẺD$ED$E $U܋Ex}]9sD$ED$4$]RËE8^E qEx fPpڍwJЀv<ҋMЋ DQEċED$ ẺD$ED$E $'Eă\9uuME1҃U]E1҃<$}U} |$ D$D$D$D$D$ fED$D$E$D^u xumU bUWU LUAu 6M +fEx DD$ \$|$E $g,EĉU܋ED$ ẺD$ED$E $U܋Eă.$} |$ D$E؉D$D$D$D$ s4$tf]p|$t$E$^f1$E)ύ)ȍD$4$\&u [^_]ÿU 3E=w t]1]UWVS ʬ 2u4$jUT$ D$D$4$}-?L) RЍ)ЍmGEeM) RЍE) GM*S)ύɍtD$4$K%u [^_]ÿUWVS4 2ufF(}ȉ|$$Jt4[^_]É<$;11t9ufF(4[^_]UWVSx ß1u  f\5fV Ed\5 4$:V(EfD$FD$ $U[_=UwDE |)ʉM싆t7T$UD$E$_U9vUJM|M))‹FtIT$UD$u4$^U9w4[^_]1$d\5[^_]ËUыU|UVS. U0utnF$3|F$(|F$|F $|F$$|F,${4${9 t 1[^]ǃ 1[^]ø裩 / @蟩 º/ @tÍfffffffUWVS[ Â/lj$UgD$$ =Et$UT$U$c+9UuED$$ <1[^_]ÉUED$$ < $x-UD$i-UDgUWVSd耨 ç.-6EU1ҍEEƍ EE> ;uD$t$M$+Mtɋ$,$,MDŽifU}+:!d[^_]Euu 't< tPvcFuM$+$+MDŽ\UWVS<藦 þ,Ɖ-68}11ɍ tuduπ@t:H@u~D$@D$/$8ZV:tP:uwUBu2$W $\WΉ$)D$)D$D$ AD$D$o4$jAQ;ȋu+7h<[^_]Éƅ/$(Ή$,Ή$(D$($(D$+ω$(D$m(XQ$0R[Q$s)$EDƅD$/4$[h/t[D$AT$/T$[T$ |$D$4$t$D$$AD$AT$ |$D$4$ɯ뷉kEUWVS転 (EED$:E$s-tpyt!ED$E D$E$=&[^_]ËU Et考[^_]UWVS5 \(D$:E$,tpytE D$E$An[^_]U (Ewt ]1]à ]UWVSh薡 ý'E} -6MU1ҍp UED$ D$D$@U$UfUUU9~EE ω )|$t$ʉUM$W$MUӉ΋ʉU$]%}D$N%UD_E$  ut$|$$#EE}+8uEh[^_]EUWVS` C&EM -6U1ҍpUMED$ D$D$@U$UeUCtSD$$ h3EED$ML$ED$!;EUT$$ u>03M+u}`[^_]à Wut$L$${!2 U$#ED$#UEDb]|UWVS`轞 $EU-6L$\1ɍxwbtNT$E UD$ T$"D$D$@T$$T$)dT$t>$ uT$ U MT$L$$PL$\+u`[^_]øUWVS $Exw|Mt_AVƃtA#ƍ U$R"ED$C"UED [^_]à u$"Ɖ [^_]UWVSlA h#EU -6M9}1uHM$}m:m8@8}k6E81nXE-} )|$t$E‰U$U֋}$ uD$ UDZ t$T$$M}M+l[^_]êEf:FD$D$ BD$D$@u4$Wa}tPf>~$E~LVF9u1`f7AY,US !!EPw&u tRY-$"[]US詚 EPw&u tY-U T$$8[]UWVSO v D$:E$ %tpytE D$E$[^_]|X-[^_]UWVS ٙ D$:E$$tpyt"E D$D$E$` [^_]ËE D$D$E$ [^_]US S zEMPw&u tW-L$U T$$] []US EPwt1[]à u$/6[]UWVS諘 D$:E$i#tpytE D$E$j[^_]V-[^_]fffffUWVS/ R}E1E xtC1Utt ƒu@u[^_]UWVS|誗 E|-6x8}1  > E|EE. 6 Eƒx  EB A E;uuˋE%@ ED bEP ExE}Wuwuw EEEJ΃ 9MuEЉ̉ эuEE@tuEщ ʉ ʍ  ʉ  ʋM xEEEEEtE@EQǃ  1)UWVS\ uE EM-6E]11ȉ܉ %Ev㪪UUUU UUUUM% ؉E1EE EEEƃ4x  EF A Eu1E1EE܉}ԉMԋEƃ4x  NjF A E؃uƉ}ċEMEEE@ EE4uȉEEE܋E؋uu؉EEċuuĉEE}]1#Eu܋113^1݉]ԉMuEȉ} }3 3 }3 }3 3 3 }3 1EċE }3 3 }3 ]3 3 3 }3 1E؋}؋Eĉ1#MMԋu܋M3]1ËD1M1EƉu 3 3EE䋼 3 3}E3 3 3 3 3 3 3 3 3 3 3 E3 }mBuumEME% ME%MɁ ȉE1E1 EME0Ãx  NjC A EuƋE8upEu+0u)1\[^_]ЉEE E4sUWVSP譍 Eԋ}] ]-6EЋ0u1;$]܍u 9u$EE<_tuX< P<:fF]S7 l:c]ĸEE]ԍ ]]$(#?8D$ D$\$$ 09u몍uEEESD$ D$$$Ű]0"thU9tD$ )ЉD$T$4$f}2at^}sha1 f}1}argo}argo}argoEԍ,]Ћu+3P[^_]À}uE؉D$<$>uыE<*uE؀x0uEԍ/볋]MԈ ȍ  ME`Ẻu Ȁ`QŃ?u49uE ЉE;}uɋuȅEjX]PE]ԍ ]ȋ]ԍ`]]u2NŃ?}t}<9uȈ ˃r2u`ƀ@~NN҃?뺀@6Q<ًuEẺËED$ L$t$Eԍ $`EfM ȃ?u1`K?1`K ?1`K0`EfM ȃ?1`K?1`K ?1`K0`CEf?1`K ?1`K 0`CC EwQ҃?}n2id<~2E؉D$<$l}n2d+݀}E؉D$<$ ?E؉D$<$+}n2i뜋]UWVS軈 E-6E8}1EXEEƍ}S1J 9uZ9uE$}u+7u[^_]Ë]UWVS,? jE؋}}-6E0u1_EE}ƍS1J 9uZ9u} D$ D$ED$$uJ]܃8uE܋}Cу9uF9t܋}܋Eu+0u,[^_]ÿ]'UWVSDj Ɖ E E}-6:}1DžDžDžvP88}+81D[^_]D$D$D$ D$D$$@D$$ P@D $9ʉsÁ tщD$@BD$ $ |$ $?2 9ȸU?!~9ȸP?J9ȸK1?߲9ʉG?+59ʉE?x}9EDž\DžXD$$^D$$B(D$$XP4R 9ȉ )ڋ09<19D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$y$D$$W(,48 1؋ 1 0<9911҃DžbDž@SDž DDž5Dž&DžUWVS ) Eu -6U1D$D$6 $5DžDž4$8$u D$$_o$@DžD$$o8vuUx=uOT$$|D$$n Dž|DžDž DžDžtt$<$dnptLtm$QSDžu+0sİ[^_]ËT$$[t$<$moD$$mDžDžxDž_<Hv2Fpꋽ0~Nz) ЍN!ȹZ) ! ȍ~й9) у! у+у>׃/׃? ȉփA! =ЅD$$'lt$D$ uDžFЃDž| $%D$@D$,$F$N|UUVS| ûuv$蘎‰)Ѓ[^]øh`UWVS4R| y]荻T}u u4D$ ED$E $!lEE8$E $] h`)‰UE E h`9t$u+E E܋E$]9NjED$ut$u t$u܉t$ [D$D$b9 E$'A8 t$|$ ML$D$E$}v/lj|$t$ ED$D$<$9]uىE D$E܉D$ED$ED$ ]荃dD$D$b}<$@U^D$O O ȉD$$EPU9uD$]8 8  8 ȉD$$EPU@D$D$4$螯E4[^_]14[^_]+M MXELffffffUWVSˉU 3]3։3 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 13<43 13@43 13DE] [^_]UWVSEfM荰uHE1ɺ1f9M ؀u1;uuEE}u]܉EEEC;]uE䍐UEE荘EEEC9]uEE9EuɃ[^_]ÉTUWVS nu ÕUɍ4 u9 `>0UZ9]MUQz  H? >H9Uv` ˃0]]9]vDZM  >Htu虂>u}$2a$E؉D$ oD$D$G$K9G1MԋU+u[4[^_]Eru؃aA11UWVS$r -6E1ED$ wD$D$ U$U8UT$D$9 $-1t؋M+u$[^_]É/UWVSvr ‘@EHE -642u1EOrphEeanBEeholEderSEcryDEoubtx2,P$=axƅ;a$G$@‰,<w4$/@?G2W`UȉDы@Fxltct^f Ј;`tFFx>$u ~1QH t $t9u+p @4$5 |$$D$4$JD$D$4$0L$T$(4$u4$҉|$$D$4$L$T$4$щ|$$D$4$軉t$0,$%C(~T$,D$<$k׋,@@@ Ƌ(,D$<$!t&D$uڋ$D$<$uڋfǃ@: $1ƃB: $D$D$C: <$:D$xD$G$(D$,$ 1 D$$D$4$gʉʉʍWUUUUʍ׉ʍځ$I$(tsD$,D$4$t$,$g4$蝇(:D$,D$4$裇7 D$$D$4$肇뉋 D$$D$4$dDD$D$4$C@:  : D$06 < ȉD$$ :  : D$17 = ȉD$$a :  : D$28 > ȉD$$ :  : D$39 ? ȉD$$ :  : D$4: 5 ȉD$$ :  : D$;T$$k : P : @D$D$,$%}+8uu[^_]À~$Dž0Dž4Dž8Dž<:DžDž DžUWVS f 8MMu-6U1҃}@2Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\EU҉t\61T22;Er䋅$~D$@|$<$/~E D$D$<$~|$$<$}D$@t$<$}D$t$<$}|$4$EM+[^_]Éu4$Q}ED$L$4$p}t$4$~Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\ETfffUWVSa utJD$ED$4$QNjE9t=8u86 8"tE 81[^_]ÃuE 1[^_]UVSua EU ]~Í у? H9u[^]UVS6a MEU ]~Íу? H9u[^]ffffUWVS8` ƉUċP,x0 9s1V8UEV(UȉMԉEE܉}F4EMĉM9s}t$}ȉ<$t8[^_]É<$uEĉ|$4$Eă8[^_]U=` XEt t&t1]ËM t6j]ËE tr]ËE ta]Í5]ÍF]Í>]UWVS_ u} 4$uw[^_][^_]UWVSd{_ âu}$}(E($P)EEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$*…uA}4)U4…u'tE(usQuAu:M,ftE0uZUE(D$}<$<$0UЃd[^_]äftt&uqtӉUE4D$ ED$E0D$E,$;UxE(D$}<$ E0D$E,$p <$/bf{vE(].U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$,]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$S]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$z]UVSZ u4$4u1҉[^][^]UVSZ u4$ u[^][^]UVSZ æu4$ u[^]o[^]UWVSCZ j}u <$ Eu<}wAU/Eu%Ot12 ׃9uyE[^_]EEUWVSXY U$ljEE$#ƉE<$#EE EEEED$UT$}<$W5t.1EU$\+U$Q+4$I+EX[^_]ËuE$ #EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVSQX x}u <$ Eu51҉DEu%Ot12 ׃9uy E[^_]EUWVSW }u <$ Eu8Eu%Ot12 ׃9uy E[^_]EUWVSjW Ñ}u <$ Eu8ZEu%Ot12 ׃9uy E[^_]EUW "E##+\ፂw]Í&]Í]Í,]Í]Í]Í]Í"]Í3]Íȝ]Í]Í,]Íߜ]Íd]Í]Í]ÍО]Í]Í]Íʛ]Íߛ]Í]Í]Í]Í;]ÍO]Íb]Íy]Í]Í]͜]ÍМ]Í]ÍE]ÍU]Íe]Íz]UWVS U EwjE$+9NjE $9ƋE$9E|7E$8E}E$8}$8 [^_]Ãu$L|ffUS T $U T$D$U$X []UWS] }Èĉ Ⱥu$u*t 19r[_]êtfUWV}u uu.tft^_]tfUVSUu 13ƋL3L‰L=u[^]UWVSS u M]مt2u#E@UWVS$J  MU -68}1ZA@yDD$ HL$D$4$JZ 1ƋLÉL=u苍A@D$ HL$D$4$JZ 1ƋLÉL=u苍9z(@tD$$}+8u $[^_]ËDUEU Mt t]b]UWVS\fI ÍuU -6E8}1V(F Bу+?Ѓ/ [^]UWVS É։MM<}R)Ѓt u }E9usytgMM11EE@ƃ?'كCwU9UuljMt)?UZE [^_]EE [^_]UWVSEUEEEEU<}EHv(UB]9}}EMڍ{Kz) ЍK!ȹZ) ! ȍ{й9) у! у+у>Ӄ/׃? ȉӃA! ="}w"ЅEuE}8[^_]1[^_]UWVSE0 w+׉1ƒ0 w!w ҉9s1ɉȃ[^_]9t}0t ȃ[^_]Ã9u׉UWVS # u} FEFED$E$?$ulGE$UljD$UT$E$u=}F8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=ustUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$? [^_]øUWVSX" ?}EE-6uU1D$E$ƋẺ$,Ef} Tf$OME Eĉ4$9E/PMMȃ>MU)ƒ$v=AMEruE̋@8D$MEĉD$ D$D$E҉ljEȉ$<$C9ƋM@}uȃUGMыE)Ѓb$m=QMUx}E̋@,D$EĉD$ D$D$uȉ4$4$9NjM @}uȃvMыE)Ѓ,t=QMUx}E̋@(D$EĉD$ D$D$uȉ4$u4$-9NjM@}uȃ`dMыE)ЃL,p=QMUpuE̋@0D$EĉD$ D$D$}ȉ<$<$9ƋM@}uȃEЋM)уf$xqE̋H@$)ʃf$}̋O $ZcE}+8-EX[^_]Ë}Ȥ6}f}ȃ%fv)fffvfE}}o \kE%)E}f}ȃWWUȃAyuӉ fAyuӉf AyuӉfAyuӉf?~UMR)уtu]UVSU ṽщcw[^]ffUWVS <$$ lj4$$XF$\F$`F $dF$hF$lF$pF$tF $xF$$|F($F,$F0$F4$F8$F<$V@т歉$`VDRQ$dVHl>+$PvLh$TPPkA$HpTك$LPXy!~$@\5[$$X$\D$pT$t$x$|$`$dt$h|$l$$$x$|$h$l$8$<$$$p$t$p$tt$P|$T$$$$@t$<t$D$D$ D$ D$ D$ D$ D$ D$$D$(D$,D$0D$4D$8D$@DŽ$XD$X6_D$\:OD$`+D$drn<;ʄgDŽ$@ɼDŽ$Dg jt$H|$Luw$Xwt$@w t$8wt$4wt$0wt$,wt$(w t$$w$t$ w(t$w,t$w0t$w4t$w8t$ w0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$4$_p 1D$ ED$,D$$, FT FP,u,D$$袳1(u+1uN[^_]D$4$xtFXF\FPFT문heUSEU MtttXT XPu []?1[]øUWVS\o ÖED$} -6L$T$X1D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TƋE9FT FP1F@VDF@VD1FHVL t$FPFT)ȍT`D$D$$5V`T$ D$FD$FD$ F D$$FD$(FD$,FD$0FD$4F D$8F$D$s2!D$0 "D$0+ !D$06# آ"D$0y躢!D$0[ 蜢!D$0= ~!D$06 `!D$06B!D$06d $!D$0m!D$0 "D$0ʡ!D$0kP 謡!D$0M莡"D$0/p!D$0R!D$04!D$0!D$0r"D$0ڠ!D$0{ 輠!D$0]6<螠!D$0?耠!D$0!b!D$0D!D$0&!D$0P!D$0!D$0̟"D$0m.讟!D$0O萟!D$01JD$O%D$^"D$0J"D$06"D$0""D$0"D$0"D$0"D$0Ҟ"D$0s辞"D$0_語"D$0K薞"D$07z )ك\$0ك,كȩ\z كȩ\$0݃s,t$D$$Lt$ D$D$$k8,D$ D$D$$j,D$ D$D$j$j.,D$ D$D$$zj,D$ D$D$/$Hj,D$ D$D$$jќ!D$0r,D$ D$D$X$i),D$ D$D$$iC,D$ D$D$$qi=,D$ D$D$|$?i,t$D$$Jt$ D$D$$h,D$ D$D$C$h,D$ D$D$|$h,D$ D$ D$$fh,D$ D$D$1$4h,D$ D$D$k$hH,D$ D$D$$g~,t$D$$VIt$ D$D$$gK,D$ D$D$$[g!D$0,D$ D$D$V$g,D$ D$D$٤$f,D$ D$D$j$fa,D$ D$D$$f,D$ D$D$$Mf9,t$D$$Gt$ D$D$$ f,D$ D$D$X$ej,D$ D$D$Х$e,D$ D$D$$te~,D$ D$D$Ƥ$Be,t$D$$Ft$ D$D$$d,t$D$$Ft$ D$D$$d,D$ D$D$$dfffffD$1ffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09vvK4)ȉU9vEEϋu)փUtftЋu))։‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C01[^_]ÉMD$K(t$H( $P ljC8U뿋EC4C4S,9tcC09vEC01[^_]1[^_]äC4C,C01Mf7C4u0u\ u5ufEffZP;US]|‹C@ CCCH u`@4?@@@@@$@<@@4HpHTHPǀǀ[]ÃK0똺UEtH tP$t Pt;t]ËJ4?wB,B0B4]UWVS }] tWxt/ui1ۋB8t9Z(tUD$G($W$UB8r Z(u8G@,@0@4} [^_]g| ۍCv [^_]UVS Z]E81}8CC twS(s$tbD$D$$ЉƅtpC@8@4?E D$$tEt$S($S$CE[^]K$C C(1uиɸUED$ E D$D$E$]UVSEM tWX tPP$tIPtB;u>B-4?w1x6(r@1 w#EB?EEE@>D$D$$]|]CUB0C??E Ex6E܉m؃E܋E@N?EX څQ}wIu]Uԋu}؋MBǃvUԋUu}؉M܋uȉ+E̋}G}G OtBU)U_ۉD$T$ $]4uEHUJ0P E@D}؉ЉЉ9EЍ UBE@Q?ẺE^XEt]ЍuFPFX FTF\FG?}  mmUԋE@H?UgḾu]^ N]ԉV}U؉WߋuԃZtftE@t E@ | )UUԋExD})щHD3E@UBDB:?)uV$tB]CDC;?}w@EUԋ]u؋MBƃvUԉ]u؋E@$tu؉pE@t @  E@7?EE$E@~E@,}wC]7Uԋ]u؋MBƃvUԉ]u؉M܋uE؉F<]EЍUBFQ?E@D?mmUԃ} wC}Uԋ]u؋MBƃ vUԉ]u؉M܋]؉ڃ}WdGh w`]؃mw  EЍ8UBE@Q?Uԉ]u؉M܋M+M} ]ԉu}؉M܋M+MwmMcMt1ҋ]9UtlL}G$t p$utwD;p(sGD} 7<u‹E@u)։ u}6E@??XE@ E@  ED$EԉD$uF$]4fFEM+M̉}]1ҋ]9UtL}G$t putwD;p sGD} 7<u‹E@u)r u}yuԉ]}؉M܋M+ML}W4w8])9)W,ƋEPD9vȋ]9v)E)‹}WD}9u}ExD@1>E9]sBEUԋu}؋MBǃ9rUԉu}؉MܸЋu!UBDBDu)]>f.ẺEEEE@O?DUu̅E]CDuCH?  )uNˉMMYluftYtu9uU}؉E܋UzQ?ft EЍ\}GBQ?[EE MM ЉE#E؉EPfU@0;Uv|]}}ԋ]U܉uuGƃE!MEMMHfM@M9w}ԉ]]܉u؉U܋um؋})}܋U]ԉU}؉M܋M+MfEǀPPHXӋE!؍4F9EsR]]ԉUU}؋MtCǃE!u4FE9wՉ]ԉUU}؉MMvm)E܋]sDE@M?UUu)ƋE@DzEǀPPHXӋE!؍4F9Esu'q}ExHXL@K?1o9]sBM>Uԋu}؋M^Bǃ9rUԉu}؉MܸЋU!ЋuFHU)]\m)E܋UrD REǀ@??}L}wCM]ԋu}؋MCǃv]ԉu}؉M܋Et }@$t@0E؉B))9E؃EЍ}GE@Q?EPD@B?} EEEEЍUBE@Q?A@ EЍUBE@Q?E8EЍ$uFE@Q?mmU^]9s:]ԉEuNs9r]ԉȋuY])1au]؋]M܃w'EXM]fDQt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]5TUBGQ?}ԉ]u؉U܋M+MU}؉E܋M+MT$UEԉD$uF$]]FUZEԉu]؉M܋M+M|EE؉ED$ED$uF$]]FEЍ̩UBE@Q?} ։u]! ; yf}q<;}vsM}UU܉EEX]؋]؃#]M]u4NfMvM9wEԉ}ωU܋EU؉M)ȉU)E܋U艺EBDEXL@I?cE@l@E?13^]9v:,]ԉEuks9r]ԉȋu)M)]utsrY]nE@R?EM{U-E@G?} JM+MEMEP$t EEt E@ xE@6?EE7EfED$ED$uF$]'[FFEE]C rT$EԉD$UB$]ZUBuB}{M+ME}E[fevPFEԉ}U܋M+M E@l@F?1`]C T$EԉD$]C$]Z]CuC}EUP }̉xUԉ]XE}؉xuuEtB0M[^_]äftt&ftt&u-uYu5urfM yf떻UUWVS E l6}u|wFV u*=>?t*U UMu[F [^_]=>?u>D$D$$0[ML$M L$$[9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS,H k5}̋EE-6}Ћ]1ۉuEԅwu܋GE^@E܁xS?h@S?ك@H t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1]UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]UWVS2 ]-E}M|11 rtE xfDU9u|fh]]ZM)fJutu@]Xf@htuEu01Č[^_]UWVSLx (E̋EX߉]؋0u@DEEp u@+U UE܋C,EC0EC4EċC8E[~l^`FpEV8T:NXFH1#VTVHNDQEF4!N@fAEf8^xEFdF`t;s)ыF,-9'v 9^`FhF8D8ZZZf9FlFtX^tx18[^_]FhGFlFtX^tVtE t_~l^`FpE^xFdF`F\Vl)…F8D$ T$D$4$]WVFlF\;.~l^xt+Fp=F`~FtDE]f+FdPy YfZ]Ӌ}ff=vff}f E苆E~x}Ft)ÉFtWVxFlE܉U]؉Fl;Ew2^8\ NX~H1#NTNH^D K~4!Nj^@f{fm}~xu]FhF`E}܍D8FlU9UV\)ЅxeV8D$ D$T$4$]TFlF\|@^t[F`^x~l11뚋NhteV8FlDZZZfFhFlƒwg} tlV\)ЅV8D$ D$T$4$]SFlF\v@8[^_]ú} uV\)ЅxRV8D$ D$T$4$]8SFlF\x8[^_]ø8[^_]1W1UWVSP E}ƀ,&u-&Ewt,GlW8TOXwH1#WTWHOD Qw4!Ƌ_@fsft)Ӌw,9W`YPf+Gpqfq ҋ]ff=vffuf EԋEЋG`E܋wt)Ɖwt_l]؋_8]_X]_T];w QUU؉WlG`]GHTM1#UWH]9]G\Wl)…G8D$ T$D$<$]3QGlG\HD1P[^_]ËW8ZZfGtpwtGl9EWt] `Glv‰G`GlX_`GDE̋G@EȋG4EċGHM؍Q]uWlMuL1#EGHu̍Fu!֋Mȉ]fq]fmuw`uuUU؉Wl\1tƒwg} tlW\)ЅW8D$ D$T$<$]vOGlG\Z@P[^_]ú} uW\)ЅxKW8D$ D$T$<$]OGlG\xP[^_]øP[^_]11SUWVS$ɋ EEP @,ru9vEECEЉE9vME9E} 1;UEED$ D$D$E$],KEP@]و\EP@|EP@шLEP@ӈ|EEEsEEEP*K97)ыE@l}+G\Ǎ0E ;UE} u9v}J _\_8‰ωރtftuC )CCF\)EE.S uEs )sssEEu)ƉuteuV,~8;Udž3)փd9*EP,PlEP\Eu)ƉuuEPlE9sEaEHE E;P\Ep,E;vEH*E@ E)=}O\)ʉ99G9} D$ t$EH8L$$]HEp\~E$[^_]Ëuvtftt&1[^_]ÍHw5@u[^_]1[^_]u/u=yf XUWVSO v}EGGGG,wFFFFy؉Ft@F*D$D$$-+G0F(4$>E[^_]F9D$D$$j$EUWVS { âu4$ Džt [^_]ËvF,F}U )u׉[^_]ÿ[^_]ÿUS]tDS t=C$t6…u)CM MMMH|[]ú[]UWVS }U \É ÍBEtƉ ƉU u\OAtWЃy0IPt9s؃ [^_]Ãu ]Ѓ [^_]9rgC [^_]ËAEtjxtm@E}t )ǃ|u}$t )ǃ|u},_WC땃yl ?5UWVS4{ E܋EE؅} E@EEP 'PE@=u~QuN(} ~(v=* EPB@qEX EM  @M L$M $MP<t%} }  EZE@u E@(E؃4[^_]ËE@D+@MAEЋ] ۃ} u ~ 9=EHEXEHtU mx} VEPEH0uFXF^EH0VFX^,EH2VFX^ EH3VFX^ EHVFX^ EHVFX^,EH VFX^ EH VFX^ EMA~؉AEX1EeuF0E 7E@lt B))ЃuNVZ^$NVZ^FlD$D$$]w#MA0uFqFE@9D$D$$]MA0uVFHNVFHNVFHNF0‹x,tXtHtx$tuNFX^FHVFX^ FHVFX^,FHVFX^ FHVFX^    }OGX_GH WGX_ Wrt*JWGX_ GHWGX_,WZ,{ E@ @E}  E9EXۋE@-} #E@D+@MAEVFHNVFHNVFHNVFHNVFHN ) 9 }OGX_WGHOGqEVGGEdEPr]{}K B)ȉ‰E[ ]9iUmtftB BJI,t ;E EB UEUBmM+MM]z }JqJ 9EE])ZE߉΃v|\UEa E@0NVZ^NVZ^EP0NFX^4NFX^M)ȉD$BȉUԉD$E@0$]MA0UE]ڋE}x΃htft}MOOWB,0E@ E@IBuN&ZV z~ ^x~t4FV9F uՋz,t9EFV1묋EPZ,t @9OE@ E@[B$uN*Z$V z~ ^x~FV9F uыz,t9rrE\FV1묋MAE D$E$K)ȉD$NL$E@0$]MA0)ȉD$NL$E@0$]MA0e]C@,S9dMAgtp]CP;S vEC.MI0uVX^ EH0VFX^,D$D$$]MA0}GqEw8B,XfEnIu EP[;gE@@,1ϋGtG`W8GlZZZfGtGtOlQWl9pGt^E Eǀ} ETMA\Yl])…sA8D$ T$D$}<$]2GlG\PG\)…x9G8t$ T$D$<$]^2GlG\B@1;M썶E)L$GD$E@0$]MA0WE,&Mǀ-&UB`Jlr8utut]:^E XXX fjtBl9ZBt=QЉU(UBt=6M CB`Jlr8u4@ED$ D$D$E$]-} EEp()ȉD$}OL$E@0$]3MA0W)ʉT$KL$E@0$]MA0G@,k:^e:^\u썴uUԉEU؋]L:P':P :P:Pf:P::P:9E:PtUԉƋEЉ]+]Z`9B`ÉكXXX Mff B`)BtBlB`9B\Jl)B8D$ L$D$$U].UBlB\U@U)&u^VFX^ EP0NFX^4NFX^NO tE}GD$GD$E@0$]MA0WU1Eǀ} .MEPE*E$],ɀ@\ϋYl])D$ T$A8D$ $]-GlG\HE@AE@D+@FE|}GDWLfDPTT$D$$]Gt*GlG\LJ @\Yl])…xoA8D$ T$D$}.1E@D$}fEP1됋UԉƋEЉ]UUԉƋEЉ]BUԉƋEЉ]/UԉƋEЉ]UԉƋEЉ] UԉƋEЉ]UԉƋEЉ]UWVS_h Æ} EEMEp 5}+M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^tiFDVLfDPTT$D$$%dž% @9E5E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS f >EuE EM}EEEEE U$n81e8\GFF ^$}uEEG} }UD$D$F($V ÅF0@*UP@x0ljC,@C4UJKPCLCT SXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃUJD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]O?|A11u3 cEF$EF F( [^_]øCE@D+@F4$~̸U ED$ED$D$D$D$ D$E D$E$]UWVS] .EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8C,{@uv@CL{DMqD%C {uvugu`CMQ+QS $ | 0 E[^_]ävflfftt&mft&_0f&t&fu5Ifa{@f3f+0f(-f%*$ E/E#E^ UWVS<^ EU O]Ӄ}E U2X3 ˃uE UEEEċE EEEEEEuދE30u؋M3HM܋}3x}ԋ]3X ]ЋM3HM̃Eȉ4E܋EEËEE]] E34}Nj<1}}Nj<1}}Nj<1}}ȋ1EE]umuEU E U 1غ3 ȃuM U3Q1к3 ȃuM U3Q1к3 ȃuM U3Q 1к3 ȃuM U3Q1‰Ӻ3ÃuE }.U EMщ232B32Z32B32Z32B32Z32B3)ЃwMEu DE t&M EE 2X39uЃ<[^_]ÉE Ủe)EUEEEE&1<[^_]ËMoyUWVS[ >uUtbEE}EtBtEu41ۺt 1ÍJtt5 tߋu1ɸt 1Pt t t1PuE 1ȃ[^_]UWVSNZ yuUtbEE}EtBtEu41ۺt 1ÍJtt5 tߋu1ɸt 1Pt t t1PuE 1ȃ[^_]UWVSY }t\EEEtBtE]1t 1ƍJtt5 t߉[^_]UWVSY /}t\EEEtBtE]1t 1ƍJtt5 t߉[^_]UVSE]1t 1ƍJtt5 t1ƍJuE 1[^]UWVS<}M E}]}pE}EPEEm}EF]؉F}F‰MFUЉF]؉F}F‰MFUЉF lj]F }~ E^ N VFЉEEEEEEEEEEEEUUE9)}q ))Ǹq] ))É]E}EE <[^_]ËUtUʋEY9uEvqE )ЋU)‰ <[^_]ǁvE=t-j}]EEȉE8A]؉AƉ}A‰uAUЉA]qEYQA <}A }A }A }A }A}yENjEEEEEEEEEEEEE;M/E]Dt]T؋MX9uMq ))NjE ))E <[^_]ËE-uXUWVSMuq ))ƉE E)ыE  ))֍11}t9Ov=v=w  ȃ[^_]-=vѸ[^_]UWVSMuq ))ƉE E)ыE  ))֍11}t9Ov=v=w  ȃ[^_]-=vѸ[^_]S :øUUS +E@]USR EE $[]USR E $$[]fffffffUWVSljU䍱\ ]ɋPE9fEE苄\ ]fU9M~Q` }Xwĉ]f9]sċEƋE܉D [^_]Ë}X8>Xv֋MD ;M~E܉D [^_]f}E^UWVSLÉЉUċU@0uЋx ǃPǃT=1ɾ1!P\ ƄXƃ9tf<ufD9uu|Ẻȉ}ȋ}M6u11҉` fƄXuЅt T)uŃ uΉ빉}}ȋM1t1U̍DPEċUP}Љuu}ЋPuu=B;Xfyf~GƉ` ỦhP` ֍PP\ ` Ủ*` EЋTX JTT uȋE̍֋UЍ ffUXEX872TFT` EX EċUPŰ@UPUPU@Eȍ< E 1UЃ1 9rE6E$EUfD<\ PEE]<)ߋ]<6Ƌ]EtD9U: ]4 D D]9}EfF9}|‹]fC< ]9{11uK: fNuEtBu|9t2VtLUԍAfDU1ۉȃ uf9u΃L[^_]Ë]Ћ}tEȍpuč4C: fEĉC< ftfC< fK< f< Uȅ#=uS< }ȅt>\ 9M|<}L9t)ϋM }fWmu‹}ĉ}랋MȋE]A=)"ȪfEE1ȪEqfmdUWVS ÉJEfDrDE1E?;Ut f| f t_9u:ME19ut:9}9t;E}f| t!UE19uuƃ [^_]ÉUE1룃  f xf kUWVSljRUۃҁpuD E1uEE}?}EE9}9}9ǜ}KNY^^ FHNN)fD8mt>E|T f )f9mu‹EMEEE9E [^_]Ë}fE9t{~ | )9E fVJNNFPVV T)}؋EE  E ȹ)9fVJNNFPVV T)]ۉ߉ f~VJN~FPV )fUWU9U&MEEE9ET[^_]Ã}  ] +M9щ fVJN^FPVV U؍T) } fNVZ^VFX^ )f ډi]ۉ f ] ø+E9OfVFHNVFX^ ]؍T) }  fVFHNVFX^ )f MEf MډEEEE U؉ ;]ۉ fME  f(U؉UWVS(E ô]ƉUMԋfE싆EEЍẺE|Ef ]f])9~fNVZ^]VJNN)ы]f]fL:E9iExDE:É]F‰E܋}UU؉f ])9fVJNNVJNN|:)ы]M̋ MtqUM+‰ ù+E9YfFx~~Fx~~}|8)ËEE=MMDEE؉ f]+Ef9vFx~~Fx~~)]f]f}L8}䋄EE+ f]+Uf9#VFHNVFHN)f]f}L8E9ϋEE ù)f9Fx~~Fx~~)}fD([^_]ωMEM/fM艎}쉾]([^_]UVS~CHPrpHPrpfǀǀ[^]Å~UVS@ ] $ |, | 0 h8 fǃǃ f9uЍ f9u f9ufǃǃǃǃǃ[^]UWVSE]uf f HyxxPzxx )f KHPrpHPrp<xPrpш pHQPftxxu s/u!uX[^_]Ã낤X[^_]ftuutSfUVSEt.~%HPrpf[^]HPrpHPrpfǀǀ[^]UWVSEf f pHyxpPzx )fJ󉈼 ~xHPrpHPrpfǀOt=~%HPrpf[^_]ÃuHPrpHPrpfǀǀ[^_]Ã#UWVS,< E]} uEE싓Ex,E- +$  U= E䋋( ‰%0  Ef~ u޹ DH  9F9 >}w} fsKy{sCx{ p󉳼)}( E E܃ -E؉ fsKy{sCx{ p)EE E؉ fsKy{sCx{ p)EǍB  E؉ fsKy{sCx{ )EN􉋼}4:u]KqssCpss )f 9}t<W~ f 9}uċM܋uaM}Rt f849ufu-fu#fu 9f8tMA,iFM荋 MV9ED$ t$|$$E荓 f9uE䍓 f9u| f9ufǃǃǃǃǃEu,[^_]É؃,[^_]LR 9E fE\E fsCHKSCps )щf } Ǎq N ǃEf- ǃ+1 55UWVS7 9EyU yU 4qUU u#]f9[^_]Ã} Wu3fvf UWVS56 \Ɖ׉M$U=yaratA=tcidu-4$ƅt874$1GE01[^_]øV[^_]É4$茧ĸ UVS5 ߻MU Eaƅu [^]0[^]UVSr5 ÙMU Eƅu [^]00[^]UVS+5 RMU Eƅu [^]0[^]UVS4 MU Eƅu [^]?080[^]UWVS4 ĺM}EDƅt0[^_]É|$ED$E $1tE$g[^_]0E$KtxUWVS 4 <}Gt<D$UyƋGD$U$htE 0 [^_]F1 [^_]UWVS 3 ͹}Gt9D$U ƋGD$U$htE 01 [^_] [^_]UWVS 53 \}Gt<D$UƋGD$U$gtE 0 [^_]f1 [^_]UWVS 2 }Gt9D$U諁ƋGD$U$7gtE 01 [^_] [^_]UWVSU2 |ED$E D$E$ tSEt4}D<$蠤ƋED$<$ftE01[^_]s[^_][[^_]UWVS1 ED$E D$E$ytSEt4}D<$荀ƋED$<$ftE01[^_][^_][^_]UWVS-1 TM}Eƅug|$ED$E $twE$EtKUD$UNjED$U$det E8[^_]'0[^_][^_]8E$z[^_]UVSL0 sE D$E$uƉ$O=tciduE0[^]1[^]UVS/ #E D$E$wuƉ$IO=loobt 1[^]É4$юU[^]UVS/ ˵E$t.ƉD$E D$E$uE4$+KE[^]1[^]USK/ rE D$E$tUT$$X[]US/ 9E D$E$tUT$$Y[]US. E D$E$TtUT$$bY[]US. ǴE D$E$tUT$$Y[]USg. ÎE D$E$sUT$$Y[]US.. UE D$E$sUT$$Y[]US- E D$E$psUT$$Z[]US- E D$E$7sUT$$uZ[]US- êE D$E$rUT$$Z[]USJ- qE D$E$rUT$$ [[]US- 8E D$E$rUT$$[[]US, E D$E$SrUT$$"[[]US, ƲE D$E$rUT$$/[[]USf, ÍE D$E$qUT$$/[[]US-, TE D$E$qUT$$/[[]US+ E D$E$oqUT$$M[[]US+ E D$E$6qUT$$M[[]US+ éE D$E$pUT$$Y[[]USI+ pE D$E$pUT$$f[[]US+ 7E D$E$pUT$$f[[]UVS* E$D$Qt.ƉD$E D$E$pE4$VFE[^]1[^]UVSu* ÜE$D$uQt.ƉD$E D$E$pE4$EE[^]1[^]UVS* ;E$D$Qt.ƉD$E D$E$"pE4$EE[^]1[^]UVS) ۯE$D$Pt.ƉD$E D$E$oE4$5EE[^]1[^]UVST) {EU$T$UPt.ƉD$E D$E$boE4$DE[^]1[^]UVS( E$D$Ot.ƉD$E D$E$oE4$uDE[^]1[^]UVS( ûE$D$Ot.ƉD$E D$E$nE4$DE[^]1[^]UVS3( ZE$D$3Ot.ƉD$E D$E$@nE4$CE[^]1[^]UVS' E$D$Nt.ƉD$E D$E$mE4$SCE[^]1[^]UVSr' ÙEU$T$sNt.ƉD$E D$E$mE4$BE[^]1[^]UVS' 9E$D$[Nt.ƉD$E D$E$mE4$BE[^]1[^]UVS& ׬E$D$Mt.ƉD$E D$E$lE4$/BE[^]1[^]UVSN& uE$D$Mt.ƉD$E D$E$[lE4$AE[^]1[^]UVS% E$D$7Mt.ƉD$E D$E$kE4$mAE[^]1[^]UVS% óEU$T$Lt.ƉD$E D$E$kE4$ AE[^]1[^]UVS,% SE$D$vLt.ƉD$E D$E$9kE4$@E[^]1[^]UVS$ E$D$Lt.ƉD$E D$E$jE4$J@E[^]1[^]UVSi$ ÐE$D$Kt.ƉD$E D$E$ujE4$?E[^]1[^]UVS$ .E$D$QKt.ƉD$E D$E$jE4$?E[^]1[^]UVS# ͩEU$T$Jt.ƉD$E D$E$iE4$'?E[^]1[^]UVSF# mE D$E$hƉ$B=gntst 1[^]É4$c&tU[^]UVS" E$$t.ƉD$E D$E$hE4$r>E[^]1[^]UVS" øE$b$t.ƉD$E D$E$hE4$>E[^]1[^]UVS8" _E D$E$gƉ$A=atadt 1[^]É4$ztUEt4$zM[^]ø[^]UVS! ED$E$xt.ƉD$E D$E$gE4$==E[^]1[^]UVS\! ÃED$E$Jyt.ƉD$E D$E$jgE4$<E[^]1[^]UWVS "E D$E$vfƉ$H@=gntst 1[^_]É4$#P$UDžtڋUT$D$4$0$t U:[^_]ÈE<$E[^_]UVSd ËE D$E$eƉ$?=gntst 1[^]É4$#tU[^]UVS /E$!t.ƉD$E D$E$fE4$;E[^]1[^]UVS ֥E$!t.ƉD$E D$E$eE4$7;E[^]1[^]UVSV }ut,t$E D$E$ueE4$:E[^]1[^]UVS .E D$E$ZƉ$T>=loobt 1[^]É4$}U[^]UVS ֤E$|t.ƉD$E D$E$}E4$6:E[^]1[^]UVS U |E $|t'ƉD$E$3E4$9E [^]1 [^]US *E D$E$VUT$$`G[]US E D$E$UT$$G[]US øE D$E$UT$$H[]USX E D$E$請UT$$TH[]US FE D$E$rUT$$H[]US E D$E$9UT$$H[]US ԢE D$E$UT$$H[]USt ÛE D$E$NJUT$$-I[]US; bE D$E$莊UT$$I[]US )E D$E$UUT$$I[]US E D$E$UT$$I[]US ÷E D$E$UT$$I[]USW ~E D$E$誉UT$$I[]US EE D$E$qUT$$I[]US E D$E$8UT$$I[]US ӠE D$E$UT$$J[]USs ÚE D$E$ƈUT$$J[]US: aE D$E$荈UT$$J[]US (E D$E$TUT$$J[]US E D$E$UT$$J[]UVS õE$D$@t.ƉD$E D$E$UE4$5E[^]1[^]UVS - TE $D$-@t'ƉD$E$E4$4E [^]1 [^]UVS E$D$?t.ƉD$E D$E$蚇E4$S4E[^]1[^]UVS r ÙE $D$r?t'ƉD$E$IE4$3E [^]1 [^]UVS ?E$D$?t.ƉD$E D$E$E4$3E[^]1[^]UVS  ߝE $D$>t'ƉD$E$萇E4$@3E [^]1 [^]UVS_ ÆE$D$`>t.ƉD$E D$E$'E4$2E[^]1[^]UVS  &E $D$>t'ƉD$E$׆E4$2E [^]1 [^]UVS ͜EU$T$=t.ƉD$E D$E$nE4$'2E[^]1[^]UVS F mE U$T$G=t'ƉD$E$E4$1E [^]1 [^]UVS E$D$<t.ƉD$E D$E$资E4$n1E[^]1[^]UVS  ôE $D$<t'ƉD$E$eE4$1E [^]1 [^]UVS4 [E$D$4<t.ƉD$E D$E$E4$0E[^]1[^]UVS  E $D$;t'ƉD$E$誄E4$Z0E [^]1 [^]UVSy àE$D$y;t.ƉD$E D$E$@E4$/E[^]1[^]UVS  ?E $D$;t'ƉD$E$E4$/E [^]1 [^]UVS E$D$:t.ƉD$E D$E$膂E4$?/E[^]1[^]UVS ^ ÅE $D$_:t'ƉD$E$6E4$.E [^]1 [^]UVS ,EU$T$:t.ƉD$E D$E$́E4$.E[^]1[^]UVS  ̘E U$T$9t'ƉD$E$}E4$-.E [^]1 [^]UVSL sE$D$9t.ƉD$E D$E$E4$-E[^]1[^]UVS  E $D$39t'ƉD$E$E4$p-E [^]1 [^]UVS öE$D$8t.ƉD$E D$E$UE4$-E[^]1[^]UVS - TE $D$v8t'ƉD$E$E4$,E [^]1 [^]UVS E$D$8t.ƉD$E D$E$E4$R,E[^]1[^]UVS q ØE $D$7t'ƉD$E$HE4$+E [^]1 [^]UVS >E$D$a7t.ƉD$E D$E$~E4$+E[^]1[^]UVS  ݕE $D$7t'ƉD$E$E4$=+E [^]1 [^]UVS\ ÃEU$T$6t.ƉD$E D$E$$~E4$*E[^]1[^]UVS  #E U$T$G6t'ƉD$E$~E4$*E [^]1 [^]UVS ʔE$D$5t.ƉD$E D$E$j}E4$#*E[^]1[^]UVS B iE $D$5t'ƉD$E$~E4$)E [^]1 [^]UVS E$D$15t.ƉD$E D$E$|E4$g)E[^]1[^]UVS íE $D$4t'ƉD$E$\}E4$ )E [^]1 [^]UVS+ RE$D$t4t.ƉD$E D$E${E4$(E[^]1[^]UVS E $D$4t'ƉD$E$|E4$O(E [^]1 [^]UVSn ÕE$D$3t.ƉD$E D$E$5{E4$'E[^]1[^]UVS 4E $D$W3t'ƉD$E${E4$'E [^]1 [^]UVS ڑEU$T$2t.ƉD$E D$E${zE4$4'E[^]1[^]UVS S zE U$T$2t'ƉD$E$+{E4$&E [^]1 [^]UVS !E D$E$MyƉ$G*=gntst 1[^]É4$tU[^]UVS ŐE$F t.ƉD$E D$E$myE4$&&E[^]1[^]UVS E lE $ t'ƉD$E$$zE4$%E [^]1 [^]UVS E$ t.ƉD$E D$E$xE4${%E[^]1[^]UVS E $k t'ƉD$E$yyE4$)%E [^]1 [^]UVSH oE D$E$wƉ$(=atadt 1[^]É4$ btUEt4$aM[^]ø[^]UVS ED$E$`t.ƉD$E D$E$wE4$M$E[^]1[^]UVSl ÓED$E$Z`t.ƉD$E D$E$4wE4$#E[^]1[^]UVS  3ED$E $@_t'ƉD$E$wE4$#E [^]1 [^]UVS  ڍED$E $_t'ƉD$E$wE4$;#E [^]1 [^]UWVSY ÀE D$E$uƉ$&=gntst 1[^_]É4$M P$UDžtڋUT$D$4$ t U:[^_]ÈE<$E[^_]UVS E D$E$uƉ$&=gntst 1[^]É4$ tU[^]UVSf ÍE$t.ƉD$E D$E$5uE4$!E[^]1[^]UVS  4E $t'ƉD$E$uE4$!E [^]1 [^]UVS E$t.ƉD$E D$E$tE4$C!E[^]1[^]UVS b ÉE $3t'ƉD$E$AuE4$ E [^]1 [^]UVS  7u t%t$E$tE4$ E [^]1 [^]UVS ut,t$E D$E$sE4$Z E[^]1[^]ffffffUWVSk ÒE 0Ft%uFt$c4$[1[^_]Í: <$葎Ft<$肎1[^_]Ét$: $M<$^FUS D$: $D$: $^1[]US EU 9t8J 9H u(Rt<@t-T$$|[]1[]ø[]ÍˍUWVS) Pu F tPV|$E$u 1[^_]ËFD$E$ t|$E$[^_]ÍVD$E${[^_]US LjE @tUT$${[]Í0D$ ,D$D$oX$OUSE lE @tURtUWVSEtw} |$ ED$D$$TƅxEH $M…t1|$ ED$ML$$UU1[^_]1[^_]ÍD$ HD$D$EX$EU8cUT$<$]UVS8ut4$3[^]_UWVS uth9u^FtFN AM$DžtAFMtAMD$<$_M [^_]4$ [^_]1 [^_]ÍUWVS @gutP9uFN AM$Džt/FMt/MD$<$мM [^_]Z1 [^_]ÍUEt 9t1]Ë@ ]UȂEt9uP@tt ]1҉]Í]US]ÄEt 9t1[]ËU tH Q;Uw@tD$E $[]ÍU"Et 9t1]Ë@]UWVS}t;9u1G $ƅtGt"D$4$a[^_]1[^_]ÍUp‹Et9u @t]1]Í]UWVS*Qut 9t 1[^_]ËU tM 9uFtA F EP$UDžtŋE HɋUtYFtJL$D$ jD$T$<$rF~}~ t$si뮍UWVS\Ãut 9t 1[^_]ËE FtE $VF EH $M…tFMtS} |$D$ jD$L$$U裿FUV}~ t$oe륍D$ D$D$+X$tUSjÑEt 9t1[]ËM tM 9uL$$US#JEt 9t1[]Ë@tU T$$5r[]ÍUS~Et 9t1[]Ë@tU T$$q[]ÍUS{â~EU tG9u=t99 u5Rt@tT$$q[]Í@uፃٸfUS8~Et.9u$@tU T$$+q[]ÍfUWVS }u~$Ft  [^_]D$ED$ D$D$4$" tȋUBU$TDžtFD$ED$ UT$|$4$tE9EtX<$@w$ ƅt'D$4$aFF FE 0 [^_]D$VD$4$mtM1M fUEU @]UWVSzǝ|uM ^t|F9rItX^ [^_]ÉMD$$…FFM빍hD$ D$D$<$D$ D$D$<$D$ D$D$<$1u֋E& tЉD$$>u1 [^_]ËU tD$$uϋE&qD$$u럸 [^_]UWVSu} F t*19^ vD$ 4$u1[^_]D$<4$|u1[^_]ÉD$4$btȃuE >u[^_]>UVSu] D$<4$ u 1[^]D$/4$ttD$4$t̃uD$>4$tE u[^]UWVSu} F t*19^ vD$ 4$u1[^_]D$<4$etu tD$4$BuD$/4$,tD$>4$tE u[^_]UWVS|ƛx]< tD$$u1[^_]ÍD$$tD$ $[^_]US'x]D$$$tD$$N[]UVSw$裻ƅt'$葻tFFF [^]É4$1US_ÆwE$k[]UWVS:aw]u}E E $LEF t|Jvt/ut!1[^_]ÍBFrEPF(F ǀ u( t&/t&t>tt tJwՉ)‰VM t%]9u\$D$E $]e?/F$<>"G9tHv~ u#) t$=t&t tJw׉)Vx"xPVHЀ"u"uxzF(F(`F$>RFFFF ~%]D$ @D$D$<$w1[)щN x>FUWVS}E@tJ1u t 9v8u t(<&upatluAxt1[^_]pmpuxou߀xsuـx;uӃ'놀guxtux;u>hquxuuxouxtux;u"t7։>t/uE$EE[^_]ÍPEP0V(EPUSoE$觻[]UWVSsÚoUEy:$UzUD9uH9/t9wY/u9t 9t8/t)Ѓ=;փ.ƄfDž.U$ϦH UU/.pl@istX@XXXXf@ X<$pƃED$E D$4$j9E謦84$l$ 菦81[^_]{?1[^_]c1[^_]äƄfH1[^_]É4$kF$萕lj$膕ׁ|$4$n4$kUT$$UWVS0/Vj$W}BFtD$D$ D$ED$$X@}PtҋpG$uML$ $PDžtօl$ˏtPuDžLL$$PtЉ<$ftoƋPtҋ@~<$#ttЋ $P0[^_]Åu΍ D$ D$D$<$DD$ D$D$<$D$ D$D$ <$D$ D$D$E<$ D$ D$D$;<$'D$ D$D$ <$rUWVSnƍgE$uD$ED$$t{$u Ct2{t1$([^_]Á8versufxiouڀxnuD$E D$$t$DžtD$ED$$cu<$_1[^_]UEt]1]UWVSDlÓf$SUtEDžDžEU 9 u @|$t$ D$ED$$vTEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$Su1D[^_]ÃD$D$ E D$ED$$RtBEU DžDž; 넸D[^_]ËE%ED$ D$D$<$jU D$E D$E$]UE]UE@]UVS,Kd]C$$#[^]fffUSEU 9t6HZ1˃t"X@xJx3Z3B []1[]ø[]USchD$$k: $g[]UScÊc: $g[]UWVS4;bcM AQAD$ T$tjED$D$ uԉ4$͢3|$E$u 14[^_]Ét$E$Qt|$E$4[^_]Í_xUVSbE 0t$; $ԋ4$藮1[^]USeÌbD$: $zfD$; $1[]UWVSBbƉ莚D$ED$F$WEU;MErgEF[^_],8"u1UWVSúaljD$ED$G$|V!ЃtNEG[^_]辙8"u1UVSM UBAt%tOYA R9ˉr39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS`ƍhD$$h: <$dt$; E$@t $E<$dUЃ[^_]ÉE<$d$ )Ut֍ D$ $M|MAFAFA<$ddt$E$輅Mt+$ED<$;dM $UЃ[^_]ÉL$ME$M9uE<$cUЃ[^_]ÍLD$ D$D$@X$[UVSM UBAt&tQYAJR9ˉr49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS>e^ut 9u4$[^]1[^]UE@]UWVS^Et 9t1[^_]ËHX@t5P@wz1ɻ9Ӊru9[^_]Éȉw?ȉ19ljr.9[^_]ø@` VU4O]Et 9t11]ËP@]U"]Et 9t11]ËP@]U\Et 9t11]ËP@]U\Et 9t11]ËP@]UVS{–\Et 9t 1[^]@t'P@9ѹrۋE [^]ËHXȉEU;uErE [^]UVS\Et 9t 1[^]@t(P@9ѹrۋE f[^]ËHXȉEU;uErE f[^]USSn[Et 9t1[]@t#P@9ѹrߋE []ËP@Ӂw] []USZEt 9t1[]@t#P@9ѹrߋE []ËP@Ӂw] []Un‰ZEt 9t1]ËHP@txE P]US+FZEt 9t1[]@t#P@9ѹrߋE []ËP@Ӂw] []UVSYEt 9t 1[^]@t'P@9ѹrۋE [^]ËHXȉEU;uErE [^]UVS:YEt 9t 1[^]@t(P@9ѹrۋE f[^]ËHXȉEU;uErE f[^]US§XEt 9t1[]@t#P@9ѹrߋE []ËP@Ӂw] []U5XEt 9t1]ËHP@txE P]UWEt 9t1]ËP@9ѹrE ]U®WEt 9t1]ËP@9ѹrE f]UMhWEt 9t1]ËP@uE ]U/WEt 9t1]ËP@uE ]UVEt 9t1]@uP@xM A]ËP@M Q]UŸVEt 9t1]ËP@uE ]UKfVEt 9t1]ËP@9ѹrE ]U!VEt 9t1]ËP@9ѹrE f]UUEt 9t1]ËP@uE ]U¢UEt 9t1]@uP@xM A]ËP@M Q]US GUEt 9t1[]ËM tM 9uL$${USUEM Ut 9t1[]ËX@txx3H3P []USùTEM Ut 9t1[]ËX@txx3H3P []UVSSnTE] Mt 9t1[^]ËpP@uxx11 [^]UVS TE] Mt 9t1[^]ËpP@uxx11 [^]UWVSS]EEECt [^_]À{$u}S<-t_<0uzxtF&t9D$3D$$teU [^_]Éhu끉uoffffUE 9E]UWVSRƅuj$@訖DžED$<$D$G$}XEG,w0G4G8G<[^_]ÍD$$EEt#$@DžMy $/1US'R; $WV[]USR1D$$9Y; $V[]USQD$; $U@D$,; $w1[]UST{QED$E $D[]US'NQED$E $PD[]USQE$WE $W[]UWVS(PUM܋p4@,EEGEt@E<E tbMUD$E$CUMtօuE܅t!81ɉȃ([^_]ËE܅t8ȃ([^_]1ɉȃ([^_]1ȍD$ PD$D$zx$USPPt:9 u0H 9JD$ (D$D$x$ԧUVSɿEE 0t$,; $nF,v }FMu0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃D$ xD$D$$uD$ xD$D$$KUQl+Et9u@]1]US@+Et 9t1[]ËM tM 9uL$$tUS Ҥ*Et 9t1 []ËM9H uU tL$M L$@$5 []UWVSuÜ*u~$u7Ft=D$ T$VT$$-t V [^_]ËFD$U$11YtՋEH $MmDžtFVT$U$M$E9ED$D$4$]uE$ymT$$EͬE@xp U aD$ED$F$8Et|UF F9:"3D$ `D$D$$ي<$t[^_]É<$t$lT1( a8"ft_E<$tE%1U|—(Et 9t1]ËM tM 9u9]UVS0W(t$H; $yƃP; t$<; $`ƃD; 1[^]USݡ(E xu^D$E$耮[]ÍLUVS螡'uD$$.u<; 4$ռ[^]ÍH; UVSKr'ut9u4$蘼[^]1[^]U9'Et 9t1]@]U'Et 9t1]@]US輠&Et 9t1[]ËM tM 9uL$$UVStÛ&uFt [^]À~$tD$ LD$FD$F $u_D$ ^D$FD$F $tWD$$g-<; 4$HE 0[^]ÍD$$0-H; ǍD$ xD$D$P$ffffUWVSkÒ%ƅur$@IiDžED$E<$蔨ED$G$+EG,w0G4G8G<[^_]ÍD$$lEEt#$@hDžMq $p1US虞$E$*E $*[]USeÌ$Pt:9 u0H 9JЃ[^_]úrD$ D$D$$荄D$ D$D$$cUWVSW~"E 0F4N09V,tdtd|ED$D$ D$t$E$tDn4E 8[^_]Åt\HD$ D$D$e$裃[^_]É$mF$'4$m1[^_]Åt?E 8[^_]Í(D$ D$D$d$,D$ D$D$u$UWVS!ljEp,uUD$$htYUtt 9t%$$ [^_]ÉUMGE$F!UNjE$/!Ut$裰ME [^_]D$ @D$D$$$|1%UE]UWVS脔ë}9GE$ G4tMG4t=1M<B,U8$E茯MQ,E:UB49rɉ׉A4G8A8ME$) Mȃ[^_]1ɉȃ[^_]UE$2t`8]UWVS誓ut 9t 1[^_]Í~<$v0<$[^_]UWVSYÀut 9t 1[^_]Í~<$fv4<$[[^_]UWVS/ut 9t 1[^_]Í~<$E 9F0r<$[^_]ɉUWVS蠒u~<$t_9UuRD$$8`t:HE4$賭EpU9u%@V

17UWVS M]}  D$\$ۋD$D$ˋuD$u 9ƉD$1M9|$vFȉD$1\$|$tكۋt$t؃ڋuVȉڃ [^_]ËT$ƒD$u{9r92)|$ȉ뗅u 1t$1҉ljƉ|$PЉD$كۉ\$]U ] } D$ T$)ЉD$ ыT$L$ щL$D$\$T$ L$t$Ӊd$D$$9rAt;+t$$L$ D$L$L$ L$ډD$9sy+D$T$$D$1fffUWVSM]u D$ \$y كۉ\$ˋ}D$u9v2։1 M9t$v:ȉL$ t؃ڃ[^_]Åu 1t$É1뷋T$ƒD$u,9r9w)t$]U ] u D$ O T$)ЉD$ыT$L$ щL$D$$T$ L$t$$$9r't!)L$L$ 9s+$T$։UWVSM]u D$ څy T$ كۉډˋED$u9vJ19v11L$ t؃ڃ[^_]uR9r ;L$ȅu 11҉NjD$]U ] u D$ U )T$ډL$ щL$$T$ ֋ $t$щ9rt13T$9s11UWVS8_ÆEu Mt Mtxt|xHUPT$0PT$,P T$(P T$$P T$ P T$P T$@D$|$L$ ED$D$4$§t8[^_]E11{EtۋE8[^_]USM] CfACfACAC A 1T T u[]US]M CfACfACAC A 1T T u[]USM] ȉCffACffACAC A 1T T u[]US]M ȉCffACffACAC A 1T T u[]UWVS4gÎ}u ?Mt E<$i=$t4[^_]À-uFD$0FD$,F D$(F D$$F D$ F D$F D$FD$FD$FD$ t$D$<$N uFx,EtEtED$4$24[^_]Ƀtʃ ?iIh;  @tL:u DŽh; ?x#`> @] `; \U1[]Ã҅~h; 1  9t:u뚸#[]UrE@M `; 1]UrE@`; ]UrE@DŽd; 1]US]Cu U C1[]US ZrÁd5u#ED$E D$E$u []$!0 []øUSq"[]USq$-[]USq$>2USqd5u1[]$|1[]UE 9E]1USLqsE EED$D$vtE$"[]USq;ED$D$wt@E$"xEu[]øffffffUSpE t tKt="/[]EED$D$tE$E"[]EEUS JpqD$D$^t E$" []UEU P(P$1]UEU P(1]UEU P$1]UE `` gPP]UE@(]UE@$]ffffffSL$D$ t9tEA&v€tuuuu˃t@Au D$E D$E$84 []fffffffUVSEM )z@&H`b҃⻃rQq҃ⶃwQÁ@QMK@v%Ax Ƀểr rɃᶃwJÁJwu Bxƒ҃⻃rYƒ҃ⶃwQ%==uYAxf [^]ÁujBs뒁@uUAs+ cuwuml{'ASvA-YATf [^]B-BSYA-f [^]ÍYAtf [^]?pstAdta-UWVS5l\D$E$^ED$ED$E$aǃƜ;6u E $[GEEtuEMED$UT$4$Mu E<=tH4EE4u;}5)D$D$$9c1[^_]É4$봸׸)UWVSjE{h|lptDžxLEEEEEE|(D$ut$$ƒE$D$t$$#Dž<Dž@DžDDž8H|$8D$$DžXDž\Dž`Džd|t DžX}tXuĉ4$XD$4$I|$4$aD$04$;6D$hD$t$ D$;D$0$,64$,4o'8D$t$0$߫tD$(D$$.D$$D$$D$|$$(4Ё[^_]D$;$41҅‰Ё[^_]Dž4`&,Dž4D,D$(D$$l,o,D$(D$$=D$$D$$,"ffUWVS@gǢ|$(D$T$L$,tȃ"|$FD$8UT$$\$(#u܉L$8ƀ-5+uD$D$,{L$8D$0T$4D$T$ $D$\$(D$$T$ D$0T$4D$T$ $D$=D$L$811҉D$8T$1D$D$ uǃp> E ;M!8-pxt> -D$-E$ǃt> --|$E$^tAx:ǃl> >u[^_]Írt> :u>ut2E8:t*迭|$ D$D$,$?[^_]ÀxF_>t%l> [^_]Àx:tV9M:E8:tCb|$ D$3E l> ǃl> v:US I8D$ D$E$讫 []USHD$E$$]]fUSHE$1[]UWVSHD$}Et|tAt wG W9w2G 1҃[^_]É]E G wW9vߋwMx_);M E|jE G W9v멋E E t\$LD$ D$D$X$/E Uy\$/H\$T/\$CD$ D$D$X$T/UWVSHGoEH 1ҋu1׉u}9}EE}E@U29w|)ȉ‹E9wI<u sKu.u&]K K [UR9w [^_]ÉftЉ<u ru^uf뜍GD$4$JƅtYE@)ǍD|$D$$?E0]ECK 7Pf뉃JUWVS E uE D$$‰$Dž0E GGG 1D$D$E1D$ 2D$D$<$t7D$$E4UЃ [^_]1҉Ѓ [^_]ÉEM<$"$rMUc8$L81US DE D$ED$,X$Lk []USDèED$ E D$ED$,X$qk[]USCDjU ML$ D$T$E$c[]USD-D$ D$D$E$([]USCU D$ D$T$E$[]UVSCóuD$D$ D$D$4$Dt [^]1[^]US7C^ED$ D$ E D$E$[]UWVSB#uE D$4$~7F0u D$4$[^_]tJF0uҿ1F0fffUUM EyEM EB]UWVS u] }u6)t2yD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSAE0x$tu[^_]1[^_]UWVSA} tE}t+fp f@UPx$MH,UP(UPDUP [^_]þEu1UWVS #AJ}u$ ‹EE Bzr EBt7tpE tZ`7E 7EUUtnMfH f@PM H$x,p(@D7P [^_]Í7E뭋M t`7E E딉UU$W1 [^_]1UWVS@EUB0~4r,txM q J$tE D$ E 0xt$|$$l[^_]US ?þED$E D$E$u []USf?ÍED$ ED$E D$E$t[]ÐUWVS$+?RuED$E $E5F fJfF D$ED$E$Dž;EEF FFFFFF0tN@9t $F0ǀǀ @$MF0ǀǀEt9tD$<$WEfF f~vBF$F,HF(F E$[^_]èHV Ff"UED$ED$E$<DžUUEU9}F$V F F$6qD$ D$D$4$S$[^_]EPEt=8t,38t"v&Ec<$I}F$V D$ED$E$>됅yF$l4$4$1<$1pfF M1YUVS;uf~ tzD$4${F0tN@9t $ F0ǀǀ FFF t1FD$4$H1[^]ËF UWVSJ;qUB0~4r,t} p J$t} Lj $ M Q!Ѓ[^_]UWVS:uD$4$]nx$P8D$4$f[^_]É4${US t:ÛED$E D$E$  []USC:jED$ ED$E D$E$[]UWVS, :0Et8uj}ԉ;$FjFF )t$|$$̻,[^_]ÉEԉ$E؍hEEu}[w끋uUJ9eEx9]Ë]Í]UWVST9)}E uu-6uM tV9utRD$2@D$}<$<$PEt;UED$|$E$Uuqx<$PEuŋEu+0ЃT[^_]Ë@E< >tSFML$$Cu|$ w L$ HD$D$2}<$<$PlH\ZffffffUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UE@)@3U u@ @]1]USEU ]xuQwLHtCu?HH LZYZYR Q X SP ҍ1[]øUExuxw1U ]ø]UExu@ u<.w]ø]UUM zuB u<.w~ 9| D ]1]UExu@ u <.w ;E ]ø]UEu E D]1]UWVS 95`uU }Euu0[^_]ø]YUUzuBu :Br]ø]UUM zu#Bu:Brx9s D ]1]fffffffUS -3Ttu []JHT$D$$ []UE ]UEUJσw@)P U 1]ø]UWVS]M4{ }}9+E1|!})1׉;>EE 8th@‹Mϋu sftftu+EP)‰׉;>+US 1[^_]ø[^_]ø‹Mϋu ruu&넍s*yPfUWVS]M}w~4{ 9t~)1UD!ЋU+U1UU֋E M )Q)ʉUEUE)C [^_]1[^_]ÍsuUVSU] z)uGB1w<v5J q 9r#L t18tP9r P9s[^]ú9rB9v$8tP9rP9[^]UVSM] y)uGAPσw<v5Q r 9r#T t18tH9r H9s[^]ù9rA9s+0;ut)tH9rH9rع묉1UUE ttuB]ø]ø]UWVS/9EEEuM<ٸ9E|0)ߋU t;} whEtfEEtlt5PKHKL$MD$$U]XUM MPU [^_]ÿ[^_]1vUWSE]~OSt<);U www؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSU E]tvuqUt6E9vt0u0H9r HD9s[^_]ËEŃp9rxD89rЋU U:3+E[^_]øUWVSU EutoujUt=E9s t7H9rxM9s1E[^_]ËE뾹M9rω8t E렸˃U:uE+EUWVS] UЋ}uރstft[^_]uuBfUST+{D$D$ED$ ED$E D$E$u[]fffffffUWVST*Ɖ-6M1ƅD$D$D$D$ D$T$4$dt,DžM+T[^_]Í11  rFDžDžD$ T$HD$<$.#stjƅD$D$D$D$ t$GD$G$ut$$tu<$e"$R"DžUWVSTS)zƉ-6M1ƃ> ƅD$D$D$D$ > D$T$4$D$D$D$D$ D$|$4$t;DžDžDžDžDžVDžDžDžT$ D$HD$$3!tjƅD$D$D$D$ t$GD$G$ut$$thuGtLD$ D$HD$$$? 1U+u)T[^_]Ë묋$ ܈UWVS'>EE EE-6M1ɅD$D$ D$D$$2eWD$ D$D$$`t6D$ D$D$$(dƅ3$袪D$$D$$l$ZD$4$F2$ $t&tw$r$t$̩D$D$4$hU+BĈ[^_]Í @$F- u,D$$JD$/$6pt(D$D$$kPD$D$T$D$ [D$t$$D$,D$p$$@D$,D$`$߂$萸$,D$G$观$X@$8u ;D$/$D$|$ |T$D$$ɿD$D$T$D$[D$ _D$t$$~D$D$T$D$[D$ ~볋D$,D$$w,D$/$P,D$>$.Y,D$P$$踶UWVSp!×Eh-6E1p ׉lfDžpD$D$$xKfDžrlT$$wx1rfhE+u=Ę[^_]ÿAl<$f,lJUWVS ìEhU-6E1pl } t.} tn/E+Ę[^_]ƅpt BtE qD$D$E $譂Džy2ƅptËBxB |BEBEfDžrlD$<$xrfh=l<$lU D$E D$E$]UWVS7ƉtE|E xE-6E1zDžDžDžDžL$D$$&ǃSDžDžDž,D$FD$$vDžD$D$<$?FD$FD$<$i^<$y?8018=~4$FtDž.8#tf|$|v D$D$$͟U+pĜ[^_]Ãp$M똋F?BƅD$D$D$D$ |$FD$F$A|$${vƅD$D$D$D$ |$FD$F$u!|$D$$D$D$<$+D$D$<$A+$aD$ @D$ZD$,$_8D$FD$$DžD$$MD$ wD$D$$$D$D$<$$9fDžfDžD$D$$ D$L$4$4$ҋk<<4$D$t$<$ |4$D$t$<$x4$D$t$<$˛D$D$<$D$D$$ݛD$D$D$D$ D$D$ $u(4$Y=4$Y=$t$H<$@PD$D$<$Džx$w4$뗋%D$t$$_ PD$t$<$~t2$Iw4$~1tD$<$"w$ ^?y$vDžUWVSl`Ç}EEEEEEEE-6E1E fD$ y D$D$ UЉ$UEEEEEEM MEEML$ D$UT$$ukEPt%D$T$B $UUEML$ML$M $M;NjE$)E+u1l[^_]É$D$D$s$ wUD$ED$ED$ED$ ED$E D$E$h]UWVSluEEEEEEEE-6E1E fD$ y D$D$ UЉ$U3EEEEEEM MEEML$ D$UT$$*E@t"D$D$C $U>U9D$$ tM 9Ht?ED$ED$E$MEwƋE$e E+uhl[^_]Í$#D$ ED$ED$E$ME 뭉$ D$D$s$ uUD$ED$ED$ED$ ED$E D$E$ ]UWVSEdE TEPEX-6@]1D$pH$¢DžLDžDph,`,\dD$ D$D$h$4D$ h4$Sp< `\ l4< t4nЍLDSt l< F< uȍV< t< tщ< u Xvt < u;h>uPp<+<-pq<@[LDH\$ D$D$r$ ؉DžL<+tr<-:lt$X$Њl@81FF<@lFD$zqS<@0LDH\$ D$D$r$DžLhUTd J4$褾 u6F<@f lFD$X$}؋llHD$ XD$D$F$;lltbqUTqUT؉E@M+ [^_]DžL1lHD$ XD$D$F$`؋lUTDUTDƅpypUWVS۔E,E(E<-6E1ǃ> U@D$D$ D$DD$<$ݰ@D$@ D$4$fD$D$4$豈R84@@ $p@P T$$Gc@@$(HD$4$0t$D$4$pB0|%=> $Ӽ8$襼4$跼E+{[^_]þōHD$$0…tG(D$ *D$0$L$$[0x+t7@;At,5> > |t> (D$yZ]}3}3}3}lj]1Ӊ!1׉u]yZE|3tu13uƉ]3]!3u|yZ։U3p3U3U‰ӋU1!3UxEyZډډUt3Xh13]É؉11t‹En؋Up3P]13|‰13]p nˉӋUX3M3M3xM11MM9nMP3}3}3tlj}11߉}}7n}u3u3u3pƉu11Ήuunu։U3U3U3U‰U11UUnU‰E3h3|3EE11EEnE؉]3]3x3]É]11Ӊ]] n]ˉh3M3t3MM11hM9nh}3}3p3}lj}11߉h}7nhu3u3u3uƉu11Ήhunh։U3U3U3U‰U11hUnh‰E3|3E3EE11hEnh؉]3x3]3]É]11Ӊh] nhˉ|3t3M3M|11h|9nhx3p3}3}ljx11߉hx7nht3u3u3uƉt11Ήhtnhp3U3U3|‰p11hpnh‰E3E3E3xE11hEnh؉]3]3]3tÉP11։h nM3M3M3pM ӋP!ى! ˋM9ܼˉ}3}3}3}lj} ȉ!׉X!ȉ }Pܼ}3}3|3hlj} #X! }ܼ։׋]3]3x3]É] ӉP!É! ڋ]XܼډډM3M3t3ME ؉!! ȉEEPܼEȉM3M3p3MM !މX! u>ܼ׋U3U3U3U‰U #X! uܼE3E3h3EE !! ؉EEXܼE؉؉M3|3M3MM !X! ً];ܼى׋U3x3U3U‰U X!Ӊ! ڋ]3ܼډ|3t3E3EE !! ؉|EXܼ|؉ˋx3p3M3M| !X! ً|;ܼى׋t3U3U3U‰x X!Ӊ! ڋx3ܼډp3h3E3Et !! ؉ptXܼp؉ˋM3M3M3|M !X! ً];ܼى׋h3]3]3x‰p X!Ӊ! ڋp3ܼډE3E3E3tƉuΉ މ!Ήh!Ɖ ؋uXܼ؉΋M3M3M3MM ֋h!! ً];ܼى<X}3}3}3plj} щωP!!щ }h7ܼX]3]3|3]M !׉! MP9ܼߋX]3]3x3]É]11h]bhU3U3t3U‰U11hUbhU3U3U3U‰U11ډhU bʋhʉM3M3p3MM11hM1bʋhhE3E3E3EEh1މ1Ћu>bU3|3U3UƋh11ʉubډXU3x3U3U‰։11‰Phb]ډދ|3t3E3EX1E1؉h9bNj]]x3E3E3E]11ЉxˋX bȉȉt3p3U3P‰ӋU11t3b|U3U3U3h‰Ӊ11‰X};bډډUӋp3E3E3xNj|1ډ1pbȋU<}E3E3E3t‰1E1ȉH|:bMȋMM}3}3}3XljM1}1ωUbˋ}}}3}3P3pljU3U1ljM1bNjE3E3h3H‹E11؉UM bЉE3E3x3E11EMȋMbʋEȉE3E3t3Ebʉ11E3E3X3Ebʉ11؉ME3E3p3Edbu11ƉƋE0`X\xMlH LPT-6}+8u Ĵ[^_]ËTGUE#Eg@@ܺ@ vT2@@@]UWVS EPEЋMAs EA?JEЃ?v|@)ЉËu<u uyUEHL$$U);Mu} T$4$qڃ@;Ur)]] Eu<u sCtft [^_]äfzuZuAUuLuT] EDE|fE pCfUWVS$gjE}}] -6E܋8}11u1҃‰уTuD$}䍇 D$$ C%=t) D$|$$C%=uD$t$$Ut#1у4 uߋE܋}+8u$[^_]Ë])EffffffUWVS(WiE؋}u -6Eԋ]1ۅtX|$}܉<$]i1 F TFuF(}ԋu+7u([^_]$)]Ȭƅt둋]vDUWVShuE E}-6M1ɍ $sD$@4$3fE ES1;1;EEE=TD$|$$eD$|$ $;uE})EUE Eu-0$Rf0D$ $U+[^_]øGџ0$e輟0t1D$ D$|$$$e1sD$$~t΋ptEUyRBeBUD$D$D$D$ E D$E$]UWVStgÎfUUEE-6E1u4$DM L$UT$4$ED$4$M+ut[^_]AfffffUE@@#Eg@@ܺ@ vT2@]UWVSE 8XpuH MPUHMpuPUH Mp$uP(Up,uH0MP4Up8u@<|E\EHp@ URl1p1‰x\ l‰T ωh11׉tp߉` 11Eh d11Eh  11؋UPd 11U 11} 11u  11]  11E  11M 11U 11} 11u 11]  11| d1lj!3d}9yZЉX 1!1}:yZd X1!1ڋ}8yZX 1ljd!1NjtyZ  d1ʉ!1΋UyZ Ƌd 1!1Ӊd]yZd  1!؉X1|9yZ d1!1}:yZX 1!1ڋ}>yZd ljȉ1!׉X1xdyZ d 1!1΋EyZX d1!1ӋEyZ ˋd 1!؉d1}9yZ  1!1}:yZd 1ىʉX!1ڋMdyZ  X1!1NjMyZ ߋX 1Ήdu3nd  1Ӊd]nd ˉd Ӌd 1]n dӉ 1]nd 1ډdUnd dЉ 3d|n  X1΋M n dΉ L1ËtnX d d1UnL d 1Und 1ډdxnd  1ljd}>nd 1Ήdu3nd 1Ӊd]nd  1dEnd 1dM nd 1!1‰dtܼd  1׉d!1ω}>ܼ<0  1!1֋Eܼd 1!1d]ܼd 1؉X!1x9ܼ d1!1ً}:ܼX 1!1‹}>ܼ d Ɖ1ЉljX!1ϋEdܼ 1!1֋Eܼ X 1!1d]ܼd 1!1dEܼd 1!1ىd| ܼd 1!1‰dUܼd 1!1ȉdEܼd ։d1!1֋Eܼ d1!1ËEܼ ˋd X 1ߋENS  d 1xNSX 1ʋENSd X׉ 1‹}d>NS <d 1};NSXӉ ׋d 1؋}:NSȋd d 1‹}9NS  1ʋ}>NS d X։ 1Ћu7NS ։ 1t3NS X d 1ËuX2NS ˉ Ӊ 1֋]NSd щX 1]dNS X L 1ʋ]NS߉ H ʉd1|NSL@ DpҋT ы`1ً\}>拢Plыh 1ϋu2拢P p׋PЉ 1E拢P h 1ډh‹x拢Ph  X׉ 1֋}8拢P  1}9拢PX h 1}X:拢Pى щ 1׋M 拢Ph щˉX 1Mh 拢PX 1ډhU拢Ph މh1֋|拢P XЋh 1]拢P  P 1t拢PXh Ӊ 1ϋUX拢PP h1U拢P h Xщ 1ڋM拢P 1щ!1ދM$M\ X h1!1ЋMX $M\  1!щ1M$M\h 1ΉX!1Njuh3$M\ h1!1ˋx2$M\ X 1މ!1u0$M\h 1׉X!1ދ}h8$M\  1!1Ћ}9$M\ X 1h!1}X:$M\ 1!1Nj|$M\h 1!1ˉh]$M\h  1!1hU$M\h 1!1މhu0$M\h 1!1ЉhE$M\h 1h!1t$M\  1!1NjU$M\ h h1Ë|>pm  Љ 1ʋE>pmh ׉ ։X1Ƌth8>pm 1؋}9>pm X 8 h 1Ћ}X:>pm؉ Љ 1E>pmh X 1ˉ؋]h>pmX hЉ 3hЋU>pm0 Љ 1E>pm h 1ىhM>pmh h ыh 1ЋM>pm hщ 1M >pm׋h X1ˋM >pm  hщ 1‹x>pm X 1M>pmh ؉Ӊ X1]h>pm 1!1ЉËEvmz;X 1h!1Evmz h1!1ˋEvmzh 1!ډX1‹tvmz  h1!1EvmzX 1!1ًEvmzh ׉1!ȉX1|hvmz؉h 1!1xvmzX h1!1ˋUvmzh 1!1‰hUvmzh  1!1hu1vmzh  1!h1ً]vmz  1Ӊ!1Ћ]vmz h 1!1h};vmzh 1!1ˉh]vmzh 1!1‰hUvmzh 11MΉ4 11| 11}  11]  11t  11E 11M 11} 11u 11]  11E 11M 11x 11} 7 11u މu d T}wpDw13E] lHىO D d@1ًLu0NS\HuO `ډĴ[^_]UWVS]CSƒ?@)ЋM41s{s{9w[uf}?v/1@} D$$#v@9us1;Es/)EE E|u sltft[^_]1;Erу[^_]ÉE|u sfEuTEuKEUCD$$U)9uEr} `uTu;xfEtfuKu1MEtffmM qHMUWVSL]} -6EM1ɋGWEU?@)ƒw)ƒT$@D$<$ D$ED$<$t(OSSs9uݺ\1u.u4tftEM+u[^_]ê[tfʼnj'UE]UU f%f=t1]ÁE ]ffL$$Yai qyD$A(tQS[tKRjjG [1Í&t&T$D$ Zbj rz $z(t RPS[$KjRjG [Xt@fffD$$X`h px1Ít&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[ÏJRjjG [1Í&T$D$ Zbj rz $RPS[JJjRjF [Xt@US !JED$E D$E$, []USID$ D$ED$$F[]USõID$ E D$ED$$Mq[]UST{ID$ E D$ED$$q[]UWVS,?IEEED$D$}|$ ED$D$u4$#6EE ED$D$|$ ED$D$4$5\EEED$D$|$ ED$D$4$5EEEED$D$|$ T$UD$4$55UEt>MMMEM <wE)Ѓ9uEEED$D$|$ ED$D$4$4؃,[^_]8 uEƀUGUWVSh+G8E ut$$8E @B1NjEEE1EUME1ȋ}Gt$$xx8E @B1Ƌ}E1UBME1ȋuF D$E$`5u(8E ]ٸ@B1E1؃h[^_]øh[^_]$'+8E UWVSۿFD$chD$E$guEǰ,@t&tD$E$u܉[^_]D$D$E$Ggt 1[^_]ËEpD$$CD$4$gE@<-u?EP,DPtEPD$ ED$$U!MU9p9g^My+th)ƍF߃1BD$ŶD$4$ifE@t<+ !M?!UA\DE?w°,t u]Ë u@u1]UDEP>w °,]1]UWVS(½Cu}܉|$D$4$)SxFNE uD>wg86EظыE! MD$|$4$R([^_]Ã>w086EظE e{{UWVS&Cu D$ to!D$D$`E <$蕂y)@E ,t@@E [^_]ÍU T$ t$)‰T$$ 뵍Mt }#x!t }#x!t }#x!rt #X t #X ރI#H ΃?lP!փ&EjUWVS`Fm@u>(EEEE}|$EԉD$$<$h$EhD$|$$EBf~uU)E4$jUtsuփWQuRN>w2MϋMM}R tUUw~1҅ډЃ[^_]É)Uu$erЃ[^_]ËE$$jEUMt>MUt$D$E$RMUk^v J}B FۋrUWVS訟%DdhpE\} uElEX-6<M1f]9r9f>*uf~*u1f~*@DFP;\XD$lD$ PD$|$\$phdrhfDžHdf8D$D`D$T$Rl@ @T $P ``l@ @DfTt4p8`$TЅ$lS t%XYLYL x .& h;pHfKfu9pH@u5l4d#6|%= P\hS;8sfC/fXD$lD$4$pddhfDžPDž@DžHdf8tldIu|%=@tn1ɋ<}+8ȁ[^_];PXf?D$lD$QG$phddf5TэUF9t3狅T$D<``?lpt=1dATDYD$T$օul@ @T@`x .Vxfx.Apf8` p`$@lPpl@ 4Y\f9.k@k\hCSXD$lD$<$pdlP @pDbXpND p+lP 1G=6vDXh/lP DUWVS>e`։ϋUE dE\-6pM1fhl1 fy9v7fFftYf/uڅtQfF/f/u%9wp}+9İ[^_]ftLhl맅t:\D$dD$ lD$T$$h`|ftld‹`u{dP t"\HhHht$f~/t|%=@=t)d@\‹`%11ɍX`JfhhuNX@tSlL$$dP(u|%=@q9v/^uNlL$$udU/.UWVSD轖׉-6]1pf~ fb"f*ff ftFf?f[uZىX!Gf>Vf[ fuffW uAO f?TW рO N;t fx*4f*΃!B f7f/-B9uݸ2\$|$$]+.D[^_]Írfzuf[VpV f f]uf[!u Xf@!Zf]tIډˍKf%f2f-uBf]ifC-Kf%fCrZf]u։ځO Af]mD$D$ D$D$$M6P f9sQfPfu98t6P9fx*P9fx*W ; T$ D$)L$GO$ ѓ$3…?D$D$ D$D$$G5nGu^ f[!)Z-efP94NUWVS9։)ӉσXPft:1ff}tMCftf[tHf{uCfuM u1[^_]Å~릍sCf]fu돍ZJf]8t$Q D$\|$4$Dt8t$Q D$Q D$4$-tD$\D$$Cƅ8tщ$7uċPtP >t|$$VuቻQ ?xuxu U+8[^_]ÍD$\|$4$B.8t߉Q 8#kD$\|$4$Bt8t㉃Q D$\|$4$B8t߉Q 8xuxxu x Q 8sxwx]Q D$\|$4$2BtM8t$Q D$\|$4$Bt"8t$ոQ Q ueQ D$D$h$lQǃQ B;T1mǃQ ǃQ T$$puUVS w:Q tutQ [^]ǃQ HD$4$"AQ uEt$($&EUWVS vuǃQ Q t1$ot$Q $tMu [^_]ÍHD$<$@Q u͉E|$($E뼍Q [^_]UWVS uuǃQ Q t1$Xot$Q $tM(u [^_]ÍHD$<$?Q u͉E|$($E뼍Q [^_]UVSNuuǃQ Q t$nЃ[^]ÍHD$4$]?Q uЉt$($_1UStQ t$d$ǃQ []ffUWVSDtuĉUMЋ}0,E,Eԉ΃UƍFE܅ÍTMDAtEEE? *iVЍL]DS<*u,U܋utȍ\ DNtE<*t݉U].X$k>}+8 4[^_]É4$6t$ D$ED$E$C$5E[1Dž;~2D$$j:T$D$ |$ML$M $D$D$ |$ED$E $9t0;1D$ D$D1D$<$oƄD$D$ |$ED$E$@ƒDž(8-؉DžDžDžDžDžDžUWVS<j*Eu -6>}1D$ D$}|$$uRDžDž$;$;u+0<[^_]É<$<3|$ D$ED$$B$2NX1Dž;~2D$$7T$D$ |$ML$ $D$D$ |$ED$$9t0;1D$ D$D1D$<$lƄD$D$ |$ED$$6ƒDž &8-؉DžDžDžDžDžDžUWVS<g@Eu -6>}1D$ D$}|$$uRDžDž$8$8u+0<[^_]É<$R0|$ D$ED$$8$ 0NX1Dž;~2D$$4T$D$ |$ML$ $D$D$ |$ED$$9t0;1D$ D$D1D$<$iƄD$D$ |$ED$$,ƒDž (#8-؉DžDžDžDž DžDžUWVS 2dY}"D$E D$<$$ututЍv [^_]UWVS c}"D$E D$<$utu6tf [^_]UWVS qcØ}"D$E D$<$ututf [^_]US c:;6D$E D$E$f []UWVSbEEM -6E1EUt^Ǻu )ԍT$ MJtJx9uT$E$ o}+>ue[^_]úUWVSEbdEEM -6E8}1UEtoӸ{u )čD$MHtMXʋy;uT$D$E$j}]+ue[^_]ø롉KUSaòED$ ED$E D$E$ΣUS YaÀED$E D$E$;US .aUED$E D$E$N;fffUWVS `"ƉUt- t D$4$!u+E [^_],DPu 1 [^_]É4$蹡 [^_]U`°Et8t l1]ø]UWVSXX`-6EM1ɋED$lD$Ẻ$_R }e1󫍃R EЋM̍R |t:tEЃ9s EЄuR t$D$Ẻ$&dFD$XFD$Ẻ$ dEЉED$D$Ẻ$cx/Eй €XR $_1D$:D$Ẻ$`StXR EԉEȉD$D$Ẻ$gvEԉ(R EȉD$SD$Ẻ$ft Eԉ0R EȉD$\D$Ẻ$ft Eԉ,R EȉD$KD$Ẻ$ft Eԉ4R ED$ t$Ẻ$bE0fR EЉ$D0EȉD$D$Ẻ$+fXEԉ8R EȉD$T D$Ẻ$eFEԉts4$xD9u n9tg8/t9spz/t9u)ЍpvD$ t$T$W <$ZƄW [^_]þ`À8/u w뱉¾USM ^]>%BU؅7%M EM$U(ED$t$U$M$UED$t$U$1uE t Ex E@MA]؅xM 0< jFE0M]F0< }uJȉɸ)9ȉ|FM]EE0< E؉EE@0Ɖ9ȸ }}1M E]؅MԉL$ ML$D$4$ƉEuM EU$ CƉEEMAEPM1M U$5ƉEM U$c1ɉƉEM EP$ EE؃My uAM U$c1ɉƉEM̅?EHQ)ȍEEMAMEHM M؅PEM $=1ɋU ƉEE M E؅EYE؅EM EP$;1뤉M EMM ElU$'1ɉ}ƉEE-lMAEMiM E?M E؅ZM EE؅CEM E؅)M EnM EU$c1ɉƉEE ME̅t+EXQ)Ѝ)ىMEHE8M EP$1ɉ`ƉEEyMZM U$/ƉEM躓$I)))EHEtE܃  }EE@EE@El‹E)ЍH$I )))ыuȍDU)D+EЋMAME܃ULZDSM؄tE0DV@)ˋE@ @$MH(1EusuEPuuE؅uEPuuU؅{EHQ)),i)\P(\= ף@MAQ DAME܃z1EDdEsu{M]S3lʋEDH@YEDH@DP@SDP@St DP@uD$$MM)iuV$V(EËM UMEЉAME[Eu؍NM>TVEDP@NM~CV}1ɀ}zEU}z]M 1(NN dJ|EEڋEP$@(E؉EW~}ED$E$0Å9Mu EPtJЃEM؉M}]EMDA} Q)ʍ)M;))ȍOE]DA@CÉEDQ@u1fA1ڀvVM)ٍ)ҍJEMMʋEDH@IK뮋]D$$ME t,MA M)iuV$D$$MEoMuN u6u؉ڋuV$UU 76,D$ ED$E D$E$]fffffUVS<6U E-6M1tHMȋHM̋HMЋH MԋHM؋HM܋HMHMH MH$M@(EMEȃt'tTt7U+uR<[^]ÉD$D$t,E$ىD$D$t,E$D$D$t,E$蛗UVSu] 1t  9t)ʉ[^]UWVS5ػE0uto4$xuEpEt';Uu"|$t$F$譗V9UtމuE tH9utFE]E[^_]EUWVS 55uU Mt;A t+ ÃutF\$D$$ [^_]ffffffUWVS4ºD$E$EU JND$}|$E$ƃlE $fELǜ;60t6Eu01[^_]ÉL$M$U#UM $ tE $WEMʉNjusStftM|=Eu stf`Zu@u'ӨuEuP똋E|fE밸xUf`UVS 2ٸE UtuD$E$g [^]ÉT$D$E$ƅt$Tt01 [^] 1뼋E [^]UWVS,2SE 0E,}-64M1Ɂ}D$D$E$-H@hDžDžD$$蹻D$h8$膼hǀPǀTǀX84$8Dž@fDžDUfFHDžLTDž\dDž`DžX|$ ,D$0D$4$WDžx 4$u4M+u8[^_]ÿ UF0qUT$ U T$,D$E$]US 09ED$E D$E$E []US/ED$ ED$E D$E$-D[]UWVS/εu}}t}D$4$4$'F0tN@9t $pF0ǀǀ FFV Ш\}UED$ED$4$HU …tIME 19tуM}tIfV M N~MtP~IU}<$E U 1ʀ뢃fV M N~UFEH+6N D$4$E[^_]ÉUF$9U\}1EfV FVCVFD$4$E[^_]F߉~eMU<$E UMt19tU $M}E MUui4σUWVSN-uMD$ $MQ( $MؿMA uoD$ D$D$A$MQ(Ɖ!ЃMt!A t?A)׋A0tA<)D$ $}[^_]ËqPyTut֋t+AD$ $CUVSO,vuD$4$V(4$߾F D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$EUw0E[^]ËVPNTUMutt+FEUTD$4$D$4$UWVS+:E8ep >EFt$V tQFtB1ɉωMT:0$V T:($V D: $M9NV w$F,t$F4t -$nF8t$_4$W[^_]UVS%*Lx4$|[ D$E$U4$_[^]UVS)x4$7[ $U4$![^]UWVS)ȯx<$[ D$$YƉ<$ٳ[^_]fffffUWVS K)ruED$@$bED$E $vcEt9t$}$Mt$u ǃtt$$)uEPut$mEE [^_]UVS(̮4$\ D$E$b4$߲[^]UVS`(Ç4$跲\ $+b4$衲[^]UWVS!(H<$x\ D$$PbƉ<$Y[^_]fffffUWVS$'E°,:}؍]]Љ]0E E1Hڋut^}u 8}|;ЉEuEԍ]9tiwa.EԉxA0kPу߀Xt_EEU}ufuE܅u$[^_] f҃a)߉OPEt ‹uDF@tEԉ8HU)уwt%1 ؃9u뉍u9ux11rUWVS ,&SD$!D$ƀ,<$E tED$E D$<$LD$$ E$YUS%ܫ,UT$ U T$D$E$gfUWVS %EEt-\u [^_]à tF [^_]U U^E} ?U  ЋuE [^_]E T,Eg} ;U ,DPEDBE u'} B} 8U ,DPyE 0uE EE 0<MEu DЋuEE} #E11ۀ} ;c }}} dڅt<|7;}3;]uЀ}'N} -.} ^tEEE T,NE 0u ЈE } z=3 huE EQEEu } \Et } %Et } &Et } =uE E T,ZE 0uE U ,DPuE $0E 0<Eu DЋuE7u VnwK@EuڍEuE °,u DrSuM uE 0uEEuunuuZuuFu\u2EEEu uu uu uu uu uu uEc"dhEe[d8؃7t&E 07Fn,WIuu,W7E E1"EEnE [UWVS,Ť} EEEX]]UU؍MM܉ىEˋE)؉EED$ E؉D$|$E܉$Pwqً]EE@tn륉ً]CUÃЉEcUЃ,[^_];]tdECb5Ѓ,[^_]É߉EC~EtEt +]덉v tUED$ E D$D$E$t]UD$ E D$D$E$H]UD$ ED$E D$E$]UWVSޢM@\ />3)Ѝ)Ѝ4>~ 9O$#H\  $MMt0O$wD$ D$4$[^_]Åt1O$wL$ MD$D$ 4$M t1[^_]ËĮM$ЃH\ MWH\ u$ĮM$ЃH\ MM$(kljM $M>0[^_]Ë] t OwǃH\ 0\ *MD$$=Ɖ@\ MGǃ0\ ǃH\ EUWVSM<\ ))Љ)4>~ 9O$#D\  $MȮMt0O$wD$ D$4$[^_]Åt1O$wL$ MD$D$ 4$M t1[^_]ËԮM$ЃD\ MWD\ u$ԮM$ЃD\ MM$(nljM $ȮM>0[^_]Ë] t OwǃD\ ,\ *MD$$Ɖ<\ MFǃ,\ ǃD\ EUWVSuE$ƅ8\ ^uE1ɃP9u/>3)Ѝ)<7>V~2T$UE$xUu;V$] [^_]ËH\ uĮǃH\ D$ ED$$4E$@F$] 1[^_]ËH\ uĮ$ЃH\ $(kƉE$ts@] 1[^_]ÉU$ЃH\ U=(\ uV~2T$UE$pUu;V$] [^_]ËD\ uԮǃD\ D$ ED$$,E$̮@F$] 1[^_]ËD\ uԮ$ЃD\ $(cƉE$̮ts@] 1[^_]ÉU$ЃD\ U=$\ uf.11~fUWVS }<$ `\ $E쉃\\ ǃX\ Et{,wE}UWU}:uKxpu<\u$JDK@tÃtDK@tB<:uEЀ}:t}uPE1 [^_]Ë\\ t$ǃ\\ ǃ`\ 1 [^_]^ px8UVSE] :tu1҉[^] 8u4u u݃}:t@1;UuЍPx@tΉ[^]Ã8t̄u@t}:ǘt:fu‰[^]U3 ^Uخ]UWVS}u 8u u|t3:t.t*9vv :t|tu[^_]1UWVSh ېU -68}1}!0Mu$\\ tT$4$,f$)Dž9DžUD$ D$D$4$D$D$ D$D$@4$D$D$@$=EjDžDžƉ19vhpȀ W:Dž\1҃ t t DžO;>9wD$D$E$-'؉؍pȀ Q X@<#D$<$خbDž/D$=D$<$Åu<:BuED$D$E$ C:{DžYI@E<$Džj:ߍO;))|$$5/ljeDž<:tu)>|>:t:)ȉ)‰+99)؉D$\$$g|$t$ $g$zzO11cC_)Љ)Ћ))ÉT$$‰‰ÉtE$+)P9rX8U+h[^_]D$ D$D$E$D$<$<늋`\ $Džst$$nDخuƋ90<$K0DžNju*$E$與ËE$uhƋ<$$D$ \$|$4$V tWu$Dž4$VDžPu#Dž묉$H $DžtxL$T$$c4$Vx-18 0<$uտ0Dž4$V賿 Dž<$%uzu $u)$4 <$E$Hċ8bE$*pUUD$ED$$M E]US4[T\ t$ïǃT\ ǃL\ ǃX\ ǃP\ 1[]UWVS,EE -6M1DžL\ T\ ǰ,H\\ tX\ D$T\ $8D0Dq@:#P\ ux|\u ǃP\ ύ:\tWut$T\ $7lDҀ|\tǃP\ ǃP\ T\ $wƋT\ $ǭǃT\ L\ PL\ @L$$AT\ dǃL\ ǃX\ ǃP\ f:wʄt <:tBt<|uD$L$$~ƍ@M+,,[^_]ËT\ $=ubT\ $蓬ǃT\ +L\ T\ 6HD$L\ $T\ SYT\ t$ ǃT\ ǃL\ ǃX\ ǃP\ ǃX\ ]S$ΫǃT\ <ǃL\ ǃX\ ǃP\ ]UWVS u} T\ t$kǃT\ ǃL\ ǃX\ ǃP\ } u[^_]UWVS|ã]D$=E D$E$$d9ƅ:Ed\t0:tY^tU^uW:tGtCuЋM)ˉލCdD$ $]cƉEd:u^u)ڍ{EM[^_]WU:t̄tȍOMJЀvMB2wTɋ}싔W0UWUU W0ҍ ʈM} } } } }}:}}1T$4$]lE4$]}QE$]k]辷 UWVSE]D$=E D$E$6$dƅ<:d <:tCZt{u)Cd]D$4$]rU‰ƹd<:uЉƍX)Ӎ{t<։\$4$]0…u%4$]`Љ)Ӎ{uċE[^_]1뫿4$]ы]o UVS D$#E D$E$0<0tP 1F<w1F9~ƒ1F< w9E1 [^]ÍF<wFqs;u/uƄƄft|뤍/>:@O 1ƒ ue[^_]øTfffffffUSMtxD$$$,` D$ _$&I` []UWVSL"xuu؋} }ԋEE-6EЋM1ɍD$$8` u}MfMUT$U܉T$ D$ ut$$R.u} v M܋9c} u ` tM؉%9` t1EЋu+0ЃL[^_]Á} u ` uD$D$ $Vƅt@Eĉ4$ZBfxHuPP}3z$M3J u֋M3JʀuɋPD$EĉD$$U賢DžuED$UȃT$Ẻ$趤9Ev % ЉD$:D$ D$ED$Ẻ$;E҃"A9FAf9F1҉UȍQ Mčwt$D$U$薅OMU|:9I9ur?M̉ωփs6tf[UU؉4$WU="3MuuA q EfPUS 7uD$\ \$ ED$EU $T$u؃[]1[]UVS<tUE uEEEHMM@Et7EȉD$ED$$uẺFEȉE܃F1<[^]D$ED$$贃<[^]Åt"EȉD$D$$蒃t<[^]D$D$$oUS,tEEEEE܍ED$E܉D$$VpuE,[]US,ísEEEEE܍ED$E܉D$$puE,[]US2YsEEEEEE$o[]fff=̀rS[s[ḽ̀rS[r[̀rS[r[(̀rS[ðr[L$S[Ör,[t'L$̀rS[mr,[ 5US "IrD$E D$E$^ []US rD$E D$E$l []USqD$ ED$E D$E$>^[]1UWVS}äq}E 4M0M(-62u1,hEED$E$JuD$h8$vhdžPdžTdžXfDžD8H<$D$$D$(*AD$4GGPt$89t$4PD$( L$L|$Lvt$H$D$,D$lt$\|$L|$d QՀMwEҋp|$D ~0d$\?PT$lGGD$ll$Lut$\ƀ$Pу߀XuD$lD$dD$$8D$lueD$hD$ D$DD$D$D$,$o ы|$<|$<{@{D$TD$l+D$,D$`D$@OT$0t$DrT$DT$\&ҋt$,T9 d$\D$DT$\@փ濁t$\T$0t$DrT$Dt$DuL$\D$DT$\b?T$\[<$ht$\D$ljqXGGkP;t$8 @‰T$$L$4ƋD$hD$4$IL$4T$$D$LD$ D$$mq-q-GGQP;t$8 PL$Lt$L|$$mL$ T$4L$hL$4$躖T$4L$ DqWBG P;t$8^ PL$LD$$D$(q+Gqx1t$Lt$\|$dD$L)Љ<$荊x G9w݉t$L)ȋ|$dGʉt$`D$h$:D$$D$8$D$,<$&';t$8D$Lt$LIqGG@ P;t$8 @‰L$LD$(D$LD$ L$\<$誉 L$\;L$8 L$4)D$<L$HD$<1D$4D$tD$,D$hD$D$d$Z…(D$LT$8D$h$9T$8T$(T$dNL$84j|$t t$4D$hD$D$,D$ L$8L$$t$D$H$ΪT$("N D$HD$hD$$u>L$8L$`l$LL$\ D$HD$8D$dPt$8t$,D$8t!ƋD$dD$F$ 9t$,uD$\D$HD$TL$\<$) L$\;L$8 L$4ЃL$Lt$L$D$LD$ D$(ʀ|$$ @D$TL$L<$蝅L$LT$89T$4D$(rL$4<$hL$4;L$8D$ D$LTGIP;t$8 P^D$tx< t< tED$<$>p<$MAE @(MAE1ҍEEtD< tH< tDE @H9tS}BE4ED$4$H>tpUuE4 먋E4E([^_]ÉU<E xED$|$E$}M蝂}E xExUZ<$MAE pt:EpvHD$$M +1([^_]ËE @ D$D$ E $ }uE @MAEˁ0E t$rE E @t$8E @@E @t$E @E @a01&UVSHE$ ML$ M L$ML$@$Ru E[^]É0E[^]UVSfÍH,$ ML$ M L$ML$@$Ru E[^]É蛀0E[^]UVS'HE$ ML$ML$ M L$ML$@$R$u E[^]É10E[^]UVSýG,$ ML$ML$ M L$ML$@$R$u E[^]É0E[^]UVS)PGE$ ML$ML$ M L$ML$@$R(u E[^]ÉZ0E[^]UVSF,$ ML$ML$ M L$ML$@$R(u E[^]É~0E[^]UVSRyFE$ ML$ML$ M L$ML$@$R4u E[^]É~0E[^]UVSF,$ ML$ML$ M L$ML$@$R4u E[^]É~0E[^]UWVS$~ǡE]ESt u $ ut$T$UD$ D$D$@$QU싀$ t$T$UT$UT$ U T$]\$$QHƅuE$[^_]Íu븉A}0E$[^_]Ë$ 1ҍuU薾D,D$ED$ED$ ED$E D$E$]UVSSzDE$ ML$ M L$ML$@$R8u E[^]É|0E[^]UVSD,$ ML$ M L$ML$@$R8u E[^]É%|0E[^]UWVS艽ðC!D$!D$ƀ,<$JEt8ED$ED$<$|$ D$D$h$HE $ԓD$wD$$E$}US߼CD$ ED$E D$E$/?[]ffffUWVS<藼BÉEȋ}u t$E$c/EąE,Euu}EEEE t>  t1 E] U}#]#} t]!É]܋E!ЉEE܋U t1҉EЉUԉNjU̅tEvw EE@iEЃUBftEЃ0<Eąu tEtJM\EЉ0҉Q0A0y AE؃E؃<[^_]E@Uǀt MǃU؉<$]跍U؍JM؅^@zE@uJ4$]褍uM tHFv@E %Fv. #M؍Q\aE,DptGE؉7E؃<[^_]ËE\@tEE\@bEE\@nEE\@vEU\B0E0<UE\@aEgE\@sELE\@fE1E\@rE-z<$]%E@0@ 0EB?E\xEUWVS۸?}U EEuEE tu$UUtT t! tT$U$q+Ut== GG W[^_]ÍB߃]wʃ=uËEEuEEU }[^_]|UWVS>>}u EEEEEE4$tuF_tAN߃ w ?u.%dGG W[^_]ËEEEEEEu }[^_]UWVSrÙ=ʋEE-60u1}}fEuD$$ԄD$<$讄|DžE %@ 1)tnu䋅D$ v D$T$<$虉x9G hu1DžO+;uvu$sD$$Y.p 1󫋅t$< 9uE t?*HE t`'HE t E t E t E t "E @u \E LE 0 L$L$ U T$OL$$Ѕur$$$$ۅ}+8~Ĉ[^_]Ë$讈\ 1󫋍Dž,򋽬);\$D$$艆…lj99ߋtft@Dž1Dž tr1 t1 !! tߋ;!ȉ!؉ t1ҋ;Dž9D$ |D$D$$ޘ$腄…j9(떸~D$ D$D$$腄 <$|2t0,1,ыWыWD$<$}{ .Dž^tt$+$$/qP+f#1{9m D$ |D$D$${D$ |D$D$$QDžDžAqUVS%D4EE-6EE EEEMED$ UT$UT$$1MxEM+ u [^]1dUWVS読3EE-6EEEEEMU ED$ }|$}|$$xEU+u [^_]1UVS&M3u t44$HkD$ UT$UT$$1ҍEi[^]1UVSԬ2ut54$jU D$ ML$ML$$E[^]1UD$ ED$ED$E$M 1ҍE]UU D$ ED$ED$E$ME]UU E D$ ED$ED$E$MEu]UVS2EE-6EE EEEMED$ T$UT$$1xEM+u [^]1- UWVSkÒ1EE-6EEEEEMU ED$ |$}|$$xEU+u [^_]1 UVS1u t74$iD$ T$UT$$1ҍE.[^]1UVS虪0ut84$hU D$ L$ML$$E[^]1UWVSBi0}u t74$[hD$ T$UT$$1҉z[^_]1U 0D$ D$ED$E$M 1ҍE2]U袩/U D$ D$ED$E$ME]Ua/U ML$ D$ED$E$ME]US $K/EEEEED$E$,E []UWVS$ި/DžE = t>gЁ$[^_]ÍƍerD$D$ t$|$$` 1ɉ 9FD$E$D!u؉G} t9;4$yЁ$[^_]Éf8 uf;t<$y$\qDžeWPUE D$E$]ffffffUWVS-ƃ ‰ ‰ ‰ ‰ z|$F$utF~1[^_]øUWVS胦ê,9H rt~t PRuF$D$ D$L$M<$!^M΃t ljډE:BGuETB[^_]ÉUy(MvdED$|$F$n_MRdUu ~ MFЃ[^_]UWVS补+ljօxlxD$$CtU3W4E3G0 u|3WtxG MQ T$$tˉ}ӋMEAA$KMA E@@eEtG>uuE$}SE@ EjE $D$@E$ E EMH ?^?QUWVS}G $Rwt6$RuG[^_]US谀E D$E $[]UVS8{âut&芦== =UT$U܉T$U؉T$ D$E D$E$V=t3w |Ef>@fFE܋UVtfNȃ8[^]FfFt׸E@EÿE?EEEJ1ոfFFfFt{FfFeZffffff̀rS[@[UWVSljEЉΉMމuEtME9UEs7lj։u\$4$U~  HS9u+}9ur͋Umu[^_]UWVST|~Eu }Z E EE̋}}G$]6HEąMEЃ~)֋]ދ}߉}E$MučDMEED$E$U1ɅM9}EEu؋EEE؉E܋]]]9]?]ԋ} ]9]vE؉D$$ׅ;Etډߋ]ԃE؉E9q}ԋ}؋u}؋uUUE;E]+EE\$$UU9tʉ+EEĉE؍G~}u؉M HZ;EuuE9oEɋE$MEEЋMEĉEEEċE9EE$]zN1T[^_]Ëu؉} 9]vIEËE]V+uuĉ2}uڋ}lj]XJ9u]9]wu؃uM9MDEЋU;EEEUBEMċ}9EMȉUM܋Eȃ+UUU;EzEȋE+EEE؋UԋM99U]\$u4$UuE؉EE}Ѕ}\$E$U;E~~9]wދU9UM̅U܋E 9wMA9EE܋U܋EM9uU܉EM9MU9UE̅}܋uEԤ9wUBM9)E܋UE؉EM9M>E؉Es}؉u}tFEM9rD$+E$UE؃M+UUĉU؉M}uً}}EuƉM HZ;EuM}M9{Uʋuދ}9u\މۍ9EvljD$E$U;E܉߉19}E9}s0u9us<3|$E$U;E}9uruU9Uu̅U܋E 9wUB9EE܋U܋EM9uU܉EM9MM9M3U̅gU܋E]؋ 9wE؃+EU܍DEEE]EԉEE}܋u9wMA9r@)]]܋uEߤ9uu]]X]+]9w ]E뻸\$E$U;E΋EE9wÉEE;]v)1uE<|$E$U;E͉Ӌ}܋u9wMA9r%)]]܋uEߤ9uu]]ָc-EE}܋uEؤ9uE+EEEEEM9^EċMMĉEU܋E]ԋ 9wMAU9r Ѓ)C9/EԉEE؃Un1T[^_]ËED$}ĉ|$E$]y}EĉEEE4UWVS uEuFEt,~^tH1ًP1 uV9P u [^_]$]?t"N^HXVP }8F [^_]ÃUWVSbuÉud5u [^_]HF$$4$5NjF$$[^_]UWVS u0}E wut6tn9ƍvuVFO9N uO1MO1 MtGD$ T$D$$&GWG1D$<$#tG9F [^_]fffffffUWVS[tÂu2EF9FvF FD$ D$D$$&FVFD$F D$$Ft|yjfV21EtKV uzN)9FJ u M Pz u F @Ѓ[^_]F BF1]11UWVSLss}d5t2G$$D$<$ƋG$$z[^_]D$<$Ɖ[^_]UWVS rR1EH1d50E@$$ D$E$&ƅP } fFE@$$0tlEM 1 [^_]D$E$ƅt[P } uduMJ0u?0}8눋E@$$%0uL0}8E1 [^_]ä/Bftf / fRE x0fE xfff̀rS[[ḃ̀rS[[UWVS$pEEE E.8D$D$ED$ ED$D$E$t 1$[^_]É.8 u.81$[^_]UWVS@p2}ljӉMЋMM̋u MUUȋE-6EԋU1ҸQ)‰U܍)lj}ظQlj)<)]؋U܍<Q))Ӊ]}u}u|EԋM+@[^_]Åu E܅1M؉D$]D$ EȉD$D$ }<$5M9r 똃9tPu}t]܅M܉\$]D$ EȉD$D$ }<$4M9@ 91Pu}܅tcd}܃}~Wd]܃}9sQ-E9t@u<}u}t&}uM؋]ۉ\$]D$ EȉD$D$ E$3M؉C]>UWVSymàEMME EEEEE-6u>}1Etuu,u;}tX֍VFtC<%uEDž|1ɉx}rBu h[^_]莨+̀ffffj̀rS[[ÒrS[[UWVS{Fâ}u t$<$u 1[^_]D$FD$<$耈tۍFD$<$€tȍF D$<$诀tpD$D$D$ FD$t$<$zfffffffUWVSE]}E 0|$E$蚀t?;}vE8th1[^_]ÉepuWUD$$]ƋE 0u(]썃0 D$ $螤1뚅titn1ۉ}߉ut\$E$]9}wUZEE $]E E6tu#EUWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVSBDiu -6E1Vt(.E+pЁĸ[^_]DždDžhF\DžTDžX)V\f8DžllD$`D$ TD$XL$U$$…QD$dD$ TD$XL$E$…hL$t$E$‹\f8\dP\p9\hD$t$E$f\P\wDždDžhF\DžTDžXDžhhD$pt$E$eƒq\D$ hD$D$4$"\D$`D$ TD$XD$E$A\6*ffh̀rS[Ð[UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS ?u}F9r+)F|$E D$F $~  [^_]1 [^_]UWVS ?u}F9r+)F|$F D$E $軡~  [^_]1 [^_]USa?xEU ]uHPP UP[]Í@fUWVS ?2}u t$<$~t t&t 1[^_]Ãt$<$~[^_]ÍFD$<$zt̃t$<$z[^_]UWVS>ò}u t$<$.~u 1[^_]D$ FD$FD$<$~tԍF D$<$}tF t6u$FD$<$Zztt$<$Gz듸[^_]ËFE }F[^_]UWVS=}u t$<$s}u[^_]D$ FD$t$<$}[^_]US z=áD$E D$E$}} []UWVSF=m}u t$<$syu 1[^_]ÍFD$<$|t~uD$D$ F D$t$<$~UWVS<}u FFt 1[^_]Ét$<$xtFD$<$A|tӍFD$<$xtF D$<$xtt$<$xUSB<iUE JttH[]ËJuL[]ËJ t't@H[]RP[]JHRP[]ÃwJ< JHR P[] | q f[@HFfffffffìrS[p[v̀rS[P[VWST$L$1t8uЄt`B͉ t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^UWVSMu tSY99t=PutC{tP9utCE[^_]É1Eu1E1[^_]ffffffUWVS$9lj-60u1D$ t$T$$@c 4$@;EwDUT$t$$Gu%1M+$[^_]øE @O)D$ y D$D$4$<L;Mwσtft%D81= 3D$ y D$D$4$BwO 7t$$* tG$b,u?u&9O 뗋GfuUWVS7׽ƉЉU -6M1ɅtA~t7/u+0Ĉ[^_]ÿۿDž9 EFfEfD$ y D$D$<${<$;E@ED$|$$Nu5F~uN uF=tu ~tME}}0D$ t$T$$\_P4$;EwdED$t$$811Fȉ<32$`<]<fDžE9T$ L$D$$/8<$;E=ED$|$$$_D$D$D$D$ D$؍ DD$$PtQ0Ie ED$E$F <etNtu:Euۃt?ED$ D$T$$ ] ED$E$BvUWVS8&3MuU EEEE܋}EE؋E E-6ME1w^~wXN vDt E؅tFu f~(VN'}U+8[^_]ËEM+EԉEE؉E} E܉EM8[^_]yvt E؅*Mt U܅ 1댅t E؅FfVT$D$ *D$E܉D$E$Džxi9}vdFutF ftV ff҉T$D$ m D$E)D$E8$U@Ux_9EvX1EtE܅uMD$ T D$E)D$U$UUx 9}SEtUEE܃iviD$t$E$-1FT DD$ y D$E܉D$E$dx9Ev1t&FD$ ^ ƀD}pEԍf M؍YxMЉu EЉT$D$ E؉D$t$ $MM9)9}u1fэ~ȋE<Ήuԋuf M؍YxMЉu"9M)ƃ;}tGUЉD$T$ E؉D$t$ $M/yVFD$ y D$D$EEԉ$Eԉ$^9EE؉D$EԉD$<$aD$T$ *D$E܉D$E$?膐UWVS<.ljE-6M1ɋG ֨uI<$Ytpt$<$Zt㋅9Fu؋tD$F $茧u6ffd$L@=v1M+ P<[^_]ÍAƅffD$ L$D$$R2D$D$ D$T$G$0jA;)ff9t<B9L$D$B$ D$ T$t$<$FtVuMeM]\$ ]\$D$$7t@M땸-V룸 1뵍9UWVSƉ׉MJD$A M$…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftuu fUWVS &68<ʋEE$-6 0u111  r} !} t } 0<xf@fPffЋ<ȉHQ PD$ T$ LPT$D$ $'cL8@ u+D$L0ЅLDPDP} t!} t} t@Dž6$L=L(Љ@ύALQP9H?DžDDžE, ;P1LLdP9HRJ,@)lj|$D$ PD$HD$<$aƅ8@ u@$0ЅP4$4df(F$"df4F$dN Pf4(4} } } 9U "Bvq'tlH $xNjE $x$y|$t$D$D$ T D$D$$%4P1ZQc1 }+8 &[^_]Ã7D$t$ PD$HD$<$_…xH8@ u44$0Ѕ4t!P4$P9| } 19Dt0d@pT4~ HPL@@@11LrDXDž\Dž`LTtDžxDž|$8$4u+D$PtpDP;GDfǃ~ HfPt(ЉfHtuϋHfPu؉x~P`N04(ff!cfT(@D$$(=H 󥋅@D$D$ D$D$$%@D$$=y4N PWP @<$$VV VVVVD@` 9uP‹A@u4P'1Dx?$^H+$$xF}(@D$$(4P14P <@ff]01$FF FFFFf(@4$D$NN NNNN(@@k$FF FFFFP4|$t$@4$4Љ@1\鲤P$\f4F $[f(F$[fFPD$t$ D$HD$<$XDž(8@ P4$=$Dž44((D$t$G$4 (Dt9 u7t t*DD14$X5HDu (0…t+49 ut t؉:11[tUWVSlýƉ-6M1ɋ$U%$;11 rFFtH@FENRYX1ɀ.уu;P1.d9.6<$1ҋND$F D$F$Ƌ@ut0HT$‹@ D$B$tF$$}+8Vl[^_]ËqD$ D$D$<$"(dPGGDWDDžDžDžDž<$O<8=t_WG t HW$Z$LDžG GDWDDžDžI<1$@<E6d9ZDž<$1ҋ3HVG GDWDE%1oY<$1ҋbW<$1ҋCUGtGDWDE+hU8VU $c8UDžUnUWVS -Ehp@`t%=mDžthE11҉ rMd11҉`d r`VtA<$]TRTt[^_]ËhMEEdUMEE$Ju\11 rU؅t d<$E؅PU[^_]ËhMEE끋hMEEe`F:Xl}\1Md1҉ rGTdHpPL9F\D$ PD$D$`$'"hL$P T$ D$LD$l$l1xSE11҉ rlUEE!$Xl$=;T-XduDX$#E4 \i |‹dC뭋HA‹@uH_UWVS@ æƉU܉M؋EEЋM MȋMM-6Uԋ:}1 $U؉$uxNtq`} tB9u}܋UML$Mċ}܉|$$/MċUt#1EЉ81}ԋu+7q@[^_]1F;tBDž;Ẻ$1ɋU؉r@u둉UML$MċE܉$)MċUhMUčD$}܉<$.,<CFU;MtDžẺ$1ɋU؉uu`@uWEVwt$<$uEEȉ$i‰GE뻋Eȉ$i‰GuiUQlEw ]Í]UWVS?uvGt$<$u[^_]UWVSEhE tExEl-6pM1ɍ1󫍵1҉ r`11 rhxPu x3Dž| $U1t vGt$<$ulpM+/|[^_]ËtbDž|DžDžDžttu7Dž$t`|Tljd\ t1҃tTtP9t GtFuBG9tGt/tu'W9Gt bh* Dž|T`\Xdt# t1҃i9]F9V@N9tu tDž$t`e|9tL$`D$hD$\D$XD$ }YD$D$$sfzDž|tEdTΉvWt$<$udT GtDžuxtxFF1҉@уu􉍜xKD$$-DžD$D$|$ D$D$4$ tx$Ft$$+lDž|muu tu th$t`` 9udr@D$%h$[Xlh $a‰HXh)D$L$4$t`|dpXLD v~u~XxMG<a$_+DžDžtPG t7Gt1H11 ⋍ ։?u$)1H$Dž|BDž|hdTƋt0fǃ~ $1ɉvxFtuËF@fu뾋FbDž|$ D$D$|$ D$D$4$kȉQH9wO$PHxrHH9s$$pDžP|0@BƜ9]GGPHH HH H@FF|t <DžDžDž 1D$ D$D$<$z$1ɋ|~D$ D$$1Y…D$D$$z~D$|$$)F|HF<<tFDžt19vDh9K2Bt⋵ht9s 9r.$zy1OD$ D$xD$<$tp)0J9uB$t/0PtV2$0Pu$FDžDžFdT|l1hVDžtuH1׉tD$ D$D$$tT$D$Ii $袥i\NxS$IUVP2$^0Pu݉UWVShT{yE֍U11  r1UEEED$ E$}HMED$E$l3Pt+< < ED$$qluȋFE؋FE܋F EFEFEFEFEEED$ EԉD$D$E$tt8EEEESkE Utȉ։vt t$U>TFUvu׋EtMA‹@uUEz}Љh[^_]ÅuUWVSpwuE$&E~u11 rGtfEEEEE$ML$ML$D$ ED$D$E$&t}EЅUp[^_]ËE$%MML$UUT$D$ ED$D$E$&t>E$Sp[^_]ÉE-tFE$bEԋGE؋GE܋G EGEGEGEGEEUԋEyEЉƋ@uh8UWVS\ v-6U1ҋSD$ D$ D$ $ƅ8#3D$4$iD$4$hxDž< < D$4$hxt$$t띋BBB BBBBDžD$ D$D$4$X~#|$$?u@HD$xY$11M+uy\ [^_]Ët܋vtHt$OFu܋vGt${<$suzNUWVS4+VsEȋEE0xU11  rŰ]ȍHD$xY$?EЋỦӍEЉẺEtCË@uEuEЅt $]CEU4[^_]UVStÛruD$F $)tP PH p[^]UWVSD(OrU-6U1ҋ@ ut$Yt$$dtӋD$$dtD$F $du[$蚩=w;$t@=wЉ=H1M+ yD[^_]Ë~D$<$dtu狵11҉D$ |$D$$Ѝ|>rtftD$D$ GD$D$@$&9pt89T$T$$6i<T09TN 9- |9;u׋D$D$$uL$ D$D$$S)uurvBf;JUVS zánut$F $uE $MUF t [^]ÉE4$LE [^]ÐUVSÉ1   lLLLL9w[^]UWVSTNjEGEGEG EM]Br 2 r 9u֋]Exj׋]؋M1ȋu!1U V1!1 ‹Mp $1!1ы]3ν1!1 ˋuč|1!1؋uȍ*ƇG1!1 ‹u̍F01!1ыuЍF1!1 ˋuԍؘi1!1؋u؍D1!1 ‹u܍[1!1ыu\1!1 ˋu䍴"k1!1؋u荴q1!1 ‹u썴Cy1!1ыu!I1!1 ˋub%1!1؋u̍@@1!1 ‹uQZ^&1!1ыuǶ1!1 ˋuȍ]/։1!1؋u܍SD1!1 ‹u؉1!1ыuč1!1 ˋu؍!1!1؋u썴7É1!1 ‹u 1!1ыuԍZE1!1 ΋]荜㩉1!1]1!1 ‹]Ѝ og1!1ӉU1ًU䍔2L*!3u ދUȍB91UԋM q11 ‹M"am11ы]썴3 811 ˋuD꾤11؋učK11 ƋUЍ `K11U܍p11 ʋ]荄~(11ӋE0'11 ދE0ԉ11M̍11 U؍9ى11ˋU䍴211 ڋu|11֋EeVĉ11 ED") 1ȋ]Ѝ*C 1 ËU썔2# 1ދUȍ 9 1 M䍄Y[e 1ыE 1 ˋE܍0} 1؋u] 1 ƋUԍ O~o 1U, 1 ʋ]̍C 1ӋE荄0N 1 ދEč~S 1M5: 1 ‹M* 1ы]؍3ӆ 1E u_MOUW T[^_]UE@@#Eg@@ܺ@ vT2]UWVSEP?ΉM} 1ÉPHʉP@)N9rcڍ<u usukPE+U9UEƋ} ؃@;Er)]] U<u sHtft[^_]äftt&u^uE_uOuW] }u|7}wfu SfUWVS öeEE} -6E0u1Wu5G?7w}8)‰T$`D$<$D$t$<$EX1u7u=tftEu+0u& [^_]úx)끪Wtfd@UWVS(d}Ћ]E E-6E؋0u1°,:}DWuủu<051 I1҉}KMHɋ} Otp}UTyċ}toE+E̍H_(EԅtFʋEԉ=}uOtJ fɃa) yHȀ_1E؋}+8([^_]<.cEu9tԁw̃u܈VEXPЋ}DWt<0Cƒ߀Xt>1҃o}DG@YC1s:E  EE M EM ]>U ED$E$u ]ËE]fff ̀rS[0b[UWVS4bEċuűU -6E1Ju5  t8t+E̋u+74[^_]ÍuЉu11ۈEËEȉ4 rEËučJۃDЃuEu 'tɃL " u+Ep1i]<UWVSaE4M 0u,}-6U1ҍhEED$E$dD$h8$ehǀPǀTǀXDžDB$*8HDž@DžL|$ ,|$0L$8$蛸ǃt>8GD$H$蝨t4E+u=[^_]ËHt$謫4 ;U]_UT$ U T$,D$E$@]UED$ ED$E D$E$]U'_UT$ U T$,D$E$]UWVS$^u4$uE荓jUEEEEED$,xX<$uE؉D$<$eD$<$"u $[^_]UWVS.U^EX-6TM1D$D$$:ƍ`$1D$XD$$PPT$D$i4$q4$t'D\pTU+İ[^_]\\$xh\Pt_6tU~ tu틅XD$F$_PuGXP$xXg1^P$ST1>t8UVS\Ƌ@0$轨F0F($諨F(F,F$蒨FFN D$$Ft N 1[^]ÍHD$$xt N 1[^]øUUB t B 1]É](UVS\uF uu,F [^]ËF$FF F tԋ$8F F [^]UVSkÒ[uF ujtfF0$iF0F u>D$D$ D$D$$F0؃[^]Ë$f 벸US] C t1ҋM ЉC []ÉC UVSZu4$F$详FFF0$薦F0F($脦F(F,[^]UWVSDkZE@0VU UT$$M4p< t< t򍃺XD$4$MPU4$fU BЋUP ExE xED$$UMt_p1tG< t_< t[E@P9t[E xAE4ED$4$Mt1pMuE @<} [^_]Ã둋EV$ED$ ED$T$F$i t+1[^]ÉatF F$F 1봃F$ED$ ED$ED$4$c[^]ffUWVShTD$D$}Љ|$ D$D$4$AEЉ$sEąD$D$|$ ljD$D$4$A}Љ}9EfEE1Exu7P u%Mftf9HX^p u~9EwEEEuE$蠗EE 0Mω}t$D$lj$r}UfEzu4B<<u$Eftf9B]B %Ef9UwEĉ$=MAu9wAE01h[^_]@tfH fMEuh uȍLM9EBu=fE9U#bfE9EbB fEu11  r}}؋BEE΃FEtfEtuDE}ȉ}E<vtft}a}ȍDEr!E9U.mEE$衝1h[^_]ËEEĉ$胝1h[^_]ÍP UE1ɉ֋UtE6փ u11ɋUEuutƒ u؋E9EE؋}GE܉GGBGB E1ɋ}tƃ uE1U/tkHE EtEut_t/ƒu}ȉ~utftExu}ȉ~ utftEȋ}O yBMO7U}G E9U}MuEȉFNjMr1Et1fEt1}}ȸu}ȉ~Eru'u MfmHM뿋Eĉ$諚USxßNE$脚[]ffffUSMtNED$E $[]UWVS$!HNljUM$<ƋMEFWUVGEF G EF$G$F(FF,EE=OF-~MN O(N1utE)NEEȉF99E9}9UEE uuu=ED$D$ 11 +D$$D$?F4F:ON;$[^_]#4$谘1$[^_]Á}w.F,EE=E=wF-F,E~F-EEt uuu=ED$D$ 11 +D$$D$>F0F8ON9Sy`F0F81F4F:1UWVSSzKD$E$IƍxD$4$Dc}и9ED$D$t$D$ D$|$$t4$qItt*'v8NBCDt*|$t$,1Ĝ[^_]ÁxB u$,u뾉4$It&Ƃ1Ĝ[^_]É4$H1UVSBJEU Mu'v8NBCDty1[^]ÁxB uu[^]UE@ ]UWVSIEEU 9P vnH,X<3t;t*9r/9Pr*XˋE)ʋE1[^_]ԋ͋]́ԋ]跁UWVS$AIuF$ED$ F(D$ED$E $M~;N:]f4)ЉMЉ}F$)É]}f4)MMF$)lj}Ef4E)MMF$U)‰UN-FÃthtLÉf0ED$ ED$)N8N9F )É\$4$C$[^_]벋mUVS G]tS T$ST$S$Љ$迓 [^]fUWVSGE]Uu y7y7} vyCS< ) 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉ 1))‰׉1 wU g}#sC )ى 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉÉ 1))‹uF1ЉF[^_]Ã} vyCS< ) 1))ȉ1))‰ 1))щ 1))ȉ1))‰1))щ1))ȉ 1)ʉ)lj1 wU v/ t us s sC vTtzftjtws w}#3}#s zrt>t0t<Xsss{sssUS ԾDD$ D$E$q! []ffUWVS蛾DE,0DFt"ҍDB9D~u.tH 1 $֍V9rl u ʚ;}1 ~  [^_]yDVt6<}yDVuE{ 뚃jD8EVUWVS蠽ƿCuEU,]|Yo1tX|Yu]@t|Y@u]|Yy1EutX|YuEu؋u@t|Y@u]DY*1E|XDYuE}}.b\AE}@u DA@tDY@u]}EX2wۋE1EE<2wuEBRDQ@u DQ@tDQ@uu؃[^_]EEv+E܉)u؍4)u4)Z)E؍4)EE܍(E=E/EEEB\AuE1BE\AEtGBE|AE󍄀]܍CEB\Au*&EEE}܍DЉEUWVSMt@5r̉EU)‰U)ƋU Q)Ɖt$T$HD$ D$ D$<$5v[^_]UWVS裹?M -6t M1ɋ`M!t$:D$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,b|Džxw4X,`p lh\h^q`  ~ D$ D$D$$ cu_tUatF[o‹|p p ;ut$xD$$u f})D$|$D$ D$D$$ `?|$$$|$$ 訯u8jt&t$,D$pD$$<$]tM+m[^_]}n p9u}m P9u쀽it$T$ D$D$$ss8<$臇=!$@zD$ D$D$R$@|$D$ D$D$  $Zq|$D$ D$D$4$.q|$D$ D$D$ $p|$D$ D$D$<$p D$D$ D$D$4$pu艵EЉT$UT$ D$XD$<$}wC%D$D$<$}Dž+ufNffftD$`D$<$)}dFD$D$<$|9uۋd|$ D$D$p$>F DAu.|$$辫9uщ|$ D$D$l$B>|$ D$D$h$>f|$ D$D$\$=DžwaD$$ n{||$ D$D$h$R=dFD$D$<$G{;uۋd|$ D$D$p$<F DAu.|$$;uPoo$襇D$D$$ztqUWVS謰6EĉED$ED$E $[/D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$, ZED$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,YẺEEfEEEfEEEfEEEfEEE`t5 u)K}f 8g1ҍ p9uED$t$ ,MD$`D$E$xE`t fED$$;dE`BED$ D$D$$P:D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,X,D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,WD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,FWD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,VvD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,vVD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,VRD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,UD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,>U.E`}c‹w puED$ t$FD$E$tb‹w p8uED$ t$Ot$E$tbW] PK8uED$ T$t$E$MtObWu W}?uED$ T$t$E$tE`t tED$$ ED$$1ɋ}E+ED$$ EED$$@EED$$EEf Ef EMf Ĉ[^_]Í |$wD$ D$D$4$e D$wD$ D$D$$UweU D$wD$ D$D$4$?e D$wD$ D$D$$UeUM D$wD$ D$D$4$dHf$D$D$E$rĈ[^_]ËED$ D$D$B$3ED$ D$D$>$3ED$ D$D$:$i3ED$ D$D$6$?3ED$ D$D$2$3`ED$ D$D$.$2ED$ D$D$*$2uMt Ev[^_]Í|$wD$ D$D$4$_EtËE[^_]UWVS,)uZǹq Pt9uЃ[^_]Ét$wD$ D$D$ $_vXЃ[^_]Ét$D$ D$D$  4$^Ѓ[^_]UWVS>e(U} tdUZ~U ~t;u[^_]Í T$wD$ D$D$<$L^[^_]ÍUWVS赡'uYǹh^ Pt9uЃ[^_]Ét$wD$ D$D$ $]v`Ѓ[^_]Ét$D$ D$D$~ 4$]Ѓ[^_]UWVS'uXw# wVfK B v|@vF[^_]Ávf[^_]Á @[^_]Á v,낃@t9u~jtucOD9.# c1t$D$ D$(D$<$[~ix ^UWVS%}VYD$t$<$xWx [^_]É|$y D$ D$(D$4$[[^_]UWVS胞ê$}jV1ҍ pt9u[^_]Í |$wD$ D$D$4$Z[^_]UWVSL,$-6E1E <tmD$D$ D$.D$M‰ $M/ZMt#PT$UL$<$(U0E+u4L[^_]D$ .M‰L$ME D$$MUWVS(Ba#EEEE$M[E܍U}`EUSEEU t 1([^_]ÃuuE-xE+u PUXư,uЋDJ_p1ɉ}؍uNLY>vDzu}؍ 4u؀.M\BuuEEE܃@tMDB@9wMDB@9=E؋EЋEDJ@tEDJ@9wEDJ@9ËEЋEDJ@tEDJ@9wEDJ@9&MDB@89wE} U؈W_GEȉGEȉGEȉG E]]EEDJ@9w덃EDJ@B9wkHMX\Z1HMX4X\Zu,uPUXEwEHMX\]@\BUWVS EM HMHMHMp΁HɁ@ =*-E썃E,ENMb׍)ƉuԾE+E)lj}))lj}Љu̅EEMb֍)Mȹ))lj))MUĺQEM)U܍)ME$EE $E$EU܋M\EE_uEeED$DED$@ED$*u|.t B[^]ÉЃ[^]1[^]UWVS(轕MEEEE$fJPlPHH8|$x|$x|$@ D$L$ T$D$4$([^_]UWVS2Yuh^ Gt-D$4$IUu?E tE [^_]Ë?D$cD$4$<…ukN,DHtU)SD$ ED$4$蘄SҋUyE8m1ҁ]1VUWVSBiuq Gt-D$4$YTu?E tE [^_]Ë?D$D$4$;…ukN,DHtU9RD$ ED$4$訃RҋUyE8m1ҁ]1VUWVSRyu D$4$/FFy ;F|/} t)P}D$4$/[^_]Ét$E$b_USےEM QQy ;Q|< tZ[]ÉL$$_[]UWVS艒ðEu E$PEEEEED$4$.F0u ǀED$4$D$4$.[^_]ffUWVS"IP96uWV@tWufFuFuFf~@tJD$4$lj4$]I[^_]ÉV@ut"Fu띉F룉4$fF@먋FtUVSBi96Fu "t$,XD$ D$ED$4$E[^]UVS96Fu tE D$ D$ED$4$[^]UVS蠐96Fu tED$ E D$ED$4$[^]UVS,Sz96Fu 3tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$7,[^]ÉED$4$EUVSď96Fu t2ED$ED$ED$ E D$ED$4$[^]ÉED$4$pEUR}96U]U4_96U]US=ED$96$4i[]UVS96Fu t$ED$ED$ E D$ED$4$Jm[^]US蕎ü96$[]UVSnÕ96Fu Nt2ED$ED$ED$ E D$ED$4$[^]ÉED$4$EUVS "96Fu t9ED$ED$ED$ED$ E D$ED$4$ [^]ÉED$4$EUS肍éED$ED$ E D$ED$96$豛[]UVS?f96Fu t4$[^]RD$$ USD$   D$ED$96$诗[]UWVS 諌E8th׉ƅt|$4$JHt>u(<.tqAtN<\u~u~t&뺉+E [^_]ËU9Ѓ [^_]1+EUWVS$C]Uϋu U MUL$T$ L$U‰T$$EU;tqu?E8@@P]})ˉ$[^_]ËUt U t.t7Myt.:u)|.tPM;wH.ȋ똍둋]IEEu0UWVS&ƋE9vtˉЋ9s/u#uE щ )Ћ]1[^_]äftuuBf։HUWVS ZÁE։ϋUUU܋U$i' M9ЍTU9qE썃E9utoD$E$tE$ExE$yHE܉E] [^_]ËuE$i'Kx+E [^_]UWVS:]}ˋMu uJZ9vC>}])BvJ {9Cs1[^_]É4$Er[^_]ÉM]*GEEMUWVS+}äE}U(E,E M0|-6M1E$t|$$CLƀ?QE4$6;DžE4D$D$E$E@ƅ)E4E$kE$T$D$iD$ D$dD$$C‹ $=t$ $ }wvE}Mt#t<. y<7|7.f}B}$+)ʍ1r &ȉ9%9I $fyƸM+.Ę+[^_]ÍE4$`kxD$$1ɺ pE4$H;+ M$D$L$T$D$ D$dD$<$%A‹$;,f @)lj~ Dž10D$D$<$p9҉+򋅐${<$m~F|$ $1ɺ0 f; @@1xJɋDOu.9̋+$;)+|}$$Nj$|$bD$t$ljD$zD$ D$2D$@4$g>‹$D$D$$U u+|}$$D$D$ D$dD$4$=‹<$L|$D$G|$D$$U <$r|$L$$D$t$ D$dD$<$<‹$,dP@D$t$ D$dD$<$r<‹$B$D$t$ D$dD$<$<‹$rB:}&RxD$D$ D$dD$4$|;$y}$t& $fPPHp $$aL$t$T$D$D$ D$dD$$:‹$ B<$9 $.$D$t$ D$dD$<$*:‹$$$D$t$ D$dD$<$9‹<$2j$WD$D$ D$dD$4$m9‰<$|$D$$U D$ *@t$)‰T$$,$r1P)/~0> $J09:!$.:‹$y}$t&r$ЋHpH@D$t$T$D$ D$dD$4$7‹$<tD$ *@t$)‰T$$)+!@!r1P)/~0> $09 $8‹$dy$򋅰q+/}+}$D$t$ D$dD$<$N6‹$P@D$t$ D$dD$<$5‹$b;&R;D$t$ D$dD$<$z5$yt$|$$U 4$r$D$$qD$wD$$4$C6sP8Pp$B= $~t$|$$U x4$rO$K$1D$t$ D$dD$<$G3‹$$$D$t$ D$dD$<$2‹$K$pB$VB$<D$t$|$zD$ D$dD$4$D2‹$) VUUU)ʃ$Gz}$ $]D$D$ D$dD$4$m1‹<$ @t$D$E$$+4$2‹$$+M$LG}$D$D$ D$dD$4$`0‹$0Q 09(@Dž@DžDDžHDžL@)t 1҉  ;rE4D$ D$t$$苜4$)1)E4ȉ39[4$rt$|$}$Pd e }$t&D$t$ D$dD$<$.‹$*P@D$t$ D$dD$<$8.‹$P@D$t$ D$dD$<$-‹$LH@<G E4D$ D$L$$菚4$-/Ɖ)E4H97)ȉǍ4VUUU)ƒ${D$D$$U u9iPP@ 19 :t1 tb$D$D$ D$dD$<$+‹$P{HED$D$ D$dD$4$}+4D$D$$U )1i9t։4$ZD$D$ D$dD$$*‹ $yR|$D$$U <$r|$L$$U o<$@n)ƒ [}$U4T$ T$D$$訖4$F+Ɖ)E4P@D$D$ D$dD$4$<)‹$;Dž1P0ƀu1$SDž |$D$ D$dD$$^(‹ $Q;'$mp}$n)W}$uU4T$ T$D$$訔4$F)v@t$$4$)‹$0}$t&b$ֲ$輲D$t$}D$ D$2D$@4$&‹<$/g<$A4$r4$dm4$r4$&4$rRt$|$$U X$E$+JRT$D$t$D$ D$(D$4$'%‹$) VUUU)ʃ~$/bf; @9)(n }$$[}3$rB2#t&jуP P@Dž====$;iPP@k 19H :t1 tb$D$D$ D$dD$<$V"‹${HуP PPуP P҉уP P@ƅ= Љ;2H PPH P҃H PPH @$)`Dž====fDž==уP PPуP @fDž==ƅ=0t$D$ D$dD$4$Q‹$1&R9D$D$ D$dD$4$$yV$r)}u 9D4$YbT$ @t$D$<$5% r1Q)/~0 $N09>$2‹$񋅤yT$ @t$D$<$[r1Q)/~0 $<t09d$X‹$񋅤y6$)ʍ$ƃ<$t$MD$ D$dD$$Ɖ<$‹?w|$$1ɺT<$ D3$/ƃ<$E4D$D$4$U)E4|$4$1ɺ><$ NU$艦ƃ<$UE4D$D$4$4)E4|$4$1ɺ <$Y$ƃ<$wE4D$D$4$ )E4|$4$1ɺd<$ b A$=ƃ<$ E4D$D$4$cƅ)E4<$l|$$1ɺ'<$ o@s<fWD$D$$U 0U4T$ T$D$$$D$ @t$D$$ … $QOUD$D$$U  ;$r'$l}$t&@!) $莢D$t$ D$dD$<$‹$=Љ;TF~'$lD$D$ D$dD$4$$ X$,d<$`"E4D$ D$L$$V4$Ɖ)E4HT$ @t$|$ $DžZrDž[+/~0 $L097$*‹$y$$h $+c$&艸m*UWVS8VE  U8u`E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$8[^_]UV7M8E#]UWVSU u}(Q|EtO9M r&Wfҍ<t+E D$<$/y([^_]9} r+E[^_]UWVS\UEE}M OX9ff_X9@ffG 19wzsfftG u1Dw fu3Du9uEG$G(G,1[^_]ÉD$ t$L$M$x&\ËM믋]([^_]øUWVSdTEu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$uF,F,^(D$ML$ D$FD$$]趘=F,F,H^]9f]fPV,PffN,unǃfǃ ǃF(F(V 9F$F(DF,1[^_]É~$F(DF,1P 9UruHɋ]HN,@ff V,9ErEMF,F(F(T~ 9~~$kF(F,1[^_]Ë](K4]UWVS &RQEu} ]9~$t~$F(DF,u^(D~ 9V(9 F,9~,)щL$ |$VT$$F,F,^(MT$D$L$ D$FD$$]mAF,F,H^]9fҋ]PV,Pf҉N,uoǃ ǃǃF(F(V 9F$F(DF,1 [^_]É~$F(DF,1P 9UrtHɋ] HN,@fV,9ErE]F,F(F(T~ 9~~$lF(F,1 [^_]Ë](L5]~fUWVS OEU} BrJm U0<Ѓ?}E]썛`#]]M}KFm M0ˈ]<NN?M9UM ]L]M\ˈDMD} tE u;UEЃ [^_]} u~Nσ%?};}>qEDP@=T$E$tXU t}9}vI+EM 9ENtSEDP@M=tT$E$MT[^_]É΍NuߋE[^_]Éu} u9uv} l롄t&뒿v1vlο`qXEDP@u=CT$E$,EEEύNt[t] At DB@uE E9E] <NF]BDC@u=uJsύIGeUWVS -JTE80P߀XHp@EU1°,U¨,U<+u6\]tE]\Ftu0 7)YAtZM DADNtF0 Ƀ7) ‹E E ٍq„t;}sXҀO1 [^_]UWVSI(u} UEXf0xu~E~j1E ɃT 7  ҃sT 7SEu9E~sC.9EE[^_]à EuE[^_]AHl@ UWV+HVu@ o^_]ø1H- UWVS\GϋMM-6uM1t$D$ؔD$ D$2D$M $MƃM;w,ML$$U7M)11}U+u\[^_]ø UWVSEGpEuE E컉))lj))MӺэR)É]%I$)‰)؉)U: 1UEu ]E u"M EÉ$Sr~=Ut3}ư,Ǭ,w\DAtu܋E +E[^_]ÍM E$WE?M E$DxhU#M E$HEx@EM EÉ$MMExM BfUWVSKEru4$qH;MX} slu^uVM T:.utez\t*:.tU ƒ.} 1[^_]Ãt8z\tפftu:u!xU 믋E Pf} 봋U r(iUWVS.DUE -6E1D$|$E$xFD$T$$rxT$<$M+u [^_]CfffUVS|CãEuUMx#L$ T$t$$x9s[^]ÉL$T$$T[^]äfffffffUWVS C2utcEt\E $b%ljD$4$'u?|$4$"u%džt$|$E$d [^_]É4$%"fUWVS yBàutcEt\E $$ljD$4$t&u?|$4$"u%džt$|$E$ [^_]É4$!UWVS Au t\E$G$ljD$4$%u?|$4$z!u%džt$|$E$) [^_]É4$ !UVS aAÈuD$4$tD$E D$4$5 [^]D$E D$4$ [^]UWVS@ u} tHƒt-u3D$4$$tD$4$v$V1[^_]US@íEU tttu P1[]UWVS<@c}u  t'@t\ft wvtr fwk#D$<$.#tLD$<$# v@u271[^_]D$<$"tD$<$d#UWVS|?ã}u tPD$<$"tƉ׉$q+t/Vk)Ѕ~?D$D$L$e[^_]UWVS>þ\$tD$hT$XDŽ$ $D$\$D$Hrd== 6=DD$`ݜ$D$hD$|-wËL$t@$D$P0D$DÉ/D$p1|$T1 |HЃT$|É/~994~كۋL$p DHЉD$pʃ|$|bD$`BT$<|$@|$TT$\8gt$T1D$8D$\eED$0D$TD$0+D$8D$Dut$TL$Tȃ~L$@L$hD$ll$hݔ$|$T ~-L$t&L¸L$pL$hD$ll$hݜ$؃|$TT$D |$D%+T$T;T$D?T$T)T$DT$\|$`D$TT$|T$hBD$|J+-fD$<T$hBD$|JAЃ  0uD$|D$|0tAσAЋL$|L$0QT$|I/nD$0=NyleED$\D$D  \$\(iUINL\$tGD$t$|4$mD$|8(D$tـH%\$`5D$`WߍGXljD$|@X0tD$DD$`D$<D$8D$\D$D  ݄$\$`D$hD$|t$XtD$|D$`e[^_]ÍDAЋL$|QT$|I/~9~+T$0D$0ND$<\$0D$<n݄$\$`nZ\$TT$D$`10)ЍT$| 0tAσ|$|AЉD$0CD$8|$\$tSD$t$|4$)݄$\$`6\$`NDŽ$5DŽ$DŽ$DŽ$D$`$t$D$PD$$D$ $D$$D$D$|$\$t蛼ƃ=݄$\$`D$X|$h8 \$0݄$\$ P$$$\$tL$H܄$T$Hݜ$D$L|D$0؋D$$=u D$ CDŽ$DŽ$D$HD$L$D$D$5$<$\$t$$t$ $D$|$$$\$t݄$\$`|$t'4$^D9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USòUt/9E t*'D$ P'D$D$p$'$GE []US.UE%t/;U t*'D$ P'D$D$p$'$M []UEtt]ËE ]1} ]USñE ~>u>EtQ'D$ P'D$D$p$'$<[]ËEwǀ[]ËEǀ[]US"EU tt 1[]WUWVS $ ƅt@@@ D$D$4$u [^_]84$f81 [^_]UWVS(OuF~O9tHNM 1[^_]ÉUtED$|$E$iUMuFUF맸UWVSɟ}t;t-M tWt1$9ww$<$w[^_]UWVSDkEPUt8E19ut%E'i'^'T$ t$D$E D$D$|$ |'D$D$$z`u(u~M+8[^_]yL$D$ ZD$D$4$KzD$t$$j`t'H󥋅D$ $[^_]EExUI0EE왙E E ;;MQ"@QW7 U܅o_TExEoE܅u01) [](lUS çE D$E$[]ffffUWVSK rD$E$٦E@0u ǀE EEEEPEE9UED$D$ $M蝟MUp))‹}W7‹}΃K$}D$E$;E[^_]ÉT$UD$ $MMUuE@uЋ}΃stftU)UEu=u$ȉ$sEPfB볋E)‹}WȉЋ}΃u1u$}}Ef}}ftEfH @D$$Ϥ1[^_]uruYPE;ED$E$芤1KfkPLfExUWVS W~jD$!D$ƀ,<$EtE D$ED$<$-D$$  [^_]UWVSu D$4$oFFy ;F|/} t)P}D$4$c[^_]Ét$E$UVS iÐuD$4$D$D$4$ff D$4$ [^]US7ED$ E D$D$E$2[]fffffBfBfB B UWVShЋPQ@ $(KDžDž x^D$$~tmpЉD$D$$*Bu t< u򃽴#wH@+9N4)ЍW9w։)ЉG 1ҍ9tftH<@ lj)9tA;wh΃r2놋D04$@;y$T@ Džh[^_]Ã< t< t򋅘D$4$|1Ҁ8 Hit$${t97 tb t] 9vx0D$4${wpd u뉋@ k‹tft4)‰NDžLtftQ :)9<44$!@;‹hD (T$$d…9+Qf 0Dž1aP$%f  (D$$kB+lj$}Dž>f`BUWVS`DEEE-6U1ҋ@E4 D$ .u‰t$L$E$X(})EE4$ڼML$ML$D$ t$ED$4 $X4t\E$E@ U+u_`[^_]ÉM4 $3MB΍)EfMUEPƋE$u_UWVS(E8P4 tkEUE<$ڻML$ML$D$ |$ED$4$^3Ut/E$E@ ([^_]ÍE듋MEƋE$Mt([^_]ÉU荃4 $}2t4 U9UWVSMxubx u\@@ HtEӋ‰t"ƃ))u)9|[^_]UWVSXhÏE}E -6M1Ƀt/苺/1M+X[^_]Dž;E~F D$.${,8tGt2fDwu<.tfD$:$htOfu:t .Duـx.0}GPuNWP v@9T$D$$ '@8@lj)Ɖ$W@92‹Љ@ э:E4$虷|$D$t$`D$)D$ }YD$`D$$jDž;ER1D$ D$D$$y.+1hsfcuCu*>X1!fYUWVSd~׉E EuM-62u1} }t*}t$1}+> d[^_]$(?u3Dž$D褵1돋ωAfAffQ 9fED$D$ T$D$$;@ u1$ЅyD 9c}}FPVDžPw9uDž Dž@*T }}} 9}#GV'M<$RNjE$R$CS|$t$D$ D$D$$%B1Ƀ9)‰T$D$ D$D$$p9DžA@ u$Ѕ48D8 9rQ4$;fF$;ǍF$;Ћщ;wfp1$1+!BGD$t$ D$D$$Z8Džx#@ k4$ЅXCf ft fttD$$R9P u,04$輰t~9)9nv8Ћtft1%dUL}BDžDž O819tl!9hu牕f zOut|J9~ 9~ oti9~aGH0f9~fpfJ2r 9uك9u@ +x+)9~փ $+Q)9nFNjtft4$蒭=2,D$t$ D$D$$3Dž@ 94$x)9}T$t$$1D$ D$D$$%1l$mp)9HEEUSc$D$D$@ D$ D$ ED$E D$E$[]USïbt$D$D$ @ D$ D$E$[]UWVSBeb($tDÉt$ D$@ D$ $ًU EƉ$ [^_]1[^_]UVSa tpǃ ǃ$ ǃ( ǃ, ǃ0 s#D$D$ @ D$ D$ $"Ɖ[^]Í $  t#ΐUWVS 2aƉU,8DGtlUU؉U0tr\G0 1 4H\Gu2.utE]9t]srBDGu1[^_]Ã0 vNȃEt0ID$E$~oİ[^_]ËMx1DžlDžpEP:E@ fu%!tHMfA E$dDžiED$ E UD$T$E@$t!Ѓ8E@0tuN@9t$E@0E@MAfa D$ $xnİ[^_]MQf7xD$$oE@ UUuVLfF EE UdhE{@ fbEPPHTE@\lp+lp։ωlpMI0T XZMI<\)ωlplpƉ׋EH8+H1)׉lp\bf uBldh9p|$1lp9dh=ExL߉#dh!D$ |$D$E@$t!ЃyE@@MA0tI@9t$諡E@0Ef` ߋd)lt.$E@l9})ЉGD$E$k1İ[^_]ËE$aE@ D$ D$D$E@$tЉlp!ЃE@ E@)lplpE@0tE@<)׉lplpE UuEEP$FfE@fuxT$$-lE UEUԉdhu~TvPlpNEAu+Flp)@0TXEt"@ fbE@u~<\@\E@ fbE+H1ҋlp)׉lp\DžXD$ D$D$E@$tЉщ!ȃE@ fbdtl)UB+tЉJXt+@9t4$蛞Ex @0TTߋ}fG D$<$i1輊nfffUWVS4BREMHM@ED$E$h1EEEUtED$ ED$E$…uuGE$|DžID$E$9h<$~14[^_]À}F|2 EtNML284֋EUDMD$<$ߙ…Mzȋ}׃;tftE׉ED$E$gEED$<$iUuu؉}}}UzMqBtz}u:Euߋ}OMMU8|U88uu}GEE@EUzMqEBu}<$EE ^E ]4[^_]E89 JEܸ)ЉEЉủ}ԉ ;MȃEU8Puut9wE9Eu}ԉ)։u Et)E9rU9|UEEEU؋Eu 0M܍D0D$<$mU M}}ωփ}EEuq}8}xEEE9Eủ}E#E\E\flM}8}fEqM=uU8Uuu8EuMU8mU8aU8OPu8EuÃEU܃9Ufl1맋EXM}܉DfmNm.ffffUVSMuF0t$ UT$T$$g+tM F0[^]ËE F @u18Tu1fffffffUWVS SrLÉσt )Njt;u&CL$T$$P tZu` [^_]à [^_]ËCL$T$$Pt#tɋC|$8 T$$P [^_]1 [^_]ËC|$*T$$P [^_]U EE D$E$U]øU Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]UUM ttt1]ø]ËBM U]B@]UUM ttt1]ø]ËBM U]B@]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]U Utt t41]ø]ËBML$$tEM f]ËE EBML$$P]UVSM] 3t@t+t 1[^]ÈUuAut$ $PUtۈ[^]ËAUT$ $tUUVSM] 3t@t+t 1[^]ÈUuAut$ $PUtۈ[^]ËAUT$ $tUU Utt t:1]ø]ËBML$$t1UM ]ËE 1EBML$$P]U Utt t31]ø]ËBML$$tEM ]ËE EBML$$P]UEU Mt]n]UWVS趿EuE tbt;t 1[^_]ËEEFUT$4$PtڋU ;MvIuɅ$hE 멋FUT$4$tME;MwuQtbtkEډ>aY}ME$E E1]u[^_]ÉL$M$]ËE ۋMu*D$ $ENUE D$ D$D$E$l]UWVSu} EE]EE|$4$t2Cu Ct9 uUU u[^_]Eu1[^_]UWVS谽CuEE 8t utQ<${EED$4$qtM;Mwtmtt(1[^_]É<$aE [^_]Et>uu}uE<$E E랉ȃttEM밉MD$$蕊NjE 8Mu*D$ $CEU D$(#E D$E$]UVS]tZtIt 1[^]ËE M QUECUT$$PtҋCUT$$P[^]ø[^]ËCUT$$tCUT$$tEMu F[^]UVS]tZtIt 1[^]ËE M QUECUT$$PtҋCUT$$P[^]ø[^]ËCUT$$tCUT$$tEMu F[^]J@UVSAuED$t$ ED$E D$E$~>.t[^][^]US蠺@ED$ED$ ED$E D$E$$[]UVS`Ç@uE D$E$tE)[^]UVSEHt9.Q.tFÃ.t,.tDuQCvCv0 w[^]Ã߃AvXЃ wUtމƉ뤍sw3Ƹ.듉ރ߃Av܃0 vԃ-u ӉQ|svŃ0 v1҉[^]UE8*u P.tt E]]ÃE]USUtGÅt91.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]UU!]wBu]1]US蘸ÿ>E D$E$[]USnÕ>E D$E$[]USCj>E$r[]US G>E$@[]+>96U>E Mx5]UEf]UE]UEfU f]UEȋU ]ffffUWVS$Ǣ=E EEEHEËU ,Ej9U 9UXr.Eƒ>@tK9U-@>}A4EHMtTAcI} BEE E1ɍ,E,EЉM[6U|$M $=Ut|UM)ȍ<FD$ $=UUM)ȍ(E,\.u+E܃E%E}9}EM؈v/M؅<.U܃uyUD$]E$<UEE+EP~xF~EЋDx0~ru9}19u(EEEE1+EU}f떋EEtEEvUD$ED$ED$ ED$E D$E$]UWVS0袪0EEEx}܋EZE@}8uEU1i@(HˁLʄűE EEEE̋} EEEȋEE:uE;EEԉ}؋EԋEEtzEutE+uuЁ?aP0t;ME?@ ƋEP0uEE}EuEE9Ed}؋]gEFFEE 9]+E fFEpB'}1f6EpBUWVS$,E-6 M1D$D$|$ ED$E D$E$t8ED$D$<$tE+uЁ$[^_]úUWVS$Fe+E UM-6;}1D$ D$|$E$lt-L$T$ ED$D$<$U+u $[^_]ÉTUS]E M9r 9s9vu[][]UWVSflj*EE;E szX0t0ʃ@t:ttSb([^_]ÍX;] wދE1[^_]9] v)Au@u#!E!39E w뾋EEUVS责)E UHu'u#9w5)ItAZ…uމ+E[^]Éa[^]Éa([^]É+E[^]UWVS%P)EEUu Ɖu]Ӊ]8]}N 09Mvy 9Mvq9uczPt$|$$U]JuCU270:ۅtNt% t] a[^_]1[^_]Ë]`([^_]1[^_]UWVS 4[(u}E9E |2&6D$D$$IumtF;Gt1 [^_]ø [^_]UWVS͡'U2E uuZ1[^_]ÉuZ9wBZML$ ML$)D$D2$xC9E~E}ljr[^_]É_(_иɉ_?UWVS .'ME tjX1u%9w8L)ÍF[tA…uۍF[^_]É>_[^_]É'_([^_]ÍF[^_]øUSzá&E D$E$j[]UVSOv&uD$D$$YtD$T$ tV[^]øUVSuU ]t*>t8u9t Ju[^]fffffffUWVS 诟%EU܉Mtȃ"uuFE]\$$\uMÀ-u+EEE}EډU1709M~Kt#E;]])ˋENQЀ vQW9MU܅ttFEE܋}8؃ [^_]EEpEF0E E?}UE<;]PtI]˸YQp7;M3\" ;M~x\"EpEG\E܅to}81u [^_]UЛ!UT$ U T$,D$E$]UED$ ED$E D$E$~]Uo!UT$ U T$,D$E$G]UWVS 9`!E} E0E@0zE@1/tftE@EM)ȋ}GU\}EU2D$ED$4$w0Et)EEEEEUM 9s[=sFt%  Ɖ Ɖ  pt$$h…t_EE 0E0Mȉ׃u_uFE$jKEu[@ CXTEfH @ [^_]fEǀw@ @u}]t6EtE [^_]ËE -WruUWVS<}D$<$5|$ ED$E D$E$D$<$5[^_]US跘D$X $%[]UVS膘íd5uH [^]ÍD$$%X $|%ƅu$#bƅtD$X $0%FFF US cVU T$UT$$ []UWVS赗JD$!D$ƀ,<$vaE t8ED$E D$<$$|$ D$D$h$ #E$nD$wD$$a[^_]ÐUS 4E D$E$5W[]USߖE D$E$W[]UVS谖Ƌ$hFt)VtF D$F$ҋF9t$\[^]UWVSYÀE։ϋMt%L$UT$ $r[^_]ÃD$$dƅtM1UWVSu} GD$F$uD$$U[^_]UWVS,袕-6M1DžDžDžDžDž$t3D$D$ ,D$D$<$Z=~j$t p 'p T$ D$t T$$1M+,[^_]D$<$Zx,T$$Z…D$D$$҉t6t, L$ D$T$$c;t$+ZDž$ZDžYUWVS蔓û@l$xD$ym4$E9` d Ed$hHD$4$r]l;6`Nx h| txhDžptLGtWt1 t $dW9tu$dGt$dpp ;| rhth$|dǃ| ǃx p tt t!t1te;t r狅ttt$dǃt ǃp `$zA| u;EU` d d$l$1Ĥ[^_]ÍT$ D$ D$x $ UWVS(ZÁ}u OW$tRGED$D$ t D$p D$E$R1t([^_]Ë3UWVS ϐ}GFX^L$ D$D$ -$WGEiE썃(E荃[E3E$`WEE9GE4G0D$E$1WGD0t‹E$WGD0u-$VGD0t0-$VGD0_@-$VGD0JQ-$V7$ U [^_]ÍUWVS[Â| 1u9| vx <D$E$ZOuΉ‹OtAGEt"1Ut $aO9uuUU $`GUUD$ ED$<$UЃ[^_]$ | x Etx 1҉Ѓ[^_]úUWVSl[ÂE~EsEhd5Eh Ph E$4EEčD$D$ | D$x D$Eĉ$|O*PU@E1GE0EEEM E t~} tpD$4$MuOGUT$L$U$ЋUBuMu#TEM9MEU4ЋM yuED$D$ t D$p D$E$}NtMPtFMMЋMMԋUT$D$ P T$@D$EЉ$>NtH @,1EM9MXE$Eh ul[^_]E\<$l U 9PuMEAl l E<$<l[^_]Í\<$EtUPU<$RE0E1U<…uEEEHh  MEAl l E<$w <$wEtUPU<$]EEf̀rS[[UWVS諊ƉUM}PЀ wK1HЀ w%0P9~HT1[^_];U|E[^_]H1[^_]UVSӍu$1ɉYts‹M)::t Ѓ[^]ÍB$;1ɉ…t4M)::uʍB$<1ɉ…tE1UWVS草ǰhFٻ]t1lFdVىudFډ >-00u[^_]Ë]!؃[^_]UWVS6]ƉӉMudi)\P(\vB;SBLLL);Q= ףvEK My *)R)ǃQ))|gfff)DbQ)))׺$I)))ljC)S}u v u싌 .4)֍t09@9| )~`E@E썀 .Ƌ}|)9uKEȃ[^_]ËC )KEȃ[^_]ËSBLLL)KEȃ[^_]ÃC)*E B9At DËA+BuA +B uA+Bu A+Bu+UWVS=` |$ D$T$0L$,} \$THx|$\p t$FD$hF;D$@l$<D$L$D\$H|$ډ$$9ȉ8|<u(3lFdV-00tD<<<sĉ|$,,$<\$ <D$ \$T$0D$D$9D$ W D$\$,hF9u͋\$  L$0hF9dFL$,+dF1G D$D$$D$E$T$(щ€|$;;D$D$$D$E$T$(rщ€|$; D$0dFT$,+dF)1W G 9\$ W +\$8T\$8\$UWVST%zLU0xu}ʋ IXXU p x9uU|u}ċUIlX}t`XE.‹EEƉ)Ǎ)})lj})։u;MEU+EUĉEUEEE<ED$QD$ u}4$|$wEUD$QD$ 4$|$E.‹E}:))})+}Ѝ}lj׍))MD$:D$ EU$T$k}|Eиk9)Ѝr)‰)))D$:D$ EU$T$qi"EU}MЍ_uk9)Љ))щMD$dD$ $T$ nD$D$ EU$T$k Ѓn9EpSc} :)șEUEȉỦƉ׃MЉE؉UD$D$ 4$|$OEU܉E؉UD$D$ 4$|$'EU܉E؉U܋MЋE؉EЋEUƉ׃MEUD$D$ 4$|$EUEUD$D$ 4$|$EUEUMɍU)‹E+E)‰UEȋỦEUEUƃBm9Eu؋u}ƔE9EpUbE}x$I)))MEUƉ׃EЉUD$D$ 4$|$EUԉEЉUD$D$ 4$|$}uƋEM荄5ƺ$I)))ƉyEPųE }O)M)ѺW)Ѝ)ЉUM9ЋME؅J .E@]9|u)ӉFT9~]UEP @ ]X$T[^_]؃ډƉD$D$ EU$T$@D$D$ EU$T$׉ЉEЉEMmM؃ډƉD$D$ EЉUԉ$T$D$D$ EЋUԉ$T$׉ЉE؉ЉE܋MqnD$dD$ u}4$|$ u$D$D$ 4$|$ lP.g؃ډƉD$D$ EЉUԉ$T$D$D$ EЋUԉ$T$ЉOE<E0T1&EmUVS8r_uE$ E tu t dVP([^]Í.P([^]Í.USJMt50 wsS$m1tX8/t}C []S $ t%8.u S$t8.tH1[]S$mlzSH-t++t>[]S$15CC[;[]UWVS.ED$ ED$ED$E$ƅHE@9EE}G}mș+EU؉9‰F1EԃEt}<$}Ћ 1(ƅEЋ t"dVF(M]؉ș9둋EЍ.UWVSd m-|$\T$PL$,fB<: u3|$X5|$Pa )GD$XT$X|$PwGW9|`Y`D$\T$`>|$T9t3T$`3TD$\3D u>L$Tt΋D$P@|$PD T=Y`Ӂ|cD$\T$`7>^t$T OT$`3TD$\3D u>t΋t$TD$P@1T$P9~[>u|$PlFdV-00t:L$P> hF1\$XhFt 91|$PZ1z\$\%8e[^_]ËD$\8bD$D$(9D$@tSD$ 9D$@tAD$P|$$xt$@pt$4p >t$Tu4t$X8>D$8D$D|$LT$HD$<ƉB ʉ։߃9D$Xu|$<yD$T@L$DAQL$P\\$D$$L$H1:t|$P7>9y;|$@|ӿe[^_]ÿ?e[^_]1D$Dgt$H؃  ȃuyƉ;t$<|\$T\$\#8JY&L$HD$PpD$PdF1L$HD$X4 u|$XyA<CA;D$4C;|$@|L$H1L$H\$4t$PdV9|D$4D$HL$4dV|$Pf@?|$$dXD$@D$HD$XD$4D$TD$8>tE1t$PFD$\=E0, [XX\$T ;A Yzl$Ty\$\\$\K\9D}%\$\DTUD$X:>NE9]D$X1ҋ}  T$\L$P]D$XA|$\;|1TF;1XF;1\F;1`FD$\|$\9 |$TT$T4$\$\T$TЉD$T17D$XЉD$u)T$lt$pAT$tD$\멍AT$tD$\t\$t|$hGGD$t؉dFƇhFLJlFfLJpFLJtFƇxFLJ|FfLJFLJZt$Xw dV\$lډNjt$psgtftt$l0e[^_]D$PD$Lxw1 y$/\$`#Å$1ɋT$h|$`y-Ɖ$+D$htoD$PD$L1 @D$\Ru>uT$\)щL$TT$tT$xgD$PD$LD$hxD$tD$Lt$h>>> 9f |uA؉D$`1҉|$Pt$h>hF>qFuL$L+L$`L\dFt؉D$`;T$PuD$L؋t$hdFƆhFdžlFfdžpFD$x؉tFƆxFD$X|FfdžFFdžZD$h\$HX dV\$lډNjt$psgtftt$l 0T0\$T؉׋t$\stftD$T0Ũy{dXt$hdXeXeXfD$`Gf\$hdVeV\$lSf=AyD$Tf.\$hdVeV\$lST$x\$x|$XD$`T$dD$DD$@^i)\P(\wU= ף%Q3D$`T$dp;\$Dp0\$P9؉\$L}"D$`t$d|$Dt3뿸븉|$ |$@t$<D$<\$ D$@|$t$~i)\P(\= ף%Q3D$89t$Dz|$DL$@ D$XD$`T$dD$0T$4D$T$0T$T$4T$D$hT$0TT$TD$u0T$P9T$T$T$L|9t$DD$hL$@>AD$@D$XD$`T$dD$D$T$ T$0D$hT$TT$0Tp+L$T$P9ыT$0T$L|9t$Dt$@0>FD$@;|$D$}QD$:t1ɋU8vUWVSP-Nj t@U$=EU~)|$ $u[^_]ÅxE } .dž GXx2>u E [^_]Ë_yUtPىfu$ZÉ ;.dž 1냍D$|$ $UWVSjNEu] N~61hF9u lFdV9ut [^_]Ë] 1[^_]UWVSN%E] H~.hF9udF9ut[^_]É8 [^_]UVSMþ4$1h4$[^]USaMÈNk$[]/UVS6M]4$]Nk$4$B[^]UWVSL$ZÅtUDžu ؃[^_]É$3 81USLE$[]UED$ D$E D$E$]UWVSOLv<$vNk$ D$ D$ED$ $=Ɖ<$2[^_]UWVSK<$Nk$tE D$ D$ED$ $Ɖ<$[^_]UStKÛE $ 1ҋE t tdVP([]Í.US"KI $ 1ҋEt tdVP([]Í.UVSJu ' $ Ertu t dVP([^]Í.P([^]Í.UVS^JÅu E$ Etu t dVP([^]Í.P([^]Í.UWVSI<$Nk$ D$ D$ED$ $Ɖ<$t 4$9 Ɖ[^_]UWVS}ƃL $tCƉxtD$<$E FEF e1[^_]ÃUWVS}t3Mˋu Ήt$E$Ut~uu Wׅu1[^_]ÉUWVS = EU΍` <$4t?$tYMHMHp  <$1 [^_]Í 1 #txu8u막<$UMU E]HUWVS5=T` E$|  1 E0E}Uׅt& ϋCtT9S tuߋu}샮| E$| ut?$u[^_]Åt* MK uIUCЋU ;EuO| u;]rF;]sAktڋ MUCK $ЋU ;Et׉E](U11ҋE]UWVS;ME0}U-6E1E (,hEED$E$D$h8$dhǀPǀTǀXDžDE ,(tY8HE @LT$ |$0D$8$8}+>uE[^_]Í78HDž@DžLT&Uc:UT$UT$ ,D$E D$E$X]U%:PUT$UT$ ,D$E D$E$]UED$ED$ ED$E D$E$]UWVS9޿D$ƀ,FX$?F`F`y ;Fp|4} t.FXPVX}D$FX$.[^_]ÍFXD$E$US29YE,Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$c[]US 8E D$ED$,X$n_ []US8ʾED$ E D$ED$,X$_[]UWVSc8Ê} Ee E EED$E$E@ E@U~1M19ssE}EtfEtME)‰UE$[U/E@뮁}bE KEE[^_]ÉЋ}tftE)PD$$(EEE[^_]Ëuulj7wWU<$Uu(w+WuދECMAAA듋E)1u EMuouV0(TEfH @EUD$E$FEU)1u EfBfmWMyHM2US 6-ED$E D$E$\ []US5ED$ ED$E D$E$\[]UWVS5»ED$E $JƅD$ED$E$'xy=_fFf~ vBF$F,HF(F EtED$ D$D$4$_[^_]É$蕹[fF 1[^_]UWVS4ں}D$<$Aw fD$<$O[^_]ffffffUWVS[4Âu 4$;EU9v 9ru׃s$u8u:Ѓ[^_]Í 9rU9sՉ׃ru$u,tftƤЃ[^_] zfRffffff!̀rS[[UWVS{3âu F0u ǀFFF tBNt;})9F~JnJM 9FtHF t t=[^_]É4$|u:N})9F4$%u뤉4$tD ffffffUWVS2¸Ӌ} UU tau! uމ[^_]Ãu1ރƒ0uEtԀ0tσC0[^_]{ xy1tv҉)Ѓ0CUtʋE9ut ~sECExtE1띺4)0Kщa0C[^_]UWVS P1wUM9 ?p9s΃ttUUED$t$E$MU)UD$D$$E}E01 [^_]ÉUE.ED$t$E$&M u9EU JHJHJ H JHJHJHRPV|U0U$G0VUWVST 0/T$L$\$4\$11҉  r\$\$,D$0D$ D$$uHtDP%uD$(\$0\$XPZw @/t u\$ 9\$$G|$$ D$D$$6 L$, < 01ҍTPЃCHЃ v$h։YD$(UUU9t$09t$$st$$D$,D$ 3L$(D$(UUUp9t$09t$$st$$D$,D$ L$(D$(bUUU#9t$0 9t$$st$$D$,D$ UUU9t$0*9t$$st$$D$,D$ _L$(1HЃ  1҉t$ \$Ӎ\PЃpЃ vt$ L$\$ \$<$UUUV9t$0wT$,L$9t$$st$$D$,D$ D$(UUU9t$0x9t$$st$$D$,D$ sL$(ED$(@s࿀ D$((D$(UUU9t$09t$$st$$D$,D$ S*j HЉӃ CPЃ vL$(UUU9t$09t$$st$$D$,D$ L$(]D$(-UUU9t$0wL$0T$,cm9t$$st$$D$,D$  D$(; D$(L$( \$ \$34L$,st$ 9D$$;L$U $J1e[^_]Ët$t$L$,^\$붋t$t$vtL$,t$^\$돋\$ \$stL$,\$st$eD$(ttUUU9t$09t$$st$$D$,D$ UUUN9t$09t$$st$$D$,D$ D$(D$( UUU9t$09t$$D$, D$ qD$(UUU9t$09t$$st$$D$, D$ )UUUy9t$019t$$st$$D$, D$ L$0T$,e[^_]D$(uD$( UUU9t$099t$$st$$D$,D$ {UUU9t$09t$$st$$D$,D$ AD$(UUU9t$0wL$0T$,(29t$$.D$, D$ L$(@L$(L$0T$,L$0T$,L$0T$,L$0T$,}u+$t]T$x.$$ C$$$$@$T$x_$8\$HtD$H$$s$@ @ftD$x$t$9t$$3D$0$<++ED$xe[^_]Ë$<$$XCG f 4$fx"$$DŽ$DŽ$D$$$$襨D$$8$q$ǁPǁTǁXy 1??tft$B f$f$Bf$B$B,$BD$$<$$DŽ$DŽ$DŽ$D$DD$ D$4D$D$$)|$l$$$~,$'D$|D$|$$‰D$H,$$$<2 |$<|$$<D$ D$|D$$D$$2L$H$D$l$et$<4$$@$4$$n@D$d_8V$$$Ѓ0$1 , 4Jу0 vꋔ$$"\$lKh)[4t$tL$lL$tnىL$t}$3$L$lY$ _')I \$$H1ہ$$D$l$$C$3YƄ$$D$d|$W$ D$HD$@$+$D$P9~ƅ~@$$r$$$$y1t$P)ƅt$P$|$d$ D$hD$,$$$0@$$$$$+$D$h9~ƅ~D$$q$$$X$)t$h|$hP$|$h,$$$$$Jƒ~G$F$B$vDž1ҹ$|$h$$$t$hp$$w$tDŽ$$-$$$t$t+t$|H$'$$$$$Jƒ~G$G$B$vDž1ҹ$$$$8p$$t?$D$$$$肕DŽ$DŽ$SD$LD$xCt$t+t$|$($$$|$\$Jƒ~G$G$B$vDž:1ҹ$$$$8p$$$$+|$p$"$$$$$Jƒ~G$F$B$vDž1ҹ$$$$x$$$D$\D$$$$vDŽ$DŽ$G11ۋ$<$D$$$$"DŽ$DŽ$11ۋ$$D$$$$ΒDŽ$DŽ$"DŽ$$$|PDŽ$$$$y$P|$h2$p$$D$,$$$0@C$$$F|$@GF D$$V1ɿ$t$h+t$@F$| \$(ZÉ$$B$$D$$$$3DŽ$DŽ$11ۋ$$ $$D$8$$Jƒ~C$G$B$vDžu`1ҹ$$$$8p$$^$$D$8D$$$$ DŽ$DŽ$11ۋ$$D$$$$蹏DŽ$DŽ$D$l 1$L$\$\$h$(  uB$@L$p֋$$à u剌$e$D$$$$ڎDŽ$DŽ$11ۋ$~DŽ$$$$D$$$$`DŽ$DŽ$11ۋ$$$$D$$$$ DŽ$DŽ$1ۋ$$'$$$A$$$ $$ D$htB$D$,B$$$v$$JD$hD$HD$@$$$$0@C$$ y;t?$D$$$$袌DŽ$DŽ$s$$D$@$$yt$h+t$@*!$$$$yك~G$B$Y$uDž1ɿ$$ r$$T$lRݔ$|$W$T$$T$$T$T$hT$ D$$$-$'MDŽ$=\$PT$h9)ډ։t$hD$hD$H8N$`]$(3$$D$|D$pDŽ$D$`D$XD$P$@D$pË$$$ڃ0 u䉜$$[<0SC0B$@ DŽ$$$$d$D$$$$蕉DŽ$DŽ$f1ۋ$$AD$@D$h4$D$$$$,DŽ$DŽ$1ɋ$$\ t$l vӅ$D$l1Ҹ DŽ$DŽ$$ \$l [D$l1Ҹ DŽ$DŽ$  L$lI DŽ$DŽ$$ L$l ID$l1ҸDŽ$DŽ$$tt$d$+$9~х~9$0Hˉ$$$|$dy1ɉ)΅$L$Xtet$`uil$dl$X$@$$Q$>`DŽ$$"T$`sl$`뚋$$$$$у~B8@$Q$vDžuP1DŽ$$8p$$$:t$d$D$$$$DŽ$DŽ$DŽ$11ۋ$(ukDŽ$D$d$1$D$$$$wDŽ$DŽ$H1ۋ$$$D$$$$#DŽ$DŽ$D$d1ۋ$$DŽ$$t$dn$$$Ƅ$-$$L$\$ׁ|$hу$D$l$$ljօR DŽ$$@D$pD$dD$`8D$ D$ <$t$$tlj։ O$AL$|$D$ D$ <$t$$s0L$|A$$D$hrD$`<c9[ 9GA$D$\AD$`xtD$`D$ D$ <$t$$sljDŽ$t?$D$$$$DŽ$DŽ$$|$D$(É$$DŽ$$2$$$D$pOxDŽ$$$DŽ$)t$h$$$D$$$$DŽ$DŽ$1ۋ$|$d}$$$$|$p$Jƒ$G$B$vÅu1ҹ$뷋D$pD$$$$+DŽ$DŽ$11ۋ$fDŽ$$$K$D$l$$@$D$$$$荀DŽ$DŽ$^1ɋ$D$W$|D$P+$} 6D$Wttuf9uE[^_]À<>XuD>t6EtD>t&u9u9tt[^_]ÍD>UWVSù]}ED$E D$EE$h<3E܋h3\$D$D$D$D$%-MM0U$T$ 4ƅGT$ DV 9ЉT$ v")HFL$D$$辉T$ ЍN99T$9Ӄ9uT$9Ѓ9uU'} ];E tE C9wwN9ue[^_]ËD$%-uMEED$E D$53$3Ɖe[^_]ËED$E D$,3$m3Ɖe[^_]ËED$E D$H$;3Ɖe[^_]ú+]~ t$^L$E$UE|tET$r@dUWVS Z}m|$D$U <$~3eP3m܋h3|$D$%-BuM"U$T$ 1ƅ9T$ DV9ЉT$ v")HFL$D$$T$ ЍV99L$9˃9uL$9ȃ9uU%}];E$tE$C9wuN9u [^_]D$%-@uMEED$E$D$53$0Ɖ [^_]ËED$E$D$,3$0Ɖ [^_]ËED$E$D$H$0Ɖ [^_]ú9]~t(^L$ɋE$UE|tEL$vPhUWVS`&XE(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$Wb¿p3D$DÿED$ED$ED$E D$D$DD$ D$HD$|$3$U:ue[^_]D$DD$DD$DD$DfffffffUWVSĀW}== =DD$pEU D$PT$Tu %=D$PT$hq D$p~D$pD$xD$ D$|D$D$h${D$HD$xD$LCD$hD$`D$l% ?D$dD$(D$`أ3܋3܃3݃3L$`L$`|$vD$v fD$tl$tT$Xl$vt ؋T$L)ʍzt$X&\$hD$,D$DD$8D$D$H$sD$HD$`D$`e[^_]D$pUt$T%=dE'E  D$E D$53$,D$`D$`e[^_]D$,D$DD$XD$XljD$ D$xD$$؃3\$LD$LT$PD$-@D$D$$أ3D$ ؋D$$T$(D$LT$P|$DD$<L$8|$h+|$HGD$xuVt$D)9D }D }: )ЃD$x}~T$\~ ;D$\ D$TT$,L$0ȉD$0T$h$UD$DT$h~t$T~9~D$x)D$0))D$TD$,t D$8eD$,)U$HUD$hYt$X} D$Lt$X+t$Tt$xD$0D$TL$ D$\D$8Fr |$DD$L D$xt$l|$X|$Dt$Lt$d$QL$TJ Mu M9 ~ |$< D$LD$LD$dAD$\9D$x D$D$ 4$Rƅ%;|$XD$D$ <$lRDžD$D$ D$X$FRD$XD$xD$hD$4$TD$H0L$d|$4$XD$TL$XL$D$h$X…@ T$T$84$[XD$DT$8$PD$DM(M L$Dʃ T$<L$dt$d|$D|$Xt$L9 |$Tz L$H1E VD$DD$X|$DED$`T$\D$h$&P|$DT$\_D$Xt9tT$h$OT$hT$hD$D$OT$h*L$TD$ )D$0|$X|$T|$4D$,T$lD$D$d$MD$x} lj|$D)D$HT$l8D$<=D$E݃3D$hD$lL$ll$t\$ll$vD$lD$xED$8D$D$\r|$<t +D$0tD$8}rD$\D$D$D$h$KD$hD$D$d$RRD$lP1D$4D$` T$\D$h$LJt$DT$\=}D$\|$,9~)ljD$\D$xD$TL$0ȉD$0D$x?T$T$hD$D$ND$Dbt$dt$$\LD$dF4$IT$h|$HE@D$L;E D$0D$TD$Lt$\:M؋3\$LD$hD$DEЉD$4T$lD$`؋D$<؃D$`(|$HE@9E Ut$D$D$)OD$Dr?+T$,T$X1҉D$,q|$0+|$\D$xBG$6GWx q dtftD$$NDžD$<wz4u2D$hvt(؋t$lD$4D$l1D$` D$`?0tD$41L$dt$d|$D|$Xt$LT$<*L$`D$D$d$MD$dL$hL$$NL$`9oL$H1D$< L$dt$d|$Xt$LD$X|$DnD$hD$DxT$dz|$<hL$`|$dAD$D$ <$GDžD$hD$<$0D$`L$\t$dL$dt$D$h$ML$dQT$\~L$\D$`AD$D$ 4$GD$d9t$D^D$DUL$dt$d|$D|$Xt$L9VD$DD$X|$DD$` vD$\o|$؋bT$8XVH؄tJuU tu ؃[^_]11US膡í'EHP$A[]UWVSDKv'EȋE @E]9C] {ETU]sučDEEH1EԉE9EEEE}EgEU܉Ӊ1ۉM؉]܋1ۉEEEUEU)Ӊ؃EEN9}s}]3uAC9Es0uV+E)‰؍M9ttMЋE]ЉXE D$E$]HEԃE̋uEE1ۋG1EU)Ӊ؃EEN9}sЋMċ]Ѝ2u4B9s$C+U)Љ9t\tUЋE}ЉxẼD[^_]1D[^_]UWVS`]Ä%-68}13HDžDžDžDžD$D$$!T$ w $G $D$<$2T$T $D$<$N&كP% ؋$8 T$HD$8\$0D$$ DŽ$D$\$$Ɖt$Hp\]؉]1EEډ> 'M9Mv9uv 9uHؿXHt4U tE ‰؍XHủu;]s A;]}ދEإ9v}؍GS9)߉} T9E)D$D$ $]2$Eԋ@u%E9EE؋U9tt<[^_]ÍF}<[^_]Íx}ԉE19usoF1FEF}}܉1S؀ w P v0P߀Xxx nf_)E )Nj]̉uȋuuZމ MB;Ur]̋u]c 5މӃ)u!Uu,)u}ԋG]ą )ٺ!ЉGlE؋E<[^_]ú} T9)E )Njډ]Zމ MB;Ur]|H pfUWVS0n" ]E$dAE.6Ex0?EE0V0wF)<ƃP0tEÈE‹M<?t2M1U܉}} 8tU܋}߉]؀PEEE1ɅF}]܅E @ U4;wE E6}1tu$] ƋE0EFt!D$D$F$f }9}~ +M}DE @}uE1ۃЋM<u:E)]}!T}Ju:Ћ]΀<GЋ]<u)]OEԉE1EUE 0BE]޿L$ME؉$]ƋME ;Et."L$E؉$]}#"fUWVSkeÒ Ep98)} 19$btWUP@u} K}|> 9u~2U)49t$W0T$D$ $Hu1[^_]Í~ u u ;}t$O0L$D$ $u}1KUWVS0mdÔ }u D$(D$<$\$ D$ T$$D$T$D$,D$4$f\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVShcÏ UME DEqAD9sץ9w)ȃTE9v#)D$D$$[^_]UVSEPXM 9} u#9w1[^]Í~M t09tݸ[^]UVSb #0)ˉ u鍊6a)ˉ u鍊A)ˉ u[^]UWVS} Eu^]9~kVU\ttt )EV9u]M ؉FB9UwU+U}Tt83E@E@[^_]É9vޥ9wE+E}Ћ})MA9tÃ[^_]Ë}GtUUVSaB UBJL19r $ 9vt9vUE$Ɖ[^]fffffUWVS` d5} vTMU$u*ƋUEFVu3FF [^_]Í M4tt ,$뽺ME )ȉ= @N ,$%V ,$CUWVS_ñ ut"F w"d5u& 4[^_]É4$h1[^_] ,$UN? 4tU${[^_]UMtuQtZ]ft11҄uuuut]1҉]ú ]UWVS]CEEƉE EE1ɋEDEEdUƉ׉1D9MӉu} t"E9C~$E}|C؃[^_]É؃[^_]ËC$&tMSx s stftE$&Eu2uȉE$Efx s UEuAuuux @t]1ú ]U$7t UP@]UWVS<\ u EP~9|׉‰uEF M9N}U$EЅ5HM̋UԍD9Us-U+EЃD$D$Ẻ$KUFEȍDEEE]\]9F]9)EċẺE E]9]vnEE@Etu܋}11ۉ}uEENjEgu61ډӉ1ۃEuF}9}wȋE܋}ĉ 8E]9]w]ԅ~ŰEtLtEԋEЋ]ԉXEЃ<[^_]E?UWVS 8[_ Mu  Md5E ,EEut?tDt|$E$EE$EEuE [^_]ËEu?|$<$‰EtUE$UvE$u뫉ME [^_]D$6D$ $EE [^_]d5ubUM$DžMU@q@ M ,$M~UM ,$ MUurEG ,$Eǃ UWVS$Y5 u EPNj@EHMG9~ 9$ Extt$D$<$ Ep@]T] ]t{ )؉1}܉M>M CFM9w}܋]K9rG)ڃtEEE]XE$E$[^_]å9vܥ9wպUWVS}u F_)u)ODT9s290tۃ[^_]UWVS,]E @s)KD} T9w:98tJC$ljE؅'p CEԍsu̍DE܋E EE @M DEGEЉEu11E]EEK1)@1)Ӊڃ1EEʉHE9EwËE HE+E 9ME9M ]ˉ]MЉM9]v9]A1)EU1US9MwًE܃+EEu}ԉڍ tUԋE؋}ԉxE؃,[^_]É؋] E x1$2E؅tNjE@@E؃,[^_]ù-1UWVSEpt$PtFD$^$+ )NjM 9 ~T |$9|$s%~?\$|$ D$ e[^_]ÅD$ ?\$1ι )D$ ?T$T$9T$r1ҍH Ӊ\$ D$ e[^_]ËV)‰\$ ً\$ D$ ?\$F9D$LF >1-UWVS $ÅE %tT$ED$tpD$$8T$ )L$ KT$SɃKuP-2uD$)E؍e[^_]ÍD$$T$SC tu5)‹E؍e[^_]ËT$ST$lUEM Q tJu]UWVSLSs } tD$E $ƅD$D$E$VDžtt ʃ9t-xD$E$t|E%=t`fp ttu ffp MfH@BP$ P,HP(¸P Č[^_]1Č[^_]1Č[^_]O1USQ# E UD$T$ D$E$[]UWVSQ uD$4$Onx$P8D$4$X[^_]É4$mUSfQÍ UjxH []É$6[]UVS/QV UƋUu 1[^_]ËOD$M$%…1]~ˉ߃Mt~tctQt>t,tt<<<<<<<<<<<<9EC<댉t$UT$}<$٣n(H9 ]U9 ~(}Љ}u胮$dž dž(UWVS; M ]EUrt!u8tP][^_]Dt4][^_](dž,[^_]Édž,UVS;5 M UEpEuU1҉[^]cdž,[^]UVS: M Ep}w=tE[^]`dž,[^]dž,UWVS@:k } D$$ƅǀMtzL8xD$ UT$|$M $!84$ 81[^_]É\$E$m T$ ML$|$}<$ É{X TUMQ D$t$$SF~^^VN~^F^V f F N F ^ nNNVFnN^NV~^F^NfFFV^fFN F V!n"N#^$N$F%~&^'^(V(N)~*^+F,^,V-f.F/N0F0^1n2N3N4V4F5n6N7^8N8V9~:^;F<^<N=f>F?F@V@^AfBFCFDXhH ݈JHXXhHJ݈ZJHXX h H J݈ZJH X X hHJ݈ZJ;Nx>alF]D$ 7$ ;F@7~F(dž‰DžN V DDTNꉖD$ T$D$8$R]tEP {D$4$0MM4dž$$$Džp8X?G1W >O &>_ .G7w[^_]ÿO$X,mr8E8F8FF F FFFF4X, ~D1 󫍾][U]StV4EHt }Gu]Stt V1v4s$^≕@DDDHN F$D$ D$ IL$4$~BF0F(LN,NV<~$;~v~,)F8FF F FFFF4X, ^D1 󫍾󫍕xT$]$vfE=~F $ F1T$4$1!$F~ 8118oxF8FF F FFFF4X,9 ^DlUWVS$~0å uF(F(NjN0!MNU9IF9MD$V$UMF($AV 9} LDLDF F,9r|$}|$4$2$[^_]ÉF0 F,ۍUE$Et]ED$L$M܋U$ǑME)EL$D$$XU܉$sMEFjUS]ED$U $ #C,9C(}#C0[]fUVS .# EpFtD$D$$ѸF u  [^]3UWVS.ú E8TumpXtwRuMP PDžPPH4xLxt[tS1ɉȁ[^_]DžXDžPDžT7Q8DžLDHD$$$fƅ0ǀDHǀ$$CFt dž qAAJA A AApAE UtZt\vFFt$t$S4$1ɉȁ[^_]ÃBo DxD$ ED$E D$E$.HDE EIXu$EX=X Tu dždž XPLt DžCXL9sЋX1TG1Pf{fPTD$ XD$HD$$^a PXD$D$$荲Xt?fx'8fxD$$ޱ3XX8D$\|$$襰TD$|$$聰Dž~\q@@f@fGG D$D$T$D$TT$$̳D$|$$足X XD$D$$蔳XE t @E@t Ed UqDxD$7$~H D7fdž~XD$`D$H$H4` =b1Xd `abcdefghhijkllmnoppqrsttuvw`b1O!ЍDLDžXHDžX9FiXt$ ˆT$¬T$$ XQ87 dUhX=8/t_ lpH1YUWVS$F&m EpFtD$D$$FUED$E D$4$TDžEtwD$D$ED$D$ D$|$4$2!@uFЃ$[^_]ÉED$D$$xUЃ$[^_]D$D$$SЃ$[^_]땺UWVSEU M HpPPHHpPPHH p P P H H pPPΈHPPΈHPPH t t][^_]ftHҍtPވQ‹ˉZˉZBtZ ˉZ Z ˉZ 9uŃ[^_]ftxҍtPu(r utMʉQʉQ;}dΈW‹ ɉ ZˉZZttr Ήr r ur Ήr ʉPʉPPʉPP ʉP PʉPPʉP[^_]UWVSEU U P׃X ރHpPPHHpPPHH p P ˉX ffxPΈHP[^_]fwHҍtP‹ˉZˉZBtZ ˉZ Z ˉZ ވQ9uŋX x#ʉPʉPPʉPP ʉP PʉPPʉP[^_]fxҍLPM3r utMʉQʉQΈW9}p‹ ˉZˉZZttr Ήr r ur Ήr UWVS([! EpFtD$D$$0FE  D$D$$臨Eb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$q$ժu ([^_]1([^_]UWVS' N }wFtD$D$$FD$<$~tx$tiFt$t$t$E4$<$E$3؃[^_]øfffffUVSEU Mw:v,290t49t)XJ8t)[^]1ۅuԉ[^]1ۉ[^]US  E;EwD$E D$E$ []WUEtu]11ɍT9w]1]fffffUVS UE X71rVȉ ȉȃ rȉVȉrȉVȉ ȃu[^]11ɍv1É11f1놉1_UWVS0ã UEEpt E 9F EEEEEFEFA~ MM܋FfMft LHfME}tC~ JB! 0Eu ~u܉CG GWPWPWxG8GFAW0O ME9Oft DAfEzD$D$ ED$L$4$趇O1EEtB#E ljEJE 苲E<΃}uH10EFAFF00[^_]E뿉UD$$ƅU=B UD$$FUQt } ~ F}t\}wF~N1D$}|$D$ } |$D$$虃0[^_]F~N1D$}|$D$ } |$D$$CJU E]#u܋FD$M܉L$ |$D$$U訅FEM܋U F4$1EEEe uE9tx}FFt"O L$D$$F$FA4$;ut+F uFtUt NuM u6;uu1[^_]D$L$ D$FD$<$Kt¸USUE @@ @XYX YXBP[]fffffUWVS 2 }ED$E @D$E$軛ƃtt|$$t [^_];84$f,8UWVSD÷ uE -6U1M[t$D$ 8D$D$<$=7DžDžDžDžD$D$$莙<$ƃtI<$D$D$4$tntD$4$諴tSD$D$$M+u{D[^_]Í)$v8D$D$$軘4$賚y8k?xwfffffUWVSx E EċEE-6E0u1ExGtD$D$$tG }t5EQE}+8x[^_]G(<u͋EċPuN9Eu9rYt$ED$<$teEEEEȉEE@EME؉EEċ@E9v]t$EĉD$<$Mt EEEEȉEEċ@EME@Eă9ЍEЉEJ}u[D$GD$$軛GfEEEċPuN9ED$D$$Oƅ'GfO @EV)‰UE@UB 9Er[tGFuKfuFGED$EĉD$<$p)fLJO fMEYF?LJD$t$$ẺD$EĉD$<$AƉE`ENfMu}3EEEċ@EUB ƉEAfEQfU)ЉE9Ef9UUfQEf+EfAufDqȉMMMQPMHp UċBD$D$4$KtMAD$D$Ur4$-tG( <Myt.D$L$$貛}  1]QA;EuLJEfҋu)҉T$DqD$DqM$sMAfEAfEEċ@E  ]EED$ L$MEĉD$<$ƃM5D$L$$ĚED$ED$ED$ED$ EĉD$L$<$-ƅID$L$$c9G|Gf;EnfGbEuFD$D$<$>`A5f}*LJfLJ E9GED$T$<$mO t4fMfO MfTLJ}'fM pffffffUWVS,+R E@(ƒ 'EEEuTpF~> EHE)ʉT$D$$qEfx]\X}Wft*}M|y f9sf 9u}Dx}WMуft"ҍ PPf9sf9uExEfxE@(E <t 1,[^_]ËEu69puP;UvރufF1ҋu}?9~V;UF(  EEEfEED$D$D$D$ D$ED$E$hIUD D$E$8nUXЉUF D$E$nUtF(M 1EUu^@f_E@E@9EEEEfEEH(EEfEut$E D$E$iE@9EsEEEfEt$E D$E$iNEH(EuFEfFE@t$<$ut$<$Biȃ([^_]ÉU܉M D$<$iMUuED$t$$螒MfME EF )‰T$L$M $jEfEfFEDFfENUBft;ЉUTVȉM܉щuuf9sfUf9uM܋u؋ELAFƒEEfEt3Auu}}Af9sf9uu}VBfFD$t$$蠑E8tQED$<$4t#fFfFF 묋ED$<$1ɅfD$D$$11IUWVS4E uExGtD$D$$G Et>tMЃ4[^_]G(tިЃ4[^_]EEEED$E D$<$_5ƅ4EUuFE@  Vf9"t$E D$<$cFD$ ED$E D$<$tD$ED$$ۏЃ4[^_]D$GD$$Tƅt@fGD$ t$D$<$GF$UED$t$$JU 1҉Ѓ4[^_]fU}6fUfEUBfFft$E D$<$RbFD$ ED$E D$<$FHfu9fFMAUEfNpFfEE@fE?1EE@ftD$ED$$ Mf9MtED$ED$$UD$t$$čGEЍMML$D$<$20G9fEA‰EԋuD$L$M$`F,EE9Mu2 D$L$M$*E;}܋MGD$GD$$蓊 GNjEA9Etf}ڋ98}fxVLH|9fAD$D$$lD$|$$1Ʌqm}ufMډD$L$$"D$EԉD$$誉$F9kD$t$$ڋD$GD$$bƅD$L$$蜋D$ED$$~:)M D$D$$?UMIEt&薿DD$L$$ED$EЉD$4$/0G,EO9NM܅D$t$$藊E;M2D$T$U4$fE9uU#EFD$FD$$ʇ…DF7ftփfEڋfPEHUڅt{MDFDED$t$$載D$ED$$Dƅ@PMfPMsfUD$t$$SD$E܉D$$ۆƅjP֋MU9fff1̀ffff ̀rS[ [US D$D$ D$ED$E$t E[]øUWVSï ElE `-6h M1Ʌt}u]uxVE%GpuFl8Z+Edpl9wD$/$݈tDrDžphM+pİ[^_]Ã@8\΀>X$>N;\u؋\D$ d)D$t$X$`l9r9?/utD$l$1/|%=@tWiDžpl8u+l-?URT`D$E  D$l$6Ѻ8fTd9RƋX@8\)@u08p9d D$\$识uQEt8D$l$n0JDžptD$l$t08pl\fffffffUWVS.U Eu U;Uwz9v 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xf7\fUSô `$[]UVS fÍ `4$轄D$$D$F $/ [^]UWVS "I }$DH$6H#1$HD$$D$<$G/t$<$f. [^_]UVS0 EE tm E싃 E EuD$D$ED$ ED$D$4$lt}u E0[^]ø0[^]EED$ut$8$Ft̃}uƋE쉃 E E􉃬 ƃ \US~ `$[]UWVS|x]y}AEq uy}y}Y]IM]Z]Z]R |MUĉu]]UUẺ}u}}ȋE]]ME te kE2-byEnd 3Eexpa}Ћu]ˋ}11 ˉ]1}E1MM}1]1߉ <}1}]1M؋U1}1 щM1u1Ű}ЋuU1M1 }11u11 Ɖu1uĉU1Eȋ]UӋE11 Ӊ]1EM1ŰU؍ :U1E1 M11}}ЋMϋu1]1 ω}1]1m~u֋UexpaxUnd 3SU؁2-bySte k߉S MKMMȉK]]̉_MMOU‰W ]]_$EEG(EEG,UUW0EG4UUW8|]ĉ_<|[^_]UWVSl{ Ɖ׉M-6UE1EEEEUEEEEFEFEF EFEĉFEȉFẺFEuЃs8tftD$@D$E$*E}+8uBl[^_]uuuуfqVUWVSz ƉPH-6LM1Dž`DždQDž\ TEX$)h rD$ |$X$1D$D$\D$ |$D$`$@g\ D$ |$X$a1PtHL$T$X$;1XD$<$E1D$hD$X$(hlFpFtF xF|FEFEFD$ D$<$(TF LM+u [^_]TUWVSx t2|$ƅ^ 9E[^_]Í`4$|uND$@D$f$JD$F$~ƃ4$|\$N@$@@#1$'@D$D$D$D$ D$|$$&ƃtuD$|$$&tPt$|$~`4${ ^ 911҉[^_]É|$4$%D$|$>~UVS;w %ÍU59t E[^]ÍC$D{E[^]UWVSv x}u -6t]1ۃ w@Éx9$tM+lĤ[^_]lÍEp ‰rx9EEEEG`|)l9l)މd?hdt>`]|pډEuE@9|uhlqD$ D$p$x$lD]Epډ\jElڋ\ƃtf"UEpl EluE|ƋhrhtfhtD$@D$$x# C$xx*C$xxuu"+ulPf͋xOE[UWVS s E1uUƍ]ډM;Mrꍗ9t1uЃ [^_]ÍF$wMUVSnƍs w119t[^]ÍC$w[^]UVS&Es /ËM UI9t[^]ÍC$Sw[^]ffffUWVSDr }EUMȋ} ?f}EEffEBEfEfE1fE1EԉωEuTF2 Z]f9};E/MfEMA)fAfDYt$T$Uȉ$]7NM؋U܍L1f9MwE}E]f9]f9}E@ Eƃw*/EuTFr2EuTF2Ef9}\E9s1E;Et(f9}-uE\E9rωD }fGE@(#f;ME }f)8EEE}f9}E1ҋEYTPt2fBD$D$ $UD$t$$9S1҅muuÈrS[ÐQ [ÌrS[pQ [Ḉ̀rS[PQ [̀rS[0Q [ḹ̀rS[Q [US P EU D$T$D$ED$ED$ ED$E D$E$A, []{P fffffUWS[P Ut}< (8w>8)|>)1ɃtftȪF V$EUD:@t@L>))t 19r\$4$ߺ81tftf뎪gf u`uO7ЃE1 ;Er7MfOfm7Vf먉ȪUWVSӉMp x$?tp@)։u|(;uzuރEEM41p x$ut2uˍP(T$$EEutM?Qt@lj\$<$xG W$@9ue?Mt)ʍx(3tftM1H X$[^_]Ã}?"x(MQt@uƋSWSWS W SWSWSWSWS W S$W$S(W(S,W,S0W0S4W4S8W8SF Ppp)|>Q1tftFHVLEUF@VDEU3ߺp1uDuQ1s^tft\$4$Mߺ~1uou` t䪃ުo)f+u?u0rуM1ɉ;Mrqf뙪}fɪUWVS É։T$L$@@SDtv)|P9T$ID$+D$- 1s@{Ds@{DsCHSL|$D8D$T$CPD$$D$|$CPD$D$T$D$؃D$ |$ָL$ B"tftT$D$D$$s@{Ds@{D9T$rCHSL;T$yd$T$t>Ѝ{Pt$4tftL$1C@SDC@SDsCHSLe[^_]ËD$vL$D$1L$L$$C@SDC@SD9ƉыL$rCHSL;L$uBfrT$Ћt$%ubfD$u_uDL$D$tCP{QD$ffl$JL$D$GUMt U E]UWVS蔴û: } Et.1T$T$*MTuۺ1u)u/tft[^_]êtfUWS&: U@9 D9JH9JL9J P9JT9JX9J\9J`9J d9J$h9J(l9J,p9J0t9J4x9J8|9B=G ==D$D$D$D$ ED$ẺD$=$$uwUD$D$ED$ ED$T$Ẻ$E$tBEh[]=A=uEE랸 /o뺸 문른랸뗍ẺD$$auExEE+EE,EE+D$D$ED$ ED$T$Ẻ$E#>E3h[]ø1D$D$D$D$ ED$ẺD$=$["U>ẺD$$=EED$D$D$D$ ED$ẺD$p=$!t5D$D$D$D$ ED$ẺD$T=$!zD$D$D$D$ ED$ẺD$@=$I!1EED$D$D$D$ ED$ẺD$a=$ BEEGEEFEEEEEDnEECVEEB>EE& MEE ED$D$ED$ ED$D$Ẻ$D tE EE<D$D$D$D$ ED$ẺD$=$xEEE D$D$ED$ ED$D$Ẻ$,D$D$ EU$T$$EE*EE)EE(EEEEpiD$y$B EE&3EE%EEREEEE EEEEEEEE}EE eEE MEE 5EE EE EEEEEEEEEEEEuEE]EEEEE-EED$D$D$D$ ED$ẺD$=$@D$D$D$D$ ED$ẺD$=$dEEaD$D$D$D$ ED$ẺD$=$2D$D$D$D$ ED$ẺD$=$CUS. []UWVS4ħ- EEEEEEЉD$EԉD$$54$1U+ $Hq…nEBE   U$qDžUHE GE U$pUMHMtغ غM tԺ:ԺUto̺̺14$0D$EЉD$$34[^_]Í 1ҋE 1E+1R1룍  2t 9t$ xt 9t<$w Wܺt獃 9t݉$w ,UWVS 藥þ+ <$/غt V6uwc$uEt+wкt V6u<$/E [^_]wȺt V6uD$<$5/E [^_]US$+ t$[]EEED$D$ED$ D$D$E$t $[]UWVSoÖ* E }0@DFƅtDFU U 9BMD$F D$ $aGEMtwFFU tmHU};O#D$D D$$FMAE1[^_]ËM!@dGF Mu1[^_]ËU!@uMAD 1[^_]ËED$ED$ GD$F D$E$oED$ED$ ED$D D$E$u‹]}[^_]ÉD$ $qtEUBL$$q…vEFH}OUWVS肢é( uURH fu xutlTP<L Du#MEED$E $[^_]ÍD$D$ ED$L$4$uE미뻸UWVSUE xru9wt% 9t 8t)؃[^_]ËE)[^_]UWVSUE x}z9v=0t# P9tT8Tt[^_];}[^_]ÉUWVSB' }E pE0EEE90EuKEU9vщL$MFD$E$D$t$$*M)Mt/MVD$T$$(ƅu[^_]1[^_]ÉUt$E$-oEtЋME0UFUWVS,*Q& E MMM@E1EEԉ}4UHD$D$E$)U)U}}uEԉD$E$YƅM@@@ @E‹}9vM؉T$U܋ED$F$EU܋MTE)UqD$t$E$%)1,[^_]ø,[^_]UWVS)% }E pD$D$$z&tU@ u\M D$UT$$I&t$+uPUD$<$9ur1[^_]ø[^_]D$D$$](1[^_]ffffff̀rS[`$ [ḿ̀rS[@$ [̀rS[ $ [S[ $ [፴&v̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUE@U +B]UWVSA# tMƋuA~8t:F4@9s3`V8F4@9r$nF8[^_]ÉUWVS覜" EEu-6E8}1s[F8t1EM+YĔ[^_]ËF4A@E$'fF8*E} F4F0}}U1EM Q|D$`}|$}x|$ F8D$T$E$ NjUN8UV4V0D$ D$`T$ $F4E~81u @urP2uB8}8BX;EuF8$ mF8U ȉȍB=6Y8 CU YUF8$l YUF8$fdF8tmD$`}|$x|$ D$|D$E$ DžuUN8X]XUWVS@ EE E-6U1҅|%;EK=@9RƅDƅd/%D$$%BƅC8DžD BD$4$#)< D$ |$t$$Ƅ=DVD$D$$QƉ׉V 8;D$BD$d4$[D$D$4$Ap @utU}u⍃8n44@ Džh1Dždd 4$s`D$`D$D$ |$D$$  9ȉ։D$ D$`T$<$G489Ƌ_P((1ɋx9z11tpvu@8R<L9H"99wǍvuB8`9wtswtD$D$ $It%SmuDžP8d@41`;t 9N@FD$$9 udt;G%D$GD$4$iG& tD$dD$$GtQt9HVtftt81D$ t$$G DtD$t$$FtP?.D$BD$d4$ GDžP8D$D$$1PP8f}tD$D$$EtPRtD$D$$Et O"M+Ё@[^_]Éd..D$BD$d<$ AdDd$N,N8 6!$N<$PbO(9H(th89:]``;<$ad$MpuW4P4O0H0O8H8txyPRTP`9uO7t'D$DD$ $CD$=M_R1;s$4`9u닅408$`H돋t3D$D$$B$^L$`X*Nj@8@P1f,$K‹tEt&D$D$ $Atቅ$WKUWVS' <$WE D$ ED$ED$E$MU EƉ<$$[^_]fffUWVS蘌ÿ EM$u,U-6(7u18uu,t.>} u0ptvDž} tоJ0(U+E[^_]Ë}|$T$,T$ L$U T$$뺅t%=v}`u$ Dž0< D$D$4$?4$mI@8ȃ  υtAtft `9?01 t 9Auˉ0B$4BT Dž861%=}`$`_vLljDž `hD  tf t```9tu`;uDž,t$,$t 91RMd1'`9u@t p0x@$Y9v$σtft@@,G f  xrDž _~ -f:1H-p0t]uu fbUS 袇 EU BJ  D$T$$_ []UVS Nu utu#[^_]ÉL$$'ԉЋUWVS=X }MtP49t8u))t7} ttu+U [^_]1E $BƉ[^_]ffffffUWVS8E uuЋuMΉủމuU U 1Ƀ}Muux}]t<(&]EEt$E$UED$4$UEUMẺE}}}9ẺEEEދ}}ED$<$U?9su];]ED$$Ux;uUtω؃}M< ]XJ9u]륋EMEE]}}}E9F+E؉‰)ߋE)+E9vӋE+E9~Ѕt0E)}U։] ZH9u]9f9}9]E)E1uuMΉűU UEM̉MEEEu9(E9Es]339}sJ+}\$<$U~7Mt׉}MىMKP;]u9}rMME;Er8[^_]ËMЉ]܋8Xzu]؃}tUU]} ZH9u]Cu!MM؋}EM؋EEUЋM]9Yxu]E~8[^_]tủu111U)ƒ}EEu]XJ9uu]E)E؃}MU]XJ9u](}]MXV9u][ML$4$U-ML$u4$Uu EEM AMEED$U$UED$M $UE MىM܉)t$M $UED$4$UEE܍ ȉML$E$U\$E$U*\$E$U] 9] 9}rZ1uMЋU]8Xzu]E؋Mut$E$UuED$ ED$1uD$E)${ED$ ED$1uD$E$UЉ]XNu]pEu]0Xruu]E)U] ZHuVML$E$UML$E$UEEU/ED$u4$UuM $U]\$E$U3EE=UЉu 0sHuu%ut$E$UuED$M $U>EE:U+UUfffffffUVS | EU M;Mw/9w 4 9r$9fu49rL$T$$ [^]0fffffUWVS${|â lj֋ tRT$VT$$$ЋFE1҉EUL$D$ M$T$m3E ‹Mu`EUD$ T$L$FD$$;uCtVT$VT$$$Ѐf1$[^_]/:UWVS{² Ƌ; rHu @[t9CuugCtwBCSC t^B C ؃[^_]ËD$$HÅt@C؃[^_]Éډau1F룋KD UWVSz u xD$4$E%=D$($AHDžts@@@9uE ED$D$ EЋUԉ$T$uEČ[^_]81Č[^_]UEU U U$]UVSy ]tvtWJ}u tFP@Lt4ADTP@SP PS@[^]ËP븉D ,D$ D$%D$xF$ U D$E D$E$]UWVSx E puPHt,JHPt9Q P E$J1[^_]ËxuL HPuNjEPUWVS0Oxz E}u 9FE NjAX‹9QuMrEMM䋏M1҉E؉U܉L$D$ $T$]1 ‹MkME؋U܉D$ T$ED$E@D$$]9‹Mt1`VME@T$D$$]E*MEpE@EUBAP]YEDCCGC CGtST$t$$$ЋE@0[^_]ËZt]XZAtZPQEDBJB tTA B _BZ BGEuJB0[^_]ÉY AuQ 41։뱉41EA 1먋]4O1UE PMt ʈP1]UVSu ut PtH J H $Gu4$G1[^]UWVSuǭ uu $[tCtډu[^_]Ë$x؃[^_]fffVSD$ L$t 8trtl@͉ э&t&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^UWVS tǸ uU Et6t.ZYutD$D$ $?' [^_]UWVS0tW u e}tdEE}}EEED$E$ED$E$ht +E1ED$E$u}[^_]Á}{h1[^_]1TEfH @1UWVS$Nsy E܋E XE@ }Otzu :}ruU]u}tqvD$t$E@$EP,)NjM IM)E Hu1$[^_]ËE$] 1E@ d3{끨E1E‹u9vEX;H@9 ‰ÉϋutftUu4$]9U)ULU)UE @E)Ћ} GEYEPtEMUED$D$ }<$]\)E] M{}]UtMqu9fBfB$tpEu9qɋurtft})_UEUE @E)ЋM A-E@ UXnE9xsN]ڋE9sB؋utftUE}8$]|)}UyEHE91ȁvL$ED$E@$EP,… )E M9EPp)6p9rD$$]>…]+CCECSs׉;C zE‹urRjMȋus+tftuE)FEX1^>9]\$ED$E@$EP,… EfH @$[^_]Q1"Љϋus;tftE)P)UUE$]u1ɋUuguo믋EEfP{BffvEXcf[fE]+]+ UWVS }G tPwtI)7tI1Gu-)t'\$t$G$W,fO @ [^_]ËGDu1 [^_]ËG봋WU [^_]UWVSl utLD$4$> F t$4$ED$4$G [^_]* ,4$ $Dlj4$p[^_]UVS<lE uE EEEEEEN>wK t$ED$EȉD$4$CxE<[^]EӸ<[^]*UVS<kæ uE EEEEEEN>w@ D̍ED$EȉD$4$x E<[^]ø<[^])USj (UT$$9[]f̀ffff7̀rS[ [>̀rS[ð [USmjÔ D$wD$ ED$E D$E$C[]ffffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVS{iâ u5tdF tF$qUWVSe Ɖ׋@0$F0PEz9EED$$F0Pt$T$8$ F0PuD$E$~V0UU쉂PF0ǀTu Xt$R[^_]ǀX\D$$F0NjF0TXtXUd Md5u]1҉]UWVSfdÍ ud58u [^_]ËF0$F0PV09t'Pt($p[^_]ÃT1݉UUPV0ǂT1UVSc ud5u[^]ËF0$F0Tt$[^]ǀP8$%F0UMcx MU d5u]É]sUVS#cJ ud5u[^]ËF0$bF0U t XtTt/$9[^]D$\$ F0ǀP8$\F0UVS8bê -6E1EȉD$E$U+u 8[^]ffff&&$D$4̀D$̀fffffffT̀rS[ [Ḹ̀rS[ [US a E D$D$t,@E$d []UWVS4yaà D$(΋ED$$M ED$ED$׋UL$D$ ED$ t$|$D$($ƉT$UvL$ MT$L$uBD$(9t1;t$$|Y9t$D$}{E"t$T$4[^_]ËEW;t$$|(E9t$L$|Vt84[^_]ËE"t$$ʉ4[^_]ÍD$0E |$,8tEV4[^_]Åct$T$4[^_]UWVS`) EU uM] $\$M] Ǡ,}}$}M] $\$M] [^_])UWVS EU ]\$u}M] $\$](]M$M $\$M]u} L$ [^_]fffffffUWVS;_b }D$<$dt(tt$<$&[^_]1[^_]UWVS ^ uD$4$trXt`|$4$~t>UT$D$E $;Es1 [^_]";UE9E r]ø]UE9E r]ø]UWVS]  t ;6E1 D$<$ t  PEu׉uD$D$<$l tGƉ}D$t$E$J  8Gt|$E$ <$T/uE 9t$$9/ǃ ǃ [^_]ËM TD$D$$[^_]E (UWVS\ u} t%D$4$tt=t1[^_]À=t[^_]UWVSV\} ED$ <$ tƉD$<${ 4$>.[^_]UWVS \2 }G$%ƅtx @D$ $[^_]US[ ED$ $vtU 9P []1[]UWVS {[â EE;6E8o7e1}ƋE D$ED$<$j u E <=+EF fF FfuUT$U T$$[^]ø(8u F 본UVSVë uFft<ȋED$ E UD$T$ $H!уtfN FPVT[^]ùff [^]USV< E@fu$[]UWVSU׃H΃ J JH щHz11ωz3H}t)HtJ ȋMu"B[^_]ÃHtJ ȃB[^_]UWVSӋt B΃Ka |$,D$T$L$0tȃ"s|$FD$}1Hȉ`Dž0Dž<ϋ\<%t09 <;`s\\<%uЋ\P@ƅXDžhDždDžlHZw X扅8\p1DžHDžLDžhDžTplhƅXdыh9}Hw } LPu atT,pXt$ D$D$Z$ft$ ED$D$<$oWw 1}`f%9w1~t 8tbDžL$L$$xu~ut Љt=9x KPf)Dž`<$z6fLJWp ~r1fDŽBDŽ|:t&t:1t:qt:q|:y ;uf@@ GDž8<DžDžP[0,lX,C[$[\[Du[d[[[\a[]Z< U[ Y@(7[,[Z[4Z[ZZZZw GtDžxtHxXxtf@<j< DžT$x ЉkGE|t@`XF<<DžxG>D$ |t$D$$~9n&0Gk 0<$2xxt9G iPP9G5${2`<Dž*uL$ML$pL$ L$L$4$Ѓw<$1foLu+7e[^_]ËtF<5Dž87P担xt ƍ$RD$ t$t$$=T$T$T$T$T$T$ $ lXhpD$D$D$D$D$D$ $C)ʍ‹fDž@D$D$$^DžD$T$D$ ED$|$$蠛ƅ"@ lf9ua t\lPXT$ D$D$d$舣T$ E9D$|$$fDž$!uT$$6G<ED$ |$|ȉD$ $ @u a ShD$ D$D$\ $舢hD$ E9'8 0G$,D$ D$ D$D$$.@<$3-DžhD$D$$xxGD$t$D$ |D$T$$<;|t$$@<$d,ua hlPXT$ D$D$DD$ D$D$D$ t$TD$$_t$ xD$0D$,$Pt@<DžT80@=0$>+DžtЋGDž`Dž,x t 󥋽GGGGfy׉Nj|Nx99 ȋ|99‰ !ȋL 99‰ R Dx9;& Ћt x 9u㋕|1t tt$tt(tt,tAAf9ut 󥋽GPPP f~DžTz0Gh$D$ D$uG ;DžDžED$D$ED$ED$ D$D$<$Mxu1@<t 1G D$<$=eDž1GDGDDž^GDGDDžD$<$==VUWVS){ u }MME@ uuM[^_]1[^_]ffffUWVSpz u} U(Ft~}, ~xBBU(4$ fF@fU(fv  Bf% fJUEt[p[^_]ËE$PEE$'RML$D$ ED$,D$\$׺U(#},~r EML$ED$ M,AD$t$M $8jƉt$E$;UFD$U$;uU(fBMM,щ) ML$}|$ D$t$E$N8Ɖt$$ ,;FD$U$;FD$$;FD$$:F EU(fB E)Ѓp[^_]ËE H E, 9hB B U(D$E$:U(BD$E$:U(BD$$:U(BD$E $h:U(BÉEE tE ߋus!tft} }fBE)HuuBzE fUWVS úw U }E@4E)Ѓ FD$$)9FD$E=b$9VfFE@ uH1T$$_9F D$$L9G fffG F ) [^_]ø뗨u믍]$U >U#]$U{UWVSìv U u} E@EЉEMM}E)9UB9E;M}|$4$g8GD$}<$S8V׋u$s?u3u,}׋ED$+E$8+E[^_]äftu.u=뫍@]$U "MAyEffUWVS,Kru EU܉M؋M@EU܍]M썋]M荋]M< t< t֋}֋} ֋}O ^E@U䍃^$Uu< tt< uJ,[^_]ÍBU$I/U~ƃ}dM dGtUD$]$UtBU$.U~uFJUD$]$贴U- ^t uWEHB U$e.U~uFFUD$]$-Uts^ujEH@gUE؉D$E܉D$x]$dzEHU%E؉D$T$T]$蟳WEH %^t' (^uE`EHuEH@@uEHp4^u^MԅMD$$Uƃ>Uv?t$T$U}ԍ$vƄ7U<^u^EԅD$$Ukƃ>Uv?t$T$U}ԍ($ZvƄ7(U E^h D$P^D$$UUuEH2D$aD$$U豜U E`UVS4Szp $@ftL|xEEE%EEEE^D$D$D$ D$E܉D$t$st4[^]UVSo Et4D$E$^EEFEF%LfF [^]Í UWVSxMto -6EEtbUD$E$@^Ef3EfF}<$D$t$<$|$4$F FUM+ ux[^_]Í tJUWVSn }x$NmLJft/1t$mDŽ9Ӄ[^_]UWVS7^n u4$`t&tuOxu:<$džt$džf[^_]É$}l뼋|EmJ9Eut$ZlUm Et]Í *]U{–m Et(]ÍW^]UWVSu] }4$sfdž1~t1҉u뀃9t`t[{uMt31sqsqs q M31sqsqs q 뀃9uuF [^_]UWVSûl ED-61u1D$Ɖ$m.F u uD@@$D4$^4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$F. WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$_^$蟅 w`D$D$4$*pƇ_WHwDG` \Dž01'< t4t 201Ƀt+9< x< t&uuDž(HD$$聮8Dž4DžLT,, 8D$ D$D$L$s<;t<#tL8domaL8searL8nameL8sortL8optigfxon[xsQ< t< >D" << ufxinE< t< D(< t< t< Dw`D$T$4$mƇ_x^D$4$\bDž0]t DA 4DdLʃ Јd8$zD$D$ $/fx8$k,D$x$Dt6hlp   Dx`0DHHp`pD@H@`tX<.ǃu~=D$.4$kDNLFHtD$.$kNPFLD@^$Y…t(D2DHu+1V[^_]Áxservfxer< t< 9< t< tv^D$4$@< X11rDž\DžTD$5y D$ D$ D$<$PD$ ,D$|$4$}PB=iDt/Rωփ]tftPB@Dω f fu$0P@~N <9V)<9V)1҉=tftH4@ Ɖ);;,h΃r낋$@ $SDž褏@ D4$#@;c‹ytft‰)‰DžHtftR<lj);44$E@9‹yUff PD$s uKu2kfM/f릋$~@ Dž}UVST 5t$&[^]ÍHD$$Ԙ[^]UVSgÎT 5t$}[^]U4_T U]UVSBT ut$[^]ÍHD$$<[^]UVSS ut$_}[^]UEPM¸t]ËE@ ]UWVSjÑS }E0upq @AHD$$芗ƅu!yH L$UT$@$跭tEG D$GD$ GD$D$4$u4$|G [^_]É4$f|[^_]ËG [^_]UWVS õR E`;68 ˆ,:)lj}싓\ u2EL L D$T $: [^_]Íb-t$E$Zt$X $>t{\ t1=T 9txED$D$uًED$^D$ED$ ymD$<_D$$ [^_]Í^D$ED$ ymD$_D$$貢 [^_]ËED$^UWVS %LQ 4 ''w}8 < )ƉT$U$賙tn8 < UT$D $茙tGD H 4 8 D@ 1 [^_]ÿ'y qUWVS,TwP LJ LJ0 LJ, 8 < D H 11,E`;6E܉`g54 )‹H ( ؉Aw _D>ЉD>T>UT>gHL>@MAD>( A,  f_E։‹, xyt, =w ]; et, =w ]; 0 tG~j, LJ, , yU U;, gU썇u$ 0 ULJ0 < 8 M싗H 1ɍ_]MEUtwM<9ErMt< E艇H ,[^_]LJ( 54 LJ( D>ED>ЉD>UT>g`ef9D> wU0UD>HL>PD>HL>( Hf;Ë< ;@ mbH< PH HH $ HLJ, 0 f0 MULJP D>UMD>ЉD>T>g`eف9_bLJ, (LJ( D>ELJP D>ЉD>T>guMUD>@ND>EUM7MUEEE܋E䍇T $F6UM^D$1ۀ} ËE)؉D$ ymD$_D$$ʜUMLJ0 D>EP ]X2 E쉇P zLJ( D>EdLJ( D>EN$ T LJX LJ\ LJ( D>Ebp< zW8 XUUx~, Mt < H 9@ w t^b< H< PH HH $ Hf #E쉇P FLJ, ^$1ffffffUWVS,I Eԋ| ` u苸 }9x uЋt }E@nu܍lj`k]؍@m]ȍmENjE]]Ef[^]б7 迱7 l 讱7 h 蝱7 p 茱7 ` Ux7 U]U`7 Ul ]UHs7 Uh ]3^7 d UJ7 Ud ]UWVS ,7 u"$  uމ4$LJ LJLJ LJ LJ LJ LJ| LJl LJh 1[^_]USW~6 E$f}~)ʉL$D$‰U$EUfFMA)‰D$D$‰U$EUf>fL)fD>fT>[^_]UWVS5\ E xfEEETf}tU)ƋUJ;MLW)ȉD$ЉT$ΉMȉ$ E9EU|HDU+UU\Wff@9tPHftffP9uEftWf4T]TfTEfEh8E H1[^_]ËUƉE봋uv E D$E$[^_]UWVS$֖ E}EW u}EGE9G ED$E@GD$M $3E$[^_]dž(Efufdž $D$ |$UDBD$4$d…tMME$EREyD$ |$UDBD$4$d tʋ@f8$dž @UWVS($ EE} w8}܋PUEE؋E@E|F5U9vTF)ʉU|$E܉D$M$])}CUfFfۍD\M)f fTNfDE D$E$] E M5|>fd‹M9vfU;E@L>f+MT$UE؉D$M$]UU)UMfL>fD>}f)|FfLFE pH|FU0M9vʉ;}|F)ωT$UE؉D$M$]CfUfE D$E$]VE tUU؋pH|F([^_]1TUWVS8_ E @u E1SfUDPND$ t$D$E$Caƅt|$E$FfUUPMuJfwfu Uf|Pu E|U RME @EfE@ =fEMML )ȋMfDJMfLBE Ht$E$t9t|$E$Eh81[^_]DHfBfBFM Ac[^_]fEhUWVS} U EzMq uf+4GMM9U t$ED$DM$]u)uD$ U T$MDD$E$r_…tzxEp uf+w;ubLf|Go;uu-t$ED$WUlj<$c]Uu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVSx|ß E 'D$ D$DJD$E$^tDP2fzuft,΍< f}ED$E D$<$]@fEfEEE܉D$t$<$]EEEE܉EFEEuẺD$ED$ED$t$ D$L$<$]蹐…D$E D$<$]QtX@fE҉ED$L$Mԉ<$]MED$L$$]Uj`]UWVS(r uExGtD$D$$GF!9t~rd;4D$D$$F)L$L$$!%E䋇E} v&0([^_]ËME} wڋUoE 0t9  ut$<$tH9s`!EEUU,D$ UT$D$<$EOH9r!<ED$ ED$FD$<$u@}} uw$ D$E D$ t$D$<$f([^_]G(w$E 0EE 09뤋$Ud:E\UUT$L$$=#H(L$$?…FE$Bfff]]fffff]USo ff{vqle$Y$Mffff@;61,fff]&&t&UVSo. EEEEjuVj uǃ H+6tjjjyjVjQjj UWVSEE] }3t>u_j/V?3ZYtp t0MPVZYMu}] EEAe[^_]Vh hU h0,7UWVS ]u 6ְYhZ VS" tful5D,ۋ= ,)]u=D,u h] PZtD, D,e hj5D,H@, @u5D,hn j hZ1Xu4&hw j MWRUjZYMtCUk uVEHPW P-Rh j UWVS] 3ïh2"jCh2"Sup!@t h  ,DP$d,Yu d,2$h,t, 5t, jjP1h, y 5d,@,'@,&=P`+v`,u h j $,u#(,$, 4, 4, ,%H%hPR(, yT4,P,%H%hP5$,ң(, , y5$,h<#j ,&,%,u-,uX,HH&@,uj,H X,,9ʡ,\,s &@,tá,,%,t@,D,,,p, l,t-0, ,,t.,%h=`u= 0,, , ,,,%,,RP5(,4,P ,t h  jh,=h:jh?jd,h,l,`,h-P`+PP`+_,,, t5,=,5,=,9ss X,D, u15X,5D,5h,t,P$ uP,T,Vd, rPPh<#u(XZ`,u5j5\,5X,5h,t,P  t5d,h<#2_X,X,\,P,T,H,L,B5X,=\,u}5H,=L,9Uu/9Eu*P,T,H,L,,,T,t#EUP,T,׉5H,=L,P,T,H,L,,,,t7H,L,, ,j#H,L,^s/5P,t,,D,VRR_& P,D,,,=wu!=Bu!=^u!,t=, ,9ȋ ,,s")1=,,,, , , ,t j"[\,5, tJ ,1=,,,, , , ,)։,5, u=(,uj4,PY@u$8th 5(,4,PZ@u h jj&UWVSX ] 3h2"jL< h Su G-$ ,,,,,,,@,t,,,Q,B,,),,,,,,,=,th% =l5tu hJ j21nuou,j,PEZYFt@jV-2,Y^u hZ I8pj,W_Zt x>Pht h0,-j$,,=,t t$h @ ,th &, ,jW,ZYu hP ~;T=,u6=,u-=,t$=,jW[^ 1Dž=,u ^=,t ]l1i =,\t 1Z01C PUvjZP0P Ct 1B 9,h u)V/ZYu h j,RP]^_y/u$`u /ui, RP\uZYuh=,i =,t& rhʅ#3h V ?Ƥ/uhʅ#V3h VG=,3h<#^_=,t4011Dž8hh$P( ,5,8i, Dž;2t;t SY PZ9}D1PL@DXTHL`\PThdX\lp`dtxhl|ptx| t/=,t&,,=,tV05$C19,vi $Cޅ(=,h) -1e[^_]USEEE EE0Z1҃vU|r҉T#,UEh RP- tvpt.Et?SuFH#,Ƀstxu0R9l#,볡l5",L#,P#,Ph h0,' jE ,EE)ЉEEt9E8-u/L#,EH~ ,)EEEHEjJ$[uYhjPXZjjEY[h j7XZh#,͘Yt1h0,h XZh qY$hj[X2@#,EteE8t[E0J]YtLEj0AYZyjFZrE8!Eh0h@", Eh0,h YXE8tjZugh pX`#,MÅL<vh0,h XZjYy =h#,th$,h"h0,% ",u CyPh<#"[Xh,Xua=\#,=L#,h0,h XZh o$Yf%,\#,Ox#,| hm o[f%,&f]Å1$",SPPJIà j\#,h0,h AXZh o$0YQ=h#,ujOj[uh$,5",h h0,p$h$,h"h0,W$ 븃=h#,uj/h$,5",h h0,($UWVSXu} 7h!YZu[  ful5hf WV utt ,)NvE8}WZE1  tAB;EvEUPQMW UuMt6QWhk j փ빅u Wh AE@t1j URPE ;F|E8tEph jE1~PS?YXF=mw2=m=m@w=m@m=m8@=mF dUuFfEERhmWB UWEffEERhm+fEEERhmW 1!EPhm8@W x E 6Sh!jf9tfuPh EPsh KUy!~K U } }uuuuuh $uuuuuh uh0  uhI XZQURPW x%uShc ] ,URPW ySh<#jPhz jjUWVShu EE1ۃ}~F8-tEh _th PZYu X%,h \_th PZYu h K_jh h !EPuh" z0蚸EYt/tj@uY[t}u U9sUPUxt}uEE1ۋtPZ\tSvX\Et'U)RPSSÃ~t C}u"h9 hs$HMEZYu hs 5}uEEuhT%,WuuEpEPzv  DGu΍EPEPj =X%,t}t.D1}tEܮjEP4 " GuEy h!j>Vh~f5T%,>Vh~fS2SMUEy}u j uPXZjUE 05jĕUVSEU J `:,ueE1ۋ40!Vh^"uU8,H,Y^yh,j XZ,P, Cu 1e[^]ÍL$qUWVSQpq_,_,_,_,_,_,_,_,_,_,DžDžDžDžh*!Vm @0J9$!a+a+a+a+_,jP5l5N@a+ :u]5l5h"*!H_,>_,/_, _,_,_,_,14!4!h>*!C u_,_,_,=l5j/W#Y[ÅtC?t tT@tNj/S_ZDžtG;t t@st j/WZYtA?t,t@,t9_,Ph_,h_,h_,hG*!5l5#ul5<t hR*!=_,H_,9Ph_,Ph_,ho*!5l5~!l5<u_,_,9v hy*!<_,=l5j/WaY[t4PW_Zu!%=@ul5a+l5A>,_,ha+a+l5_,O5l5x[@XZLa+:,!jPRa+ @u 5a+h"ǡ_,t+P_u 5a+h+!@ b,ea+=_,tRPdZY@u-5a+h+!袩^_5a+a+[E̋UЉthRP5a+h+!X?M1EU \b,1`,Tb,_,Pb,Hb,_,Lb,Qh b,hrdAPU @u;5a+h+!h b,hedA5a+*@u5a+h+!5\b,15`,= `, Tb, `,Pb,`,Hb,a+Lb,`,?w `,_,_, 5_,=_,_,tJthSPa+ @u=5_,h<#5a+Ca+ a+a+ja+~SL>,Yu Sh+!j `,11t | @_,1&`, `,^,%_,t#_,`,_,_,_,_,DžDžjjVjjSTv>,Zu hA!j0jjVPjS賺y5>,g>,Xa+j/S ^_ޅtp}, 1ۍt;}fWQݿZYtuMtGkT ƋF `,F_,F_,VF u_,_,eCT뒁=`,w=_,w =_,?DžDž>,tx8 1ƅƅ;}-p9wƅ9rƅG ˀtt_,? _,k?\b,1`,9v`,1PP?GY[y u&)PP^Z+Ӌ)ӉӋ)Ӌ tA t;PSQË u@ =_,u h ,!M9[=_,_,_,Љ_,_,=a,t4a,a,uK_,=w:Pu3_,,;`, `,}_,_,a,Fƒt<tb,~ދN1ۉ :,:,F 1ڣ:,:,a,5:,DžDžh:,@Ph:,X C5:, 5:,:,:,>@u$hd(!7:,:,Yȃ<t̀t<t <uuut71Ӌ19 :,:,[:,t.192DžDžf=a,a,a,t B1#DžDžBŃw 1҃.1a,t. a,t"Jua,1҉q@u :,:,19}Ct1t(ru1Ӊ@DžDž_,=_,t u$a+9:,"PhV,!_, _,tO_,5a+=_,1RP1RPh|,!Zt=>,>,;8u h,!fX5>,FV=a+RPSQ3Pvvv Wh,!QG ]j bX`,1jhjjjщ¸-!r`,_,1jhjjjщ¸(-!K_,(_,1jj?jjjщ¸>-!$_,hV-!qQ=a+Vjjjjj1ɉ=a+1tj a+_hc,kƀc,Džtc,$A"hc,bZYc,tc,1ۀEu @tj tPt-thA"VaƉt>tFhc,h-![^hv-!h-!h,jdhc,3)hJ !ۋuw1ۉ_, _,u*a+=_,=_,a+uÃ=_,uMh-!Ytpjh-!XZؙjjjjjщڸ&.!&hV-!tt Sh7.!^_1a,@u a,_, _, _,1O=_,>,Džt~ DžhT.!>ca,Y=tk jhjjjщ¸r.!;ƒti¶ fa,j:,DPf XZh.!bGjh.!a, 1DžDža,tK>tFVh =a,1ҋωT u9u @ua,1;5:, :,؀tet\Ph q :,1ڋ߉T 9u9uFtDžDž19~JCVSh.!7߉D 9u9uF뮋y1RPjjjʉٸ/!TljW f=a,Qa,!t!u 9rGD8yGa, `,1ƅt6a,t-u9uu1@ƅ $uta,u a,q:,:,Dž9}ɀ~.t/>t*AN219u9ta,믡_, _, _, _,=_,uYh/!,_^=_,tyL_, ^,t h]/!_[h/!YtM@_,^,2@_,~ h/! -Z^,w~ h0!,Xj h00!j1ƃu h/,!e\b,11;\b,ǍPPZYx+=w;uv=`,_,5_,jStP 1eY[^_]aUWVS}] DžDžDžDžhB!SW rfq1ǃstwDž`j P5l5%l5 8uPh\B!1:u8"ZM5l5hB!j Dž,Dž ,)Ot|jhQP2#Ãy2h@d,hedAP y hB!=d,Z9 Q@fd,V1ɋXtjh@d,h,br  u hB!t OB!u2"PhB!lZYDžfd,h@d,`fd,h@d,-k~PSyhB! ju"PhwdS hC![XS脸1e[^_]US] 3vSuUS] 3vSu~ US] 3yvSuv%UWVS}u DžHj/6@Y[$f,t@$f,~ PhW^!XXZDž(Dž,DžDDž@Dž<Dž4Dž0Dž8h^!VWà A6$ S!Dž= f,j/WDYZu]Why_!h_!hh@f,xPh@f,c@u"5 f,hy_!h$hh@f, f,@f,=tj,hj5 f,à 0tPyphh5 f,蚲à x29=pj,~hPSG jjjS!y 0>P5 f,h!Sj5 f,2XZy 0 P5 f,h!SxPWMZYy 0P5 f,h!S%= tn=t5 f,h_!hSY^h$PXZDu DžDD1RP=Dj,uFDj,PLP5Dj,W5 f,@u5 f,hT!j u6h_!RYX4u2h$RHYZtRh$6h_!tRDu TDDa+Htpj,1Dpj,5pj,4t(h$P\XZt4#t;s @u%9ы@Dž@ s Dž@@1ɾ9։s+@ u"9s h_!j}h`!L!^u t/u !<1󫉕<Ĝ}j2~~W~~2 ;~}|Ņu4u Dž(@6Ew Dž( Dž(Dž(Dž,Dž0Dž4Dž8Dž<C0@hh4i!APƅAECr rl5}CrWl5h?w!jCH1;D})V8t!wd!PVhKw!#G` ϋH~v Dž~tYhUw!CjEP5 -誇 f=+t!} t2"PQ!cut8l+uEE5<+P\ZYf=+tCۡ,t ,fEjEP5 - f=+EPڿX5h(1"jNUWVS E 0d< -W10--hiA"_Zt hA"L-qA"hA"љ^tTL-MBugl58tpjRP :uS1ҋ -buV4-8- -hB"u udà uC$ ="5l5hA"@-D-먃 -륃 -뜃 -듺A"l5낃 -v5l5u#hA"h="hW -hA"VY[ƀ>1hA"V(_Zÿ="SRVg u<̋5l5uhaB"h="hKh@"1k$-t!VPpYZuÀ-(-GhpB"VhsB"jҷl5 -a= ,u) - uu~Ѓ=$-u,P3Z@u hB"j苕B"荕 -$-Z!Ãt~="t%Ft!á$-0RhB"  s$-0hB"_X s$-0hC"Y^t Sh%C"XZj uhRC"tthvC"jj臶E ~C<-3hRǃ u R3h!xPhP責 tlj=,- -u %޻"1H-hPW.y0- uR5,-hC"jh4-PMY_@u5,-hC"(-t&h -PZui(-05,-hC"j}=<-tG(--(-8u5,-h D"jNh -P_(-u $(-ȃ8t̓=$-uh2D"h="h0hjs4x- u shJD"h-P_ZY@u shiD"-%=tE$-Bt,=@t shD";5-x-_ shD"C- -5,-hD"ź(-ZYtpp 0hD"診 -uB-%9A"=@t2"MA"u-uFA"RPhE"[ <-t Ph:E"D_X -$-th -P []A"8th -PYbA"#Nu@u hSE"jyh -PZ'!u Rh}E"<-%=u50-v_@u5,-hE"@t50-;w^@u 5,-hE"-tPw[@u5-hE"jj޲htc%V肥ZYVPhE" 6 - G -Ou8=RhA" 8=tRhA"\[^뺉thtc%VZYËtt ug(Vٯ[VSYwh!jPV‹  9w(<,tuxG -=QRhB"NVS7hBB"UWVS}u 1ۃ~^;-t ,1Dž8Dž<Dž4hQ"VW腥 t]it Dž4@+m:;B uBul5B믃PrShT#hQ" 독uIdx1jSV{CtjjjRǃuhL&VhiP @u hQ"j辎WtY@+7tvFtjNt^HuTwItBQ0=Z.0QXɋ0u hQ"j輢돃넃<tC4t8t芞jѯiul5IouDž<5DDž8=US] 31h2"j hV"Sux Btb$U"jj5l5JQ-------q-b-S--:jh,$YX'-QPhV"h0,辷  ,=-tBEEEEEEPj jq @u h j6- - - - - -tS S٧Xh,ٜZu-]UWVSE 0/h2"jL 1DžtDždDžp11jh+hW"u uPt!HLHl5뵃xe~P$V"Džd눃RtiX ,lM lL9-uQQ9uIyuClJ ,413'DžtDžp ,U)tuJu訧pt.tt hW"jJDžl0bt1)ttDžl`Džl0bM 4u0Vh6V0XDž`ۋhu4VhW"xPSZY@u Sh X"jډE`1jWR!Ph 1uhX"th#TXFHHf wa$ W"puNjVh4Y ;v LPvh!v ,Pvh!J`tFPpS.ZYPvlZYdLDvh<#IZY+耨8t h%X"j賈WUWVS]u 6,h2"j (-$-,-0- hX"VSD TvXeR0GDf8$0X"H %$tX"a$--(-R0-$-,-Y,-$-#-4$-,-0-(- --- ---- - ,)Ӄ蔭(-=-t*thX"0- ,- $-tbhX"j|t3=0-||=,-t=||)=$-||| Dž|4 4-j蔕-P艕K<hRxh+袛=xv Rh6Y"h+XZ++@x^ZSP@xJ9|uW;uSEJ9MuH;B uCsh+hY"CP@% =@jStQGB%=@t4M1@u#sh+hY" 1Jl΁@tjw p,`bu|u|t{DuPSϠZYi PSksH (- -u)fNushZ"Y^jStP fuX58-V8-@-h8Z"hX"h6nU@pfug=-u*8-P8-@-y+h`Z"hX"h?jRqZYu5hKZ"tiCPph+i^X1SshkZ"ZY8=(-PRD=(-PR败= -h+sh-! q8t h%X"jtIWeDžp=(-t,- 0-1P6,(- -:DžpUWVS|]u >j/WDYZtxh&WY_Zu^h2"VS @ui ,)Ãu]p0fY[@u jj~je;LtEPtLFu'|$.hT]"VS蒔 w~^fw$["p$.p$.$.t$.d$.x$.t$.$.rl$.ch$.Td$.E ,4)Ël$.-`$.u |$.&=|$.u=t$.u$.d$.ttu#`%V1ɋdP|=x$.xt)SWYZuE%=u SWXZt Wh<#j}E%=@p9t ÃS豞UWVSu 6 h2"j=jЉÁtDžlh$Vuy tVmtDžlptc5l5C#Yu5l5hW"jD|hP!tW脯 딡 ,p8th1lhw%V'YZhw%VXYZhw%V YZtthdPSYZdx0tupplcdxPSYZcyd=E%=@t Ԛ!t/tSd^Z@lSh<#;Y[lTtS^Zx,t2tp03dY[@p0h<#;;XZWGUWVSu] 3h2"jձ h`"SV4 tZit)ft8huY8%.σvuH0%.<%.4%.4%.<%.뒡 ,)ƉlN4jjx,%.hjn =8%.tluˋVPelTtP2p-Y[u|%=@puh2pQɎà =pv2h`"jxȉhtx/t>hƄ/C-@PRh]zu8QuthА"Xt@.؋Ht ʉA?jo£0.[y<. 8.u u1=(.t =$.t@jPW"7ǃ uh"C =<.t.u)W+;XCHHf $"PDs iPsh!j2p=<.tC ?uts (Psh!@.k=<.^KPSCtlHjSW?C C )C  Cu>=<.tCHSft.wRfuIKPSC luszR"VY+=<.8_=4.usqZuC1mt=<.͎8g迎8?Y豎8F螎8t h%X"jnW68Y_xVSYZu8=(.tCj螦PSh!D@._u=(.EE%=@u"=D.uSh"@.XZ묃=<.u=uE%=uST2ډjuq=@uS~=4.u S ^tXkt:=<.uSh<#c.ga8S8?E8u=,.SY5@.-sh<#.@.XZ,.  . .sXs1e[^_]UVS@jjbXZEEEEjEPjP {{Y¸9u 9E`.j jR[^h.H h.jd.$2"jXZh"Cn+E$.Y4.tt6Hu=P.1/...E .P.4.t.U=+y=.lcؚ=4.tEPX0.,.tA:P+HyPzXP+H J hl+yX聊EHm8../..Z߅EPXu u*XZu uY[}um=+t,Eh"^E=`.u PEuE=+u}rEj^=+'7=`.uh F[u"jh"PjÃPs$Y|=+uL=`.uCEP$"Zu EP{X8tEPb[$XE.1ۀ=+t$=.uEPX.+u'j4l"l^XC̈́RPZY=+=.ԟ+.5P.svh!x$l+ywXUWVSpE 08 h2"j腠E , 1 ,] ;E9hh"W ZYEW/_9Euphn"Su~ tZftatDeuI렃gu=j5l5MEZYz5l5h<#jRh^ ,E ]SugZYy ht"EPhBt @u!{ y h~"(X}Whht@uz y h"(XEPht@uz y h"m(Xt$FvE 8uVEPuWSհSKYEEE 8URu VحYZURV菦YZuURVͮ^ZuoE 0,DPt"Vw PS>XVSGXE9jh"Vez uVSEZYVh"{{E E}tSju y h!jf}t Whgtuy y h"*'Xj@UWVSE 0 h2"jѝ!+0. xo4.1Džl1DžhDžt11ۉpjh+h}"u ugtpt}RtF!LtNt0Hux1봃Pthht7vtj j5l5Uƃ u跀8"u 5l5h"D5/j j5l5ƃ t 5/q8"u5l5h"j`j j5l5ڱƃ u<8"t5D.5l5h+"뺸o5l5`^@jfS/R/C/4/%/t9ʶ D.v jhd"uh" |/tt h"jV_@.p/ƃ;5/u;;/u.t/;/uq/9wu ++//5/t)Pu=/ۃ ,M)L„t =/<1jhh`/P7rPy h`/=/u>xPP]ZYu&%=u//w.$"L1/PpL Ph!_^u[ h"Ph$hS貄SǃuSh<#EY[hB!P\kXZthW=Fh`/h/V5H.h/V V#nXDž\Dž`DždDžXhVXPj@ Džy0|8#tjVj@h!j_jVj@kPCkPalhr"^ƃu"SVhj%TPTu h2 jjPh|"h;p$h;p$ZÃuVn^SM9tTPYyjVj@TH  hH!PxXZuPh<#_X/e׋H詽Vl^t+PfuP赽[DžLh"较h,O,H,ZYyh,vmX,P,0t- t( ,y h,Bm_ᡀ,P,΃߃NPYLLP=L/u L/ =P/u P/ Ph/XZL//PA=/q=/t /ٲ,h`/h/h,l5H.h/h,h/G_pdL hH!wn[^uwh<#j%Dž DžLPhmdP6 h"j`YLq_WZYu Whf"D/eȺ/t jSRE h/7Z4PVzUWVSjj]Sjjh"N-@u h"jXuӃYtjjSPjh"-@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQ MQh<#聀U1G맅u) ,yh,j 赅XZ,P, 1e[^_]UWVS uƅ]-ƅ_h/l/h/p/t/p/`/d/`/1h "u Vom ycPtJTtgP$@" P /뭃 P / P /  P /x P /l5l5VX /Ygl5:Xj:RXB[ZXuh"]Hp/t5TRX31ZYXTu C[Ǹp/=h/t h% j2Vl5tuhJ ݀nuxou|+ |+htc%P@[_t2"h/֋=l5X P /L2"l5`/2h"Ph"h0,ʀjmw^]T /P /tP /P /t X / ,M T)tPDžXhq h 5X /RMXRrRh"RLv/ZYTLSDjjLRPV9X}XTPT0VhPHà uj/SzZYuShy_!h$hSX{V?Xu"V>Xu9S>^ty2LhVGà LVh<#juh!LRZ.ZYhq"LR?.ZYSh"jjhVjSgǃu Vh?"jpSh/hzd@Pqf uWD9X0 /`PhedAWGf @uVhP"W9VrH__9~Vhn"(xuh#l#S_XuzkhgX$SrZYuhg#h@N#hqPƍH_v󤍅PhiSq @uh]n#YSK{j fVCZ thmn#h0N#hihf#KVF󥍅Phui S@uhn#vUjmZt hX#jCh h /Xh /賆 Uh+h$ / h$ /;h- h4 /h h, /h4 /M h, /]XUh`+h@ /蹅h@ /h@ hP /輅hw hH /軅hP / hH / XUh`+h /eh+h /Vh /脅h /zh h /O h h //h h /Zu[ j dR@P d:u5l5 PYp5l5hW"j dR@Ph d88ODžX$ ,)Ǎ\X= /uM /p1\;= /}Vt VP[Zu?Vh<#eFZYt Ph#eY[Ft Ph#eXZj d[G 뚅\\8rGv\jfLP`ZL`%\QYYzu?ctptbu.` `*`DžXth&#hF#jcPl5XdTX!/MTADžHDžL( ,)Ǎ4L D"Åsh"VZYt"h!VZYthq"VqY^uPs-^ZuC $ u3hw#V9ZYu%C\\u sh#XVhP*ƒ uPh<#KCjjHVs XT<Lj\P^_1u?h#j6i P\P1ZYu \F9|1PtP6_XTt*u?\uO?,\u<څ6!X6 X6h#j 6\LPP!^Lt"0hw#V~ZYLtC \äS!XuSQ XMWh"RP ZYt:h!PR ZYt#hq"PRZYt 6h„#$hw#RPZYPu7u\u\tً\O_G PLRhPc(ƒ cjjjPXTL6hP (ǃ  P]h#6sZY#BjWsYX T8t Wh?"j>4hWSIj/SEZtXSSZPP1ɉrQ19wPR9wS)PYrjPÃh /hzd@SF uSXp!/=p!/^\PhedASF @u S`[?SWWRDZYax%9}(US] 3SuUS] 3SuUVSu] 3X] ue[^]UVSu] 3X] ue[^]UWVSP] Džp'/hܜ#PjpZYuCt!hۜ#P ^_uM'/#='/u#DžDžDžDžDžDžVSuG @B4~$#Dž=l5h"!W ZYu 4'/h"W ZYt2h0,h#|'/_Xhx'/=p'/Qp'/B=l5hI$Wn ZYut'/Gjjjjjl5O"L+qjjhjhl5Ң#od'/P5l5h#.l50'/jjjjjl5!#p'/jjhjjl5Q#H'/jjhjhl5t#\'/jjhjjl5#X'/jjhjjl5#D'/bjjhjjl5$c`'/;l5='/tRR._u ,DHuRhE#j/@vR@jjhjj#D+jjhjjl5V#@+jjhjjl5m#P'/kjjjcjjl5#oH+Gjjhjjl5s#HL'/ =l5='/t.jh@'/h`+Wu hH! PlIhTG$WZYuT'/Nhw&WY_uT'/.h#h#hj%k=l5h{$WFYZu '/hϣ#W)YZu '/Wh#Djj5l5t 5l5hӝ#Phjhjl5|# h'/l'/=l5WQ1Zu,DPuWh#@1WA_=l5=('/j:WZYuj/WZYth# ?u h!#j $'/ ,=L+=p'/u='/p'/p1󫍅l@'/AuUE)Ћ'/HDžBDž3= '/rhM#6r@@'/jxlP5@'/phܜ#<@uphz#(B'/@th#S j L1󫍝`4󫋅 =d'/u d'/tdDžl'/ h'/P[^@=d'/h'/l'/Dž=x'/u;h'/l'/|hR @uh#P)ZY@uh#=x'/ h0V~à uVh!j)Ph0PB ujhh #/jP=yh #/hȞ#/P(^_@tڋ%=`uh #/hڞ#=x'/jjh #/T yh #/h#jP Y[uh #/h#jh #/hy_!^< #/u#%#/VRWQ^ZtN xRjVhy_!< u ƃrVWYZuSh #/h!#j9(=0'/u@0'/`PP50'/h #/(@uh #/h#1=0'/,'/=d'/ud'/ h5#? uh #/hL#ph #S'ZYu&$'/ugh #S^_tVuK=$'/th9! h$SY[Dž #/t*hPC!h #/hl#Dž Dž #/t'd'/RP5l'/5h'/h'/l'/5h'/=l'/19|Y<@ t d'/SQRP=  5h'/=l'/19| hh#t5 h'/l'/9sSQRPh#j&tdd'/ h'/ˋl'/%h'/RP*5 @u+5l'/5h'/hП#j%'0P_Z@uh#G[^ D61DTZY~93<616 4utlPSh#l1 +TXDTpp@;T40pf@flX40Hff9lu `+30 403030 30u30P40P@P40<61Dž`Dždh sCp@`p@ h`ȉEEhiE'%Utpp U30.ݕ`(40(40݅` 40 40h+ܝ`v ݅`h+݅`040040<$#jXp:[(p@<$,#h#Dh #:h)#0hJ#&pf@fPhg#h#h#h#hѿ#h#h#h#h(#h9#hR#hl#Ph~#jXp :Y6h#.Xp0jXp9Zp@<t%w uh#<uh#h#.Xh#Ph# .^_p.Ph.#0jXpQ9[~pf@fp@fRPhC#- jXp8Y+h^#jXp8Zhv#jXp8_p@t <uh#h#-^ Ph#-Y[Xp.%jXpM8Zzp@Ph#,XpU._XjXp8^1h#jXp7[ h #jXp7Yh#gjXp7ZhG%DjXpr7_h1#!jXpO7^|hF#+[Dž`DždDžlqjXp7Y5pPhY#u+XZDž`DždDžl<61htXp+DžhDXT<wY<Tp{CP_=Glhk#*XP+P\kT1 -ōCPCTw{@9~@@Xl;30uSSh30PC u;lt hs#)X@H)ƉTP.3030NjP󤃽lu!,h#)XDžl h#)_P).@P\kTDT @,뵃lh#)^wluRDppf@fucd`VhX5DžlPh#(ZY DžTTNCPTP[lt y+h,X.P40;`40]%=61C؋lflf`61!htH61PP40Džh%lflf`6140@Džl9Dxpf@flfufbd`WhX340P)؃t0(u\461Džlub<61t@461h #)461Džl u7<61 t 461h5#&XRSh`#& Džlhuipf@fPffX+f~8<61t1KQ@PRh#d&<61t 1m*ufX+<61u[luRDppf@fuad`VhX%2Džl551F9X<6151)P50PpDP#? a9~p508DuC烽luODppf@flfu<`d`VhX[1pDP50P+51Sh#$51;51}+u h$$XpDPhY #$C^_Džl)Ѓ EMQMQMQMQMQMQMQMQMQMQMQMQMQMQMQPh#R-Ƌ5151H19}L50@91B<61h#$X95150Ph!#CY_UWVS} ^À8-uCh!S^Zu&d>1EEE+h!SY[1ۅu`>1Eh#Wu tWdwA$#փEʃ=d>1t 빁뱁멁*0E듡 ,1;Et`E1WtUPZU<R%XEtPVh$VED>7tj-2Ph<#j}tVSh!j }DžuP_w#t8=d>1tj jh!1Wh#=`>1t j jh!1Wh#j>28j jh!1 tVWh#j2Wh#j2 h2"h!hd"2jjh2"h!hd"2 }uvjj+jj"jjjj jjjj jj4@u h#jjjZY@uz8th#=j走X}uj袰_j jZY@u;8t+h#$Y2 u h # OZ W_XVSh0# 0+0jjuƒ o#Bt2"SPh$jUWVSDu]  'tA1h#SV v~jq cStITtbLuA1뼃dw$#A1A1A1A1zpA1kA1\A1MA1> ,)ƍA1=A1tjjhE$A1 >Ejjj"ܺA1jURh@hP @u hy!%dY=A1y hL&j;u=A1% 2 W:Z) (    u /  =A1t1ɉڸ>3Ehj%E؉Ehj%E܉Ehj$EȉEhj$EĉE hj$EEhj$ljEhj$EMU ʃ} ʃ} у} хuu hD"EA18gtj5A1!Y_EE2"E2"FEȅ-CEċS:-8BRUb9ZH3U$(#A1"0+A10+A10+A10+ A1u|A1fxA1WA1LD<1&@uCEċSEP1ɸ uCEċSEP1ɸuCEċSEP1ɸouCEċSEP1ukCEċSEPM̸2ECE u7CEċSEP1ɸ2XA1uCEċCU_(EuKMċ[] t\uc0A1hwO$#(A1M@A1AHA1 5PA1@)XA1`A1u1 8A1 A1|A1 xA1t  A1 $A1t |A1jjuCF RmA1u#EPM̉U[1EXUUuEPM̉UR̓^uCh&sZY=A1uh#h#h{%G A1FHw,=A1uh#h0#h{%G A1SEP1ɸ0^]ċuA1MuhL#5];au uhn#"A1EġA1}t]ȉ]th#j\Mu}t }EEă=A1uMEȉE E>11atctgu<E>1E>1>1A1@A1>1A1>1>1 A1A1>1U9sHxt)ЈA1t`E؊HwuF:T80D019w)19w)1ELE؃9vIJ >1A1tIutHXSVh>1w>1 =A1t=pA1u #C&A1tAutHxWVS) =A1t=pA1u #%A1tAutHxWVS߱ =A1t=pA1u #%A1tAutHxWVS蕱 =A1t=pA1u #e%A1tAutHxWVSK =A1t=pA1u #%A1 tAutHxWVS =A1t=pA1u #$>1f>1=A1t!=pA1u=A1t%>1$'=tA1Sh>15A1ƃ  87t $PhS#CXZ 83u =A1tHt 8tupE1t&hW#S^_th?#SZYt2=E1u)U E1;ujOuSh$#h0,PShA#h0,@j =$E1u.$E1hW#u W t@9A3w$t#z=$E1u$E1먃=$E1u$E1듃=$E1u$E1{=$E1u$E1c=$E1z$E1 G E18 E1)E1 E1 =$E1"$E1@ E1E1E1E15l5E1X=$E1$E1=$E1$E1j=E1l5E1h$PY^>E1/=$E1F$E15$E1) ,E+EtH:u =E1= E1t =E1=E1tEt hW#WYZt&h?#WYZth$W_ZE U @=87@tCƀ5E1jj5E15 E15E1?xag5E1jj5E15 E15E1?>5E1Sj &Sh<#jjE178=E1jEPj @u hm#ǦEUuuh#]n[h`RPXh#-t S2nYxE  1SQ%RPh# G1=E1t>58ph$V_Zt#h#VZYtqujSh# j Sh# jUWVS u] Dždh#SV t"Rtfu0HI1Dždʡ ,`19uDdmPW3ZYxPPBzY^%=`=@uyhDuyPh#:XZ``PhW :Wh<#jWhCt hCƅ_hh#hW l=HI1u Džp#lPWKQYZ8t Wh(#XZ5HI1VY_@Vh<#ң؍e[^_]UWVS`h2"jw[^E 0i1t2$p2$l2$#_u #l2222P2L2\22,2x2i1d2`2 2$22 2 2 2 2 2 2 2 2Dži1x2m1h"#Yt/hPhm1 =vj?e$Sh(#:"1h!8Z 2u  2[ h8#Xh#S^_u P2hL%SZYuP2L2Qh#S^_u x24h$SlZYuP2L2 Sh@#97_X^hf#PY^uP2L2h#SѺ_Zu x2hk#'^t2t8u t22"=x2tt28uhu#6[x2h%Yth/"PW_Z1ۅf,ftP^^202,f,ftP5Yt!2ut ,2i111Bh5l5hm1 =v#j?+$5l5h!jx2U Ehd#RP hP̃DQ$#x2L2P2 2jP5l5蛢 +t8u5l5h# 12S 2D25jX5l5ZGi1=i1 225l5d2$"PcZY020,l5t2P2L2j P5l5腡 2~8_5l5h#j5`2>j P5l55 2~85l5h#뮋5l5j h"W 5l5_htc%P+ZYt"8u5l5h#GujPWl @02VDž25l5Y/2,22,25l5oZ15l5h #1t5?u,v1Ph!#i2^_0,Xn5t5h5#PhK#&jjj502 E ,)ЉEE E 12T22tq1x2DžDžhh2RjVE5t& u0P4[PVh#q1q1h Yt8t PNZq1:udP@Xt= PXt߃=q1uF t8t P_q16Yq1=m1uyq1uhw%Zq1ghPhm1 =v&j?$5q1h#0 m1hh#hm1輵 =w=q1tj $ h#P) j h#V~ h#gX#1h#NX2"#h#2X2"#h#Y2"#h#_2"#h#X V#h#X7#("h#X2"#mh#X2"#QV j XZhj Y^hj_XhjXZhjY^h1j_XEt7U ESRPà i1uSjj_Xj,XE j:0[^t*E 0aYuU ERP茥XZEjh2`s^_uh#j,Y[hrj ^_E 0j@VZYÅt @1hPW E @Dž=2t 22ER@PXZ=2=2uu 2ujSV =2t  291Ph#502 5 2菎X=2W뻃jh2rXZh#jY[hrj ^_e[^_]UWVS}u hm P菰ZYtdhh S~ZYthg SmZYut#269=0~u0+hD $VW ctD~σdu,p#2ЃVu8h$h"h0,jJlul#2t#2h$h"h0,oSh $h0,_j ,9u!=p#2tU-#M1-) .;u5h#2UWVS] 3yh2"jR <62 1h$Su uc`Gt+It2EtJa>$ $ 52먁%52뜡l5u2"<62@>2z52k525l5$aP5l5P h!WPHl51;H 52l5u2"<62@>2jjjh, h$/52jjjh,h,$Xz PPhM$h0,Jj , 552ut gGF;ttG1tG~Sj5#2?ch, t h j5D>2oUWVSTuE11h=$u Vk t4gt$utGu3l5E8 l5;u=l5? ,E)ƅ(ct3SVYt@E'U&cMM@uShD$jEEt `cEE}tvh<#jh"Xu;p$jh$SSSh<#jUWVSĀu] P222@2V$2h£2a1Y$Gt&W =(2uRh(2+XZ RwP ?u<22222h%Y1u"h0,h$tjEDuE2h$SV tsmtW~փptXrth0,hM$-jUft$Cuh2h2hG$5l5{뜡l5觠됋=l5T2y\>xVh$d[ZuUu;EE|Zh$Y1ۅt3Rt込Ztt@ <uCuRXtjh3#h#7 Åt5[5ͱt5[5豱jjtRP12uh0,hǭ$ht5252!'YX蘃52͗hIRhLj hLjhIj 5[5whh 2cEEj@xtj@|t tu1jhxtPt|XZt }u`%}u $jP}^~jWƋxZYoV tJXK;tujjjjjjjjj jWVj脎ǃ4tj蚘|WރW^VXx;]}4|4C_XP|j8à tPjjSh"RP2j2j"Ě2[^=T2t jeY jj*XZ[?21e[^_]UWVS(}E 0o333XDž1DžDž1hL$u WJ @p&ab$$zFjhjj5l5h#nBul5jhjjj5l5hA$/336l53' ,)Džt&jjSyǃ y Sh<#jRt d11PW[X%=LP33UShW$PQhH!|Ãuhb$TShVx uj PVj j33S~y h$jNY13330,u,3@ftPhht@ƒ PBt3Zu h$PP[y h$5y h$u@U jPV;0S3+63h$j)Phj &j*W̬à y8tjh)$j赭Y11PeȃZ…tuʼnu8,9uDž 9u1 [j-jj VuSDžSP^ y {8tjSh $j1ș 33)uyPZy h$ƅy h$t*WI.#jjWjhf"h$h$:(h$|UWVSDžDž }~]E ph %V ZYÅuh %M_hG %V[^Åu!h $h %h %M (1Dž` %+DžDž$Dž DžDž(,Dž\EEEEEjj6Y[@Sjj#^_@TjjZY@ÈUK DžDžDžƅ %ku % Rh@$Pu u}VSMh 6??4uƅ뙃Nw$$Dž%Džqfe$$Dž%DžEl5`5l5l5lXZDžÀt ˀDž%DžhDžDžDžh %KX ƅeDž%DžLEH; ,t dSlE tEp ,U)‰u (W ]jjjWSƃu$k^ ; ,u uPjWPt kuɅ! h %Jph%JX; ,u;VW}Qjj ,u 4WASƃ u uPjWkPmt ,h#%I`\(PX h4%cIhd(S/hA%AIplSdz  d h ȃHtd @Iu 俀dhd t @SXd@RfustS_v8Sh!W _"t~"t2"h`%PShR%j+(P,h2"h2"h2"hR%j+(Pdkt(PG[ hw%Y@uh$$hl%+XZ uh$$hy% jj Q(Shqjh$P P{ $@uh$$h%E .S?xÍxXwà t=&Sh%2SuHV8t h%aXv<8t h")(P Y   Sh%DžDž Dž$DžXZjP+(PCw @5 @c~Sh% tt Fdhdуhu,PP ,} 4 dhu3 Pj ,} 4H xdhPjj @Hs8th$$hN%cY[g@tO8h_%78)8 hfhhu%BR_Z@u!8thu%h$$h% hh% RY[@u!8th%h$$h% (SvZt&uSh$$h%~SPh%rh%#_St&h,hB!hE$ u h% [e@Pjh0j$@uh3L&YUtPjh0j@tv(\נShp\UtTj _Z@u hKL&g [Ttj ZY@to d[_/Tt&h,hB!hE$S u h% Y@uh$$h%quth\h!h%$^h\ǟShp\UX 艟ShXbe}Ph&% XZh@(P6t_tPh$$hH% 肋d%h t =u蹝dr=1r ,} QP(P @uh$$h\%dh % u2" %u2" %r ,} QRPhP&\(W@uh$$hn%1҉hSPxZY@u h% XWh5udr dRP(Pkuh$$h%Dž9~T4PZYu4h%x u4h%+ _X떋t x tU@h% h%P(Py fuh% 8t t M U 䍅P(W f@tWYt4z t)ЉJR) ZtRȋdhs%tz tRu;uW1s-r' h!%PWK "t@tWhRjVWE0[_~ tVhխjjvg@u h%Xu u(S sh!%h_g@tzhShșjj@@Sh @PZYy+h$$h>%s[_Dž 1Džfu!(PY@uh$$hN%/XZtPMXh t=t HXtYZP P _RgDž[V(SC ZYtPX1&SjPtjP舙SUS ;+tP_h@tu h_%^BlY[h@t1\t&jRP薖 @uh$$h %XZhu t$SAh$$h)% h$$h:%؍e[^_]ÍL$qUWVSQ@YDžPT31L3Dž,Dž0Dž4Dž8Dž<hI%S@ +H00$X>%@(5%@(55l5fp31Ɋat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fp3FDžLj LP5l5ƉP 8u!l58tL8u ;PhG%pj LP5l5t ~l5:t L:t5l5hG%3 @(5@wtQhH%jX @(5jh,,,,Y^l54 @(5j LP5l5t,l5 :t L9t Rh2H%j¯@=RhFH%l58 @(5 0LP5l5l5_Z8tL:t Pv)ݝ Q݅ tjYPhxH%6#v5l5hH%AٽFfF fD٭D߽ ٭F $,,߭ #٭D۝ ٭F ,xy5l5h]H% uhH%E,^ @(5T\t.hH%j LP5l5Fr< xl58tL85l5hH%$,%@(5 @(5 @(5 @(5 l55,tDFu hI%)B卅(R$R RRRRR RRRRRRRRPh#QQƃH1Ʌ~ )1@(5h#^Y13@9u919~3Ph!&GXZj ; @(5t1DžtDžxDž|Dž:h(5Vj5l5tPCPh7I%/(55rJB5R< @(5@Yj LP5l5o, xl5:t L:t5l5hRI%=hhnI%@(5% - @(5l@(5%@(5% @(5DLP5l53XZL8u5l5hD#6LP5l5x3_XL8u5l5hI% ,@)Ht{fp3B(5j.S贖Y^u SZ)؉@?wPSP@Ƅ t@ ,t ,fBۍ1V*@KjKPV**@SV*VdP+$TVhI%jF1 Hd`hSVjz4S(mX@(5t=, hI%+Xt1DžtDžxDž|Dž:h(5VjStPPh<#j(5BtÉ3ru hJ%e 5Jr rrl5 y hL&LA(5@t"55h5Pf t hD%!41DžDžDž:PtPj4tPP4h/J%jxtA(5t hRJ%Xppj0j)55t hyJ%^_A(5tVDžjSj'j)55{t hJ%jSj(j)55Xt hJ%BP7P@(5؃Y^u hJ% u0,1҃‰3Dž@0 r+0@3,Dž@0 @4Zu hJ%Ktd33133Džd@(5@t6jdPjh55;;@s3@Dž@=5u(jPj j)55@u hK%5,t/҉jRj*j)P@u7hK%TDžjRj+j)P@u h6K%'@(5%u) t DžDž j Sjj:55y hSK%A(5t-DžjSj&j)55t hlK%0փ =,t1ۅt#VXu hK%/d35h31҃0t9S 1 C)C.K,h3d3 9v1ۃ8t/08J-0B_u8hK%=,tC)C/C A(5@"8Džjjjgà 8y hK%\555f5'u$55tjRj.j)Srt hK% =,tMjh,jj)SGt hK%=,t"jh,j j)St h L%h5S y h-L%Ph5S( yh9L%uSӈ^P,tf9} hEL%r[jPShh55yhpL%$jShh55`yIhL%jl= ~ hEL% YDždjdPhh55DžjSj$j)55y hL%bZjSj%j)55y hL%bX@(5  r)r  rr,PR(PhL%5(xPhL% 5xP)< ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6m k~$lM&s&{ L&΂$ K!‡r LJx f~ d  - D [    U!m D#]("p p44" Q i  _" chB#  *  (" M#+ Y`"j     t{#  1  1 %$   $ $% $%*  . #,6 $ 8 ;$? * E $E 7 E #E C F O 3F U 3F z$W -H%a ! } ! } # _ z $v $ $p g p m p n  t  $ ! }%ݲ {   OH%      ~~$ x& x" ƈA 2"H 2"^R \ eI`"f  2"  ̇K   d7!usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu f:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportal"ߐ   ?$@@ #Ǐ @@   *%ԏ  a@@!6"a@@ unblock and -DNO_CONV?]^0^x^чЋp]0\oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of inputXtgtuuuuututuuuuuuuuuuuuuuuutt*tuu6tBtqttuttttuuuuuu 0100prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s(5ER_ly_ly@ NNN"NNNN"??????????N"NNN jX/\ODw oUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undo9!   mdP& m m m"m m/"m m u$m m m m m@ m@  m m m m  m m mI`"m8@' m, m%>!m 0 m usage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache |ʃ  [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dUaiulfs_cleaner_mainbrelsegetblkincorelfs_dino_setiblfs_dino_setdbcheck_summarytry_verifylfs_dino_getib]`L0^`^bbbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALL%s: clean_fs returned %dincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d bc > 0sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free list?B?!!i!Usage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]NZfrۋlj~։!hA0uŌ[j; a1$!b0!~0!0!0!0!0!1!)1! 1! 1! 1! 1! 2!2!22!1!G2!f2!y2!2!2!2!3!3!/3!K3! g3!!G##G#$w3!&G#1G#23!3G#4G#53!6G#83!93!93!:3!;3!<4!=4!@+4!A?4!B{4!C4!D4!E4!F4!G4!H4!J5!L,5!M=5!ND5!OT5!Pd5!Qv5!R5!S5!T5!U5!V5!W5!\5!a 6!c6!dR6!et6!f6!g6!h6!i6!p6!qG#sG#tG#u6!vG#w6!x6!6!6!)7!H7!U7!j7!y7!7!7!7!7!8! 8!=8!U8!o8!8!8!8!8!8!9!9!39!M9!S9!l9!l9!l9!9!9!9!9!9!9!9!:!:!#:!.:!G#G#G#G#8:!P:!b:!{:!n=!G#G#r=!w=!s$=!=!=!G#=!=!G#>!+>!>>!Q>!]>!>!>!/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionreallocarrExtended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?PBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!||||4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!o& F!F!F!9!F! F!&F!,F!2F!9F!C!@F!DF!F$8"C!z$cF#JF!z$PF!1$   usage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdH!H!"!$#$:f"$H!H! H!H! H!H!$@$-$H%!H!@$@H!H!usage: %s [-o options] special node getmntoptsspecified device does not match mounted devicemount table fullincorrect super block%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimeWarning: realpath %s"%s" is a relative path.using "%s" instead.*BtH!H!"!$#$:f"$H!H! H!H! H!H!-$H!@H!H!usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidgbcaseinsballnamesH!H!"!$#$:f"$H!H! H!H! H!H!H!@usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %slfs_copydirnamelfs_dir_setnamlenlfs_dir_settypemake_dirlfs_dino_setib`%!)5]i§bqŨ7c%s: can't read disk label; disk type must be specifiedbrelsegetblkincorelfs_dino_setiblfs_dino_setdbcheck_summarytry_verifylfs_dino_getiblfs_writesuperlfs_ss_setocreatelfs_writeseglfs_newseglfs_dino_setiblfs_dino_getiblfs_dino_getdblfs_update_singlelfs_updatemetalfs_gatherlfs_fi_setblocklfs_writeinode]`L0^`^bbzero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s50rf_ReadSpareTableT^m!Hr{,Drm!Hra+Qm!Hr{,Rm!qCm!qIm!q0m!q1n!q4n!q5n!qE5n!qe)n!Hr{,L=n!qܲbb[b̳bb#bbbش bNbbbbbbbbbbb'bbb=bbbbbbCw{!# {!/{!4{!v!;{!**************************************************************************************************************************************************************** q!K{!Q{!V{!Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. RAIDFRAME_CHECK_COPYBACK_STATUSCopyback is %d%% complete. Reconstruction status:Parity Re-write status:Copyback status:UNKNOWNdisremainstat failure on: %sinvalid device: %smirrorRAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:Bc:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureCopyback.RAIDFRAME_COPYBACKRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid* B$tI_d                                   8 K9?K?c39E;$.>8wbr֡֡rT:T.7M"t!fa\x!WRM}!HC>usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / quitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl23Ldf/a!!!/!@!g!|!!!б!!&!H!_!p!!!!!!H!}!!ӳ!!!7!Z! ! ! ! ô! ٴ! ! ! %!J!^!u!!!!!!!8! O! \! o! !Ӷ!!!7!H!f!|!!!Ƿ!!!D!`!!!! !=!q!!͹!!+!D!\!!!!Ӻ!!!1!u!Q!o!!! Ļ!!!!!"!$O!%d!&!&!&!&ϼ!'!(!(:!)\!*!*!*!+!,!,!,!-E!/h!0!0!0о!0!1!1.!2D!2g!3!6!7!9Ŀ!:!;!;!;"!;G!;x!;!;!;!;!; !; !; !; -!; O!;o!=!>!?!?!?!?1!@J!Ai!B!CN!D!E!F!G !H!IF!J\!Kp!L!N!P!P!P!P!Q!R$!S4!SO!Sc!T|!U!W!X!Y!Z !Z@!Zb!Z![![![![!\!\ !\!`9!aF!a^!av!b!c!d!!!n! !!%!5!!D!P!^!k!{!!!C!%13u %8u %4u entire track defective%10u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: scsibus%d target %d lun %d <%s, %s, %s> current disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. failed to clean Unit Attention: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu unable to allocate defect descriptorinvalid block number: %sbusunknown %s command: %sresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identifyreassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x www wwww!ww0www?wNw]{b%PFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslipE HH5IIGHEOOOOOOOQO]OOOOOOiOuOOOOOOO9OOWPQ@RR'QsYY[Y\Yw #n%!!!!bitmask_printbitmask_scan!2.!U3:!D!U3P!V!U3'l#k!U3P!x!U3!!U3 !4!Z5!(6!U3!!U3! !58!!--;!&%I!U3Y!a!U3Y!u!U3Y!!U3Y!!U3!!7:!U3!!U3!!U3!!U3'!+!U3G!R!U3f e!U3~!!U3!!U3!!U3!!U3!!U3,!1!";";W!U3i!n!U3|!!Z5!&!K,K,!U3!U3!U3!U3%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorcccccccd!G|xߎi"J2~~'''o܁+++2bbbbBbbRbbb$yў!ը?0Dm8+֥vRV¤zOwkǧ&/ǫ3RS- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. C^r"# !*!#####!###!"###"] g q #!##G!##o!!##!##"P ###"--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)Waiting for dataHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t2"H!X" Cannot allocate memoryLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESCOLUMNSkrklkukdkPkNkh@7kDhcxndaticmso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadshifttildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundYZYZQZXZBZZZZYZZ_ZYZZYeZyvvvvvv disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)py5no_editbootno_clearbootno_setbootgetmachinegetubootpathsgetfstypeparseoptionsmainF"=c%# 0$4F"<F"HWz$@F"@g"8F"(!Dff$ F"@F"LF"Pq$Tset_sunsumcompute_sunsum$+i386_setbooti386_editbootV$$$̍$$K"K"K"K"$, Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap paths != NULL/usr/src/usr.sbin/installboot/installboot.cmach != NULLInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %sb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'Unknown option `-o %.*s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbd=]M~ݏQ"Q" R"PQ"PQ"R"R"(R";R"usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCSIFFLAGSmust specify interface nameSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] string too longUnknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: Tj%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvk+GggUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_read@Yr1popdnepushdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory =]i]usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvwʹʹʹʹʹʹʹʹʹʹʹʹʹʹʹ,;ʹʹʹʹʹʹʹسʹʹWuʹʹŴʹʹʹʹʹʹʹʹ)TIJwʹʹ6w-<Hfݲʹ %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longC    J 9 1 (     r      - b. * b. - b. b. b. b. b. . b. .. - -  . b. b. b. b. =. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. b. s- - b. b. - - b. - - b. b. b. b. b. b. b. b. b. * , b. b. b. b. , , - b. b. b. b. g. ,- b. b. * , b. E- b. T- b. d- b. b. b. b. b. b. b. * $+ b. .+ :+ b. j+ b. y+ + + + b. + + , &, 5, N, &, R, a, p, b. , 7 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 7 7 *8 *8 7 8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 A3 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 *8 5 5 *8 N6 c6 *8 6 6 *8 *8 *8 6 6 6 7 !7 *8 *8 *8 67 U7 t7 *8 7 7 7 *8 *8 *8 *8 *8 *8 M3 R3 x3 3 *8 3 *8 *8 3 3 3 3 *8 3 4 %4 *8 4 4 4  5  5 55 @5 *8 5 abcdfiklnoprstuvwxABDEGHLMPTUVXYZI @I H @I H @I H @I vH @I H $c 2c Bc c rc Rc bc rc rc l l l n m n ~m m m n m ././@LongLink-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./      *   B usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directory                        h    ~ P  X Ȃ N     ΁    ǁ Ձ     ҄    u  = W ; f -        Z e o  i m        q    u  y  } " "!" "" # "" #"0"D"X"Ei"Z}"""©"#̩" ̩"_ީ"^ީ"Fީ"<ީ">"?""   3 f O ؞   ݟ ݟ   Ѡ Ѡ ' Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ Ѡ R q PATH=' V  0 4           = F M  V _ ~  t `      0         7 7 7 7   F    F `     !   = H Q V  K      Z s  f m     L a  <   l x       w&$%tQ 0g"fF#в"dײ"в"s#0g"c"в"mݲ"в"l"%r %"p""n"в"v "ZI"b    ]E _G _G  F _G _G F _G F F X P U V  W nX W W X  X X }X uU MP O Q T T T T T T T T T T T T P WQ T T Q T T T T T T T  Q T T T Q T Q Q )Q T P f f f f f f f f f f f g g f b g g g g dc dc c g g f g  e }-+?=EOF reading here (<<) document#"ķ"ɷ"t"η"Է""o $+"".""5$ $ڷ"""""""""" ""?""""!"("-"5"="C"H"O"S"W"^"e" o o vn n o o o Pp Pp 3$J"3">"A"D"G"2"2"=c%$@$5">"D"J"P"GF%V"`"@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'|.0"h.1"T.1".8"@.0" .0".0".0"S; .0"   &  - ? Q c r           ϟ ٟ L   ^ ^ ^ ^ b r        1 k k      #  7#8d# 9"#x1"B!"P Y ! $/$& H!X" qB" zl&B!6e#!U#`"m#yi%" "!"$-"$"3"#"3$                4" ! `%׺ " :f"9 %% 5"` "` `%X #z$: -"0: ##Ż Z&} Y"» Ӵ"F #ę "m Cu&` "` p" ھ" " " " " $ # "= {& " 5"+ " "I M# g") "u " L%» ~&A ""- Ǿ"J~ " ɾ"z Ͼ"W/ A$ )4$ " ־"  i z             © ©             i       Ѫ     ˪ ˪   ( ( ( ( (   ( ( H H  M M M M o  M M # * M M M M M M M 1 M M M 8 M ? M F M s  4 4 4 4 4 4 4 4 H    H H H 4  4 4 4 4 4  4 4 4  4  4 4  < @  ڳ  ֳ ޳              ҳ Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${(...)$(...)"((<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvb%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20251129160226Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedpB#"B!""" /"Z;""u$."""ߝ&! "$ I`"$ " w&":$f "3 d&  " " S0! " "ɼ " f" )% "ݻ  $ s"ͽ "о 8" N %h " " 2# g" Z! """"G"N"U"\"d" k"@"C$"C"C$"C!"p"v"""}"" ""h"""@"@" " b"Z"""@"" "%"$" "("7"?"0"" "@"""<" ";""" -"1"5"9"Mv!#="3F"#E"3M"2L"3S"3R"#"s"z"" "@ @""""option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZ T T   T T . T T . T I  owner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.     w            5       )    w                        @ G   \   c r               ?   """@"Q"e"u""""""""#/"U"]""c"h"o"v"}""""K"""""""""""""""""""%"0"5"<"A"H"Q"V"^"d"j"r"z""@]"@"@"@"@"@"@"@"@"@" @"@"@"@"@d"j"""""""0"" """ "("/"6"<"H"@O"@T"Y"c"i"t"{""Q""""""""K"f""""""K"""4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!o& F!F!F!9!F! F!&F!,F!2F!9F!C!@F!DF!F$8"C!z$cF#JF!z$PF!1$+ o o o  o o o W o  o o o o o   4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!o& F!F!F!9!F! F!&F!,F!2F!9F!C!@F!DF!F$8"C!z$cF#JF!z$PF!1$ Y  Y Y O Y  Y Y 3 Y Y Y Y  4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!o& F!F!F!9!F! F!&F!,F!2F!9F!C!@F!DF!F$8"C!z$cF#JF!z$PF!1$changing %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tableD5can't get msgbuf_! " h! " " " " " ! " t! " ! # " " -" " " " " # [-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]|$$V$$$$4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!returning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dM( ( ( ( ( g( ( ( ( ( ( ( ( ( ( ( ( & ' N' ' ( ' ( ( ( ( ( ( ' 0( ( B( \( ( ( ( ( ( ( r( }( (  !   ܊ !   ˛  ԛ  returning to single-user after filesystem check  ffs_setblockffs_clrblockffs_isfreeblockffs_isblock""""        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? L     wapbl_replay_readwapbl_replay_can_readwapbl_replay_writewapbl_replay_freewapbl_blkhash_freewapbl_blkhash_clearwapbl_circ_advancewapbl_blkhash_remwapbl_blkhash_inswapbl_circ_readwapbl_blkhash_initwapbl_space_useduntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d.#6#6#6#6#6#(7#17#Z7#d7#é&7#0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-4#];#:#:# ;#;#0;#D;#R;#* c+ * * s+ k+ {+ * * h, ܢ++++(+@+X+t++++أ++++(+H+h+l"#qc  c Oc Oc Oc Oc Oc c Oc c Oc Oc Oc Oc Oc b Oc c Oc  c 'c g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g 4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!$!b0!~0!0!0!0!0!1!)1! 1! 1! 1! 1! 2!2!22!1!G2!f2!y2!2!2!2!3!3!/3!K3! g3!!G##G#$w3!&G#1G#23!3G#4G#53!6G#83!93!93!:3!;3!<4!=4!@+4!A?4!B{4!C4!D4!E4!F4!G4!H4!J5!L,5!M=5!ND5!OT5!Pd5!Qv5!R5!S5!T5!U5!V5!W5!\5!a 6!c6!dR6!et6!f6!g6!h6!i6!p6!qG#sG#tG#u6!vG#w6!x6!6!6!)7!H7!U7!j7!y7!7!7!7!7!8! 8!=8!U8!o8!8!8!8!8!8!9!9!39!M9!S9!l9!l9!l9!9!9!9!9!9!9!9!:!:!#:!.:!G#G#G#G#8:!P:!b:!{:!n=!G#G#r=!w=!s$=!=!=!G#=!=!G#>!+>!>>!Q>!]>!>!>!#w /w w Tw `w lw xw x x <~ T~ s~ s~ s~ s~ B~ s~ H~ s~ s~ e~ SFH0eCE#.:!SFU0eCE#9!Hah!IdontNeedEFIE#E#(s*K>;$E#|nQn- q+F#F#|nQn- q+F#)F#|nQn- q+6F#?F#|nQn- q+PF#[F#|nQn- q+iF#C!=rGy=iG}mF#xF#;Mt?F#F#mWC 3KOOF#F#yD<#*=(F#F#3Dh&NJ"F#\ M}-F#F#-чHC!F#-чHz$ G#ZIчH$'G#IчH$:G#IчHF#EG#2IчH]:!`G#S'@ )ѸlG#sG#*1@ )ѸG#C!1x )ѸG#G#store_tblstore_gptbackupa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedgpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in6_statusin6_addr_flagsin6_constructord#+2%+d#d#+d#m#in_statusin_addr_flagscommit_addressdo_setethercapssetethercapsf#f#f#`1 0 1 $0 1 1 1 00 1 1 1 <0 1 1 1 1 1 1 T0 1 `0 l0 x0 1 1 0 1 o1 / / / / / 1 / / / 1 / / o1 o&1$>%do_setifcapsdo_setifpreferenceusagemainclone_commandsetifflagssetifcapssetifdstormasksetifaddrstatusprintallsetifbroadaddrsetifnetmasksetifprefixlensetifmtusetifmetricm#zi+!yiɾ"ɾ"ɾ"+{e#+Y#ɾ"ɾ"+%@+v"%+se#@+Rn#gX$+#+o# + m#x+o#ط +o#ԫ+o#ԫ+o# +o# +o#o#o#o#o# o#o# p#@p#!p#-p#5p# >p#0Gp#@Pp#Yp#^p#|% &cp# np#tp# zp#@1$>%media_constructormedia_statussetmediainstsetmediasetmediaoptinit_current_mediasetmediamode,r#5r#q$r#5r#)q#q$$+,"5r#,"l+Hr#GSr#Hr#ZI#^r#L%o&1$Sr#L% Hr#L%`er#mr#@er#mr#Sr#L%ZI#^r#$      paddr_match (   q    N    x settunnels# +s#+print_link_addressessetvlanifsetvlant#+t#t#+t#t# 2"   B I          P                W ^ e l s z     setifbssidsetifnwkeysetifpowersavesleepsetifssidsethidessidsetapbridgesetifpowersavesetifchansetiffrag`z#cz#fz#iz#setifrtsz#+z# +z# +z#z#5 +Hw#+Gw#Hw# * +Y$+z#l+z#+z# +%+8w#%* * +k%l+u#@+&!m y#y#N w#w#  u# u#  [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameeui64eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %sinet6 address lifetime not allowed for the AFpltimeia6flagcould not determine link local addressinet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sclonecmd[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %s%/ ]1 ]1 ]1 ]1 ]1 ?/ ]/ / ]1 ]1 ]1 / ]1 *1 -$H!H!"!$#$:f"$H!H! H!H! H!H!H!@H!H!usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o > ?> ?> ?> *> ?> #> ?> ?> ?> ?> ?> > > "G L L L L [G L G L L L L {G G L L L G *H L 9H L L L L L L L L L L `H H L H H H I I I L L L I J 8J K J L DK L yK K %s partition type is not `%s'o##ġ##4#n#Ǣ#ޢ##'#D#k###գ## #0#X#}##Ϥ##+#K#p##%s: can't read disk label; disk type must be specifiedWTWTbSS usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock>X Z Z Z Z vX Z Z Z Z X Y Z Z Z )Y Z Z nY Z Z Z Z Y Z Z Z Y Z Z Y Z Z Z  Z +Z Z Z Z Z OZ Z Z Z %s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk labelwtfsiputallocinit_resizeinofsinitrdfsSSSWTWTbilog2usage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir e b #g #g #g #g %e #g #g d #g #g #g c d d #g d #g #g #g #g #g #g #g #g #g #g #g #g b #g b b #g b Ee  c c #g #g xc #g c c c  d $d 0d d #g zd le [q Mr r Nu Nu s Xs ~s s  t Rt xt t t t u q q q q q q q q q q r r r $r .r 8r usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x(knNzDK A-C6??333333?{Gz?`RMb@A} } } } } } } } } } } } } ~} } } } } } } } } } usage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()U U U U U  U               K K K   dz ճ ܳ γ    y p      ؀  ؀ ؀ ؀ ؀ ؀ ؀ ؀  ؀ ؀ & ؀ A _ ؀ n  ݆ ݆  ݆ f  ݆ F ! ݆ d  0 0 ׄ     ݆ F U ݆ ݆    ; ˅    o   ̃  ݆  ̄ ݆ ݆ ݆ ݆ ݆   w ݆ ݆  2 z z z z z z  z V b z > z J DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR##1#^#v#####1#Q#}#####I#w#dfLnqSsTtv0123456789abcdefUGHRBD M@dmCLS1@2plbatalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal Error%s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s InternetInternet6AppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspec Ŏ Ŏ  Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ  Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ Ŏ  Ŏ & > Ŏ Z i x Ŏ Ŏ     Џ ߏ  Ŏ  7 hw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)PriorityCapacityDevice%-*s %*s %8s %8s %8s %s %-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Y@Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlrecvrequestsendrequest#3#U#             ƙ       W      J  ֚  ?    ]           ܙ   '  9 H           N  ' 6 v   ***************************************************************************************************************************************************************************************************************************************2"U#Y#]#a#e#i#TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sNLSTMLSDMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dPoll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cWriting to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)_?n>ZyNetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzaSfk>puzZ{=g g g g v ä ڤ g  g g  g - g g g 0 g g < Tg@?|@n\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i]iuo{E&2)`lxKW~`47}07f47+87!8777774777773466635$$$K"D2 $$`2$2"2'$2"23$<$2$M$2^$f$~2$$2$$`2$$}2ʮ$2"2Ӯ$2"2ݮ$2" 2$$`2$(2$ $2$2"X2$$2&$$`20$A$ 2M$1$ģ2Z$1$`2k$>$2t$O$2$$2$$2$$2ȯ$2"2ѯ$2"2ۯ$>$ 2$O$2$2"2$$2#$$2/$2";2;$2":2collect$$W$r$]$v$$OOOlOOOOOOO!ӭmount_disks$$V$C#|$NAME=4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!str_arg_subst> get_available_cds    !"#$%&'()   !"   !"   edit_and_check_labeledit_fs_type_ext1L_Co,-]  h~'/ 4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!V$$$̍$$K"K"K"K"v$$disklabel_set_part_infodisklabel_write_to_diskdisklabel_change_geomdisklabel_freecdtUaFac8_c)\X]bYG\X=X!p__xl][SZdlg?jSkYY+YJ]Y4#]:!C!'C!1C!:C!AC!PC!WC!]C!o&dC!iC!v4!qC!4:!vC!C!C!F$C!C!9!cF#C!C!C!C!z$C!C!C!C!C!C`($/$@2yuuuu.vselect_part_schemeouter_fill_part_menu_optsedit_outer_parts{$$!$$$"!$^;#$f"%$5$8$2;&>$"E$f#K$ t"T$I;"\$!l$q$$$ $$&7!$ c%$t!$%$e"$a$$ }!$ ;y&$L&$$$ q! $ $$ $ '$."4$D#G$Q$\$g$q$normalize_clones   !"replace_by_default----------------------------------- - --------------------//tmp/usr/var#2<R\f *Hp2T&6Xzc$.A8 )6CP*J]jw  .Lv\iW)N~6W,422p2 P2K$T{Q _  :M`upm_from_pepm_whole_disk./01234564#]:! %"$$$$V$$$$0 v4!5#$:#$ z$C!$ #cF#C#h$G#K#z$$C!G#$iF#gpt_get_uuid_part_typegpt_get_part_alignment$gpt_get_part_deviceDetails for index GPT part - gpt_read_from_diskgpt_create_newgpt_free ($Q%&%\111c090Y,p&',+$8@"$"{'^!!!p0;9=p<2,=$"'###"$]:!""$$E#$ mF#E#C!z$F#lG#G#G# iF#!.#6#(7#6#Z7#é& SFH0eCE#.:!SFU0eCE#9!Hah!IdontNeedEFIE#E#(s*K>;$E#|nQn- q+F#F#|nQn- q+F#)F#|nQn- q+6F#?F#|nQn- q+PF#[F#|nQn- q+iF#C!=rGy=iG}mF#xF#;Mt?F#F#mWC 3KOOF#F#yD<#*=(F#F#3Dh&NJ"F#\ M}-F#F#-чHC!F#-чHz$ G#ZIчH$'G#IчH$:G#IчHF#EG#2IчH]:!`G#S'@ )ѸlG#sG#*1@ )ѸG#C!1x )ѸG#G#GIvIvIGIvIGIvIvIvIvIGIGIvIGI{WWW{WW{WWWWW{W{WW{WZZZZZZZZZZZZZZZZZZZZZZZZZZZZZmbr_get_generic_part_typembr_get_part_deviceadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_read_from_diskmbr_create_newmbr_init_default_alignmentsmbr_free @$.$.$WbZW]ZbS{JO^JJQSRRRRcVOP!pmrF`Kzi`LHO:_UbTPTS9! $$$9!H7!F#$C!A%$@7!;!/$?$O$ b$p$/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/i386 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the first serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.1_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failedfork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:iwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr/usr/mdec/mbr_ext/usr/mdec/mbr_bootselCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)Ukrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal errorparts->geo_sec != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition $ $  ŭ $ $ $ $ $ Э $ $ $  ***************************************************************************************************************************************************************************************************************************************2"U#Y#]#a#e#i#usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_writeonecontrol_handle1control_recvdatacontrol_free״ a  a a a   ǵ  O a a ,  a a  a O ^ a a a a a a v A##0#dhcpcd_readdumptimeoutdhcpcd_readdump2dhcpcd_readdump1dhcpcd_readdump0dhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_stderr_cbdhcpcd_handlelinkmaindhcpcd_handlehwaddrdhcpcd_linkoverflowdhcpcd_handleinterfacedhcpcd_prestartinterfacedhcpcd_initstate2dhcpcd_reportssiddhcpcd_handlecarrierconfigure_interface1dhcpcd_selectprofile Copyright (c) 2006-2021 Roy Marplesduid_geteloop_starteloop_signal_maskeloop_signal_set_cbeloop_exiteloop_q_timeout_deleteeloop_q_timeout_addeloop_event_delete_writeeloop_event_add_rwif_discover 4H\)=Qe#Rc,eUAOXiB`m6X"g%GrM^^FZnsplitvadd_environparse_optionread_configdefault_config%b;"c &d(%e%f,%g<%hb%i"j$k8%l%mB%n"oI%pV."q#rT%s[%(!t%u!vc%w%xj%z!yz%A%B%CR%D%EF%F%G%H%I{e#J%K%Lrt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSfwefwipvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigreading standard input%s: reading lease: %s%s: %s: truncated leasebootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: %s: became stale%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 router solicitation for %0.1f secondsreachable again%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completedelayingbroadcastingunicasting%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to decline duplicated DHCPv6 addresses%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%s: failed to request DHCPv6 information%s: failed to request DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %s%s: redirecting DHCP6 message to %s%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6`??ccccccccddfdebbbbb\ddddeeeeed                u          ?     T s                / 2=%L%PQ"M%F%bX$-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limit%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s failed to get receiving packet informationinvalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 addressrssssssssssssssssss%%%%%%% (%%B%Yv%%ч%%%%%%%%%%%%%%%%%:%Me%%Ň݇%% gfVU%I@843.*c'$#" rbFCV{J`%\]"r%`%F#`%̬<`%~& `%TG$&E`%<&`%TBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~5`%,9`%T%\%B`%X%\%`%]"%`%F#`%<`%~& `% TG$@E`%&`%&&&*222nnnnn$nnnnnnM]e`%]"V%`%ܔF#`%^<`%~& `%%TG$fE`%&`%/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d %ju%s%0*jusnaparchivedsappendschangesimmutableuappenduchangeuimmutable ,?ηηηηηηηηηηηnηηη η۷N/Alink#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02xMQ2222222222222222222ٿ\\\\\\\\\\\\\\\\\\\\\\\\\y\\\\$\\_\\\\\\\\\\\\\\\\\\\\\\\\7\\\\\\\\A 8 m pqrstuwxyzPQRST/dev/ptm0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ%s%s.pidjanuarygmtmidnightyeartomorrowa.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturday,N? Nq$\ b>uuRRO ,.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c !"#$'+: ,2/ +0-*1. )#'"%56!    full-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT.sysctl hw.disknames failed/rdkno match for `%s'sysctl kern.root_device failedkern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot allocate %zu blocks of size %zuCannot re-allocate %zu * %zu bytesCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]Cannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string`XXPH@80( h`xp%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrInkey wstate screwed - exiting!!!ESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakech5MS7) +q rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n    #$ ! acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$^G^M^Ikbskcub1kcud1^M^J_uN$$$$$$$$$$͚w$wW5e$ww$Nٜvg>1( ל)))))))))))))))))te))U)))))))))))))/))))))))))))))&)))))))))))))))))))))))))))) unknown error%s: generic terminal%s: hardcopy terminalTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo database%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe    # "  !""$acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerombitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon2Kn,X` %K/usr/bin/rshRCMD_CMDCannnot exec %sR%zu W%zu L%lld %d *0*12aargon2idargon2iargon2d./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz   !"#$1234%&'(5678)*+,9:;<-./0=>?@                                                                                                                                   #& +6 )4%/7(3-!0,1'8"5.*2$ 91)! :2*" ;3+# <4,$?7/'>6.&=5-%      :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'argon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$ 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy6789:;<=>?  !"#$%&'()*+,-./012345./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzArgon2idArgon2iArgon2dUnknown error codeOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureOutput pointer is NULLPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0The free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Some of encoded parameters are too long or too shortThe password does not match the supplied hash##$$$>#6#.#&#~#v#n#f#^#V#N#F##################"#                                         ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[acosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error neg**non-integral: DOMAIN error 5P\0*܉Ƀ{-Kυj^KW7ƊLx̆~05P\0*܉Ƀ{-Kυj^KW7ƊLx̆~0^-DT! @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checktoo many length or distance symbolsinvalid code -- missing end-of-block55v*Aڮ˧Zcpx PZBҨȮXA@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler @  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N60w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version  0@`  0@`  (08@P`p        L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c      str != ((void *)0)fmt != ((void *)0)src != ((void *)0)ps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)prop_string_append_cstringprop_string_create_nocopy_prop_string_rb_compare_nodes_prop_string_rb_compare_keyprop_string_create_formatprop_string_create_cstringctx->poec_capacity != 0ctx->poec_buf != ((void *)0)<>&plist version="1.0"!((*cp) == '\0')?xml !DOCTYPE plist