'V i'0y.NetBSD/earmv6hf ramdisk 08N'i<  N'i_t tN'i@@<@T 08N'i<  N'i_t tN'i@@<@TU N'it`AN'iN'iN'iAN'iN'iN'i]A.N'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iCN'iN'iN'iAN'iN'iN'iAN'iN'iN'i$h N'iN'iN'imD N'iN'iN'i (08@HPX`hpxX$|N'iN'iN'ixL$IN'iN'iN'iM$N'iN'iN'i (08@HPXE$vN'iN'iN'i`hpxK!N'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'iaN'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i!N'iN'iN'i4!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i B!N'iN'iN'i B!N'iN'iN'i!N'iN'iN'i"!N'iN'iN'i"!N'iN'iN'i"aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'iaN'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i!N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i!N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i!N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i?\!N'iN'iN'i>\!N'iN'iN'i=\!N'iN'iN'i<\!N'iN'iN'i;\!N'iN'iN'i:\!N'iN'iN'i9\!N'iN'iN'i8\!N'iN'iN'i?\!N'iN'iN'i>\!N'iN'iN'i=\!N'iN'iN'i<\!N'iN'iN'i;\!N'iN'iN'i:\!N'iN'iN'i9\!N'iN'iN'i8\!N'iN'iN'i:\!N'iN'iN'i7\!N'iN'iN'i6\!N'iN'iN'i5\!N'iN'iN'i4\!N'iN'iN'i3\!N'iN'iN'i2\!N'iN'iN'i1\!N'iN'iN'i0\!N'iN'iN'i7\!N'iN'iN'i6\!N'iN'iN'i5\!N'iN'iN'i4\!N'iN'iN'i3\!N'iN'iN'i2\!N'iN'iN'i1\!N'iN'iN'i0\!N'iN'iN'i2\!N'iN'iN'i/\!N'iN'iN'i.\!N'iN'iN'i-\!N'iN'iN'i,\!N'iN'iN'i+\!N'iN'iN'i*\!N'iN'iN'i)\!N'iN'iN'i(\!N'iN'iN'i/\!N'iN'iN'i.\!N'iN'iN'i-\!N'iN'iN'i,\!N'iN'iN'i+\!N'iN'iN'i*\!N'iN'iN'i)\!N'iN'iN'i(\!N'iN'iN'i*\!N'iN'iN'i'\!N'iN'iN'i&\!N'iN'iN'i%\!N'iN'iN'i$\!N'iN'iN'i#\!N'iN'iN'i"\!N'iN'iN'i!\!N'iN'iN'i \!N'iN'iN'i'\!N'iN'iN'i&\!N'iN'iN'i%\!N'iN'iN'i$\!N'iN'iN'i#\!N'iN'iN'i"\!N'iN'iN'i!\!N'iN'iN'i \!N'iN'iN'i"\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i \!N'iN'iN'i \!N'iN'iN'i \!N'iN'iN'i \!N'iN'iN'i \!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i \!N'iN'iN'i \!N'iN'iN'i \!N'iN'iN'i \!N'iN'iN'i \!N'iN'iN'i\!N'iN'iN'i \!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i\!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i!N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i!N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i$!N'iN'iN'i4!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i !N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'iaN'iN'iN'iaN'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'iaN'iN'iN'i aN'iN'iN'iaN'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i?\aN'iN'iN'i>\aN'iN'iN'i=\aN'iN'iN'i<\aN'iN'iN'i;\aN'iN'iN'i:\aN'iN'iN'i9\aN'iN'iN'i8\aN'iN'iN'i?\aN'iN'iN'i>\aN'iN'iN'i=\aN'iN'iN'i<\aN'iN'iN'i;\aN'iN'iN'i:\aN'iN'iN'i9\aN'iN'iN'i8\aN'iN'iN'i:\aN'iN'iN'i7\aN'iN'iN'i6\aN'iN'iN'i5\aN'iN'iN'i4\aN'iN'iN'i3\aN'iN'iN'i2\aN'iN'iN'i1\aN'iN'iN'i0\aN'iN'iN'i7\aN'iN'iN'i6\aN'iN'iN'i5\aN'iN'iN'i4\aN'iN'iN'i3\aN'iN'iN'i2\aN'iN'iN'i1\aN'iN'iN'i0\aN'iN'iN'i2\aN'iN'iN'i/\aN'iN'iN'i.\aN'iN'iN'i-\aN'iN'iN'i,\aN'iN'iN'i+\aN'iN'iN'i*\aN'iN'iN'i)\aN'iN'iN'i(\aN'iN'iN'i/\aN'iN'iN'i.\aN'iN'iN'i-\aN'iN'iN'i,\aN'iN'iN'i+\aN'iN'iN'i*\aN'iN'iN'i)\aN'iN'iN'i(\aN'iN'iN'i*\aN'iN'iN'i'\aN'iN'iN'i&\aN'iN'iN'i%\aN'iN'iN'i$\aN'iN'iN'i#\aN'iN'iN'i"\aN'iN'iN'i!\aN'iN'iN'i \aN'iN'iN'i'\aN'iN'iN'i&\aN'iN'iN'i%\aN'iN'iN'i$\aN'iN'iN'i#\aN'iN'iN'i"\aN'iN'iN'i!\aN'iN'iN'i \aN'iN'iN'i"\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i \aN'iN'iN'i \aN'iN'iN'i \aN'iN'iN'i \aN'iN'iN'i \aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i \aN'iN'iN'i \aN'iN'iN'i \aN'iN'iN'i \aN'iN'iN'i \aN'iN'iN'i\aN'iN'iN'i \aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\aN'iN'iN'i\ !N'iN'iN'ii!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'i aN'iN'iN'iaN'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i!N'iN'iN'i!N'iN'iN'iaN'iN'iN'iaN'iN'iN'i!N'iN'iN'i!N'iN'iN'i!N'iN'iN'i B!N'iN'iN'i B!N'iN'iN'i!N'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'iaN'iN'iN'i!N'iN'iN'i!N'iN'iN'iaN'iN'iN'i aN'iN'iN'iaN'iN'iN'i aN'iN'iN'iaN'iN'iN'iaN'iN'iN'iN'iN'iN'ibpf!N'iN'iN'i $N'iN'iN'i^$>N'iN'iN'i$N'iN'iN'i$sN'iN'iN'i$N'iN'iN'i$N'iN'iN'iAN'iN'iN'imN'iN'iN'i$N'iN'iN'i $N'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'iAN'iN'iN'i&gGXTh QCtPPXv.CQ*}9T$P _sWw48H ."1MG|JpJAMFiy,2j$ ^~P.L%0b!NS4A4|ZVU+Zm`(`xLtvex9ؾz9!hr,C37elrDS{<SDl2d othux5}EBўe-&Qg5rk_@/QK=vK {lʧv} {vwbY%?E{c]R i+D(Oe^O._@& ϸ9KY%F{Cw@Z,IWgq@Gh$m-gn\?PQZm|F\O&N3FTݣwZAăKm])YDK(yy DGwMD0.> t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4X 4 (DD$D$sLLDD$D$NetBSD@ ;PaX NetBSDearmv6hf4H H D0P/!p@-@P`C`F&a03/T@p#<#A-`0`` 0PpU(pGpG@Pq`P03/T@0US j`#`@-lPQMK \!\1 P` 0 R: 8 0S  /S 0SP 00S5 0pp WI2I0@3)1*03/ T@pk0pWH2H0@3(1*03/X@ p`QL0d 0 P0 0<#|h#Hp# ؖ$(@-t ttPl@dphP LJ"}.`POU @P f@%uP@-@%`H0`  BR` pRp RX Xp/Б%(%O-pP  b 00CS0w7p@ [E0S TX 0S7 0T0 R0S p |16@' 0@ LA`000`00<16@0 0S 16@ 0S $p @ T T 0S ^p Ip0S TMxp -tp @000 ^jp T?@0 @4%P%q (%Б%OO-@Pp`0ĀĠ00S 0.P  0Q @P p噪0 P00S Ѝ @0 P0=T0`00 >Б%4%SJOA-1Mfv1 Ap$0v`S(0SP0 S(0( QP$喒$0S;(00$0( $JPP  \H00ЍD$ 0PPUБ%4%`%OO-PTqTa@P1tLLLMt@00SC 0X.P0@tt@)  R  @P≶p0: S  30 P00SЍ@P0 P0g0s s0T TmБ%4%SJO@-0 kt% 000/d%pC-؀-`P p0M@  A '  A{{z(`P Ѝp Y@d%X%@- M @00@0  P ჩ Ѝ@-` x1V0zP 0 ʴ@P@TV ĴPF $$c W@V4  Ѝ場v00S@ P@0;0哴P W 0pW]0Vp ᗴpT00-S T`/@@圴p ,P@0S W |$x%O-5M R _ M@P| Ѝ p P@D5Xp0S 45 0500P 5PPUP0S50S+ D$`D00CS0@Ȥ Pp  @YT @0 @00CS0 0 U,0 p8嫨00p 塳p`300 啨᪳80: Sߴ +㉳p`  pP* R@t U0@@ 0, 043(P$05u00000 R00SQ 0 0 \ pE  pv@ 0T 1(#E0 * 0P# ||E@ ᚴP X<@R0S P $\/DTA@! ,+," 0R@D 0Z0TT$@ p00 R0S pp0PS  0 9( Pl PTH@T c@P@0 ?oR20S 0  0 0R0SP ɧ@ݲP ll@0S L"P@ P0Rt00!P ꈞ%|$Oh%p%t%l%%%Б%M%|%d%%%%0@-MM@P  僲p  ;0U$C dѳP TTyۍЍ08 ឲP ,(0P X|$|%Q@-@ T害P DDV,史P $ 0P@|$|%Q@-@ X右P HH70"P $ 0P@|$|%@->0 㽾%0$/h&0$/Ḯ&@-@- @-!@-75+@-1   0 0 ЍL`&@-1   0 0 Ѝ\&@-1   0 0 Ѝhh&@-0   0~ 0 Ѝt&@-0   0o00 Ѝg&h&@-0  $ 0] P/ Ѝ$@-1  (0 K00 Ѝ&<00/@-0   040 Ѝ&&<00/@-0   0 0 Ѝ&h&,0A-PA!q!ᘁ M`V0 |! R0B=00 B  T{0L!D!7 Q<A 84100 Ѝ P = SP 0`00S 0  p0P      0 3/Q ! 7000@0@0LD0긮&&h&#=O&i8T0p@-|@PtP00 R 0p800 p0  B0Sqs 꼯&h&&0 0 0 /h&&@- 8O@-@- /O@-@-80M@0(@3/P $ $H08 : S( 0h 3/P   00 0Ѝ00 0 1/qp,0S 00Om8@@-  PЍ߾ P Ѝp@-(`Vp80@  03/PP8003/(Pp@-@P`P 80 (0(3/@O, P I,PЍp訮&O-3 PMP`(P,`B  0SP0 0K S X0\ 0X0\Y0 P % pHp 81/qp4 D 4?P p 04 o+0S4 p0 0 0 0 "0 0 0p0 t 0 %0 0 VU0 5"SR* x0| 0 x0| ! R(P0,`R!*0 A 000+1 xpt| 0( ЍOcp0t 0 p0t x0| 0 YXx0| 00 0S04D0姌004 0X IЍ訮&&OQ"FR/ R 0 0 /P0PL 0L B0R/S/  AA  AA  A A  A A  AA  AA  AA 0S AA@-tBM 0  \ 0  @ I? `(c$P}%B@Ba cHDP}%?L3c`?`RP0!!!! d 4 !`P޼4&4 㲮" Bhh `!d4˼4&4 㟮" B !d4⸼4&4 ㌮# B  d4⥼4&4 y8p<@ !0/0]&0 /W&dX p@4ℼ4~&4 XЍ`&tMb&.KT2IS@-P-ۯG- A `00P4 2#&`8` (01/qp $ 㬀夐pUЍ80 $0(3/P 0 `V`PE0S0C0<0  Z $"h&O&$@-XAM P0 401#"8 P0(5/qp$ P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080 p0h( 3/pLp #U0* 0P/`RP `긮&Om@-@L M 0Q   0  k  Ѝ&q  O-M0@S M. 8S+ #='0|▻0S( 000| " ! !x0|0# #ݻ|0 \ػ& P%һݍ Ѝ'|! 0 Y0 S 0E0WS06  S  S $0S0 600000S60 060 00 6R9% R0r0C0C00Q0 0S, ,B< 406,|P`p0V 0(0$0,0PUp 00(0$00,0 0S $[# 5%(0S%0 %00   0 |5|M,0S l5l%0 0dC\WXH5%DY; ?Y07* % 0 $` {%0 $0 r%0 $P(0, 0 00(0 0@"<G00@ 0@ P|T' M%됶Yj& ?Y0: 0Y300$0吣* ?Y0:W%00S. ,0S#$`V  !40S ʺ\ ?\0 * %0 ($ 0L巺 %%7# m |0⨺$`[㐒3 0 !{0 $ ! s  !m(0, 0 00(0@0 <"p~1,0S 04a Q0X$8_0V00, ?V0(*$ 0  #4$0 #$0 #0000004 00 p<$9V㐺+40 ?V0:$ 0V㐣$0吓) ?V0:s$5!@<$ 0Q 0$ P `9& 4l$ԯ&2sNYrx3`@ @-pPP`@@ $P Ѝ`3MU@p@-XP8@T`@D p P<opQ<Pp&A-AP0P$ 0 0 SQ ( $0*P K'偽h d`P, R3HHqU``0``000P.'d x00CS000 f   0,`0CS0000 (00n/U R &58 4ϹD 0$00 0$ &7d%&#&&T0 S 0SP/P/S/@- "&fp@-HAHD0040S*0! PPP P`04 0PR@ V04 ^000( P 0PU 4`0PEP P 0P4  P  P0CSRP40P 0  p&&$&&p@-P0:  R R1S7!P P 0SWA吡S@ @@  GP<v$嬺T PFL00CS0410& 0`00 Su!PT 0@@00S , P* P   P 0@0CS0\00@  &t&&Б%P&&7d%#&p@-Pd`d@000 PPPP崸0P0CS0p(00 Hp&P&&G-@0` V V?ЍpPP 0崀 尐R`00@`0SoP 0S 0 h0  0?o2S @`sP&&&&P `00CS`0p S00 P0S X0X /XБ%G-p`ㄒB儢0SS CpP[ U\ XLDV00 0IPZ 00CS010a U0Pd 0@Z d#嚹 4 00CS0h10=uPU 0PL1` 00CS00 P0` R0V00P#S g00CS0p00 UV 0 00 0 @00S 0S XHx&l&&&7d%&#O-- RM `0000100010S @0бq`  0.0P0 0':0J?oT20SS SRO b0S  RZ@T  Z     00 10S@@  0 :P 000CS000 Ѝ S 0P  BR l  @0S Z0 0$l&&&x&&&%)&;A-0P!S`P@H"~ 0&KpP0!S 1P -"c 0HHH<00S ,$00C%MdT&|&A-P@dp`T0S P!2$ ̴F蜃x&7d%O-`@ ؀P0S p0 T T R R 0pfP Ѝ PP P   P Pp@x&&&l&A-p0`!S@PP!ҷ 0k @'4y P0!S P !嵷 0PPNPD00S 4 BT@G@Ѝ %T&|O-@pb00CS01,pW PU>ءTpp0pp00 P";!q   00CS0Hx10 s@p@P0 5 0p0CS010x0 S0 0  X 000 0 0 0@ ) tó= 0`00h0 P`0W0$0T P 00 Б%|&&&7d%#&&t&&O-PpP0 SPEUP ЍE P 0C0 X0 Ub000qP ֶ p 00C0S.20 & 0 0CS0T200 ; Z0 P CPEP 000S S  `V% V000#P Q 凶| x!t 00C00 0CS0D100 0X 0PFiP 0Z0 CPF V(崀VPP0PP00P  Et p߲lY 00C0m0 P0CS0<00hj00`6&l&&7d%#&&O-P@`p "P`T !. 0PS_P 0@^S00\P0S \ [ hP @P@+0P00$(%@-T @0D P 0S( 0C00S 0C0 Ѝ䀱&ht@$L0 R QQP0R/@- 耱&fG-P`P@ X 0S@ @0S @T@@DT ~pP 0S 0 0 CPЍ耱&G-@P tp0SX`UPUP 0 @,P @Pf&X0000@-@U 40aA R    0/P%&40000 0h@-6 P%&O-R蒟@ 刀p0 pWp0#s) 㼢0`?VJV$ V0 00 0S0 =D  [1@s40"S00 @∀ FQu$SUUUTlUUHUUUU$SlU$ST UTTTTTTTTTTUlUUUU U^V^V-Vk @ 0s000@^V-V00@R e p 1@s@[0"SR 0.V@0 @R J /Fo@P0 R00R  G@PR 00;V0 00 X@} T0Sxꀱ&P%&f0@-@00 005P 000 0 00 ,R;R 0S  S   0;SRp耱& p@-PD0QS@@R0p`VP 0Cꀱ&p@-P7@P  , (声$ p 007d%#Q 0Q\S@-Ao/`@-0S*  0@0S! PspP }PP @P B0 S</R/     0 뀱& ,3( Q 0@30/@-뀱&00@- R 0C30p뀱&A-plA1S0PR a  R R S0` ` `0S 00 R0CS .R R P000`P 00CS0"0 l W  KU0圁0CS00 pP耱&Б%G-AP pRpGWR0`0`0` 001S 0100CS0H89 kP00CS0' 0S  [P 0Sp`0 0`0R00 00C0p00  %`p耱&G-p0A 0RSXPBp0GB`pPPU,000P 00CS0'0  W  pP 0圑0CS00`PU*Pu`耱&G-A 0`0P0 P 00CS0-0 p& 0FSNp K1S 0p10EP0CES0耱&O-PB`0pS!P UB0S0001XPPPP᥯PD 0Q0CS00KM!1  P[00`F`0ZP/  O P) 0100CS0G'(>P; 0堑0 S- S   `Pű _00CS00  0堑0CS00  ,0Pz耱&t7d%#A-A`qW ڬQ1ECe R1 0 C0|00PP=s 00CS00 v 0q0CSQ00 \R `R `ꀱ&7d%#0O-D0!108P` Ѝ0S/T SPPP  幮PX T席P200CS00 ! `0Q0CS00! P1ȃԣԓ 0 S*"Rʜ0Upppp00zP 0r0CS00 ^ 1Q !@o!S/ %S pW U 00 0KP 0帱0CS000!000\Q00pPR# QUpp0pp00Pb 0q0CS00ik0p 1 1S 0S11a0S S`l   P5 0a0CS00<>10P!pE S:`00  1S `qP ʼ10PE pBR    Pp|000宭P 0q0CS00 ꀱ&87d%#H&P( Q 0@30/@-I뀱&`01S @-0@!S @P /P /耱&87@-A00 S1 RUWʐ0\00YPB徯 X00CS00- 000 @P R0 R P Ѝ00!S JP :H0 Sڴ 0R0CS00000  \00sP 00ꀱ&P%7d%#du?A-O0 Q .#p WO ! GrYQWYRT~H~xmpopuupo{k$ll\mnpo8p0qq lR? 00 S1S"\(PP%&P$$&7d%f,$`&H& =&$O" 0"0" " P0PPmP_p PPZ0S- `V0V PPp0 nR pR lR 00 S/1S888P0PP0SP0 nR pR lR 00 SP0PP QR000P0P0@m `P 00 00  P0 nR+ pR$ lR% 00 S1S0!S d 0S1Sr bWW P0S0P0PP1S 2SqX=0S 0l0Cs0S 30 S0 P0010CS 0nQ( pQ! lQ" 00 S3 00SL` `幍S@p 0"SZ`{ 0  P0 nR pR lR 00 ST0\S /P0PP0SPRP0 nR pR lR 00 S2P Bƥ2SP0PP 6P(  X-@- 00{ ЍЍ/'&-0^S0]S0]S S]S[S .0As0S>30   \  R]\0G-霁`Pp0 SS'PG(!RJppU``0``0,0(@P.W卩0 ,'(00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A   L0 0pS G 0&&&7d%#&4f&p@-!0 PJ@p P@01S?0A0S S n@P P0P 00S`0`00 kP0A l0X 0v0s0a%P`0, (句$&&l&p&'7d%#O-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``006P@ 0A0CS0p10H 0P \RI0P 0 S 010S P/ 00P S)  R [ U   P0$Z n00CS0L00} \0`00Pp8 P&&$&&&&Б%7d%#A-@`@0@P X0@ p>P" 0 R00R000 1BQ@ @Xz@p0"S,@gR000&&O-@cMpS唳唣00 0GS T`SXsTP0PP00kPЧ( $j 00C0-0&SM0 L\  DQ<Y0 0C@p \  0>P 0k塧l h;d00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW  B@ \  P AQ 0 T Tp p pp  ¤P p BR   @e0 P0CS0,00 0 r긵&&&7d%#O-M!@^0P0ߍP40S 0 Q0 000(0⳿pP@Pd p0 S pSx 00 0(0Y01 Y  $ XP$弦 |Vx  B R`30    BR 300S 0 0   0(@P#Qb 0bppG XxhY 00 0P\0f( $ z00C0S0 Y( Y 1  P1 F Z1  B  BR l100S 0   @ Q 000 "2 0 0(0P1 0 0CS000SUW#00 T00S 0 Q r@ 0 0S꘱&&&7d%#&tO--p *ᬡA0Q0C` M01 00C S00`Pt :  P Ѝ5 /P!` 00000`P00CS000  [  }0S00CS0x00` P  Pꈱ&&&&&&O-RB0M00bsp 0sbЍܑ0ԁS 1 7  000P@ 0.#⩟ɐ Y Gt10S 0p0000000CS0D41< $ \$ \ 0 0#0L\ 0C000@000000 0C LN (ꐱ&$&̵&&&&&A- `P0 0Cs 0p 0 h0 d   B 0CR0@pT y@̵&&$&G-@p0 PR` 0 P(S%0  d P v0 ,(̵&7d%#@-*0 㩞%O-eGM0PS@pM$Q403/P GݍЍ0: S00W +* P8: ?04P0: S 0SP0: S 0S 0S 0/S& P70p0p P- nP 0#v☟ PvO+U0P ]<#P℟]ҒP w/ %P/%P 0P,I [)H Z& U9.0. 0⫒PT:.0. 0⟒P@D!0Q\ PT1RP o R00S$ 0ST 0: SPݑPO 3  0G=00 04K G=00J0SP/ HqXG 8X00CS0p Pp  pYW LX0 X p00CS0 0 )0S PP 0 d( R;c 00ص&$TOo(% Б%%(\\ 0\\ X X0p@-@P@@DDT` U H H0Rp@\\ ppX 0Xp@-@P@@DDT` U HH Qp@\\ ppX X0p@-0P0@44T` U 8 80Rp@\\ ppX 0Xp@-0P0@44T` U 88 Qp@\\{ ppX X0p@-PPP@TTT` U X X0Rp@\\a ppX 0Xp@-PPP@TTT` U XX Qp@\\F ppX0@-t pX0pt0\@ ^0@\\1 X @-0ptX pt \@ ^ @\\ 5S %R R S R SSh -^L^S R 0/0/0000&O--QMTu @ `u @ 0 @0L0@@@ @D@H@$@(@<@@@4@8@,@0@5 SS$ܡ\ Tl0 !00`V0SE 00刐0L0S{ ,0D0000400800$0S00( $0(B?)$pXpR,0S 4 @?C000d$0D0p0H0~YG-p㼟P0EL0 P0S%00D0H0P0` Pt0  pYX5T H0J0P 0 8[P >5X0 s0X00 00dt |  ` `R`S Y ( ?R004(0'R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z  000Ѝ1@GPꔪXd4ph8|Ī̫ث(@L\tH 0PPL0 P 0PPH0LP PTPGX0s0X0 0PPLPTPHP=0 00PPLPTPHPX040LPP00PPT0LP P0`P\0&0\P`0"0d0``0<0080 `000DPh0lP0DPhPl0 004@pl0 h000  L00S   O%oh&l&D&$0\ 0S p&oO0L0S/0 000/@-0M0S 0 00!.pxp˙Ѝd0d@ `0R@X0 0B? 0Ѝ@贙 &&$&q ,&(&P `00CS`0p S00 P0S X0X /X⪚Б%: S@-  S  S/ I* S  S%|@=A-x1`@pTXPM !Xk@P10S D10S- 010'p  P@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B? 0 T00S &&$&q 5h&l&d&t&,&(&D&s@- ʔP@@P `QU00S @HT DЍp0t  Q \0 \0@.T )P@%U&&p@-P@Tp0 0C0  ,B @G-@0MY,3(30S`V0Ѝ0 0C0| 0XPS !,唘0S 20Sn  4 "; $p x xO0 0 poL20S 88g ((c$20S  $[0 : SL( 1r"6000 0@0<01"$0G10S10S41 100H 10S|10S : S0: S t`w818q 0Rp(1 B?} 0  'Q Xp{ 4 pP^ 400S ꈶ&@&&&$&q 5X&# &*`&\&h&l&d&t&,&(&D&1O-0S,0@010S 10S40 001q 1000PS ЍO\a0TQ '0P 0 4~`0S5p1QPPU& Ѝ  B 10` |0  ,R4   V 0S[     &&$&d&$t&$&010G-S,0@010S 10S40 000 0000PUG`p2눠PUG m0 0C0 W dp0S,4  `YpP T`&&$&d&t&$0G-@0T,@0@SP 00S40 00@p0`0夀S㤐@VG -0 0C0 W ,$p0 00 S p0S,4  Fp` &&$&d&$@- M @ ᡙp ЍT P 0@  QQ  00T P S  (%0p@-0PS`` @P P PA⒖@P4 ,PiΘpl&8OC-CM@ ` PĐT *F 02pPPCߍw ? P@w0S ?@P?oP@ؖ%@-ׯ 媖WG% 000/ᔶ&@-Ư0 嘖Em%@- Mኈ0P ! 00A00P!0 0| p||  Ѝ "$  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hp^0P @000 h0h pX   DHd"$  (0dꔶ&iOO--\e@PQM opPp S0St  -|pqP 0S jP |  t00CS02 p1pЍ0S JP PSPApPX 1)<$ Q840l0pp0 ! Օ0 X Г00CS0 ʿp YX 0 P 0S  x PP X0: S gP<P  P  X0: SឆPX 嘆pP{ᦆ`0S 㞛 ሲ  P= Pv{ኆ K R (g{ḇP `{0 ¯S ,!0 0' A '#! A{{ z0 8p:{O00@0 ဆP @({p l}P @0S {X0;X0XqP {lP )0-S  {PVOPtpW  HTMp Y@&'%Б%q 1|MO]Xhvs@-@ `P᷆P60PY UхυЍpU 商㒆\@Å0 P4偆~@$ . @-Q~M0pSM 0`  0 ` P `! p~,sP 8!l1@~܍Ѝ00 `P ~,W@Pw ~,NP0`  0 `ΆP W ` "Q  X00 00᷆PK 0$ $1$m]=00CS0 ㏔0 /O-D`LMp 000tTt$tt000 0000SxHV04`0p Q 0SI\#P0#0V 0030p Q  #ÄP0 00d#0V00<30 #嬄P0#030002PP0"0堄0 0LЍp(0: S |0 S%l P000`P3)0-V'V|ЩVrX2PUT  ?$0M1PP S0 0 00qp`0S0 0V00R V 0V 0d1\!00X!00@@D!S9XXLX~<0V 10S0C ^:ˠˠ\:PV0 ~,0 e~\P0 P ;  0 \U0Y 00V T0<$&&$$5$Oj$b'ض&m8@h&d&$}D00S/@-4@~M0S~, P~܍踶&$0@-p@$0l00S Ѝ0 000Q , /P$&L0@- R89/P 0 0 -/긶&c'h&A-p`P@ s0PPEU`@T@A-p`P@ @0PPEU`@T@p@-P@T0` QD@P 0 Q @;;S p4@P00T@ O(0( (/( .$&h&]~s@-R@T` V0a@$00 ?00S 0CS1P1#0 S7@.@ЍpPڀ;;S! 0 00/0Q P?'P@@00" 0S @@0ES TT 0$00S0S 0S 0S $0STڄ00Q ᖪQ`R.T( HK.(00 .$$&4d'!~W`!0SN@-PQM0SB @100CS4:Q000SS60S0@pT0S 0pLQo 01 T0pQSQ00 t 0ԃP00 0S L-Ѝ00/ -긶&$$mG-P0 P Ѝp@PڬAQVQ` 0Q P 0@@EQ< -P 0S$&@-pAPMP \1`0S0 SU0<900U0p 0pQ -Ѝ P0S(0S 0Q  Pڌ0U 0?u0 dG-0 P 0 P 0, -$&L{h&mO-rM4M R0`RX0@FPv0 0S 0  F00 S(0S l  \"aX2p00 &08"T>00 "#MTq " #>6܍4ЍT 聟0S =! !5!0`#/#)# 0S1p1 000@!>0H!041 04q 000`$1尐(00C0   0( 0 ,0$ $ 0 x  000 0 0 `#ڎ## 㭀T$(%&4d'&h5c'~&W&'mp&$~C-LRLb0HBS0000 Ѝ(( 00 0S  2 r0S |1 勏X 0S pP (0: S)0ց p10S10S P}劀P  00 0S q4m< 1 !00 0S000p000 S(00(000 P@0S !000S x0tP 0+0t0P 0X$&&c'd'c'c'c'ض&$d'4d'&p&A-MM4 P% #+H P"+bR$0@S 0@̂0S2b+pP| Pw 0 t S( -xN+tL+p2Tr0h0CS``C+@+P>+L<+H:+DH+P4P0@0@)+ 2 ލЍ +0S  R  sS SS YS~P+yS+0q儁*x*H +P8P 0SD @P4 h(1P *0S +@(*CPP "P0@0@**c'$&ld'c'0$$`$tAi Qc'^ !@ 00@-@Rp]p`$O-ql L|0S'P6@PXXLP&PV,L0 R4T0S  *@ET  A0d#0V`@P@UPk*PT0S d^*Pꓢ" <2/PL0!ᓢ#, 08$$&$Q&&4d'O-騁0@`PpM∱ @FdQ PPPU3PP$*-PT,010S( $*P@!0$0 3/0P% 0 R T @ A| 80 3/P{0Pp00St l) Q < 002/P0 " "Ѝ4d'&&v$& @-AMP/M@PAލЍp`pP/0P0 UX0X )L0_"=/0P0 0@ 0 `)ꔽ&9&M00CS0 Y0 /0O-c$M00P[ P$Ѝ"P0,03/P000 0r`30S LCL:P9PPP 00 30S[ P U P!P r4 CSR pPt hP x}PzG8@"i)?0/SfPa AW z 10S  P0S !S 0!202 03/pP XX \% d1  0S HQ0S 01;00A Ph0D0 3/P5 0S 0 R 0pU0403/ |C00S \'P0h0CP0PP4d'(d'&c'd'&&&c'c'&c'c'c'P&@-@@P( (舷&@-}p @@ (@-@}p0 (@p@-MP}p@0S  0C0 `}p 0: S `S NS Ѝp@C-MpPЍa0H03/P0 03/PqqphA]P@ 0AS0@0 a3/PE0 0.P)3P/P aP0/S5P0 AO0 0006@ @p (0(03/ T{\ P4d'&&&(%Б% c'O-MPЍhe0H03/P0 03/PPp,5p0S 56|P %'40SD]7P 0(03/ {5P 0AS0@0 a3/Ph4C00.DP 44 C(P40S  |P 00  |P 0R S "`Qd 03p Qt 0pP\P H=SP3` Qd 30/S[P V Au 00  |P0SU 0S "`Qd 02p Qt 00S "SB 0H 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100`"Qd P  t1 ,^ T RP (10 P I @ 9/0S 0S 0S 000Y\0C00+4S 0S 04d'b'$& (d'&c'&P&$d'&d'd'&&&c'c'c'c'c' $c'G-Q@zP@ЍT  T 0 &H03/P0 03/P0SB0 Y Phhq 009XaMP P: 0 P0(03/EP 00 @0S 0! 00PP@  zi>P0 l0  X0 0S JPY P4d'; d'c'd'&c'c'c'c'h T0@-0S^P P 00H03/P@d'4d'0O-MMDp$0$ PP000SPER0  ; 0P! 0p 0P0U00pPF0P0 000/`F p 00`00Q Q P0 S  PF`&$q c'4d'p@-0@0PpP E0Pp@|`&$A-`PlplU@@DTj@P U@0 00`PE`&$G-P`ကpU0 @@BTG@PğU 0@0 0@UP0 ``&$G-M =@p P``10S vP:8,! ((U00" J( + 90 0CS0P`ލ/U 0 jtP0PUouPJ~8\ @D 0RP J(@ Jm8, F `d'`&$    Q/p@-JTUPMtPR0P + Pp}uPF4$  0 40p $ b'0@- M@ ruPl0PUP $ 0 Q ^ 040Q\Ѝ0P$d'5 0@-MP @KuPЍ000S0: SxPtPU 0D uP 00 $d'Qd c'$ 0@-M@, 0000S# Q0S 10S uP'0S% X0 "?A3c000S&!h0 "?A3c0 DtP 0NS 0X sЍ00< k0S sp$$Mb  @-@ tP  ЍsP $0j0 Cc' @-!@sP 0V0@ .c' O-@0P/S`p/M/PP8 0 0{tP  pp /00 atP%  P 0S  AtP VtP0 K pw  Ѝc'G-@P 00/S (QP u00Q  GrAZP0 0`0S 뤀夐p0 媀屾P0S@$<iP@D0W 40 @UDb' Wnc'c'xA-M`P@psP5(10S Ѝ 0RP  0RP 0: SP sPm0 FsPW rP Y P W0 @($d'Q0@-:(4@: SM=!R \000[ P0 msp 0: S ,Ѝ000  u:P/  0 gA-`QFZDT@qP0@!81P @$<pP10SP+(0 000 =  "4S `qP`0 rl0p 40Ѝ(tS|(tHP!r r00  c'c'$$b'O-Z#Q30`@ (tKMMp 40CS񟗩8dl3lP\30S r0P0 0$#: SQ ZPX3P @$<쒟 ?o2P0S(4S2jP prPrP{?0p"0 + 0S820S{ 4m0C?o2 000! "Fmpp0!Z Y- Y10S- 0 !K>0@4@~z=0 Cqz q 4n6 pv PF@$<P>4S(4R0(4p l$hR\00 X0S 0(4} 00H 0KލЍ0qc'Td'c'c'$$c'xAs/O-p@M W 0DP 0S08 0<000SPP0C080pG0S 0`S * 0R 08 0 x x/  P8 b@0 X2@ @?yQ*S@0 ,0嘰 R P` dЍTT ~ _ ` `@xd'td'd'|d'Rs@-Ѝp@ 0@`P6Q08  oP0 b'0@-@MPPo00800S =J" Ѝ0c'G-z@M`Q M Y #P oP 0P 0P=! SR J(@ݍ ЍqPJ8| = $ HL0RP J(DP 0PQȄJ8 4G- AP 000qPU+`00CS0JpU 0 0S U 0 P 0 SP P0SP 0S0 0 S P b'b'$Б% 0 0 S00@-@R00000S0@000S `}P LP40Pd' d'b'c' Nc'p@-PP 0Sp `W}@Pd @P0/S0080f R P@@@@p}b'h0 RX R  H R/< R/ $R/Q/ b'd'd',d'l0A-0S X0XP@0P`PpT R S* t}0@c'b'7d%G--c@ 0(MS 0SzB0@(Ѝ0 0P50C S=%\%$%\%$<%\%\%P%P%p20S 0X0 00!P 0 ! " PPP  0!$!$! 0!㓭 X (4 : SB  S<  S)  S08 0T! O0 J ,!F$1$/@P@ 0 S  S0  S04=! 0400S -ЁЂ ;Ѓ" 040+04 mP0H 00  b'c' &B c'Vp@-8M@  HP)w0`P`bU0$ $ @ 0[P8ЍppzA-t1hM0@S Tt|hЍA?`Z(z="(<p@|1WpP0 0000p084 P|40CSH$0r"60"$B|0( =|4 CR+x 4|hЍB>'P+|S+<  Jc'7dq \|@-@XM="p:(Rz0 XЍ7@-@PppfP Q Ѝ0 0 ) Ѝ0@(0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq0@-C0S&P*00 ,  SΌ!0W0@0BS0B0b 0r 0 00Ό0@0 P*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 Br^00 Cr@ T A Cr@T   \a0Cs R  @-0C\@0# S#:0CBPBb 0 ^ 02W"!0C S*040@-@T@@  d'A-P0q0`Q VA-QQ@@TQ S A}A9:TP0 ddz?@ 0:S@ 0S000 @,b'ċ%% /s@- ` P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* &#P00PG- 0S`P y0P  p T@R 00T0pT0S ,I@Pp=DPP {&:b'cs@-@PP0@l C300Ѝp0  R R00`oy@P 0 `F 00b'@-  &w뀒%z0 Rr @-/$@-00&$(& & &dw뀒%O-pဠ倰 @ "0P0 p`0, Y/   `KFO-@-/lM`$봯PAPP 0p p|/||_00 `?`/pP?L?A0s 8/S XB\    CRX 0F>vzP񟗳$9\73\79\7\7\7\7\7L9\7\949<9D9\7\7\7\7d9\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\7\788\7\788\799\7\7\7\7\7\7\7\7\738\7\7\7\7$8,88\7\7\7\7p98\7\73,8\78\78\78\7\7\7\7\7\7\7x66\766\77\77$7,747\7<7x777777777\77?<P p,PM>J=0 -R,Q0 000;l= =p, 4hP\PPU @ SP@g tw`P jP "PiX PcpPX\ 2P ᫠\50S  o &P  'P@5嘵00Kp:% 0yp B;X%04 L50pzR񟗺GAAAAAAAAAAAA GGAA$G0GAAAAAAAAAAAAAAAAAAAAAAAAAAAAA@AAAAAAAAAAAAAAAAHE\EAEEAF$FAAA8FLFLF\FhFAAAxFFFAFFFAAAAAA@@A,AA@AAAXAlA|AAAAAAABBBBBCCA(0 0CP;TC 0S0TP* R00;T 0S Y 0 0tYpi Y 0 0S ddRr0S X 0 0Q0 ( ArKc' %C-`PMM RP s\SP RW P0S #  P0Ss\SP R1 PgQ PQ' SQ GQ Ӽs 0 0@pQ sQ00000Q0 R @@@ۍЍ00帊 P ᤼stUq@P p ~P ; {0 $issc'JA-`P 0StVp)q@PP P`P80 PP p@ @@ @c'X0A-@0LPL`LpT  S& pq0@c'7d%L1p@- RE jDTA ,PU; P8 \Q Q 0T + s04# P  0S/  00P0S/  0P03 @0/S000 0DPpR0 c'd',d'"?0A-j40@TPp 00S 00S0 00/S @Tt0o5PL0D0S sP040 c'd'0d'x2A-0@SP' 0`.S0.S0S/S 09P 0 Q CR S.R  S.R0S/S S 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p 00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0P%A-Q@pW :<00S ull@Hd'c'$$$7@-@@Q@0A@P!!0\S q  10@ Ѝ0 @G-鴑M@T- `P!ApT |0S! @T )j@PO 0L0 0QB -P4]" 0`! Aލ00!!QP  { P    P] $ 0\0 D Z%lx(  Hd'G$"""##1G- `V@0P XpY  i@P) P! P AZ ]@P`WP kP< kk@Hd'A#n##d0A- @T`pH PAT,P 9@Hd'Qqp@-@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSB 3b 300pp P <  - R0 R:00R:/A-0A Rh1\pP.@0MTaMQ 0  C0/S' 0 ! xh .P3ڍЍ *\0@C ?\0@C ಀ 0pC00C 0 0 Ph P 0` TEh P 04 $9h P%# ###p@-`0Sp@e\ 1e #m@ iPj000p 0@-# 000S  /hd'0-p00@^SQ 0Q00Phd' Qp@-!0PS   pPd @t Lm @@T@p00@R $$@-P`p@P  P 0|Eh0` l@ Ѝ0 0P 0AQ$ 0 =$$G$u$$hd'A-`PPЍ8"A:0J840K0CS 2  `40 01 +  d] (lV <tQ @ |qp}  A=/ 0$  4 -BL2P " 1P* 0(5P/S00*040(84K0@SKP 0 040q;;00004(4 :(40/S04084(49(p k$td' |d'C-j@EM0@S(zzz${{zz{{30S EߍJ(eJ(J(J(!L 0\ ` @ 3 30pQJ(t S7000-00 s++  10>L  Rp0<x P J;p0@ P J01  = 0tpP Jx<Բ@\TYE   aXM  a} 0 OpP J} 3P NP$PP P P 0$p pt s0cR `3Phd'X''8'x''RfO|'''O'b''q '0@-PMM@ ` =X X 0P0 U+@0  $ $ ,  ݍЍ0$ hd'p@-@ PP hp@*'A-0p-S0S) cPP%g 0NЍ0` S0 BPp@P,0U FP` 'Б%'-@-0@P   Wu:Ѝ@Ѝ/d'p@-@ATp@0 R P1P ` `獿P`pd'-P@- 00|0 x0 t000 h@0S X 200L0L <1c ,u$ 1 Ѝ@ Ѝ/c'd'c'c'%c'Ip@-x(T@PlhPP XP pΌ)T000S  p( d'(d'( -P7@- 000@ 0 000 P0S x100l0l hb XtT4fD 8b0 1 Ѝ0@Ѝ/c'd'c'c'(%c'I%`@-{ be`8(%@-M@P" 0/S +P|+P Up \Tp 0RP 0RP @ލ-7I(YQ 000/d'@-{ wb$`M(%@-q`@,MT xxhbpAPD300CS0@a@@a Pp= @Y@DOoB0S@,Ѝ0P: S TP j0S ` Q |0! P000庰@ B0At@ Tb0 @00CS00 d't(%Б%(q (O-PQAMR @ <R =R @ |R@ 0&S@ 0=S@y  0+S'@p 0-S(@i )e&c#a@ ^P%e'.e'xe'5le'60@- he'260s@-0P`0V0`0@S P 0R@P@  P@0S00S y0ST P000 R  Ѝphe'q'$R6&.c6@-L ^4(@8hܡt8TTL @@~$ \1#P?  B 0b0?  b0 0RQQQP0R0R0P0QPQP !666O-`ps딀P @%RA &R X*5! 1[00   PP@@ Ѝhe'6p@- 8M@ T` 0  P@8Ѝp @P R 0 0 0PS@V P @0 F1P@$ P@m\ hThe'Jp@-@P0)Sphe'O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D \ S! wz! q0  0@@P! d0  @P[VR'T  `@P, @ [  he'666JO-p`M8P젟찟8!@ 40 X@0DS '00S^^* PU @ 0 U 0DS00SY Ѝ` pUU he'D)C-`p  0BS00@SP! @ 00 TQP@@ Ѝhe'G-`dP0@S! p0 000PP@he'@-@$MP 11`PLY0P  IR NRpp J0PPEP@@0@S ( >1$Ѝhe'6PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0P@ 0,O0v1q $$|l'q'F@P/- 0/SSS00e'@-@PMލ0/S XMp Mp 0RP 0RPQp@-`\50@ῬP #0D0p@a0`00"SP Vp^qe'7p@-T` RpH0@Q 8 FPP /pp@e'`$-7O-pW,S 0S)P ] C000000000CS020S @T   R RT/Xh2hb0d00@/SpG/pHHDPR0S 0/p0CS0p@0@ppW000000pA0P00 \00/ Q tQ00CS0P10S 00CS00W0@0 pR0S/S0@D00c0@0W0 P  R*0000t/S0S  P 00CS0p@@0@pK0S 00CS000@/0@00e'e'e'*7-7$|l'$QA-`p00@0GLP 00CS000S @ 0P0CS0X00S 1X @06 R0S U$0$p)N%e'e'$e'7dG-p2B`M6&0@T"RR@P$ 0SM .S00.S0 00/SSC10 ) PPB| ePpZ% ``VTG"PP@ ` .` Eÿ0EWW@`0-S0S0@T@@QP.LP0: SVP >PЍ$17n'347*e7e'A7M7Q^7@-5$0Q @ P @e'-7t7p@-L@Q50P000S LTPP 0S{s@@L 101/M00CS00 L 0 L0pg\RDn'7e'7$7G-pPp@R` V101 iPp bPp `R\TQ @0Ti \0DsQS񟗀X`hpx@00CS00 ]L 0@ 0 @T0S 00CS00 FL 0 0SX00CS00 1L 0 L 1% 01 @0Q  0BPA0@D@@@ @ @ @ @ @\@$C7A-@ ` PR 0R 0S SKp0S0 R QL0S  JLU  4LT?L[ x9Lmq Td@00CS00 K 0 AK$e'e'I$O$ @-0S ңe'@-@(0Q Le'@-x0@T   @@@@ @H@00S 4060S $Ѝe'xl'$-$0@- R    e'-@-   0p@-e'-@-0@0 H@-@  =@-@-   3@-@--@-00 " ЍЍ/@-@ Ѝ@-@-  ЍЍ/ L 0S0 @-4 4~K,S0 / T)7e'0/e'p@-@RIPPPP nHp` rH`P bHp` fH`ps@-P30P d0d`6 N 0X0@T PLD0 0@ M@Ѝpn'$B e'r's@-`P0@S'㻤<0`X%kg{{'jfk[P[x V06S 00S TMЍp @0t0S0T.S N@e'K9 0    /e'@-@TЍ0Ѝ0CS꠾  000 P 0 4@ 00 0@-@M PU PP 0lp <+P   PPP 0]p 8 0  Ѝ0 OX0 0e'd$Kl$@-@P 0S0S 3P 00 0 Ѝr'G-`0S q0P00+#@\T0PQS$@q&$00CS010S ,Ѝ00S P UEGLY7  R L)P00CS00S U@0S$G@ UGPG@e'e'e'P9C-s@P`^PM( UPG*릐) QdDh\\xxxxxxxxxxxxU2$PP^0S2 0S@*T ^0S2$ 00 *|20S G0S X2$PPPU H^0S 2 R$0S20S AE@yP10S 2E10S )Eo^0St1 R$ R @T$@L10S E(10S E10S E00S D  @06 $0?o2$0-x0$@T $ fd00S D 4I0pH Ѝ$e' q'o'e9$G-PMp@)0 E`㠀堐堠 ?PP \#*Vx0$`W U ^0S W JP 0`S)Ѝq'$$e'P8PG-P* `0@00 0R0Cp0W S `S0p 00 PY*W*S p0@R)PD0(00$F* 0$ 0$/$$|l'e'A-P`@耟0p00}^0S 0S 0S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R SR 0$`S Se'$O-P࡟$M^`AV $`:)pWS0嬱p0p0✁0WY 0S, |1{2GlG G00CS00 G 0= H00CS00 uG 0 WG  J ^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 )$Ѝ$e'q'$r'ɡC-@$M p䀟( 0 0`@T+ 0S0 PU@ 000{P 0t 0 SP0 0U$0 @ R^PU $0($ЍP0q'e'$G-P$Eo@p0婒S' 0S$ 1a11:G8GZ/3GU/G00CS00 F 0 FtaU000 f&PE U04q$0! X#$  B CPP00CS000S F@00CS000S U0S0S<0<0V1FDFG0TFUp$r'$q'u999e'e'e'9p@-(2FM000000 10S 00S 1 `1%1FF0Q@TF1FVPP% t1 1@=0S @T D1U A@tF4rF 1E0S  1$ FߍpA 0 000 0?P00CS0 0@ 0 00t0 W=00CS0 0S ?Fl=FL0EX00S K@00S Ee'$r'q'u9$9e'9e'e'9e'0 @-`o 0 00^0$MSP4P @;'000P> pR%0P 000S 5C<-C0 p000CS0(00S ?'$Ѝ$e'9e'C-@?mM0$08@P0?_0 0?0,@0X@ &d@`PჀ 00h0 0@Th0p@ 0`o lP 0p@T 00.P0p ,00d0S,w&d0(S( 0L0>60S >0S,0S(00L0, (01C(0>0S,0S pl@xnT@(|X P07S 7S6 <>0S7 00SB .0 00P 04000$0 0t00P 3=&0S(7S% 00S 0 0S= @  `=, GCp@? PQ 8 `= J@ L= $=, R , k᣶4 0 i$Pg$00$0<<0SR PV0 0`@GU.P  @J, 0 , R(0T@=XpWU IK! 00'pn'e'O-pWC R``%` P0S:S2ǵEА @0S,W@  @ᚲ0T/S/00~J0 00S00P R:R0:SPPP圵@DOO!S!$$e'@-P@/` 峨P*  0 뙹PU0 "U# "`VZ0S  0 o놹0S 0S ~PM! ~pPP<> ER~   0_e'~@- P@MRq$|P1p000 Q`!pWZU x@?U `?T?U<@ 04AS 00CS00 w? 0* 00CS00 g? 0 ЍU ??U P000oJ00CS0L00S <??0,r'M:e:n:O$w:e'e':::p@-P@@Pp 0S%SpP @D4p@-P8@Pp 0RԵPp@3- D0D0S RP P\ 0$e'G-`P@唀0吐00p 0S0 S0S00+MPP|U00CS0$00SG;pe'e'$e'G-@Pp0`0帐0 Q :RQ :QR``R %Ru /$PPP0T:Sp0  4@0/PSu`Pr'':$A-`P倀000p 0Sp00JL@T`|V00CS000SAe'e'e'0A-pPS R+c`a@T"W p000γl0 @0 0 H00CS0H00S `P `@e'e'e'p@-P$@Pp0P0@3@-L@000@00 YL00CS000S@oe'e'e'O-PM/`@ 0婦P @@@ (<P00š0 0S 0S 000y#   P@ P @cP< R R R 0S 0   # R00 m P B0000S - Q p" R[0 RL"00p@0  Pp[ X 2@b 0=0p0ЍQ 0S/Q0S[q "P  P x"P R ޶ R ڶ ( <P0 Q<Q 7 娲0@D[ P Q  pP@0000S R  p  BR 9D R5 _3 sr':$e'e'$::$:e'O-@`pM2%PP2*0S*[ 000`"0  p0Rz0#| 0Z8 RhB<01 P=PЍbPEU````````````p  `@Q 4,V  00X!W QPYXV E1 0 0 W0S& 0s1TP P*W 00SY0 [  P 0S<XT 0s  P ap=T:n'e'$:pf'r'$p@-`P0000S S@3H000 00 00000CS0p00Spp@^e'e'0@-p@M0 0000T0P>00G 00CS000S ?Ѝ0e'$e'@-aP 0SGO-`-pP@pM$P0cS    @0@ Ѝtf'@-Qp@0` 0S*00DP@`墮P@0`SP Ѝ `P0@P0`S@0S0O-@p [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xpPS@ R0B$x r RP R  \$Ѝ$5PX:$P 0U0/Sl 00EpP $0S/00E0S``0` xqQP /000S V/00D x0s0SR00Q: 0 R @?l0P . B/o.Q" R  0P V 0 @$tf'QKe'0 q Q0@-0 @QC\0CC/x~^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0S P $$$C0$000CS0L00S 0S 0P 0tf'e'e'p@-@ PTp 0@ @@tf'G-p @0s0 ST@D0P ̀`V q`RxpP VP V V@ S`` S =RR QU  L0P @.0G-p@ Mo oF0P GZ8a000e U00SW-00E@`PIPE@T Ѝ00CS0@|l'O- R@@0`-SPM S! C RTTTTTTTT?So @Sy 00C Sh80 0 '`00S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 P6솟p覟ԖW@A0S 0f0CS00  P6FBЍx6P6l6_0000Q00S 6 pR&V(0S 0 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 R L 0ppUppW~|0m R  R9 V} WHs 83 BR  BR j ~  B Rs `2 BR  BR  ~  BR   f ~ `   0S q QAQAQ   Q50  ' ~ AQUd Ra 4q B R `V~paQ 00S T 0s0 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00n'n'0|l'tf'**$tl'e'$r'0$O--$M000 06 0=``(dVdp0  P600`G6 @ V 0@P 00@S0(00 60P@   R@@0% T A*% R *R@R Z  JRG xA@TZ   + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S1 0@80,  [0  0+ Z R CR 0S0[0F0[0 0@S30S 0@0 00J S񟗸#"H"##"""" "`3 BR  BR  ~  BR  ~  K R  BR ~0 0  BR ~0 0 ,Rw[B0 mT@ 000ST @Z$ЍT TL aQ00CS0)0 儁000I0 : P 0C A 000 1 1 0AN0000T0 0:LP 0 00@[@R p R0 Rp Rp B\T   R0S.tf'|l'|r'$$ <n'0O-0M  P0 4400̴̔0@ 0~Q  0 pd匤0@Q Q#:Q =Q Q Q     BR  CP AA  p A P񟗁(%(((%&8'&&X 0S@ЍQ Q@Q =R 0p(0  BR  pw w p    BR  u  q u  BR   ` ( R  0BQRQ B  X  BR  v p}< v 0Sq Q AQ~@AQ  RX ~     ?@@ M  7@P)  ~R&=Q0S! 00   @r'0$tf'$|l'q'G-P`h1hAf0dS 0\q00P0L1 00<1 (V0 S000`0`0CS0!0 0@p   0   0  R 0r00j 0p $tf'$|l'$q'f' @-0l@T$O-XAX`0$M`F:0PEPE000PCP$Ѝ0000tf'$|l'q'JO- aXP q0@ 0 R    0X00P X 20P E00C0 Ѝ0S L H. 008  @D0000D `tf'$|l'$$7d#<*,<O-@ 쒟rP0  DR40H0 R`| R    0T0d2P`8 T_ T@-@FT+: fPR0CZU * TR Q  S0D2@ LP80Z0Y0S@@T: Ѝ@FT: 6P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C0`FT000@ D00C0CS0 000000C00000000$tf'|l'$C-PpM@`᠐ 0嘀00000p000CS00 p0@ @5Ѝ00ptf'$|l'$A-Pp@-A00CS00 V- 0 ` V-00CS00 ?- 0 ` V绢`-00CS00 "- 0`$Cj@-F<@-F<00S/ R$T0QH0 0Scq o/P0//f'$0    B /f'A-P夀0@000p `R$  0 `0T @ `  0 0C  S000SA.e'$f'e'0A-P` @0p0W0 1P 0X S S0 000 00 0h0 $P   00T :00CS0 00SA$e'$f'e'A-4b4B0 Qcr 0S U,S,r0S@0PP0/)P2b000r0Sc00CS00  0S 0X0#S )P  )P, 0 00P0 P   PERP S   BR 00E0CS0000`0L00S R,80+`Q$f'$$h<$$@-L@00CS00  [p00CS0@Rf'@-T T@08     00000 0$00f'$A-P`@000# =)V |`0Pږ#p0PS  D0  0000CS0 00SAe'`3$f'e'@-4ap00MP0)@P }*P(0: S$0 /0  (P  mP(0 000 (d#T(L00CS0,00S Ѝe'<<<<<e'A-h@Q0P0`0 PHpP壠<0`00CS000SAe'f'$e'p@-`P@00P0"P K9 0S00D90X 0000CS0p$00Spp@P$$e'f'e'0/$p@-@,`,P0SpSTp]$f'<p@-P@0Sp$f'p@-@Pp P0Ppإ"0@p$ 0 R/$ @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0 j'5rO$A-R0S20SP`AR p N"'pp5PpW* 1N -(p !""3P ( 0P x&&&' qP H(p9  3p,9 ' P -(p9  3p9 !00g&d&a&`j'xl'$(<$=tl',=P=0S/p@-@PP1PDHA[P0a 0(00R 0S"0D@E05#0s  0C?o2^0SP4xpBP v9+P p0S *00CS0p\00Spp@ Ao PQPj'x=5rOe'==e'p@-@\P0P00 7@00CS0p00Spp@e'e'O-@`TM R0 TЍO)ؐY. PPY   p0 SPs   0S0P0S PP PQ 00SЀ0S@TЍ0S{22 F!0R+  p  !R -  "z)yp 00X" n) mp0 sR ,230ap) 00CS0(0p W )e Z 00CS0(0 00CS0(0 | 00CS0(0  Ѐ YZ}(000w ) #40  ) )P S#4s`8  0 0p@ gp  (Jzp0㓉(ЀHp0ꮳj'$5rO===}z=== >@- 0 SS0C 0.^\Q0 p@  C/o "P R pO-PP10 0%SX P 0@S"!Q@ C$0S 0S  R-S +S %S @@1@YZT X@t1 r9 002#00S 0S 0p?Sp  P T"@` F Po P I \0@00SJ R Q !" R @$>2>j'">B>G-$a$|0S Qq0l0@S @ 'А㼠0Sʰ00CS00 b' 0 (0 R  0 S !'j'q n'5rO`>P>> >$A-pP`A$P00Sʄ10P 0S hjPp pPP gP`W@ P$1@@A'PV QPU, 00SJ s'0 l'`00CS0 &0S 0 0 00S0 S 0 0`$p$>>n'>j'5rO>$40@-@T  VP@@dj'2>8 P  /Q 0SZ//j'G-Qp0SPS@00SoZaP000M: 0@C$ @p U0Q000CS0\10S Da000<>,10S0000000W@00CS000S 0S @`VZ00萠i@ ᧘0 Z4@Ꙃ! P00B R @j'e'e'$@-`!@S1p@!P \$Tx1@WV2 h1N0SP U 0S0%($V $1/p5!j"g"060S% `"]"Z"Vo$l$U 0S P f#`N#P PPVWT  0  ЍVxl'e'tk'j'$$P=<08 N R S  0S  P 〗$O-pR0M|B0P p` -0S0S ЍP$$0P000@0 0#T):U 0S0 10S  160S  0UGE RE C100CS0l10S 0S 0 2"  \ P 0Q R0 @|. \ ~ Lo ^ \ Q  P 000 QPW@~ Lo ^ \ 0 q'e'j'xl'$$e' G-pPJ@P DP1N0St `e.@#T @#R.pl4 V`㜠@0S0S 0S0S<`@Y 0 X 000 F$$jP=j'A-@Py P PT0Q 0S tUlP@ pP@ ZP@gU|06 R0S@@Q`` 0pG  0 0 Sk>n'O$$O-@Sc$M2 PT  %P )P lnQ pQT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP p㴲jY  \   0`P 0S00Y 0STP i'$260Sh0`00\  \ 0?o2? TW E'\0#Q 0 !X R6  p"P0S 0S00 0 RZP S  R 040TpP/o" R 0 S0C0 . p0SYX X YPPV>n'>?>j'n'$p@-@'!``Q000 R 0S <1,p 3!0S 0 00D1  S  Bo00P0R p` R\ p`` R00 㼍0S00CS0000S ipe'$DP=j'5rOe'D1@-Q80@S vU#P`q0SP00CS00 " 0 $0H,p c2.M!+#PpP000T00CS0@00S  Ѝj'P>`>O >$$P=e'e'@-w @ 00q n'@-@ l @q p@-`@0 0 p 0Qp\ PU"00pj'!?O- 0@LbLPDDDr0U0S  U"0PE0P ЍS S =S\ 'S " C 0CSX___x`_``` _$0!PU0 R$ \S0 \0 0S0 @ P   0@ P0#P"0!0 P  0  @}00 S$0)0 !"0T 0@ 1 }SP0  :0@"00  j'P?9?C?$^?L?G[?7S?A-@dcdsdMTZ 0SW0Sac$bbbpbaabbbc,c$d$dccddacccccddb b R0S  "%#00CS 0S2h"!\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8 Pd Pa P^ P[ PX PU @,j'p?SJ?s?x?}??97????&??ɡ ?mR????g?j?~Im?d??:p@-@P@`TpUPU 0S G@p@-Pt`t0PP6 R@N0S@2@@0S. @D0    p 0 pj'$A-0P@`Tp R@ 0N@T P 0S@@W\0HU 000000V0@ xl'$$@-@ <}p P0  Ѝ@00Ѝ?O-P 0qM00S 1a б100 0000 S  @PЍ0SG 0 RS/Q  CP 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S-@x*+ @00CS00  0 ( `0SH0 @00k'X,UP0>P0 |P000P$@: 0ЍP0 ,  0P% 0&P00 0<P_ >P &P000p0p0((0 @ -P 0(0  p 00 H$$1|l'$f'f'vEEEEEE F'Fpk'lk'$P%n'.3F,$DF20/ {P B@ < } p l {S  D  B p/#P0p*}P0$  @@   ? }P0 O0 p 0H$  @ Ip0H! , s@ BR #@kx!0  = BR@ Ĥ0S@0Wj%S` :S/ #S0[ 0 p?0C Q s@ BR @;W0 0 @ R*  B 0)0;F"p0ᜲ uP H02!R1S p0HS2@p0 pXp| !0X2 ` !p,!!k00S Go}S㫲[| p'P023Q w0 00"0 `!a$0 0 @ B "  0$2  `!G-`̠̀0@T@@0PU @ 0S 0 0  B/o"M`0p 0S 0 X 0 0 0,$1@-0P0@-2_M0$ 0 K< 100100t1x00005dPI@1x 1Q @<00 dq 0S $Q. 4QG Q (0  400,8  (\000 0 0 0 0 0 S00_ߍ0  p0 `0 H0 D0 H00ScS,0 0e'$e'$1$e'q fF G-Vp0 00 P" 000P6 PP PPPPPP̾P0$00p@]P 0 R 0`     z0@0S 0 00' P0, RPZ 000@ 00 00 R, RˁP4 C00300 0000    BR   00p` P 0000 CR Sn 0 P P`  ``zs 0 0008 @0C 0 H00;`0 SptP \0 R   L000`0S0 R Ӻ0 0P 0 R000& 0  qP 0@S P 000d `@` 0P00`O P0 000000S$ T 0S ~0@000@00S0P0S0S 000@Ѝ0$00pX$~F$$A-Q@`Q` @ p0 P0 0X@p 0P R$@@`.R ( W% R"pm0 `4 mP +/r`P 0 08 00C0%04`Ѝ Q  0Sg0 00 00 @ 0$$FF A-P@0 P. 000`P p@``@@{P 0`0 U000 PPe``0SU +P$$Fp@-@|PP 0 @OP P 00000Sp Խpp$F P/0S/80 P/0S Q/0n'p@-@ `P>00`Pp@-`}P埽~ PP  Ѝp @P_s\sYsVs Ss  9 0P/n'RQ%9Pp@-@ Pf P g`\ NTpGA-P`@XpT@Q00C0V P;@n'p@-X@X`0P000000CS0p00Spp@e'n'e'p@-PH0@TpU@`V P`n'@-@h 0 S000C T DP ,03O@dA T @0@@$gfffn'p@-`@0 Sڌ S  PPT pЁ0S 0 S P0S n'pk'p@-P @80Pp @  0pn'@0@-@ P  Q M@0n' 0 P/ R/n'C-@sP0 U00000@0CMS񟗧,p ` S@P @2@j徼  SV M IUh20S T h`H"H,@P(2V0S' `!p@" p4P)0P 1 + 0: S00`x!`h!x `V'qP4P = 04 V U0S00  vP # 000CS000S Ѝ @{$ T  NPƀ` 0Xe'e''$ H Ge'Gp@-@PPP U0p  x勻p`U |pU  005/HOHpO-`PppW@p  40Ù`ȐȠȰ0S UT  "O   0@  U   T 0S@@ `U $q T ,aX^nHtp@-P  @pp R  pp pp pp  ppn'tHp@-@PpD0 0RPPp03/Ppn'O-@M0 @ 000Pp`@A _`2@ 儲|U  0Sp"p2 0Sd2X" Ѝ@0SD2 R@00CS 0SP P  固PmP pT 0SR PMt0000 S|L1 0R  lp)y B R$ r ` UP c0S  KP  ET0SP 00CS0X00S T0 0 0P_n'pk'$$$lk'Ge'Ge'O-`0@D#DSM@@s` `00 wp 0V 0@D<TRG 0p0sS vS V`p0+S -S  Pz ሢQx PR: wP    PT 0 K@0SA0cЍVW p p01      r  %5S p~ $ 0zp0~ qY0 !pW hP00S0SLzP0ST00ShjT00 D ,ċ%H,lk'pk'HH ,iI$6IIHUIA-PQU 00CSQHq1QL R@ 0r`0CS00 `01L00<S0S  0qL0S 0CS>S0SSxd R 00CS0K0 -  ,wIp@-@}0TP R R R& 1S# 0 }PpR!Q QT " "D0600S0T0S 00S0wo'e'e'$@-0P00 4P0  ~ ЍIq'QA-@ 00CS00 P `ppp C?U U P@U00CS00 `OtA-@`ptPt@0000S 00S p`V@40`00CS000SA e'o'o'e'L0P  A?Q Q R:///o'@- b@0pSM10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 np0 0S" UEomp$ W`RU30@D>T000 0|00  Pt0N R  DTR 60SЍQ Q2 1 @D@o'xl'$n'PO-P@p yP `yP yP 0PEpSUpUX@@&` PPy`Ppl44yyPPEpU]X P$d$t$ 0E0 10ST@ T@P@UT @Pcs1 R 00ST|y@ TL@P@UT ,@,s,Q0S 00S iX@@T`X `Ȣ娲pGY P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP PP :2PP1 ~` a0S\  0E T0 S R0T00 #@1 R 7 U@ ^00CS010S GPx`PP@ᘀPq0S 000T 700CS0t00S @@T00i$I&I$o'utKJUJ`J`e'7dJL$iJSJe'G-PP ?p0@`吐 D0S 00S Eo0D0@000CS00S pW@UGo' o'e'e'p@-H@P02`S@20CSpkV02po',0T0SP/0S//o'C-p@`1010r!Q0@S10C1 ЍqXPU X2ؿTP៸k˿P 0S οo'e'@ 0P/!!R /o'p@-8P\2Sp@xur\Bpo'0-MM 01`"R !R X"R   1 1d"1!d2S 0XPh10 0XP L!0000XP(10  P @T0d`0P0 U @T 0S DP$00CS0 !!k0 0$0(0,00D>S /z00  "!031o'e'e'e' 0@-`"d{o'p@-L@!'Pi PPp0B/U00p,p@-T@TP0 0P0 0 0000CS0p00Spp@讴e'$e'A-p`@PU 0PPEU` XDy0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP0000 000CS0h00S MsDP`0000 0C0lq'e'e'p@-@P@0SH00Spp@00CS00  $0$0$@-@P- ЍJ-@-   Ѝ Ѝ/-@- 0  ЍЍ/$ -p@-p0M, @P(0 0`0CS0a0`10@0DЍp@Ѝ/G-@'` hP$ 0S! hEr0S00CS0>0 "  u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 J,$0R$@-@@$@-0rS1JJ0G-@0 p0R(0帀P0=00>g=`:g`F@V@p@DR000 S=S B`` R`ť` @G|P$|l'$0@- 4@ 00C00 0 0 Ѝ|q'J0P P PR /0@-PP@^ ^ R0L00/.A-鸀' 0S RV'p`@PU pWp0 \ 0S 0S   3/P@P00q'0SeA-@pPlsU p`pp0S'SSP@DAL'fPP(  EA]JKKKO#A-P0`Sp@    3/@PP@X "W p0@=SPUP00 00CS00  0 00CS00 w 0 T 4$XO-A0Sp 00P̀ 0`V S 05b@PU* ЍY   R Q ʁ l <0aP`0 l|q'q'H4r'@ 0R S=R/=R/A-Pp0S=SRpGp'sh0h`!0aU@`T 0S  T?PU``@|q'q'@-1`0@S @  PPV 0 `)  K dh  `C Ѝ@ @q   R <0 2/0`  0R , R  c0a00 0000@!L @UP U0 c00CS0\00S ЍY0#L 00P P $"Ke'|q'e'@-@P= `&P pTpP qpp0  BR = T  `\ Ѝ00@05K-\0GM000 0\TP00$0 0  Gߍe'p@->X@P0`q @0U<x! 0U`00 0p@|q'TKMKgN?B!0-P$M00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ]$Ѝn'[Kn'e'$hk'p@-@`TP000T 00CS0p,00Spp@)@e'e'7@-P@T@ PP0 P00p Ѝ0 xP 0 @ 00000 00P-|q'kKA-Pp` 0   0 @TPUA@ 0@00`q' @-:@P 0S   3/P 00A-P`0@T PP 0    R   2/P @@@ pP =c@@e'O-p@`0QrSP W 100S V'>nP pPW`0I?o2V0S Dp`VD10@T0  ЍOe @0P=S7 P( PW0 00 0  媯`U 0 X  ЍU0 00 U 00S ,W DP,.PPPPꗨn'oKK@-` pj@P@ Ѝ0  R@ PR000 00S x0000    0 @@DT@00S e'*e'A-`pĀ@TP0U0  l 0 R R   0 02/0 l00 0000|q'$$A-p`P@P 0`0PPEPvT` eTp` fTxTp`X #@V Y@Kn'PP@- p aKC-ԑp000P0`-S㬁@TQ 'l@ 0@00`0CS0`10S  Ѝ @P=YbP 0 @0 0  0 00 000000  RP 00 00=S l0T 10=S010C0 PPPe'|q'$$e'  |r'p@-@PTpw@p@-P@`P \حNP@ xP@ IP@"P(P0 P pXKKn'00@/ 0S0@/s@-@r0 0P`r0S r0"S U1r0!l%*0S`0T叭000 @0C?o2R0SЍpTLP%eL@-M@ P ލP@D0 SQH0PP0@-M@ P ލP@D 0RPH0PP0@-M@ yP ލqP0RP 0RPA-@`P13@ 0SC PUA PPPpPJ! 0RA@- 0-RS# 0S0 00t Ѝ0SX0 0P0S00 040,nP$-X..vL-0@-0P!S@M0SPЍ0P{ 0SxPUo U U dPo U P? PPEURTdlL tL  L  L L L 0 @  O  P  P  P  P  P  P P p0St00@T @B0(S0)S 00qop@-@`P(P} 0Sz00CStp        0 H \ x    ( L (noop nPnnP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(Eb0S0!SPpp(S0)S0S pp@-@PmPPEmP.U)  l    0op=Pp0 \0!S0P p(S0)S0S @p߆JyLL@-厫0CL$@-$0$0 00 5e'$L@- @j R1P\0* =ЍYMO-P@,MU0pE `-R lRF 8R -R| P{&@P 2 000J @P &pe pGW` mPpW ````F %RX gPPx8pW3sR RP3pUP`/ RpE@@W1 000 ~PPP@U\&p &P h弪dl㚪X1Dl@P  &@P0S0Sp@~o  i Y0Q 嵪 RP!|0*QP_o RApu`  偪TT{2wq P%iK\MMtM7d$&gMoM0@-DMo0   0@@DPU#@0     P x, pp LdDЍ0=^P "kf'f';->N0$eCN?gBCNhN`0.S0@*S4@YH|<D`$>@0xY0WY BYR +%Yv AY* X0I S&!!!!!!!!"<%L&&"""!&!!!!!&!!!&!&!!&E0IS0Q[  $0'S"S!Z 0S !00吪{[v& t  iTP o f P T! ^d\s00v t 0 | q ċ%]OdOO(OP%Ods'$7 s'O\\0LS,%4%% %$%%%|$|$|$|$|$|$|$|$|$|$|$|$|$$'\ \\ "\ 0 \M 0\? \-@ÕÅe0\fnrtvabXP \X P  \  P\  xi!s v  t 0 0 p{ X0 , 0v < Lߘt  lט0 R0 0D@000  B+ 1H 01 +t v0 t  ti0$0$ [ 0t 0wNVBT,Ѝ3 Ȥf0C- 0`qMP` Pp V@P 0 0pN@PC 0p W ) PuY <YfP0P( 0ES P vG 00S00H lf^YPH0?S0 -S00H0,Ѝ'OPTTTU0UQU P@-  99UU@-0@0 0 \\XPX`Q D ? 0Ѝp@L00 G PUO VVO-Mp:XP0ԑԡԁ0 U@P1 0S. =WPP00  DEc[peP 00 \a8i[LeP 00 4eP &E 0$00SЍl[eP 0 0o[eP 00 eP E 0(0 `Q 0 SeP00CS D0 0 0SP%V)VO/V6V0P  (Q\   R4 0uF03/ЍpD-P_VTA-Pp`@Q`-VPQVdP 000 0 `IdP-V 000p0p@- P@@0P ,pT 80$P< D0TP$ <0<PpQR\S`Tp@-$@P0S 00Ppls'7@-l@PU X% Ѝ0bHP0(0ls'~BOuQ+ 00CS0@-  M0| 0-0 0BQq0^@Q ^ 40 ? 0 C  / /ts'ls'TO-M`pA  Q TP XP tPW `PU m PDoT<†pS Z Y X W@  U PCT<p S @[  Z Y XW   PT7pP  X W P T;%S( < S. &S)  S$ 6 CTy"  W(  * /49>T`P($F$V0S:ЍJS@ThZTcYT^XTY5CTT5CTOTLp5CTGX5@CTB@5 CT=(5 CT8U@T44CT/4CT*4CT%4CxT 4 Cq$ B 0hT 0S`\`TP4@CYT84CRT[KT 4 CDTZ=TY6T1TW*T3C#T3CTx3CTXPL T@3CTW$ TW@T W@S@ S2 CTWT2 CTx2 CT`2CTH2CT02C  0 d 0s @PpЁ0SU gteT   Q  T0녑0t  PH UHtFP pXXXXXXXXXWOXXOYX/W7W6W=Wa r 0 ! 0 0US- !S 13 0U SS0C SIIIIIIIIIIIS 0U  0 lpPd(%hZ6Weddddddeq  eee(e1e:eCeKeSebeO-(Q ,@Q 0QxP Ѝ4QPTPQ@80S,00 80<0S#<0P@PP@P1 QB"=`p㼑弡弱8W0aSq R  <0R P)0< S P0pS:`(]Q (]Q @P0S0 BS `a 0ph R R* \*a x `0(S0<le{eeeeefs'Rfff ge$ffQgO-;$M `*RP 0$S  ߍS ?p@Ġp$ˌl@ p뉔ᨛሄ 0W YX$ $ f Pf/jX,"RQ 1RR ̑!,"!R Q1P P @p0 0ꈑ|1P#>0  P," R,7 P 0 <`#>0 /r Q* R 0`jM P R 0 `!Rw j(  1S jD f/jPX01P P%Di y's'wggVEW}}ngWEVq gh/hZh\u'(%A-P@`,Pp5S$ Pv $0f0Q h/%R 0R00000( s'y'zhs'p@-0@P  P$p@Q 0@- 0S, Ps'@-P  s'O-@-: PkCM M00 p*8,P 8IP008 800SP : MP  @00t 0hS [P,X <(W(0 0 $ P P:HHἂY9 0  $0P$0S ɿ$02 [P,唙唩$ [ 0S$00 $ P$00  P$00  P$00$0 喿@ [P丟$& $ :P($0S  S;ƑZ}0;s 00 0P$ 1\  dk@  Y= 0SX8 0 S(0(0 0V[P g) L[P  C[ P00 $0fP$0S ++RP0  0,$ t([ P 00 $0KP$0T0 8[ P 00 $0;P$0`0 [ P 00 $0+P$0X0 Z P 00 $0P$0\0 ZP tZP 0 0$0 P$0d0 4ZP  50 $0P$07 Z P 50 $0P$07 Z P @50 $0P$07 r |Z P 50 $0P$07o b @Z P 00 $0P$0x0_ R Z P 00 $0P$0|0O B80 aHy0S0S g_0Y: Y0 l*2 0TPSH )H 2 0S0> 80 0S 8@pCލ Ѝ30"0 00 00S D 0X  RQ<0 %P04\  BB! X 0S 0 0SO 0Cs RSL\(RL\(R(R](RL\(R(R\(R(R(R(RL\ ۊ 0 0 R0 00S 0 J0  d2000"0$0 0 0 $0P |@$0!S 帽嶽0$0$ 2 N 0S P E 0$S Yv: 0 S Pl 0 0$S Y& 0S[y 0 Sq PP  0$Sh XE s'h#dbm]h(xxyhhs'iihYs'Zxs';iHi\iji{iiiiiiiiiij&js'a^P%Gjvjs@-`0PU V  PV@P h%Ѝp`PD!T 003G0@݊V^j`?$00S O@-[00T$p@-@5S4 0PSP p@WPp 0S 5S 1S .,|Pp5S T \Pp< HPp*(( Pp,s's'QjedArdAjs@- 1 AP(000( ;ge V( 4 5S P}[0S y[0S 005S  PW0P(5S `ЍpT TkPH`0bPWEVs'fdjmdkT$pas'gd k@-@P f/S@s' 0 DT$y'md0P:/ 0#-3@-PP ?P 0S S@@ rP@Ѝ0@ Ѝ/Б%p@-4@4PQ p@`: 7 @\$qq@-t@t0MQh  `P0cS CS SS 4sS00ۍ0ꈙ'}~qq@-\@\0MQP  HP 0nS yS0 $坉00ۍ舙'Poqr0@-MM@` PP 00YSP ,ۍЍ0OP r0rBr 0 l\y'(%@-@M0 XP ۍPrW@-$ $0 ЍK\u'(%\y'{@-YMM@p ip\2YލЍ<0< S <f%Pژ10YS<0<0rdAdr}rr@-*0gj zgzz'z'&z'z{zgzzz { Ѝ5r7@-P0@ 0$S0S ?0S7 TQ,BQQ, Q.10S 8@0 U0000! Ѝ0C0ASgfff0P z ` 0P 0P: 0Pp@~p@ 0x@dp@xrU@@~Pptcidyararbmngnts\MFOP0 P-  #B%B$14!8<䘝'p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @ꘝ'0"!#/P/'A-PT0p(,`\L@XL,0T@@DA??@@@蘝'?0@-<@< (20,20JP0  P*0 002蘝'> 0R//G-`0(,Bp  PJ EL@PP6W ,20CS(20CS G'0蘝'p@-@`42SM%^  E@ 82<" 0 (2,"Ѝp@}<"82El@`},"(2H0X"\4Ѝp@ꘝ'$ˈ *s@-P`N  00SЍp00S@~N0"S1Ds@-,Mq$QJ00 $ 0 0:q 9%A-`0x @TʴP Ϡ#p 0d  ? hFqp  RЍAL`0S`@D@,F Ѝ$̌'@-`  ppPp@0h Ѝ!$LR@ @dQRQ @6U'p@-4@P0S( M0B1p蘝'O--ʇߍ@ hhQS/2SrW#,X p` 0 ಟ00 D 0`p6W0 002Rp`", p p< T"QP20H"H  0( 1 RS Q0S!Q10! p12S  ?01P' !Qt10p8!?l012S02S 0 0S>0)S Z0)S  "Q  R  Q !P00 0D0<   0S<(ꘝ' mq !$>MbVđʐ U.~I؎Ghq@-tM4rW@Pp@lЍ@P(0P`  B1 @  $SЍ@\ X1 S1 0P(K1 F11< 0=1 81 ?0211< 0`)1 P$1 @?0Ѝ@ꘝ'pq  2EVhyO--蒓Y`:X& "!R &/ .0 1  Y 32 $4(5, Y \   Q R ` H2,0L2000&0S, 1S) D, W000P0  00SW0!14!8!<!14!8!<W0,p0`\T (`0 S( 21S$ / .0040 81 <W , S  PW 32 $4(5, W0\,0000P`$p 0 0$000P ptS 0 S00$000P P LWT $0P0 E 0S pc 0S 0s X2 0 RS  $0@DoO@((0 F 4 0 8 0%4 0%80 %< 00p P0 @2S` RU 0`BPX 0 1<Ap 0PP,2`0C 00PPM(2p? 00`PP pp0`Fa ??`1`<A` 0PP,2`0C 00PP(200PP? `Fa?`?`` 0S\ 2S@X @TVJ041S 'pΒq '[O' DWfwC-LBp42MgS4tsP,r,b42S 0PCU42S 0S [sPԁԑ 42RSgP:Ls42S^1!$1(1,ЍC0S dSp t04rdW2S |0`~p 0kPl"R Sb0SЍCr@D\ 0ЍCSPJ 0Ѝ蘝''.֓Pis@-0@M0@ pp`Pp¼ߍ\ <0  0 P \ Ct02S 0S " ` PD!SR 0Pꔏ6'0@-Xa0 0LAP d2S8 P(|!p! 2SP0U  $pt"` Rp\EU$pR0 00P d2SP P@B Ѝ0P0!!1 $'mdk'ߔ'A-@T2 @P`@P [@P V@P@ `p@T 00S p`V@A@PD00S @@4@@P6M{u'$A-Pp`Y @6 3 000 0@@@@-@`TP >p> m 0@$ @ Ѝ @DO-MM p4 P@T\D ?P @ <?P44 00(04QT(0 ,0 4@ 0#0@,0S @@((@`@,0s0000CP匃0P@PP0 l!41P430 (3Q,#  $ s4T0> r>p@: PE ,0S , <(00S<(00@1 $:P1'0FSʆ`P0S -S@= J1P00 @@P,0S ,܍ЍA0  /P 4?8800  R0 R00S' \,10PAPQPa400C0 CA0S0SA0S0S C 0S C ⶺCⱺC⬺$0#p t PS<(0  Pע'q 7u=xP{u$o̪+~0/'0/'0/'-@-$@  P 8뀒%G-P`pA@0S  0S X pU `Y 0S c0S Y Ѝ'I`-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @PPݍ Ѝl!rp@P=0LLD@rO7P,0: S0RP0 00PPP81: S`P% S  R  rPPp PPPU r,PP @P'K?'ON^x@-P 000, ,$Ѝ  {곬'¬0@-4S 3/ '@-@0 @(@ 0$F1z@@D'@-t@@=9161j@@@-p PL`@@0 7/P0 S Ѝ =00'O--:M6M@  @  @ P0 0e PH @ `PMF 0S=f vY 0R R0 p 0 0X@OepT 0S" P%5 uP吅eU \ 0PP0HH @ލЍ03/0P0  LP⺸P@p  0S0SW SW hP0:0O.: ; p` H p ; 40@0Z0C @ `V)` 0  0 0!000`0`00 Z!   00 +0 07P0 0S `q<Pl Z F@P ZH Yp Z\I0S< e So Sl pWp 0S 0SS  @W 000 !0>0S# 0S,aQ/00CS0".@ T 00CS0!$ P @YT Y@DOoB 0Q  } @OoB` 0 @0  0 0 SNT'Б%(%oP0@-M 03s0|c00@SdM 0SPP RPP d 00Uh `Ѝ0S 0S @  0S\0Sl\  0/.@ \0Sp 0@u0 @Vkp 0S0Sl @\0S~l  @"  @0Shll @D <P@ @0 @ `0x P|"%   T    P  @@``; 0 @` 0G H D'''ڮ4Yeԯ!G-0@  0P 0S< 0  Q*p  PPxi   0`P Tu !URQ ,T l <0 p H0 0W40p P > u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0pP  P 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`|-0, 3$.0 (/0,8 001 42 00$4 `0400 QP  `Ѝ  8 0P P y`P1S1S1US1S 3S3S3US3S, L D`P0`$ `03 0(3 1 31300`0@400 QP    ʿ 0P`00S !14!8!<<0!14!8!<@040  0440  QP , 彿 0PA0O A0  P 45 ࡟ 0R  , eYomkXpW P0EO8 07#;;S`TXD $ R,0T T0,0T0 RC08D0P 2L0#1\0\0Q 0P 0L0 0#00P 0L0Pdd@H`zڰ"ARRaArrAaUE\|Ա(P@-p@`P P00 P0^3 00QP  Ѝ 0P< !@ !0 P0@3 00QP 4 о0PE7@-@P L0 R0!0!0%^l00l0 ~p00p0 Ѝ0^ P ^3# ~\ L ~H00L 4H ,PP000AòG-XP p` !P 3 Ѝ00$H 02QP D" RX0 }X0 P%O-@,M0p@l@$0`P P " pP  $)Ph/:$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p 0 0,Ѝ8(y L0 Q$2 q(@,"  P "  @P*"*  P0P S "!"0  0P@P $3 8zX˳ P r0 r// /ӳ׳O-`P@M䱟䡟0P0S Ѝ p W 0G s 0C0A s 0 0 q s w qpp d\P0P@ 0 `P 0 00 P 0 00` P0A s0 ` P pP0 0 P` P .޳ABTgϴJ_R0/0@- PBU02S0P^0A-p`|Pz@P  PpP P0R*"R0R0ꭵO-0p` P\PPX Ѝ$P  qQ 0 0Q\@T(2 R@0 PQ SC0 BTX t0D s   0 TX Q  0 0 n x P [ P J BPTQ2P PEȵDvO-X`0pM@PP`Ѝ 70Yl0L 02 R0 r00 P䑟P#б 0 STR rH 0/BP 0  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX0 )"0# 0/0 QP 0 oPO-@`Pp㤡失P0S00S <q.p@q8WO$0S  0S 0S,0 ( 0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0ɶA6@-?`XP\@#@3P@T@TpW @@T`L'O-P@H@M18 00TP0S<0T D0S Ѝ1@ 00 `p0Ds#p w0 0 0 / QP 忺P 0X:0 0 0. QP PLH  冺P<0T 0B'zaO-M@L0Sp<`@DH SP PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:ꔷ'@- @/px0%B?kP0S I20FS `C $/p@@0T Ѝ?  C0'0 PK %/'O--` 1aMV  0. SP0 S@0P`(0<@@0$0 00@,D0$ R! X0p1#r380#8  ,09.80, QP r0P@0`(0<`@0$0 00` p0C##   ԹPW  q240pGDD04 SD00S   408 2400 0,0-80, QP (100  RR R0(100@0D0 p0D0G >\ "T*P2  (1 0(11 J    0 0B0 @0Paߍ0@ S100S  S:I@(1  0I0@;+ | P(10(10@0 00 0Sa 0@ J /o<0(0"s R`$ 00P `, 0 50(0 0$00 0<0S<0! 0C<0 0< 㓲#P0P 0 P P :P R:x U 0`$00`P1Sh L U50$00`P^(<\Q U`V  $   P`$ PK/T4 `0p!P0hgQ P P0S*0`Q`  0' U$0 0 `H0i P H0 00  P@`  Q . A0  L L  @G?LL0CS \Q*V L0!st!0<80t10Vx1 , m,000(00UTX0$ V0 0  T$0H 0$00L0 00  @Vt 0 S1S IpQx1PPt!hR T80P PPL0sPPt!30It1@tQUP0U*0" 00 0p x1S TP@ 0I 0000@x1d`E1PP 1t!R1 8$PP 1@A03 s0Ps (0RZ U 0`$00`PR1 SR`1P0S 0S Tw[R P0S02S 0S0S 02ST] TXt! ;pQP @PP 00I@P sT B t1HH 8P$P PPPPPPL0Is0PP@x1K@I$`0P=PU `t1VS P@ ta``L0Is``@P !SP `PPO 0 1t10t1#40L0s]?000w10PP4@ K/T,PP05P1U U0@Ih00h0tP0U*0RPd0x1ST0x!(P %4xQP0%8%\0 P0PEd0U03:T(y P Pt!dx1Zb" :0 0t12P0P`, 4 娶40PI!2S0P0 S0 U 0 P$0[00$000  @ D00S8 0 ,0*80, QP40 R80 kPI 5P0e'az!HO֭Y'xָ˳Q+Hjչ0G^C-P0@2SdaPX pP, ЍP K/2D00 8QP0Q:" 0PS00  Q puxPh`P 80"8 R 00 05 !${'ĺ )]p@-@5%SQ% 5 %SPR UUQQp  0Q Q0'A-lP`5p@ @ 0% Ņ~@ŕ\'O-POMp0P> b5S5夢05ET0  .P05 ET `T 5d 05 !dP 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0) JQP d <d0P Eh0K/0h0 10 @!3,qr0d  01(*  j 0  0,10,1#40L0sK?000/1001001#40>000310 00 000T0 C:)(%,5QP Hd ˴d0P{ '"D'+@-@ P 0 5'0/'0/'0/'-@-$@   ㇒_뀒%G-P`p0@0S  0S X U `Y 0S 0S  (Ѝ'I`-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-@M Mq` @埵Pݍ Ѝl!r6p@P=0LLD@rO↵P,0: S0RP0 00UPPiP81: S`P% S  R  riPPpPPPU r{PP @P'K?'ON^x@-P 000, ,$Ѝ  곬'¬0@-4S 3/ /'@-/0 @(㏳ 0$ /@'@-/@=-  /@O-PMM`@pPP0 P: S3/GP 0rS /00P 0#0@0@uz@ U  ,P  嶴P PU y/00@23MP@ S @V``帰张围`P60: S)^0"=DP@PTⴴP V+ S R"<P-P U nT.@\ SP@`-\ P@ `UPXp%t!0#8PU00`00  @P  iP.0S`X PPtTh0 OPLJPP W80% ܍ЍU] FkF F@0/p/p@-P@! $( $(0XRX0X00\00`0ddhhllppttpp@-@ P DD@@HHLLPPTTXX\~`\`0p Qp` 'P0@ S p@-0@"!Rc0p@-@PpA-0@PJ04S->C{->C?Xj9>:>Ce?n:>CF` 0? AC>W}C>GRmFNEnFJE~GFX J.X R  $$((,S>,&}S>G!mFHHLLPPTTXX\\O-@  $$((,,0P04 40TQȑ\5 S L5sT 0K TTXXp\\``ddh~h`lzlpwptttxqx 1[ hepb`0 `$Q*\5 S   0S&P%@ PSزK 0CA0Q R,2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P@ `$P`P600@AO-HMQM $#0@2`0F/ Ϡ _ 0#Q%P(,PDr 04P,`P `(0, 0S_(0,PۍЍ10S&  1pVW03?00?s0?0P 0 0(0, 0S_S(0,P0```00@@Q"R0  P 0 00 @Є0 03/`)  0 0 0 0  000 0C  0|* 0 h0k40S %0 0t ''('H'T'L'('P'@-P@p`AMM(0$L 㐹0 P@ 73U0:t0 R0*d $@>0P 40  P,, #AލЍ4'd'7@-0 Ѝ0@-\M`PpX @ '0H0T0 `'!D0DP Rp9RLt4Pm\ЍPD'PA-`:L`p`P#3RP3R#\@A'O-M`@ ) P0E: 0 0@40P$? 0 362Ԓ2Q p{ q Br sQ0<30<420S0 sH2pQ 04  0R  @P-( 0 1ȱ r0 4 Y: 10S0<00D0`+2 `0Ѝ 0 1 020S 20S 0J` `$110010S p1p1000 ppmT'T'$ 'H'D'O-@PGMM X `%pS:0 5 R"0tSb 0S! 000S_DT00 1000u 0{5 H0\00`0Q4p0Qdth " 8"0S/ | L000 0Pt HP% 4$0000S T0  0O.P3GލЍ.P3 09"0K 0 ; @p  0 0S ㍷s$  P1 $" i.P Ѐ䢟 L000[0 H  t 00`02  0J0  0004r00STP2r0"0H000H0H 0p 0 S 0 RC 3#004 S 0040P! Ti 04  0. 00  c  0 0%000C00 S J8   0 0001   ps0000 l0 s!0vs  0 00S ʶd''D''$tTp'8\'1Co'tG-P`E@pXpAZ x10S l10S 00 0L P4ЍG!@PEU< 1 RP0H 0  P !`' Hશ0S"00S U ^ 0S =S0S GprpЍGVX3-P H0 ЍU''' '$d'6LX\'0/p@-LP@088200@ 00 %/0@0 #p'00S/p/T' 00S/T' 00S/oT'P000R0S /O-`@$"P0 SMf0SD S0_졟ď080T C/ S ! R 0C00 0@ἰ? 0tp\5`!S 0 00Ϯ0 ?@U '  ϬR 7 R  0ߵ \5S0 0/070/0 0 ʵЍ P L R  H0ḵ0 0400ᱵ'''jTPO-0`P:1 R0* 0됑吡0 pP3Qx 0 V0A:0 R@/<#\%@ 1R  0 ?>#‚ @ 05` @ 0`<0@0S   0 .0x@0 1!0x 0000(00S'''T'D'O-hCM0 R S ! R0* 0(Y 0:3 `0   p/<#\\%p2R  0 ?>#‚ Ppx 0`0 C c00d0Ppc C c a$5bSWQ,040(0ÿ 08I,10SC 180X @p0!X (u! RKK/W08:‰ W2p P| XG 08p,80<00<0S<00<0ЍGGGG`G W  R0 K R R'('T8'0'D'p'L'4'G-1P 0p` 0  070@ 0S 0 0 80PS `P` 8UH0ZP000PSj`4Q$,$ (,`(P|P8'K'D'p@-@8P Z080'G-P`0pS100 B?I P@P 0@8@Pt1 ?`10pA0 G   000 0 0 Z` `1 `#"p(,0(pV Zp`0PQ(d(0S\1@@ 0XP\   0^P0d000 AD''l'x'h'd't'P0p@- P?@8800P 0 _!SRpl'x'p@-X`0SpL0LP@1D@A0S婵姵000p䡵x'd't' 00 /'O-H0MSP` M 003/ ލ Ѝ40 pP䣟00 +0H00@0 t0 /  S 0V 00X0t3!0S& d30SfS t0  " 0  0励00Z0 02\+ 2R720t0S22 Q o   Zh"$K$+PH"42 R{! {  ! t R1 +졟W000e1 Q5 10000S1H  B/oQ" RK h!B0   +BLD)P: !P R, P N 10S0Q 10S 03/     0P  0p`V0 ,','D'4'n\' X'0O-S0P0 0㘄RM`#V@M(, : SH \p(5R<R  P  RSV !0 ,P0 PB?0`s0 0S0 0000 0Ze 85w @5D0LT 0 b32 RP U`P80 00S 00`PPƯ RF 0 0G  0 #30t ?:#b 0PU p0Y0Ph0SM  iV a08001(P Y 03/ RލЍ}0 1TP+U000H R00S 0 0G n*GM'PR0@S P\M T0  PD''p'\' X'@@-@{!SP80< S0 80<  D :p@-@@PU D P XP$0 Q0: pp'@0@-P@80\U< S0 80< 00p@-P@ 0U0p81 R0p8@q0P0S 0Sp붤P0Sp ZU00S LtM0S 0TD0S(-p@,9?'H'D'4P'IYd@-p@`MWP 1  P  sp`V' L 00S0H0S 0 0 $,00Stt, r?)00Ѝ@L&P0S 00`Ѝd'\'n'D'''y\'0@-@PM \" ㈯)Q Q0 $0ASЍ000O-P5,Mp0 /@P`0 T00: SR) 0Ḱ0 l倡 R09:` V `3 V `!ᴰP@P(0S @P(0`S @P0!0$0 0S:R 030  `(`\Ő 0\"  ? 夣 ? '0刳 0Sp30m Sm `3 R #R Dr83 R R( 3  R0\ 0㵯 0 " 00C 0L40S$40 0C$0嘂*2c)l20S  0 : S( S,  Sg000 00r ( +2p ZL *|0M0`S 1 00l10800S0X0 QZ0Tˏ @ 0`; K F!000S00S 0C&  ,ЍJ*)P( d  0 Tˏ @ 0`; 뫴 h|'''`'T'0'T'U ('P'D''H'O-2@ 0lMp` 0P#\P  ? 嘒 ? &0 p2p0S0 S 0T"S 3S <o@X $20p`c2 RpR\tR`Xd   X 1 R, h3'00X0S  0 0 %*L!00ST06 0 !S0\ 0㵿 0 " 00 04$0L4R0@ 0$*0g0(0S <P88 P& PlЍSr  m'|'T'0'T'U D''''('P'O-`|2t2PU@"0U0 ZPp0 0 Ѝb0 Ϡ˿S g4G@ WVLQ TVgU A 0 &00100 @0  @T`T0p HT Q 0@`J @Q `  T 0D0 0!닁 0 %P 0 |0 r`0@S 0 000h000 %[P00U0'D'O-P-,,Mp$WWhs`p0 00`?00S iA3@30000]T Wk L @00: @TT00T S @@S  T 0  0 01 *0PV pP 2 000`?0p20SA 뉑 0 04 Y@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0Ylh# W *$p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 ]P  ,ЍD''/O@-} P%s@-@P `0S 0S 0 ЍpO-EM` MP0S 0S PpP P 0SPލ Ѝ000S  wP b0S 0S 0S A0Sb 0Sxp 0SdW0SP0S 0S0 0$d sS80!"70  0 " " 0D@!8!? 0 0 0d!! 0~0 hpP 0SR "04 0 R0  0"> 0, ß0S9)(0, 40A8?S%#pR [0" |Ъ0S l˪hbPUt ㄪ@0S HDb@PUn y,巪0SP@PPDP\H0S  `QCn* lcxl%|0S l9l60p00S0P0(% 0,0UA:000S 0S P H1 H0S 0S,0S nP  P   000(㵜PP 0SțP OP JPP P'8Od -Rq 4;ho'!KuO-H0@Sp`M W0R0: 0P 0 H"p`6<"0 S0 X20SW FЍP 䱟䑟  BR 0S#/  !.V  R.. P x!`T  R0 H  yP  @@" 8 < P8 <`ũP0H P 0 2$ا RP `  ^ V UV U 0''$'''\''00S/p/T'00S/0/T' 00S/T'O-M,Mp% @"<:$Z 0 0`SCZ ` pP# 0`VP!00 0؍,Ѝ0 (P  X0`VPh0S  0` [\ P  _0S, 44~ $; [+Z054%00! ?0S S00:00/0S 0 S00 :0V00#03  R00S :0S;  0p Ȩ6h: 0S RT gP 0@4[< S04`?0: :R00n0 B?qQP%90S  0 吨 0 0 T 0/P0 90S, @P$0  ZP00 0 S_8Q<80S8 0 V0;R02*h0S/ 8((d0 #0 (P K`80S (00 0(00h 0`8  @((70S 0h0!7'(5SZ/V U:'<V  3 #P  RISQ; !0D 8 U0$000(p g0 U(7PP0}X 0Z~uP] 8'000w0pPP6'~Pk"h0S0P%Q_!1Q 0PQ^100 U0 EPP P00t @?1#R 10S0B0 P 噧 Z$0S 10000S l50S $0S 00 P0|yt ?y$Q  40S $0S  ^ Qc 04 0 S0 0 0 0000 0L$000 0 #600S,40S P4 PP  z@ p t 3RpRLtRPXd00H00SS1 0S l30S* \P00  0(+$P 2 +2 0\00Q&&:0 @000S428P040Qd/<05#fP8`PT'ML'8'T'eyp''''@'|'8W O-p<6`U`00S 00p@30PpL\$\5S0Q%0# PD ?0  $40S40E SE 4 `V0`@0x@S b d0, 0 0030SC 30S? 0 S( 3 S? T!. 0 / s\@T`  Ϡ5  0S  Fs0 S\000 T @T`VT0? @`1020兑A0^ 1QS  0\J 0P0 8@0 ^0 00Y 0?* 0  000VT !pW ` @p \W@ V00!03S%Q@1:0Q@0a p0  00  P F0 TS YQ! 00  `P Q00*  B `|''T$'n'',''0'T'D''%''U `'/0'SO-` @ 0Mp̰̐ 0 0  BRЍ PP U QP g` {{@ pQ RP Q @pH''0/O-plMX 0P`X0D1D0@1@ <1 0,0SlЍ0S d0,@P0 @兤00@԰ 0D Rp`T0!:<P 0 AQpR Q\tR ` R @Pԅ'''H'%T'D' 0000@/00S/p/T'00S/0/T' 00S/T'O-9M`PV`@@M90S 0P )S0*`00#0.倉Y xPpP 0 WP H)D P<9p`0S 0S )P00 8 #R0밸p0,S00000% 8 001?1#0"v    0P@plrhja00C0Z z100S 0y  P 0sQ0 S$ 0S x'L0X0PL7|`z:0,S00000 7 001?1&p)0pp00ppP*0S  `Pg 0 1p`_pTP[ @p` xp] V80< 0 80< 0@0C0ş 0 00R.*0S  P  0" RVލЍ0S 80< 080H5 0< S 4>0 00$001  aP 0S 80< 0804 0< S >0 00$S! Br ` yp qP 80< 0 80< e00C0@(80P<.\SP# .P #PXPP3P`080<C@3 Q035;:,pW P0Sp\\/&0AS񟗮ꈐ<S3 0020S04000aP x2 J#R0 200MP028 0 05#R0mQ" 0S0S@ 0/Pp  : S000 !0 #R0 Q   0lFQF?\!\  ,10 S$ D=#R0 š!ʡ0S  0R 1 0 0U0p0P``000C0WPpv ! D'L''H'Qh\' T'j7C'''7AL[O-MM@0AS񟗀꼓L\Lh3 dP T7 t@& <}P $7 00n@0  6hP 60S 60̆V6 X  0h06`$00嘦100V3:6 Rpttt0S.`@aViPVoݍЍ( &P"P   5m 0S a @ FL1 00 @00@(0S Shhu`%p (P* 4 0  B, ! _50SW 00(000_/0q 0S <p(0Gm 0(SF jpQ(Ag,xu d4p0(S9@0W78U,0 S1 #0 R( S000000W!"!#4Wl/ px3  (  _/& $ ,0 S1 #0 R S)R ) *V { { x0 S( R ,  "2 pR)@ W(,`0@' aV!W#Wl p d aV @0 (0S $ 0 s00Q P0S"0`10S x10!a!00C0!U P0 }00000C0!" pm0S@0 0 0C0 00@w\'H'd't'x''('lh%D' '',LT'X'R0/O-ؒ؂PԢ1EPMQ@Tߍ0S  d`@EDAF@Dp0 pp`S00@   B 0    S$"[ "[ "[S[ P0:000S 1a  1R R@0 S 00"P P100C84P X   X !  Q ph0RbT0 jQ\tR c` 8h00!P^ p00& }000d't''%'''''TD'T'TO-0p(4弰 ` @$M?wP \P  ? ̳ ? 0 q30S30W SW 0 S 3 S p9@ 002 P00 00CSFTY! P 80R0L003030 000?%` a2! Q,S Q0B*i2x20S =P9 PDB P$ЍS   APw?00 1>!W 00S>>0Q#b ! RQ 3 T0 0 S`0?000 ?S  R.. 0" !00S0H0S 0 04040c/0 $" 80QT $0 0$0404 L3 0  ^\ {0{< 0tPp1'|'T'0'T'U ('P'$'''00S/0/T'O-plMX ` t2t0pB0,0SlЍXR0S  d0,`/0  `d000P㸀@ᇡ 0D RpT07:`1 ARpR\tR`Xd00X00@SH4إ`V %P 10S  0刜@PZP 00S  00S  RQ {{00͞ x40R! 0 P  H 08T'''%`'D''Bl O--oMM@P00  0t2|?0SX0S $5SX0SYLPZX0S $XnS X Rg ?`0V\2 PT20! X" \" Bl 1\"T000B`X$dPڀ0A^000h21`l2\B1d2>V2d20C:=SLq QT20B  0S 0 L$5T> *w4>%(>0S KH0 0S0$5  B11  !`0P00B1- 00 S$ $|0S$  봀 -0⃀Ḁ$1BP`R!B@ LPP  f| 8PN 08S  <P| *堀<<0S 0 0/X0bA?:d<5A?T0 =80T0.H0 ;0VHQ RX0`0@ <08 84<ϡP b8{ S X,0 Sh?^ <oPC <;0S < A>+<B<  CP:"  <0\ 0 0009J*|:7p:0S ]Z0 0؍ߍ0800~8``!.Q  R  `0" ti0S @d,p  0@ @@ p00 ,y+1#\Q  0 T ?䘟 0lhS90x Sx 80S 0(S 3S |0S 0 080S 8 0S<(0 00( 0X $8D80/˃2#\%R  `  0 ?d h pB2 `b7"<6+?D "@ D @ 08L<PLRP$ͱ 7`V=S؈<0D 2L0VpC p,00C S=SxszS   +1#\Q  0分h ?gY `680S <jP#50h s(60S K0%\Q\u5P50 S5550/˃2#\%R  `  0 ?d h pB2 `b7"<6n @ S>p@0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//D'O-4`@MT 唴qy+|] :ltl0_ 0 @P @Ѝp\ZP 0S0 40S40S + ?g: s0P0t Pp \2P3#0S #S7| P p0S d-0 CS kD*0S `0\%R##\%\5"0C?o"20Lph0 S 0X24/R%Pd >(2 ? :010SA, A!,Ÿ0#\ P  0 R ? 0SR0S 0ȡh  0S 0|\%Rt!\%P l10S%\|XQ% L!0 0@! 0 * 0S 0 0 0@0@ .PhpJp0p 0 0U* 0R A t'X'G('8'0''''l'F_T''8 @'TD'u'''P'x'|'<'O-@9*@0MM08x`̄P ȕ БލЍ80S d:P|岕 p庑 0: S T XP@888X04HSP 0)00S  囑00 7 7 8    8@ p8 [WppTpPpT7WL >P 7@T P  wH8P 00G 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p(hp2S )P )P ).U4PZN-`Y 4[ 0S0;<관X| V.+0b  5 0,P %Q$ f Q춝C ?2jP`u 2S<4$040404尐X02P#W20AT2@02 r0G  0l H  ?p0l3& 8 S20#"20#205P` 2Sd#0P\@Q=S00P 5@ ) 2RT0 S @x0S !C 5*< 53 30S 0 0@20S 0!|3 0 S@ T 10Sd"d2QXe 0D_3 @ 夂=C2t,00000 @DO#ʁ0N$0 @@S葟0S0S0=S0S p)80009 p 0L%000P%X30,*q  *q 10S FC0 0<'d'bh'ul''X' '''<T'X'u 7ZTG`"T 2'b]H]nCyf4p'tW{h'SP' H'L'D't'('P'7|''$'`'p''l'd'h't'x'-8'0''4'T'\'=S%0S& <0 p0P%<<00*X300 00S 0 00S5 0 >0S XPLq 5*N> 0:#: 5p1h $10S 0 000S(4P0q0*1H 10S nk0 00<cQdkP 0`r<0*zp2( $20S NK0 00S0L%r0L%r0H00q" P 000cH00SP8P$s*I4320S 0`# 0 00L40q"  400cL00SPs*!330S 0$ 0 0t4pW. 4E ^  \pWR 0SPt*4T40S 0$ 0 0t0Q,%R0%45S R! lg004E0S|PP*`5l50S 0% 0 00(0Si xQ$ >0Sx < 0(%0S^,P*6@50S fc0<& 0 08%<5HSR$  H00850<S6SP*d6|60S 850& 0 0@%D5LSR$ t L00@50DS%Pp*67470S  0' 0 0 7 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*880S 0) 0 0T PYd P4TQڨ0QXڌ U 0 0S Py*9Z\90S }0) 0 00S3 6 z)0S0QQ*P #0 0Sl iP`z*zp:($:0S NK0* 0 0 K)0S E)0S  ?)0S0+ Q^ NQ L -)0SQLd ')0S{v<Q )0S )0S )0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0*p<$<0S 0, 0 0<0S <0S(L*<<0S 0 ]h < < PRL PM\= 0S@ lPL \ ` [pd娭@PUWʸ- 0 ?001>0G.P6  6,P0>P<) 3D^ S;L.00 0 S 05|>> >ӌ>p͌WP>ppY@>@$00PEUP8HLd  BL 0b03",P P Y) T?0S   p?8 H4L0d P B b"30 E?0S   0`00p] P?{ 寏\6PP ^0D& 5000460S 1S  P  6 6 @ᘤQ U @ 0`P @@ 048 ,5P l50S p>lP 0 0 B ``0  0 04 8 P 씟 $0S_mP`0 4?s0 S 0Sc\Pd0 4?s0S `p0SfDKPg0 4?s0V:QQ  /Q R 0Sd0Pe000N 4000 Py c0ScPd0 0 0ip '0S 00 0 0 00$  &0S 0 0 000  0&0S 0  0000 0  0l&0S ``v0`#40  0  0`q&0S 0@000  0 1 1Q1Q,+ 0S A 5< 0 !00|!@0t!0 pCSq #0p R0 !40Bs00WP ĉ`@f0PUP0Qo R E/ !0!Y pG  ]|'P'h'p'X''8'LBALzh' O' '^'`''\'q Wtx00S q: S  S :C / S : S 0P/@-\T''1A-0`S lh&@ T L10S@10S0<(1 10ST00S +p@$00CS0ᱳpP U 00CS0᧳ P PYU ɈYU0 P0  0 0 SNU' '4'(''1Б%(%@-HP 垈 $* PЍ';O-p,1 p$1p 100 =P0 pp/P 0P  ppPPQP( @ PT`00 WT V p pXP @@ 00'''O'''O-@-1$M0P Ϡ,"4`H   0帄 P p 0 @v ,ZP$ U  0 mpP$Ѝ?0 0 ?   叄 P 0ݾ 00?QR0 0#Ϡ?0 8p0P!X'kpT'4O-- M0P8`А:Pp/2#V F[ 0 Ѝ 0|@[ ЍO蠇 ?   )P } ? ч0@pX' '4A-P`U@ ,1f UP0 PP0 0T3`p+0 L@D0T@S    8HĒL d  B 0b<3l@"z0 S  0P00`0@TЍX'q (''T'4' 0S/A-@p d`V F0 fP2Qf00 SR P00@00 0` PЍ''4'8'@-0P0@T@T5d pL `l0p `̠V W @00 0 0 0P00@@000 Ѝ'' p@-`P@XMX  p `P @XЍp0@-S H0@S  BT00S H#0044,P00' O,4p@-<`# $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍTs'0'T'\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,'TPC-<40S 0$0,DP$440S0 40S, T0SB 3`3 30S@=S= S*330S 0P 0W`dSTSPsyPUU00Q A P 0S ??@gZXP`"hR0"00S7 lr002Pb0S) x50S) 0R0E>0*X4 2920S _\0 00SY!YP10S M! 1XQ d1*_\1 P10S 300 0P10S D,! 01P 0*>000S 0 000S d0$ 0 \k (0 v ЍCv ЍL'\'4'8'('<'t'''X'D'P'T'''' ''$x'J@'|'c''}O-PPMp80S#C \/ " / Q @aV``  [ΑYP ᦺd \P  ?8 , ? ~0 c2r0S0` S` 0!S 3S  0P? 0!0! !0!S`0 0 0` U\/0ϬL3 80S30Ð0C03` 0S300CÀQ"0 0P*S00S (`$ ` `Ѝ kS  $0 0C$040S 4 $ P@ P V''$'T|''0'T'U '('P'A-Pph0``ATR i@P<L0S @ 1p0A\'80 0 1S/ 0S/\'\0 5< ÒH0\ Ò3S\ Ò3S\///'^FPO-0(P,0@4p8`. P P0P` 0S 0 S   000 00 00S 0 S L0 w0    p p''`'Q/0/O-@8`堠 眰P8Q ЍP p Q0p8pQቐሀ@X4`0S  \ H P/100s P000sB00s @-ؼ`0S4  o/0! 2/B1   P"/ @-`0S00/1000/0B10B1/101/ @-`0S`D(00/1000/0B10B1/101/ @-bG-p$Q  l$Ph!Rr lR`Π|S p  $@Z!T P*B\  @@Q ! L@Q% LX R @T @ pW   PP AO-RMPhb  ߿@P D囿@4 TPpߍP(  tpp0S g<08 (00,0 000040!04 04$0D0(0 P dVph lop 0  DVU 8U ,U  U |U 9tp 3tp < u sp 8p?pq8S0Pr 0  *0*0@0  0* *d@edA *<Pzd@cA-PCMMPp`;8 ̺p@P  P0;PlrU 0 2 "0 CލЍO-PMM`@pPsP0 P: S3/P 0rS K00P 0#0@0@$)@ U  RP  esP PU (00@23MP@ S @V``帰张Js`P60: S)^0"P@PTcsP V+ S R"qP-P U sTq@\ SqP@`-\qP@ `UPXp%t!0#PU00`00  q@P  sP0Sq`X XPPtsh0 rPLrPP 5W80% ܍ЍU] FkF F@00S/p/T'00S/0/T'O-pl1`d10P0ɯ 0t X 03#ˠ121@ R` 0f0P As 00lRQà00S! % 0%p3sp(0 RXl000R X0 0pp<P00^''''\'h\' 00S/iT'O--pM 0`P@ᐱ0V000Ѝ000/U0p00 0 000P00S l00 ?w000 0 P00T0SpP8Puyp'^F'.R/NG-P `$ 0p@V` 0@`` V`@&!D( `G-@P 4`Sg Y00000pquP0Y T0T! ## @P?Ѝ_uP :F^^F: p@-@P`    pp@-`P@ ((UX0 3?X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@Pp02#U 1!F `R ` J U c9# S!V Q V3  P! I P` 0 c9# S V!Q V3  P 0 P$` U P `` ЍD|2 0A-1àQ`P |0| ||E0@Sp࠱ P$` p@QL ࠁ PQ De p@-@P0080P 4 PR*SpL0L LS@04 <<E0C800S   09|  ,0S/`0@-0@  Le,%|0,0080S 0  kE0@|' ,0@-S ,0, ,,YE@TP |@{ƿ O--LMPpU`@( %88S0@ @84@D2@D1@DS@D50  0 00Pjy U0#03?[[[UW|y@D `0P 045Q ,NyO0 0 {;D 0XR @sz"!L0<p$08p$0 0H(0 0 `,0`4  0 4$DHP 0 PL40  $00 0DP y, 005RSUSP3S` 4$`UQyV  0f 00 ,040`F000C3: 4`C#,0PQ(0 $ *,80f@P,Ph3Q 0Q+ 0CQ؃ 0P`S $T$PP@ '{T@P P0xTp@W !0{P` !T@'0`P`0p?: 0T @ u8< @D0RP P2v`0 S2$0$0S@p :0 P  S Z 1!A 8 B`40zx40 040 00Q80080p0ȯ0T`0 S2$0$0S@p 0 0 P 80S0 0C800S   0z`xO@  D e @ LЍ0 0'LBAW<^ؿ|h NBAW  G-0,0S0 CP@w`00qW40S*;zЍ!  0W@P   l@Pp $ A-`0@c,0Sl0l llfCPp*Q L0< H 0P@DT@3>  ? C-`0(Pc,0S0 :Cp@Q |0l x@PEU  0P !  0 P P ЍIO  Q X0sC-Ђ0@ P@` 0 00 0Fw 0P4Ѝp'4'#X0sC-Ђ0@ P@` 0 00 0+w 0PЍp'8'TA-0PQ q@`p0P R   T0! w@P 8N4P:u+'''@-,@P,0S ;00'@-,P ,\  D Ѝ'p@-P@&h0h 0 SX0d0R 3?5 @006.4 Q#3SRppD'T''27@-0S S+,Ô2 R0 ELh `Q tp>PCtaQ* Q( H<1P 4,B 5*< 50d30a39210S   0 00@ @7.Bp#x3 Ŝ & 0P xXPA 5*< 50d301$10S ص0 0@ d3S+ CQ+aQ# 0AS"tP y0@a3d3*|0p00S ᫵0 0@S Ѝ04'''<!('P'T''Xz @- Zo8O--0p M"##0@@` 0$0@4 0S {pPt0SP-# 00"0 qp*$x:lU tU bU0SpxP*$Z @ P80 ( 0 0S (00,0 `0$#+CT P P0V ЍVp FpvP` xx pgP `P0V:P0V4# XP pW0P0S00$$0+S6 P@ 0 +S( Px  P 0 S 0 00$ 0S Y(0,  $ 8$p I 0 S 0 00$ 0S Y(0,  $ 8[pa 0X W  @ 0 PQ8cċ%4$p?G-p@P` 0P V  0  0  G 00`000O-0` mM$0P@䄟004080 0 zpp40S+ mߍbW AW LW x8v4vcW iW0p8 4@0 0@4: S@ @0(0D08`,0000400P  P 0! PT| Tgp 0Q= $ 0! $∡匱@P 0V$0 0/S ဍ<<Y+ `jv`0"<P0<0$t`P eP%< l y ew <FvVD <"$X=v 0#$0@0P!SA `VHfp 0 n?C0 n?< n/ Ke0Pp < 0S `0S   B/oQ" R 0S! m0$H 8HfP`0F$0p0I $ pC pp:0S ,( PQ S RPQ \T ċ%P$zd@iox'`O-`-Pp,MP$`` Nyp@($0S0$020S'$00 P W 00 PSk0  0"#fT AT PT tX@pT$hp@,Ѝp00` 0pP ,N ? 0o 000 00 p p@0 00`&qp p V@p@` "ċ%(>h$SUeG-Pp`l xp@<P10S<  p o0< 9X $$ ip@- `&W00S $$ Xp@ Y``V @fT rT GX`$$  ;p@$Vċ%$ @- 垨o8A-@P`pP 4܋\ XrT  @@r 0叄U  Ar AoAI%f@- R0ЍpP`@ @P0 0S 0SS0S $$1!BS0S ◲P , (P/00#s01"$#O-`@V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! 0O-P((@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR 3O !00G-(p$ P@=q`P 0㙥T$0 0Q P xs`Ѝ bPC-p$4 咓`pQ%@ 0Q P Ѝ gbP404-@-0  Ѝ Ѝ/-@-00@t 0 Ѝ@ Ѝ/-@-P 4(p zx ypЍ Ѝ/IO-MPp`@PЍ P P 4S  0DrT0P$ kQ$YP 0S 4S $ X0P4 S $rSG0!!p`000 0 0  @ 0P 000 00 0 0 P 01 T0哇* P$(` ,`$`V$R ڀ 0`  O0 @0  "SPb 00pP0Sp ꛔ(Lp$ OO-,MXPp\@Po 2R 4S  0Ar,Ѝ 0@Q Q0 '  PS[  "S 0X000 00 @ 0Pr4S 0S6  00 000 @0 0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3 1  #  0,$0@S4S 0$R  @0 RS 00 0 000000PV P0P 00000 0  P1p>U7ASG-`pMMPKp@PUЍTC^t# E@0$4$ 00; p+p `Tq@ bpP @4$$: S R B., ap $4S ($,40(B. ap E0dR04<($$4,40 K>؀C$$0 0E g00`d$t؀E0   P0`P 0$4S   0p 0)p 0p p}p p 0pp{ P P 0"Q Rp5M*pIg Z0"d@d@ &@-@P 4B BRP aap 8\4  fЍ@_Ѝd@Onp@-@PP PP \.p~z4PS4 PPA- @pP0TP ` Xp@0 p@@ 6$$ - Q EAQ0 "(  0T 02 /$4 0T1 / $4 0T1 /O--`P@p M7W`7 pPЀPP `00000n똰 V:Ѝ 1*00 0P0n`P1 0 0mP UP%Nq X%mC$$0A@-P@- t`R@`kЍpP P 4 R 0 V,O-Pp_o!R0`@|MR(0S00S "R0oU |ЍP {P`U 0SIQF (0QSB!RS R9"R S R0A +00S00P0#  7/p  7/p 40  m0$80P P P s@-`@P0zPЍp 5/p 4 5/p 4 C-(00pS4`  Ѝ$T@ 0 0 0`P 00  0 PW0&O-0 0`Pkp@ᜀ圐吠T Ѝ0  0P 0 0S Cp j@ 0 ,ZA-P@ ` p0 l@TvO-`p lP`@`T吐  00  Q  a ]@ Tq O-M Q@8`< 0 0 PЍ P P0S*B PP  00040  0004 pp `040p` 04p  0s@-SX`@ PE9?o 2R0S  Ѝp,@- iR sR aR p` V~7@-@P ,PP  _ Ѝ0,p@-@T 40`P᪄PVpp,2iR@-. 0 aR bR LR) BsR& tRP 0P0S00 T(p` Ѝ(h0 V,Dp@-@ M\P`;P0 0͵0,j0S j jЍpq o`A-Q@P M Q   ЍA~␀ p$!k!`P h`B~ `PP lw6O-$M@P`HP 4P`$ЍpP 0 0 0 $0Y1,"P0*EQ  p0 0?Y S0SXp Y0 p G04 pW 0pp $ ikP 000 00 lP l4   \ $  0U,S( 0 P$`4 80Xpz $Ĕ{'!#, RP P { T P R*L0Sf 0p] L004 0 000 0PK 4$$  M $ 0$$>p5 5Ot00S 0@-@C^M E$iE$$0  0;P4Ѝ0 @tq !i"`#XT 80  @xiP8uiċ%$3GZl0$ 8O-PLM@p4 1嬑嬱D0 iop  0S$ ! R p!LЍfR lRJ  I@1` 0S   P iP  I{ k蠟 7iP؀ 8 xkZ d 0-i @  %Z  Q ` 0 ` P` pSJċ%q,$Б%2A-p`(P@jP0 p!`P @00 0$0@-@P$0S &k@#kO-p`$MHLPPDT   V  \ D@=x` @SR00 Q ^00S P UP 4 0 T0P 0X0$0sP UP000 P1!!U111y@^P 0yPPJ QPT0 0X0$0 00 @R P TP0 \ 0 0@;0 0ZS @R PP0 V00IP  0 0   0R00 0P0@SP@<*4$$Ѝ=@$.O-4MFT`0X\,! 0 Q0  0J` ` 0 @0 0 91 ,0tWL 0Si     R ` A  [  [00[$000(00$ 0S 0(00 0 S0F 0S0B0 T0  0  0 1%4 0 0$ ( 00 000 0,00p4ЍT0$(` 0"0 00 1!00P$000ppO-M<p` 8EJ@PJV 0S 0 0 0  0@P@000Spd- 0  J) 0PUT@ P T0 @ 0,@P 0T@0 0 00 S0 00 Ѝ c0  0 \ J)P T%V@ Q  R0P Va0 0S 00 0 0 RV Q T0Px  P0 T@ 0000Sp@?Y}P/0S//P/0S/C- `P @ pR Q  0X0 RU@-@,MP@p`rP<o,Ѝ ( p`eP0  4s@-XPLLL0 Hf@@@8P8`@}T`d%]%dCR R R @-@'R R/////7 Rp@-0@P! R8lllllDlL RxT\dpp B R"S@d dle\0 T pppppp 1 ppV'[O- M0`}@PPЍ0!S R g8P0p (P\4S 0L0$$8P(((8S gQ QP0 4S ڠ0"S1 @d0  <03/p 8 H0 0($P  0P 0 0 $ P (, PpWEVV'O--0P`p,M⌃$0  0kp@d30S$` vP 0"   pT AT fT N@,ЍsT0 0$Xp00 0*0:@Dqp 4 `0}p0ᴐ00004S 00Q-$2!0  R8 +R.R+꜅(HH(H((HHH((H(HH(HH(H((HHH((( R@d!d+d\1R R8 0S4 0S$1 +10` 0`[ppr pn 0oO@@ *:Lp@@[|qW 8 H0 0 8 Y$ (, `ċ%$PVD'-~dIA-@ĔQp Mp  A^PP`|t`WP \&PЍpP ,0 /Pꔏ6xG-@`"pP& V4 t" Anⴐ崀 ` $$ \0 P ! p" $ppP  H00p$Bn 0 Pꔏ6G-`-@"Mip ЍG20SP=`pPx $R  4SЍ4S_P R 0a $ RQ } vSMP 4S P P 0UpL0 08  0 P ,!?o  0V0 00 apP:GRP P  V0p 4S 4S  0$ċ% "U>SUe@-  P$E/  g[@P* *]|00CS񟗆갬Юl HPl P4 0Pe o_P0Sa GpPX x%/PQ  d/PK  P/PE  </P?  (/P9  /P3  /P-  /P'  /P!  /P  /P  /P  /P X1SP t5P= HS=[PX 0P @W 0P pG Pd/PU f="80xx /P P R2"(.P  pRP [GPU  p $ 02#W: ,0PE  GGPP? [2" j.P4 0!xWxx /P) !0xLx /P "/P "t}/P #`w/P m0$ 80S SP <   /Pp7P0T [00ЍSJ,ċ%$H(%  $-8ESbo}:OY[|O--@`pZȚȪM a_p :0S ЍO0FS iSPpC>؀C$dP W <>ЍPP W00 9PJpP >GP0$$NBPG<,GPP (GP (0jBP\3<H0 -P 0$, Q 004 0.P 4P0P 4 P#[  $P00 00 0 00[000000S$000(0FP XF0P: QPP <<<M=`P&M= 0$YPP 0`bqp R$4< "#Rqp$0`A4 B.Pb 4`5P `ˎP @ ,PQ @H },PK @0 SD00H0$ RL0( 0X} I$4P `$$I$4P` V`F`P! \FP wL&᛾tRFP xQP+8,0 <`P <<&?  0`qpt"p 8,P4po  B,P   ;,P  4,P   -,P  $ &,P  X ,P q@ ,P  ( ,P q/   ,P r ,P 01S 0r/S㲰, s? Ѱ  +P s/ +Pz$$I$4P PPУ| 7<`P7<$$ 0 `0 PqpS p0t< >-Pi <p1P < 8r < .-PY <!P +PN  +PH H +PB 4< -P $ <8 k+P2 8 Y* 0=c$ Bp $ H P$4 "`#qpt$ {HX$ j0<"\U8008$0 0(0$0 00(0 40P0,` 0$00P00 T0 X0$$`嫼qpY$$>H$4P0 00H00L0`$+`0#勼qp9$$H$4P` SJ ,ċ%$ %}Fh8[:U! $-8ESbo^|:z0@-@M P   0 0Swp< <x 4fIp$p0Ѝ0''i'@-SM@P, 0 % %$ &&4 '@p H0P0x00p0`0h00`0 0X0D0P0L`0|`ps oD Sߍi@'i'!i'@-@  ] h0Ѝ1p@-0MS1`0`SMj@ A. H01P A!⵻AxUP 0`0?oS cP 05P PP(U0 0A. 00`0P A ∻AUuU0 0A. 00`l0P AX XiA\xU000D 08mUލЍpH''q '''''((s@-?PP 勓UP 儓 _`@TЍpP  00STV ; T@2(60 R !O--M@PpJp#K`P"    ?CP+ ZI8CP83CpP NIp,CP GIt (0P0&h 0R0 0 p "( (Px 0SuhQr @ Gpgl I 0 00  R R R[  0PW t [ `ϒX (oDƒW 0f0S, @ hGP@ `Gpd HQ L 40R !501Sp0S 3/p\ R 8 XGp \ 0S 0@ `Gp Ѝ'2(#G@(H()NR(O(a(((@-`A@P@ Ѝ BPU 8P DpB P |7@8T ABP@- )P Ѝ䔽A-MP pu(@P003p`ЍpP i Ⰷ0 Gp !0  )Y(i@-@p @A-P`BpP00HP@?0H B F/A-P`ApPq00GP@:h?0H $ F@-( 'PR00 Ѝ䌴p@-8M@ (P'P1!< AP# G0 Q0s0S00dGPP"  A@6$p`8Ѝpl   IG8 PA`6V(O()i0@-@BM M  \p 0S 7  /  0(ЈP(@0S700$0/ 0h (dP(@0S Bލ Ѝ0S᡼@Rᙼ@i)D)Y)0@-MP*A@P ;GP Vl0l l P,0, ,,[$9? p`S*]*7)@(00@ S/a0@SW@/A0@S=@/@-?00@- M@ 0( 0 p塎 Ѝi*p@-` MP@>P D Ѝp X    ED( P>@3$p` /vi 0@-,M@ P`$P0  p,Ѝ0 0R0 s0S 0   0$ DPP  0>@W3$p`+ODf) /@-PM \@@KzV {G 4 4 OЍ  M?q M++@-\ @$P0@0Ѝ  p@@  \6+NO-$Msi@=PP mz`P00L0rP  0  .Pt0@`Vm`b`PT0 0XX@ @@@@P2M03/`\+X$q +++%,////0 0LL/X$0 0TT/X$0 0\\/X$0 0DD/X$  d00d0/X$p@-@pP 00p00D S 0A0CS0$Pĸ>P 0@pX$@-p0' 0`P/ R/X$0 O- 4M@@!2T0*  D`Apď* P(0$!pSڰp D@T PoS@ڀAP`@ p00L\pP` R  P Q R/6 0TS $P\(P  1/P J@@0S  rAp "SR(0 SdÌ\0 2/P W0 [  L'.ɚ;6e6-.O-MMPp  Y p` % 㚌 }pP$ 100$0 Շ-RN   oAp4  bAp Q d6N M8 p$<Q ,&N$_X@T ցX00@0 07AP N@a 0 0征 ,0@4@ Ap 0N0Px0t 0d 40,@ApPj 4HMKPNu *4L'Us@-@P:@P|0| |z@P @ e@P T` |PNu( hЍp@5_3L'UA-@!9`P0 KP@?p?dP _|p8 =400@@Ѝ_3L'54@-@ \PP0P PPL 0 S@@00 >00Ѝ=4O 3L'ꀒ%G40@-M@v9Pq9P l9Ppg9P d0P P P P呸 4PIp JЍ0@5*43L'7i4s@-@G{hK m{P LJHPH`z{ P! ,JЍpJ@O4^4O-M`@PK ?ppP"(  A  ~ =p% (3( px" <@T t8PJl2P\J UR TIЍ0 PtK@Pƈ $@=p zJt 0R |Jk)6J 4JP ``oJtqttt` R#Q\bJ Jm?P8ЍOLP\ 0P   Q1   DJ0! RS[z 5J3J" I0P R ` V 0P `\p\\6('8i(i4444Jl34 q ^md 554Pp@-P`@d7P V  8`P C-`@-몷 00pP7Tp5-p@-MPP00Ѝ`0 00p0@ 0 P =0P 0 p 0 `P0G-@(Pk00p( ӱ P1r0`*0PU!V0"R0 N"0K0"SЍ/0P? 0 , vp 0 @0@-@P ,@ ۶O-`@pP,(0V0S 8uIP$P$P 40S 04S 0S(0p(`8P0S$0(PKO-M00q W$000Ѝ`Q Q 00 APP0P XU 0zbP p,,(,`4@[T /-@P00 Da0800@00X5}8 "10#Z0 00q 8 _@ 0YPpG@T 0CS0 0r xC0X0^ :T 0CS00xC0 xRaDPW@DADP7@Dt@S q00@Dt@ TSS0Z`<@gJTh l. 6PD+U8 @ 0 0 0`0ꌴ&w5p!5!*;*A-X Pp@`qP00|$0P 0 p 0 `P0O-P`,Mp@ P 0Y: P X 0  0P` 000   0ᄨ``V``<>@pP`0FS>U>A>->OO-`MM@ 470P4 lPgE7EP|7U'S 0`@ 0 @`F( 0RtPx['Vʀ9 0x9 0p9p 0l90h90d90`9>(@ !!0P _Q  ?B0CSU 0     -B$ B8##!``F 0^k 8EIcCP S@BA`pP80P0 a, @>!0@"0$0$0S= =0 P0B'S 0؍Ѝ 7R  0CR.B B7R  ǟ#110BS00 2")B B,#!% `7R.B<7.B3"" N-B B00Q0w*S SS  h!!2SK S` 0S- R< )StS0C'S񟗐D&<&%%%<&<&<&<&<&<&<&<&<&%<&<&<&<&<&<&<&<&<&<&<&<&<&<&<&%%%& &&&$&,&4&0S 0 t t0=0$ 0 B$ @^ R `%Sp=눅刕pW>G= lR0 0 ~=`L0S< u=0S `p000 h=5H3娀XP0  @ V=p` P=0S V70$S1L@=0S p:=`5=pLY&!1wp`Fv0`(,04Y"( 1p, sgqwpW=V'0Si  d (( =3IP  #P|# xßx Pt# T<`L 3I@#S0S <<0S8   <3S<0S+ <rp쒟 `0V V"  " 0<V)<0S 4<$<p Y1᳐! 0F `(0Z1`( p'' 1u (( <1I!P  $P! P! hq<``J  ^S| x!Stlhd`\XTPLHD@<0i?;;E;Z;;:8;̔'; $';;:z:Oq ~I;7;;;;;<P<<<:::<<^TP:P7+<0<I<d#W<:<+;4;9;:::::::::; ;;;";:p@-P M@` ]QP0 aPp@@{" Ѝpi<@-< @P$0$ $ Ѝ<Ot#7@-< @P$0$ $q Ѝ9O#70@-MP "M.@PۍЍ0@;" P+ --P@-"ۍЍ0@?-0S0S1iS<<0@-M TPp@@"Ѝ01 y@i<<@-T @~P@0@ @@I \p yЍ:O#A7=@-T @`PM<0< <  >pcyЍYO#7"= 0 /%/-@-@ M,00(000 P  Ѝ@Ѝ/P00  @@@@0-@-  ?? ЍЍ/@-@>(.= 0S/@-'-@-  >> ЍЍ/-@-  >> ЍЍ/@-h0M0S@ 0  0000 0 p@@Ѝ'=@-@y,HF,@,p0-jp===@-|MPP2P0S 0@P 0 000 0`ۑp PiP@H 00@4P8P` 0:e@P <-@P  @$@(@,@+1 0@}w9tL-t1 .P H `PaPqPLQ pק0S $@ T Q0S  R 1+0S Hژ `֘|Ѝ  H̘ RSS  S0 0$0(0,0 \+'">X>e>r>`7>>%O??-i?-s@-P`0@00 0 SЍp@Ѝ/0C>Sq`!031 0@-Mt 0 @P \w 9LPP @ (@@ 0P 020Ѝ0 %Y'Jl@-?S4@ 0: #  :7뀒%S@@EAIP@-d0 !X|!T@0 6p0\ (0000/@#@8@Ph0h@-` |!TD0 6p0\ ,00 00/@#@8@P-4s00#q^0<\ 0000/@#@8@P 4qs00#\,s0Q00/00@#@8@PL- 0:# ^4 0Q$0000/@#@8@PL- 09# ^4 0Q$0000/@#@8@P 4 <# \,4Q00/00@#@8@P@- 0:# ^ 0Q0P@d|0:0# TDD#^<s0\ ,00$00@#@QBeB8@@- 0 006P Ѝ1(%A-Pop`@WЍ )P #3MP@ p7@-P@U0  (l: Ѝ0lDA-0@nS0oSp@ plP``6P:0nS0oS;PP;PP'@-Q0 8=6D%O-MM<(0<,06BtT0S  -0SH0S40 !<8@80@D0/(  , (P(0T0(00 VqL lꃞ0 0D@00 l0m&p͡0S SH ơ7 00,00 )r;2>cM4MtMMp@-@PPp@(0/Spp@bKwKK@-M j42J%O-p0000@P`᠐ (,嘰00 9p0@DTq oP\0 jeP<q[e9 O4ċ%,M,J@-M@A>0 0D@00 l0%pD0S SH =s7 00,00 q1ucM4MtMMp@-@PxPp@(0/Sp6p@2bKwKK@-  1뀒%PO-`0@P(,p娐娠娰0 X9p00@DT oP0 dPP^qd  d1A+ O,Oċ%J@-MM0An H 0P0 $@]%p 2q=1OPp@-@PPp@(0/Spp@bKwKK@-L o31R%O-P@M P0=`r"8p+x2 0S00)0x0& 0 x`1p0 +00*`&0`k %pY puPfPMP9 9P$ GP g@PM(M(M(M(MMM(MN(M(M(MM@NMUP|0 0|00|0|00|00|00pt`x0 dP{pc|Pw[,0p0Z00t0X 0;;0x0U7-$00|00|000Ѝ,Rċ%nPJ-MMJNP0 @P:00 |0f$p0 `:p0 0N/0 4 yk000 0@(100KRR7@-@P G0Lo S? 0 p Ѝ05S@-@c$0P@g@-@%0P@@-@ 0S 00S0?  oЍGSp@-@PᴃPp@(;0/Sprp@nbKwKK@-oV@-EK40 0,0,0(0(0$00 02/XWiW>WW%WW@-  @P 0 R\  oЍWp@-@ PX0 Ğ0(pJPP(}o P/p@3'HO-@H `p夞H 4寗000V B7p60`FVQp 2@FP(TTRRRRRRRRRRRRRTTRTTRRRRTRRRRRRWRWRXXRRxXRRRRRRRR`T|TTTRRTRURRURR(UWTW X$XXR@X\X40S = 4 40S 4 0<007aE08:d$0000000D30@90;g)04 0I 0(80@008 0@bPn0@B (Q  Q@       a20  xa0$000 Ta0 000 0a0$800 |a0<:00 ra08:00 ha0@900 ^a0,000 |Ta00000 0a0909Rg01ra0$000 0 0tT0,0wM0 0xF00007000+0嘕40 F Ѝ%KX %,ċ%'''`SJ '*XXX(X2X=XCX %A-RMMI>0PC@P@(0L BH`q刁( `L0!p10KSh0  R< (Lh0- T0^/$0 m( h0^/P  0hPP ` p,@.`0T@ mP 0\ $00X 00P00\0|00x00t0 0p00l00d0 /RݍЍ`'&YKVvXXp@-@P Pp@(0/Spp@bKwKK R R @-!m/Y0@-@MP`p 0 000 !PPЍ0P0 0 0!0 z 0P ]Hs@-`/P0@00 Q P0 |9Ѝp0/0@-M@P _0 0P0h RP P @A@? 0~.0Ѝ0P'VY(002P0/0@-PCMQ* @41010 0000000 0P D2< 8L.H00Cߍ0Cߍ0@o꠆V~O-M`p8@@PpЍpϿ| D<唛0D< Dn4<408 h0e,bD0(00x0 @E0h@0Kp PH00@JPF PD -P'\[VYO-- M* P@`pP0FT0<0p0Ѝ 0 3/X0p _0PP 0@ `LG P* 0- PH D@03/ppUP=p0PTP@`P꠆VY0/A-PMM`p/ P@1L# 4ND0@@ 0@00 0@pߍPڀ@T ߍA8HꥆT'O-`[ 4MP @@P :`@P`4Ѝp p⌚ 00` 0 ▾@P z @@00 p0p0000S X0Sp00000 xp  dP@0 Ryq D0D00X00000I00@ 000<0'Y`&ZT'@-sF F-*[%--0M 00H0 @,P (jn zg 9oЍ[\O-P@M$ 0䰝0p 0@"b0"@0@@ " 2p2 0BPa g@Peeeeeef fPfeeefeg0p00@0mp xj! 0 ]Pkj] P   ϝ 0 S Q Lj lFjMz e!! @P   孝 0 S Q /z ' lp 00k+ϑ   p x 0S0<S0@pS(@p @Ѝ?B,,ċ%]\LZJ6\;\f\\\\\"]@-MMCN@800 0@(00 0p i 0 +"+!+(0P( l+,E0P , T+0L+ލЍ4}+(y+h3]?]L]\]m]]]}]]7@-@P 0Lo S? 0 i Ѝ05S@-@0P@g@-@m0P@@-@ 0S 00S0?  [iЍGSp@-@P7}Pp@(0/Spp@bKwKK0/p/p@-P@%y $( $(0XRX0X00\00`0ddhhllppttpp@-@ P xxxDDx@@xHHxLLPPTTXX\~`\`0p Qp` P0@ S p@-0@"!Rc0p@-@PxxxxpA-0@PJ04S->Cx->C?Xnx9>:>Cix?n:>CFdx 0? AC>[x}C>GVxmFRxEnFNxE~GJxX J.X R  $$((,S>,*x}S>G%xmF!xHHLLPPTTXX\\O-@  $$((,,0P04 40TQȑ\5 S L5sT 0K TTXXp\\``ddh~h`lzlpwptttxqxw1[ hepb`0 `$Q*\5 S   0S&P%@ PSزK 0CA0Q R,|2.0) TU 0/0+P0sC@p/p@-0@R M4 @8 P#‚ @x 0`0 C c00 d@ @@ 0`B:C0 0 0P!\Qpx 0&˄0sS ( (X0xSX d`qVfl  00 ЍO R꤄0tS ppЀs XА`sVfP,2l''U j&jTTP ԀȀ00/1000/0B10B1/101/ &Pj%O-  dϠ 0@ `Ì0 150S  0d R\[PU[Lp Ѝ$ş P` ` b5B?0L RW@QWbR3\4P/R܂Lp\ D "r P D!!D!$ "r P "! % 080P0 U PPpأ  0$5S?00 1>lV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00020SQd 0@ `?5*0"ST0T00  B 0|"PSX000X0*d 0@ `5?먐ɿ 0! 1#" 0. ?0 00C000 xS p10S   dϠ 0@ `Ì0 1&! ! R$N40AZ80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30l''U jnjjj% %jp@-Pl`0@S     {@00Sp0?00Sp0?0p %'t0p@-0@SlkP NL00S000000B0F0p\' %O--MMȵp,+ 51N_R0ePS yqሢ儒 ?D 0S\\/~D? 0?D4P p؍ߍ51J 2@ŒD 0L 04;20d04 0@0  00@4T@:T @:T @9T @ 9T @8T @8T@@04s0p0x4`0S7w 0죟00 00p 0 0 `  ⭉0S X 00S ``a  ,| 0#\0Q ?,040<090(08? $0mP@Z  0@Dő$ L00 /4;0 0d0@ 0o 07 0r `W5 p|S< yq/0/~D22220OD0? 0 04!0hl 0@DE0 L 0/4d;00 0@$ @` 04 <01C?\0X0`0d09{0?,0{{{{(0 " @őDL  0?$+4# 0 d 0@ `Ì0( 1u % 'l'X %h %AoL''TO--M M: c>0?0 0 0D0Dp0S3 80`V/,0P0  0 c  ' ''P'd'^s0@P`P 84k P@   4kpW 3T@  r&CP` *b g&P S(X0S0,5 S<0x0(5002 0,%S0022Q04!N 0Q!Fb" 0 04 0A !8 040A d!/ 0 4QD!& 00 Q*$! 00Q(! 004 Q! 1 0 S0 C' \1\cXXY1X0S|j! 0X RR $%0 bH4aLBϠ8A<Ń@ϠPDŃPT\TR`8\PR001;! `4W0 P c 2# S Q,Qd0Q38$Q<4R):$ d'\' % %j k,'8'Sk|kkkl,l0''gllP'lTm@'=m %lT<' %('4'H'l'D {  P\0`\5?>C00#!3x000844$0<0t D0`@`W0|00`XcL5P5 P4`F   ?68@pD ?/ ?dWaWt00唀 ! o  A   >08$ 05<44R 11 p84<00x0 08SoPR @ҊP0@? @P:EPP0* : ԉ@PP(5#R0:㳊P@$0Z`- 0000 a`8! 0/  !.1 >0Z`  b0 R[ Q[" Ϡ  ! 0 0S  BB00~P`*02#$ 0 ?~V`1V`#T0`10F 0eI  :_ B@TP 0ἐ~됈  00B1  BZ`0 Y3  B0 S B!I0B ?50 `~됈 0 BZ` S2 B Q 0S p,Xu @P`x1 F084<ĔCP`0S84<$-0BPQ,`QɑRB1ȁ@L0 0 0000H60S|0` ?L4 0H4 0 06hp>'/\#R2\3PPT``0 S  f],7\5?>C00!#4t x0WP7 (1#T a2!, A3 31 0  P 04 P ၌ 0H$4  R$ (  B, @%LV.  R*h ( < ( X ( \ (( E.?.XT+BA.B,-0 HU P_t8 @40K P|U0 ,p B8d i A YZQ!bUZ 0X RA{ pW $4?.t{ 4 R?D400P@$04 0H4( 0Āp@2 R 5#< 5$23dr0S+`됺z z'xz {' 000d0 CSQ c6Rc+S`P^ @ z犸 z'(Ȋ0 (08T+S,hL 0  R0:1P000\hP2#00@Q@0 0gp00 R00ʺ&A0 吋0S_` R PP0 t`y6 K  TZ⋰>L'^F[mmmP'm8_X'n Б%ht@(%/n\'~nT'U q Tn' 'nl' %n''8  ' `00Se 0 #  hT 0+V. 8|00S  L 0=S,0S H0S0 0! , 0 BϠ2\ ( ^  0 d0/ A! a,3 1 !0 1@ ppPP04SP0 0R0 S  B S0 8:0,0 0P0 B 0,0S\{ p开8ȿ 0ᘥ+" < Q \%x"R!0@$00 @DU`@4AS2( @R,0 `0```0T08役(s 0 偊` pT3$4[0`0 I9pQ004 帀 P0x0 0Sx0x0t\0\ 0⨁  B`[d HQ   h ` lS2  B±dd 0RLv%U,U0   $0 C00 0 0 R R` `  0$5S  l01` p00040S2d00%ST0T00! !0T%SP5bX0`P5`S$0d]먰 Y  S$0Æ00080` 5Q S+@0@  )P+@ R@0-ᴐR㰑 ,  BU (05(000T0 10X0岁0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4400CS T00C@dw 0`4 8 0 RT:  $5SʬG $`$`(0V70S ,4 ] d,04  0,4 $> 00`  VjDL80S   0帀0 X#` x0Hx 0X\%Ϡ  R   d@ 0DĠ  dÌ!1[ @X9\%R dI0SP-|i\`/ `ƌ$  $ l0)`S`0 0$5S  l01` 00090S/dᩅ0D*ST0T00! !0h*PSX0b``[d먠    00080@% 0C400400T$*, Q`?0@$00$0l0`0@hppT:S $S0p0S $S00pW`@R[l倐H*[P00@xQ8p`0x 1pZ90JY!@@[l00 @ T: @ᔵA$\Q  @080 $0  $0d O@ LL lB;  \ p0SD=0S0 000S.>08C =R= 5,\%R   0 d0/ @ `.3,00  X0000P0S0> 0,@0P0 X>0S lA0S >0S  P 00|:x*0`P>0ScN C>`>0S3030404004 spCVW*<3XV.僀PToV.GVn0S  |?0 PS?\5=S,Z??^ E?P0 0S 04 X dLĒH 0@ `Ì014 ,$0S0S 04 @ d ,04 0  04 ލ Ѝ  $0E;cp@tSaZO-RMPhb  W@P DW@4 PpߍP(   pp+0S <08 (00,0 000040!04 04$0D0(0 P Vph p 0 ᷆ Do 8 ,    R p L p UW ᎆ  p 8p?pq8SITPr 0  *0*0@0N ~ 0* *d@edA *<Pzd@cA-PCMMPp`;8 Rp@P  P0;P U 0 2 "0 CލЍp@-@PjPp@(V0/Spp@bKwKKR/fG-P `$ 0ppw@V` 0iw@`` V`@&!D( `G-@P 4`S Y00000pquP0Y T0T! ## @P?Ѝ_uP :F^^F: p@-@P`    pp@-`P@ ((UX0 3?X0pA-  0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX0p0\00``P居0 0,, 0S% P 0 VmS aSMSASB0C0b0C S`SS@U@@sS@ @ @U00 0DT dS$ 09R j"P T 0U8$UQUDT P 0  @@@ X 00 l PU0S00 0 000 00P4ЍL_k____@-*1,@ ( 뀒%&r}`n0@- @   } O-@0p |ᶄPh`G0 00000B_I0V W `BF ᴐ''P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@p'0P  C @- Uco`/qrs@-PL@` 000$V @ UЍp''qrs@-PX00S@H0`ă5#0404V @ TЍp'''qrX10 PS/C-DQ@8MPM`f8a1p P05 0 T:86S,Ѐ <6ۍЍC+ 0  Q 0ˍ14 ^ 3?0\ P;0Tᫀ 0+ۍЍ'''''qO-LBvM`\PP$"$fT 0F 050( u,6倢" R 0 !PT0 :0C 0 !>T00,6&0A,6 0  B 00C0( 6V0:@!$`V0 t,v$&p? tp @ 0`7p0 &$& ?t00S&L0S% I|0: S(0( d V0d &ЍOS'qs:scssx%@-`a,F0S@&R:p PP 0  @1AT@T  Ѝ P @C1@1 S  S R21,6&0,6   B ! ! 00C 00@'qsO--@PGM X&?4F@0VD ?`0F  ^S|?0V 1p5: T*; \QS T8 DT 0 0,/P(/U㰠Z 0 @ / @& d &F0K K TӔ> R`$` S k2+ [S!Qq 0BG 0((#0 S 0008cS05=0:0ᐊ 00UC 0 $P 0$   BQ 00~  ~0pF~0L000 60 6~<g 0(0Q0L d01D0 0S ,0S eP 0S 00S40  0U0l0( XC<000`01$0pp @X80R<(0 x0S 0Sp0S00 0  0C##@(0,8P $pp\ PPpuR0 SpG S~}P@8:`0S $~qL0S d0 P# 0<4#S 0+ 0Ey&,"y @&! B  I}!(`H Z60CT 00C0CS\: B EXW:Ȗ刁XS: ,66(㫱 |( H #TㄢB ` ,6 0<6&$(6XS:0TSL0S d0 iP UHP50S `V=@_ S!PSȌ01 210@! !0 ST40##02S0d$6$[:,6 0&4.hF 0V4#000040 (6`P0SMVPEPUI 30SA %V 3PUCL0S \08`0 H PP1 P# xwh3706|0X0000096 30EPp`<P HP `W xJ27X0000f & 01/6," Q *dh"P P 0 |0$PPP$"u v`Pw!k P  6!b!PU:< U*!:0U:0 0 xp.L0S]_U 00ZP@00 !$003 $ q W 45v:$ R% G  (!r h h$  h Xa XabV1h 0A0 btZ$ 0@S%0P0GVt 0h h0@P!01ZH5C: X0 !X00Qj*!?oR 20 P  X0 X00 ~7xK"cOc"-cP%ix;i\i|Y-jc:/?h=q MG (%6gfff{UORRaArrAaẵ'Q03!PE0QR0Q f 1 00S 0S000 X01 00S03 15 1p5 X40 0 X1 d0_ ?80"2`U PP gG8?C"5Z$ @02#D0g X00D 0080001l0$4s0P0<0#4s0T0,0#4s0X0@0$0 Q  *X" *  H\  0d0|2Q0Hh080 S r0S d08;s800 0o 00(0S( X0q"W030#W0 W00S  pR:*`pn0c0S  `QpY T   v0S X1 t C/oS" R P0 X 00 @ 000$00<00T00,00X00L00p01t01x01 0040 0 1$00(01,0F?03G?03)0 01 01100 04"/@!b$ 04v 08 0#$ #(#< 0 04%\?h R(0S00d0H 0o0 00 ST n%?   p T]   R 0 Q  !R R S 0S 60$610110D @QS*@ CrQL000l R X  R   0D0 00B?oQ20S (0 00 25 010P C0024 01000pX40ST$00 @0l<0S 0S,0 0L0?Zp0 <0!t0A?0x0 040S Z!|zx h XQr0pQk (80S Q@F,0S1   k B*{@-S-I A 8 /eA@00@- 44@4P\P 0B"" (-@=B'@)0/p/@-  `먄%G-`@ P pt!>09P U0 0  P@ Gl0P\0F 0LE R 0E U   (,Mf0@-xP@ 0M  \ 0XXmPЍ0 P 0 0 0 [(O((@-0 $0$04}S    Ѝ䈅N@-@p$M0 0S ` P-1 00P 0! 0}))w1 lr>\m9Lh@DpQUVPE:$Ѝ[ꐅ΅40@-4M@ 0P0S ,Q 0  R0  7  0$4Ѝ0@&R  (  0$R 0S 0S 0  ( 4Ѝ0@4Ѝ0(/Pe @-ppD@(vH@- 0 R* 0s# p@08)P `00CS`0p S00 P0S X0X /XБ%p@-`rs@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hcdc`0KsPp <10C <1$0 810S81(%(%%X(0@--@4MT nA`jdghQ b`"R d2RKZ d2SA = hk0:{PPS['ΞkHk?[E{7<1 = >킨 * + (+S  PPP- 0 @@@ ! zj{ k{[+S[4Ѝ00B:k{{'*k{h+S ?@@-C6?Y@x((Ɔ܆%#(([o@-lci0d2S(@0@-0S0@d2SVc`2"R2%(@-@ 8!<qH 8!Y{  { ,00X@ 㚙?333333?(%O--pdDdd`2Ms=pl"PT1^RP3 204* *@-@ P D PUQ"P X ` R D \@@ 0 0 ,$`Ѝpd*%0*(%A-PLL! E@XQxM` 10S  xЍ  iR R R0d P 0V 0@  0 pP 0  gP 0000 ` `Y V@000d*%*%(% *0*%:`0@-@X0 B0@T1 S"@ 0P   0S %d*O-tQ0S hhrG @P 0S <@g000@T0S @p㼀 T0:ۍЍ`PP@p0 8 Y 0  000PU$ 0*(%X*0A-0S 宦P`|p| U0({@TP`0  RF000S @0*(%X*4A-p`P@P hpPpDorP 0L0 0C?oR20S  P J%xdp@-/0@PW 0Pp SRp*@-8:Xf0S$0$ 0 0#덝*ԝ%$0?S/ @-yUP*%A-0@0/0000 SPnڨ/0>+b!T0 L< [UP0? 4  K00?*0*%0@-@0 0'^0@0Ѝs@-@P`P @TZ TT?0 00? ^+"+R  + Ѝp"%p@-<p@ P(2@P0P0p% G-1@`pVBMu Qp@0DWBߍ`TV B/ de 0R ?s0 0a b@PQ 0 ?2/ 0(10S 0S Q0000 (hX:0000R%*0S [0 0S R0 000R*Q l\/0S D`W0`S ***p8*(%FZt0*O-l3P0_MS XXTsTC L0D#D0+b! L<SP L A0?0H @L !PPD sd CP !P&P|u_ߍ0*(%P** *%0*Ȟ *%)ܞK p *>^V05,7 *}%%@- @ 00: Sp *G-@qaP U+ P00S  0 S00P R GRڀ00S |pP Y XaP Y 0:0S $X**%ƟKO-AM M` 0opP@0 @ Aލ ЍO/9/P( 0`!`_PQ D D @P ,`PD }@T `PD s@D `టT Aލ Ѝ q lA>00C 0  R + x [D M@D s`0 .N  0 D r20*Q% 4]C-M Mpp0 /R @`㬐嬀 GPP 0S P@ۍ Ѝ00 D ?_`D @P 0V U[P`K0*p@-0@ @P EP @p@-@@O-3tM0 S ppl300RS\3 P3P#0LDC0#S8 44tЍOܢ$ P b  0p`00;@Тв?` 8_0@ 屢W6 ! h`V5VW b@P p0 ?0@!  叢匢I u?0@ s{x%tЍpI\1P0xSiS?P 00@ 000 0C0T10S 0`S#Y \` Xh0SS   80S d00X00%E0P!Nd0 8 d0*(%z *P**%%*$*(* ASdH*Ρ@-AMMP 0pP0 pPd!d@P TTLRa,< 0AލЍ QD D<*`PpU U + p 0P a tD0Sxp T0TP 8 a8 [EI%0*$*p * 8b@-+P@-L@0#S 04#S 0@%%0A-@P` 0 P0: 0tpp ?R0@$aH00S$` T` R 7eD0&F$ ЀP 0P  }ɣڣ$*p@-@`PP0S @ 0P0 @/wPa[I\0P 0 0s00pO-2lM0`S ||Tx2XGhMP ^_P L.Di `  @(rP 0/*P Q 0?*A Rg@ !!!0 80` 0 08;5h],8h)80-04*48'8<$<H!HLL888 xx||79^E7E7:^E7ET0AS\sxsrrlsr i Pl 4PE PehT0S\40S PP@00 ((,,TTXX\\``+V0 # #1 0002#22 02 0 (0#(0/,0, H0T0/X0X0\ `0/`0d 0,dO20m000%60"d20=S" " \" R `LrVCDS@"@ <#3 ( i!0!x30=00 1R 00# |# #X0/80\ /`0d 0 %0L0<040h0T! AQltPttt`tfI9-0CS A  R0 R R 0N\ \0Xx0=0- 9!`M*lT**0*(%k*%Yf%Ѭ*CZoC- 2 B P000000 MQqM0S a쑟=聟0=P  RP 0AS^wvxwDv\wlw=0=`|0VddaP  RP 4!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ0=ۍЍt0 h0P0`0\0S H,@咕)p *p*T***P**>%X*˭߭%O-AM0U(0 "S j#r0(CA#͡ 5/0(0#R00 #0Q0У dZ0 (0S  F(C#5/0(0,0S3,0P0?0!#0,0@'  P Aۍ<ЍP(0S #r(0AC#͡5/0(0#r0+#͡$0 $  BRʠ0@SP (0S 1 P@0S& 0$00S  B 0S 8#R00SR 00S \0l 9P tlx3  P8P0Sp*Tw***%bp **(% 0 p *V@-@0SSp* O-@M00< 04000 0 8 0@bPb  0@ @ H0LP Dp`P* ` R  R  R;  R 0 "PL RM  R"  R`60S  PPL60S i868PU)-$P"(T^ 050S  P% R #P 0 t% R  dd PЍ0HU00L%HHX0S50S  $40S   PP 0 0 8' $   W0 0040S 0 d $ R  8z#PU# R  :  0?2P S 0x^  W 0 0 8\30Sc X \T 0 hI+0#P0 0020S  "2PU-20S v^P<Bލp~@*WA-P@` I<0 pIW A@*Wp@-M BP = 0SP  bPi0PP 0@ 0;PS ! 0C R: p  d!  `V$@1@a0 T0 0d Do Ѝ0@*I#@-@T T  0H ,(Ѝ@R<F sW(%eP 7P P / //ᘺ-M M? Msۍ Ѝ(%4`00CS`0 XX0 X /Б%O-pQDMDЍO<@x`pP W200 RR00u0PS00C00@@ Rp@T+ W-Y* U U    J  C;0.|    J  C.0   Wp W8(%\@*uO3<0S/@-@QPM PЍ@: p31Q``1X.00CSꈥإإإإإإإإإHإإإ@@@" 2PЍ@M !0S S/   d0AS&ģԣܣ0 H <840 0SPЍ@ty   0?C1hS fS501 0400030020j0CS PЍ@f=01 (0<00$0;0d 0:0090080070060 0500400300201jS$ $Q Q yv!oj(e xVPЍ@*\Iq p ,>;HUcwihpAg&HQO-@`pRm@-(M0@ #\S@3@#:@ (Ѝ ܸ7@-P  Q,X?P Ѝ0 ற@P .6PP DPBC*D*0@-@QPM @4OT 0d@Oo@5_0 ! "U  R P Q ,~?Ѝ0T%< @|%%(Tr d T%Tq < (uP"  @C*B Q0@-.Pd0 @X!P@QR00 00C*ܸE*0s@- @R`  P.5P ,?0S , ?|Ѝp l0!PU U 0< 4Ѝp@)Ѝp@%D*BC*@-@T T 0( ( ЍЍ@5Ѝ@C*p@-@"1Q0P Tp@@  p@0 p@OO-@"P\MA@ (p @@0$@,0@0PP PP  @@00P``7uU]\Ѝ`P0  FX y RAx   <y0P  nyY  4\100 0 S00C00  Q4P p0 <r 08pl0Y Ix`00CS`0 XV0@T:\ЍOX0 X @ZSJБ%%@-00= Ѝ@-0  5 ЍO-@p P4 aTAD -QP  P PPP@D`FRPP00SP Ѝ@-@0 0 0 Ѝ?@- ` %@-塦@-aAMp@0WP M0`zqT1T!TRL0P 0e$1 ,Aލ Ѝ`00 ! !01 *?t0Z !!R  0G~48@P6 95<T0 <<@D0 H0X0X 0 DD F*' -q FvK*M@-K*0@-6S 4F*@--555x5m/l`@P" XT  <4@, @(G*G*@- G%0@-h@  0@ 0\0CS @CP%p@-@Pp00Sp8PU``p840#U:;0X 00rX0X40P80 00X0p`P -7@- 0@P0J0P R*00B0 Ѝ0@Ѝ/O-dM@pP DP@DU 0 S :sdЍ` |0 J0]0 0 ^`%!0  0 `00$C0  .0`  V0B sP CPTP%YA-@`Pp尀@"!023 U 0 rpp px rP@T0S0P   ЍCjflmq r-,M 808"40!00!,0 (0 $0$Sw%-7@-`P @XT@ R 0@  p000 Ѝ0@Ѝ/%IXM*p@-PP@ C0S 0CSx 3 0pCp@ PP 0 C, ,Up0SpXM*lM*#A- `M0p  0 -p Ѝ P  @P   PP0,pЍAt01Sh0 `0X2TpT0`0S 6` FrP `HXM*%^q fC-q@1MS0`n1SP1SdV1 Q묁XV ЍCVR 1S  @1ЍC02V,5p0S) S S ;X    ;X  VЍC    ; X ` TT ЍCVЍXM*%^(%I'sz 4 0Q 000/ XM*%A-|AJM1MSh=`p10 `P+B c40`0 +p0S JލЍ;X P0 BA7J.H0 0A1$HpL  $`0P0p0 P+p@Bv Ls0S8l!10 nXM*G-`Qp1 `S1S@1SHV$1$ S1SV GV1S G 041V9S0  夠D@d0SVG'1S !Q 1S  < GVXM*%^(%I5C-a0$MSP@D pTp/ >P 1! A   0S T0S0SA0S@ @0 2+po$ЍpT 1S!0T0  rq 00 CT !10!sr 000 20 0( *00 0 "XM*^A O-lb0MSP@ἐ upTp> ,p/A,0  *p[Ѝ h 0[ J0Sz  sA0S@ 0 *poMpT 1S!1T p 0  T 1!0 00 0 0  $ ( 0! 0 d ,0 ,   0$0(0!00d00 , 0  , XM*,>[C-0P80圐 ,MR/ !!~/P`,ЍC`@ @F9(0`0$0F{ xP%lM*XM*K O*O-\M`L<P@谟Q% 0rS P @0  0000 0 0P0P    RQ  \ЍS @0  0P@ O*|euA-8Q夁X@`!1  0AO!pRS5V0 M1SV AVS A 0//Vt3TPDP@\`XU H&A  VXM*%^(%I0@-P@0$M00PP0 n)p$Ѝ0 R  h&d0 0 1S00 000 0XM*IG-pq` M 8@0D @CT Ѝ0YЍG)S" !10  @@0 )p Y PP   @@0 )p !R Z tt00CS0@$$$L$X4{( XM*lM*@l0@-P@04M0@PP0 (pz4Ѝ0P  "!  0 Q T0 0 8AQ(<(7XM*%Fp@-`@0M 0(`` 0 (p5Ѝp R  C|P10 01SL0 D1S**P m!XM*%^O-DMhpXP2 0S 0 000 (fCP (0((  `@PDЍ0(0(0 0$``(0s(  ``$0 #(pDЍO(P 0u(  0C$ S  u'P`㨡娱唑( r00R0S X 0H0 0,-,`!10< 0( (0(Ps ( = (U((0$ 00 0 00 0 000  00 0$P 0 0$ 1SDD"!!!! 9XM*%;IC-M⬀p`` (6W000 0BP !  Ѝ0000P,@P! PP  PP 0i'pЍC` 0R  (0W400(00 P(| 0SQP k0 Ppq0!00(aP0Stpt1S`\p\`D0S rU  PXM*%;I?0@-P@0,M08PP0 &p,Ѝ0 R   0 01SLv zZ{e[jKZfke[KK{K+SfXM*IIO-MMpdb9D00PS@ LTO P"y J@ < 䱟Y:0@@0 &p/o>ٍЍ<0 0 p  Y  \A  < "QPR !$%*1 "! 0T 1S!1T0 0*~T !10 0*r}pw8 0k9 o@i8 0  \*XM*,OYjO- JM M`@pPO83 #p0pH@P0P Z!p ppH0'#p 0H KlM*%Qq ?^^%XM*Il: Q* ,_b",5F]P*x%O-`ĿqM=P`P(@Pp Up#*p0T?SpDp00p$P.0`0\/809` R  1PS0R @`  800 14@80 ,&@@<@%@(P0@0 p @0XW!3X0 S7 JRExL='@P 8   <8@8@5P T ,'P  5P+Y =y-  0S%CT 8 8Ḙ80T  0S80S @5PY@(5P,T 5P 5P0p40 5P0p40 5P 5P0p40 5P   5 PT  [8 8 \804T 8 0SJ80S a5 P"T  =8 8 !8 T  k R+8 R!P 0:{x95P:TZ 8@80 Ro aBQ*xlp  `080ikklgj   | p5p3p17 8 ᵘ 8X ( 0S 70S 1P00: <00140k0!S0< 2  x 0G0ux9Wh)  7 8  8X X 0S 70S R0* 0%0%00140k0!S0404@Tk0M34I3T* ^7 8 8X l0SM70S `   40k0!S0 S01W40Sv  kW01Sk4@T 0G?oT20S0G?oT20S0G?oT20W0S| \NWPJ 0sWp0;p00!0P.&9008`d `@AadNP8 B/804@U08080S@00 @ c/4 4 6@ @Y 5p8 80 @ @0Y @  1=0 ! `0400<0@0,[ p6 !105 "04qߍ 1PS co p0 A6dtD`5p`H  pH0SX Z)6H-0A1 Nd! `0 D00@0`q p_6 !10`100CS|$$1" =V%@P qߍOdoob4S 804(4 (04c0(00000(4, pp;W,Y RT=00D@ 7.`P0=S "8 R  t).P 0=Sf "8 R b  @.P 0=S t"8 R  qߍO ( T V0@40,@p_VD@90S  1S%X'  PPP `V-p P 0D 0(0 0,003Ap06/00 HX00( ,p0,S(` T'&5 Xqp ~50"S z5 L0 SX0T R  00Sb SV S0F&$0Cs=" XM*[%"OiCX3 #(Fd(/q(Cl^q:%}0P*.lM*0P T0LP0PT0ppWfp&000&00' T0&P0.T0hP40S\@@T T TT0P 000@L F0' 0 0 & 0.0080h 00؂0`@PV\PP P\0p^p WqߍOS40S0 0\0w0 00 p0000s@-@P Y U xQ lM `I TE HA <= ,9뀒%:Mnt0p@-@PT`m1 P  p@0#p@< },R*-M M P $Pۍ ЍOp@-IMM @`PIލЍp >P0 0 lhP 0S 0S0 q0S  VPO,R*@-M @ CPDᱬۍ00 R   6PO,R*H-p3MM@@cPPXY2 P公0  40P00S` = 0P  ŎP``V - 廎Pt2  ` 屎`P_ H2P @0P ,|"PP0 0U,00P`0SvW J1!P 1J HPP bJ1!@ !P\10S P 0Q00z 0\K0PPPUq&WP P 0 ^V_JPiP`ZZE_oR0 $P  ?4S J P t 60 `PEO,/,R*9CT`du\%"O-@M M`;@j/p" P@@@ $p p0Wp0Y:V0S @Pm ᘶލ Ѝ0Wc@P @p/0P 0Z 0 ph 0V9 H1Z ]P vZ.$ pZP hZ. 20Sa000Z0 0;0V9 0Z 0P IZ.p @)0T:Z_P 8Z. p$|do"^edA,R*4`@-0`0 06PP y0@PT 6P Ѝp@0"(PP 2ЍpO--\M, (@$0cPPʴ`\ЍBF0P0  PPpP U  XT] T` Tc;88T8000 -<0$ 0S0R0S p 0 @ p0`@TW*303# 0303P0<0 0`ZG*$0S 0[S0dOt  㜃 0H%pz 4; @pp @ H6R801肟R800S8<ȂP0؂R809-Wp1Bn,0S 0( S5@F000 0S, Z竸J0相S%8 ?, <0vD8 ϠĠ?4 00,@4 00, {{'0 {0[Bnv 0 1 0@0pt, t?H4  $;p  @D0?4 $;Pp @0 0<0$ {{'0{0P H8 ?$ 0,@$ 0y,0 pK Y@JlpsQw~. 0:cq z0SP0剴kფ0S? 00 @C%  pTP 0pP@)p~ ?4 ;Hpt ?4$;Ppj P0H @8 ?  0, P0 ,` 0,0 P[ڐ竸z0^Ë4: 0相S?ቤ 02 @ `LQ@*0 @`Pp& ?4H `@;p 0 0CP$`;@ p {{'{<0 P {{'8 AϠĠ?{ 0+? 0 + 0 +<0 Y@q @- `%G-䐟`DTp  P媨TD PEE$U@X ,P00@,P 0-40 P @ 3MDPE@DTR*"c O @-@Q0e 0  ,P  @0S `#P L'0D 0@ 0Ѝ R$#p%*.+%+%+%+@-?3400S (0 0 pp ?؁**t`V*@-@L0@&3@00S1',0, 0S00)'$**܁* .+dW*C-pQ@AP@pM0a00 M0 + 0<P @0 @0ۍ Ѝ0 000nS% ?S aS@ 0@pS qS @ l0h n@<0 P@0 @@*Б%*L%**(@$00S 00S/**A-X`0S L00S 08P8@p0Pp00*؁***@-RP`tM  E P RQ ğE R`S% 4p R0`F\ R    TBP ׇ Ä CR ` 0S $ L.  4\ P00@0ß3P [P\ \PP $P  0R0F p1 B!$PlH D RB D^a R @T$P \P! P 00^@\ 1Np$$ l  T\pH 0P P0 P p00$0 R   DR%00 0 $Rk f 0P !F0S 0P_ ]P \PP0 00DS000S+%`tЍpp1@$pWS l0HS D^\P! $P( " 0RF p1 B!$PlH  R D^  DR R P,P ]P B DRڰ0P0Tm00  DR Rx DRtژ,Pu ]Pn qP%L%-+-+)+%+*PA-@@P@T f-@ P`p0Slm d0 @ P,0< 8(0@Ap%*^?9.+%+ A-@P@p0S0P0`|0 R dp R 0L 0S @"!P@`T !%+p**p%B0%+P@-- 0 >.+^P@-, 0 2.+]P@-, 0 &.+eP@-(@ ,000 凿.+*T%+kP@-(@ ,000 u.+*x%+P@-(@ ,000 c.+*%+P0p@-AM 00@0 0@S, ,1 AލpS> 0S0!C:P 0S0=PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&04 CE:P.+.+.+ .+G-MPB, ,4 ލP 0$C&:P @3@/ PY30S CSc 95PP / 3@cs0S0S PU~T30S4 0 P. H30 0,30E) 3 3Q0RQ300?o2M&Q20S  2 0P0002@0 0R R00 R P (2<"0P00  22\Q100?o2& Qy10Su 1pP0001ph, $+ $0PQ$0S0Lm$4PU Q 0S 0S 0lP 0 000 00QQ000?o2%Qx00S  `0 0EP00080.+* `V**܁*.+* .+.+*؁*.+PG-0JMM 00`0 0`S+ @1 JލЍS2 0S! 8P 0S09<PP V0  t1t p1 R0 0S0QZp% 41 @T (1(j! 8PۯZ@#P0͡ *0S w@$00 R   R 0D ['l0P04qp %R0@.+.+ .+.+ %+*#0.+NS0 0 0 0\0.+X0 0 0 0R0.+ XC-KM MPk* x2 Kލ ЍP0\"CN8P @<2@82000(F'P 2 0S@2 j . P0 NaQq0S 0S 00 C3@P -`1@0S pM5PH1 \¼0P 818!00,1 060S  P+ 00 000T   /o" &l0Q00S 0@0P0 00`0@\兢.+[*0.+h %+*# `V**܁*!+o .+.+.+ X*S؁*N@-PAMM ) 0 AލЍ@hPP0 K` pF x!t0p 0hphp0+27P0S 0 `X.+*k0.+ X 0P/TP@-0@f)000  0.+*Pp@-@PoU p pQl0l0 pP `@0P00 )P .)pT*0@- 0*.+P@-) $0 00S/0h.+**0@- 0*.+Pp@-Q !0?o20@0`Q  圻0S 0 唻h0S P (00p`@tȾP T0 H忾P80 4P400 0h.+$.+T*I0*_*(0@- R 0u*.+0@- H 0*.+@-(@(0 = 00S 0 *.+$.+0@- - 0*.+P00P0SA-$a t(00Ѝ AP0q?oѣ2 PP%YP00\ Q 0Sh000AP ,L 7`0T0 0R0D00$\(  ,ܺ.+*`**ThX**0@- 0*.+0@- 0  *.+P00P0SA-@ (00PP.p`P 0 `0 S   S  哺0S00dӽPL03P <~ 0?o20.+*p*l*TV<P00P0@-S ' 0 ЍP  5P 0Pd00}S`00S T0T[g0HP 40 0, 0( 0.+p**(%+++0p@-PP00008@Ppp d$p@P p@c'L2@ 0S80 0 00g.+*!+*P00P0@-S A' L0 ЍP 4 &5P 0 7P 0.+(%+@-M P ' D1 ЍP0! 5P @1@*P0P`p 0@P*0@ 0 S0 0S P P l0 Q0S  L0@ 0P000$0@.+[* `V*؁*(%+*@-P& 0 ЍP 0S t 4P 0S0TP0@P ,0 $ 4P.+$(%+ O-@P`pHoᩒ @y#PM10S1 ЍO;fUlqI@\5@ 0, U g& <1 TD  ЍOpX(PPQ 1RP "`Һ5|0@0 P0 000"P |7@P ?PU t$#p0PlppUUU@ @ Ѝ %+*6,SJ.+i oc1A- MP& 2 ЍPO0S!3P 0 1C"P 00|S %7P P 0t"@h1d@) PP!@4Q$U h0 ,0S0D @Y  )$.+*܁*0p@-p@P0 p@$\0\`0XPS 0Sq/0S0p@$ 0 ЍP | #2P 0h4PL00}SH00S <0<c00"P 0.+Y**h(%+P00P0@-S $ 0 ЍP | 1P 0hPL00}SH00S <0<c00P 0.+Y**(%+A-MP`+ @lpET \P4+ GW+ A@ 0 ۍO(%+@-P# <0 ЍP $ 1P  .+q @-P# <0 ЍP $ n1P  .+@-Pn# p0 ЍP 0S L P1P 0S0,^  B1P.+2bPp@-G# <0 p00@PP0 BPp=.+*0@Sp@-,# <0 p00@PP0 'Pp".+*+5Pp@-# <0 p00@PP0 Pp.+*BGoQP@- " $0 00S@m+.+܁*OoQP@- " D0 <@0S 0S '.+܁*@-0@-P000P0S " L0 ЍP@ 4M@P@$_ /".+Tp@- M P" 1 ЍpP! {0P 0#p`1`Db0S@1D0 0S 1(2P1&P/0 0S 0@T 0b!&`{@P  d@ !0@ H0 @ 0@3/H0T 00S00%.+*]rdW* ܁**#d .+0@- 0.+.+0@- 0*.+PA-PPPPU㈀ "00P@lph0hPa00`0 @00T,0P A.+.+*-+-+7@-PA 0P00a00 Ѝ0P!0P%0S0P 000@0S 0 S  @@00+T0 S +< 0 /P.+ .+*́**)+%+Pp@-@ 0?o20 0P |!00pPlP 0 00xP0t tS00Pd \0@QP(0 0JP0 .+**T*P000 0@-S$00 00 *D*$.+L*000 0@-S$00 00 *H*6.+P*p@-@Pp@0@- 0H.+.+0@- 0U.+.+PG-rR@PpZPYTP`Q ,`PbTJ ,@PP[$$ UL1`H1@W <10S $1$!0   S! w U1`0@W 00S 0 0  S  ] u$ r$PKP`pᒶP \卶P L制P Ѝ4*8***Td<*@*G k @-u0.+P@-r x0 psP \00}ST00S H0H#`@cP 00 0( 0$ 0.+** (%+++P00P0Ss@- ? 0 Ѝp0` 0S P@P 0Q R   Lϲ 0Ѝp@_$Ѝp@².+ %+*#0.+/JPp@- $0 p0@P0Pp.+*zC-P D2m@r0S424_P80S20S 1_@0 唀 0ܑS C"! !    㒃#A P0 U0CQ00CS0Fi PI00CS0J` PA P!-PS0 Rp` 0]_0` Ѝ0 `v` V` 0咃" QP 000 UQ00h0PEP00P0 0 Sp(0L{0 0 S.+******Б%P@-00P0S`  E00ЍpPl  +-P 0 )qpP@ 0 $0$ױU000.+*CP00P00@-SM@  00Ѝ0P  ,P 0*)qp P0P0  ) 0,ᠱ0S0000.+*LP@- 0 P.+RW@- (0@P0 @u *_P00P0@-SMp  00ЍP  ,P 0/`P PPP 0RPT@Q   -@  D   \00.+iP00P0O-SM  l 0 ЍP  Q,P @P@ 0R@`-|0P 0U0hph`h@Р0000 0<0 8嵲.+i$.+0.+*XSPA-p "00`@PP  P P@*p0 ` S P寰@@ @000 (墰0.+X***A-p`P @Pd0 A\劰P [009-400SU0 Au긁** A-PP   R ЍAP  R  X@0S00Ѝ@`p.+%*q 0A-p`P0 AP@PLp @A3P 00 )00.+*Pp@-o H0 p@00Sp@000']0$@$P0cPp.+ %+*-*Z0@Sp@-O `0 pX00Sp@H0H]0<@PP0,APp<.+ %+*_* @Rp@-( h0 p` Rp@P0P\ D@P0P ,Pp .+ %+** - BR0 R  P R  O-M$M PQ  x3 ٍ$ЍP 0\#C*P HS@p@3`X ,3 (u PP@) 0`t' P0S 20P @B 0S0B?003pK\"lX\<"0SP$S \S0P0$ 0""  0 P##00C   BR 0 D)b0p 0@0SPiR 0PS 0 D )b[0 @P$18 \ 1 R ! R0 R Ȱ[ & 0  尰2/ R 0S `0) P0 0000wX& 0`SM!.+*****P%Ё*]r܁**ԁ**@-@P p00P j00Pd00 -d0lM T00S D 0d⊭ P,00pp[*؁*A*hY*-lMqP00S @ 0dk P(00pp< j؁*[*hY*@-@RPp `0 0Cs0S03  ,P0 S 0Cs0SP03P  0 0Cs0S03  ЍPs@- P@: G P , 0S1PS !|,tЍp@,*`(P %) P00 0,ắS!0Ruh~p@-@P 00PU  Pp00p@-`P@0 P< 0 >.0St 0l R0 0 {Ѝp00S 0C Br R0" x*P/0S/0@-@\0%\#0S P   R   0W7 0C20s0W70 0C0P%C-pPM0P@ +PP0P   +P 0 00P10S&" h+P0P 0 U ))) 0 01P1 \{8nЍ/E P @)`@< P 0PS 1` P):`- P P)^P Z: PP000S`U'  z0S 00S0 @Rđ.0 {@  X) ` 0S 00 0 m) 0S S St0 PUt 0`S[)H0PU R),Ph**K*q  - BR0 R  P R O-0@!M M P<@8@4@@0D@@@*P4` 0p 0S 0S 40S 0S z@4j!ݍ Ѝ<P0S ;0@P DzP 4uP $pPlz gz0040S 0S 80SxT0sX0s\0s`0s0Sd0s di&P>0S|0 /.P&||&>|0S |00S(1S  0O 0 -=0S z_|tP' (1Sh=- L)0S zO1)፜P$-$?$O 0 ")00 9Q /h>0S-@> pR*` @,|0 Rd|P<0] |00|SY X|,0Sh<0K|\ ZN H屩> = }x奩L,<@0S  (1RS  S ;+q 0S 00S K? 尐0P{ 0Sx 0&P`hv@P@ 0S : .PToV :F'@PU ,h@h0S(1S h0S\ < 0 P;$P A%yP  0P!Q/1L1H1D10d0p P10D1S 0S LAT# 0S aP  \wQp0 0;v0S 00S P @Ҫ0L1%LGTGύQ000(!R_ @@Q a000049010_/109pP W20 wPdPd0S ! we9PTp`HVu  0g_0P0/H/Pl90S PP<g/⦎` $   00S l g?/冨80S00?o 2#PᘙP0 P70S P 0S%P 0S%878G`4WP@3) :707P 00@T B P 00@T 3 P 00PP 8NpL/DF\P<0db'(P< 60S'Ph@T)$!&G&&5u`V;f 0( FT & |ק@6 hЧ6@T K?0`0,%14§@($!x&50SP P4$g& b&`h$4QX&T&px0S``\4TTPX 40S `5 h儧@ T:&V 40S 5 0t@ *&T %&&p omL40S 4oTPC_0:xP0# 0 PG  }P  0$ R @3000@ @p`P@ Pt# @Pp`@"   0TP[= P u`3Q00S I[ [ 80 P$0DP 4P 0*S t`Q0-S tpQ P0000 /R *R0 t0Q@00000S(2 0Dt*hY*G *5[$*(.+SJ(%LlZ*%+  AKKX*d}q ****Ё*ԁ*_ x*X )d*d=Rt*er&%P%h>MW^jD1dw* X l_ {(*hY*Egz4*$.+@Bh*0** 8.+(*0.+ *P 0, o<0<0o0P 010So DP "PdP tP BtP:tkp00p0P P xP 0x0 "xP$0S S 0SX 8$0K?CS3 U 0Sp1 0 Y ᄧ 0S U {[H [ !"2Ss"$2Q0S G?00 l2 @~SGP2 lrx0SD30= 000Q00SvzL30 00 Q 00S% 30S0l03[R0st3@VZ | Pr|XI0S40|xq|?`;4T Rʬ4$>p4R P 4D! 44p\0ǟs \0\0#(EpPU>  %PL3s0 0t 峋 2t PR 0"0C?o2? "0 "t0Aيq0t0t0 R ;R t P 0t0t0 R RU 0S;0S(0?"( ,0"-p0S ?0-U0-͡P!͡!--R0l 0"R0-͡0  $`P#PPp0Sp0S60S#PP 倊&8000-R0040#- 0 xxD @@p@D L HzHPL #P V | R70S 70S7P #p0S PEU0S PhBp  1Q 0!PZQ= 0 Q0 F#~8 8pŸp U00R0SH PtPr   $P  4P( Ud f890Sf09 Q aX) Q0h9 GV|9#B 9R-sr VO -!0pQ3/P|Jp:@% ᨣ: R0 0:QH:L=`*`0 0 S00T.X -\,`+"0S-:| 0R/G0S 900x0S x20x00S +000S $00lݍ Ѝ0S 03/|0S |0|0Y @p`@Y@p`@s@- P@w!P  q!P0P KЍpqk`P  ^!P 0x FU 0S S TwP 0S  (E!0PP Ѝp@s20@-Mh 00P P10S 0S00 0 Ѝ qQa @T0 S 00S 0s 0 :P 0 S000Br@ T d P 0|S a00 0S00 0000꤆*܁* $ hY*h* *SJ@-P$M`@ 0000000po 0P/S:S Tf @-  H,`& 4p0/0&@P/:&`P p@ P $Ѝ@/000`0 ?@PV@`00l0@@DcT@@00@0CcS1S@K .+PP00/@- (0@  000@*x[*@- p0@ `00S T0 0Lpp<0000S @*؁**tx[*@-@\00S P0 0Hpp8 10 10S @؁**tx[* d0@- T00S H0 0@ppo00 101000*؁**tx[** -X0lM@ yd @80 00ssJ v*P*\*@-0lM@\0 0 00 0rS sS ld dd XP0 00ss,Hd $**x[*(.+|*\*@-PP`@ @0@ss00V 0ss0000@? P UV 0A0T00Ѝp00CS0 Sp0 S 0 /hO-- LM|0xp0?W0 d "?p0pW ( P`PV0W B8 8 (0,0R< @ 0PZ0S= S0D๹0Y 0   姑@P* 0S 0#S |0pS L1 R 0@@0`P5 p`5刵P<!00CS00 S(P50S5U <% 00e 0We S00G00S,+ J0S 0 S Z000S800CS0PP00CS00h `ȟ0 @P00CS0 00 0 s`83 ap0SS 00   00BލЍ@d3@<30S VW@@ c030!xE30 V S$ " R 5U Q Q$Q V RV"d 0I0H"0M0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U 0   0ZR@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/x[* .+x***|****;* .+%+6P%T*-A-` @T l 0 ЍAЍ/0p0$ P txKT h0h oB0@S |P 5/꬇*.+x[* h*OO-@sFM M`  @9  5  01 0$0p30(0$ 0,@7/0P S l 墡0 (l 3 @ /0 @,Q(2@@ಟ@aGT  gl 2 . 0 PD0P2d $P x"xdc d_0S 00S D 0@d  IPP d@0S00?o2 aP 0@6.6 D01@ pp xσH1pD0(66S0d00 0d0( A 0aPS kP bP ^ 0 00S 0 0勝OP@ 0 @0巏0@,h屏 0@Fލ Ѝa*X*.+%+**}a*7* *k0O-GJMMs~0`VXf600S00p e 9問PEX 660 9傏PX2L60 0 040S97S\ 6 0S# X6&0S00]%Q0*P! R % BR$5J00E0S P,97S9 p5xI00HT%T0՜0 RS0$000(0000  0 VPR 4 4X ׍0000Y4I40܀C XSX `400$ 0C h00d00`0\D C%P 4D!>\ 0h0$<` ((0d $r 0( 3?$r / &<7R 30 R0S R3(0s0?008'PP3Xm97S JލЍ000 00u0S   0lp;N8'`PX20 0 0@0U 0  Tpl 087}PL97Y] Ś 0S [Q0sN0010S ;7='0:7<0?70>7<P0S ,0< 1, m"P!1 R  L 0 0ZP 0S 0097S0 孛0S [[ZX  ST000 00ύKx[****a*l*D*܁*L*p**.+**7d]**.Uga*Mm@-2Bp`WLM LЍ@S ypPk  rpe 0001᠍1 0S<0 ?!tq(Ⓧ ( 0R0 0SZ=9Q ='/?@#b!"/p8W0S S0#S 0(60 8Bpp C0S ?0#S / p!p 90S0 00 0 02LЍP49i00**x*Mbx[*0A-Pr@L0 @2T` R ] B P2  Q  ,00EE?AA?1 R$!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 0 S 0)DD P p p( $8S 80pP U 0S ,8S = (8S J90p 08 8$ 0p3/48S 0S 3 D0R <4 Ѝy*4*Б%-]r $ P/ @- P, P   Ѝ@-<@0s(00ppv0Co&%*p4p$0 00/O--TtKM⚂0 P 0 0SZP=9 =:k{ A8`Y0 P@  A{ QP@0I03 3# ( `#0"{p`Yڐ !T <#Z030(0 0f$# `  Z (f 0"`<  d00CS0rp0 dL\0bp 0 p P`, ^02S^0C0YPdp0S    Cb"c!   c# 0hS<0\tY*p.+q *%+) 6h***P%**@-0 @0SFP  N P  0 00@ x0 l.P T0 L%P 00 ,P 0 P%* %+/oY; - BR0 R  P R 51A-0aS0P0P3U P!00.SP l`1h咊 \HT1P@  D(P00T,!,!,0 $1$ U 0!q0@p000 00000P0 0pS000P0T h0h0 @U t0P$0`W7p**z@***Eb*B%+%+^%+%+  %+T*| Zgrp@-@P 0x 00p @0h hP0d Q0 P0P H0@D0@ ߋ80@0S, 0p謇*܁*%+%++h**L*P*** H0@- 800S ,0 0$ppz*؁**t*A-@Qp0S `0S 0ss{即00`Pzz00000S t`0S 0sszn000080vT  5p܁*** .+O-2AMp2 M0BS t20S Wt tW @pt W` 4S4pW  $Aލ ЍtWh1P+;004P/S +2+.fPToizpUp們0| 00g000000000S H1oK41+ 1 R100CcSppW000S 0o. 000000d{tWU00EW$<KWpP干x +P0 p0~**.+܁*\*K*$.+** 1.+* A-Q0qS0`00@S Q05P P V0 R 0000@ `ЍPl00}S0s00T 0S$@,5 p** %+*-V*P%.+O-쑟Q0AS0`00ԁSp4M Q 15`4ЍPF P0.0lP00XbP" H@P$,!0J20$A$000 0A@, EP 0 3@ 8P 0$0%qp`00P0}S0s00W 0S(@<"5 @p** %+.+*^**@-,@02 P2+!s@-Pd` P@P <@P (@Ѝp*Oi@-@P!+ 0A- 0@0PS0p`0P㬀" P 0S 0"S0x R S  p`"R"^ 0 00+p**.+-7+*p@-MM P  I`PۍЍp@Phjm4/Sc @ P;0@TP/PQO-@pP`V1@@P`3:`E0P԰0Y/  0,T@1PSZ 0 10S 0#40 R = 0S*00 000 Ѝ@.+*@-L0@0 <pp{ypP0 0SP0 0 @Ѝ踁*ht@@.+P  P @-pPx0000Q/`0000/0S <S0C00S/ S/0C4*<*8*@*@-0 000& mm R Q 0S0000S b0Cs R S          Ѝ P%L%@-(A`0S0 0 0 0!0xp 0S:S50P0S0 0 000 xp0S:S5000h `0PoxpT=l00, 0 cxp(1lЍp舆** )FG-@\〠pA`^ P \T1:00"^ ^ N~ W\^ \ @2O-p@t`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V% 0V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&܁*SJ%++q ++/A-p`P @PSP0  T  `00T  0@ R   `FVx`00CS0 ܮ PpTL000`000 0 ST00cqБ%A-pP `@0尀T 1婄 00@)ax 0 @P`0 \嘄L00D P 0 Ѝ*?*Б%ԁ*Ё*O-MMP @ 04`0  T3@`T P 8#8T $ 30S- p Q pWp vp@w0P00E.002 P E"cEPt?jލЍ Eupp0@@T /j@ 7up@ T"j010PS  \v 0$ 0/ 0$  up@O'0$S*F>C0S  @vX$ (0Q`$0SZ=9Q =)/?@#b!"/0 0tp70S 0#S [0AS  T0 0000 0up 0S 0 0 tp@@q0T4T ikP<00*7x*Mb@-@Ѝ@utp@-P`L@P@ 00P@ 0S xip&L@-P  Ѝp@-MP@-Mp  ЍP@-"P0@-PlMQ@00 00 T  40S P 00 P 0 0 0 PIcsPI 30S @@@` P X P `(=P@ 0S  ϸ@P@   ' P@ TN T  Q 2 @0 S7 x崂@P l0@P/T2 P如 02 P t00 PU  s P e0 0PU  dP VlЍ|/m0S c@P@$u E0S @P@g 7T 11@T  0P 0p`VPP)+000m0 0 0@Q X~P@h*)***OGL.+1Б%@+*܁****Ё*ԁ*++7@-PN 1 Ѝ0Q0S 1 1P !(0 CRtA R hS0R L1P 0S0h,S 0_P 0S 10S 0 0巁@ @ 0 @0@0 @0 @0 @ 0 00S 0P.+܁*%+Y*En**`***]%+%+%+x%+t%+T%+P%+h%+%+wK0%+,%+*00S@-@0M, ? 0ⶱP0S8O@0Ѝ0@*-A-  p%50S 10#S -0'P0,0,Ѝ#0#S @P @`F@P40@ 0 $<00(0x*Mb*;0A-S`p@  UP;P0 000(0(0S PЍ,0S Q 0PPEUPG 00 00 0P 0 00 0P (0S,0S 0S0 0XrPP 0 S@-p`P @P,0S T000(0 ЍT00a0@ R   `FV 0P 0 ST(000(0T00cq/@-%e3+80!R/P$0<1s0S/~10/3+)%@-4GM000030S3QGߍ 3? P t#1Sl!`R< 03/@3@CPQ@ST$A 00@S@ c?S~@PJ brP MPF}1P @00S 00,S00S0 @10 3/P 2Q  00000000S0S 11 03/ 1Rn}iP0 P0 0 S+Z000  P`Q0 P00 S>0000S 00,S 00 S00S 0  P 103/P H0Q  (  000000Px>+>+?+<+ 3+_{)% ?+&%1?+|>+K9IB#d0?+@- 0 ! ?+@-" 0?+4+P `00CS`0p S00 P0S X0X /XQ~Б%C-Pp@  l1s0S `l叾 n㉾0S { 0}`V   Ѝ<+)%?+s5+@- p( P@ P xuЍpmX0/LAP 00*, z*)%%h0@-0@ M+)%>+t>+-\MP \g P L00SD0\ \ЍoP|#p:+)%@-@80nT k|7 z>+D0@-|AT 0S  0 m)%<+@-< LA/} P  0 -Ѝ)%  @-@0S S S 0\ \ \P \ @P0PA-`@ ?z  嘀?up  ?pPt @{P@T*\ЍA01 !QTUQ s00 {'%OG-AMMP`PuxB  d2d `2 FmT2 P_m 0 04R 0 0 Rm 0R  0 S!R^/`MbPp@D✡0S1 0m1 0S000SR&@@T  lT @#<1<1s0S b P0]! 1 lmAލЍP0S S  S00<1s0S K{p 0圠0CZ lZ < 0 @<+?+>+>+(?+l:+>+4+! )% t;+>+0@-EM,P mP#@PEߍ0 ,PP l l ll x0 <  TPpml 'y ) ? L ! )%m O-pT3MP@ `<<Nl8pV(#o3 ^lUPE*pgaR00CS00Jp00 R0S^P1s0S2 Pp1 Ps0S 0 0 ^%\PP2D2l1s0S  #lUx0 PVS,1s0S : 0 S 1s0S <1s0S pczl1s0S 0〱0»h1 k RHP1P) 㴻 X $11s0S V`F'`P`ᑤ <1s0S0 k ЍS R   R\P0 U0q0QLLD>+?+! >+>+(?+)%<+?+l:+>+t;+{   p@-BM,\@P3L1 Dbkkh$!1 qkPPx`0<1s0S s` P00 =k cB?Bߍp [`@`⹜UPp0'l)&N<yw >+>+>+(?+? )% >+t;+<+ p@-BM6,hX@P3X1 Pj0!(1 $kvPP`1<1s0S ` P0G0 j Bߍp _@`OUP|@kkT<-ylw >+>+>+(?+? )% >+t;+<+ 0@-Pp@4M0\0PP <<0000<<0  4Ѝ0<+t;+0@-@DP4M 0 0P88 04Ѝ0<+@-M, ,PF A e 0 001 Jj1 010000 001s0S 1 011s0S1 011l s001 012 02 2s0S܍ )%>+7T>+@-(@ $k @k<+{t zt @-@HTkj@;p@-@PPpP p0@-AM MPAލ Ѝ0jP^0!wjPPl1LAd1T@ii@jii0!P0#Eku^iii+i@i 'U 0S S 000 %T^   T lxt  10D0 S B/o" R  0C nU )% 5+% c  4+@-MP Pppp pril@PL\܍@w, HP j܍,0 < )?+ ?+- L )%0@-MP MP%@i0@SۍЍ0@AP551d d3iPPTۍЍ0@w@ 5(w , ۍЍ0)?+C 4+K - d p @-#P xxE P ``xP DLЍ@bw@@Ll1s0S(0Ѝ@#uЍy?+ r )%<+p@-P MP(P0@Sۍp@5P5p`w@P\ۍp@+wP l! r R< < 5v ,=ۍp)?+ 4+ r )%   @-  $Lu뀒% O-P4M p858p=0~0`P@p0p 5% zp0G$t `V V Q 0 P0$404``TQNK 0p$p`vh6P`k pXh T~TD T<<u44 U! R ! RD$ ttS)`S FSJ (9S /S 00C7'pa0CS> = > = d? = = T? = = = > = ? t? > = = > ? P{ES 0SvePS43@=P{ 8Pe 3@Pb 2 Py00T2 P$PW  PS dPPA d2!00:P2 2 0030SD$2/ $ $ P %!,00!0 0 ȡ0,P   1 T T@0!0!!00PP@ 0  R 0 " l +>+x>+<+I P9+(%Y}ZX)%%O ,xY"3>+g@-Q\9+@-@M h ]0P0 0D!0@10S  10S0S@ЍP  ȶ00Sf0@㼶P[0 000Sg0S f00ST0T@0 S090Խ 0Ph$A \9+>+`9+<+<+O t A-U0S7P@@P|=x0Pp% /Q4 Cc T&e`PHeDpM@u0S+ 05  (5@$5 5 5 R- +5 400000@T ,P 4 @Ѝ0400/S@gP v v vd\CrPC 0SeQ d0S Pfp=0c Hfp;0c0S00:  cP|s R  0S \3Q 30S t㦲: hbPX30S 2Q P =o2: @bP 2 : bP 2l!: bP 2 : bP 2 : bP t2!: bP T2h,!: bP 42L<)%H)%$?+?+>+>+>+t=+>+EQaZx>+P>+$s)%%SX1HAVXM{ <+n>+)%>+)%>+Y>+>+>+O>+>+>+l@-2(@ $t sq뀒% @-0S fqfh:+tT@-00CS0p0 00S00Б%h:+P@-@P h:+3 ֻt;+ ѻ;+0@-M0Q00@ 0 s ƕP 0 @P00CS0᜝p 0  h00S0@oЍ00 p0 P 0S*000h:+HJ OБ%Aq 0S/S/p@-^?P\`0L R DQ t p hR `0QR@  0R  P;+DPP 80 dÅe"Å^ P?d" @pef"/h:+<+A-|rx@xPx`xp 0TS 0T `0h2Sltr T 0T*  0jr @Q@'%)%VZh:+0@-P@4Mlt.p/p 0<, p"lR < 0 2  s0-   S 0"!8 0r 0R><r> 0ֺ4Ѝ0h:+)%@-`0S@ cP0S 0000q20\ @Xh:+iB7@-0Pl000p@h R R  l R  R4q03/ Ѝ0Q P)%4'%h:+Op@-,AP1$aS 0SP ;tEAP00pPP0P P0 P P0 t p:rh0T@T  "  \ p0)%h:+ZX6Y}w%(%<+,0@-1s0S 0P ՛o)%?+(0@- b@0 c>+(?+>+p@-`BM Pb@0 S0`01s0ST01y0 q0Pn00x0 bBߍpB/ BR 0b00P y0001>+)%?+>+ 0?o2 0/)%H-AM M r 00000P00챟a1 bPھ0  bP 0SS WS BSr1 +b P  sUr0S Y e1P0 S0Y ?b1s0S Ԡ0S  Q@ |PY 0@^ST00CS00  S00 P0Sq>+0Q <+(?+)%l:+?+p@-PH@P@pWP P PP @)%10/@-bo/A-@PP" p00CS" V V V |V V V V V `V !PPrᲉP0 P00TA  0S P0000 !0S0R 00 DS< `00CS`0p SX0X /X&qБ%7@-`AP00C!S0000CS/W W ,X X ,X ,X ,X PX 0 "S 0S!oo0 0P0 q0 do0"S0P0 Ѝ0@f 4o0 0P0 p Ѝ0?+O5`30@- R RR \R ^R^@N  @0 Nr@T 0N~@T!0N~\!n0( ^00@ 00S@hG-@IP2 pqp =`P`0PP2 00PF 0P  V @P 7@0S@0S 00@PP?P PPP P  0!SPoG s(?+3)%A-@MPP\1 n o@P `p崀  =PEu00u0ۍ0 uP 0@ 0000S n  P00 Z)%p=+p@-`@:PP 0 ~Tp$PJ@p(s@-@P`@TnЍp ` a R a xa(R( d`0PMP O<HP K(CP <+f@}yxt yt ?+0@-@M@0(@,0 0 @P Ѝ00,幯x0 _ᲯPPPP0S p00@SP^ ?+)%<+@--n (,?+@-@ EaW ?akkP Kk _0P3P xntn9h !a Xs_/k a_Ѝ<+xt yt f@0@-4MP3P4Ѝ01<1s0S mA0 0 9 0jyk D9_<P4N0 1_,0E RL &_ "_9P 51PP Rk0(0S"=Rm00ES80d" PI T 0Sf Dg 4g ?@d j00 S @. @ C< j0ЍC\j0,%(%`p@-Mn]P! 0: S0 0 S P@` 000vЍp [p P @TPT0dHS 8$    ϖA+'O-0]M-SP M0S 4P ]ލ ЍOv/u]ލ Ѝ@p㤄\P$ 00S0W0S 0S\` ipP@ X T@pu0: S  SГ0S \[PP _u h[W ]ލ ЍOl\P [[xK0v: S+5( `P@`iPg  [P p  0060 00O 0S0S`-[P`c[`[vH`0S 0 0ZP V ZP z{ R"\yRwZpPT D\Px!1Z[ h 0Z\Z[UZp`4 0S!P0!0v0h P: v?b o 0S -vZpPv7*P-RZ 0S Zp<vA+,%JlGVhv -^gБ%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000TP@-@P@@0a0S 0S Gnl5Bf(A+@-iP=6kp@-P @fp 000/|A+@-@sP 0S`P f g d#PЍpPU P  P0P0H|A+H@-@P @ 00S@p|A+@-@P$00SЍ@Ѝ|A+A- `pP@P000 PP0 0q @-@P P0P00S@|A+0 R |A+hK A-`0QS@X0S@ p8P8 p$ p0S@|A+u p@-B0M 0SB 0PPdb$0 (0S ,0(0ueKPj >P^ ,KPX #P1 2P 1 0X00\00`00G?000x000020"00 Y  P0ЍpnP X1 KP4 P. P ,1 P 1 K P1 K P+ 0P$ P 0 P 0 P! 0P 0 P 0  0 0 t0 h0 \0 P0 D0 80 ,0,|A++:,7@- ZPP@0PS0 P xP0S00UdPPP dd0SP0d0(Pd Ѝ0ht@|A+Hlo0@-@ ShS0CS| | | | | | | | (S 0h i0 hЍ\XTPLHD@{P0ih0(|A+HHHHHHHIIA+@-MM0DP 01P00P00m5~{x u0P000tS ä0000000P4PT L4000)P44 , "P004P00430S 30S 4ST4STP 0S0P0 0S P 0S0P0HP 0S00$34P 0S00Tb400PP 0 00404 0000404 000( 04t04p0$0`PPTTPd D25<P`Q0`S PdP5!tPpPQ0pS   BPcPta \UP`L eOPP`4`H0PSe 50S 0 ލЍ04,.P 0S E|A+mI I I|SPq+q  ( 8  2Ep|A+hK D0@-0S K00ET@YKU@q+|A+@-@05 0@|A+@- Bo 0 |A+hK A-P/o"`bp2qp -@P UA1p PU||PHXU`X8/pL V@ P@T*U A Q I-IDI[I D uI 0 0A.0 00S/F+pp@-@ P 0s  x1@p@,%IO-@`嬐0娠T$0P ?990 VYvT00S[   S1 RP T@F+I(,%P 0S  R $ ,0/8<//F+O-騔M`VЍ0(tS,  RQ0$R00:?002P?00" 2Sh@V !sr% 0S 4 30S $STdP 4 0 40@!0`000 00 @ ` 0 0 PP00p @@0,t(dvyf`p|V0 Z$4SRA 4? 0 qp0dt2 0Dx RQ&0$0@R*0S 0 0 0@0@ 002  @@04 S*0MPf1 qM   10S 1[0?0S  T0$ $  [ 8dCB/F+A-Ā`pMPP#@a 0 DBC.B $-0DBt P 404'0$rdA{pA+F+p@-`PUp4 @ P@ D4p RT 04p 0 bb0@p@F+pA+ 0P/F+p@- @@0S p@P BbS .S 00CsP U2"cS T- P:40BS F+G+IJp@-PP`@ 01S E"0S *Sn0S 0Sn0*S x0sR  dR  kR  0C^S0S갼P@uR  @@pF+H,%0S- B 00P!P* C\/p@-@P& P`PpQ P @tPQV`n-PyPN0Sp PppL,%-%J@-lMcdPP0P 0S .40!0`,@$!$Z3@cP@P{@Pw@P@0 0  @P0;(P6(P x1(Ph,(P LsP q 3J?J}JJG+JJG+KJRJ[JP%F+vJ`JfJlJqJ 0p/F+@- p 01SP0|  Qppn]h ЍR @0!0P0< 0^Q 0! CF+JG+Jp0 R R R R 0S//////0S! @-@PPQ0 0 `" br Q Q S R0/@-@@P 0 P ?? q? ??  ??? ?? ??<1@-1@SQPqP!3? Qs0*=#=P00 !&?0Qr 0*--P 0!ɠ? Q| * !P p!lq? `P`ĕ ?`ll@@`@@F+0A-`@PP QT4@TT@DQpW E@T0t0S ;@F+ .% 2% Q p0/F+P@-44(\,P@P @ $P r0 L]0! KP0!T0@T0  T03:T03:T03:T030# S,,A #c!4,!0St ,1 ,!?   $CJG+JF+ @%00P0bA @SP//D%A-RPp @8`TЍ`lP 0T0 0fPL 1P TP00T0 0G+s@-3 @P 0S PPЍppP Ѝp@T @P 0S  `(00 0P\OSJ3+Oop@-@pP Pd0 S P @<` Rpg]@0P  4OAOP P / k}O+0@-PM@ T  0 BRЍ0@-P , @` 0P FBЍpG+@-`@ (8R808Ѝ 8 0 CS  8 0C 8nG+O+p@-@ M8S/ 0  0S R(0 (SP8`000 0C?UR B( 0 8 80C 80 CS Ѝp 0P*G+A+s@-P@`8 R8 R8SЍp 0b 80 S08W) 8 0 8 0P0S08H)G+A+p@-p@XU 8PE`V` D0 p8SopppG+hA%p@-P@M8`0 0 0 00C?UR  0 R 00C8.Ѝp 0P00S0 0G+A+@-@8 R 0 0 ( 00R0 8 80 8(80S Ѝ0CR80S  0Sʿ(08G+A+(080S @-n/G+p@-P`@p Q0(0p0CR0R: $0 p00G+hA%s@-@@`P@T  :A@P Ѝpp@-D@0S PX 8P 0 ppG+hA% $0 ((( ( 80 /G+hA% 0( ( ( 0 /G+hA%C-@ĀPp0S Ѝ @`0S 0S  80 8808'P oPgP (8 (0G+G+7@-D@P@`@00S Ѝ0 PG+0P$/G+0S/p@-@PP` |P "@(0 00P@@00p@- @$P $8 G+O--474G0pPS`M(X/ Q008(X 8# 0S0S  P0S08 Q00((XʜP  PЍ0 80 8XU080H?oP20SЍO$Q 5Q) PpP0@S$ 4 0 L \  ܯ X Ȱ   $  D eP 048048TPP0480488080 SA?0488S0S S 8S0S S ec0488A04880S} 048x0480480P48k0488S 0S S8S`0S S]8SW0S SS048(04880 S 80 S C80=08:0$48X3X3` @R( B WH`X  UP`WH80S 48PS8P [088  80 Zt2"8Q WD 0`48 wD(<8RqDPp4@P 0480 QZ`Z ` 1弁 0 0 0 K Z@@P) ᰂލЍ R R R00$P@ PX@ 0"ST  'P 0`pTOA%hOlA%pO0 ,0R0S/0@-MPP, X@}ZT% pp1KP0: SppI\ \XX LXH D 0X4Ѝ0@EЍ0hA% TO7dhOlA%pOA%@-@0 700000  0  x0  h0 X0  H0 <44@,08P+wOOOOOOKs@-P0@@@`0/00` 0S V DT T Ѝp@8P+]SJOT7@-P@0$09en Ѝ0@8P+A-p@9 `P0  P0;0 A3  ^-0@P    P  %X A 8P+O@-v*@$p@-Q@0%S!S0C Sp Sr\  h \ 0C Sc ػ p /S 7Sp!p@$,p@0P S+S@ AP WY0S0pwp 0!00p 0p@ 000Sp} p@q.0!S P -Y X00Sp HPDp@l00`Vp$>p@w$p8P+xA+P40U \40U h40U 0S P0P 0 /8PxUUt0E Sp  8 8 8 8 ( 8 8 8 8 8 : 0#0%*U @U !UW<50SQ07SN < 60SH07SE ;07S0? ?P 0#0CS>P;50 9e`0 S &0!R0?0m60S  F e`0 S '0!R0?0R | !R00 !ıFp70S!R0 !R0 0!ı3 !R00 !ı*70S!R0!R0 0!ı !R0`?0 X80S `M0 S 080Sy 0 S 0  D&mx!R0 0!ı/n!SeR0d 0!0<0<]P0TV0S`9 nMJ$  C@90S0S ~ @ 9 <P- 00!R0 0!ı=0p:0<0!R0 0!ıw?`0000!R0 0!ıe-``000<&:`S:4  `@ 0S X \+ drh;0S `D; FP  ;0S  + `+0 l#;"i,P m!R0 0!ıP P P v !R0D<D<T 0QH,Pl L!R0 0!ıP !R0<< 09!R0 0!ı+P . <Pq+qpm < z i!R0 0!ı+P$ !R0 0!ınPT Q Mh=` PDEP h? =000 0g000  0SG- o0% @>P0S >0S $>0S P P 0 d(ih>P0S x>0S >0S P P [0S  % M>P0S >0S >0S P P.P0P/% $$Pg0  b!R0H? 0SX?0գ?0/0 p/0 S00C0 ? !R0? 0S?0գ?0/0 /000S 0 (00S080?r+00S/G+p@-@P/!ှpO-pSP@`MP៺P80 `0@0 Y:X  80#1  X RH W0H 0Ѝ 0S  R  P R  AR  QQQQ R  X180 R    80 SP MTZZKI  P R:p@-P\ HPV@^^'P gP dP fPpdpT ^gP PP0  0S0A0p0   /O-PR p QPP @䠟PU4PP0p0 Ѝ S@0p0`P`@0 ͹0S ``F0 S0S P B0㍽ 0R R@0Q @-P@|P+ Q @-P@P+@Q 0 P|P+ 0 J|P+@-d@ CP kP  0S 2P Ѝ|P+G-,2@T @Ѝ`\AP!RU P0pcA@P`P 0@僵qpR 3AKA?Y W Q0 R MR +R GR  SR 0SSk SER SnR0SdSPX0EP` 0 @vT cT eT @ Vx@T@ @ ?   @PP OW  yO<uOsOTtЍ>P00S rP|P ``  YP >pA+lA+SJP+PA+tA+4A+`A+xA+0A+Pw+OR_Hq+RP @- 0@pA+00@-P ( @P+RSJA-P`XpVPU@JTP0+ 0 pA+ 0 pA+ 0 pA+ 0 pA+p@-P@@P Pp@pp@-@K`PPpVU Pp PpC-M@pἐ@PXЍ`PPPNY04Pt0SEpA+@- 00S T ЍpA+@-(@0SP00P+RS@-@%0P 0sS@ @G-`did@p00CS0 ovp PP 000 P U 0D IS  G*J$NXp@P@- 0PSA-@H-0 0pR`@0S00 R0S@00(`P0S U  aP@00A%A%O-MpG`@ P1!Q[ Z@P[@P* 00p00 0JЍPP P : PT0T VP/P  IP00pWpA%A%)S@-@9`P 0S PP Ѝ@t᯴@᬴@@pH0H 0P0JgM s@aM ЍoN `@-p`P@ Ѝ0S PPPL@P T0P 0p0uJ#Pn<P2M@/Mz<3KG-p@`P@ 0S :P@0S0# CV* UR@ R %S #SP 2@# C V* WR   R %S #S 0P H@pA+lA+p@-MPPލp@ 0@Aqp `,; `P|` 0S:T  K0S 0S   A 0S*PlP@q+C-Mp|1P0S ~s \1RPLЍ44@P,A 1R@ᱳp᮳p뫳p``0000 0p00I aL밐@@ᒳ`V 1`PLV @s0SDL 1=L;LPvTTP/ 804   $ ( , 0  R 4 /P+q+O-ap0PS$M1A0S 0!A   W  R ! W @  000000S ⸫PPP  0$)`P {04 `0 `04 4 Z `J P0p0PWP1 P#P3*0  Z0 0 Z Z`S ``$Ѝ E  A0r+q+P+8,%0,%5P 0@-厞P/P+P @-@P$0}P/P+O- P0  V1PU(0S 00011CPH(PꘑQ 0 (Q20H0@` 0P `2R <10?Q 0`@U 0S H0S0S u0(R0SH0 Q0H @`ʈPpP "E E"ETP0(0E7PH00C10H00PP(0P+(r+S+(S+G+A+Q+@-(@(0S&>C0(0P+G-tAp0P 0P0W0S %> 0`S@U `0PS mšP 0QR00 0R 00S W 00S0S 0  00 0   0P00SX 0  00P+q+TA+ B+B+0 0@ /P+d0, R X00S P@0~0/0P 0/ 0 /P+q+ 0,  /P+qp/G-`P@Pcp p倐x X 0 F 0V 0U@00CSʝP 6P 0A@P++PG-P0P`sPp̀@ 0@D P V 000U00C@C@p T aP0 0C J0 Q@ @D 0@DRCP++80P/ R/0 0S 0 /0S+ 0 R  r+TP+p@-L@ 0Sp0dS 0p`$P `r PUp 00S+TT0 0Q 0<0< (., 00/`S+0S+`c+A-APU  ^%(`P, `(,, RP0`VU, ,0 0 P ^PQ p0࠱ P 00S+1G-P0sUPP@PP0Ap`@`V R0 XWA V$ 0 0W PS 0)pP ` AY0 0 v W0@TP0  0` &qp .@PGP tA ` W0 0M0  0`qp @TPr+0S++P0G-dpPU !R00 RS@ U W0S Q0*P @P P`@V0 0 0 /0 00r  0@P`Pl`@W 00 H0 00r  0@P`V@0S++G-`P P@pl0Vs 0SP@`= P@tu TUPA+00CS0 Sp0 Sh<0 p/O-0P-SP }y&$L4-p,X,P*-D=P0S0@ 0S 0S%@T :v=, -,^X @>  0 ЍOu`P ሤ@ᅤ@ h@E 0A ( |:@=t(oNTP+`G-@` $PP( cpPP| /@yz  0Z`p@Td  `0 n(p Tt pp@ pT EtP+C-`qp p6 qp@@PP. .Y T0 0 Ѝqp 0 p 0a0@S , /A0@S'0@@- `l+U.Pp@-1 $P 'P6 Pp srpp^P@P<@050O00pPp\0,\ O  B%@ $,P M $0ON0@4ppU`l+pA+TA+@q+0 05S /`l+@-o0@-M@P P&  000Ѝ0pA+@-x @ sr NΎ004Ѝ`l+pA+7@-~P! 00N.P ēO.|~@P@BT  $ @P Ѝ0@  P Ѝ0pA+`l+q+@-SP ,0 0R HpA+$U0@-5 @P00QAC R0`l+@-0@Q"P P P0@Ѝ00St T00Ѝ@D00S<Ѝ@0,00@P 3@T@U 3 ЍP |r+@A+d@-@P |00o/C-MD@ 804S S S0U0@S  0 [Q0C0S 0 C Q ? 0   ^R000 QR S$R 0C000S0`0000\R00000L%+O-pQpPpWCM Cߍ@tcPSTp`3`#`C \\Hs PZ PUA (3T TQpP 0S @DT2 P@  @@ 0 HX ) fP@ )T@"0S 000P @B?1P SQ@ 31 Pp 0Q 1T PP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S P? ^0p0000-+L%>eБ%+P%Ce HRe0@-@ᝑP喑P |呑P l匑P \凑P GPYL%]ecejepeSJ@-@P DP P P(@MveeeO-P1M0SM A0 ЍOy` 100; 0p `wx@PЍ0S  0 |00 0ڏ 0P 0S0S S @P@P+r++e0@- PPPP^0S @T 0 @ +L%0@- PPPP^0S @T 0 L@ +L%0/+0/+00S /+@-rP 0 (+/@-H@ p P*0S00PЍ+FP@P7P/P?/80@SQ 0@p/a0@SQW@Q7@A-P`p?P@P$ ?0P0T0S@ s@-0P00`a0C@S     D        L   T  \  d    P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 Xc \ [@Q`V1!0 Gc[0F?o[\20S7 @`^V`00]QQ! ]Q0[Qp.GqQ 5 p`0W]Y0`QV0 0 c\Vp0[W` W nW \W`Rp0 V0++ee+f7@-0P| @R RP L L Dv D   Ѝ0@Rw @P%++MfG-1`MQ@P㈡``0pW0 p1PK P1 H1 000 (b\W R T R 00P@0  p0 [R .BqQ  [TS[Q@]R  00000T[@T[T@  ST  SR(0 R Ѝ̑+++jfL+00@-00M/SP M $S, +S00, 0 0 9S$\S @P0 0 b0IS0@S0 W00ۍ Ѝ00@00 S00@++ffO-@ MTЍ0tS bS rS aS @{S000`Vp F` 0S0QU 0W0 0mP 0 PUP @0@ `0 0a2pP%++++fO--`?M @}Q ;Q <,0 ` \ @\\ `<`,0 t@T @@ (<(,0 @\\\ \0\ AP@000J S  4P <40 @ R @XT;0S008+8p  _`  R @   R @` @ R @S 0R @ Rt AT- 1p @ 9)0 4" X 0庌P00)9 0:@@\QQd9d)0 f$ K@P$9$)0 pV,1S0 K$0,4 @00T@S0 8 0@090>: 009 Q00A0 0C S0 00, 4 P8(0 t\QG THP R,4 R $H, 4 00P@0) 00A  0哾0+ 00 0 00)Rm0I gRu b9RZ0RR R 6&0 PT   9R/RRA@ &R- 0P0 @  y\R0)0\ P0 Ar R(6(&0 [Q 50)0 0)0\ Q5%0 (~0;Rv IRpR wR9 iR0 R @ 0S <5<%0 \000) 0)rS0m0 0 0 m@e0"S T4$0 ,=09@0C09@0I0)0S 00@<40 0)0  0) QQ L4@S 4$0 9$4 0S$p5 0I,1pS0 KT% 0S @;S>B0110@\SS434#0 ~ P3#0 x4 @P 0S 00@0   p!#ppD^p2p"0 0$ $#p W 020"0 20S$000 S 0Q 0Sz @;S> }S Sp 1!0 0w$ 0 0$ (0 0< 8p"p000p WH 0S  "p U] $ "ppXP  0$ 0     呻!1 !  0 0 $p$( $ p$p|! 꼁+P%+++fgL%OkgrgggjEkԑ+ O8kkZx+gghfh+hihhiWiiijDjrjؖ%jk++7g0 0 (\<0< 0 Lb]00܍<ЍG-@`@Zp圀P䘐U@T00S Jl0h0CX0 0S0 0 e! P+++pk+8+L+H+p@-P @%000P @pDN%@-@ 0  @0DN%0p@-P`PUps@P 00CS0YIp ᱂Ip0  Iđ+G-p`dBd 0S2 SQ S$PUVP(00S S  ;P$0, \0000 00!"PQ$00P0T00, VPP (00S(0 #R nR0V ,0020#00$0,0$0H P( T0R #R nR   PH \T000(0V0(00PP P 0\$T 0\$w 0(0V0(00 000TPrđ+OM6+ml@-@X0  0S 0S00CS0Hp X0 ođ+G-(DMX0`SpM00S 0S \3#X0X0\030 `00d0XSXP 00CS0UHp X孁X %pP0 p[0 X PލЍP2 Gp0S 0yP 0hP ,p4S z0p0p4S \PP GP 00\0IP|p0`0d0S00d0000S 00Sf \P00 2 02}[00S +6+u P0 l[+0(J+0#] ]JL^ 0p! P*\PP uG@P\c 0 p,p\0pp! 0`PS(00PX5000.|0\`0P l000S S0P@ 0 P00 00 lC(00(04đ+slБ%4+,+O4+llllll @-P Z ЍlP@- Ѝ>P Z Ѝl@-P0 Z Ѝm0@-\P@MP  0&0 &Ѝ04+@-`MQqM0S000@03 0@-0S (^  0Z 0 0S S ` 0Lyl@P *0 o PF 08y00ڍЍ8+ +$+~@-@P   0S|VZ`p0 R `   80P S t ;ZЍЀ8+msfG-Ap0吁0`PU , R:(,50(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0   bn 0 8+P%A-@P p0R`*W00 Bn 0P P 0O-/MO00PЍ080?PU 0PH0\\e R7 0Sd?0 C0R 0i Pi PS4 0 PS>0@oP 0 R >0R*0 0HP0S40P 0 R D>0R4>0 0S> 0RR0S0S4 0 S=0@oP 0=0C>S񟗐L 0 0 0 0 0 0 ܭ 0 0 P 0 0 0 0 0 ( 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 t L  0 0 8 l 0 0 0 0 X , x ` 0 0 | ` 0 t L0 R: L `0p#0080S < < 800 [04 0dw<0S H0STP80S4PU 0`  E=yP080 A E4 m0T P$ 0  004 0 0  0:40z 0 :0RḚ <00s {0P 0S ռ0S 0h( . P2S 0 Hp` 0S0`V: $X U00@ 9@壇0S  0X  H0$P x0 H$0=$ [P9`0V:D h$$ !` 00C 0 s0P0 ,8 0R:L`8  0v `[ p _vx8P0  R:d0`dd8K \`((1 S:` 0   07!R7 800 g04 0Sv<0S diP0800 D0$YP80S g04 0-v<0S  80S0p4  Hx`P <000F400<0吆04 v<0S xV 0400<0H6 800 0V04 0u<0S `uL0 R: L / `0pZ00pY R  Q l5 50V4000  P 04`Z Z 0Z 000 G 000 00 V ,Z0 0RP  0 0 0 PQ@ `VpX 0  `G0P  ßH`pL(L<Hp(L<(0000S c04 0Ou<0S ` P/ 000Q00 0  0`Vp P\   `VXp0  `Pa 80S0s " p0 AV04 0 40P0 0{ P 0S 00P80S0s$"$ p 4 0^ 40P W P P R0x5\0`pL<0p<s80Sp4Xm P!p 0`R@l0#0Va*00000S(0!0  (0Z0  0;H0  0 1 RM0P& 0 01+8+h++ +ܑ+t+(%LN%ht@$+~e^m1m5m+;mP+ Oq ؖ%+|h+$ (1 0X`4H`pL(<Hp(<x0h0<0 0R0((Q 0{Q  꼁+q +p@-@P`Tp0wS {S sS 0p P 0 DCU0`@p P `OG-`Pk0pPW00!U01@ R P ~o0PV(AG=U !R <BqPQH p   T    :R 0SP0S X00 0P00 0V 0S`: _sPP 000BS KJl+fmmmp@-P0@0`T P PP# 0SȽ Խ   00C?o2S Pp0S000S000V0V@긚+:, 0@-MMP@P  PsT p4kT+  PۍЍ0OmH0  BR Rp R1 p/Б%%@00CS0 S0 / Б%@-,Aw0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@W^+0-01S ^00oS^ P0\ S0S Q0S R P0S0S00QR P,+0@-  `Ğ\ @ T\    %R    +P,A-\A0 5S <0S 300,!<5P a q 0U&%0 ! R8  (P  0  ,P  0  4PP wsAL00\P $P @ 00, PSP, +%{z+p@-@0` P(T  st@sd lP`PT p qP000STn @Б%%m+ms@-P IvP8@P-0?S0S@P` ~p Ѝp/љP@AHP 0S S e@?0S;00REmmm@-/. m%@-0@<TQ T00 0001S R0Slp@TX` T@0$ @H4T(8  @,+AnaHn%P,On[ndnwnn@-- e0o%7@-@Pځ  y0S 0@T ́00 Ѝ0Ɓ0"S p`@-@P  p RЍwop@-+ e@-6+ e@-.+ @-  &\+ A@-+ @-  Z+  @- 0+  + B@-\+ @-  Y+ @-  |+ @-  +$0Qa A@- +@-@D|P d 0CCq  0@-0 |1E, p@-,A-@PP 0S u`/P  ./`1S0cP /P 0p RV /`@-@PI P { }l0 0Dwl000A-@`\@*T<0p " RG\<0d$N R 2`N%@-@K@-@@-@M@-  偷뀒%p@-@PUP,2GPP( "`aݎP  u Pmp`GuFuF@ PP , 0@ S< 00p(+ܒ,`N%O--,M@0P0 T; R~0ATz 011!0 S01  R01;bP n,0S  R3/00S 3/[1P PP n0P 0 0S_`: p` 0 011S`@S0` $0eP$0pr$0P``PpU$PeUP$0S000 CL R RڰDPCPE_ C B R@ Rb 1  pdP\ ~ 0 `p0C0CS0V`0Z `1Z0Za 0 000 0^  0 "P P ]rV`x 0CÀ  S CUPPEPE_P0  zP a 0 00@0 PE묍P N m1 0 y { Q 7z90#?@0CS , l 8 `!0 R$P0g0w0[PP7000mRQ0!R0c !ġ1S 0C" !s0R11$`V0,Vsps0 zyP vye&`P0PSY ' G 5am0 \m Kdd/[ Pd50xPd}0jcGV S0S 400C`$`~H1Sb !0C B/!?1!1NSRPNQ0^ B0жs0xP00S11 ;zP`PxP@a@1S0020+ (P%J @@P8, 0@S%  D  l  4  ,           P h3P?P <P >P PP P$ZvP P1QF P xZ}1S(ʰ1 F P xK}P 00P1 RF40S 3/Pli PP gi P,Ѝ0R0 $` 0SpW 0~ 3/px P 0`yF P }x =i `}8i0010A^90 b"P 5 00P000xPdP <P >P "qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00P(+[%W,RSP%ܒ,ɅL% 001/(+P0 R0//(+O-p`*@PP [ ! 0P @ Ѝ0s00 0\"<|P 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @(+P/D0 R/0@-A1 P kh@< s(+O-Bp0 W 'k0p 000 Ѝ`$Z 0S rqP Z00010P@P 0S 00@ Z 00 QqP Z0S Z0 00` Z0S 8qP Z Z 0 0 00U0 P0HS0SPPq 00q0S q+C P tZPU m0X!0Cs0S 43 000 PE\Z<+VUUUP% @O--$MPZSQ0T @ 0 p$T`B <0X0 0S 0h )kajn@p pp0P@0@ 00t0000. 0DSDU 0 E 0U00ө?0U0 CR C 0ER 0 0jpY 2 fj0  BS9X Pp} PC ! PZ P P#0STkpD EWPE@ @ii,i@P00 2P? P AP7 0JSI1000 C 0 E0pW0@pP1Pp1 W 0p00@0p00@pW E@DOWPE]{pGT@D¹0 X@P hjnP@U@§0S 0 B0FY0S 00 0 0Bj$ЍO0XS <+TކJP%%A-lP`Pp `o@o@0T K`P@ P P<+@-P@Mp 0 `T` P@@Ѝ0 00i 0 0`p @MPu ,n@P ⩦ e%<+'Pp@-@*TP0Ps D` R :P 0S@@A@pe%<+@-@NC<+0tm<+0m<+-@-0 0  Ѝ Ѝ/-@-00  Ѝ Ѝ/-@-  ~ ЍЍ/@- ЍO@-@Op@-P@`M ,0 0(0 00`Ѝp@- Ѝq O--0M P` HpLnnUs\0 0`X 0YPc 0S` T00S\ l@PPT00PXP@ 0sHਏȀ0 0W 6p _PUWpV`JЦo`0 S 0`J0 0sPF 0 00`>P\0 0Xh0 0T00P0X sBZ  wt 7ey2e0eЍ@00Y00S 0S dlT00P@#@3@pysP 0 Ht뜰IH"g%g 9BŁ 0 E0GYsXP`HH`g g<+,@-,, ($ Ѝq @-P@`$0 0  0 00`Ѝp@- Ѝq p@-P@`M ,0 0p(0 00`Ѝp@- Ѝq -@-00Y  (Ѝ Ѝ/q p@-Pm@mp<+@-c7@- @cB$O8[PU x% m`a,00h@PU h%T ]`Q,00000S$$噯 Ѝ0T+3]+o`+%O-pCM@`P \\\ P,,Cߍ@ &@ Z-⑝0P0 ^P@Q Ok 80P0Y pW    n 0 =RPeP h0 0 xg@#dh7d%o1@-\0O-MM 0p@t`P2 &yPP* P 7P 0S0 0    4PnP'lP 0 Q0 0PqrۍЍ0P 0 0  0 K,00S/ 0P C@-Y+D+@-TbP P <AA(O"P@3KC-@$M  @cn0S0d;%P-   VnG0S$ |P 90Sm Y0] )Pf :BPaD' D* 2B^($ЍP@R0@ P@ 9A`P'='P'\20S hAp0$A P@ X $P 0)AT 'P P  AP  pPP0 +Q !Xp 07'WpT+pAT3 x@p 0T3:X#  4APQ  R@4Q p0Q  R@ AP`Vp003/P,00  h0S  R l 10!@+,+O0@-M M+@(e+(aXB+(eB+WX(8@PP B3@PP 0 ` @@@@@ @@@@'Pލ Ѝ0B( ?-MM+ e+L %X+ e+0X ?P  >ۍЍ0@-@M  m1@@ #P @  pP A0$*!PRU)QW&Ѝ0RL00S 3/P 0$003/0$*@P3$P/\P+X@P'@P# 0Pp~ 姈>h~  0S 0_ Z'P @P0o,m&)r*00+,,ܒ,@-@M l0@@?a#P* *@s  pmP 00*!R00$Q )*@P  T0S 0` 'P%(,*Ѝ+,O-`M!0[#*0S ` 0B00 SS@@@ahp @(0 S0 0`0@Oh 0 S:dPP@ B 0p00Q %Sg0S iSD %S* dS $P$0T !PsS$200P 0 倠ಠ@Z4!@ P %Q0@ 0S0 aR7 cR 03/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $$ Tl 00S  0! S 0 @S$SS0P @U:U 0 cP%7@-@ PU R! G\;(00 Ѝ0llP X| :!L v /\k( 0$[+o  $=^7@-@QP T40400 S  0  Ѝ0@.9+T+~7@-@ FPU  '['00 Ѝ01PP | [d00S 3kiL 0H[*k`0 ,T+]IZ+U^n%s@-8Q`@<lKZ|k bfd^bf` bf8fPb[9|h 0 Am@Pxxͪdo85P sC,Caa o2|Ѝpܒ,O%O--* {M`Pp ^0  p@(6 F 0S  P R M 0S  댵P ![|P [Mp@T Pchf @M+U\0B? 0>E,P  #&@P  &00[gPVgPe; P  h`; $;0S ;pP ; 0u00{4$"0{ߍ 0*0q_P6 00Zp @P  0A0* 0! P9hiVx00F  ASz b~x^ctV Pr^xd(ЍO Ѝ/5ht@ܒ,Б%t0@-CMlPP 0S .QV@P 4_Cߍ0 P_ d+c+G-p@ 堐堀PB`AT:00Z W ,/Z 000 UP EQ 0 @P%A-`Pp p@ Tf ,p^ P@b+A-Plb@ibopl ^0S DQ0Q.SP @$ $#Q Qd+Qc+@-M 00PDP k  ^ 0PDP ]  x^ op@ ( e i^ P)Ux@(  X^```p @(PPЍ P P`!ib+%i+b+8i(+5O--MQ zT@Pcdd0S aV:=80$d 0w-B$0B. -_ ;A %_0`Q>d0 ]@400a0 ,]P40,   TVTTr0@W R?0 2p0/djp x#|3 R0:P$P oP @0a Xk] []@P  U]P@; 1sS1lSD;"00`&a`P RP@;5b@P,>]*0x*0wrbP\8 0\8TY0 yV *0z*0}\8t*0|Z\:VT* Q0:$DR@* , Q9ʟP \ʟW艟^ 0/HU>H B0C   5PT  P8T@Y BU0X649 @p A\)x0p 0HAYip H0S[, ,)A0$$  @P @0 H0@H0A@ip AA`LVp@fv d! HdH p |)P p0 *\6S 0 >88,@P 55( #  [7S    l7 P~L7'AA\@P G@P 7T'TP\804'8\8P$G 8\8 RP0&08P 8H\8~ 4RP00 60&S\880\8P 8[8f0S X&8P 8[8W RP000S\80\8P0S\80\8@|n08E010 ~f`P `P |`P l`P `P H`P 8`P0:4X:4SU 0 PM 0$AtP @6M4SP  0@?S @P d[ 0{BQ0:$R##ßRl#p$Rt#W%0RT# U>N /N B0C   [0S1 pP 2@T [WxHHp#0l0S T 0S `"8zSn3S3 V\ #C?00N?C0C Yo`0  0@F0@`rFP;A?]p@`x080C4r@,0, P$pM0S x^Y0X6W5S  !JoX!SXF0S@0 <4Y4!S< " 0 t0 Vo iT+ %,JP%n%DVd+L+܊ oK`c+b+++,}7++XuHrb+^'i+x,/4I,8+3B7BM u`+Ĥ+/~?d0X6S/d+P 0/Hrq A-鿏P@,Mp_P3S0 `0 0` :00 0`@0`00Fo/00 P 0P/S/00 0 /S 0/0 P0% R $b@ 0  `@ߍC@-p`CM|@^PlP#d0RXPP @ W<0080 `0(PCߍCq \+X+ +@-@ @ +@-0  0 P @0@ L280 /P $  .ЍX+H Z++o0@-0@XMP70  0@ P x x0xP t0E@ 20/Q   LL 2 0/R@, ,@Ѝ0d+H X+Z+ +X+o+@-MMP^@P  *Y &Yލ0 00S@\0\ \y@P L0 (0< 0, |+`X+Y++\+++;@-bCMX6S KP \8lP'XT20S H,2\6S 8'2020"(b2PPr 10 :4S / wt\@aU |10 i:4!SO *00 0 B^x[||/2@P) c1l Q\NTKDH0S 4!4A,!,=0S  5  1,P/\6S *'U PCߍ 0 Bd+QD,uxb+Q `+bv/t+tc+b+47d+30@-P@ T\ ! 0C @TR 0\  @B_TQ  S"#0  @ S! 0  @ S 0  @ S0S000S\RQ @  Q  G-p@PhM 0S'phЍ0L0 3/P 0`  Q 1/P P p0ᄠ80:/P 0 083/0 \ P0//!01000/ 00#0//O-`$MPA@T 8[ pwWP00 0S 0S0S$Ѝ@-@MP Mp! *0 `p! Wd5\\ SS=S 8 d3R 0 ,0 ڍ ЍTTG-Pp0@0Mw'aPP ]`ĐĠ0 R PЍ 0L03/P  0 Z놁0 Z  H,0S P HI H|I`+p@-P`40@0S 0 p@~,~p@-0MQ!0`L0 3/P< 0t@T 4/@0 0 CZ 0>Z 0Hl,0S H4I,0 H/IT `H)I H%IHPZ0S0CH ,$H 0,Ѝp+&OP P00 S o[S, R ,0S R : 8 80R:P#3///@-M`p@ PPЍPPP =[PTP0 pP@$U@@T @ @!d0 @P7uE0S/p@-P@ 0000p@O-p@P|M YPP+`~P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 100,`00S.0 0P1<00 m0`pP <@D<,@0S JP 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0,0 0 ,0S pP @-[ P 0P 0Pc PQ\ QTaPQD "P 8040P/(/$//drh`p@-8@Q 0@P@DPp *Ppo%p@-P@P  'U G00pp@-  p$o%@- } p0o%G-`PzM@PN/\ T0  p0S1 0S@zߍX'P# a-P@l0 1h0$1d0(1`0,1>1S$ FoP j?l%0`J?v\0S \0SAT FP rYP @`Wp̠( p$  ? $0)LY x4 P 3SR L [ [0p0? p0_P 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@ qP mP  P  ,0!4!PŸF0#ypW2P  @000@0"Y@0@N?@@T@0S z?0 C,0!4!P刀0#B0!p J L[T IF[00I? 0011F10100 d84p1P8( s1S%4p ∠0!n 0Ai 0d ,0!!0#P 0 3 ,0!!P0#0h p uQu!}D@ĥ+QNEFXM\q P%ft'Q`@-@M`p @@ 0DpЍ oPP  l@@ 0DpD<@P 7/Pr@-0 0P Ѝ0Ep0 S aݍ,Ѝ\QQ0GoG`FqWP 0000!!9`P 00S 3/p003/NaV $P 00S 3/p $aV P p0 PP pxb.;9/ 0 PPpxP;".5/0 #X R1   D ,R0 0qP`lqllV b +PPY  DsvPQy+"Db+?"PPiVP# VP VP VP VP VP UxT ^D  ZDP (Oq`NKr,"H+M{u6O,E00C-$0pP M`A@P00 P > C 0 1/PP0@0 @P@00003/Ѝ003/$QgO-PUMM.tx`@4PX.zXQ_4yHj$ WpWp$[ Z T   70.07 00P00@\#Pz∗40([Z4S =U?h400C287\4=1 W = 7h400C26\4=1 0 00  000000pp  [0440m40s -14s[w0 00 00000 0zpp 0440K40s -1tPw003 E "P5@ UݍЍP =2 (XL=1຀P0Nc ⺀ h \  pw00$?00[000ӧ?&N?`/'#T4`(04@ TL40S N?/$$T4pWH4 0}10  A ]P "XP TP04 1p$ ,01(.8,40001A  B6`$1 (11S)104 $q,0(8,4q0$1Sy 00 t  P0o^m ,Ԓ@p1#t 0H$100$4;Bd|2P p>{`{ $10 ,$! ,0: 0G80C0(1}1S 0}1$1S!> ,! 6$40`040+ܒ,Б%܊ RO8o%,H+x++q T+YPP  (00/0@o//BO-@P MMAE0*!Rp0)Q`U0 $0   P  Pp ,* (0$0 $(pP l4\,] ܍Ѝp @4B40Spp0 @0 4p0SW00y , Rv  000x;8,9/Pc 0  x08,;O-eM0M*Q8U"U&K'@&u m X w&0 h0OT 0Q @\@$R )qWe4p} nP9 FP' P ; @P) @ pH0X 804p_R#Pp< P U \@D`@ P p PU    T0S/   0S # 0P000P FYP #p40 80 P 00 ,0ST0 S00 P0 40040804 0SS 04  0x; 8:/0PST0rԢr S S z | x{ x{ x{ x{ x{ | } \| Sb  SU 0|tr t<0QP<0PLpLL"@ @ 4,RP Ÿ ,0$ 0 ( Pe 1Pp QP0 0ꜱ5S0+^Lx1 pH u0 S\ rT0= j@t%< 00 014s10 5@*) b%`%^%0S Y%W% DލЍ, ȬT+q &ob=+ ) B d N??XK:KHMU\elx uD[u&q      /O-@BMTM\p P`P  @P`T$$  P```HPP@BލЍ؃~ГCг @t3 (4@$80lDP@<@T@ \   P  `  V443 0 4  H3 $0( 48@YĒ  P   .똢嬂   x2 0 8@h2@DDAT T2T"TTW#P @2 <%PI02 ( ' 20)ATp !0   P& !1%0 Z|#P@0SW K0S0@4 000@0x;8 8/P6  %P !c%P 0  ~ @$$0 K@pW: p@s &" uh     "  h m۶6 s\ 0+,O"q Ȭ0p@-`M2 RЍ!,^0P @40 PP@xp0 ;87/P   PBĥ+ħ+ $0@-"@!P0(@ĥ+@-$@2S 02ĥ+O- PPPBpPP   `PP ?NP@Ft$र@`V* ЍD xP P    R0SP pPBNDP%"@-@00 tP Q P 0U=Ѝ8P C-`PJMM```p 8Q@4PTaH P`VoP8 Yo`GFWI  OP 0 000!00P < 8<1P#<@XNo<0S0 0< 8`PU 40,01@ 01A010000 h@@@@,U@X0S6 0S'8PJݍЍATP0 8 RT<0$!QQ@0P 0 003/@#S0 S(0S 0S8n(0S003/@#S@H+8S pV p% 0S/p@-@P` !a(0SQ 003/@Qp@ R 0@-@`pP4M0S4Ѝ0 0L03/P 0@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o  0@o/b 0 11/ȫ+10/Mp@-@4P0 `H1111pȫ+O-P@p`АРа0* C  !0  P_P0+S   +S 0P,SR0B `p@P X 00,0` 00000 Ѝȫ+D 0 x 0@-P@M*.-P1( 00 0d0@00 0T0@@@81 0 000@.P(wߍ0| ȫ+O-P`@p4M 0SpP pPp 0S00W0#S 4Ѝ0 L03/PPp0 L03/P+ { 0 Q{ 0S  CH0 0P  P 0 0H  R,  4@T  8X $ T\ ( p` , d A- +R 0  P n> j>܍p,E 8EA @@PP@Dڸa <UPP?8 1!8<DQi \1 08808@TT OoBQP@10S nt < R t00 00000 00l0pP@ m(ht(0@C!|+1X+Y++@+ s  ++܊ O-0EMSP8q @ a 0!@w)0`SPW!000 @#!@3/@P EߍW! 000Z 0SX 0 @T W  00 0  0S h00S X  L0W0 ! ! 000X+Z+,OH@+lȫ+@-Q@0  R < 60 000]Ѝ-S rK|O-DPUM<504Q $ބ D $ ğ0*S^P3s0胟C0`*V`5# 0SPKBU@c A@ |ZPp{HP XOTLHI@1 U$?  P P $ 0RP P #^ 0 10S 0S< 0 1S800 000S MP+0pG00 0%2E3U!0a  0! 0 0R R` 10 1000pYR `0,S RB  0 P a+S  *SPR Uߍ` 1 00000000 /UR U@P@T Tt zE +,p%ȫ+&EaKz,ܒ,X+A-Ph`hp@TUSU 3P  IP`px%OO-pMM`\p pP ~rPP6P H ("@ڍЍ crP [rP mPte@P cPZ7PP4c yq0B? ;P0=Sp  < wPW@ wu ꨠ匐 MP HP  C@P KTP@w O-X #d*0p@-4 P@B0 Pp@@-G-`P4 B@T$ `V! p0F&04 p0RSP pQPp Pp40Su p ;Pp@V/0 R/@-`p0LMS@`aP 0S0L0 3/P (0! "!P 3/P 0S00LЍ 0  1/p@-@ P:BP  p@)@-@ #(!@A-P@p`p0S 0pp RA 05#h00P20#X00Q #"h0Php P#"4`V000S 3/0Q #"40P4 A-0 pЍP@`p ᫷ p ᢷ ᜷ 0ҧ`ᔷVvͺ0 t@凷T  \:PLdP <`P 2@꧁!}D@q 9M+@-@M M`p;@ p  P*pA`A`ۍ ЍA-@P _ApP` P  0QhP@|d zd@@-@M Mp;@ ` p P0 @R`oVsA`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP900/00/4\80S0 S001/\80S  00@-\\@!SR0(SS QU S!0$0S\  0s1p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q  0|P!SR:pSS P Q408S Q0  0s40S80S0 S001/S S 8 S S S0/00000, @-R!R@ b4 Br Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X s000/O-0@p 4MPPp`*04ЍO$0 L03/P Ѐ0 P p!D@ Z[H * R T Rp 88``pp 0S0P 004Ѝ, [ 0L+O-P@4` Q 1SQ " 01 r " 0SQVLLSS<SQ R0!S,0S p0 p002#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/Pl    x O--0t(0M000PS`@p0(0p00 ' 80s$(3 0!;(h,@l|Q@3p, (0d@, ` H3`R0000ЍV0V*8q 8 0L03/P 2HR b0 ( 0 0 0080<,02  ,04 :D@0  4 :0p` ,04 0:P23W 4f0( 0P0,000SOH0 L L00SH0SP000i h0,0 |0 E0 000(000  i0 90 00000PY (08O09/:0 PhQPQ Q*:p `} Ylh ,0a P0S h^ 0$0h0 0  :*<p `\ 8 0ꀾ++++q CC-F`0pSPtM^hV:0SLN:0 S0F:0S_?:0S8:0SG1:0SH*:0SI#:0SJ:0St:0S\:0SD:0S000$ R$000 "0& W40SV4 QQ00Q00Q00S 4 tЍC ( U90SWBW? 4 ` P Q< Q44<0 $b4004 0}90  tЍ3003 0m90300 0$3 0]90 0tS 0(` 0 0 b (SH 0P` 0SH 0P` 0SH0\000 SH0`000S$H0d0S  0pP 00  D" 5  nP0  z R>0  H0L0  H0L0  H0L0  H0L0  H0L0 p H0L0  X H0L0@ @ H0L0= (tЍC !SH00000P pG d 9/ 000(0B0ꀾ+yz{}~ l  x q ek++t  x   C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``B0 0pp07/@-M0@ 03/P 0 00000 #003/ލ@-`,MHP 4@0 0 0PP@00 RS THP pW V9P00P00P0,Ѝ @T@0/W/0  0L4H P00P0P%SJ0@-$M@D0X  0P 00 00a0P/H0Dd$Ѝ0O-%,Mg@PU \NXq pPIpDEP`88 ,pVV !R "2 V pP P`!V$Ub$U p 0 屙0 00 00 0% 0MsPP CD,ЍH s 04`A00 00```B0S8@P w0P40 0H03/0pSP,0` p p0C@ 0DP000P`ꋟ@0 StpP pv0,01v0(pp1P !r B B%2":  R B *x9 t90 R80pPa0 R#,500y6000ЍQd2  0@0D  V 0$ p0pC 0@D @00ZD 0S , S00000@3<0X ≡0L0 3/ 00X00=C0H04 0.$xU 0S  T0Pa0 000H0P0 F0yPT0S bx/P 0S4 `Q00Q0S 0L0 aA3/P Ȑ 0&003/f0F0P ! E  0 2.1( $0Y(00$0 S(0 0R0$(@0D 000@ RD 0S8X#a`v 0";0(000!ꀒ  d 0-x 0 dZ0  0- 00M 0-Ȑ 0 C0l010h t0hp?++   [`*pV 0 T`U 00 0dT`0 <T`T0P0%0 Q030#Q0S ,0 A, 2Ffp 0$&(?0 0PL 3/0!L P`Q.V#P S(0 0K$0 Y(00B8 C  01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a,$0pQ@-4喻~ #"T R0//@-(@T@Ѝ0 0 0003/@PgO/@-|M#PP@" @a1!@p@P  *0@T@pT 0 @p|ЍT0| dp0p pNwP P D  X+K+0+!//@-z :@7V///@-0@Q0T@o?0 \ 0P000@-@4M0  +P0PU(0 00U0 00  074Ѝ0+//A-pP@`|VT0S0S )PH0P$1Uy(0U0 00X0`p@+0SR00/p@-@Py'<0P4`" 6D0# A0$!p++A-<`P@(Pp( # A+@-0@-AM L+0 hu0S XPP0P@0,U 88 0 $Aߍ0]^|+`1G-1`P!M@PM/1|!1x  pqpq{lG`PdLt T+H0 [ܹ!ލ l@P RY>' Z#@P 0=S'!>A@ > @T@  P 0 hP L <  R3 @?#d^T+O1s@-1P@,PM/1\`\ 1  L L P D 嶽 00'eЍpT+3 6p@-0M0-000`00P0^@P @T 1X 1T1D 1 S4P1 1 Ѝp9I56 0@- P 輢+C-`CM P@ `<*P pܐ܀0 `0`0S1 1 Cߍ5S  |rp pP\ ``X0S  @810 1|+g{+6 ,G5Qp@-P@1 1  p ,17@-@P剸@典 0 Ѝ0@p@-P@ҸP P.1 1 p2p@-P@1⤲1(1 P.11 p-@-㨸@G-@M,p)T+R@`r夒T5 TH To20$0@TPp"pp0`pDBpP0Sh Sb  @m) 0` 0P@MP 2 SPP ލP H;P !080 0*P |!0t1X 0 , ^%, 0PN0 V% X,1,1L0d,b,0!0P PM?00P0@: D: 0 0 0F& 000 p @ڱRx%+? ,{+|+ ,+/IT+273,ܒ,% EP% A-P$p4@P a-@T ) ݻ#P( 0 +P  0ƻ P !@ᑽoЍW\\h P寻r< 0  T+ +]h//O-0:{4pn@T Ѝ@T@T' ^% L U [Y  [ XY P{ UPE P P$@ @$0"/ ,O-4Mp(tZ,@fP @ P %R!0ͱV0 0$0 V0 #1!PP0@P@0 0 000 0 T000 Q0#02S4Ѝ;0 0Z   R% S   0 @    0@ PV0V0 #1!PP0@P@ RN RK RH  R ࠡ࠳ $,( [Q$[4TT [ 0Z0@PV0V0 n#1!PP0@@P 0 T00T Q Q 0   ~+0@-4MP!! 0  P PP@4Ѝ0@/@-@ @*p@-P@/>P `@ H0P P `Ra BQQ pQQ 0@S:p @-Hⅷ0RH #@-x0@-P@04MS!1P4Ѝ0 P*   P +0R0#@"*S Q 0R$ ,0p@-@ ^T00PUPU' \$ST ^Vp 2@Q.^U@P@ @$ $ 0 00C 0p0 p@-,@P&0P ;pA-@H`HPpF{T00ԗ@"T01 PS$v+ 00S@- /+x+C-麋XP(p,`0@( 0 XWaV|V T0   f ЍАYĐY R  U:0V @ @T0  E:?  @-@P 0  Q@DAvP0@-0@S~0d Ts0"S  @0<00R( T40 + , ,G-錑P0`Sp@Q 0Q02@1;1':X 4kpB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $q"p Q 0S T v 0@1 00 00T"1$ ,up@-P@mP000p1O-0@Sp`P 0 PQQQS SK0UȰС0r 0 $R 0 0"60(Q $"p0, 1QX#  E vQ 00  R [ R @R H0H HP R# Ѝ 0W1Q:P +PvPp@-P@P0Ss!U E p(0"E0P4 305050 0(2#p+ , ,40@-0@SYDP0@Е+uA-Q`0@SG!V V p0耟 ST  4V(Ѝ0⿸PP P4p00 0@0$`p0T L p: P04 `巶0'p(0,0P(+ , ,m|1A-0`Sp@P0 PQQD R<0 ]$ 2r 0 !Rv?000 RU  (0$0X3,000 1Q\RP 0 00  W1Q:P0+K@- @a00S T $崲@Ѝ7@nO-X0MSM2";\0@S2"`0Sb2"d0S2p"h0Sx2T"tH L0SLĴ8 80R[ , I0pQSPPSPs @@`P- @ \00`0d .0h X 똱;S/ʌt|!|@0hP@_oRݍЍ RQ8 R 0:S 000a 1 0 0 0 0C0 ;0CS||zPpnvP %@Zc uu/.P%tp@-\P@0S Q0 >q   R@Cp$ ,O--BM MpX\0忶@P 0` ;`( pP\0 ✨P ڷ%@Bލ ЍQ  0 0d!`v0 00!$0`4X00 $00 0v0; S P|呺P +RQ 0P \Q S0Rʧ0S R6 S 1 S S"0S000000 0000004P 0S   0 R$ ? ! 0$ S0S 0$ ` edA(O-$6#Sp 0 (P` ;+[0p0 d00\ `0h0|0 0X00 P$`P`l0 (04H₲000 00 00p;vZ@-`X0Sg0 4\0@Sh0 `0Si0x d0Sjp0\ h0SkX0@ pP U &0W ЍpwP %@{O- 0TM,00P(00$00 40 0{{p{{@00@vP40ZZTЍ@`DP S S H0!401R < 80y80< 1#0@4 PD0 0LR0HL0H0L ,[` `@D,\  0 pS `Sq0S5p+R ʘ10R02p1;1':Z x(00PCQWQSWQ 0S0W0S0G?o2P0S p2Ȱ`(,0,0(Q $p$0 S  0S G $vw00p1 0$ 0 0 0S  0"ıU0S 0$ P0G"1$ ,uO-M00D@TЍpP`Ра@D0SW@ 0   0 0 `1/Y  S      Q R  0@0 00Q0 0`p1/P , ,vA-Pp@`0S  R 8p0 S7/P 0403/P 0D03/P0403/A-  P@`p1S 3/P P`VUd0PT0P0S@000S4000S(0000A&w( ,, ,v{p@-@4`4P0Sp@10S 3/@, ,( ,0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 P   `‚ 0S0P000d 00//00/00/00/10/Q@-@@L 0A0003/Pg@. @ OC-B`0pSPGM;00S0 S 0Sh~0SPw0S_p0Si0S00$ R"000< R&0pG d8 9/ 00 (0` ŭ0 t+)( 纭90SWQ @Q Q Q Q Q 00000 00 Gߍ0000 0000 00 0Sl0 00 Q0 +yz{kSJ++tG-Pp 0MS 1ߍ0L08 3/P H0 8 L00S4A 0S:0 0 0 0000P@T 4/@@1 0 t` 0m 0`hA0 R Z/x0 00T h0:/P h00S0V0S ZtZ?V F 3 A ?0!CZ? fh0 010@0`q  ++8OO-PMά0@ʬ0` P8 ì`(b0 E00 0p!10@0 0!%00p@囬 Z@F޲߮@x匬 0 `! fレ @p0 8!4y(!(p 0`P0 R  PЍ 0p!X0i `֯ `OT0 0-p @ Y NT R ` @q ++zK+ls + A-@0P\03/ p`W@@P@+P80BW  \W[0 V  0  !   0 00$ 1 x    l   C`  0SJCT L0L LLx{0<D@+ka Y otN wy8e s@-P,`@ 01Ѝp+p@-00M0P,03/ , 忰0@ , S:000 00 00 0p` ӥ0A0Iұ0Ѝp0Xd N O--@M4(P PЍ ذP 0   <  `@V0H03/0`SPpHPpA0 0, UPP 0t, S n?2I0C 00A`0000p0400` 啨fިg0S \(00 L0P 3/P XPPTpP\p0 S8P[ 80 S (- 0( S001x40P ≡0L0 3/00 P0 00006`0p0`0 0厦p`b@YѦZ0S @, 0H03/p,U@9@0 0S001ЍDz%,+ 016 0100 0 00ХpP᤮& 0☢᙮p0S 0h 0Q*08 @,04/P,qP 0q00 0S001xЍDz%\] z%O--hS 0UM8 :P40@pD P `PD Uߍ0P,0 P U42,30 00S 0RD 80S:(1SK1400J ,!LH!0."\0A 4<#H@; $幥<嶥< 0@PkP11@T "2B ,04 P0S 3/P|20 SU@0%0cD0ps `2R僥1Y N {Zx ,H!!LPH@0#pPpT@dP #p @ 000@ @040Q @ᜧ    0 呧 0 ∧Ⴋ40P1: 1 !  t, @0 000000 0000 00㌢pp D[D0S#, 5Q7[T Y PNL,Jw ỢCf( ,, ,q jHN iSwG-p/0JMM`@ 0 pp^PP+jP) g0S% c0l"`J!`\ p/-0P T 0CT *0C/Q 00PJ@;m+s P:??0  |P+0: S `V0>00 PJ>00C0/S04!+D S ՚P+ 8 P*)P 0/S`0oo`bS p & 0 PV+t P*+ P*КP@Ι@]əJލЍQo^KI@-PG@-M @P(0 : 㗙@P ጙ P  ꠙ0#((R 3? sQSЍ O--M pP@P` WP`0PЍ R   0P:0*  FDpPK P W`0   ofG-|Mo `P`P PP<^+m |@P@R 0 Ŭ@ dZ@P +JK J.0㨬+J<  J.0T㙬TX 㒬PP~D4 ቬPPu$ +J 0J.yPPe+J  J;` bPPN+J tpll40 0J>⛦P 0 .CP UT 1ލ֙P@Y+J JՙPPp0J.@+  P h lJ> PR u~v  z%o% /00/00/00/00/0@-0@4M#|0$P 0P\ P0T0760 P厢 M@P V Ψ4Ѝ0+ ++O-AAd2M(0!0PB(0 0000m 80sS0`p(00$00 0?00$0 s 0$W `5 0T%P500@%`ʥ0,0W,5 #=5P00 0`000 00嶢W Dۧ`4D 0S_ @X%SYeP X:000` @@`S@0S 80< 03/P0p80<P NЍpv'80s @0D 0 0Q:8`0S}0L0` $3/P$ & [P Tp|Gork 0$ Wt 83H3 y0 D Q%0C?o2000;00H03/W0@0 a& 0X  0  1!`00;000Q!{  (P R`p,2;0H082Lp0,!<1H0A``0P R0$ 00 00S P V[0꒘ 40P* 40Sp t, Sp ,008q ^ Q  Q0 0 0 p0, 哒)000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`Upp+q T+^P%h,|KG-QM{0`Swpp0 0 0 P  "  "" Q 0@T0P S"TPu@&x"P@0@@@,0ST嵠X@0(@"3@!#㫠,"P@&0( 001 0 !00' XP(!0P@0p00+0@080s 0=0 | 0 T 彦XЍPU PP@@P $c0!X@( 0 h00X@0S0 400t0S00ᣴ00P0 00;X@(0l 帣@l1 @8q 3/P+saz0@-)M@j0p \*3 + ,P 0 X‣I*X B- 0 F  m.0 0dЍ0!0P8q0 S+P ,̟P X  Et+w+A-@  "(0M ( 0P`Q2X1200500@1081$ 001@`,01000 1800 P$p 0PUp 0S0p\'Pp,P(FAߜ(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0} w ( O-P`pp400W(ZWp "!ତpPP p 0  0 @p0Q 0S  00,0 $0T0 0X00@G$, R+R P Q  P 8qT00PR0  R RP  P Z0000 ЍpO-l2M04p@$fP`PP 0 Szn?2@|1 01Ax00 00@llfx0ST( PPM p(P01ᑙ!P0P(0A x 0`R b ",0$x  B   0 008mP0h lƾ(0, 040x0?o21000Ѝ0ᒾ᏾m,ȉ o O-p@᠁堑堡,M0 S0 0000 /00㌟0S,Ѝ/S  /00`pPU/(ᆣ`P p呈!PP PP%0(` 1`Y U0 400`% ,08`ɟ0100/  P 0 0 P/%`+QvO-pP@\M4 `儰0 SpU  0  Q $0S  0 0$ p形P8\ЍO*.M P0:0pQ ",^T ^ 08 %0`0000Y (0S`e ` 0 R{H03/p`0 [ 80s P\0!0000 SPU0"U00[P 0RP  0 p0 P  !€ P 0$U$p0p[P0P0[yp P 0PQp0[t?[00S& !P0 :p0 00 0RP=  0 1!2 S  P0p X 0S'  0R 0 0  !0SP0 0PU pСZ050Z0* Z%Q Qp  0S S00 0Q0000 00000000 \Ѝp0 0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P 0 0 , 0R 0S 1 `R ($ P` $  P 0 Q0``T R T  R X `( 0S0L0( 3/P <00S D0SS000(( } L0( 3/P 80<00S (0, S004 Q00 `( ~[0\vAQv0[[r8qnP U c`p8|Yʜ0 :0 L[p㜀, SS 8q 0PUp0pu R 0S  0 p 0  ! 0 L+ x,+zK|O--`M,p@4 00PVY papPT Pp0Z:`PU`J6ERUA 6&j00#h R 0  80s0`F`pHU p h0S 00  80spHY pPp ph0l0 0L03/, 00Y:pPp@p00P80p5ЍO;p0H03/,0$ 08RPP0$P(<00WX:< R/*pp,0PP UP`0$0$ PS(0(0$ 1! 0 Sk@DS d0S 0 `p8P0V]:40S00004000,0(X{$0( 0c2#$ + 08`@ <00< R:pp8`Fp0< p 00<<( `8q ,0,( 0L03/0 00 0`VV0$0$ S(0(0$ 1!P p0h  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0Pu0H03/pq0@08P0D00[s*p0 0 `<080s^00[ <0 0RU4p0 @ RD0 0 H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00  000 0W 08  1!7400000Pm۶z]@L+0 04 Q000p <0P80s}00z } h0Sz l Yv* 0L03/Pg !0 儐X09/P] 40000$0$00(0 0 0 R( 0  0H3/P. X$ 003/p3 0 L03/  $0( 0S "n(0$ 1!24000040000@0$00(0 0 0 0  0H3/P<00`0<0w 0R40$( $ R( 0  0H3/P* $ %P 0 0X 0T80,3/00T00X S \ $ ` ( d , ,0S P0 P  R0P0y40000@0$00(0 0 0 0  0H3/P P80sa 00^ Q Y 0 SV 0 R80X T,3/00T00X0 0\0 $0`0(0d0,00S 8/ L0 3/P @D0 RP RP{ 3/p  0 L03/040T0S ,0S P0 P  R0P0p0`W:0pQ>Pp`,0 0U=:8l  0 0S$ p0p0$  SUp$`P p P0j"RTp YT Ye:PpW00 U0#Sw :p`Ѝ #"08,00,L0 3/P p开8 Q 08y\ X W 8P@DH P0   8 rp08Hp0!8p 40X 00 0S 0P*p ` 80s0 L0 3/P 08400H0, 00,0+$0T00X0pPx 00 80sh p Pop@-@P(Mi(0Sp(`,`0P00 0F0  0(PP`PⴔP,(初(P(Ѝp000{,(|0,`(Pܒ, t R+O-hpM)1$AS TP T(!0 "PPPЍ0 @0> C 0 1/@P0$A Q 0 > 1/P@P 0U:0@!RP C$ 00S H @3/Xz$HLP`U X["1/"P, (07, (0;P0L0 3/P 00S 0SPX003/PX0PH03/ 0! P5/P%$%$)@0 Q0pLYI@/Q P, (01/(0, Q 2"FeX$Є  02PP  0' Hp0  @D@0 ᄐY80Y> PPmՕe,0S ,0P p@H H 8LP (08/P `  ` @(08P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000 ,+q p408| | } ( ,} | o K{z@ 0@-@P`#}4Mp@0S $ 0dL03/P `80< 0 80 < 8PWV`4Ѝ R00S 0 //O-X`P@ < b"0800 c#  p 002  0 S R( 0S% p  q' R Q0 2T 0 < k+800 c"p0p00S    $0!0R!/S01/+!0 /+$1p@-S@ x1SP $003/p@舚x1煚P$1 0SO-@0`PKMM0((0DpH0S >I @s0 0<0o- %#{ 娻 KP@T8p0U 00 0 00000@00 @@@@0,jppK܍Ѝ(5᭑(0S*< o #80a&@@܊ o'O-`0@PMMhh,00p 0S ( 0R> 9 H 00 0 <0.%#@~40kP`0V,p0U 0000000 0 0000000 00p`ލЍ,܍T,0S*< #0,0A#X0S000C0C0000S0 0,0A$P+܊ o@-@-0  !<$10(10,1P001.@-@0 0! 0O-4M`@(0T`X\d0hpP 5"\ @ @,0;/,0P R7P FPp2CF |p W 2 s 0 " ( 00 0{`LĐM(04ЍO/P%4ЍU5p@-@Q-$ @ X | P 0 Pߒ40 Ppْ <0dp@?PВ80 P<ʒ,0 P(Ē00 p!"#%&p@-PMV`@Გ ~ VP t ؽ ( d  8 P囒 0P咒 ލp`凒P00S 0`y40PlPs80 S80 Vk 0X0S(!@^ 0PV\0 `0S ϕ@`Ed0Ph0S ⿕@l0S ⵕ@tp0S@ ⫕@PL`!t0P3567~Z9:;=>?@-PAMV`@  V(ܿ L t 0D`qK0 @0S  A  =8`V@ 0 Pܑ 0CAߍ(0S l R@d,0S D H@00S $ >@)*+-0@-AMP@0Q*T ` 囑  g q0`N 0S (0S    ,`V HAߍ8w  C q0`N 0S (0S    ,`VP W $0PN 0 PH0 PtB0 P<0 PH60 P40 0 O60S O-@MU M,Pm 00x R# R0p]娥娅qt8`  0@0S D` P& `  PC  D7  1pW00(0S%V$B!00,0S$I$B0000S$<$B0+ 0 p0B/ߙPp᭠ C"U0S1 ` ` z똣0p⇞ 0S    `,pYV "n$ Dkz`嬎 k0`0"  !2ލ@噎 0   0S  "Ez `PV 儎 0  "1 S ! t 0N0S @0S"@` 2ލG<0040!00"Ց@0n$ 0DL03/00 Dp p q r0S |!0 ⻑LD` 0S " "{p8`Y0a x 0QW 8 <0RN  0 ㌑ 0@ ".+@ 0  c R0Uh 0"s  SJ7 Ow#@-x @%+0 @0p0>d/ @y@-D @000(0,0000)d @jyꐯp@-|A`0PsJMd!   01SB l x ͇Jߍp@0P 0 0PP@Վ`(PVU@@ 0 (0 0(0 00@0Ἆ(4P(3#n,P0`0PP`{%o./10p@-aPM,0$0Ps@!   0(❊$1 SPT x 4 @ L X d P$1P$\PЍp 1 ,R,0S$01`@VTPP 0 0|0 000 00P0I03P03X`@P`@o@<` @`@{%o+    O-P`0  $  ( 0 00 P0 PP? 0/S  !0[U@@ 0/S  ލp1?o21QUx1N0p,!@<1(0@`1?o21P 1?o2 1 1S 1SoIOVTPP 0 0 00 00P0.2P*2 1S 1Sp`JO 1S 1SP`KO 1S 1S0`N @,O-4MbPp@ᡍX  IJLXZY  L @  l bP 30 @ L@4Ѝ<Pp&1`SPe# "1S "N g!ᖎ @ b 0PPp1`SPe 0 l1S  1S0P!l @ b< 1S 1S$1![ @ b 1S 1S(1 J @ b 1S 1S,1 9  b@ 1S 1S01D ( @ b< +SJz^+ O0O-@PQWM0u1 $0` 0VŢ40Sq 4000S4l`V$P |X003/$}1S}alx \400:"+Q:  Q 5 $$0XʍY/X({0.}1{.{ K#)1 0 &,1 T 7db p  /    C0S@- 0@S !1R000 i0S/@,uq20S O-@`Pr]MP2BM T]ߍ0 L0@ 3/P/ P0,X[) 0S& (b(>I1P/S <(⩉0(0 00S0SvU `P  (x u0S `P $ 0 SX2vU Z xY $1 0V!7 Y0  0X!pSH1@!Q$1S  0Q p $ 'p 00!15:% p ֏P p Q 0, ($!p p $ P] 00 8a4Q101S/ ,\,H+Koq ]! ;!0S@0@-S@00 0S/`,0O-P̲EM 02@T PP0 2P  |1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 8pPP2@0S- $P* 0 x0D 0SP,,z" ,uq\,v,,"A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T  @T7 @pW4dpW1V 82# @ R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0,,,, , ,\0p@-T00P DPPp0AS@  1SAx+,H+0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""0 ,l0\ Q0/\P ^U Q0000@-0 ,0O-`GMM40X2@TL2V 00 0 0000000@@@@ ~0hIp@c<  % G܍Ѝ$1SpA0L08 3/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0@W 47 `4|,4 VH0 <0G, ,,LH+o܊ +0@-PDM@T P08 @\ 0@  Dd  0 0DЍ00S+0@-@DMP/ P0, P\ 0P  0T   R X  0S0000000 0DЍ000S+p@-@Q`P@M<@P   T0 0SP@Ѝp@)0 @00 D0U@Ѝp+17@-@SWH Ѝ0!|P4PtP<<0nP0<0gP0<0aP0<04PYP<0 S, 0<0NP<0 S@  0"{080#{0,0${000꼃ăՃ̃@-@PD x 0, p U0 h 04 ` 8 ,<   0 x`0 6/Ѝp@IЍp@-@$P04M`L0 p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-@|M8 P l0 $妯< d <Uၺ ,0$hP 0|! *|Ѝ0,[@-80@SP`4Mc00 0oP 003/00$1U Ut  4ЍS0 000 0xp 7/( (0  " 0p@-PQ0M0@$ 0x`0 6/8 ܉`Px1x1a1S0C€10Ѝp"p@-@P 0VP  Pp0S@}p CP 安Pp0S 4! B! .P  噉Pp0S hP R 0L ㅉ 4倉Ppp"uq""="#O-uM Mp, Z-H0cS_ C+0SSzB0S 5PBԒ0SzIJB0Sz2 P     P x2@    PP2 HD     P90x0001 @@K @P @ PHPP< ,h@ ,D@31K 01R010|100P Pd0!}p@  P yb} 0S10$1S10 0Suݍ Ѝ㣄PaH㜄Pk啄Pj1S |!R |㛧P {%+,, ,\,,, , ,|,@,`,$,,| L ,H+Z@-O(00S P  Ѝ| Ѝ ,#@-@PЍp$QU 0 `P PP> C 0 1/0P $1$00 HL Q>,80S @-0 N/Md{m /#G-`@Pጐ匠X0r2%S80S00 00 S80S0|1 P S$1S00 0OJp@-8M`@8  )T P $Q,$00S U 0 |1 08Ѝp$P ᐭP P Q ? ᬺ P | ĭ CP +A-M|P8 U`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `pXM@0 803/PDG 0`a'!!` 0 3/P"#"#00 03/p 0` L03/m -Jp` 0SXpH}Y 0!|1 01!M0<0S P L3/0L00 3/P @0D t0Rv`p0L00 3/P @0D t0R 4 d00`RP  w00p 0Sw`z+Mr{ /#O-RMPhb  @P Dɿ@4 TPpߍP(  tpp@0S h<08 (00,0 000040!04 04$0D0(0 P dVph op 0  DU 8U ,U  U U gtp atp j  "tp 8p?pq8S^Pr 0  *0*0@0  0* *d@edA *<Pzd@cA-PCMMPp`;8 p@P  P0;PrU 0 2 "0 CލЍ /O-T  0 + 1!P 0 ࠱ \0-0  \࠱X pͱ0000 @00R00000 \ 000(R0#02S<Ѝ^ 00$00 S00) 0R $X' S   P 0  `0 T0T  0  1!P 0 ࠱0 0S0 84p< P ,40 WR,[7\ \ [" 0 S000T0T  0  1!P 0 ࠱0\ 00\ RpR0؀0@-4MP!! 0  P PP@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-`4P7 #P.0'% D0S(0 D (a0{S  0 ( 0 0{ :@00#@#000@4(0 0 0{"d@[$b$s$+%%$$$$D$p@-@P} # #0S S |"00 00$00(00,00p@-`00MOQЍ S 00W@0u r#0$P (0Vp  P0W D @0W  kW0S U0ąA-P@\^ 0  `04pX T au0p04 4`X \^  R  0  `04pX ^S@-`lM8PpV0 00! ! 0 ( 'PV$8 80R:V  u@#RD$ͱz@PV008P?{0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0uM%A-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* yPW000 0 0004P 08000 <0S $0R 0$ A 8< Q\00L+ \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ p|z%@-@ 0S PO--UM M00 5%C50S5%  P=}PP Uލ Ѝ5 :0|%@|PHy@P T@v0 $08<0(40PP vPD 0 ` pX0,DDP 000  0SXPD0(00040(0<00a@08`0S XU 0 D  x0U0Q0SpPX X X0S X X qx` kx0P,0 X:P(00W80400<0tX.P0 000$0,0S <X&PcXqxPP @y 0S$00)yI` D00pp<00008``#004S``V P0pp`00S00PP 0P0 0C5 0{ 0! 00$0080V/ 0<0`$0500D0;p0PUH HPLP jP 0P`vPHL`-Ayh0S 4 R 000 0#0P 0S 5߯뼀8 0<$ 0S P 0$ 08000S`H iP`T0S0P 040 Q\8<0 Q\   wP`%~s#,%%+&t#d3 A $ ~|d@-鎝 0P 0P, ,-0,M$00 0 00 00 00 00 0 00000000 u,Ѝ C-` M @ P   000sS̀p ᝬP0㓗' p0lS|p` ቬP0㓆& p ЍpW `VpG-pP8M@(P2 0S b(00202000010 020 0008Ѝ70 0600500400300100000.00  ,0 P #00R R 0S H `P0h#X-p@-PP@M `8@ @ 8`  5/V@@ЍpO-0p8SGW*QN PQUaBP@4`PTB S`#`3S`#V2 P%  A^6*q6 0ABT+ PQ1 `QV^.b4 R$ aX` Q!S#3S#X FQ*0S*@D\!U^\ S*A\!PUB 00 Ѝ 0RS /S 0 $ 0( 0 ,04 8<R#3//0C-0S 04@0 0 $ ]P"R" \^0 RSœ\RS 00  \!  0 $`Qp Q0"^ 0R/ PD0/,P" P! @ P PDEEDEDEEEEDDED/@P3#/P////C-P@ 0}oM`"R Q 4 ‚oόP4/ЍR^8" 0S^"R }pX ^ XY Q2o?000P00P"/ /0 V00SP/Qo/0 @F@-00 0 0ЍYp@-O@@TA @ `Q\PPP?AP P P  0$b0 3c0S00pPAL@@@?A@ @ P @ @ @DPH AppC-P`@(M  Bx 0P @8`PT\0(Ѝp!SQ0P ؁1/T 00i[&O-DM 000 00 0 uPXDЍ 004 0S/004 800,00  (0$ \P,8<\`/! (04 0@_%tP$ p _5#$<0_.8̅ R0PPPPUW (0PSu g"? <1 0@LH0 R p ? 0 G$7@ T S`@`000 00  0 P R02# !"8 0/RSrY<0 V`0 0P0peYl^,/C-P4`M P}p 2S XS^ @B@BY^ \Q0SQ00 000 +PЍO-4MXPpU\0PP㰒hl0$ p Y(0,0t0R00` 0!Y000$U0#02S: 0` ( 0, 4P0(,T 0 00T 0  1!P 0@[ 0(C,,`"Q"`0 `P0 Q04Ѝ $ \ 00@-@P4MA@P  A 0 P4Ѝ0/000C R /@- $0 0Ѝ_@-0 0 0Ѝ [@- 0 |ЍN/@-0 0 0nЍ[0@-0MMs@P M b @ eMލ Ѝ000; p {dЀ4╳G-0Pp4@ )0R@10PTP04@`2S$ ^ SR!  "0 8"0 \PW B1<<10}/ Q 0S G`VBTW HnDϕP0mݕP2!,,!,O-4@pPM` - P' V \ P\ PU2Ƒ0ʱPP #P0L 0Ѝ`VBTUKO-Pp `D@  40p 0^@0s+0Y0 @@0@PH,$+0p@-0PS@U$ U# U p0UpT 0D SSpSpSSpSSpSpSpSpSSSpSS @D 04 ppp$+L[,,>,H,@-@0S$+C-DP4@0 | [ptl pp0(\ @Qp0p @ 0 @Q%@@ Ѝ,m$+80@-0@S_D04  R@$+,A-@p`P0    `B 04 8 <00 00S00  SR000O-0@Poo`#0S Zp`0BT ЍZ  R  SR S0"P0S R00Y0 0 0 [YA-Pp`(@$@0" 0 $ 0( 0,2Q 2R0 002S R02S0(2M 00SM )S"S=  CR9XXXXXXXXXXXXXXXXXXXXXXX(XXXXXXB0C0#S S0 SS S S0 S , r RЍS  0S0000@P Y YYY YY @- 0  A;MЁ&p@-0@P@0Suk00S00ӵ0Ĵ00p$+p@-@`PQ Q pP  Lm0P00E0, n0Q  5@-0@0S  <PP  00S T <Kk@ЍD @@$0S[@$+,S@- 0ЍHY  (P \P/ ‚!S Q /  ( 04 Q S 00PS//p@-@Pp_o;qUp@6qQ`00 Q@-@0@ @{:Q€+q @  "2/>&&@-1 Q`0@d1@Q`q4Ѝ%&>p@-xP@0S0S DLR00T0SRD0  p"@ p$+,08S^/+,4, p@-@ 0(  P0R0PS 00Si ppC-@NMMP`< Ѐu@ @@0 ` `Bm@;@ ⡧PPD `pE_B_ wNލЍ#ydG-xM` @pᜠ堐0P@J!0@P 0S PU 0 R<\1\!\\900S 00" !PP0 0S0L0H 3/P HL 0RPPT $0RP 00  x@ 04/@xЍZ Z Yd    ZY < l @ lF& &"A-P`@6P0 p P  ^ R Tl000 L"Ġ "Ƞ", #$ 0 #(#<00 0 << 0L+O-`p@BM MP/08;@( ȦpP@0 Z@*0j 0#;$  h P!14"S; WR^xo@ U01U01Bލ Ѝ 0lP 0 00 0h RZ0 0J$,$0 0n 0RZ 0oS 1 SR 1S  RS1S1S `2B@?↏0Q 0STE 0"0S@0S@@amP9 Pn 04 8 < QR@ Q  "r" " Q|  2!  "Q RQ" 0,m  00N LURX@-04MHpL` L1L!LL7Pm@P* T00M 0R0 !?020 203P000204 pn@4Ѝ 0S" $0Q00 L03/P P P003/%&>A-P2uSvw_10000“b\œ@FҁL@$H @A- P@ \T@@ 8ž\ @Tvg `Č `Ȍ `̌b` ` p PČpȌ` "0q1aPaa m00`T08)BLP080}@ T\ 0Sp`82S @4008 q2aq0R @Q2T0S X 22 040TP 2SX&O-P`\M(@4000PS}1 0\  \^T 0SQppQpW X@\ЍTfb(0,F0 1!P00 P PQTP Q8b0 RX3 0pP W P\ T 0pWbV0V0N21 SR 00(040,082S`00!$02( 2S01  $ 0 PBE X2p ̓Q R @QT aB`@ V````Z R2@TP@@ 0S1!b02#38( R,00XL v fI 00 (0$0oS4  00"0(4,Ʊ@P4 80  02 S02@0S SP -l@7D0S 1H0Sp10S 1 S  o00( ,04p\P`` 0ST0` ``Q52 P B!X,0E''M7TB'l&O-`M40P@p0V00P484(445PV 83ЍP  0} "UR\P R^"4  0S 0Z000[ 00S 0PSVT7 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@2r/40q?0840800s (8  R    T R,08 S000e0D0iPD07V50Xo_P0"Ph0S SP kh 8 @U 0 o?0 R S2 RQ  0^&/ o_S㴒!P% 0 8 ,0 S0000IY0X0\04024 0PZh0S PS jhɁB I )! R0 2<0C00$@" ^(P0T0^X0\0P&h0S SP jh啁0T2S2Z 00EiP3R"? 01@22]UV 0w?20"S0 L    0 HL H0SP LY0H0PS B 0D  >1!P0 P0XT \ YY X\ 04"o0Ph0S A<SP jh<PR#3P8H0 01H2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0|, R0 V000'G&'L+UBO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8"V0 P20 4  0 P YP "#"#0 0D00 P 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0H,vO--:0aM M Q@ 00/;ʠ`PPaލ Ѝ Yp *H6P:0@ r,'W 2S 1S<2<"<<T20u   &      0S!?⧻t  0  d T 9 bPTRUXL&HRQ  084 1Z!*??  @%!0Y!)??  0NfpP  zb?XT D , gb|h?X T Pd@MT&Us@-RU0 1@Q`d0T `Š"; P0H0X`04 oЍp1(^ &E(s@-@P04P00 1o0S  `VRUp qW0P 003/8_ohVhЍp@he#pk &p@-@0AMP 003/00; ✟pP   f`P  Wg7WAލpO-p0\M0SQ `sa8Q P0e P0c(0@>S@ P0d P0b0@SP0 0HL R   ?  ?/Z[\ P `@10d ἐ 09/0P@\Ѝ,G-` p0@PHLR0418S ^ @Z R  0\ nX0?Pࠡ࠱000^ 0 G/,>0@-@0M 410810!'a0 P0T0T ,a0 J0PU ! 5/GЍ0,@- <HW@ TV@-h~ H0 6ebq *%@-<@0sV(00pp:b0Cod{%_,-$M ?0 0 V$Ѝ0-4M 00 000LP4ЍO--pMM⼤弴 AW " @8W4 `0 P`0p PU(0 0CSPU"R0*P ğbD0S 0s 0SMߍ0S P 0b30S #1c#S006Ћ A0'u A{{JOdTd@008#i c,3 3R - BP   BRڔ2C"B "0 i "2yc 0Ÿ R#3SPmS0| 10x"000 i^c 0 S$0 (00SZP=9 =:uk{1 AP09࠳ڢ A { Q P  # 3^   ŠRˌ!53d 110 0;#;2 #5 0!00\!i c(1 @P0&00 RdP*!."%+0! U5  b@0S00d b@0 00ppTY@.A`,_,_,`,_,Ћ3_,O_,q_,Qq (xt_,@~P P!ᆥ0  Aဥ A k{I{7{Z\0U 0P  b`||P<᝙00<@r||f0 b@  b@-@q@QRG-PP @ R700pP:<`X:00X 0XbP#Q@-P@`pP0S -S :S S  000`  0 Q0P0 ЍU0SE00T  IPP%p@-P`Tp@  TP"TV@&70@0pp@-P 4`Sp@  SP T@p@-M@ @Up$ ЍA-`p@T/  %PP *P. @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0Ѝ0pC B 0 @-3M M 媼p 3ݍ ЍKp@-P@@TpPppA-@Pp p` j E0W0 t0WpX U`0\0P P  0h0@ [aЍU0 0  "K&q BBBQ@-`0tM0F?oP2p@ 7pT ZTpCS}T@tЍSp p2S?Tp D0V4 - _Tp"tSp0p@- @  pz0 S " 0PUPUp@c0 S  0 0S cc0S   0 0S ccT+@-@0  d R@0@-PM 0@     Rp||)Ѝ00 S   000 00P0 PS0 / p Ba+C-p@PM$MU `0S@PE8  ¿0P00ۍЍXچ700S @ Q@BPE@C0 00p j0S f0#S u@UX r+BB C@-M@ 4 *R0S\ۍ p@-@$`P`Pp0 @ `P0 002 0pj0p@-pMP` 0Rp@& Rp!  Rp Qp  Qp  0P < l p(WpЍpSt Q+  p@->@P`ypp0D I  ,0lp 0 < p褖p@-P"R q@ : Q01p@@@dq * Q02p@px0@-tM0 p@ q QpPQ@tЍ0C-QM M}700ۍ ЍT  Y0/ @`V "Q@pP`A-`RX00Pp@0ST`@PT  Q*R@00 S   0 0S0 S *`P `aa ``0000`0 @ 0@ Ȓ@-@s @ +@-p0M0@M0$+pU Ѝ . +Cp@-P@ `$ 08 l, ?U\F( 0 0 008 , @1pp@ ACZV9Cp@-`D1P:D11S0p0@Tp 0S  00:00T1p@-S@\1S#l1S.RU9tRUpxbV:t2atbp1C-aT10CT1T1XS%a0X11Ca\10C\1\1`Sa0`11Cal10Cl1l1pS a0p1}2,P0C2bV`bpx2,P0Cx27@-@0 JPP! P1 0L1vD8@ @@   (   )    ,  Ѝ0@ Ѝ0@-b@ OP p 00dk @ 1S70`]^P 010@ c +0@1/@-@`V'L0S  P 080H0S S@ >'bCXC>@-x!@RM Q|0 x) Ѝox1SjC0@-80@@? P@-@ }OP p 004 @ Q 0 @+-MM+ 0^Op~06S , ۍЍ;04@ [ +%ap@- B@AOp  PlOp@r P 11P p1@ R  &lQPEUQ T`00CS`0 X^0( p@X0 X +(%Б%@-@T 0S h@C-`P-H0$ :0 0 0100 & 00 0 sD00#4S4& 0>P&0 Pp0P W  g080P040 Ѝ3? 0S %/%p0p@-8P` J4  :0 G0 P@p@P@  @Tp@p@-@QDA$:01`%p4*0 qGPTJ4*0 `V$: I0 ppps@-@ @1`  l!1P D1R$ L Ѝp@}%P P 1 p Ѝp@ PU%P P0pPЍp@o 0 -@1)#90 -1S O ] 040Mp\ @1 9@144N041 ЍpC+rCvCC%Bp@-@du @11P`PUp@ 0Sf%P4@1p@u-.9C@-p0@SPLM 0$M0@(p> 00 p0 `P  LЍUtP @ t L GU`  P10L1h,CC@-@MPP` p` 0R  p x0 0 VU  Ѝ@;ЍCD0P!LA-`@x0 P ЍA , 00  ` 0  01PU 0! 0SHP ЍADT 0S 80 P P Ѝ%D=DIDA-(M@`O P,H`p$G PD 0Sr PuPUn 0 8PU,P E Dp(ЍAj$d9 `e$T;080SI $0P   % p0S > U6 A(ЍA U. 0S V  L0S p`MP V,p RmP 0S H: 0S )8$(ЍA&(ЍtDDDXCD},DD> 0@-@ 0PHH0S$ `@R H0p@-S@P` 08PU $00P  x @1 08006? $0080S  p, A\ p p@,@-@^@O-pP`@టT(  ZP 0S!W 0 8Ќ# } 0o? X(00U0X0S @iGX   `D@-@1M@Da 9PP` q`0 P  4 KphhPЍP& P P' P, 4MP5 P!!P@1 0 P Pp iL!d10B0P1]t tLHQp\ ڿPʦ,BdE5E>EEDDEE&EJd.EFETE\E @-@4]Kp X00D1 ЍP 0\,EA-` 0S0 00@p;eAaPP8 0S,p`p`[P,A-q`@  @P000Ѝ 0S  O60 S   0` 0 pPdo`w @P 0`0P@[ g PP 0S $0$0> > >0S **⫿V q 0S S`0 S   0001  @  0S LBP0 S   0EE,EE0C-MM000@!0Kp00Pȁ+ rJP`pQv07S 0 S W X00d!h1`P1 ލЍP  P " R؀ؐPU [  0 S   0  pP 0 P1p  P  0S 0 P, FFZF@-@x+p07S@d0 S 0VS@m-A-`R@p@M PP U 700 @ЍAUP"R 0S 0 )r>XU$  *⒎P 0S <0 *? p \ <05 <V>P  *@ЍA肾@Ѝ-~oFFFO-@PMpP  P 08 ЍO<P `4001p@Tx EIP1D@T@11@1Ѝ@P000 @M@T W@P`@` ;  ᆽ0 00V`l`J@YD3L#`H3``N[p#3b @11@1kQ NQ@ 6Q`4Q`UQpQ xQ nQ 0S0 0 @| 0 "P  X S  p 0 0S@i0 0 X S  p@11@1w 0 P `` 00d : 0( @10S 0@8P 0S 08  * 0000ST 00S j0P 0S 0000S600 00C00)FFFFċ% GG'GL.>0S p@-0?R02@?P00F=8003?00> *0>0Cp/ြp@-x1PSM@`("%@P+ T0x14!V@1t1%0 0`0 p 0%S <P ;0@X@ 0S T`kiVPHd|A|ЍpxA>0S$ N01@T t1S D ~@>0S@ 7`t1S  m0 @=ⲿP 0  @  B.(0%p(4t1S NO,ODOO-iOOOO 0 R/ 1/(`,0@-@T0\@@^0S\P*\@0\PZ 0Sk R0@-`pMP@H (0p``FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$qL1L!LB!W@14!<41Z`P(@ 1!0S0S0\,0 0 @T0@TU@P0\400 (P p`P,00@,@0S  0 S0 0@@O-P1Pʚ;BP/G-@PЂ@1@!@@ p0`,1!(qP000S3 \L0Q  H嘞PPL0H0L0 \ 0 S   00S000@0`PP0P0 TPV`XO-IP[PJ@- Ѝ@- 0 ЍP@-0 u q@0r00Q 0Sg0@0 R    R 0700@R @ 0@00O-P@-@^@00 Ѝ ^   ʚ;@-0 Ѝ@-@P`pF, 0B0 0p"# ЍMb@Bp@-P(`0  PUPUR PU PTP,PP@4P`P4\pQ@ O-#PP@-0 0TP0/O-7P0P0/P@- 0  #08D0O-JPA-(MP` n1U0@0$00 0p@000 0<0S gEp(Ѝ8010C>S@( ( 03(00@000 0<0S80 ⛲p @ꔿO-nPp@-XT@P |FpPV@p0P@ P00(P,000P400T0p@-@Pp0080<0P  P(P0PUHUHPLPp0 S   0U0 S   0U0 S ,  0U0 S 4  0U@-@@UC-@PM `rP0SY 00C01@0S D3/D2D"DD(PU0ST2k0S R,0 S ,  003/40`0P4P!0  P0HS 0 XOp/0S `ЍH 00S0`   R 0q   QRq  `  PP U 0S 0 SIr 0S Yp P0S 3/0s0S 0S 3/(`,O.P@-4 0e$@ "p t@Ѝ耒%@-`0$AMrPpM (E 0Rp@ C@AލЍF U ڠ# "U  RU@@ C  4,0@0$   cVl{%%-@-   Ѝ Ѝ/p@-MMP@ ` 0Q-V 0 `ۍЍp~-@-   Ѝ Ѝ/-@-  ЍЍ/-@-   ЍЍ/-@-  ЍЍ/-@-  i ЍЍ/-@-  ЍЍ/-@-  S ЍЍ/-@-  ЍЍ/-@-  = ЍЍ/0/l{%0/l{%p@-MM p WCp@ P;00 dSV n0@0ۍЍp P0 4Qdl{%O0/l{%0@Ul{%p@-@PPuL; @țEk UT >V00ppl{%%U@-@P=:?o@S@-@p Cp C1S6"@S|D@-@M    90 lDp1$0Ѝip@-PM@` ᨾ  0 TSDp 1@ R! 0 p`Ѝpii$00 H0s P/0 #  ///A->PXMUV0P0XЍU700p@ `R0 PU B0>000 <0  ,> !PP> *JP@-@T@>@@-@T>@0Q/ R0 /RG-@P(M[0'0S  僶P P |P:W`P $0!00 0   $08S0 2$00(Ѝ080 X00S # `p$P `P ұ0 P 0iS.S  `P±4$P 040:SP%O--[M `F/@P 0埽9`0GPpP$C P!p:Rp[ߍ0S00:Y 0S 0S_0PP0 $ ֺP PU0SB 0$ʺP 0PSP0SPP@\1S<@d1Sh1 $RP=d1 S S RP@T1SX1 $@P-T1@COoSB@$TP!P" `$ _0s 0$儺PD1P `1 $P@\1SPö@@00STATl p1$_0P0; @T$ P p$[0P0P@PD  ` $T 0[$0E  PK h0 S ׵9`001P d0sBp `0 D000S0 35S S  CR0UX LPS y r R 02 > 0*@1 U48#88 S R p 'S 0 S U  R P| 0?D0C p 0L0D0}>D0 P 000H0@@@.6PPi(QQ0@-@PDM QP@T 00p@DЍ0U  ┹P @0SA-p`P@MT@Ѝ 0S P 0S0Q   <@P @-?000Q/P1P/$0/0@-@PM  ػ PUP 0 0pЍ00 vAi~i@- ` R@0$Mp0 PR  RU U 1 # ⴴ0PP  R@T!@T00$Ѝ R @A@-@p !p !p`3@-88 Q  q8A Ō8   "  0Q5ã0ã0A-`PP! .RP50R77P0.U  0 pP HRPU H0yH1SvdHP H0P00U 4^P0HP0 40 00 0 L40SO  PU 40!00 0 ګ40 S9  ~PU D1/r8`&d6"PP"`P`xP`p@"@oP   QPUY D1r8`&d6pP"UP"``KP` 0@H0P:0|H ,P Ps0P<0mUH# 0S /ᴦ`P /㯦`P00  V /0P0 P0P0<0F000H0P60<U 40 00 0  L40HS  P%h7 0 apP Pw 73pP@H08SP7SP U ,U`P 0S@ PUA 0 9p PH0P580 x050408$ 00 0 Ҫ,004PX |uP ,8d qP `fV70084, 0A;; 84p@AK0:9PP880A ;p PPH0U4 0 P 4P 4P*0 06S 06S0P90|U1 40 00 0 KK40HS PeU H0 XUPXXH0P;00QH0P90KU ` pPC`,ᏥpP[ H`PP00&QH A KP$H0Q7;0UtQP sP0Pt1 kPPtQ  dP0Pt1 P` xJ0PPx1P|H0P00U10HP2<P0HP22P 0HP2(P #PHP xiPH0P00H0P200hU3 ( 00pP@0S;7P0H0P20H0P60H0P;0H0P80U5 D1`r8`&d6`"2P"0`)PPP@U D1`r8`&0d6`"P"`U =ᏤPxP9l ᘭPH0 SP P'0P<00! ၭP   xP Po  kP  eP  _P  |YPP`P  p0,p 00 4p 00pP ,( 0% H48!   P  PTrQh{%QQQߌQQR*R9GRQRkRRMVR+WRIuRRRRRRS%S2SYSRSHSESaS{SSSSSSST?.*TQTTaTTTT]UU *U{@U]] +gU@UUU]Z]a]g]o]v]~]]]]]S]T]]UVUU?.U V/V 幬P  ,p# lpP 00 0 H,8  P   ,P2 咬PH  勬P40-00 0/ H40Sx P pP$/W`P萄 BPPV00 40 00 0 H40S P  P 0,P/&P0HD H00P D6, H! 00D&P0 0,qP/P0H< @00ďPw <6, @! 00<&P0UV H0 `WKP`H0P20H0P 000$0PH0P00}H0P00wH0P 00qH0P 00k(07600P2 T *O4P50S00T01=5 =5OPHPKU D10@0P@d6`&P w0ShP0U HTH_PTP"U @1 800P40 00 0 G40S0H0P800 P P0 0P0 0P0 0|PH0P10H0P10H0P00H0P50H0P50H0P00H,';P,UqH0P90AK&Od0Uh0a Z7 A`PLPAK⚿OAK'OAK⡿O<P  400^G40 S ,&PyPP LPp=ỡPxHP  PPp`PVHP`PPph HP PPpj$ P50HP PPpfd P#p}HP PPpl PkHP` eHPi _HPlXHP!`Y <  0 0   8:@ zl?o2=y X sWh Px1HPc +HP &HP`  HP` HP` HP ` HP@` HPh HPd (GPe <GPe l TGPe hGPl |GPg GPg GPl~ GPlx GPfr  PfW ZP0&, oP$ =FPQPP0X0GPpb 7]pP  R2  R/ 0,PSP00,0%00 0$0(00XH` p =@  dZh0PP ʎJZ d0PPhZ Z P<ЍU `P0040 00 0` E4pYePP$ 0  p` 0S:,~PpCP  0PH |ٌ0Px_EP`&|6xvaPPUd VPH6P06H0P"800H0P80H0P7 00H0P70U> 5P0Pp2p2SS%PxH0P00rH0P70lU! `P 00 `廭P@ 崭P 寭PPSPSpVPp 塭P t圭PqPpP8H0P402H0P30,H, 4P,%H0P20U  0pHP9PH0P00H0P00PV 0U0F] `  PU d0@T$(@@$P)V7V P D@DTD`fd6S?`Dhfl6S@hCpft6SApC|f6SB|Cf6SCCXCACC1pPCC1pPCX  ဦP T0 ST9d6,`0Cd62l6,`0Cl6+t6,`0Ct6C6`0C66,`0C6O-MDM` 0P@ E 00% 4p 2 +8 0 X 0 00 +0,0 P#Z1HD1E,0BP0`d60((@P4: ؍DЍp@0D,0@04CP0/@,`6hv2d62`dl6t SM@,h4Cpvt6t SGp-C0&h6l6p6t6t"&x"6688@ p458! 0 0P 00 R @0<   C 0 0  5 / @0 R R R P\R p@b@_@@000SS @3@ P4400  C 8?o@20@0<@8@,0@p0 0P }00 R*': (PR0PM Z8 pPp@@04CP000#Q00Su t0 0;$ é$ @0 R R R P\R @* @l p✉@Ph"0pAlqsYPplq @ HЪP 0S 0P  êP 0S 0P ṪpP@y@0 #0S  R 婪P W@0<   C 0 0  ]z0S 0$: 0000@`,@46lV#d~Q8@V0Q//Q :///G-p0@0P `P Y 0 0 `R:SC3@"X HGU( HGA-TpW0  T`@V0 H0HS @sP X X| |00 S DD0P 0RS X4XYp@-P <@PpZA@-@P apXZ5XP@-,0, ,, Q 0 TZ'5XXp@-@P,0, ,, PP pX05XP@-(0( (( T0Sp@i⨢Z75XA-PQP0  iU0x `  @T Vp 0S 90S@XZ?53XY5p@-@Pp PPpT0 p@1@-0@[T p0@0T0S@-0 `  YM5XA-PQD2D"DDR T0@ pR008@10 2T T'͡@Pp t0 t0 x x0R`5PP P PT T0R88wP `(|0 |0T T0RfPt05 t02 88[`Px x0R p,0S Pp0S Epު0S l:PV W(P`PZZ5X ZZZ.Z=ZA-`P Pe_@T T0pS*@p@-Q M0 T0S0| PUx0d tPe_`@P 0 < `<  ЍpZa5XYLZdZO-Pp@4M   @1 0A@1u'P  4Ѝ B ᥡ@ᔣ唳T}   ᜡT0 RD1 0800/ P T8ep 0SS 90SS⩠PT0eᡠ`P| 7 |0T T0R   P  @88UPY0Sx x0Rr m̠T 00 @ XX4P  aP T T0R88#P gPp0VS teo @XXTP8q @PS &ᅠT P 0SS,90SS( PT00S@!D18,*:SR  S p k0S g0S @l54|5sZZZ5P@-;000 0M0S K/00Z5ZP@-Q000 080S 6/00Z5ZP@-}H0H H#0S So/00Z5Z0P@-D0D DPPp/00Z5Z0P@-H0H HPP,0@o/00Z5Zp@-@Q0 RP0 0`S0@ SQ0` :p@p0 p@Y0 p@Z5mZZn=p@-@P0 QP0 0S 0S 0P 0R !P BR #p@/qLP HP p@pZ5ZZp@-PP M0 _0S0S 3?@c@Ood@T $S N0@0 ЍpG/0@d`Q 0000P 0 Z5ZH`,['A-0S(0@0`TPPQp_ ȧ0 0t' d Qp!/ὧPU00PP L0L L/00 t 0bR 0c30H`,[6ZP@-808 88Q,0 (!>000Z6Z2[p@-@PQp: 6?[G-`PM@ P ` bp, 0 Gb ````Vb1pW`0쀟pW% Ab뚧 @ 0 +@ bT  @PЍ00C>S`"P!@03@000C>Ss`"P!@03@0|-X-t-x--3@- P Lp @ p@Ѝ0@ Ѝ/R A-@P8p`B0S p/G[A-0Pp`@S:0SS 0  RT R0 `V1S* P a 0@DpR: Q [P6M[a[O-A 0MTP` 0 {@@PA<I@0@1 0S  tp 00PĀ P P P ۣP ֣P ѣP x̣pPp 0S \ @p L61@ R 86p 0@1#?H00 &&'p H0S% S% p D p L p $ p < pw L0S p0$0M0p H pe t0S@0@!Μ01Z99p M ◝P= p@ `FPG0 \dT$kPx$x p+ +` p.#p_<t p 0S P Q RZ T  8p  #8pP^ PY PT PO P PH X00S 2"Q`` Lp  Fp %P /%P01`30  2p X00S1XppW@0h1SP,rS'ׂp@Qa a! p%P`V%P ps0S   ph !tpap0S   D pT 08! pKpPE 1 R 0S  P7 Ѝ 0Sp pox6[[bC>XCD[E9C[ 6[\M\mD\\+\9\D\M\l5b\`7[[[W\Os\|\\\\Yfp@-P@pp p@RRA-P`@@pH0s  S  U@ p@@@dW0S  R H R U@ p@XC>[Q/p@-P0U@ST` 00p œP@x@T:p\A-P`1pSMBT  p@Ѝ h嚜PЍA!R @04  @ @p@ @bpV 0 !p@`P  p;0S t|0 0 0#40  DPH SP   d: 0$6\\6~\\\ @- @0P PT00Q  DPp@- 0S @0\`0S4 SP U \ @ ţ00p.S0.S0_S-S,  00  ?Rڤ"0T0 00pP%P `00CS`0p S00 P0S X0X /X6Б%p@-h1@SPOPPE @p B⣛0.SSPP X几P H傠P 4僛P 0  .gPPG]p@-@P'U^ 0 p50 `50 P~50  @y504,,)$&#  @       G50  B50  =50 850 x35p@ P NPR]T zY]`]f]n]u]}]]]]]]]] ]]] 0(ƒ -\ tx Q^ ,\ ,@-QMM@pP Xp000 4QލЍA. !. d0h z4p`0SPE@Ep 0S:0@0DFL]]O--4Ml"Ph2 'N끋` ( (@P74Ѝ0S  倚P@ zg 0P@,p,$0,PGY \P,p0[.6@00 P,p, R OP 6, R, R0S p R $60 /P p6,0S0S ,P!  pr @P !!! ]] P/ P/Q0@-0@0Pb^ .^^Q\0Q CL|\0@0Q C B\  00/O-`P@MpVU:U 0U00E0S00T@D@@V00ЍPW"0$?S 0[ `W R``V?Ro0U  Pe70 $.0 IP0 0IV:D XS0 0 @UR  ES`O-@`0p 1! Y*QP T W-700 Ѝ%P@pG`  00T W 00  'P     \Eo p  ' U/U$\U0 T WPPT W\%0P00PPpG@`T W PpG`P%6C-QM MP<p`8p; @<p] <y3p V=Gp ;L h3pT=    0 Ep P1 Ep E/   =Qލ Ѝ      0@E $ @pP0P @T*p0S4 p`@ᘑT*T 0 3p @ p L 8 /r 2p} @ /r   2/2pk @@ 2/ G    .0E/ PS E/2pM 0S @00S@%42p=ן009O\A- @pTPM ЍR` R 00L0S 0 -0 0p0#0M0 d$ 0V 0  01]^O--4M`@`d00 0ShplP (0S;0  `pp30"4ЍO 0  ,   Cp0,0 ,0SDT ,L3Ep 0"00,34ЍP U0 000!0  P 0 ,`op000\!p p PE, 0 S(0SU $0$00 (000 $ 0S *fP @TP@@P@ `/0p@-` (M00>0@SP  '0x Bnp0 ᜝0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 zTT0S (Ѝp0 8P 0T0S 0 PTA-`儂VPPFPP2X@p`EV1P 刂"20 AV0  *2PRp@- P`"p@ F? "PU!@p@-`@MpP!  ( (yX( 8p"PU@ T;700@ Ѝi///@-!M@ 0  ~/PЍ00 3"9p 000)00"pxxb000@ 0T0"p@DT 0 0" 0!pI_6@^^p@-Q@p 101p@~1p@->`FMV ͜0P0Fߍp@PF/ v9  0T01 0 `v 0@P 0*> l  6 ii@-@M:P4@ $ⳙP P@ЍH@Q@-<0< <<0SSL`///_d@^$00 Hp//@-M @ p000p0@0M00@-P@,M(     P!p 0 00S p,Ѝ08i(p@-@MP  ` ޛ V  (P!PЍp:iC-PQSM M3#T0S2"`V2"@p@"ᱛ0B01801T0t0 H00C@L0@T0H @0H0L00L0 P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0 L00$L0T@d120@ 2jT@@D@@0@L0 X9   @L0  OXH@L0   @L0  XP 7UPPEPP@ D$r &p`Sލ Ѝ  XH@Zo@^YLZ C-0`p"M 0 `` 0`$`߄p@Ѝ P@ -PP  `` 0˄@p @@/0 ( P|%`Plh (ǓV *0@ T*00Y00/ @T@x@@-`@DM pP@  ᖚ  !> U 134  4R2$ @0 DЍ0Ui@i%0@-@QM P kPp 2 0"2Ѝ0@-]MMPl#|p@ P@P -R 00@]ލЍ0S0S Sz SS wR@T Hopq@V@T@S  CRPS @@ @p`P -$0 Bp 80Sr S~ S00,0S  R000@0S  R00@ H ` 0 H_!>50H \0pY#0S 01S XXz0S0 0 000 0 0pwPq>S Se  @gPa@PU b NPK 0H H=O@LTw?0SG H☒M P N0<00S6i@@!_@-40 000 0`Ѝ@2S/2S00/@-@@塙V002S00/@-@@咙V0002S 9b/@A-@MP`p @@,@,@P= PPp  p X0S p Q.@!  p x p 6/PL p +P Ѝ@K_qB@T_lBpBfB@G-@p`0 M00PU  0S9P 0 0 P  RP弡 RV 1!e P    寑P0 PPP0PU:000y Ѝ@-  ; ЍgBp@-0M2S`P@x (⁑VP@0 \(ꨘ00ލp@ @B-$M^ *Ѝ! 6$Ѝ@-@l -@-@-@pp p`~B p@-A^ TP00p``0@D^@"000œ\p@Tp0,p/0/R00@- \!Q0s# R0p@0QRO-M@@00@0Ѝ`1Q V00Pp0 , Q :@QpSH ᦐB\= \ lP lP U  Z4\[X\T p Q*S0C!+P 0 r0 j 0 @S2T0@cSc@-@ 000~P 0S00Ѝ@-@ 000kP 0S00Ѝ@-@ 000XP 0S3Ѝ@-@\0S \0\0@-@`q0 `70`0@-@08TG@0p@-80@P >0S0&0T0>jT01 RpR 0S TT0Q  080 >0S  p@r_p@-`PK@t*Pp00,000S00 /0KpcScO-ᴀĐEM@ pp ;00KCH*P`PN d0S  GRW ( Q  R H)Qh 0 00> 0200BS* mWW 00 RS00Tm K4 $`B\` D RW Wd^ h 0 \ FQ 48?$000 FR@( p$ R D RW0S <0S @FT60000<0 @0W0FS 800007 S0@0WW00W  R 8$R  FR0+  8$A 88$0 @W& S2 W0=0S< p p?01Sn  FaP0l%*p_ 08    FR2   0@08 R  FRv3    0FSk70 @000"0, 0Q `6 ,0d&RE "(0,q0 PW:@QT; 0, 00,S P T(, "r  PW: ART  ,0  00D0C00s W0 0FS900000@Cp8D73S Y 0 FSM007# 730@(1S 0 F0S=00(  (100@ 0S W02S 0 FS<0 0" 20@W0@1 0 Z00 FR P0@ "0R_ P 00 FRQ S "   S   W 0  ^0 0FSqt0p0p95SF 0 FSe^009%  9E@@6S _pp0FSQ|0000x|6S# @000DKP::Eߍ P !) 傐F P. 0   W  @  0FR000S *)   <0 000p0, _cSc25__79__@-PR1!U`0@ 0p\ 0? R1 0R00  0M 30 0 0P0 0:0 00P00;0 00P0060 00P00 ЍP 0000t |0 00pd0 00tp0 000 `dA`G`0@-`0i0 MSPp$M 1!ppp@ѓ0S i +`*i@ 0 P` "@1Q50 00pP&P4 a ۍ$ЍR`Б%$~i`nA`p@-`\@T  PP\0S \0\08  p88 0 plx%`yA~@- 0080QPP@ `V@ @T %@P  00ЍpO-IM Pp^PHLL `PR %@P0IߍO'0,0'600 0400` 0 {p00,0 PS2 V30a2@0 0 ,0T :`0 P 9>@PFIߍ@90 Px VT` 0X`0T90 4`9P`A@```O-@pP`Q`,R尰,P2,ES#P㔀U`,@ ,$HP$, Q 0S, $ 4`,P0A``RO-y00"`p@PT:p ЍT  X ⢱00U *Z"0 p0R0    @X90 %p N9  %pYu@-RM M-00`@PBT Tp@ 00 0ap | p ۍ Ѝ0D9 $p UPU pO@- 80SsQ S   00 0PЍ 0SЍO-04MS@ h@@ p0 0_0P; 0o0  00 0`P37 0T0 @ 0P0 00 0`P 0 $ ( XpP 0$,0(,8 P@ 00 y0j`P2 0 0S0@0L Zi000!P*^"0 0rP 0$00S0(0  $ 0 j (`0$ ,0S  S S0t0(0s $F(C,8@ P@0S 0h0 0h0 l ;0304Ѝ 00 !0`PX @ TZS0`$00S,0  P@,0$S  S S0t0P4 1S 2S0 0h0p( $(,8 RP@0`q `O-P0M@040`0`p 0 ''p'X; X8l0S,0S,0匒0嚘 2S,08`0嚘 8d6S,0t0嚘 x"R㌂0,80,0H00`2 S0d6S r7 0Lpߍ0 0 0(p (  0p 0 0 0,p (0I7 0p (=7 0p(,07 0Tp'0z0,,04l0 40pl'0k@0!04,0 40p],])d&k,0 !P !,d ,hS  R0  P 0  ! 0  0$, }R0 RP 0  B0 0  0 !P !0  P 00 0H0 0 0, a"aFa4a[asa@alp@-PUp@,0L0pp@- P# Mp@ 0` 0 ` 0ppV@ Ѝp ` 0bp )X` 0Zp  00; U100FpG-`@p 0崀SP$H` #000 0 0 `00`0! 0 `  $&6 Q 0 tL000h4H0@1v XHpЍG<0 $ 6 30004@0S4H000s$80405  S /00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!5 00,*S:kG{{'{*z8 S zkg{{'{* z$5 00H0S0SZ h W 0R<0S 0ST2P2H000s8040 P024 ;P28 5P20 /#00@0S0i y0.0 0p 0h`  H  P0dh0Ѝ0S4141y PD1 _@1(0000S  0R`V dp`^ЍGf0x ЍGe??aa[aaaabb!b`bibTbccbbCAdA-@PT R0A 0p80  l R 0i0P 0S <0S $4  r 4`0  `A" ``="0Hp00` 00`8 0  ,"00 0$008 % d0h0)cO-RPp`@\M@P; 800 #3P 0 RT0y00 ^pp h@@L p 0  0 @P 0{, !X P0 \ЍL0S0 0@S@0L0L }`I00=P 800 |"x2P 0 Rzgjzzz{HT0!d0S  $i P $[ <Y, y ! +!C,p! $@(@ A,  0  04  <  @ , D  H  <8pL@P@T@p` xv x0wp 0010 p{ zE00g`@00pj jP00 0 \`3!vT 낌04S1SK0@1X0 ]<7S: zDCcAIccfcCcDCcc Ȝ@-@`P 0 ;h0X T6S @`0 ,    J3  ,tЍp@40  TqcfCcc 객p@-PUp00CSp@0@ $"3  (6000L0p@d D7@-P@ xK800  B`000H 0<0L008 % Ѝ0@0dTd dA-P`@ v 0h 0R0;P3 0@1HA"p` 'P0@1( AP      Pd0d dd 0d 0 ~PK $AmdddG`B1 ` ꀠC-`@ PR0  R $ RP608 pi2  i@ R PP  P0 ' lH@!D1$?'((700A Ѝ@ 0dD؜0@-@4M@14(0P 0S 0 0}P 0 0P0   000 0 0 4Ѝ00 w1  4Ѝ0@d0p@-8 PR@  E0P   0,Hp@-Ppp@mddG-`Mh0p P@@1D!8 8C02s )pЍG0t&0 2s 3p PUP 0P`00P 05iH00P0 0봀0  ( 0(10K#R/   P(] t 0 + 70G (PD  0㫹 , gPFLL  0 ? ЍGQ   0|P() (1 (1  0(|!x>xmP( "(1* (> >Q  0*c  T ЍGO  ЍG80   0S 0 0Q ß Q 040 PH*000s  ipPqp 00 P R   V0 00$0C40 040800 8ꬂ0S0&PU 0S 0`0h0L 60 PH ЍGp0I|0 $0  0Sm 0Sj 0Sk$u0  )0  d0S  0R/.0/DO-0M 00PS㴐 @eT0`Sp 0 eЍ> R*2QP 0S D6S<ƚ Hƚ[  Sy/  @!  Q 0 S:500 0 p0 0 0  r 0 S 0 0Cs0dd0S0 @S0L00 !p 0 3 {00 0 P0 [ 0S?60@ 600 0~p0 l0 \ `P < ?0 S\ 0@1i8@5P P0S0 0<S<0P0B!0 0 3 {00 0 (P 0S6[[0 0S40S:0 0Z ;PP   Cl00 0 !P0SS 0KSK?3 05 0$d0 /[ pi0 W84 @2SS  00Cs00Cs0 > $P 0 0  0S  0   T3@ 0 R@ S$ D :0<0@1=0: P0 P3 000 000 0[P00S* YP )   p @ 0^600 0<]P0  0S * |0P *?  p@1 f000H 0 000 00 \ 0000@! 0S  0 $ 0S S0 vS 0 F0Sq0 00 P0hPc0 <[ |- l gf*fAf]fmfff`ff؜ffDffNgg&B[Ȝg-g>g[gRA-P@`U- 0l A`0RJ- 0 D0BSpb ߅0 Ag$gO-`Pp 0䘠1@T ЍT 0S R T0 S> R *NP  !0 S@gC-,M@P`6P P0 ,ЍCIPE jURp0@SN 0SKUG:p1SC U@: P7U4:! R1!C R.   $   zP` 0QU q `q`g`  aU ,  D,ЍP 0 ! @ B)6Bh;h@-P` M\@p0M000 6p 0S LL  ۍЍ 0]`V \@T$~BBp@- P@3 P<p@0S0p@\0Sp0p@OB@-0p ;M4MP@ p`@ `0ф0<000C$00(00$0C,00U000`$0 @`c0p bݍ4Ѝ\Bp@-@PoT  (@1S pRq W02p 02v02p0S 0Sp 7@-PX0B @P 0S0>8 Q'Q'+ " B r R "'    ,30 Ѝ0@}PX zgjzzP+S, @ 0M Ѝ0zDXhpp@-@P0( VUph0Spp@pO-@`PU Q Pd0S  0  0 d0nP0.Q 0S 0P E+  Y080 | U봀8 R0 , 00C0 F080<0  P`00 0 00S $0 pW ! 03   0P C @R݃ 00pwpWL0H0eH>0p|hDha0/@- 0Sr 0 @Rp@-00p0`PQPE@ `V @d@DLd@p0P @-P01S 0 P04/P/P/Q 0\R/ 0\/0S 0< S8/@-P 0S1@-@T P@10S/ R0 " /P10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScO-`1 @\MT. 0S pW$   Ry %zPP@0Sh0S d0S4$ 8yd0 0S PP\Ѝ|0d 0|0  0 0d0  0 0090" yP p8MPYP 6{s 0|0 yPP$0 00 rPP 0  0l id8edXaS yPPl y|0d 0|0XxIyU V0S P 8pP   M U`  jP < $R R0 0#  Q  ]yP h % <   d?pP? t0<0t0008dxQY X *yP Hy UUP yP 7yĠZ 0$8 0  h % <   <}l5iiB* iuiMip@-P p`01S |0S x0S t0S  0 @T 0Q0 PSP 0U d0S0h0d0p@iyB~0d\/ (0 /00 0S/ p@-@T PP@0pBG-Pp`Px@Ѝ0H @P00 4d@P 0P000000 000(00 $0 00  0' 0 pԀ0S t/00@ s6P  0@R 0 0000@@BYH(iis@-@T`Ѝp`PV08,*:SR h0S L#H$` P (0R ,0R   `P 800000( ,0AP`0S  0h dd0S  $0R 0h0d`0SHŵij0S/0S/   O-MPD0R8<`@H0!R#00ЍpP P0 U@ UP R R R0 2P!4Y@PЍOS p    @@0 0&  0 0S SY000000000Cs a@UЍOeBY0S/C-P@$M T 0p `! 00 0@00 @d@$ЍP/@-@TP@30S   0,p@-@PPP "pS{Pk 00p0000S0p@00:S 0S @\S000@:S @P`,P%P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/% @-@A0S :^|^  ^ R S \0L:\\ |\ O--CMM`d4!SP I SLEpWH `0P0B@ 7P~ 00p@@{; 040S0 00,0:= zpP 0 R0 :R00Hd400 0p0PP u0S  FCލЍ P ; 000P2PV%0 00vp0PP@0S!+ M0P R $0`$0SG d~@ `~@P =`P00 P000 SWB p@DW:SZ @\Sp S Spp0 0T:C P @D 0SS Pp0 0@0` Z@S 0#SS `P@?0U u:00h00>P0 0Q :Q0, C B  RpG:R:   H J B[$0 0 PC P[P$0 @D pG H  0S 0y @p P D$0b$0 b0e @E 0S  D0A0 0T*vP 0P:SZvP`,%@-0  0 Ѝ@-(@ P $:0 0P`,0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ t0Pv Ps @ 9 Q09P ލЍ t0P P 0@P90 PP U LP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0S@Z\R    B{:R|R  P`,P%{@-@DЍ@MG-p= @P@ d'Pv| 00@^S0S:S^ `00A\S`0S:SQ 0C^ 0@0LT1 0L\TS`ASBC\ Xlplllllllhlllxl`bC|^0 0 0 0 R@Ad:PPd @0:SS0AR0@A P Pd : A-p= `P@ dPPd0`F8| 00@0S @AdPPd0 :RRAS@A P @-@# P 00S 00XS @00As ^a0ASW0AA0AS70A\2" 0@-4@0P Ph`, yG-Q0S`pԑʯ PV00c `a  jP00CS08 Pp0 0 S  W00S(@ xP   , P P00SW  X\00S 0 47σ,P R   S@T P R  ` ЍR h`,c,p`,@0@-0S tP [Ph`,g,@-@RP08Gh`,p@-P@PPp7Pph`,@-<P  J(0@87STЍh`,g,p@-@ PS P@p p@-P #(0@87STЍh`,g,O-pWP`@P @ Ѝ0S K P 0wP0T  RT1@ S //////0@-4@0P u Pg,yO-T@00SPp4b  4PU00~ P|  iP00CS0R7 Pp0 0 S0 z W00 S {wP  P UP00SW00 Y00S P >P00S  P P P  P  P  {P$| :iPwP Ѝg,dX0@-0S ;@@0@00DVP0DЍ;Pg,g,@-@`0P0`Sp 0`;P P Ѝ Pg,@-@P08Dg,p@-P@PPpR6Ppg,A- P@`pP 0 `00P84SUP@Ѝg,@-$ 000B;P Ѝg,A- P@`pP 0 `00P84SUP@Ѝg,@-$ 000B;P Ѝg,@    /0A-P<<`0@ %0p0D0& SQO-@P DupDpG``b0Y:0z  Z# 0@@ Du 0DA\0:Z: [=0 S: p` Ѝ `pk,A-@`Ppt t t tA 0p@-Q@T 0 do `n2 0$pAT doP n $!0p0Rp0@-`pTM00`< @PTp0TЍTT0 px@ 倉,0@$$0$ 4/00S ֥%t*yk,A-P@ 0s P0Wp`ppGWp0NP ```pT @@P k,p@-@P?0 ?@0R:@@pP pk,0S 0S/0S R P/0R //p@-QM$0Sy A1` 6/`1!6/&%!Q10P! \`6/*)!(Q'10P! \^`t 6/ ,` 1 !P6/ 0`0 06/ `|0 6/ 4`s0 6/ 8`j|0| 6/ `aX0 6/ PX40 5/ 0@ 4/Ѝpk,%q Tyt4uybUIyy'QyNypKyyyyyyyyy0<P, < /k, @-@ 0 0A11D ^Q  $ $    k,O-lQpD0H0L0$`PD @@ @$D T:d 0jHT:d @DL0 0R:P0a Ѝ030@4   $0@0 80@4 0$ (0@" 0  4/0S Ek,%q zO-EBMT`MV`v0 0000, ```p0,0WW0@ 00`o`,,U@Y Y +p B>04@tH R|Yv 00$0S 7ğ0 R 0 >80H@`@C^3A40LC32 0h  2l 3 p  !dC 2ttt 00C0'0DS 0 000tPxPN| P,0 & 9 % 4 @ P B, * R' \  B\ !\  $   R B @ @P R B @ @P '  (  )  *   0 0!0  `-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A :i00ЍQ@P ,i@0p@-@ `0PS  \*. Q  R R  ,  p 0 B##P%pl,qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00l Ѝ0S/1>3 !/0S 000/pl,0S/A-0p @RP:``S * ]DP`A 0 PQ0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-@0SP`(0aL T  $ T $ Q0@ 1pC !2M0`0sA-0p0@P`MⰂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0Tpl,A-`@0PS<0R"0!31<0S 0R0PP0S! !x000S!!!,p (C0PA , (0 ,Pؖ%L%H%A-`0 R*S\ ]\ tpPB@T Um /_PbPp% R@-@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00pl, 8 0 s000/`Q'Q!//P%A-PRp 0@S` * |BP 0!Z_ PPA-@P`p0 SV1 V00W W0St44444646464646D6D5546464646464666P 0 B 0  B  B " A A`0 F  B  B " A{  k`PpG  B0  BZ`FPpG|S`FPvA]p@-P@,`cP@tp TpxQ 00//x,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0P`ؖ%L%H%O-P 0R@M ] P&  ] P 000Ѝ 0@  HAP ЍO 0P  S @ e 0 00<00S*^Q000800R ]R00-R f0 S*]Q -QR\T0]Sh- 0 Sw:0S0086000S8^ 00000 50Sl`0rPr_S ,0Sd40Sa$0S^<0S[(0xW b 0(`c0@`F `@ dUi 00C0d-Q [QR:Q =Q 0pS: U !0R00`S0`000-S]S0`S0`0h4 R*000pBW R:0`S0`00 S<*R9 :R6 ]R300B  B]0p pBxP 0w S<0R$ A@P    sP  p$0  0$ 峠0S00`` 0R00`S0`000-S]S0`S0`0=  R:0`S0`00 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S- W0`S 0`00S<0W00Z0S Z4 0?P  pgwp400!0pᲠ40 P0`S 0`0{  P  P @ [m 0]S Q^0s0  0  EB#ЍO{{ؖ%pl,P%p@- 0@0(M! 0 0  |  p 0Q 0`0]00000P0`P(Ѝp (Ѝp@P%L%H%A- @00P`\UC S:0S004000 p4\U R[U*U .Uy 0S0 S xlP JU @0p W1@p(` 0 S *R \R0)S ) \ W 1L  l0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  Ct % : 0D #OU &02U ! 0  4 000p0^0 0 0 0]0000p0S* *Q2  0  BN  B   B0B  Bu  0S> 0S 001006PX\QV {RS00<0PS<* ,R9 Q 7 810000 'U0 R     0 S *R\Q}Q00 0RR \P 0}S 0<0S 00,000$EoЍ[Uy`pl,)>{P%A-0@pp`?Q $0As R SPIFFFFG|I|IFFI^QO [Q \Q PUOO{Q |Q720W:0S00500 @0P U1@P(` )0 S*0)S  ) U 1L  0 S:0S00500P 0)SP  0  $  $ RK*0?S{S*C\Q@{SP L$ "!,Q  R  $  U   R  #  ?S m*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^0 0 0P 0]0P0 ~o0W:0S002000 <Q >Q qx9PP iS &[N L]{S0 PSp* ,Rm  1000< U0 R  !   50 S*}Q00f 0RL}QF \ 0  B_  B   B0S  BC   B0F  B 0  B;  B  B " A 0000S 00000pl,P%0S G- `M† PQPE3\PL@P 6U: pPp P P$ @pxp_0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D z000Q R:0S005000 S=:  c 0A0;P  N00Xo p0 P>3S, 9S $S S <0R pQ00< 00u04|04040 -  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:0_0P 08 BB0U0 RB@ Q U B!U 1 EU, ^ 0C\!1LX0RU!U! 0>Q% Q% QS 00 080Se 0S  0H 0@0 @0x00 0  0S Y<Ѝ0R 10C/TUU Fpl,@,h,Ee,1p@-0@S<0QP 1,0R04S"`$0V):8p1P8S50 p(00<^ 00^ 0S8opU 0! R R0 0cP`ؖ%L%H%0p@-0PSQ@ʡ@8QD@ p<0S P pL0@0t@@P(00Ppp@ؖ%L%H%O--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T 4P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$  g%P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'P%~O-P`p4@Q{ V Ѝ>3S% *S" SY SH SR `P SX SX 0 P =S[ S SG S03S S S6 "SY SF S 0H S &Sx.S$ *S S0s0S80 S xpPr80 0@r0s0Sx[X00>@4@505 P`F`FV0@0>@>0> ^0C0>@01>3 Sw 0O-4M\0@0(0X000 001( 0  |000_V_U0^00 0,e,v_V0;0  R" ( ZP $0 00`,G0P,vu00_PU0PSPU R  S0 04ЍP%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0 X7  IS~ S F S 0>#0DϠ2@ 0u800 0 lX I0  0bP  0p @0P  0PTP 0PP@ pP@0<800p 0 3X G 0 PE >#P   0#W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$   P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'P%~O-pP4@0s0 W Ѝ>Q. 0Q`$ Qh QS Qa pP Qn QY  0WP0 @Qs Q Q[ Q6Q QF Q@ "Qy Qf QQ g Q &Qy!.Q0 *Q QqQ8Q y p Pr8 /rqQy SY> EQ\QpGpGPu > j  > >c V >  > QMO--,M , *4 d0*0 0* (0 @ V  0 `  0R   O0 Ra  R [ PZ   R    ``R  0lP0 00 0 UC D V pP p r _U RQ v     _V RpuZ P# r   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  ` pdX0w u r R ` pS0!u  vR q   _V_U P  ` 30v0_V` P R  R5   0$ 0PZ& 0$  N0 S 0 N0`  :` 0Pvu _PU PRPU0S 000S00,ЍP%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0z800 0 qX7  IS~ S F S 0>#0DϠ2@ 0T800 0 KX I0  0AP  0p @0P  0/TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--,M , *4 d0*0 0* (0 @ T  0 `  0R   ~M0 Ra  R [ PZ   R    ``R  0PP0 00 0 UC D V pP p r _U RQ v     _V RpuZ P# r   _U RM wpJ vH  _V RQp>Pu  p $ V    upv  w( ppu  v X  ` pHX0w u r R ` p70!u  vR q   _V_U P  ` 0v0_V` P R  R5   0$ 0PZ& 0$  L0 S 0 L0`  :` 0Pvu _PU PRPU0S 000S00,ЍP%O-`P@M80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0z800 0 qX7  IS~ S F S 0>#0DϠ2@ 0T800 0 KX I0  0AP  0p @0P  0/TP 0PP@ pP@0800p 0 X G 0 PE >#P   0W 0  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--P@pMLP0H #W # 2RS  Tr p!>3S  So S S S] 0Si 2S0p Ss & S *Sg &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SB.Sh S0 S 0_0S0Q0S'T00P0_QSP   0S0_P _Q0 TЍ0r R T @0 T P0S00 0S000S00{ 0S*0S0T S00S 00S) 000_R0S 0S00T 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0T0S 0 S  _0S 0R0S 0p>3p1># Rr 0G a >#RJ RT RV R xVR Ra R >c D2"H0 00 P0 0 9>c pr0 pRd[* A T0$  P0a !0R@pH0 00 P >cp0A0!RH}H A>3   0GiP  G>3`0 @ ]P0 1> Q 0p`>c`1>3"S`F0>cb 00D0/H0 0 0 7P0  R'P%~O--lM $PQ0W @$QR ``O     Q 0R S g  Z2,Q~ 4 Ry 80S0u SHPA@@@$P(P,PPP PPP9p "`!@03@0 p@& 0 O;p@ 9;p@   p@`J0  P8;JPJ0 P JPdЍJ00O-1MM @`DX!D "( p C.  PTpV@D;@8 (0Sp p p̱̑ 00Q$ P %0!pp@ t0!0'  P  P 0S RI0@01ݍЍI0S PEPU R Pyp 08D<4! @ P0 030 R 0e$0h,R @P1ݍЍhL1ݍЍX(FtH\hXgt0@-P@M 0  PLp@ ,p@ P 0 0=Ѝ08 Ѝ0A-@@`v0 PP0P! 0Lpp pYp0`p0I0` Vp I``pp0`p0I 00Pp@-@PCM3 /8P5 8p@% ` PH000u5 09{C.P F {@4EP @F<0@S VS 00 SCލp@@0S@l0l 0P@0  P@1:H?0@0@H0@0 @PXp@-QMP4@SMZ TE /7PB QP0s+ EP QaP 0`pP @ 0@@qpG H p@ ۍЍp%0si/=1p0" +@L@0 P@0 ( P@1:?H?0@0p04@1H0#S.p@ (H00$HP!H@Pp<%@,@-pP`O-$(pY,PS@`1U+00ï  09W0 0 09 0R0*V&G 00p&C{p@tp4 2x 2 BppwkP@r`Up@-@M@ )P, 0`0#L` QCP/ FaS 0L@U/1 0S2 0 "#@Ѝpꫪ*O-((60 @`$M00@=+@ I\b-0@?o2S00/ 0 P 00d 0 uQS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@?o\2  y 4YP$Ѝ0 0sx 0 P$Ѝ0@Pa (P aP (P0 )P0CS 00}P P p R4000.P0S0 0S  00000S3 R3 t 0S( hRf `#S\ BPV PM P Q XCP Q000S rp!~Q CP klCP4 XXcQ CP0.S000S00G R ؁ء  Q tCP 0.,B@ 0sS7 tts^CP Q 0S 0`0 ,a,`nJCP' Q0.R  RQ  4CPb QA (CPx Qs0 0 >  ama.m.pmp.m.,0 8CA-P@U 0U0PUP!A`FPFq ``P 0!Eq1pP 02P''O--@MD(0p0 D@0@ 0(@,@@@@ @@@p H0T L0X @܋0@l#  SE  !o0CV X f‚!  3Sf%] ZYv5.' LmSD@21! tQ 8200,1SD$" 0=S ,0S1X"R 8 [9T 1@01S O<X A {{ P XPL0QEaC0 ?L`XP0 L t00X0" T 00!0SMQL HXa PA&*021,1S\ U1X2Q SP0\XL S p x0L 0P XL { X {1/ @jThЍH0p<ql$ Q !X"R$R: p L \0 L1X[ X C@r S@KQ],1P  PX  0P0V: pS L`XP1 L 0 X 1 @P]@H(00(0000,00,09XP0,^0% <P0   0=R  %0@Dh0!$0SXP"ExPX A PP @H`XP @HWS@ XP E RQ#XP!E RQE# &XP(0S0$0 00<P  =RHL^L0X \0h@0 0D0XP0S  <QH@^L X\@0Dh$0XP0$0 0XP0 0$0SXP"x(0XP0(0,00,0(00(0XP 000(0XPP0L dS`0d t0 `0d {{ {{{{{0{{0{0cXP0 SN{{AP{d@0D hRX0\8 #Px p0v> 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#'XP(0S   R $ R`d Q  0d 000>#d 0>d 0>%0P">XP 0dR  ^ P   Q& 0PT08<XP0 SE P\0s E`0d XP E ! 0XP E!XP  \0000 Q00SPT8< XP  RQE#XP  0 Q0x*0^q*{ r0s{P T80<s 0 XP !l '.%""""0S(0SO XP80@0 P0D: c 0  >02   S.Ό  1,ώ$0 d 0=$ Q04000 0-0XPE0'0XP0!0XP0XP P1P0 P0 :($^0<P0$ 0=R%0h00H $@DL0c 0=02   S.Ό  1,ώ$0 d 0=$ Q00 40XPt2|0 P0:P0 0<R  $0h00  0XP0  0C0  BQ $0 h00$%XP @ D0 0h$% 0S 0000000XP00|$0Sj"xXPqXP0(0m0XP(0i$QWXP 0RPM #0\ !#/1x2 L$0XP2p rp t t BXP  0 R+ P(#R# & E%- R  \Q%8< &# &0 (0 0dRV$ 0$0 h00% 0C 000 00S P 00 $0h0 CQ0 @00D h00  0  C00 00S \0  $0h0 0$$% 0%#P # 0S !#/10s ad 0y<d 0t<$O--MPp@0k 0@0U`0 W  0 2c1000刀000&@P/ 0v> 0`0?d000P0?T0 00#?<0;0000 000P :0\0P@ 0TP 2 dP 0P0S}ʴ Rzʠ RwʨQt005 0Sd `0?#0S/" ES}> `00d 03@@PD0 E0@ @8 H0X`P`d 0p4 `FQ@ T PQvNNhh @D P[^0`00tx|\dPl`p@> RW S S|\lpTlVh0SdU`0S\0 R{z  RRzl8@0>C 0C0p0t R@ix0S ?0pPt`( 0( \0:PJ p'?0! P ό 01l"?! R1 R?U0v Po 0D;T7v~@ pG0/ QPpp 04;0Rl h Qh y? 0  qp`P  0qpg?0S Z R@Q @T U? 00 ߍ 0K?\ qp0 M 'pQ !'/q S=P9 RTP\0 P0,P0  PpJZP S 00@ ?0\ 嫸`?0S0000 W\ ZR0``o d`咸0\P0? T0≸0\80? <0‸0\@0? D0w0\H0?L0 n0X\p0e >0SI O937'3gS:3ß0#cP,: *PIy0 @P  刀dS_h0 [ZP 1pv0ps>@(@\ P`P ?/& Rß%0Q0vt W0: 0" Q0P"0V#0,m`V10& Q#Ό3à\!=30S ( 8L^9 0( 0fqp2 Pq">#00>0SL <\| РR10"c01 2c1Zÿ sR =T00=0S$ 0=0Q 1&`P 2&>`\3à\&=3=0 0{ x0=T00Z=T00"|lP)\(\ ףvɻ @-@, LpkheTat X00 R 0 R 0Q/  /  <  DQ 0@-0P S@@H  ^ 0S  Q 0#0S0 0/ЪH  Q j.0 0#  Q/00Ɠ\ 0@-xPo> 0@" \ 0 0 /ĩA-@P `p@P@0%  P PPA-`@@6S `pjNP@ & P 0SPA-`@@D0S `pH@P@ & P 0SPPO-P M s`P9 p젟P nP P @@ %  P P0Sp A Ѝy X p V j8  !p0`0pS긧@A-pPQ `@Q P 0@DDB(000S   @- M`pPPp) L< 0 0@0S @<0"S" 0p000S0 7/ Ѝ,<0"S1Ds\0pT000S @ Ѝ1Ds$  $tX@-@ @O-p MWP  pp2SR`PL P@C \Pp G ,P P6 0nS# p= *@P00Q Q P R  \0 HB"A 0 0@00oSp\000S PN` Ѝ,  CA`8O--AM M@p;L0 0LP:*PP  LPm0: Q7P PC@@0K PP 0 %p 0  00P: 0 *PP$p ` a@P! L 0dSPkPU0 Pp` p| % (H8P ?@PP 0 PgpR NQ P  ;00P/U` P ܾpB:0SS   3PAލ Ѝ 30H0PP0 $p>  %P:00 Z02l! 0 00:0D0 02꫾:!0 ើڕR0:&:00 Z02~:00 Z02sPq:0`0  P02elhzd@4dмh\x0@-P@M 0 P@ #PЍ00@-P>@M 0 P@ #PЍ00@-P?@M 0 P@ #PЍ00-,M 0 >PЍh--0$ S   0/ 00p@-P-2U@p9?( ( 0P 5/p舤̹p@-P$U@p9?( ( 0P 5/p$@-@P 0003/ԣ@-S@P 0003/ꔣHp@-P ?oU20S@ 0 0 03/pDp@-P` UV00P00S@p$ P05/pԢp@-PE?oU20S@ 0 0 03/pxp@-P`3@Pp]9(@0 p@/(@p@-P7@P p 0 0 03/pԡ -@-M  gp@(0(003/Ѝ@ Ѝ/xܷ@-gp@0003/,O-`$M ؤP @,0Sp$Ѝ80,P@@  4/$Ѝ茠O-`$M ؤP @v0Sp$Ѝ80,P@@  4/$Ѝ!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////,40xhT<(Hصt`L<(дl|wO--0:p0*S0pG0 00PZ0G"` `0 U0SXU Y <00p00C0`0 Pp(V ` BPE @@R> 3P 4U * 00 0 0*0G0PPU  <32 7[`= YI Ii XR3"^P<^P `0U 4@ YFX; Q8V ` BPE @R> 3P 4U *0000*0 00G=0[P & < Y` `0<S Z>03040p 0R 0<ЍPU *@ Y,PU ` * Y@@ Yp;0:,d;0:(Y 00  P4(<p A FQ ,p 0$00)Q!*AQ V S @0S Q} FQbQ0  `302 @10 0[0 X 3 "R Y 0H0PE00 @$@S 1>03P041U * 000*0 0G0{, PPU`<03`2070SE 00P0=S @Z? 0  `,)Q(P 0 BPE0`$@S>03P04U *000*0 0G0AVP 0`PU4 Z [PU`1401` Z``0fQg [ 0 L( ,!3 0 ` l:. @3[ X3"30Q040 N Y 0H0PE@ $@0R 1> 3P 41U * 0 0 0*0G,0PPU`< 3`2 70S 0FS 0(0(0S00040G0 P0 PU`0(0 ``<0,( 0B($0<PQ0$0 00PU 040FSY00,0@00S(0 P<R00S$00$0 00U 0 4 @ZR  ,*0S)P 0 BPE $@R>03P04U *`000*0 0G0_XP `PU *Z  [PU *<0,0@Z7  ,*0S)P 0 BPE $@R>03P04U *`000*0 0G0XP `APU *Z [PU *[4 0S1Y 00H0PE00$@S 1>03P041U * 000*0 0G0 ,0RP`PU*=00 <0,(0PU=030400*0400GP(0PU`0 X00S4 0X+:Y 00H0PE00$@S>03P04U * 000*0 0G0 ,0RP`PU]*#00,0( 0PU#03040, (0 0[, 0S)Y 0H0PE00$S 1>03P041U * 000*0 0G0] ,0RP`PU*=00PU0#0%=03040305,00 ` <0,0e,00(y,00uꐴP-M{0{0)Ѝp@-P`M0@ 0 4/ЍpG-PRM^  `UpP*/a@%#P T1000< pp Ѝ80S 1 000< pp30S ЍĠ 30S 0 < @0000< @ pp30S3 0 3 0 LXA`ftH@-$$@M ЍO-EM MaX@P+p `E+ ?K0P@+T! 0 3K0P@T 0 _0EAP ' #U0Eލ Ѝg3 0 Eލ Ѝ_3 0 @-@` pMPs+P, /J 0RP  rR' rR  P   P @0CЍ0rS\ 0 @Ѝ0 Ѝ@r3 0 Ld>A-`@ p@ 0P/S /vJP @0 Sp  0 S +@p@-IMM@`PP p 0: S p0 0rp IލЍp2@O00IލЍp@IލЍp20@0Hp@-IMM@`PP ޷p 0: S p0 0Ap IލЍp2@O00IލЍp@IލЍp20@00a0@-P@M 0 P@ PЍ080Q 0 080/p@-@PP` + PP u "P  p@O*PPp--00 M (0  ЍЍ/(--M  Ѝ Ѝ/ -- MM<P 00  0 ЍЍ/l(0-@- M@MP  Ѝ@Ѝ/O-,M `@RPP00:A!0@00Ppp0 0CS PY P@ 0 @SYP fM!,Ѝ4@-@0M $& 0Ѝ0 00 (p@-`@P?Mpp p@ @-80800M@ % 0Ѝ,(p@-M H0H 00@` Mp  Ѝp@kЍp(0@-4M@PMp %@ X4Ѝ0p@-@PT T  0M` @Lp % =0Ѝp$(C-,M pP`PEUP0R@@t0 0:2 0U @P0 @T L!,Ѝx4@-@0M l% 0Ѝ0 00 (p@-`@PLpp p@ @-80800M@ C% 0ЍL(p@-M H0H 00@` ]Lp  Ѝp@yЍp(0@-4M@PLLp %@ f4Ѝ0p@-@PT T  0M` @1Lp $ K0ЍpD( Q 80 @-l880@08 880/880 00<P 80880 p/p@-@0@00S 000 X t0PP  `00A/L00p@ $P,8 (O-t3M0@ 0P 0 `0Dp@ P P00U tpp0 0CY 2ATT00  RG LD@D T]:[ 2 00p0`K K0 V0 W8 P2ATT 0`Fs 0RB jK 0  0 B0SH VK@0Ѝ V0& 0  DK 0 0pHXB0SG 0 -Kv 0 B 0 B@ 0 B  BK`FtZ  0 B  BK 0 v 0 {m 0 t0S J00l 00 (p@-@PJppp@ 0RS00 /p@-@<0<00P  @Jppp@ T(808 00 Q0R00 /(p@-@`PJpT T   p@pp@-@P\ \  ` @yJpTT  p@p`(O-1!000, S1H0? MPD`d 000PV1!p !q1 W0C@(t  ,0@@KD Œ Č Ȍ A`| @p4  W R ? \ QQ Wt ,0 000IC11500Q00, ŨZ Ѝ0 0 00{(@-000 000 @@P80@080@-@@P80@0800-M  Ѝ0-M  ЍO-ϟiM QP@qaԱ  PX? `K͌U P? K͌T P> F͌(1S P~> F͌(W zP}<> C͌ V hP{= JB͌8[ VPy= ̌1S CPv`= ^B͌`0=@ 0S078 H0P `P P P Pd P@ P( P P@ (P PD (PPt PHT PxP'( 4Q780L0x100C40S0 00C,0000h0000a0P06 ,0P0@`U 0e1P U.0q10 `00V0q0 `bV, 0U @ `dp少Wl` 0 Z Piߍ`0 1 S  ,00 0! 1S 0D 0| 0>p009 P ,,0$ 0 @< 8P!P H, $  B @ 0S% 00P00C1 0@S3 00 Q!1 p WQ  pW,000 p0S,000P$0U1p㔠 0 W Pp~80Sz004 0R0031800S@@X!0@< 0S00!$0P 0S@@@@T0S0 0 ,00C00P0X00Y,0 0CR0@,00`0QQT d!@YP0 p00 W0 pgW0T,00` pp少W䰍 0 X P0080S^p!f p!:|rQ R 81 R 0S ЍQ  <00 :Dh0 T  Ѝ,6d5@5D0h0  S/4G-TP@pᨤMk +r(@($pT 00CS0SX&32D7P 0400/($$ ଀膃0尀:p㴀%LȈ㸀͠x胟H pp8At`l@Ãd\X(TPPLHxD@<84($  h2101:|@ R 0S 1q810S \ЍQ  x20 UCh Jh@ \@  00(PU(p0Ѝ>㑸A@<㌸^㉸vㆸ8#ヸ:〸0'}#zJ #vH#sp-p-m`_j|godpar^y[zX{U@|Rh}Ox6<'e5!3+!%,!-!.%0%`&i%j%k %l%m<%n#o#s%t$%u4%v,%w%x#p#rd"ye"z`"|3DH12A-``_` p @ 0^ 0(`V(P0O-pǟM 7700Jm6儲0 `0\W[  p p PP  pTPI\$ 0P s 00bRS 4T D600/O 0 ;0☷ $QPBPq 0 ;0≷pt 0S 004 0 s 00bR44 $R P|%|5  0Ѝ p PP'  4P 4 0 s 00bR 444500/1QP p lR Ĕ P  $ $ 0T0\W0yS vpP 0@    $ `004S  40 q 4Q0PQ40@ Q  000r0  cR$W0< SS) p: @pP 0@  N  $R `004S 0040 s 00bR $4S4]0P"0 0Ѝ0 ;0p4S  20"0#?cS  20|"0` py P20L"0` p 0 $ P 0 s 00bR 40 ; 0₶p1 P- p 400s440040 s 00bR44P 4p!4 0 s 00bR L/o 4"<10 p 0140 s 00bR40z 00 0#?c0`000`0000e ` \( t0t0! 0*rꨪ@>==Y0$  0* 004 44/<O-T4P8 `0$Q@DMh v :Q{#R3Z 300S 8 0P0 @P`@-@P% H|P ;PFP0S)[P& mR R@0R0 1BqQ;RS S0 CmSr ;S R R0 S0S PS0 C;Sr  QR0RRRRO-0tSp@`Md`Z|P YT0ɍ <rr  00bI|"0R 3S(0$00 0pPK?T0 ႘THP yX 0S$$ $ 0|"4`0T 3X 0 4S0300S5 p0S2 4S, 4S 0D#Tq匑Tl"2 8PR t3l2Z& L[# `P P y0`5 3V 0H5S4S 4S0?o2 8p22Yt2 PV 2t22Wx2 P/ x2x2hЍ0 D p$l h $ <%$(fW fP2l2Yl ^Pl2<l2Zj UPl2?;~0l2Y JP1x2Z BPx2?;~0x2T 8Px278x2W  -P<1t2Z  %Pt2?;~0t2T  Pt278t2|200S0X0  rr WH|"R1S00 4S,^L%R)TZ8p2@0t2e8p2,0t2Z xQQPM0 00̖@-0 0`$pPpP `@`@TPxPX@l@ h` X 0 0lptx"| @Rꨖ/8 80 00\ X 0//O-\ M`p0P@T \2 !0S S0SXT Ѝ 0 C-a\` M Q Ѝ |Pl@P QR  ㋯PK 0, R 0"0 Ѝ 0 ЍPq հ P ` P GⰐ帐 少帑  QLײk<0<0 0 aȲ\PI I@IA-P@pP @P `D`@D0 x0"P0VP@0 j 2P p@-`\@PU 0S1 RU0S@:0@S4p@1G-lp@`S0 SV0S"Q0S 0SVC-@0M0`M@ỮP0 0, @S@ @ jJ~ 0圐†p 0|" QU  P* a YTۍЍ 㧬(+PG*lF-P PM 0 R  * 0  ЍD`0 Q0@-@L00S :T g/A-0 0`0S :#pRCq# # Pᛯ0@P: #C#S# B0:#!Bq##t -L0LM0 0\ 0ʌ   , Ѝ䐎8 80 00\ T 0//8p@-P᪷|`p`@0@ w0SP0P0:3S 8 80 0\ L0:#pO-``3 0Xs0T*PL3B0` p (VS p p PO p   r  `R  01Q @R R3 RV@ X `20X2 `mpv  @R `  R i \  lp P ` @q lRQ 1 X6N @{? ` 0  S, q lRQ  1  ?p Boq`R s0 00#?c s 0\0\0 0  <  H&&&&Q%@%$@#G-(S(3P`@Pe 80$ RR a ʌ3S23pSxW " Rp .8' P`, :Qyp@-@0@P:#R  #Rp @8 “%\8 --  pp# P`p:pp8 :x (@-<@<0@00:3S 00 x$@-8@80@00:3S00w$@-0 0@ :Q#Q& " "" "`# \`#"p\"p#ƒP` :Qlwp@-@0@P :Q%Q( ,"t \\`p` p#iP`pW :Qpvlp@-@0@P :QQp!""p!"h#!h#, p p@#8* :ulp@-@0@P :QQp!""p!"h#!h#, p p@# :tlp@-@0@`P :PQ" hUh“\ ƒƒ pp#P`p :QpXtl@-@ MZqQp* c0 Z|0 `00004| 0000408003 Ѝ| 0< 403 ЍT T0 0`0` V:`c3P`hsD 0 000:P/Dr@-0 000krT0T 00:3S 0@-ppP`/qX0X 00 :3S 0-pp@- ?P`/q$0$ 000:#Ro/q$0$ 000:#Rq/p000 000:#R o30/p(0( 000:#Rq30/pp0 000:/4pp@-P0P`M0@0 0sscp 0S|000 SC q R 0:#Ѝp R 40,00 3/Ѝppht@ A-RBP0@SMu QP 0S `_ 1 P00pp!p!1L  0Q`11p0S0S  st100S0S  g030pp 03, ppm.C$ЍP Q ` *P  0:# 0` `x   000 00v0 0@000 o ht@ (L@-,@@0S00@-$@@0S00@-X@M@ 0S Ѝ< 000 00.0 0Ѝt,@-\@M@ 0SЍ 0 R0 0 0 0@-DBD2@P,MQ :3SU0b3pp`20Sfa` 0SP1p0SA d0  B0)1`00|PR 1 20 0Q 8G 200 X20B0  :3,pp0 tP`,Ѝ0`00|P   0 R0 0 0 0300D  8 20 0kX< pp@-@(M0P 0@ @$@ U8 0X`@ @$@<0`00:3S Z (Ѝp h 0 000:3S/GlhT0T 00:3S 03@-ppcP`/@-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@P!80-^\ , 0 B\ 0 ^O--J3dS0 dMbWSUa 3,p0CQ?8 <3 Q7SA0:pP8 , 0pd3S00P 0p3@ 0 00p, , G3, P 0 0 0U   0RdЍ|B0 9dЍOh/O-*,M0pP2U 0! & @Te ` @p$ $TK):0`SO p 0 WPP,Ѝ@`00S S> S0PV$0S-00 04S,ЍO>0@0S A0Q  B20RP 00C 0PV !00C 00PS  P@0 C`PQO-DM 4P3 S-0S*U= 000  0@ 000@ Q k@` p 寣PJ @0S 0ˣPЍD. P 4A " 2  0ЍP0P8[P0  0 / D0D M000S :P Ѝ"Ѝ/YH0H M00 0S :P ЍЍ/LY404 000S :P /XH0H M00 0S :P ЍЍ/X404 000S :P /`XMDD0P  P 0 ЍЍ/X@-|0| 00@T 0J#4R |B0pQ 38@-P @@W808 000S :P o/0WD0D 000SP:P4@//V000 000S :P /VL0L 000S :P @-p @/TVA-0 00pW* Z3$SP! #R`@4Sp`3@Tv A|B0tQ 7A`-U-0    h U000 000S :P r/TA-00 0M` V$ p @0p}p   vPP 0pqp@   0-@ᯡЍ@TP  P ]/p@-JP 3S P`4`琡30PV务  0s3$ S"0GP |2 $R 0X0S 0L3 |20X #$03p03ppp@(p@-jP D3S @P4PJ30@Sp@CA-`P\ J3S%sW" Pv@P033SĔ S*/W 0B@ ^0,  W0p,030!C  ! L! \0|! c0000WP3PSSpP4Stpp3PUpp@-@P PX0:|"C0T0XppG- Ѐ\-P@p  `P LTL!VW R T VW  H000S4080 ̡0 0\P|O- M0@DT  =p~PP5P(  U9 Ѝ匡P&` U$ @ႡP  0 k 0 gh `  @RYd ` `g Ѝ Ѝ0 M @0@0lO|0@-?S0P  0pP0@X p`a p@^`  00PP N4A- Q@PP% pW# 0 0S0,000 R   R   R  P 4ߟ`T `TX *P Q Sp  QW02ğhMp@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S OT00SpX@ |'(@ 8Q 0@0ppp@-Xa@P`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0pGpJT0T 000S P@ ?# Q @ $080///H((0( 00Q0/0H((0( 00Q0q/G(A-T0T0 0PRp @`?`,GHG(T0T 00 R X@0|78@08Q0@0/TG(0 00F(0 00(F(0@-P0P0@ MT X0:|20T1S@0?;@0c@000080S@078@0u Ѝ0F(P Q@0?30R @080///RY/R/p@-PS `0H @?DppP X @0*|"7 8@08 R 0@0/P@/'0@-P@PP M X0:|20T1S@0?;@0><000080S@078@0 Ѝ0D0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/0 00Ѝ-,0 (0 M0 Ѝ5(- M0 ЍC- M0@\P(,p 0I`SLTrK0 p@ L2Lb`p`8  0( 0Q 0P00D 0I?o P20S 01QH``00CQ000 Ѝ0`00S0UZ00 ЍX0pXP° T0`ER0 VpPpV 0 pP0   0T S00 , Y10~80  080 000 S0C`Cp@-`@PS pp 0p@- M Ѝp@-@T T  M` @P2 p 0 ЍpL2(\0\0T   81S 1S @0<@0/6S/1(< <0 0001S 00 @0<@0/x1(d0d M000 81S0 Q @ ,@ Ѝ/&RЍ/$1,0, 00001S@0<@0/0\0\ 00 X0:|20(Q Q @0<@0/6S/x0(0 000@/0(X0:|20(!R !R @0<@0/6S/0 @ /A-@pP` P~ghP v@000T 000S00/ X80  /404 0008  P//.(T0T M00 0P RBPP0T Ѝ/t.(8 0  Q/0Q0 PBPPT //,0, 0000P/P/-,0, 0000P/P/t-O-X#X3 0@PU @300SPH0,SPQP0gPEHY ppH`HV, 0 ^  1  !!`FVI@Y*p0S a 0qZ,0 0D |000 P0VpTXppGWpIYX 00C 0HXP qPaTYO`IVIXa, 1 \  0  !!yZ`Yp0Sa0Z,0 0D | 0 00P0qpYPY0 0CPbY0IS4-| 0P0/ 0)(0Q /p@-PPp`@T0A(, ,1C BA00T00PPpP 0S 0@//P 0S 0@///// ///O-1!000, S 1H`?c``PD % AAp0@!qW0 8 0| 0Yp@W0 0C@ P @ 0@( 0 00X'(T0 ?o2R0S P/( 1  //p@-(^,0R0SQ!R@O-A1 0@ 0MR03p P `ࠟ, @ 0S" ß#SßI00 0C ```P  (0R0 (000 0 0C00T0 03/p 0PS@  00 Ѝt&h(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P^ (0@SpH0@-0\  @ 0 Q@ R0xO-P M@ZU``J0S2  P0  B( T0P0 S `-, 0 !S Pp0SᴀK`Dp0 `| 0"pP Ѝ0 P0 00 S RP Ѝ,yP e,0rP 0X p 0 ``F0,0C,(`aaA0  0 U  0p0E4IP  p`, 004@J 0U` p0EpPT   PB  0SQ 0 0QPC 0$ 0\R R 5PT 0 B 0C G-8@P Pp5 0PUPAP0S%X0#P 0 `0UPV`C ` 00 RF `C`V` p[ t1 $p00S9 0PAP807`P,! R ! P3 ! R. ! R)  R 000U+Q*P0 `0U0PV`  `SW Ѷ`x0 @p 0 $pXPD0U0P`W`PEP  (PQ@ 0 00 $\ / 00S0/0PQA-a`eڤ1@pP0$ PZ 10 0 QT$ D 0R U E]pM D10 0 QT$ D 0R U EKp; 0D00  Q P@$ R U E4p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q (PQA-p0p`@0@* $ PP t@T00T  0Q@J P/ 0S, 0@- \$@T\8x ƌ8 t @,0A0@PU 0P0U00 S00/Q?XA-$@0S00â?P2 0\-@ 0T `ApB 0S#0^ 0S0pW F7@ 0 0 04@U/80Q@0@080/A- p0 S B0@( P`0,,0A0C1!0 0 0`S@( X0@-8  PE? J0R|B8000$ R8 R0 00S00!R0$R0 R d1S0800800 080 RQO- M 48nڌ`pV@Ph 儰到OP,c ]PP0` Z4$ 0 X01800a0 `X`F$pT`   @ H | P <L06 t1\ 80` d h l p  Ѝ.P47  P; 0 Q" Q 0IX   pp VP PʮU Ѝ@ Ѝ/ @ +)@% #! @   @ A-0QM@PP(C p`QAR   B P1 \.X) P$,P4PP D0 D0H0RH00 p0$`P!b@0RЍPЍp@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@q@ pHP^JU`^VMTPDD    PI T1D00S*Y `$@(D0p0S0`@0,0U00 D0U@pC@`C0vY Ѝ00H00H0|  P PEPh T IPIP Ѝ0P00|(0@-@l0l 0 \ B/oM "0  mPP 5Ѝ0(@-44@M00 RЍ(QP-D00M  ( @0:Ѝ8 /00@-MN  P@N000 0E DЍ0O-A-PUP5P`0@%@00?C,5p 00TP 5 5 0@0@0@0  00P 4 4 0@0@0@0  00P x4 t4 0@0@0@0 00LP ,4 u@ (@ $ R@0@@0 0 (P !R 3 Y0@ 0,@   8P !R t3 G0@ 0,@ T!R   P ,3 5 @0;@0  00P 2 & @0:@0  00P 2  @0:@0  00 P x2  @09@0  00P <2  @09@0  00P 2  @0;@0 004P 1  @00@0 00P 1  @00@0  00P L1  @0 0@0@ 00P 1  @0@0@0 00P 0  @00@000PL1S0  @08@000@P L0 } @00@000 ~pdt|p@-P@P0@P006Sp0 pG0 0p@Opp@-APQ@`Q }10  R* 0  0W pp!R!  Br (00(!C R$C1Sڸ0J @Tp!Rڸ  *d2 00000S / @T *@TUpx00 QPڸ0 Pڸ  4040 K @T,|  -M 0ЍC- `?PpPEIP$Y/ P@  N @DT`F࠱V HX $ P 0Cp@-A1@`P0M@00 !P Q `Ѝp ( 5x! h!l1P 00TtP1 0@00@0P5,10 R00S Ѝp@  0P 0 S0 0@00 @0 0P 00 @00@0 0@0X P@00 80L * @08@0P` ~p|tdA-@`PpxTV,1 @ 0 @A O--x/x? dM$ 0*#R$P/@ T<  ( ` (`RP(080@80@V @ ?0S{$$?@> 0D000D0 R_ (@AD000h0S80@0800 0S4$ P>0(0 RR, 00s0S^H 0"( @ t@T,0Q0@t@T<0(00S@0S  (  R ( , d HXL L,T,S(0 040,100 180<00,0 10 <$ 0p0H |0D00H00_p& 0H SL0HP1<08 0,0000c,08 0Y0Y 00S0S0A0P<08 0,00 1 1 01IY0Cڸ P0D00 L  /o^" R 0YP@r00PPP 00P P p, 0 R S R  0\ ɟ`V0JZ 0Z hp   0R A SwP  P  `p P V  0R  `9$00S\D QV 0C00 S40( 0S(00040 0 S(00 R4 000:3s L  RL   000Q00 0\,0(0s0,Q0,6P 1 11RY@ڶ  R5 8 r  ` qH$0`V 0\S0JZ @  @NN Œ Č Ȍ N LL\mɟ`V@<p80bT 0P TD0D0 R 0 R PP! YR *Y7 $R  0E0| xp0  0E n D000P $ 6  ZD0@00!R 7t <000V ! B0C 0$0P=X 0*1d"0p@5$  y 0@P`< 0P8, Tp P$T000 @0pI 1`11QUm 00S400 <0pD0 P X 0*1d"0p<0V @ 40S pV0A0 0C0 R d1SDdЍ 1P VUQo 0    g#$ R 00S0 ?3lcQ@APL`@ 0?3T 1HX1QEP @?0D000L00@ 0@0@00 XX0\wP40L0P S @(080 x <00  $,20 p`dЍ80 00@ 0Ce00S1$ 0D000h0S(00S2<0 (0 G0n<080 @0 80^R00C\0Rʗ@t( )0$ 0, QMp! <,\&`@VP   |xLH~~~p V@P P0,p, PQPJ q <@,T`V@ V@ P0 , PA,\,P Y AIa,@IpE ! W   P  X,00,0Q00 , BCR4 R0<084 00C, 00S<,04 00@0@0 0,00400 00 S` @f` P 0, !Yp, 1@S  Y@pL _P0000 00S000 00 0S 040C04 R00CQ8(0 00, PEuK PAj0, \ p(@0 <00  } 0PU@`0V0S 8Q004CQ0V0F0<00DPB `P | <0`0PL W H3 D| p|4$  D0@0 0Q2 R/ dP,  ) R d1S $ 5  DuPp:U U6` p 3`FV EPEE(0,,P 0E0HDp0x 0E ; D000P DVP0 0 : ,0R<00,P 0 apC0Y 0C040| & 0&: 0:6,080@40 H؜ 0SX1!0aP0S00Y0SHWMW)0 S, 0PU00P@8 J , @DHTH J@ P0E0PE0PEQ! 00 00C,0X<00,,0100 0R0<0`0,P0,0 00000Xڭ@W 0 CD0X0 <000P`]P41 pQ. S4S Yô4SQX H5S4Z  <9$p@ 0 p_D 00p0 pR00P;  0D 00 B0 0p p50 0p{0 p)(PP p0SM 4S 4S Y00ôQ0S9 L5S<  :$ @ U0   D0 00pG0  D000P \ 50D 00 B0P ) 00Q0@000 :0D000P  T P" +$ <@ 0    D000P T<$  0 o R! X <$ @D0 001S X <$ Dp@0 0L5S 0 0RX D=$ @D0 00LXDpp 0 0LgoSPk4SP 0 00@D000$ >@ 0 pC0p   *D000ȔY   j0 {\opD0 0HpTXPy D00 E XP    p|20 1 W0!Q:|20t0`1=}Q,00S|20l`0 80!Q:|20hRl0 *s0!Q j0!Q 4Z, p/p@-x0x 000@00CS0 S p0 S P00cpxPp080p@-0CS@0 S p0 S P00EpwPp0p@-,0, 000Pz@1p<p@-Py@'p@-|0| 00@0J0Q P R, !Q0000ܱ(0JP\@-\,AP /0S/ p@-    @ BJR@P`,PTa@@@AR  Qp0O-3C$M0PQ`@ ypP 0 0C S{sp ,0A10A1S!000A CR  (  \ 01A K" R T 0 0 0J T0K0 00Y?3 0Pq  vPP| 0Y0 00 W0(@p ڼ T D H0W D@ 0 ( 0C P8b$Ѝ00$ЍNT0 S80 E 10@/ @D  BT zp`$ЍHȏ$Ѝ 00C! [z @ D0 |0p H0K002 [ @T @wT @ @\Lk 0 00 t(p@-@Pppp@p@-@80800P  @ppp@(O-X6dM0Pp$0x`P @Mu0P0 X0P400Y000@p0@SUJ6+QP`0PZ0p@00@D@TX0 000SR 4 M  @ CpDR2C.-40T R8 7 040 ]x$ 40p0[VH0`00000S00U0EFxP`FAxPJ`:xP0p0C0 D S    @R4,00 !R0!!۱,(@Q 40 0R!1 AAaA"AR[ 0 0 0`F[0A40Z00 00, @ pp`4 84,0@,@ 0 <8'@T 0 p4 00C 0 Sj , 0 (0C0S00 SRs 0  3 w R $10`0 ᡍ 0p K0000 00 00Se @p0 000S00U0EwP0J S 0p0Cʯ 0I!a@Qp``P@ 0H00001@DT D0|0p =vdЍ#`@ 0\40T `R0@40 pxP`; `v~dЍ`|`v̫P /0 0[d(M,P   00ЍMЍ/0(0@-\0@X 00 MP p T  Ѝ0@0 Ѝ0(p@-@\ \  M` Pp T  Ѝp@Ѝpp(p@-P@ppT p@ pp@-`P@ppT  p@p0Q /0Q /p@-00 0`@P0 0@\1000C1.T 0*\ /\p0R000p00p00 0L 00XO--MS LPP` 0Z p H 0@TK !  5/  @T8 $T0<SP1 0000#10#.R00S0>qP0  H 0 v00 P00 Kr R0S0?1@P5/@T YЍ H\00r R0S@0刀0@P5/@TP4] [ Q" @-@ RM !R "R pPĜ\  00@XЍ/0Q " @-  MS S PpP$R (@/Ѝ/᨟-4M0 ЍC @-P000M, PЍ C0@- 0\SY ^S9 %@@ ,S'Sv{cScXÁ0@4Ÿ^C110N0000q0}00%@000@0>Á{C0q)@@PA 00@S801pP00A 0@@100CT00C0q S\S:S '000L0d%{tLQO-M  ?q\PP 0p p00047 000R0pp ` @ 0,R6Ti \ 0@ 0  @ 0 0 Rg  QS%R +0@GSSQPNMLpoIHGFEDCBA@3>=<:876543210/.-,+*)('&%$#"! > 0 SrJ 0P0Ѝ% 0iP 0@  `fv`00 0 "!.Q *Q0 0 0RZ@0 S\%p 00 @ 0% 0dP 0@  d 0 @0 S 00  00000 0 C@030 S`  00    0 0 C@00 Sm\ %p 00 0%@@c 00 a 0 SH\%p 00  0 % @ @@+c0 00 0   / 0  0 000  0  C00 <   0 @@0D0 00T0 S\R$ W 0`C0@ T$<0  0 Um/> 0000   0 0S0\S 0 S0 XV V R p@-P0P`@0MS PS   00 0Ph 0 Q00QH  8 x0 Ѝp)0ؓ88x8d<8A-@0MS0H0D!0@p0S? ` 01Q!1!1"b2cP0A @ 0L0L  00210BP 0 pW$P@WP 0fSPЍЍ 0 0ЍؒN N gA-@0MS0H0D!0@p0S> `4 0{1 ‚0  @P0P0A 01! 0120BNP 0 pW$P@TP 0nS;PЍЍ0"0Ѝ\kLL >C-@0MS00! 0p0S2 P 0`1H $@0!b4!b H1c$a1c0@` 00  0#3c`10BP pЍ 0<0qW X $`0sSP p`VWT 0S NlPp|PPЍ܏-?LJ *S0 O-LM il mPG $0$ 010 : 03 @PP: , @P 0S  R 0[ M #[ =[ =l`P` s000`0xxtpgP-  [#Vp p  RR nP X,     PkV k0PSo H0 1$ @ 09d#ds112cp0@0L!112c0A0L0 30`b1a`@ 0Pa `0```@$@b`Hp, `V @Tp@zk=0 P@@0ok`VP00LЍ` 0!q0ƒ0p0@ 0200A0!1 120BPH 0`0@4`e 0L1N $@0!b4!b N1cq1cp0@χ 00  0#3c`10BtP 0tS0cS0S``d0@0` 0 0< `0SnzxH ,rNG gppkLF >-?L8E *SH0 O-@Pp`0\ %\0pS sS lS@ 0\TT1DW 01 CR0@CUPO-ϟqM pQ P`P? 00S040H $  l0H [0   RU0P Gr@T %0%T 400 R,B*Ph p 4 @@TP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+p8mP" 400p,1S 0C11ऀ R 3400@ R,*P 0 1kp 40P4qߍ00f0\!0D]SAA t~x|{|x!00D R`@0A?S@:TgPH7gPJ$ PP ch$P_h &gP$P0U 0V PWPP?V00S @(C-`AP|!@pM0 de P |00y0S= `Ѝ@P L ` 0 2p R 0S 0P` tЍ` 0 P  pP`L004@@@+c P *k@P  @ O-M M:S%0:SSP 0`S:Spp@F T R*  @ 0  tDmP 0P:S ۍ ЍPۍ ЍC-pP0Ÿ0M M@`tPE 0/SU ~P 0tgX PK P 0 ۍЍCx0P pd! dP0 @ۍЍCu0 PۍЍa0P 0S/S =~pP +gX0 ۍЍC p 0gYW L0L 0 $ۍЍ404 0 $|= ,= = < < X< ; `; G-pP@P  W0@fT  MP lJ``P@` @T  ?P00@0A0G 8; MM-@-@ M 00 Ѝ@ Ѝ/3 Ѝ@ Ѝ/ 0p@-S@ 0000p0000  P 000p@-@fff@~f|f zf0xf@ufp@-(PS@:pS eP!pd@- ^fR^ @T nR sR^00 \ A- `@V pfS@`V P0P@ 0nS sS@`V@s00 0S00@PA-P# P a00`|pp ,RR    0S,S@BcP   p`p@W G-P@`PMP 9 pWT*nUK sUB fUH0D Y#R= @dP H0D@pH0@0 H0H @0p nUH P5 sUD fU< L00L0@P @ZP00pY 00 ,00 :c 0S0000  0@ SH0 $H00H0H0@ HH0@, H0@0H0(rH0, 0H0($PH00H0 0U T O-@M vPZ p opY ` h`0( 8000H000bP2 0P   02pPPZ P   P' P` Y    ` ` V S0P@M 0@Ѝp@-1!000 @S/ 0SpQ @\T 0Sp Q00pPUp:`AoobEU@@\S@@ T 0SpPx0Upp`A-`p PPU@R cP !0峀0 0V0pp00000 00 0P1bO-P0@ p$M 0\P `jd`Z5 | Ǿ@P   G vc0P  0e Jd ` 1y@@acP :d $Ѝ J /d-d0,@ T 0(0$0,0 0 0W  ``R P00 jPJ @T d0L`@VH0@0D0L07 fS,  0O 0 @P `V  @0nS sSW@@ c $Ѝ$GG@LN ,N A-Pp ``V@R! bP A0峀0 00P00 00 0 0 P>a0A-P pW@`R bP 0` 00P 00 0PaO--0LM< <*<+, , 0e`P |@P0|0᯽PP00zzPT sPU m:PPaPL  P U 0&T 0 , -P 3 0<*$0 0 0* 0 4 Q' 0! ".Q  ROQ> = e@P pPu< <0 Q4 Q 0 0S, P b LЍ# APP3 @ p@t , R 0S00 R 0S TR  `$0pW %S$  a$ PV $p @ @R^ /p@tP 0Qv Sq 0R 0Sx @Q 0p Q( 0Po )\QPaY'%pWp^QpWq p`W  P( 0 P'0HS3u  0Pg Ob LЍ0AyPEA/P{yxwvutsrqponmlkjihgfedcba`_\[zXWVUTjRhPONp~z`Q@ Q, @  @`, p` 5 p= DFD P R P PX0 T RC t0 U000 00Pn0}p`p_$ 4 80p80p `pp pp pp p ( 8080pppsSt 0 S00 P!`ß0 AR ,   0 80T80剑T0IY【`B 000 0 0s0 _PWP p@t p@t? ,0 Se Q0S ^ Q; 0 c4r0 0P+xP0 0 0 0 f0 P P p@t  < 00RO0 R0K Q| 0?WpMp@ 0 00 0S00 Pj  0P0 0 < 00 00P= p 8PZ@L L E D C TC HB LB B A P/$P00//$B @-M@0 0!1l!1"b2c N0L 0 0@@0#@B!A@C0PЍ赁NA g P0`0K?//$0P00?//P@ @-M@(0 o0L@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$$C!d!b8A@C15PЍ-?L_ *St? p@-0P0M`2b@P 0Ѝp0[00  R 0S"0ЍpTU G- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00Kdl@-@P J_H_F_ D_$B_,@_>_,00!R  !L 001/001P// @--@o X@X0@0@0s H PJI HH @IHp@--(M G7@` @@PR~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " k{UF{{]!00 (Ѝp0P0 P 30 0U f {kUkaE!00 0P0 ~P L30 0U 0"P  0cP0J30{kUk 0 yP  0cP0G20U 05{kF{{dPr  0cP0t20U 0x 0"RP=  0cP0x0 0U"  @P?  0cP0|10mU ! 0a"1"YJ)P2  p0cP0%ژ 0U"  R b0cP0$d10U 0"P1" P  P0cP0$10U 0"1"P   >0cP0@00U 01"0"P@  ,0cP0@ڜ00U 0 0"P  G?? IHQ $Q O N \N N M GpM ,M L L `L K 0cP000{kF{U{ 0% P  0cP0uڠ30{kUk 0 Pd  0cP0\30{kUk 05 }P  0cP0n30U 0_"3"kPH  0cP0L20U 0="2"YPS  0cP0ڔ20U 0"t2"GP  0cP0EP20U 06"\2"5P9  |0cP0 20x{U{ 0 $P  k0cP010g{U{ 0 PF  Z0cP0ڌ10U 0"\1"P  H0cP0H10uU 0 PE  70cP0k10U 0\"1"Pa  %0cP0&00U 0"0"P  0cP0ڀ00U 0"p0"P   K @K J PJ I |I I H I H I H G F GpG G F 0cP0(,00U 0"@0"P  0cP0l00 00U"/ |P  0cP0ڰ00 00U" jP  0cP000*{kRF{U{ 0 UPr  0cP0`30U 0q"3"CPf  0cP030U 0"83"1P  x0cP020U 0"2"P  f0cP0Wڔ20U 0H"2" P4  T0cP0HT20 00U" P  B0cP020 00U" P  00cP010fk{U{ 0{ P  0cP0ڈ10U 0"`1"PP  0cP 0<10@U 0' Pe  0cP0Z00U 0K"0"P  0cP0ڸ 0U" 7 P  0cP0qt00 00U" |P  E E LE E GtE |D D D \C $D B B (B A A 0cP0_(00U 0P"<0"TP  0cP0h00 00U" BP  <P  00{kF{U{"00 t3030vx30 3U""00 aH30@30 3U""00 Q30 X3U""00 D20{kUk!00 72020 2U"$"00 'x20p20c 2U"v!00 @20} p2U"i"00 2020 H2U"Y!00 1010$ 2U"pI!00 10b1010 1U"G6!00 `109X10k d1U"&!00 (10 01U""00 0000 1U"B !00 00400g 0U""00 00 A A A A @ @ \@ $A @ @ @ ? `@ L@ `? @ (? X? ? > l> T? D> > > > > = < p= < < < < 00U"T!00 bP00FX00`00.htp00N |0U"!00 I00{kUk!00 930 3U""00 ,30{kUk~!00 `30vX \3"ZI nI  3"Ue"00 30{kUkX!00 20{kUkK!00 20SC"00 >"00 t20 0h20 0A `y PI : S@ '"00 ""00 !00 !00 kk!00 "00 "00 !00 "00 "00 "00 !00 kk!00 "00 0Sk !00 {0S6 !00 s0S !00 k0S !00 cP  ]0S !00 U0S !00 M -DT! @< \< 8< ,< ; ; 8; = ,= 0S "00 50S !00 -0SV "00 %0S1 |!00 0S t"00 0S l!00 0S$ d!00 0S \!00 0S T!00 0S L!00 0S2 D!00 0S  <!00 0S 4!00 0S ,!00 0S $!00 0S !00 0S !00 0S "00 0S "00 0S !00 0S !00 0S !00 0S "00 0S !00 } 3H "xP !H H  3"0SG!00 c0S  !00 [30 0c|30 0u"00 N"00 I"00 D"00 ?"00 :"00 5"00 0"00 +"00 &"00 !{"00 I vI "2"2t0 0ࢱ2T0 0240 0>20 0d20 0~@20 0u20 0l10 0c1t0 0Z 1T0 0QI140 0H !00 X10 0;Q410 02h10 0)70 000 0I0p0 0 ?47 6 6 4 4 h4 l4 4 5 5 3 5 4 3 3 3 p4 2 3 l1 \1 d1 2 2 t2 2 ,2 1 ,1 / t1 <1 / P/ 0P0 040p0 0ذ.X00 0ϰ|00 0ư\0 000o 0ะn0 000a 0ર180 0ࡰo41X0 0&X1 000A 0hM!00 10 0|10 0s10 0j@2 0008 0\H2 000l 0N 20 0E20 0<" /+SH0@-C @AQOQPPP 00 QȠ\ 0 +CA{ 7G 00+C03Q Q 00A@@1 0^XnA!0k+C{6F{7+S 0+C00 0 /P 0S $0S 0S P? @4@P//A-Pp8`Q) , R0( 4", 0R40BV@1@! G4V @D 8-,0400G%0, 0 40@( 0 (3/P840, 0S004R000@-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?0$ R(400  0@=0U 0PE@T$0S0  0@4=0U 0PE@T$0Sx  ($  0  88 (90,K  @Uv 0PE@T$0DS, 0 D0@+@<0U] 0PE@T<($(<,00@000;00SB Pt<00 00CS:0S ;008@ Q;0(0 S0(0@080t0 8904;0U 0PE@Tx0S  :00;0,@:0000 pC0 0,0S P<@@B0S 0*S3 W 0PC000000 00 0 0#1<0 S@0@0R0 RR<,0 0PUS0S00)9 0 <0 30DЍ  R S R  BP>0 P 0pBS 00 0 C0 S 040U 0PE@T00  BR00S  \ 0S0($<,(<0$(0 R x80090 00 80B4 R,5@0 000DQ1  P !ADL B \000D0S707 UR00t0 0P <@@b0(S0 ʆ  P<@@ ;TU 0PE@00 S  SP S> 7威@D00@T80PE@TULQ60 Q H0 @S0 0CR*ʆ+R h6006000LQ`D0ʆ;460\0T 00T :0PE00@SUld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@Tz 0Sw 400d50Uu 0PE@T:0ʆD+1 0D0@D8+Ua 0PE@T:ʆH ;0 H @D;8^Dp840WR Up1 0Wp!WC 0 0C 00 00"D0PE0CD00*Dpl `R*$0ATU% 0PE@0 0Rl @Dᨁ:R (0,00C 8 P0l00X0S>0p0P0?0X00 p0tP 200L30 R=0 U 0PE@T20H?o20$0S0G $d2r ($B0#22cR<0S 420020 0L$Q   R D Up1p!W(R0 D ! $ R D ! $ R$!  $ R40,0000 100HU  PE@T  ' !X$ 100T100+000;8D@Dt00 R  B0 D  0P00D, + ) 6?7?8?=?>?N?O?5?& P?|M?$% H?A?L?" J?! C? B 9?:?;?0@\4 @Dʆ+8_,4威@D0F D0B(8<#0#xpW" h400,40:Q  ;8D@D _ 0;=04HL0  : 40040 0@S4Dp0I Z0PE@ZU8tgx|p@p ⨃ ^':l0wp 0:00pZl.  0S50P0;T050- @D{5威005@D0 :@z 60050@ 00l(4890 (8(8:0;t600T606l 0XZk0PE@ZeUx 0C00Sd  0 7 0pe41q岠pT*US 0`4`UU PE1q岠@pW0`8@DQ{8D@D,8tgx|p@p㨁U7L0R0 PpC% 8(890@+Z\8@D 0w@D(38l0R0 0 0P00<0@@50 0`pC( (0R@D0+S(0,80080 0X0S>0p0P00tpXp040P40. \9008 (892 qdSR: @3 0@0L9@0l900900 pC \ p dT 0  \ h P H:000 00威@DpCx:00:0 0S:0=0 pCwp@-@PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B44 08@.V000PA-@`PpP 0R| S  P00S  . +0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-"2 0 M000Pi@Pp`W2@ R2Q <00 0 0S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S3# R0S  l0pS0pCp)x0 00 0P,04F0p0 p0 0 0 30 Ѝl0Sl0@@@b<S???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPw@ 0!(`3/PPp 8XG  ( 0(3/P00@d  Q 0  `!ͯP S>0Rp:oRS B P T  B T p X0Bp  (08#ᯯ8Pp 0BS.  p 00@ Q 0  ` ፯P S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?00@C/O-PM@ @㬰(0ڵU 0C0 0$SP $Cp`0 sRpW-(0p p0Ѝ0` Q`V00p<J\S 0W0T0S20b60s0P0U 0 CP0S 0SCU\! V ! 10T2 0 T 0SЍЍ0D?o 240%R00S020,0@0000,004@0D?o280(00<000 0 0 0C$0 0S03p@05 :^`033N , %0! '05 %0 %!0(P<90C1P RP@00F3 0S C 0 $Q Br R$AVG  ` V$  \ F Y( V F(*Q BR  BR^ : 8 Q  Rc4 %Q  R]<  BB!   S @1@ <01( 00 040$0$ 0 08@, 00Tl O-DMX03 0\0300 C  2 000ӗ1х1&=  tx l0J B0x t HH^Hl0:8HpXT`!Dp4`ᶐH@ᰐ00Rx0 Pl h`0 \0S8 B0l0\000S\ tDP`ux0l h Rl R010#P60 6SC \0P8 B\l0\00PЍl8  Ƒ R0Ƒ0Ƒ !  h0\0P8 B/l0\0|00SЍO-T $M t44Yl08H XT "D 4@@QH 0 , CA/B BP`&P]pƈ0Cs00&#ĠƘ@ph# 0C s0!I.S8# 30җ1Ӆ1&=  `tQI Y 6R06t0l0080EV` l H 0U#@H@0 Sl \P8 B0 l0\000S$Ѝ8ƈ6&6 &!9096tl I Qtl 1Y` +t1QZ 0S Q. Ql0mR ,l0`h@A p400D`H0` l @5!0 PH0 ` 0 ll R1#:\ 6S \0P8 B %l0\0r0P$Ѝ\0P8 B l0\0`00S$Ѝ O- ,0 IY!0 M@pܴ0UWZ0c&P* U! Ep:\l`T`F Z PUP!Y /ooW"Z  [ZW  0u0 #4 B %B B  0BV V`!0\ 8  ᜧ\  0C  PEU``\  &Z  BP 0 P  `QP ,8\t06 Ap,0l06\0 `QPl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \C6&S06l0R, ` 6V`!VX\, Q* 65@ 0CP!P 1RW G/o"S W  R  PR#P`1`!WH80  D\00\0_Pl<N^ Al 0&lR &&0R8  0C 6,AQ  l00l0&l8 q, l0BP0l0\P`1`!W 80 \00\0c  PR#P" 0S $0S 0S P0X*SES[SgSqSS9 C0//O-PM@`?o2P0S{@0S0v S t0Sq0,0S$ RgL0Dp 0CpB S*,0lp\p v`FP0*SUtpWR 0s ,00VpE*0*  00 P  t0S!ԥl8P pLpD@4H0P  ;. 0`RH0`0t0l t0Sl  l \  60 `h  00Ѝ* ЍA-@P 0S $0S `PlpP l0t,@0S@1VTU@80C ۥpp@-@P$ 0S! $0S H`PP`0 S0c``,0S`  *00 00(0p`p 900,p@-P@P pP,0L D0<00 B@C წ0\ 0 1 0|0:l@\@t@Fh@H@x ` p谸p@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:`k6 @cU@ĠL Â0 6PUWtPPA-@P P 0S $0S p`P0p`P|0A-PQb!Tc@pTeAP0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`䯟0P 0 X  0@S P X 0S\\ \((PX\ L\  RL/Sv0S[Q gQ 0St0S 0Sx RH R .0 103/0@S0S>0 X0S S000 00#400 03 0  0#400  0 w0S0c0?o20 Ѝ0So = 000>Sq *S/0Sq00 0 0&S+B{l0S=  B0#2 2c0# 0l0Sm q00010S9QI Q0t0 0 0  R 0,0S0Q0Q0$ s0Q0s0R 0s000 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00Q P p K 0S  0PESp p W *PG -0 ,0 SR0 B0Ztp 6l8&`6&6 &!909&tpl0pG0Qtpl0` Wt0SX$ :Xvy 6S \0S8l  B0 l0\070P0S P{X: X(0S0(0 Ѝ0S 0=0 0 0 0 0 0 S0 S00ӈ R01q 00 0SEQ0X P7 R #0SS@ }S  y 00#  #800#"0 w0 0O ,0 QR 0 0I000S'  0 0S0   0S,0SQ9: RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:T R+0 B0o00,0S!  Rg  S 0 Q10S 000#40H0q000SE 0 B0:0#  #800#"0 IQ"V\ R8 C0 l0\000Sjp\tZ(l 8`pR B 0 ^L 6ƅp6ƅp6ƅ!9096&tRl0A0tl0 Qt QX Q Ql 8`p0  X 0Sq0 B000 B000,0I ^ ^<00 Y Y Y Y Y Y Y Io^ᩒ#Y0C0KS`00`S&ƅ&p0Cs0 ƅ0 01I>  0001&=  &6tR` l0A0`ptl0r\ R8 C0 l0\000S500 090[|B:XF 6S \0S0,000A  l0 0000 B 0<L0DC0C kt0S*l0\06\0S8l  B0s l0\000S(10 \0SSQOMKIGA-@`pPStPB T00V0SI0S: (0sT Q 1@0@!A00000 |0 `jp( 0S*t l00\ R$6S S L D0 BC 060@D0 0!1 0Rpp(Xp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pSz $0Sr wpViV`F0HSr0FSRnZ WkFoY㫲[dV @!( `4/@Pk * @ 22)X  P "L  BT  A0`, `4 ( P6/ , `8(6/ L `@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍOv `fx00$0h(0 ~ Ѝ@ @0  000'ꤻ-M 0 AЍA-P@APUPq 0`0@ 0S  00 0x!(3/@PX `!@Ξ 0 ,(P3/ 0 ,(83/ 0 L(@3/z 0( D3/80S. @ R+ D PR% , 8 ᠞, @@ ᛞL DD ᖞ 咞0 0C006& 0&;> 0$0;/ O-Q$M R0  \ "r !#4"  Pp Dß` + @0 *'@$0z t %q q{0~ 1Q`!;~`0#:~)4~P(>6"r ~!p'P% ` R ` ! 8Ÿ0# s !P#4" Ÿ " " r01P"$#00# " r01P"$# 00#0# s !P#4" P% 0# s R#4 PUS@h RR.~0R$D. pR$.0#s0A0R.$ pAR.D$0#s00R$D. pR$.0#s0APE.4$ pAU#D$ 0 @  P   "r !Q#4"$Ѝ\ "" R !L /Ppq  x L C-`R! p `  0 D^00# PL  "`@18P\0 C @$! C-`R! p `  0 D^00# PL  "`@18P\0 C @$!( @-@Plp`hPp@` 0!đQ0 0#B  P @-@Plp`hPp@` 0!đQ0 0#B   0@-1@4P\0 C @$!0 RG- ph Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H.7cHN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq%R&-7c20Bp c!qÂ'b "0C0 Q H A R,A B8P C(0@P @@ /qR&-7c20Bp c!qÂ'b "0C0 Q H A R,A B8P C(0@P @@ /q/ U/ 0`0/ 5T7ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O- |ş pjDMWP@TĆP4Q @Q- NP0P4 \ˀB XS-ʨ&σ pPpp Q-Yp& B&^ ScB C 00 p&P4 À fXQP4 !\˒0C`K P4`ˀXT$`; BXKT$T;!P P PQ͌Q- 1^ 2r6w|&A `{6P4pST.0J`@T41\0 Ѐ0 00P 00 p0x !Z㲰_Q=0ⵯ00 PQ !  W Y ^PA ׼V БR"S & &  R[P- Y> 0 Ό KK0RPKPG 0 QR0C Y> 00 B 0[0000C01 KR  00N 0 @ 00T00s P\ R @02^02N00 R0P\DЍWP 0 [Q / !@LY0S F0GC#6pQ@Z p J  =A-P@^1RPA@D0+}n@R- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O-pMWPP00RF@ʀ+m!k `  Rp: W1 R5 Q^pp`0`0p#406 R`c^@F v0`h7W@Hs`s0p R`vpWk @P0 [ЍZ㼆`f Zv` !.0@ cR(r C0` P`P`0P`#4`0f`fTfἆv`0Pc^h0v6v`@``@`.0C0nU6~ BSr Y3@s0P0P00@#4PP06cR.0C 6W W~  @[P0U R: 0@P0dS8`s0000`#406@D@0cUSFuP TcN0~ Dt@P@P@ 0@#4PP06 c^ 0C606 @0P@cTh0v@6v```@@`$D@F0C0@dUD6t@ S1 Nr 3@s0P0P00@#4PP06cR. 0C 6| @[P0`ἆ 6 Br T@PFgX@uPF Br C0@6[O-ʀ6k^pS㼖Mw 4004@0030 0300300"10` cy Rwwppp p .0CnV~pp~漖6S&00wp @4  `! Ḁpb W zp&z帠 B pp't pv pgXw&wpaY taN~bpiW vp&v``` Ipp`&d`v pg^w&wp0CS㎀aޕbޅಐaᶀir^wwp` pp p"$ InX~pp~漖 `#R~ `d0Cs0yb ^wwp@`pp`p. BnS>sps6pS἖_0 c Q~P~"`kNPP!``0C0aR! 6Ѝp἖8p἖p἖0k. 06Ѝ 6@-S k>@@0 #400k.06S0k. 00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&~ʀA-@k`P s0! Qrr  pp "$pp &bS1 B0&u 0  u0#Ġ  <##4U0 0 |   *60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-*k΂6 Sq@q;0PP@0@#4PP06c^ 0C6 S0Ҽ60k@PP@0@#4PP 06 0C6S S00k@@6 0C6006k>@PP@@!PPƂ0O-p0@S M,0S ─&]P+ (+%0 N. 0r?010S@P j600&6 0!R1Q  S030#Z0Sk0 r Y9s00 00#40编0iR# I⼖r0(+ ,Kr Y9s0k0 00#40编0iR# I⼖r0 Yڴ 9s0kΆ000#40编0iR3 I⼖s0 Y @r 9s0k0 00#40编iR! Ir漖D Mk> ! PaR, A   / ! YqqP἖   00`" P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 00G. 0R0 0xS0   0LSI>W&&&& Ѝ ЍO0 &k0p R2 ʸ006N.V l s000 0#406 cP 0C6s0漖@q9s漖9 9s0漖s0漖 4  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  T p@-@P`d0P \0PV  E@T @; 00@p)(@ yaratcid@-M @PoЍA@oЍ@-M @PЍ2@0@Ѝ@-M @PoЍ!@oЍ@-M @PЍ@@Ѝ@-MpP` @P @Ѝ b p /Ѝ0@/T 0p@-S P@0 C`'0@ T @pҚ 0 p0A-S Pp@0PC`'0@T @趚00峚0p@-S P@0 C`0@T @p蚚 0 p0A-S Pp@0PC`0@T @~00{@- MP p 0S @p0@Ct'`V ` Ѝ^0 0 ЍW Ѝ@- MP p 0S @p0@Cf`zV ` Ѝ90 0 Ѝ2 ЍA-Mp@P `P p . 0S P0 C5@ IT@ Ѝ`Ѝ0`0Ѝ0@.T` Ѝp@-@mPt0PPptcidp@-@aPh$0P p!00ploobp@-P`!@P   @[p@-@?@@-@9@@-@3@ @-@-@*@-@'@H@-@!@W@-@@u@-@@@-@@@-@ @@-@@@-@@@-@@@-@@@-@@8@-@@L@-@@e@-@@}@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`u@P   @pp@-P`c@P   @pp@-` PP@P   @pp@-P`>@P   @vpp@-P`,@P   @dpp@-P`@P   @Rpp@-P`@P   @@pp@-` P@P  { @-pp@-P`@P  i @pp@-P`@P  W @ pp@-P`@P  E @ pp@-P`@P  3 @ pp@-` P@P    @ pp@-P`@P   @ pp@-P`@P   @ pp@-P`|@P   @ pp@-P`j@P   @ pp@-` PW@P   @w pp@-P[@b(0P p'0P 0pgntsp@-P`@P   @T pp@-P`@P   @C pp@-`P&@-HP p;P U *00ppatadp@-P`@P  d @ pp@-P`@P  R @ pp@-MP@ d0P @Ѝp  )`P  @P`+Ѝpgntsp@-P@ (0P p0P 0pgntsp@-P`)@P    @ pp@-P`@P   @ p@-@R  @ p@-@"P $0P p!00ploobp@-P`@P  # @ pp@-P@P @#@s p@-@"@@-@"@ @-@"@$@-@"@B@-@"@`@-@"@o@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@@-@{"@@-@u"@7@-@o"@P@-@i"@d@-@c"@}@-@]"@@-@W"@@-@Q"@p@-P`@P  l" @ pp@-P@P "@ pp@-P`@P  J" @ pp@-P~@P "@ pp@-P`m@P  (" @ pp@-P\@P b"@ pp@-P`K@P  " @ pp@-P:@P @"@s pp@-` P(@P  ! @` pp@- P@P "@O pp@-P`@P  ! @= pp@-P @P !@- pp@-P` @P  ! @ pp@-P @P !@ pp@-P` @P  |! @ pp@-P @P !@ pp@-P` @P  Z! @ pp@-P @P !@ pp@-` P| @P  7! @ pp@- Pj @P p!@ pp@-P`q @P  ! @ p p@-P_ @P M!@ pp@-P`N @P   @n p p@-P< @P *!@] pp@-P`+ @P   @K p p@-P @P !@: pp@-P` @P   @( p p@-P @P  @ pp@-` P @P   @ pp@- P @P  @ pp@-P` @P  d @ p p@-P @P  @ pp@-P` @P  A @ p p@-P @P z @ pp@-P`{ @P   @ p p@-Pi @P W @ pp@-P`X @P   @x p p@-PF @P 4 @g pp@-` P4 @P   @T pp@- P" @P  @C pp@-P@. (0P p0P 0pgntsp@-P`@P   @ pp@-Pz@P @ pp@-P`o@P   @ pp@-P_@P @pp@-`P@@ HP pP U 00ppatadp@-P`z@P  G @pp@-P`@P  5 @pp@-PW@P o@pp@-Ph@P _@pp@-MP@| d0P @Ѝp4  I%`P  J@P`'Ѝpgntsp@-P@[ (0P p 0P 0pgntsp@-P`@P   @Mpp@-P@P  @>pp@-P`@P   @-pp@-P@P @p@-@Q @@-@R  @ p@-@0 P ''p@PP!0S !pډ !0@-$@@ ш@OP 0R @-P Q So//p d 0S p@-P`@`PPpwP p@   P #0 o@-0 넠 ` @-P Q @@ @0@ a0 ( (0( b0  T 0 0  @-0< 븠 p m0@-P M`0V! $@P 0P0 `  ЍU&ppp\ ∈P` !S  @B& ЍI :&HM@- #@P $0 0 0 pLA-pP #@P ~0 0 0 H`#PP  "P `0 000 ,0X O@$L | @-@P %@ te-@-M(pW ,P0  P#@P#`P  0 P" UЍ@Ѝ/Ѝ@Ѝ/ 0 0t 봝 E,V @-@P @ 1"p@-@P x0 00R0 PM#0P Q ! p@bpp8J$ p@-@P `0 00R P+#0P Q r! p@pI P/0 00R /,IP/<0 00R0/P///I0 0P @-od  QP  QQ -!/H P/ 0 00R/$H@-@P \0 00R  "0P Q !00G P/00 00RP///xG @-@PM /o000"P R Ѝ R0 ` 0 `p{"PP 0 S  R L  ! `PP $  00$G @-@PM 0 00R ЍQP! 0 ċ pp >"`P 0 S d P ! pP` v$000( (0( $0 (F p T + P -/o<0"00^ R  R/EP/D0 00R /@-P oD P/D0 00R /@-P opD P /ol000"\ R RP Q y Qq /D  fP 40 00RP _\/C fA-$0`SM"P@U Ѝ P0P !pP 00  0wP S # o!@P d0 0 0 @Ѝ4 PSP  (Bx 0 //p@-PQ& @R 0Q: Pp" P  `0` `0 L0L L0 808 80 p蠕 L ` , | p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ PpJp@-@<PEPp/>P Q 7P Q>/P p@ ) 0p@-SP` @ 0S P@p<P QQ P/P >P p@ p@-\@<@P(@Q Pp$pP p@  $@-@P@ؑ p@- @P   PP 0, 0pS"@P"p@-PQ@` 0 S S   CQ R 0 S S CQ\<S0S !S0-S0F?o 2-R0S0S -S 0-S >R/S `(` 0 S S  /S  >S   C\  R `Sr 0 S S  /S  >S   C\  R0FU0 P[ UPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0k(0S0$00>S`0``000 0pL L0L H0 0`tC  >R00pl P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /@- ToO--l1KM0 ` 0p0:[ 04A @ Q, [ TPP 0P3/P 0吊0  @04/P 00 0 PiPPKߍP@ 0@;/ 0 @QPKߍ蔋 @OG-@,-PPD aq`p@@0 S S   CQ R@<S,  ՃP   σP   ɃP0 S -S@0-S>Q@@0 >SS @S@1 P@   ( A-PRMePp`0 @T- R0@0W   W[ 0 /R C 0CW /RW  CW0  B/Q !@C@T@!   ;@04D.0 0   R0 *( 0 0[p@  U &0@T0@ۍ? 0 ۍ 0 ۍ S0p sPqD:p p@ C-`MikPF@P5 ,p`H @pB pEe0R:p#0 `f00p*  S00 0fp" 0PPЍ0 `f00p  0Ѝ@;Ѝ4@@-@ @'@-y_P 0 0 ld O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`R_a P0 p 03/V@ 6/T -_T T @T@. 0S2 03/P V 6/_0S @0 R 2/0P`_ P V 6/X3 003/Iߍ 0 0C/ 0 0C/ 0 0C/ 0 0 0 |0 l l0l B0C/x T ܁ 0  E p p ;Ă h L p@-P@PP  P $0SP  R PBpdERP P VPP , `PP` 0 Ѐ P0/O-@MM(p T 000 0 R0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `PMߍT00 0bP 0 $ \00 Mߍ R00 0 0K/ t P~  0/0/@-@@P 00#0 0 P 0S S R/P/ R0/@-f@ Lh|Pp@-!@ (M  P l  ```RP(Ѝp<  P h(Ѝp \~  $@-@<@-$@@/`(p@-M`P{@0 @]0Ps0*0 00 Ѝpd0"Sp@-M@`ZP0 Phqp 0 00 ЍpE0"S 00 S 0 P:\03#/S 0 P\0///A-P``~@P (bpP  ~@P s~W@(0( (0 X&`| | d| 00 S 0 P:\03#/S 0 P\0///0@- @PM @ Ѝ00@- @PM @ zЍ00@- @PM  @ lЍ00@- @PM  @ ^Ѝ0@-@P ,0 00R\$ /P/0 00R / 0  Q0 R* R0:/- ^ : P *0 S0*/@@/ / $P $0 00R //$#P $0 00R //"P $0 00R //"P $0 00R //|"MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/<"P/l0 00R / 00 0  S *0/ ɒ\* /!P/|0 00R / 00 0 S *0/-  ^: !P/|0 00R / 00 0 S *0/-  ^:  P/@0 00R / 0 0 S /P/|0 00R / 00 0 S *0/-  ^: P/l0 00R / 00 0 S *0/  \* /P/l0 00R / 00 0  S *0/ ɒ\* /P/|0 00R / 00 0 S *0/-  ^: P/@0 00R / 0 0 S /P/d0 00R / 00 0  S *0/  R* /,P/d0 00R / 00 0 S *0/ R* /P/h0 00R / 00 0S00/ \: /<P/h0 00R / 00 0S00/ \: /P/T0 00R / 00 R /! /DP/h0 00R / 00 0S00/ \: /P/d0 00R / 00 0  S *0/  R* /`P/d0 00R / 00 0 S *0/ R* /P/h0 00R / 00 0S00/ \: /pP/T0 00R / 00 R /! /- P M /o<0"00^ R Ѝ R ЍgxP/L\ /  JQ\/(P/L\ /  JQ\/P/P\ / Q/S/Q\/hP/P\ / Q/S/Q\/p@-M0 P000 00S Ѝp$0@S `0-S 0S0xS hP T <P ЍpwPRPk Ao/A-PP@'@Pp t0,p0P4080<0'P`p @ @PR@W@-0@ L @-(@@3 zក⛀@-@@O-4@T `,@@D¤@`T PpQㅑ |PZ P PZ  0 0 Gpj (m j z @-R 0P< P 4Q ,  D D0D @0 0 000 0 l j i ctl Lj i p@-@M4 00R<SP,0 S R( 1`V9 P` 0 01P 40, 0C40P0 `ЍpS 0 0D Ѝp ~ЍpR t t0t 0D \ \0\ X0D H H0H a0D k i h a k i th j i Ph qj ti ,h A-@`,pPP W 0 !Y{,P0`<,P0`G-@P MpP % 0`0Ѝ!0 /`P (0S0 젟0 $P (0S$`V00  0P 0S  `P  P X `0 vP ( (0( $0\ )@e  ph lg f I 0  @-0 |h f e  0  @-0 Dh g e 0p@-S `  Q P@30@-p 0  0 g De e {p@-0S h`@`P}Pp7P p@ 0  0 (g (f |d 40@-S , 0C!40R @J@ @0@ <0B/, ,0, (0B/f e d f 8e c p@-@PP0S ,  Q <0 0 p@` O-`p@40Sa HP@ P 2P0UP 1001000`SZ 0<0S 0  R 圑 # 00R&P P [H P P P 0  03/P PP 0 S NO 00CS 0 0PS Px@` `0` \0J/L L0L H0R/ha d P  _ |_ c b $a c b a D@-@Tx0,S<SSrPG-J `P0pUIU@* 404 SS= G000,0 100,0$ 100,0, P  ?o 0 2\0S PP*    0SuPPPPD D0D }0.e, ,0, (0.\$ a a _ a a ^ G-PP& 0 0R!p4z`P 4 R @, 儡ᄑ! ,04 儑@ 0T:80#b`0P 0  Q@-P80080/Dp@-@PF80080p@?p@-@P 80 0R@ pP14@.pp@-@P \0 0R@ pP`00S@#:p5@|A-@` T |0p0W>PP X000L000A0@S 0< p pA-`P 0 0R4 p40S @40S,0 PP@ pp\A-@P 0`0VpP0S P @T @ @0@ <0R/^@@] \ Z A-PP /o0`0"Q@@T 00R pu @P @T j@ 0  0R/#\ [ Y O-@PM 3` 0R PЍ4 00R80p > PP @`P /ЍSP yuP3 i 004Q\ a4[_ P,10Q1 0{P0ZUPE Pm 0P !c 0 ,0傁1`4 <0 04 <0h z,XG<XIXKPUF ء0 H L  "uP"  D 0,S<SSL/PP ,0P`<04 0<0v100 PuU.  ,P<PP_! Zc,04 `<0 0P4 <0P 0 |0^/@l l0l h0^/7!T T0T U0c/-$x$DY W lV X 0V HV X pX V G-@S ` VP p P  000 Gr 0 0i/W W $U -0P M ?o@2 ^0S Ѝ00 S ЍL@-PP M @1 0R Ѝ`@ 80  Ѝ AP 40 Sp@ R(*,P  C!b400C40<00<0/-h h0h d0s/T T0T P0s/@ @0@ <0s/zHV `U S F$V V xS HV U TS G P/?o0 2 R0S/00 S/h0P -?o82 ^0S 0 SF/P/0 000R/P/0 000R/ P -/o<0"000^ R  R/hp@-P[@P 0P 0 03/P AP @]p@VpA-`P @P%pP $P pI0P  pAVs*N p@-P@PP x PPP up|0@n|@p@-@P 0@,hN @-@0P RPP 0R R@-P0S /AEo/808 80 $0$ $0 w@T T T S T S O- 0S7 @` P. X0tqPpqP 0 kP  eP X0UUUB!#1<00@.B,? SP@HPOX% XP0@#r 1 ? > p> ? |8 L> A-@`,p PP W 0 !%o,P0` ,P0`p@-00P4Q8 @Q 4 <0,04Q<0pPp 0 &0P ,> = = @-` MV& @Pp yP00 Ѝx 0 P (0S @P 0 @@P  Ѝ$ $0$ 0` ,3 = 8= @< B 0  Z@-0 l= ; < 40S 0C40/ 0  @-0 = < ; 0p@-S `  Q P@s0@p 0  0 x< : 0; Zp@-@P t0`0VP0S R <0 0 p@$ $0$ ]0 ; H: : A-@`PM40SO P@Ѝ P d10XpP @10041000@SB <0 0 00S 0/0 03/@P P? 00CS 0 @ 0@S BP`hЍA #L@8 808 0,0 0|/ X/ : 3 8 G-S &X@ PU 0` 0R 00p "P U v G 0  0F/89 8 7 NMA-PP 0 0R4@pP 40S @,0a8, 40a@T:8 408 pl@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP4@p`p@-@P \0 0R@ pP`00S@#:p@A-@`T |0p0WPP X000L0000@S 0< p pj?Lp@-@P_80080p@Xp@-@PS8@@@Npp@-@P 0 0RP`@40S ,0AT 7p@p@ 0  0O/5 X. (4 RA-@P 0P 0R@ p`8040S !,0X Q<0, 0Q<0\@@g@D D0D @0S/0 000 0S/4 |4 03 t4 D4 3 p@-@P H0 0R@ pP`9@pA-PP0 0R@p4\ 80,0!aV! \ ,0\ <0L04<0AAD D0D @0W/N0 000 ,0W/E`3 2 1 2 + 1 0P -?o82 ^0S 0 S'/,p@-Pi@P >P 0 03/P OP @kp@dpp@-`P pP@P $0S p@A& p@-P@PP n gPP pr0@r@p@-@P 0@C & 011/A-\@`pP \"1S 0 €  P 1 0P !`p P 1@0@ @B0 ,0, ,A0 1 ,2 1 p1 2 1 @-\@ ^ \)QRS  T00 QL R S "  T € 00 0 Z0 G1 0 x0 0@-@R00QP,M! P! 0       H0T?o20S00,Ѝ00 0 x0 0QQQ S/  0    P / <ϿϿϿ 0  Q/ 2/ / /   0  \ /p@-@PP`(M/ 0S, R00m$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0N P0V00(Ѝp@ R 0S V00. 0Q000 00/@-@up00T000f@-@$T @-@T000 000S/@-\b@t000 000S/@-Lbt000 000S/@- 5IP?e0 3??oH0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@o P//-ptx` PP5B PP?e0 3??o'0⃑ iP5I 0 038P?e0 3??oP 0CH@5IP?e0 3??oH0 SP@ 0S05Y 0<P\4@@PP/8@-@Pj80 0 @ 0 048# /UUUU3333  <: S0@- d S V Sb00Z r - w-!= S @^ >S-00 @Sx00: r-w- 0 SPD !S-00 Sx00r-w-0T! P8 P2 P8 Px 0    0Ss00 P! Ss00 @ Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-bapP`8 cP3  bpP$ 0A0b`@@T JfP0=S AP`0AT CU !mcbAn 0 C-dd"d2dM 0 P%L\Xm P`` 㔐嘐圐堐夐 P_p@Z xp  ^p@e 7,P  $(0p@] `0<S0<0x0@S<00<0@DH!(<](_(0F()c<1<0 00L0007c(X %m0S ep@ ^ ^ M@ЍOoBЍ@um00 ^ ^ ^L L L   p O-p`M@ hP-TPm +T@`0 0Tj W p p?  0K^0 D^ P p  ! @00Ds \a0DSW0DA0DS70DURY :Q P   S  R l "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@Pl0T0Ppp@-BR"^p@<@Pl0T0PpO-p`M@ gP-TPm +T@`0 0Tj W p p?  0~]0 w] P p  ! @00Ds \a0DSW0DA0DS70DURY :Q P   S  R 2l "000R00S 0pS 0F0 0 Ѝ0S R0 Ѝ0@0`00XS00 C R @0 p` 0 A BRW p pꙙp@-BR"^< p@000O@Pk0T0Pp|p@-BR"^p@<@Pk0T0PpO-MHP@Q@0@U P0 `8 P0"0 @`$Ѝ 4Rj"00jP`!0 $ЍX0 00T0 0P000uP00S<6#0P P` U03[0<0P 0$ЍP`!0 $Ѝ?/%1R5%%;R:*%6R1!%?RP`PP` `0 \`PP4 `0 P`yp     @- M|d"{@{ @0S D <0 0 |0 30Ѝ :d -M{(,{ Ѝ 0 0 9/ fmNA00/eG-ApB`@Q" PQ J2UQP 0 0V B  P1YPPO-H,M@|@0p8@0 S00L8`p0S 0( $($$ ]P@0+0C< W Pp  q 00 AB0 0 S 00PU-0 0XF0-SPUL_]P0-S 0!000 ,Ѝ ,Ѝ60p p -U0 ̦` :U`< + B R 0nXP00 WU E :Ro 0S000X6X0L60`u0v`  $60  ,Ѝ60Pu `0 0PEPCP0 S000500S 0:S 55 ?0P;R0S00BX0?X5 00<500S 0:S ,50W 50 0+ C :R :S?k:i  0S`0  :R 0X0! $ 00Ox40l4 0$  RH$  = W0P0{ C000Z p p@P`@p`W  `Psd P 2R z PP  0pQW`0S p @Az `T 0RZ0S" 2 00S 0:S  Xy0 S2 00+ Cea0JS0S:  00 S P0S`,Ѝ p @ d1 00S 0:S  <B 1?0 1 00S 0:S  -Z 0 10S$000<1 00S 0:S L 00C 00S0 0 00+ C0 0 0 00S 0:S  t00P0+ C10|$,ddd=  Hd, Hc cb; bdbLbl 8: `9 ``9 P  \<6 T O-2ؒ0 \p`" P@T60堢 R01-[@tP-T@PA T"TRPP VP -@}V0P  :R7 20 0S! 000PP@:T0S! 000100SI 0:SF B 0?@0Sd1 0@ 0HP 810P01000 0:S"  W  00:R@ 0S  0?@?@0000|0| 0 @ @(lX[[k[4 DkZZZ 3 (ZPj ZD3 YY2  ii P0S 0K _P U  0VP(00(EP  $Pt Po$Uf ,Pf(, EP $U , Y "2 0 d4 30Fލ Ѝ` 0P0@ ^P^P8 / yP @@U  <V; VE !0  f1 L0 C"Pll80$0SH / x4!P  0  71 1 ! 0 +10  0 1 Arkd ||b x x x X L  l l < @ @-M `@$$10pP 000`T T' `/0@0 0 0 0 30+Ѝ0U000 @@P@00vP 0?s000U0P`0P`@P, 댣8 O--Ɵ GMMlčĝ* ĝ: ş$ P`9P@ @D`H`L`@0<pJ@> 5匵(000 0(ph t@P! N PPsOV`00S/ R`0=S0`S0`V`X`V `ሀ]P?`0#S PU @$4 0 l4 30GލЍ(00C(0\:`@h 0 PyP `@ Ph 0 PoyP 3  X X0S(00C(0{  0`P,0L#`p(0 [  P[0U0 P0@008`_0 Pھ0 0hPC 0`V0`i0SW SU y[  R r[  K k[  D ^Pa, R'AF0@  s_0 > ,1 0,P(0,0 S  -P (0S 0?=  0   ,pxP= P9 PL,_0S $0p2d( 8   l < < t C-L!H1 \M0@-0M,0 0(00@$0l0 00 07P ! 0" 00ЍZ 0 X O-`10TM0L000!008 0000 00 00J|KPPS @p` 0 p@P= 0+S+0S(( P,$ 0 ( P 0$,$,0S 0 0 L0 30TЍ0 rP "PZ 0 ؉d l L < O-!1 0IM010pUtpPPQ @`T 0 `@P; 0+S+0S(t P  0  P  l0SgU 0 0 1 30Iߍ P VP:Y 0 "؇ Ć0/`:0@- 0 0MPQ000@ ⷆ0  @" 0S0 0L @0 0 0 30Ѝ0!PP   @-@ 0FM M 0 `0d40pC &PPd@"H+ P 4Y0@(/Y @R@ 40 0 d4 30Fލ Ѝ(0@-P@lMt p0 00d00  q0 (0 0 d0 30lЍ0~؃ 44@-<@<M@ Q0 Ѝ7 0P1Spp//0@- 0 0$MPQ000 @e0  @" 0S0(0T H0 0 0 30 $Ѝ0)PP '( G- M砐 pP E$eeP;0F W08p;t0' T CNPP!  T0@To0cX0@W^X@  0 0 4 30!܍+LX0@@GXU@ 0P P_PQ0p x@|`4H 0- M Ѝ0@-P@lMt p0 00d00v <0 (0 0 d0 30lЍ0TO-/? 0M000d@@P 0\@? Pp la'' ` - `& `LPe! Pdl";h@Xl>4Ol!`m `"t fa\`&:p, `(9PPeQ| PTpxp2/͌7aQ&+ .* PP%`P썈5_l @$)p'paq,p`aq'p` 6oh, "   *a}:` @$@ @%hQ  P hQ%P 2/g @ @.h,]a>8 @gA!+*`&@ "$gA$,  ͌g!@pe! 7  +o&(```)) 6/`*`&* ``. &.`0*$M*l*8e, (e.ࠠ( ` (d,:+eQ ! & `_+P P&_%(`4  $&,` _&o%8 p'_+'_'(`` p p Po&o&`&na ,`  d`& ` dQ **PdQ%P*]@an!O n,mpeq! pfaσeA&n@σp'eA$ 0@菠Ϡ?/( @/"/"$@0,4)(@(p(( @,,@e1,,`Q&PʟP%0n_`A.`P@$=_`aA.m@$`c1_aA#@$O$'0 O$O$O$ fQ#@OP%a@_)0% @$+@_%+@'_%_%` PfA _@$0_0fanA (P=@$an!`O(_O%_%O$_% O$,_%m$Pc!_(n돠_(_%_% (fa((ꯌ c&(ꯌc1`&0(nꯌ0`.(`0`ꯠ*((***<=돌(a.*` 믠*($*( m*c1*,⏌a#* 鏌f#୊a.`돌f 0 !돠/(0/"?"00$(,0(/(4 ?j! fa "? #(`))<`?#?#0`?#ono80j1.j`0#-揌a1. 0#b! a1"0#όa?Ϡ#'o'p`4,++(@?#8?#?#0,0,,,Dp p୊`" ,jƟ`1j? nፈj1 naa $?`n1aa`?j?/#0@ `/"4@?#?#蝉O#/" @! "0%q0 ?p0%0?SP@@g 7Lr0gS@pG"# ` *h0S@@:`F ALp@- ! 1 0M0 00 P@R00 113R0 0~? S `` 0~? S U PE0"0 1<3R08 (0 0 0 30ЍpDm@ ( Ll0@- 0 0$MPQ000 @0  @" 0S0(0T H0 0 0 30 $Ѝ0)=PP bl0 kG-p QM稐  P 0E4eP<0G 0S08C;t0' T DPP!  T0@To0R0@R@  0 0 5 30"Qލ+R0@zRU@ 0P PJQj@p p@` k0j 0- M Ѝ0@-P@tMt p0 00l00 :0 (0 0 l0 30tЍ08ih {-0 00000{   #EgܺvT2O-tM0@ @P 0\@ 00 '` 0 ,40ʆh'0 !80ag+, 0 " (<0h+l[!h;P%PD@0eZg[a "g; D0 l l˃b;% +0# 0HcpmvmzNS.00@0i;h!@kd00@ +NDCDGDl˄@ dD@ `` @*mČƌ͌3kˌf+"d n , Th++KꭠᕳKgK0᫷K)e;#hˌg 0뺠cP1d{荠fa" a,fk`Hhekb( b,e[P@]a[h& h,aa4bf% f)b+ L@+IᕓI@嫗I d <*h+@h`i+@@de! p@d  p'e,pg|nlɠ\pfˌa "p a kfk`8iK+@@@nh *ꩠn@ @$@fi @lekb{,pe[b{'pg}0Pa{@lK&@alK$@DPdIbKf'f!b+ b-`l+g$lˁg. 8fd"fkd(hd`gb.P b,g[PdsXpa{``p[d[gzk{Tekj ,``!n(dˌn!h@  kˌ `g4m+K╳Kik૷Ki  ` k aLbhK%@b+hK$@X,MnKe! he,n0hhX0f+d@0 n;0a;$0a;#0cC3C7C`;0n;,0#dKl;%0# 0Lc:nne;$0#0<;+Al;AAld.`( he8PPh[PUjPj[ " b)g+,P(Pdˌb˅aP,b[Pn[#P% P]dK\UPg[pb[c+( "jn隠hfn+ih{$p' pHg}c{c;0 ,gH P+K╳K⫷Kfk`fl`kd.,P% P0dc<]ha[<0*ad hn;'0# 09dKg(,` nh $ T0 \$ g{ g+id+.g " (h d;h n+' " 빠dKg{(p'0ph$dKP:nPnP( fkꪉa` tЍG-`p 1?@10@Pd00U0T?WP@0P\@0W*U@(PU(pG  G/D  +D C0dW*0@-P@!1 0 M0 000" " " ? @ aR a# #0#4 B0 T  0E,̠S,ĠD 80 0 0 30` Ѝ0@JTMd xLQ) 00 R) xB@-d @4  R  *4 8/x x0 S\ R `0S Р@- d@ 4 *8/2, xxBM Ѝ/+S$# /0/--M  Ѝ Ѝ/0 n 0c  qp@^F ZF`(00QF0@@P#@EF AF`(008F0@ @P @@+F(FpЍpЍ'*`@B@- M`Ztqt1pP@P`@@T 0Q P Ѝ$ ZP @ Ѝ@ ZP"0S- -S?@0 0000 P 0U 0SP0+S@@D!0DSX UZP0S +S!@ ?@!@ꜗ E0 $  X ?P L0P00 1 R/@P/!R/4D(0 @>R0 00//C@-M Pp @:`P`W0D>S 0!31000 9Ѝ>SH 0!31000H00H00tC/-p@-MP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0`( ( hB< $4 X=Q-C #XA\#\ !  +A qR   R  +S -S =S000@Rh-+@"      000000 0@-A @0RuS#WSRX0CSH6 ,0!0R \PSPQP\     0 T 0+S -S0I@O-`VLM 0`8@ (P(0,00040g p  _ `G @ )BG@T2h7 `000000$  0pa0HSvctsrqp<nmlkjih/fedcb,bG00_G0@ZG`@LЍS!  "=X  R"   P:0$`DG @ $A0S 0 S3*-P"+  @ LЍp'}C~p=X   00$`'FP @F0S $0""@ `Ⴁvq$`F P $@F0S" B`01DsP{E00LЍXp+P-@ 0 +0B XR R  +0B 0+R XR  -R  X@PPQp> @-0@ M  @J/p`ЍP 0 @-GE/o`/000/000/000/0 00// /0/0/0  /0 // /A-@pe`Y4P+U4U PU  0  P@P PPr\P \000p@400E0P  EPꨆ T p@-0P@`T @T0rS Ppp@P0+Spp@hp@-@PrQ` 0  P<0P0 `@p0  P0@-hA M@0 @c0P0 <100S#:yp@( P 8: 00 00S3000 ЍF0 0 @/|D@:d0 00S d(ecjD00@ Ѝ(2tz |z tz xz l,@-0000S0` NTx 0` >T00V0S (04!R0x#R0h0$02``0d 0,000 `>0Ϡ #C0@ 0`V<Ѝ200$020$0~20,000PGU0$UE d@P1$?@PL@P|2@TPR0` 0 O>P0`V0 S 0Sn(0S0d :> `0 0$0 0,001#‚0! 0[`1R101R"?01> P0(00"P!40:,10`0d0(00P40/d0(00 rP40& %>00Z0P%Q5A0$0A``0@E0,0 `0@p  0 `M`M`K2@t ~ GzG (} } | { SQ$ `z O-0@PMQ:Uf ` V# V* V U 0T STЍU` V V V ^?@ T @P00P`岀pX```` `& `X `p0 Up`0岀X 0 SU:0S#pP0Q P 0관` X?[*!]-E@-0 M0M040K0s0S0 0@ $03/P H0 0 4 30 ۍЍP&%G-`P``a V00 "5E@P5 pPI 0SH 0p R0CÐP0P1 U  |\   1`V*o`CqspP Y  !@A 0   1  O--``ş MMMčDş尠 UEp` 0@T/*0U@@ R R0 0C?o2 000TU$00 S0E0 %0S}0000Sl`0+(08(0 @(0 2/Z(0 0@ 40000:0F,0 03/P   0S00*  0.S 0 S R V: R R   (0P8 (0* R $ (0TP(0 , CQ/ 31 C10 0 0 P000$0 000S  0P80: S 0p" $2 MލЍ Rv 0 r R u P EZ(0w@T  r R c0 @ 04/P 0 000c$0 00 P05 k 0.Sh0SS 0.SbO Rh  0@ 0)  2/0S  00.S8 G (0Ps (0 C 0 &P% 0 0? 0Rt%C0$ `Y? / 0 '##*  G-llŸ KMMč\`pؔܤ1 //\P  @P\/\   W!1 0 4 30mKލЍR8/\3^*`PW0/\ \@ @PP 0   R  = V/R * R( R 0 0 00`  0P&K r R @ (03/P 0: SW/0 0Ɓ Ɓ T7>/0 P0P,O-@ğM $M; ~R0`PM 0 pR  ᘤ嘴*R1 r 0 @ R ?R! [R!^ 0S0 R@000WS 0GZ 0< S L@V 0, @Ⲡ \< 0 0\S 0Ჰ@ 0  p G0 R/R00B0 4[S 0G*0; P4S 0 0CPJR*0S0;R{ W @G 0Gz +@PV t"; 0 2 ۍ$Ѝ@P 0Dj Sq 0]S2!^020 ]R0  r -R0]S` s0010 ]R0 @, ! ;   LXn \Rk0LXh 0\Se0@* 0Q 0A  001A0 #)Q Y;P\@0  p10Pd50G*0 ;@PU 00 [0!^0 0@0SJT@a=?** [!-]l O-MMQ@`P8x9  @ Z60S @}\ \ [\ {\^! N\]\@ \  ~ލЍ @ ]RRR @ Q+[S0 S]S*S [0 {S &,S^Z ' B0S00 &0[ 00ލЍ0]SS 0]SS }S^NZ  J B   5  A- 0` PpM 0 S +{\ @ \ {\@0 pGP  Ѝ Ѝ0}S0S ЍA< 0 @-M Mp      `KP ^    ލ Ѝ`\ [ \T@T@I\@L @Tލ Ѝ\@p@-`Pp@0T1@D 0CP@DP t000p0S. *S9 ?0Cs R#S 1  \0S /Q0 S 00 /@-0SD @#S@7 S S$ S" 00S "S0. ^ \S 0000S\  00"S 00 CR S 000   0@-QM M 0P 0 0@050 0n%p @EO0 0P0 p \0 0 5 30 Qލ Ѝ0D04 P 0"a $a c dc G-pepM` p #S$*~;0 峩P@$ 0S %P @ 0Sb;0SЍt `p+0@S 00 40   0Sy ltlpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000 .3P 000#3R0 \# 000H 3P 000#3R0 # 000 3P( 000#3R05 " 000 0#S RP@0 S00)P0@@0Ѝ0 S SD 2P 000#3R0 " 0@00o 2P  2P0 000#3R0' ! 0 00R\Ѝ 000#3R0 P! 000<< 0@S 0 4@  }2P =Qb)0P0 k2P=Q 0 @0 0 U E)0P0p _ ,_ @] ] h\ \ \ \\ [ x[ @H[ P[ 0A-0 `R % ӛPpPpr@P 7P $P 0S 0P@ p0'@0000@'@ g0 UT@=' R P@ᐺ$Y800 '0;'P8Z0ST 0 D800  7V   Pᐺ0S @-800'0 'P&8P0@W0 0X H30 0@0@ л' 3 0 00  " @'@2 0 00  " @'@0'0aͻp84M 0000Pil 0S 700'0˻'@7@ .Pw {i 儻@' `(y7000`00T 0SCP @@ Hhx0@' 0@0@<  Z@' 600PP800P40@,@A0 7Y0 P @ᐺ0K P@ᐺF0S0  0' `00C0  $'  P㐺@( P㐺@# P㐺@@{W S W XR @l tQ P PP 0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpFpP }P ЍpDмA-@@0`S&@@Q)pPpPS @YP  λp @BAQA3M0@0 ỻp 峻p 꼼p@-p`pP`P~@T T0T0 R@@rp\P00gA-P@P`@pY0S |@@|2 R"@`KS/@0P0060@8\$@- 00 lC-`\MPA*@P- 0S|00V $"$ @ UpЍ 0P  $ R%pȁYT^  0N|㠁0RN|xxH0R1 0QG Br&Q&R-.4 p0ሀ Wtq{\ SzڙHvL Pp L o L o K K |K do |n j HJ HM O--044% AM M $ %u *%p  000 0000+0 ᶖP0 40 4 P P @\ P 0S p400#S \ P 0S 848d0``\ P 0S 4d0``\ P 0S 30   \ 0P 0S Xj30\ 0P 0S Kjd30\3PE0 +l-D3Dc0P`0P\ l@P 0S 1P0[[ :2P200xS0xS0Sc 0P" $2 Aލ ЍdR @P\ 4Pk 0S 8200#SB \ %P 0S 2R0P\ PV 0S 100xS0xS0S 10 0sS(0wS%0S"x! t1tQ0P \ 0P 0S i@10\ 0P 0S i!0 ! 00P00 $੕0 000 00 1P J HJ dI t(I 8ȵT dG @F ܳȧ TF h0E pE xE ̲X p@-hPP0S P@L@@p@`@` 4)P@Ա@D E A-P@P0 $S ppp<1P Q0Pp<`<`PpdDC ,E D A-P@P0 $S ĕppp1P $0Pp<`<`Pp༬갰B xD 0p@-dPP 4P pD`D`P@ ppXB C @-@@PH00耯O-ş,MS 0 w ph5@0`\5000000000T 0PA  0|0?S SQ *S T 00  *Q .Y Q /Q0S u"pP [S7 \S0 Sp 0T ≐  R?\{ \ *\ p[\ \\0 SpQ 0 0sY,ЍYj /Y T lP^\!\00 $0 00P /S \S U T0  0SC -R X0 T ᱰ0]SZ$0PS * pe fT ⊠Ằ Q]Q \Q A X XY /Y( .Y)0S& 0W 0S 0W/S,Ѝ/Y00  0S9 0W 0S3 0W/S00Sp0ST q UT  ᲠQ p*P [Yp Q ;0C 0T 00Y 0 P+/Y[ & 0# /W!P|@0P@-@ P 72 0 Q 4Qoa4< < p@-@`P7/P L1/PT00pT00p2 0 p; ; O--0 Ÿ M ᨶpb @T ` !1 0 2 30]ߍ7PW 0  ᇶpL  +`P: 0S;p 0 0P`P* @@0  rp@ 0  WP0PpW*P< T ?0 "C 0 Qp@001`-0P0000`0 `0pO--0 Ÿ M pb @T ` !1 0 2 30]ߍPW 0  pL  `P: 0S;p 0 0P`P* @@0  p@ 0  ȵP0PpW*P<  ?0 "C 0 µp@000`-0P0000`|0 `0@O--0 Ÿ M ኵpb @T `y w!1 0 2 30]ߍPW 0  ipL  `P: 0S;p 0 0Pp`P* @@0  Tp@ 0  9P0PpW*P< < ?0 "C 0 3p@00q0`-0P0000`0 `0tp@-T@0`P@ P0P0S SP p4 p@-T@0`P@ 0P0S SP p4 p@-T@0`P@ 60P0S S{P p 4 0 00 (-H- M0S000 0 00  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/_d-H- M0S000 0 00  00\100M 0 R0    R  8 00 0 0 30KH Ѝ/$x -- M0 0'--M  0--M  FA-`ppQpP @Q PD@0 0000@Aed0P R   0//L{O-- ǟ 7 @T@!|P;P -00pUP0 B@T@!8@,@0@/SP ܂ b 0{-DM  {000Ѱp 800S DЍp@-`Pp@ P ㇱ뫰p V U ph p` ް۰V @հ@ & a Q?o?o 0C-@c^?c%^& ^ `pCc&Pc268270EG2&1H01. "0;:(0C0 /0 @- / ,00-+C@ P@ 7KE0 0/0E0E0C 400-+C@{$PG{6KE0{7 Q/ 0E0E0C? P!Q/o/o G-@b^?b'^( ^ @pBb&`b4')4(0VX4G1Y 1. "1;:( B0 /0 @- /k{  0 +C 0/A0C0C [k{ 0{+C{7 Q/A0C0C J@ @-p A J@ @-p Jm@ @-jp Jb@ @-_pPP `@- +00?0/R//R/?0S/R/P/R/p@-PMP`V V@T 00#Ѝp{ : { p@`($   00 R ]\,@-*00 0S@wܷ  /"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`&&@ l;P PXY  P @-881 0M020 1@ 0p\`P8 00@\ 00#30#^0#02S000RP0@  p0 0 2 30ߍ)PP @@ @0(@$00l|O-鰏DMP`00 0P0? 000 00S 4 T/ @p%S{ @0@ R0`S 00S S 00(4/!/#b!!"AK/ "bQ3:bQ#3P . ! P0 00 0 0 #>1?3c112AK? .## .cR 3:.cR # 3 00 0010!00C0 0 0@ 0R PR0<R0@@mWjp%0KUSd,ba`_^]\[ZYXWVUTSRQPONMLKJIHqTy-;(>=<:87 -,+*)(Q4ih".{s(b 00 000; 0`0P `DЍ0@@0@000@0(p,P8 h0$ @PCp$ 9P @ T$0S* $ 0(p0,P$00@PCp~$ 9P @T$0S $ 0 `0 00 0V$奵z[0@$ 000 GR +Rk -R 0400``PW:S 2a2c2SOR0c$000` 0(050 4`0tU0[04000000 @Wd0`nW`pW\ 0, 0 09 0I`0 844 40W0C`00B 00 0c0 4`0@0@0W%S0NW-|=0 `0r WD;0  0 p0p S00W0 0` 0 0 0U0 ^`0 0 0 0000 M`0 00 07c0 4@0`S0G 0X4 ?2c111400 00 0000 404c0#0`S400111v>C 0C40 &!/"b!!!A0400 0@@0@000000C S0`0`0W0= 0@C# @8P 9#@  8P` 0 0` Rv40W010 oWm 0 0` S0pYWW_ 0`0N00J50 4`0  044 400C`00> 00 0440 4440v>C 0C`00+ 00 0x40 40\$/A!b!b0C`00* W 0  0 0  RM 0s 0 0@0 0 0vP@ @ P)` @aJaj B  B0 UR ZRU R   @K 04# @ ( 0$04`L(p,P@ `W0` (p,P@ `W0` "!/#b!!"A0K/ XX"TbQ:L2bS0#03 p"10 !A 0  40DSd040ռ0 MR[ 0@^  @Q 0 "#^  z K/o "0P8 0`0000C/< 800A Q`A`0PQ0N#όF0 0  D[ 0 80< 0A Q 8{P 00`0 0@z[3 0@P 0 TR RO ` @D0 CR :D`P)\(\ ףL  Q n  l'$Ip X QA ALA|r` \V6JQu8 @ 00 (0b$0 00\00C4PN00P01?2c 1A;S40`2ca12B @0@000@V@ A\N A R$ M a@000"b"b"$ (0(p,P$`(p,P$`40 @' R$ @  R 00@ `p40 `$ 0P$ @0004 0C$0(`0 0`$0P$  @000 4 0C$00!0(0~ ` 0 P 40@! 020( 000c$0i 0 0 0 @P<@ X0^00pAtA劲0OƲ00 TAXA\A6 q$@P0,  (@ @@P eP t `0 0 5 30ݍЍ@#0@0#0@00ԯخ0   P--M  Ѝ Ѝ/ -- M0 0| ЍЍ/O-,R @p` M R00?yy00P @ P 00 P! !  :1XP<   VP WE V[X0 SPpp` `2(!(1 00I Ѝ`፵pP2 PPSPpp`00ŷ0XP C0PP00 ! Ѝ `f` apP V ZpP `ԭ\@-@ M(0S2 \0 `0( `1/qpPp0  0 0 PUR <0PU ЍPPTp 0S  0CPP"0p0@-P M(0S< 0 #p0( p1/qp@`03  0 0 @ToR <0@To1`VP ЍP@T` 0S  0C@oh"T 0 w_" 0 n0 R/p@- @Tp0 Rp0 0R0  P 0S P0 c (ݶ 0P0 ض0 SӶ,P ϶4P ˶8P Ƕp@ĶeEp@-@$PPȰQp@PFv@- @@ẰQ@贰Fvp@-,PP᭰ R@ᦰpElvA-M 1!00P00S   0 XR  0S= `@@p@ X8 CR78!0A0 S0Q\-*L\)\ ' 0 r SX   "Q \ #R.Sa A  00C "\ #R Ѝ`0@|4  R  *4 8/xt 0X\S 040:8 R РS /NxB@-@`PPLpL0ppD尀 T   $ - MP@ 3! 0Dp@-H @| PPPp P pq`PP4xo FqeT00p00 u00p70000   70Fs0 00Fs0 20p# \QP%Ao&Ao=Ao#4`p 0 0   & 0W0Cs0;V 60000l 0!00C0``p0?Q00p Ve =V_ Va 0`0p00 G 00Fs00W0Cs0 0p V VK 50000 . , 00F70Fs00p,̰D P501 0@S;V cQ00e`sdQ 1\ 01 0SS10 0S0U4000p00FQ00100C0p00FS*0100C0p-Q ^Q00p 0AnS~|{zyxwvutsrqponmlkjihgfedtba`_^]\[ZYXba`_^]\[ONMLKJIHGFEDCWA@?>=<;c9876543210/.-,O*('E?$#"m `WQKD>#V 00 @@000p2000N 0`0p00`F`0p00p00p00p00p\00p00p00p 00p 00p 00p 00p 00p 00pcQPdQ00ppdQ 00pp0<00p 00p00pp00p @00p00p 00p舤 l O-`pMWP 2 @ P@ 0  DR6 \L 00pW @U 00 0 Ѝ 0S S Q  0E  0 S0\ 0 0L0 0 0  00  Yd A-q@pP`Ui !4"#12b! DqW7 0S$ RP QP0S! 1003/P P $@00W L!P0 $@ E0V0 P100S) 3/000PP0S 000S) 3/000(㞰p000p3/P WPVSP 000SL嗱P0P000(i/>3h8 7hD7 7=A-q@p P`Uh !4#3b!b DqW7 0S$ RP QP0S! 10 03/P P $@00W L!P0 $@ ຯ0V0 P100S) 3/000PP0S 000S) 3/000(p00 0p3/P WPVSP 000S P0P 000ff5` X5e54A-PP} @_`Py qpPg  00Rc<!"#b!0CaqV- pW {PWV $00dqp0ST100S004 w,1003/P0 0$0 00``0S 000S+ 3/000(ㆯP`0003/P 003/0000S PP0000d/>3$dd343c22=A-PP| @`Px qp Pf  00Rc<!#b!b0CaqV- pW PWV $00dqp0ST100S004 ,1003/P0 0$0 00``0S 000S+ 3/000(P`0003/P 003/000$0S P 0$000ba,10la0d0SR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP T P00 D0D 0 p`P//0`____.SR; G-P0`00Sp 3/00 Y @IP T 00 00  Y @IP T P00 D0D 0 p` P$/._^^^|^-A-@P QP P@`p\Pᔯ0`P ᠠPpW 0"S b@00@`O-PM M Q0` 0 Q /Q P.00F sPPەۅPp/Q/ Qp @0/SS.Q6 0E00 0C S"/0  D060 I  0箠p  0: S+  S/ A/o" R_/Q PT?0V0/0000 ލ Ѝ DR .QRV  u/R0W03ʨ !0Pu5 00 Q)0 (/QPpPVP/0000ލ Ѝ j`P `c00>0000?0000 A-Da@P`: 00QP0<P= 0p0W& 10pp:W@^ 0 \S 0@ S @ 0:Sp@:W W0 0T0P M <00 0 0xpZYpY0P/:P-0 S\ S:RS0@S0 S S@\ :R \:\0P:P 000/'0@-A@\  \:^|^00^0S R B|S0 0:SS O--ǟMM t<č!^pĝ  ^ TG@`V 0P0(  q@P 00S < [ & 0 00 [ P@ 0՝Pv00 ` R0Pp`0 S Wp :S \Sp S Spp p0Ui*R0+  ᧝ P 0`0 SWZpP 0#SS  ]P 500S0 005@0:,0:= pP 0:R@h @R0t400 0p4WP/ pP* p):00d00Z  0S m00i:SZ P0U:H /P PE @P4 0:R` ` R,0 F C 00SpG:S:0D 0 I0HZ 0 E0= 904 P@Cۭ00DpTpPETgH PEpG@DP Pp@@0S $ E0AU0: 0@#2 0 <4 30ݍЍ0 0 0ἬP@P G@P} ᑩ|2P00PS0-0`S}`0SRM 0@q@00 ᵜ  屜 :P]  4p,@00  `6/p P0003/004`X80,`0C0000l p @P  03/P$0p0H?o20 0@mr 0 @k@c03/e 0  0Z 0S 40SQ 00 D AꘈhW % !@-@M0 Ѝ@-4@@ P 0 000OO O-ß3 M0 MȍC\@ 0夓S p` S P@T 0S l @P 00 C R 830000#30:Q0#Q0S(  0R\Sz 2@0T  P P i0 0P0 పP  20   >0S00S\S00 R{AP8 0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S@0@ A@L0S't!D1 0 8 30H ލ Ѝ  (@P 00 C 10 Y P @P @@PP P @ 00   0,P 50 0Pm @j\\O  {{ { kG[F { // =A z z kk'k [FKE{{ //=A  {{ { kG[F { //=A A{ kk'k [FKE{{ // =A@-Q@0M 0    ",  0$0(0T iP0 0# 00Ѝ \0Ѝ0-$M  00 0P$Ѝ0-$M  00 0P$Ѝ0 -M 00 0 ԖЍ  0/@-@P uM`p8  0xA|A嗡8OӡPP8PTAXA\A``0 , @4 (0 0 1 30uߍUkX4k0   jO--ϟ MÍ$000`QY 0\/\ ,  0(0 0 0  pP0(%Ypp- 0S0 R .> 0 3 30 ߍ iP0  P 0 0C 0 S 0 B `0 zR0ePLKJi\~}|{yxgvutsr0p,+*geI`\[Yu``YBR000`0C0 PB 0S 00 0@@00S0  @DT>< P0  P 00CS0000@ 0D S*hv0L0 S00D0 0`I @ 0L` H4  BPR '+[ 0vpC0Z M:PWp! 0jPP P`p + @MR^V\TZYBNMNMLKJIH654321A@?>=<;:9876543213/.-,+*)(!  XM P 00CS0!000pWP0 NS XR    0 | $ 0$        00 0P0 0C0000 S000@XT @0 - P0@ S0 B0 0 R P00S000000S0N >. #RR 0@00T0C0 0 >. #RR 0000C T0 S sP Y 0 00+ E  P BR  X *@PNU 0U0P0CS00X 00R*@P XR P@P9R*P  P0@@40 J P<D0U0S00CE SP00[ *@@ @P0ESH 40SH  P  0@0CSPH00 4000T0y: `8 <@DV*T /T0`0 @Vj 0$0P0  P k$00 p400S P0Su 0$P0 00000S @0P0CS00T 00*@P+ E P BR  X =* @P  P @0P0CS0 0IU0P0CS00X 00*@PW(  R H  R~WW  BRp P n 0@@N 刀WiU nU0P0CS0z0X 00*@P RP. ARJp P BR @ p; 2P:W8*@0P(U P BR  @p$ PW*@0P NRp P BR  @p 00@<00 0E@ @@HꈀX     SL00@900 0( 00  $  0$  㰀   +  00j= i \ 2-T @ 0 " P 0 0C 0 S P `00@00   >00@<000 0P0^U@@00P080800,H0;U 0$40A4 >>0@<@pD#C8`0-S ]Sn Sb P4 >>08`#C * 00000@ 000 0@ 0   +   +    )     00@90 0 0q *  + 000@ 0b0 0@0\ @40S@@@XL  M PL @PS40bS9  P 0@0CSPH00 00 0P0CS00R-*P00 P P0 P1 0P0CS00[ *P 4X Q P 40@04X E P  P00CS00R*PdSo?L00v0D0@` PT* 0 P@@0P0CS00T *P009 mPT*0PXp`pT$0TPP$0`5000 00S0P0S(@T 0@0 0$@P >. #RR  PR  B   P 00@ P0>>03SS 0PU0C0000P000- 0S P PYT Q 0$@0 0000C P0LP00@0 4 P4 R*0P PX*0 @PK o  P R*0P00Yi_SP00[ * @P$@`PPP0 :P 0C0P0P `V  0S P 0$@0 0P0 P0PC PT*0@PS$0lxPp$00400pTPX` P 0  B0>>@I  vL0 庡p P p0S fP0SYx4Y 0S0 00 0 ᠡp 囡>>3PS 0S0P0C040p0400S 6PkXi*0P0@0 0 ? ᢡP; 0 @0>>` BF vo 0 Sp0# P p R`80<@pD00@ 00=<@pD`P 40P40 S@ 0@00! PyXw*0@PX PoXm*@0P$00 P g$00 PX*0P@o P[*0P 800C0800]S0  ,0 uP  0PP80p0H`80v`Yp w PP0 0 P400P tPT*0P003 gPXZ: `8 >@p G  0 vspD P)YPE* 0pS,U PU RP0 T P@D P UbH0@P0C 0P Wp YPE`0pS P W P  0@-@P M 00 .0@ Ѝ00@-@ M@P 0P0@ Ѝ0DG2pA-0P7 !@00S5 0`1S010g C000PuP! pW@0PA l`PS 0 [00 @ C PC0000  Q  Q*RQ) <00@8 BP0P00`0s0 㾛P + B ?#A 0#@ # B0 `\PGp@-@PI zx0@Jp@- $ M0@4/@PЍ @Ѝ@-X0 T0M0$@ 4/@PЍ @Ѝ@D@-0M$̓0 $@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, $@4/@P Ѝ@ ЍlC@-0M$̓0 (@ 4/@P Ѝ@ Ѝ@-@0\ \  M $, (@4/@P Ѝ@ ЍB@-0M$̓0 4@ 4/@P Ѝ}@ Ѝ@-@0\ \  M $, 4@4/@P Ѝ`@ ЍAO-M@DX@P`p# 0SP 0$,  ;/0$ 0H@ 4/@PЍ/@Ѝ$ @-$$@M Ѝx@@- $ M08@4/@PЍ@Ѝ@-X0 T0M0$8@ 4/@PЍ@Ѝ?@-@`pPtt0l尀 ᮚT  ᒬ@0 $ ⛚Hh? h 0~O-,M`PP pE0P@0 p00EPs00D5ʿ000 0   @0 0! B b190Bp   U\ @ 04B@3A0S0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #       0 Dr R R Q  R \00t0!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0帛$ P 0` S^?0@00 0  ᷛP 0J ZS 0  0J ZS 0-00d10000 ,Ѝ0\r  `0\s  `0\a  `0\ S00 0 0``0\b  `0\t  `0\n  `0\v  `0\f  `} @UP 0` [0\  @`p>A- Q@Pp`! _P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0 P0 Afx  A-@P`Pp$T0 pAQ_T !T '0DS%(0$"0@ !1 0ؙ O--TTǟ UML<ǟS 0Ppခ儡<  s@R0P(0 b`J0P,0 0S0080o 9P40 H  wT. (`000P@Tp` U T 1 # 0ٚ0P?0S0d PjP P5%0 c(0@FDA T @! Do`0P$0 0 :640S V D0$ 0C BP$0  ? *H500R  ` '$50$0R` 00` 00` 00 `"00@`\00000 tpT0 (`,$@T+ 0 7/P,0@0$ҙ,Й(Ι8̙$$3 0 L1 30Uߍ<0SP$/.p@-@QM`P0 0 `Ѝp@-R M@0  r0 (@ Ѝ@-@M 0 00 |Ѝ-M $mЍ-M $(_Ѝ@-@ M00000h0 @ ED 80P @0 0 30 Ѝ軮(-أ ,@-@ M(0  0 0   @D <0P @0 0 30 Ѝ茮H \,,0@-@QMP0 0 Ѝ0x @-R M@0  0  @ Ѝ 0p@-@Q0P`0M 0  `Ѝp谡 -M00  Ѝd -M( Ѝ0 -M $$Ѝ 0-$M  0_$ЍP@  tnfsl uniop@-`T@~p@  P@P p0P~Pp`@-M @p 0: S  l~p  ]Ѝt 0 ЍЍO--3$M0@`P0 ;$#;S0 000U00S|00{ e00@Pp U *  P0@G P p@ 0T0 #p P PE U@*0S: 0S00 "  Y* 0 P  P 1T0PJUPP6TP@0 @Dp@@0 `$ @)$Ѝ0 ᆎ00 000S0@0+P @ 0! 0 0 s0 1@T 0 0S(Z@ T  0P SE0@ }t}p`u0 P p@-P & @T @ T0 0p O-P M Qp 0 `eV 11* @ 7/P  T VK:00S0 0 ЍO-RDM4xQ@ 400008P哋 P$ r 000T0(0t@D4` 0  $P0( 00  :/PppV@*000k000 R`c,@ `0P@P U` :/PP 0BY` ES*0p P@0PU* E03/P P 4 0pE$ 0pZp 0  S ^ 0* 4@ 0 ,@0( $@ 40, S ,M@DЍ$4V  PH PW0P@ ZV 0p'Sw0( 0S 40,000,($ 00P<0 00 0( 000,S$  C000(0 0 0$ P0C, 0 00U00U0#Su `:/0P@p`p @S:/PX @Y0V0 S 0H  BT 0T@30@D 000@ U  00I 0SPp 0Z: 0 J3/P. @4 0PJ$ 0PP 0p'StW 0`0@  S`^0 * T 00T0003 0RP00 R0#03Q0Sq P0 S0  BP 0PC000 P 00C0C 00000 0(0 00R00 00$ YJ P @ꉐ 0TP;:/P@ P [00P50P1p1 * @:/Pp [:P0@V02S 0  BT0T@30@D   P0@R 0 0| P @IT @00 T00T0003 P 0RZ:/P 0TPP@pE ᩐᛉ) :/P P pU0@P00P` R  P0 0C0CN 0 BP0 C000D<0, 80 S( 1 $0, ,0$ ^P( 00 M$@8 ,@!0@0$0,040$0@p@- P@U 00S  RQ QpP{00 {P  pH0H 000S@-@(A0(@;8tp@- @MT TPT @TЍp0 Q 0QP ``0`P 0 RЍpA-M@PN`p0S$00;0` 0b  4{P- p0 P'2 0 Q 0 00CR0 0 U S R 0S$0Ѝ$0 0pP0P 000S@-@(嬄0(@᥄tA-`P@p 쀟0 00S (叄P   (僄0S PnP   0Sp(i0S0p0ht0p@- M0 P` 0PP<p@  Ѝp@0 S@` ЍpC-DDŸ <MpϠl?2c A1A11A@@4a\00AD?8P<`@ Rd@PW6!1 0 0 30\ЍT00ì?d@DR ?\00S5 U*-0,!0 QP  0S0 QPW 0@d 0@T0@dp 0@U*0SP  PR Lp0  0U*0 SP  PR wQ((X a a 0a O--ϟ M|ϟp 0S㰰 ` pሟ` [ 0@00S %SP 0@zSzxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPOMBKJ|HGFEDCBA@?>=<;:9V@DS3/.-+)(5h[$zxD B)Q [n (-= 0 |0 30zЍBϠl4 @0 P $08, ##,cR:,c2S <  @@ 00CL``C@ @r  ^^A!/3b112A0<  ̟# cPp<5: cP` ;0!3b112A0  K0 S 0! [ K 0P Qd; Q00dP  ᣅ [ 0 S  R  |;  B2:Q/0A!b0dP  Ⴥ [ 0 S  R   0  ``: Q00dP  _ [ 0[  R   0  `m 9 Q00dP  6 [~ 0 Sy  R sd)d9!/ b !Q Q00dP   [_ 0[Z  R T8 Q00dP   [G 0 SB  R < 0   ` 00 S00C  B8Q2@80/A!b0dP  Є [ 0 S  R   1 '(0 dP0  ᶄ [ 0 S  R  1 p'0 dP0  ᝄ [ 0 S  R  [ 00[006 Q0 0dP  y [ 0 S  R 0 01?2c 1 R11Aãd0Sâ/d0CS0c0(6dP 0K [ 0 S  R  08  8   `W80S0 R05s0dP0|5 0 [h 0 Sc  R ] 0 0  `.Q0dPS004 0 [D 0 S?  R 9 [7 00[^0  0  `$ 0S!8 /qp   qp 0P 0# S! -R? S30 [ K  S Q X1 "`aa!B! #<0 dP0   } 0[ 0 S  R   0  `4   0  `z`0  0SN0  P,~P u [ 0 S  R 8Pw0` 4m0 S  1h [e K 0P^ QX0S 1 [P K 0RI QCUP 1 00 dP!/ b !Q    [* 02dDQlP)\(\ ףmhR Q C XQ $C P *8P O $O N LN M V PS K R K ,J I ; `; G PP 0 (07,00S 3/DЍ Lq00,00(3/  PP 0S /A-M $P@0P 00 `pP {Ѝ00pO-lhyM(p`N4PP  G@Pp 2 z20 RG {z0!$@ !  00p0 4L  00 0. $(p,`; PR 80 03/0`0` P"  R!0 0 1 303yߍ         IdP  P9dP``/dؖ|@T0<`2 H2 2 2 1 1 P00/|qp@- 0VM 0PP0T10,p" 0P1p@!p ` p0P`` S 0!< ,0 0 T1 30Vߍp茖Npp@-MP@Z`P`Ѝp \P ZP  ZP 00 0  PO-p`@(,ZPP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW ~P@@pc P600P WP / . G-`R p@P8/PP @VG-!1 0M@Q000`PR UH U [.0P0!1 0 0 30\Ѝ 0p ) P00S00 0HoPP  0=oPP 4o0PS$Up$0T  1oPp0 Pp0ꀀp opP 0 @P0 00oP}@/ B/0  Q B  /0S 3 %0C  0% %//Q0 / 0R  B 1 // 0R  B  2/ // 0R  B 1  // 0R  B  2/ //0S :p@-@P0C0 P Pp/0p@-S@ :P0C0 s P Ppp0$00$00  /00԰p@-P@ZP 0S S pp@~ZhYP p@bYp@-P@qZPp> ZP  cZP 0S SFYP p@@Yp0p@/p@-P@HZPp >p@fZ _Z0@- MP@&YP Ѝ01ZP 0S00 Zt0 00 S /p@-P@YPpZP XP  XP p@X0S S  /0S0/ R R 0 /0 0 /0  0/ CR  0  0/ 00/ 00/ 00/0 / @-b/ 0SAS/0- Č Ȍ$(0Oc?S_c00 P @ P 444P 5_0U0P5_oPT 0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030p< TP7 YP @P (! 1 0 3 30?ߍ(3@ R. R  0 y p0S 0% p 0 | 0 y  RP RN$ $ O-DIM@4MI͍,,J͍@Pp P0`S S  p4,$I= ,0 2 Iݍ4Ѝ RJ- RW# " "  J= 00岠p} #Kz0 Wy QJ=00PkJ=  00SO S UVW J= 00p,:03 00'$000J0 40OP @'0Sk0S  0S0s S0S UVJ= 0 % J= 00pfYY O < SP^ P Co03?"R<UVJ= 0 p`p^pZ<0K8 J- 0% $ 0Po J=00P00J= 0 0oS Sp#< lJ͍ 0 pp p 00SVL2Sp S SJ= 00Y0  RP pJ͍ kPp ̾d<# " h" l  O-ğ MQdH4@0P0CS,p6)('&%$#"! 9 QVW00 R04 0S SQj#3 0 0 30Ѝ#3 0 0 300 HDp@`ЍOoVW7 0 L#? s0x`P#T!0SN0S ? /r "s0 DwPT QVW00RTD`XT 00" 0 w W* P00Sz "0 wT@@? 00!D wPT`!0 wiT 1i #Qc0|||Pp`P 0X! 0 wP030#?Vp@D `0V0 0 mwP030#?p@D0Q0 p0ĠĐp `pP0 W 0`@Dm    IwT00? \  =w ظ H  l   T-  4 x ,  3 d G-p 0 FM& P@`p 'P  RW  ?P Wr`ov` 0@Sp0 0 0 1 303Fߍ000 00Ͽᰵ 00  0P Y: /r RX 0S ⍭P 0 D]0@-P@ M 0 z 0P  Ѝ0W Ѝ0p@-MP`P@@P@T 0S  R0S P4@PЍpP,PЍpp@-@pPpPp0. AASq0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0R00@-d!$M""00(  AS0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S.  R  R R R0 S 0/0S S S S S00@-g/ 0  00S S00/ 000S00/00S 0@-P M@PE0 PEC@=0S0S 0S Ѝ0/O--0BM4M@ 0ȍ,ŸP @,p$01 0`(0000` ``   P:1000 01P@ 1[ 1#V 01  8 P 0 00 000 08I P V0 08,01'؍4Ѝ 0?sQ s0 0PU 0S $0S S S U0 0 0$0U0 0U0 0U$0 0ꀬ @ܪA- `AM č@pJVP EPPU( 0@` =t & 0 0 4 30Aލh0 RP P@ .R@ A>PdEU 0 껍븩 0A-x!x1 0 M0000S@> S0  0` V" p PQ 0S @ T S   0S QRp`V| t0 0 0 30 Ѝ P0 0 0`V    U넨@-`QM @QPp Q Ѝ RR _PP)p0U R R  P0R  Ѝ  R RD0 P 0   G-`@ ptPP   @ @ ! O--l lM4M`-,, @ &\8  $PP40&< 00ZY!SP< &< 00S &< 00S 80 0*0?s0SP_ : _n0 0F 0SpP00  03/P &< 00 SS00&, R0S00j P0<040uPUpE [P㐪7,@0D0>@PH0(P$`0 Z PE 0  PS@P_00  03/PV @T 0`0 TTX00S V- &< 00SVVV !VT V <q!P0S(0S {<JV80C$0XD00S S80 C, 0 0SP, @0(PS$`C @T ؕ@ pPlp uT5 @0 0%|%x% %%  0000 00u[P ,0q0q R R 0   PR, tTU LE0S{ mS00S @$= ,0 2 ݍ4ЍVS0@0&< 00SS  F'VR1!pW: X:40 0 <`p!PR0`S`V0  0$(%$50 5s (0S9 J80C?$0hRC.@t&< 0P@,#40%P@ 5v@00SB@WtR00<:4Q 0< y Su$0DRC.@X%<0H v00<0d2zo0 0  2RP 00  03/P UU00@S0  <g:@0?s0SPPRP<(00(0XR0 0R00Rl1Pzo0 0  LQP00 "  P q@P !_@ L0R4  4S P 4S @0@@0QP@0@0S 0R $R R $R 0@ꆊH 0Ĥ T@ H O-@ğ SMD`=qPP  9qP $p 8YP00[3  P00 000 ^P @pPY 0  LPNsLs@P#|3 0 D1 30Sߍ0000Q Pu 0 .P0P R R. B/o" Se d! S<*0Sr 0 00 00DD0Q 0 pp00 PaX0=S Q0S4 S* S) p0S 0se[j0S Q00rrP0  PnzQ0S00G 0 f000  Q000S000< D 0PDd   DD Q000 0 P4 p20 yP,8Q000 DD0Q ~0s )Q00"Q00`}rQ0P0,Q00( 0 LPxUꈛ`O-`@VpPM 2 0 S[ `P 0,,0H000 0000L0P0T0X0\0`00HS? S7 S P00PP* P( PЍ0 ,0pLp8 40P0T00  0Ph h0l0p0t0x0|00 d1`0S 0Ѝ0 0p8 4000p4080paP h8 H  410T0 00 !   R" 0  vP 0 p P !0, < @ D  80  ,40)PqY0 d1 1d0SV? 900P0Ā O-p`@P"P2$M 0L000 0 @HP0S@ Q@P@T SP-  GP  P@P!1 0 0 30^$Ѝ0SQE3PPB 0 @P-0;00S @  P  Y0SQ   PP 0 @P000SPP` qqV@@ P@ P됓 P00\//} p@-@P@P ppTpO--`/M p " 8 X@0`xP  0` Z% 0S0S ` t@T P@P ppT0 0.> 0 2 30ߍ0 0|0 S0$00 `P$$`H>00@,0(z `\ l6<2 L;20\0 |0 S   S  Q  RQPP  XPppWS|0R0Q0S P0^㄀Sg : P|Q ,0z 0S Q0zS %m0P40 p P8x 4 0 B pW0P00_X\ 40 4<@D@P@`XH 0S0pS 0S S 00S 3 `P0  ;` R R R`0S0S;0S`V ;6`S0$00|0 P4<@@`D8o00SzXz\t0zS0SB x``=@H*H: 0 @*0 4 4*80` Y?,$@@ <0V 0 f362 F;2P |0SM0 S F SRCQ Q : \Q^3?oR20S Q`P0 `P04 00<080Pe?000W@P񏐑0S Y`V `tV`Y(@ Z 01P @0P0@TPU m0P0 h帠`nP 0 @@ P@ TPPnt0S 0S n t0 `0 |07_P)^: =P| R (0z0S Rx0z0e  tP : !0P00z0S z`p,@$P00v`V0 $P,@P@@p 000 Pv`V  R R R`VR $@@`P QnOnV$@E 00Swr0 0`~`| 00 P 00 :0P00 z0`@P nnXa`_ 0 0Q P  400V  R  A/o"\  P  R9 R T p`0 P 0 R   L" l1, 0S 8 008zm` ykP  0 @@P`H`ZPgkP HJH HT0 V@0T* m3z0:0$Pzt` P@ X`@o `Q輐0Y|0D Y0  0y0 y: А ]P \P40D  L L0]P00D) 0|0 p0T SR S  ^  Q 003 Sኡ*0 S :0 SJ n\@$P1 0z0 "t0R00 mPP @0T 0@l@0T@lt0+`zp,@$PD꬐̏zpy v h| s,q$ dIi . > ݨ <]P1x00x0 lꟃP@0T00T0@lP z0`O-xxqLM @ p PP0 0PF ``0S S S T@P `0S `(0( (`P00 U `V`V 00 k`V0S 00SU$@LЍT G-`M @ PHP p ` @A00 f0 RP <0S0- `ЍoPlL0 5P l@@DNP <`PJ 0  O--ttŸM  ! "4P ğ* $! ğa @#, P@dğD 0"0#P 0Hğc>  !,$P,$ʃ  $ "0P$a @ # " `!`&@ `ßj "! @ ßa  # ",@ ß$ 0&0# 0pßc> `!,`jD@LSPP"P%P8CeX@ @#@$@#D 0 ,l̈́ 0 !蒟$ `ab``P P%P"`X @ 00#@E0`ጒ`& `xŸfm   "0X"a 0P 0#PX0 ,, @(BŅ@` @@$@!D`dM 0 0#0a `̑`& P`VP0p: O0hV@Hp` E0S@@:p`F Ap@-@P0M0` 0 00 !? 7R8 bx b  D 80 0 0 30X Ѝp@I~jX ljG-L"L2 0M000424"00 P00 `p4 0R @  0XS@@ rY<0s000L T $. 0NrY)T  aA 0s00C 80BS,!1 0 0 30>Ѝ.R ^V* 00RP 0FS0 S S Q >Y00@^*0^0 48 <^*0 8<}jih- M`P Ѝ@-L!L1@ 0,MT0$00 `pVP ?o2T0S9/o"T R @ 0 0 $0 30*,Ѝ p@`!(0r @$0RV$B R T0 R ( $Q C!}gg | A-@0`, rMX0P^ppAtA"`0O^`00TAXA\A 0cP" 0 \ipP 0@)e0P 0d X0 0 1 30 rߍP e00E 0P0|fB@e0   d -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/ldp@- M@ Pt00h` 0`0 `P@@X@ n0@ T  Ѝp( d@-LL1 0M` !000 Vp @P   9Vp T@ 0 0 0 30(ЍTP@pW @@T PU 0SP@DT?0@0$|ci cp@-@P0:e(0P7e(P,P3e 0p0PP 0P 00 0p`00]cP 00 0p   / 0@-@ 0 0u 0 0 0 0 00@- 0 MP @0d 00P 0 m>?o20c Ѝ01 00 0 0p@-@P0 0U0 0pp@-@Pd0PPd(0Pd(P,PpG-`0PX pݺPQ 0@00 S S0 S S d̺PP@ 00pZp P7 幺@P 0P00S S S@ 0AS A᡺@PP 0S00 00xcP  cP0@@ l O-@ 0`p M,0(S{: B(T_TppW 00SS 0QM@D@T0PH 00SD000@D@D0P0S- T0Y  0!0J@0PI 00S$0AS0070  /0S000 %  0S& 0p@c0ppc(0pc(p,p @ ЍbP  (,@(|0  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0uP Ѝ04p 0$  $ 0 . Ѝ0O- @\ULMP$0  @@0XP0F$0apPA  0@@IP6$PPU 0`Q QB QR Q% 0U 00S{ `Pb  `0 @ 0!p R  R/ RY R 0 @Upb 0J[I0 0 LЍ   @QA@  0U` (⼐p 0  ,  p0p 04`W G`@ @U@ 0 @bLЍ@ 0@bLЍ `^ P@Q  QA@ PU ^ QP @ p, 0S QARQ  R  P@ P@  A X% X X9 p X) T( QX X X0` `?`  `F ` ?  `Q@ @  P@U` b bRO-P<`_ p$0[@(0` $pL0W,0N0-0(`` P `\QJ`0c#UU`0* 0U'PS$Y:W' 0WV #((RP P54PE2PE1PE`S0PEg "PE:`uP4;P 0 @a[030#W,0W030#-051-0%!0Y" #((RP P54PE2PE1PE`S0PEi PE8`uP09P P:04  P800 0@-MPp/ @Rp6 P0u0(04{ {@㇨0@Pt 'U N0P  9P Ѝ000QЍ0}P 0 Ѝ0tP A-'Qp@D P`P0 Aa00 / @-\ ,@\ \ Q :\ :A: 0 4 0 C-P$0@SME 0( P04 :C1I;p1 B$`00>1B- 0CIR0  R0000809L>01  00LЍ0 0 0@-S@ 3/@}`p@-W Q4S @A P`PE@F$@@  B B&"@D@D"F$@@  B B""@D@DA$@@U  B N B ^ '" ^ q N $P@@DF$E@  BB, D B,&" @A!L@  B B!"AA!@@ pQ Q@#` P `N@F$PEPET% B B&"@D@D"F$PEPEX% B B""@D@DA$PEPEU% B L B \'"\  \ \ , ($P@\ \. \* \, P@^ ^ N@N P@\ \ \ \ @w< 0PPU R800 0Y`1S   ;`1S0 N0  0PL0  0P9P  PP&0  0P0  0zP0  0nP0  0bP0 0WP`1Sy40S{ < P0ppW  0R 0oYpW 0pW  0R| ,0\YpWg 0pWb  0R4 00IYpWHpWE 0 PS 0 7Y`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P  0001p 0001p 0~001p 0swt1p 0iZ/\L XtЍ tЍ 0  /0 0  0  0  00 x0 =L P* $(4 \ 4&D  $ \ <  ܢ | @-@`0 0AMM0 400p00 68PP0S hD 80 0 4 30AލЍ.$p8650,@-@ M pp P 8`P7P 0S <0000 Ѝ00S.S 0S Ѝp@-|0|AMPt 0  ` $ 0 @P 8 00 0 4 30Aލpp44p@-P@Q`  @Q zUPV 00pV00p@-@ M`p9PU 0PU  0\W 00 Ѝ_00P0 `JW00 Ѝ, p@-@MP`0S 0 @S 0S@V00ЍpO00@0 P"V00Ѝp茝 0@- MP0@0 @x0@T U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0 h  # p@-Q`M x00<@P 0PU  0VЍp_40P 0`Ѝp @@4 0@- MP0@0 @?@T U Ѝ0p0 0PU:L@@ Ѝ0<00@00 0P Ѝ0t "< 0@-@ MV T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P( 0@;T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP4 ě p  @ Ԛ $  Ț X Ě ` < X 4 X \ 0@- MP@O@ P Ѝ0 0( 0P Ѝ0耒 0@- MPl0l@0A> @0@T U Ѝ0O,0@ 0P Ѝ0p Mp@-@ML 0 Q0P0<00P@ ` 0. 0T @D DS000T H0 0 <0 30 @Ѝp@Ѝ/.0 T.n, ,O-PM`@P P; = p 90 Q  ЍSv RSPP -\00 +\00 3P0 0  R0N1011.\ 0 @T@  R㞀( 00 S #3@  R\ Z 0S#30 "#T$P+<0+80+40'<0'4 0(< 0(400'( ((P p 0R0p ` 0T00@0 P   0R00#3@0 PS \  R#3 000#3TP 00 T @ P P 00 S #3@  PR \ 0S#30 "#T~ {00H 000J00  0L   3`+O--Q0 \M R 2?"1>Q1|" TSSNxB0c<$CdbBdAAC22c1Ab^f,RnjaLWEP0>%S8_2eRlQqQNDB<">"br!LgLH @p qN8m 4m 0m[H LP0H Z J Y L (D $T@ 8 < $, 0*0Pp4p;[ UZ UY U\Ѝ  BTꠀR(i  0 0\ЍTZ DY  4ig MbQD h ` d 0 C0 Pm*0JPdZZ 0JS񏐶Aur:ow7{`9UuUh*) ~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXWVUTRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      VP]Y 0S .St 0Sq 0Sn00S.Sai`9ZD =<00S 0<)0C ( 0  BQP5D0Sy@  0D;pD+0S0` `【t0`SpW 0S @0D+@T 0Y4  0d  0 wP8(= <0 2 M ݍЍ词@0 (08P0 ZP`0 0P:<=<00D S.D;d 0D;t70 0 7P( 0  BPH 40@寍@0 8P(0 0P D;0B& <Q060d  _0 PD; Rt6 00 B(0#8 ,0(00,0D+00pCW``W p@D+ 4 V@ p I 0 PTWoʬ0 PJ0 0(PBp5 00W0#80L5$ D0N 0C0 . q . 00CS W0 A0 PD;`0DkV:U`0 D PD;)|$0F ^D;ld0`d 0 00 fPD+0D  d 0 UPD D -D+0 D+ d 0 APD+0D;`V spD;`V0D; 0d 0 00  %P(00,p`C 0  P0 P 0  P=<00SD G-D; D+D `A- D; 0D;)X2Cd 0 =0 PhP:D %-D;b0D;`d 0 $0 POD -D;0D;0d  0 PA?C0 Sp0 P[= 00H+_!HkI=D+ 00 `0C D+Hk00 kP= 00H+?!Hk)D+= 00 L? 000#80|t: D;0B/ -0/0C ( D;0B/ "00Q0D:H 0 *P3Z 0  PD;`DkpW@ GQ9g D0 10"3/= 0;D0000;D020 20;D00030;D0#100;D0D100;D0  PdDk`Dk0S>0: 0D;D+0S0Q p〠 0pSH 0S `D+`V 0Z6 :d   0 P-= D0 10"3. 0;D0000;D020 20;D0D000D;DD=  D010!30;D0000;D0+D200+D;D+D+D=0 D @!  ;D+D;D;D;D;D;Dw D;0B- <` spPWW Ԝ `/Z 00 F=P0J 0GW 0 0P0d,0C p'`D D k'D;pD f'`D;`0D;<2 0i0  P` )pPWW 㸛 `/Z 00 FP{0J 0GW ᶯ0 Pm= 00H+Hk᥯D;-  0 `D; N:d 0 Hk 0 PHD; 0SD;.** ` *  D+@Jp Z0 P+ 0d  `0 PJ`p@ D;S: 0 PS 0)0C d9d 0 `0 oP0SG y`D;p0`SD;0D;; 0d 0 00  RPD  0 GPZD 0S 0 VP  D;0B( 0 -PR 0B( = 00H+HK= 00H+`&4xD;p0D;`0 P8d `0 W`0  P0 _Py0 PqD 2&D;`0D;0 Pd= H 0:0P\-  B H+ 0H; 01PK0 PCD &vD;p0D;`0 P4= H 0 0P,-  B H+ 0H; 0P@0 PD %D;`0D;0 ~P= H 00P-  B H+ 0H; 0P0 ]PD %D;``0D; 0OP=H 0`P= 00-0C 0H;0 H; 05P0 P0 %P0 P` 0 D 7P0 P(0 `CD;4t0D;p P 0 PD; R0 Pt2%D;d 0D;30 70 Pa0x#0C Wd0 PQD0 PI( 40 P= g D;0B" Wy0 Pq(` pPD;WmWe ㈒ `/Z 00 FP0J 0GWM I0 yP0`0DkV:A0 iP䑟 m0 ]P Y D;0B! : D;0B! 4Wڀ0 CP`1d 0 0 5PW$0 *P0 !P萟 \k k k i li i pg Dh f g g f e e h d 8e d Hd b b b K (b |a Ha ` ` _ _ L_ _ t_ h^ D^ l] ] Q ] Q \ \ 8] h] lP [

=Q| P [ W0@0@PQ 00@ =Q  МPЍ`@QxZЍ`[`P W`@`_][`X`Q 00@=Q 圜P PZ` ZQ Q 0@[W0S `QQ 00@=Q`Q H xQ dQ HQ TQ DQ 8Q ,Q Q @-0 Q0SPA00XS<@ 0SQ.C+S^1- r``p 0000   0 C R0 37 #`0CVs0 X     0B ^037# B"  A-Pp<U P0 @x0W``W 0 .p H\p@^0070.200 0 S037#P00 \00/ o////@-` @0 0DM0<000p2 00 RPK=00P@0P< 00 0 <0 30DЍX K 4 O-1쑟P0ਂ0M #੒ q i C2'r0ApqB# C@$AQh!dP`3 @@C.*T6W>YFX @00 SP$Z R 0s00    00 R @ЍW 0 pPD0 fPW H0 \PY 0 M QP X : %I$ A-`pPڧ0S.@ ⵤT$ 0D0 .R T  S\R C @D.R @0.  0T  S\R  @@ƫ( 0 0@-0M M 0 P@ 080P Ad P<o8 ,0 0 8 30ލ Ѝ0!W h 0-@- M0@R0  ]=PP * Ѝ@Ѝ/ % Ѝ@Ѝ/WPR0@- M P@&PPP0 ? Ѝ0@z0=U00 Ѝ0PR0@- M P@YP)P0 ? Ѝ0@V0.00 Ѝ00@-@Q M P4PP0 ? Ѝ0@+0 00 Ѝ0p@-P@0P p@ p@ p@-@P 0P   L  S P   p۪ 0 pQP@- 0R R  ƪ 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  tP  T@T @pfP {w 0 pp@-PP @TP i T Pf6`0S @P000<@-P-+*)('&%$ r 0 00P00 00@ Sp\ 0Q00NQqЇp0pG < 0@ ^X  PEUDP <@<+^9 -^PP<0PN UP<@-0^ :gkQR E Rkڐzg{[{{R E^_ E^N%b @E^B^ E ʒ <@[<00tЍ00XS <0P Pw 00V006 0Si^K I^H N^ 9 N^@. $ 0Z QQ0CHJ[vSF0SXZ b@P@ @%@ X`0@/?H 40 1Q * 0`@@ 0` P@ ND4@ 0(H0,P 040C0 0H  Č 4 t A-0@SpM07 S20 0*PP: `P5 80 0P P&`  0 #0P&-᠘U Ѝ 00S S Ѝ0 0-መ- 0 G-20BM0400 00`S0. S @ሢA~ P p0u #0G*0P @T *X< 8"݂02P  0 "2 0 4 30wBލ 0    ! )i*@PH PPC 8 0 0@WPAP 0 00 00000 00@,T7 0 p pIP ᛐ00S 0  0pW'   0  0 h, 0 a,ۗ 0 ԗ 00S Sɗ,C< h G-Mp0`ᣗ@P0P0 0   0 p`GPᤗЍ 0 ;PP A-M`pP}@P , 0 (   P% @ၗЍ0, 0ЍRQp@- MP``8@/0SE 0S 0S0sC S 04>  0 40 0 0P@LP00 ЍpR R / 00 Ѝp0S  00 Ѝp0S00  0o { O--LLğ p o o O-PP M@QpPM (Z? U U U  0 `Ѝ0` Ry  ?0Z' + ]`PP 0:/qp  00P @ P |'00 0 00 ۅЍ˥p pP0  * R + L UY pp 0 P 00 0SM   00 0:/qp 00`Pÿ\ <`V:X0`w R0(00 mP0 :/qp`0 d 00 0`VÿR <`VpX0P[LS 0\U 0<`ÿ800C`V0Y 0  PE`L0k?  `:/qp@ 00 `P  @ P &00 0 Y 00 OP)0 S&: 0C 0`ЍP`T 0S  0C`ÿ 00Y 0 0 AI `\` @0\ & 000  ``ȑ 0Ll O--SP\0# ` $M  0 0 0 0:p#0 B0S0 Q6  R00S B0S0Z  ^%P N0 `p0[] U0 00 @PS  0SRRV  RR00S R Pd 0 D P0Pq ^U T~ U^  C0 P  Q CTs \b X  :P04 0SV0 *P+ R0" P0 @  R TP P! P( P0 Y  R  ͌p0Sp$ЍZ P 2W P PP P X ؃j% `p@-@0P0FG p 00p`0`@p觐0TS 0 pp@-@PPeP P 0 03/P Up@op003/P U 0< p@0/p0 p@ 0/ᤝT -M0 3/Ѝ/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0 R R R //00/00/ R R R //00/00/0@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ00@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@- 0R@P M R R Ѝ00P03/P P Ѝ0003/P PP0@-@0TP M T T Ѝ0003/P 00S00 Ѝ0 0R0 02/ Ѝ00@-@0TP M T T Ѝ0003/P00 Ѝ0 0 03/ Ѝ0R /C-`@QpM Q) Q PЍ0 03/PP WP:UR X$ ЍC0  0003/P PW*UX #0P0U URPЍ !Pp HH,P0PSP"Խ ;A-P`p@P  R 0 R 0\A/U 0A/0@-M 00@SP`p SW-   P R`V V V Ѝ W` 00 R D0SPV"00Ѝ}"00Ѝ @!Pp  (#p@-@PT`M T T Ѝp0 03/P 003/P 0 Ѝp0 00 0 3/P 003/Ѝpp@-@PT`M T T Ѝp0 03/P 003/P 0 Ѝp0 00 0 3/P 003/Ѝp@-M@P0.S00Ѝ@-M@p0CЍ R? ..R0) .Q -S.S AL#\0A QS' .S 0 .Q AAQ0B Q AAQ0B QS  \0A Q-R 0//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//"0 0 /R PM0  1 0Ѝ/R 0p/0/ 40/ ̠ ( 4 0/O-P M R  <4<00 \O 0S XJ@.000PC @PG X=@\RARZJ 0cZC1 00X.p0Z`ڄ P Kf[p[P[D Y@@T  R0P P*0000@*( 0  ЍAS0S~!0X@\!0ARI0SP \P0" C:R:Y8W654SR10/.M,+*)('&%$#"!@; ! C]R#X`!`a##"!!!Cr b0Cs0!0@ D0DQt X 0@Xx0@,010. Z009ZP  0k3 ""pE dk+ p;} 0 Q0SJ*.00?\Q$O-ğ,M X0 t4tt0P`@p 0)[X> `zP @Qa UzP @Q㈀ JzP @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] !zPj  HZ$M0xSJ3  000 A P0XY /Rl ]RRP ^0/ $$ 0 ]R& PR " YXuP   Z J b"r R ZzA @Rg .R`P@㸊0@,Ѝ P` 0D0C  [4:( 0 ,Ѝ袊 0 ,ЍP    Z"    R  PXY  ^0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYy|M 4 0G-aQ`=*0 S) \5 p0P0S/ @S" 0X*U  @0s00@琐@@ P 0S00BAU0S!PPQP0X( 0 H RO-P3P#RP3 M0U 0p`\ @H @R9 R R% Ή(00 ЍW@ Ġ[? A @ GRPR@\ 40S @[A  Y*@T*0P` 0A\ R!ɑ" 40S 04 0- M ЍO-S,MP [   0S 0S@0Ps0v @P` \qTp000[000 0P0$@0C0@TW @0S @S]  0r XK*PT p@0T00S 0 Sg*`V_ ] N YZ R0O Y PB (00P0S !R* 0G S 0S 0 $p0ATgP0"1 0\0[ 00( 0 ,ЍATX0S"  ! 0SP4?<00 R`v``V0 S000R0 ABQ AAX QS R0SY 0R?0)@ *ꒈ 0 ,Ѝ !0H p@- M P0 `00p @ !p < 40 0 1 30ލp@3A A A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ34A @ Q:/R/0S/S:00/@-\@3$* 0^ @R R R ( 0 0S0QA^ R! Q 0Q" 0 ARL @-  RQ0A  RL  ؇ 0 CЇ( 0 /C/A-@P`TP' UVT ߘP @TP 0p  0 蜇( 0 0QSp@-`P@ 屘PP@`V  0R p/pA-PAUQU@A`pPWڀ1APX( 0 R 0 J? 0 Q" @-ASRB 0@S A- 0 '( 0 /-- M ЍЍ/@-M@ 3 p TЍR/0-S0 \S  R 00O-@` M P GP-Yg +Y` 0Yi T @Q 2pO`Ppg2pO`P" [)SQ" K0Iq P0aIQW0IAIQ70IT| V[SQ4+ꎆꉆ0S \0J0 0 Ѝ  00YXP 0@ \@ AL\T@p@-BR"^8 p@,00a@PK0T0Pp89 p@-BR"^p@O@P90T0Ppp@-@P M``8  0xA|A8O8 TAXA\A`0PP08 @(0 0 1 30ލp18 8 0   7  -- M0 0 ЍЍ/--, M0$ 0 Ѝ Ѝ/\7 QPO-M@b 00S000p!R !03  vPP E`#3?`:0P*Q30A !!!! iP 4 0 T~ U 0C pSvBP0 0@pQ 00S  ЍrT 0 @00Ѝg 0 0p@-@`PM ex0 0@exЍp0 05 Xpp@-0 000St@@@pdPddP@P@P 0000 04 tpp0 @-@M Ѝ@A-@`P1ppp0php T  )<0 +t&  A3 POL@-@P0S 3/000S@t A-pP@`  F i000@P p@-@PǁPpp@@-@!1BMM 0`PF040@@@ @@G0qPpS p10S d!p0@ d P@A0@ P> 1 0o!0 0 4 302BލЍ冄P @P  4/P Q Q 0 0ox0 00P h0 0 c @U/\2 2 |ԯm,1 H\D O-qQpMP P Ap@f a@0` RD0 0]A1PI 0SP p Z [ @@P 0[pP 0PU :Y P``S@PP TP 0@U:W q0@@00_Y@Qx00p@@hЍPbЍ<0 0n` lD0 0lLkjj 0@-0@P$M P P0L0 0 OP $Ѝ0j G-RPL 81040SA a q@`p #)/0@S-00儑 000S 0 000 00 xw0 00 \o0 0 @g G"(004G-쀟0S@P$0S!0po`PP @0S PU @@P 0U00 g8@ 0@  P` ` hhgO--dM␐PYSRßQ @!3 000Sc`0S00 0|#00x3 0  0 0tP `W@3@0 083U0 @ 0 Q  Q P0S-   3/0 0'@W$U 0 L00L9PL 0SI 0 <00@00<00)P< 0 S@Wp@ RP00S-! 00C0T@dЍA,@@@10\U 0,0S/  R|1|0$   @$(0e@$0@S(  ( @0Zp+ p1S `bPI 0@0C000$   @$(0P6 @@$0S(  ( @0@$  $(0* tf $f0f d dpd` c | ` @-0N~ \0N~@ T \ګT 0 \衁 0 0@- MP@0 P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000F̌0@-l>0F. "l@V,h @P^QhLl -R 0 P0R 0R R0 \aA-$Ÿ$20#Lc\*0Sm S} 0C l l;Sàʌ͌fc\*0S[ S@a 0Ϡa^l@Ҍ 1C0o 1fcf Qq P@\ pp0T0CH` G41@?L1c1c0P0B0P0BP`N4PQ` @PS( 0S l lVàڤ0@00002c2cPÌ l làL l là@)\P ף*Qgfff$I 0P /0S/ 0 S/0S/0S0@//O--M0 @  S 0H$(@0 48<0L T@W xCE 0R \ 000!10 R0s!{ 0 Ѝ0 S, 01P0% V 0? VPv42P Q%3PP ΌQ V"> 0RR!:∫ RF\0h W0PC F. l V h@Y(@ pRAh \ b 0V00V 0?0P 0 K0P  V    PR/R  RPy 0ЍP0P0 0P  R V,h ( d P/R  (  l Y`Y` (GLF0O-@PF"F,l Rl0l0U"RP*;<Ѝ"R 0S*0Za, 0*P;M@@` P P00C RVUV`,⸠  `PPG 00R 0R0S 0V0mW`2 z6 @S%VCD00S R ;S,S S@0\- 0 (\ 02FSPPE4@mpP>0@gpP+ @00c@049@@i@V|hlp崠hpx|…崠 ራ ntЍ?Ps  0f ~ [   100 0pS0S >S0C"1 0XH0:P 0,S\0:P 0S   @Dl6 ihƎp60 |ax倆0*;$吚<P,@P@ğ唄唔00p(p[pT @D bY1:HtbW 1!/ 0Pppc W p$@P(,@P0@@ @0 Q0 3#哔#cR01:#cR010! 0 cR c s S R  h3@0@j,P4@8A$0(p0P#38#!BcRl:#cR#20!WP Y c8! \ Qa ce8偡 Z , \DR/ (" !c 0@?P00cSC X>*p  1  @R -S +SDP *EX1DP D00cD0W W Y(p,P04@<0f΃g>0KpP@(,@P0$ (p,P04@00HSh0Ű17gt0s1800H2vlu)\(\{ ף3Pp@-@@0S p@xPP @P x0 h0@T D00 8 1t@h ,-H [H2p,DoG-@QPM 0SB k`P_ 0 000STH0SB `V _ rPPUS lQ8 X1X!@0d0 T000(aM@@`F T0P0\  R@ d?@D  @D0P0T0S 00 PP@0 0 l0 00WPࣥTD,kx*<* *,m@ h@)[Hl` (c(@-^ F@P  0P( S!ʴ 0`@ 0$  0, 0 (0 0Ѝ@Ѝ 0bЍl0000@Ѝ ,p@-P_@$C@_pp@-P`@h R T0U:T:0T:p@je600p@-!@R ! 0P0 0S 0BuPQ`0AP R 0 U00Sp]P0]P `]P0  hl 0`0A- R P$@ R00 0a RH 0  a0R00S00L0A PA0 A0P`#p31 L!! C0 ^` A P S P  R 3PA `RA@1, `!0C000AL0 VC-p@P@!WP` M k fk0S, D!k00@ Ѝ00k sfk0S 0   k0@gk0@O-0=<;:9r7n3l10/.,+s)('%m#"k RoNMLzj TyvNK|S WW[ 0W0   0Q񏐫00@0C \$ShPe u0Ss 0Wp1!PI  u0S 0Wp1!P9  u0S 0Wp1!P)@@@1 /u0Ss 0Wp1!P   u0S p  0Wp1!P Z u0SW 0Wp1!Pg uu0SA 0Wp1!P `0*S6 0C P@00C P00C P`a`00`F0C P$S2 uE0SWp10P 5 u60S 0Wp1!Pu)0S 0Wp1!P * u0S 0Wp1!Pu 0S 0Wp1!Pt  u u0SE 0Wp1!Pc @ u0S 0Wp1!PT p <Ѝ 9 u0S p 0Wp1!P6u0SL 0Wp1!P) p l  u0SF 0Wp1!P  u0S p  0Wp1!P u0S 0Wp1!P p[ p xp0W K*0P| <Ѝ@@@@ Rp4a KpxZ DpS =pL 6pE /p> (p7v0S p * 0Wp1@~0P  pu0Sk 0Wp1!PW C u0S p 0Wp1!PBu0SB 0Wp1!P5$Sy`40P00 pu0SO 0Wp1!P)@J u0S p  0Wp1!P p p puq0S {p  0Wp1!P kpz dps  uL0S Vpf  0Wp1!Pu90S CpS  0Wp1!P00C P0@ 00K0C P$S u0S !p / Wp1@{0 S p  0 W p1@ r$S@O--ϟ oMMƍH0@00T ! R !0s0: Xa 0S^   Rd 0$00D0>ܰ00`0>T00@匰d0<\PPU @%U PU 0T  `J 0 R 00S0U`n0S <0S <K:0@0S0000PP >-= 0 6 30C oލЍ XPZ    R:0s P=*X1RRXOSX.TQXQ\Qgˠ~@Q`G0D,TDT l(80    S+ 0S@q-0r0X?$  00 @TX@@RPPUm@ry(PLP,P4P0PW Pq`}r(P@L,401 S0PP00S800 0`@VwQ 0Qr0S0Q 00QG0S0Ry ( @DT L( p0 0 R *S9  UP@@y0Y PBU0 S80000E000X0$ SH0100 H000Sx00@t0| d7| PR1|0P <x0P0CD0 0P<0 t0$@S-0r0|0s40 p< Q00 mS60\ 0> 00  H d@8P0p0QS#\ > 00   0 R +0  S50    X 0   0 R S0|@TL< D\  P0P00iD0 0Cp0D HXXz@``  HX{0\0SD <00NSO `Wrtʜ|p@P00L@(P,@4@*Sr0ls@\0(@Lp@ R Rmdp R 00! , 0g 0@  P 0P pP0P00 0@#:} Z $0$ 0 {@; w QH $ H puC@:? Z $0$ 0 ~L,PQӡ|(4s0@ Lz`dhP, XRӄX,  B, 0 HI0Q 0 S0 O0P(  PBUPU ڐ0QP0;U@@ATTj P @DT0Q0S@DT 4 0^@0bO0 P00D0S0 QO0P3S0y[(mdp!000  0g0SP00@0GpBTo `` (P0pZp` @DT0\p0S O0P000 N0P00 0v4 10R+ S0bB- C S!!z/ @.cS#/L!b0C000A0 A00s@0A^B0. ^@0\0\0X0r(0b@(0SH$01HS-0`r0͵X$  0 00Z{ $$  QH $ H @v  P o @ lN0PNr@ (P0p,0 Q @ 0S0004@L0,000(00 SA. @0c 0c833:G{000@+S6LR S 0, UUGoPEEéQy?aCoc?`(?yPD?\ 'P 0`P 0 < PQ4 0(0Q8C6j0 $ "P PRP@J B,Q ( P$0 5P P  @6$0( ( $0P $0( S UWQS `Q` ZR R XW R! QS 00 F 0p p( 00,` 0 `$0 P00< `U`R  0 0Q``V  0RQ KX ( 0 R:   @P W P  pP`DЍWpR0C  aS 0A0c,00 X4( $0(`P WU 00X Y 0( $0 \8  kHK, \{KP | {k&[ P {[BJk{{X Q LJ ${ A kQ;0F{5q [kDk6k+K P5['{;k&C{5{0JG[2k$000Z X44Ձ v k{{ Q L{ AG{5{Fk{LJ< PQ Q    QQ,` p P 0 [ U[ UQ Q R,` p04@P qP09S $010 D0 DЍOX00 0000Q DЍH[7 `kk(@F[  { [%^F[h Q,^@P$0( / ?@?$@@|HP$0( UWQ0( $0$0( `X00 ?001k X{k&Ƌ000100 [ Zx 0 y ( $0@P$0( _ $0P$0W  0P 000C 0E@PG 0S 0X40SPE0a 4 1@P3 00S0S0JS0PW0 W B@P P0 Z0JV  s9R   E X   cP| 0[00~@{;$# \ \K{'k[E{7@{0 quNk[3{Ck6{Z0^0SN $00W 0P 0e0 01k,K ( {{[F:N8N0CB:N@:00s001 RUW+ W 8ƋF"*  J @$@?VN 0r9S 00  upPw (Pq   ! N 0P 0 d PJy X 4\Kk[%{{A$ Q N 0X 0U pp,`W 9S09 P $ 0000000ZX3U-Q$000^QQPQ S0 uQqQ j 0 s0R    000100D  0P 0 4 R E 4|4 Pp,`9S,` p Xʡ<`Z^ $@@ QD !460/\460//P@-@00 R@P@Rp@-@`0P0RP* 0PpP R 0 R VpP 0@!O-0@MS]@DPqp1 0Q[1`q0&:0 @@F0 R0 W 0 *0 @0S 00CX:X@D* R @  P `00 0P W 0*!1R 0CX:X@D* R @Ѝ0-WM 4@.T0YM  ST 0      EElr (d@-@- @-Qp@-P `0@ R @P  M00pQ ``0`0@- MP%P  @P  L Ѝ0-M Ѝp@-@ P` !LNTQ !@Ap- M ЍP/D -0")2b3c1@2`M1 ЍC0 00/o 0@-P @M  0P@ =p`Ѝ0 -- M0 0T ЍЍ/ p@-0@Q r P p0 S P1 py PP   ! pL @0O-`M p A QP +5[% 80Sz SQ  @T Rs Q)Q0 <0 rS" $W `W `t Ѝ @iTQDQD@ Q A[  P<0   W <0`0 <0 QCW   `V0BSTQ; ` b  <0V 6TP a PPl1 !P j P T@@k   2  _ 0  @0 a`P  0Q/ R  B / 0Rp@-@P*`0B @!R@ @B@DR@@@3 eR0  `f2f`pS@ * A BP   PRpb Z PPO--p0 tM@ 0OcN 0dp\ h ` -R-+*)('&%$  000R 00B S 00$0P@1T00PCTЁ0Ad @00B S0\  EPJ00 dp0d00+Sh -S,0,00d000C PR0Sdd00S 1CP*0Cd0d(000C Y d00L0C Y( @Pژ(,P(`(0\S 0p\tЍd0W(XP 0\0 0( 0 B0S  S ?o200Zg{T@Xpp XGڐ7 f01k5[Xӊ 0Sy 0Sq %0hS 0pHpl00XS `d` 0R RKQd000S\00\0R  h  Y RiSa IS^ NSd@o P 0 \0000d00(S 0h 00nS 0h dp\0\u   Z% \ BdT0 0C Y d0Y ( 0; 0d0000H 0\00 0 |PH h lpHpWg  |501{'pH ` Ph; ` l BpYlp q lp`plp 0 A0S@0Q,0|GY  Rh` %r0`000$0, Sl  @00Sh,0@0000 00j 0( S? J 80 0˟۟:( DD@| PP   ! sIh0q `P h   !gI`plH 0G@P00 S( 8 B p,0 G(8pS BpGpp W Y (0RpGJISGQʹ 0SZY  @P M pP 0S0S  ) 00SPX} 0 S # Z @0, S0\0 [ 0h S 0CQ 0 R00S400H00Ja00` 0# R00lS 0<0VI XT PM TQ0hSN  h Ph; 0S A ^@0, Si`0A0`   X` l0<0 Co4 婒RY )K{8Ik{Zɋ0SV \ `PT ?@?AV瞯<j N?Ldp( pg  ,001{p W'"Ux0p0{0z?C0C'zp:0 0:AQ'0 0R!:?C0Cp4656:m H 10{  0QH _000d0 R `00W'"t1|0{0z?C0C'zp:0 0:AQ'0 1R!:?C0Cp4656:* H 20{  00Sq l d00S 1CP00C(0d0` 0(0Q Pd@P d00Cd0 Pd0 0d0 00000h \0j h Ph& `0 0`0s 0300 (  J1k{\00G 0 G3PlP<  OZ 0J4H0  Ph A ^0S7 ` 0Q0`0@P Z P4 4 `#8PP Z% # PP h Ph @0 0C@0l00Cl0 h-00 Z 00΋H0000H^4UCZ{相00 zSI8m S\ ˋ_5aGPD{zI:țv\0H 0\00S `0KS0 hPhs  l00C l0  0HFDDB@ 0 l0RW 0 00S S SA h00h00 \0000 @BAR *0    M 00  0 b3"  0Sl $0S 0P0\M"0h 0`\00Q00\0X @0\0M"0h 0Q000 \0h0 M"00 0 000h ?dNK hSPh l0` 0Cl0H,A0P@!0\0 0J 4 H0 0,0000000c0010.0(0S0 00 0dh0P\b0h Sdp0p@00@00h40lly00S 40400CP*h@0 0Cl0`Ph LLLLQIQ # \ (Yl00P00\0, 7 :Sx2 0!l , n:6l0^, `0"5S 00 0Ӂ!{'\  H  eP2 0S400:40H0相00cH00S R0  , B0 RPSЁ S,\X Ч  3 00  h{ ' A1{(\00H 0 P ,0C.pq , 5`Zi 0S h`0 ||P0s !,0 00C \` l0IZI0S!0\0?0@ ,R08pP PP20\0l0  0Ch`l0Ph&S0!0\0 A)0S E0SA @ 0 00\h 0h000,0l0P0\0p0\00S!0\0 0 0#[00Sh0 Z 0S U0\0 3S 0\0@0, S0\0!0\0h0 R0S$00$0;PhB 0`hP`00`0!0\0l0  0Ch`l0/Ph)@-00O- 0RPP@PO ``pP r{"8 +8!80 X#0H0C X0003pFqWGL  r"8!8 Y0@@#Z 0V 0 a 0cPP   ! ZD@`@O-3ß0 M00@Sp 21 `000`C0  00 0Sl  0Sg SB0S00XS 0QZ P@  Q R^T#3\QcTPQ0 ^ \ <0QR- U00\0S{Wc*0 GV*0F@S3 F\   J0 RVOWM 06S ЍЍT@DPD@ Q09 Q0Q l  l>P:00XS Q0L)AoR^& 0 0S  0c1# 00Ѝ QN0O0l1 c, 0# Q:v00Q )Q  0N O-Mp<0` UH8@P00S 0@0P 0 B@0P 0SQ^  H0PP   Q0DR0^^ 0S 0S S SK pPr@00@0 00W@ !IpT0 Pe 0SUP0 @0 0R R 0\Pb S 0CPPa R@ 0D0CSڣ0SpP[ 0[0 0 RYd*0  TDQ @J \  T @   T 0CC10BcPDP|0S0SCU 0S S S IP@"00ЍSu 0CPP @+P~ -P% 000LP 0ࠃ:L0@^ > L@YPl #@Ѝ000 PL 0\@0Q  R  r KS S80S "0p00 0p b@0RI"00@@}P  D21 2 Qn\ 0\0C 0 ^  00@Y 0Sg Sh S @0p 0ЍI  PePgx0S`I@"00Ѝ@ @QA@EzpPJ 0H0Y@HT  21@4PEB@80SjU U EP 0 00b80S80S800c8080S Tp0+  RP!@L80S L80SH00@X \y0l 00f@`  BR"@^ 1P5"@!@V+P(& J  /A-`< RϠP@pl3 ^P 0 W`0 p0U0@PEPU 0 BP `@ pV  0 BPp0U@980@-- M@ PY@U0  C00C2S*ސ*KU Q6cZ AKE Ѝ0@-@0AC^ 0S R@-@A0B@SA *@Q0A0C00T D B @ G0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/~~|~A-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0@- !P@M: R @ 0S R0y@ЍA-q1pP0S2 U`e@T`* 0S00 000AT !0S 0`te@!0 0D1S  000S 0< t|}@ 0p@-@P0p R pPQ`00App@D `80 0QApp@; t|@T|0  0#10/sP30s R#4#2#10 0// /A-`p@P p1,0@U00p 0Sp1P@P@pP   ! 7?`~ 88S00000P0 0/@-@P0@0O-0M[ pp @ S0P0= PaU*0 F B  E 0 X0 *0I0Cp0Y003 0[P^   p0>0 Y0 0[ PT@T 06S 0@ЍG-q0p@9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,1w1rPU 0C  P 00Sj`P! 00000000i0S x0Jd0EiV0S 809 ,0R0i 7 xt@q|wwG-`0b@TP塢ڃ0T'P# Zp  !p E0  n.  P2)0@R0C`0P003 `MpG P `C-0P!1^$23\ *G-0@P@DT`G !1PG*32\ =:Pp @@  Q0 0S 0SQ 0 A B`Q3 3pU  0 0S3#U0 E B S 02LS @0@P`P 0!p@-@ AP`DG 0` P0R @*P56 +CpP `0PR `5<#511 +Cp `1<P0DR56 501?C-p MKU`EP ܀4%66T0@ 0X0   CHH5` Ѝ P0 `00 !30 0S  X0 C@@1` Ѝ0S0/0 R /@-H1HaP`@M@rPP3 pP-0S  Q5 p 0: SJW0P  uPP @0 $ , ( ЍCO000Ѝ\PC 0 ЍC 0 0 , p@-@600CS00 P6pP  BR  /p@-0rSM wS aSOP` C`00pLP`0S e C+Sr/ ^R$ L0S@@p0KS0DS0ES0PS`@`P0p@-S4 @j6 P00P! !& 0S 3/PP೼000P @ P 00 `00aaO6@0`` 0p3P*C 0P000@-!@R !P 0C 0 0 S /3p@-Q1P0@0S3 0 GN 4000S9 0"$0 3/0P:s00.p00P @ P 00< R 800pU0P|F=3P00s0l4p  0@000 pB  0@00p, h-Ѝ/@-@^S S S B 0 H0@ ,0@ Ua0@ 6@000 0 0000/ ?`4 ;`@p:pAB98C D`? >`Ep=pGH FI`Jp< (O KLM N匀FE`EF`GpD ŠK`DpG JpĠI H`H`IpJ KN M`OpL`0NM LpO`pC` pBD`Ap@`EFpG`ˠ ^ʠP`p A/``p^ APpM_Ām[PQ 0p|ePM`Q 0pqePBQ 0pgeP8 Q 0p]eP.Q 0pSeP$Q 0pIePQ 0p?ePPQ 0p4eP Uލލh@Oe@ ,!aQp@-P P4ATp  @P 41S P0p@@@@A-4!@k pP31S L @P!4Q w0P0W0S!R PMoPP !Rp W@p?p?pp@-@P 0@@A-@`ZP] VapPMPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V ?0@A}? @O-,M0 0 S ! (sp2/0, (Q0 P `@P@P0S$Pp LZB @PUXX 0 |`P_ @\P0HŸUJ[e`pp,Ѝ 0 piPPuA $`iP[ 0 $ R`P5 @\P0  0P 0Q QA Q  PರZ`K@(  bP 0 meP @PP,Ѝp  0piP ,Ѝ 0 SeP@00,Ѝ$`  vbP(@HT 1SX0$(Q $(1ն`n0 @-@ ! \ @>,>00,1S@-@0@ y>00,1R@-@1  @0f>,`> ,!O-QM `y0Sp1 Pw`@PC QP   C>P 0 p7>3>PQߍbPm 0p '0 YW \T A/ pP  0'l'%%ȠpP `'.h%t.\  ( (!!ȠpP"|"X `.#l(!"$ pP ` $(,p0`#0#4)̠))T(,0((4# '+/p3`+̠+P '\'(!"0&&8 +'t&d$%&()*,P- .p0102`48<@D)̠)X)$7;?C45P6 (|((4 l !Ƞ! G+(!+\+9:0<`=>@ABE 8pDPF|H`'&&&pHIJK`L0, p  A AA` P  L0 H HH岰 S+I !!!EEEE,TGPGp'''NpNNNR.FF`&&Ƞ&TCCPC`CpR'BpB z 0ASZ RVI^Rl  a6/@ PJ(P QPP p 0D A2n0a!NpW Q`0QVa```$4a$DPP @xCxßxx#xcx0p 0 0! pQߍO0 <z< Rq<Q  P2"8 P40D Q<@ M<pW PtP0Z4U QS!3Y 4,"YYe@49pP3j` D H 0$ `aPV<0EI<0,0(CK QdPPS K<@̠0(Z 0(084 Pp `D a;@ ;bP(P !<P`Q <PP<Y <BP<<@ axt0\O-@(`10p: `) \)0 29 20 29 20S 28 2 Rr 82@SVH0ppa 20 2j 000v감 Y3Y#c1 10J(0 #)  P0P:0 "S  "@  "#,0 #(#4 0p W,,,Ġ$ ̠# Ƞ ( "! '$!!,0&"+ (""$* #,/0, #(#4!%)- .0 :O00Pp0 d0@0S 0X 000; Iq00& Z#Z! 0J/S   0۴ 0P00: S /0 p0 R I R/?004 <0 0 U! - dp"}/0SY `0 S00R0J Z zPf/000S ᚴp p▴P P/ppGorr @ cbR Q0P:Q0Q:'@-꤅ @-@@ $ @ ꐅ p@-@P#+`P$ p@J0 0@-$M @@0S 0P000 00 0 p 0S$Ѝ0$Ѝ00TP 0Up 0S0     0&T` O- 0@TM0L3 pP` 0L0 D@ @ (,8p p $00`4P<@ H@P P "  p'gbȌP% 0#  P !@$d(ah  P% l` ca+b(*alb̌` & gx)c: eg` .dH(ଊďeZ,a*aȌ b, 㼋dL+d<.00 0bhc`: \&eb(* a#a` *錈g|(gȌ,igx(ǧi ,00dH+bldY̠eZ&c:. ̠dL0C0.@%01 U@[* 0(b僐 X @0Bt@S~[a{zyxwPutsrqpo'X0PQ* 0UN X !    {     rT    r0P@p0uP@[t@@t@ 1[@t@@A$Ѝ0   r00 0  r0`Fv`00s0W00s0Q ` P0M.XC-Mp`s@P%  nPP 0!0 000 0`r 0@@!! 0 040000 00@PЍЍA-@P` AqP00P 0p0S   L| P00  000 0ZS$1  @p  P l0  P 0 0 04WO-MPp@Pk 0   qR1 岡-@@p^C 㦽`P0I 10 岡 0@0 0D000#!"ιZP@ Ѝ `P0 !  10 岡 0GP 0  00 1@0 P@Ѝ  ЍᄾAA-qPQ A @pq  qQ Aq⁀``X  0!0 0E Bq0 @r0 r R  Br `` PPV0P00 0 0 00 0QoO-- `10C0s00C 0x P0 0RpW 0 10C0s0R p $W`0 R  `p` 0R ` xP ` C-@P`Qp$M 00 WW 0GS ( S񏐛ySuP0GS&00$Ѝ( ?   0=pY 0S !0!0  PH W W W(0XW p W  P- H⨀Hx弁HW$ WA,0p110C0s RBk  x1p崀_ P,0p1! B r RJ  Z1p ? P弁pP 0 00 P(0r00㸁(0p= `P 2 00$Ѝ0SH 0SE  0X@弁9W` w 0긁0(0弁⼁(01ḁ0C0s0xXZW( p W  FPtHxH꼁, 1 5Pd 0WS<qW0G 弁,p 1 PK 1ᴀX0C0xs0XX0H1崀ሀ!0  1 P) pp 0Cs 0 각 0H⨀Hx0!1 p崀 c Pp@-@`PP $0 00(0`00Q(0pO-@M,0 01 pP@ Ap@D@t@T/ `@r`T PuP  P] 0Ds0P @ 00!01P0 @  0V PFuP 0e0P0p 0Ѝ " VR ! B r R p 0 `ЍpQ PP P  ἀ @P  㼁0S0  뼁0@S\ 0H 1'pP 1 X0C0s00CR  r DQ  " ZQ` P] !@ B  B  `PM | Q0S0 F@UTe kQ 0R? `0E 1pP pa P1 0p1pP01L P Y @T *p = pA p`M  p3G .`:p ' A1@D@@Dt@ vP@! @1 0P P`F!@Dt@V@ `F!c000/Y @-@P L  0 0@ (# 0"$5O- t2 (P0Mp$@ \0` 0 @,2  p@@`P0 \ %g#" ," , 10&&e!"e+" 0 10`0 0p1@0 `` pP  0 0 0`.0A1. @Z98#$5#l  00# 0% b!00#b! @00 0 P 0P`0 `0 0p0p Ѝ4/B3iA-pP@ $Q`?PU(8 "0(0 0`0$0d0=  03? R0h " 08R(@R )P@ b"8 ")P8 b" 0A-1?`P@p @f(XR @ 0刁$0@pG0( $0p. ?WH@`G?`@`(`0@ @T 0 0$ < T 0$ ?pW ( 0$ qp0 p$0?W@`G?`@`` 0$ <@@ T 0$ v 0$ q0 0$ `R @-/ E@-@P P Ό 0 0@ (?" 0"0#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,`@ 0$P0#0p`+p ?(P)1 ` =<;:9876543210/.6P ڌ6P 0P#0Ġp 00rP0?CP 0P 0# 0 0|p dЍ0 0  +0#0 0bp P4 0 # 0# ,0#0Ġ 00P 0# 0#0Ġ0Ġ0Ġ~0Ġ hণ F0# E0# D0# C0# B0# 0#f3Pl @0 00@43p0Y <0#d G0#_ P@0 0P0@4p[  ? 9 *0#D )0#? (0#: &0#0Ġc 0#+ %0#&0R 048 0 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0# 0#0P0 0# 0#0ѢP  0#00040 0# 0# 0#0Ġz0Ġud 0#`0ĠjP0Ġeh% i##"""JP!0G-` Mp@  000 0ЬVJ QP0S クPPL W`A 0S7 vP= Tp8 T 0S: jP8 @V (! 0S01P0PW 10 T @0@0  ㅬ Ѝ WPTU U @ U U X00YY ol @h= HD= ,= = < < p@-e0@T 03/@ThdPP d00@T 03/@T\IpUH00@T 03/@T$(p; ; ; l; p; (; 0@-\@M@P Ѝ0P  0P pЍ0O-pPR M ഁУ@  `880 S" 0SJ: I 0 Z  0080 S 0Q>0 3 0 0 Ѝ 2  0 0 2 08 @@ @ Ѝ  P00 0 00 0 tP00 ЍȯP   P  000@-0 P R@MPQ   0 13/Ѝ0s?0r? 9P100@-@P0U1!^ 0C BS \ L0D0p@-P`V@1@!T 0N B@n\pSVpG-`P @P0Sp:ؑI Y `1`! | O PU p @P1pP pPO--Mq 0:P pG 0& PU  @P 0U`1`!000  0 7X0 PU0  ЍЍ0A- P@h P 0 a`F \ P@D pV: P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:_080pO-Ÿ2 0|M@R0t00P`\ 00S80S `h"`2 0 t0 30|Ѝ4P  P8 p0\ 14p0p2`0$  8 0 0 `[9 P%8pW= ` ;1!040 4PU 08  R88P@PX`0 A@8 12480Q8p :70 S 108Pح,P8 ራP 8 ` 0`P 8p0008P幭 P8pm 0`0h`e꠆ P 4l. O--ɟ M @pD$\  0{ `Vu 0H"4SkSi90Vm ,0:0l`000P.  ]00\ Sx S`PI \0P 0  0CX 0 !>01H0(0 p0S(00S0!Q0:X Z c/ \@ c/<0p 0S 0 Z00 0p 0SZ0Sr00H2S708 R,0:' 4P0P\ R,0(P,4`0( Ც@ 0  p (`V 0` 6(7(0w_V704`8X00 S  0 \ V Y P! P P X V0"2 R8\((\ :P00S 8Q 4Y. @ [`@' X`D 0SV 0 PZ【NX 0SQc/ 0 0 0SP ZB !SR@T 0S $0S  !0 0S 0@T `4  P!SR @T 0S?00Z【 c/ \C!SRr@T f R 00}"00$3 0 2 30 ߍ  p 8Qf!SR@T =0SU00Z【 c/\p0@ sy?0 S c`aP((\X` `0իR48 0\R408  \P0` @ C@!SRG@Tf `aX P2 `0 R(S VPR V`Pa `8@40卫 !SR0@T 0S00RP!SRf @ f@ `` 0PP ` t8@P@0@ Xv x@ @@ !SR @T k0S@ ă , 4 * 4* } @& $ 0@-Pd@$M@`@ 080040 00000_0@$Ѝ0# O-``ßp MWA5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @0@"2 0 0 30ЍhTŸ <AЍOUT 04S:`X ~> P Pp`     `X  TpK`PYH  T  QX ( Q  ` T 04S`XA @p~ _X` `H`pp`@ T W`@Z~~ @-@0V@p Y ! 1Y@pU VYp:q?oT20S@` Pc0~ 0 ^(y ,l l Hx x 8k S@P  !02300  <P0Ѝ00T0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ00- MD ЍCH-M  0Ѝ- 0 0 0 M8 ЍT[ R q P 0S/ /@-0 00@0S 0  R 0  00c0      0R0K!0 P @P 80 0 $0s0 Z @-@`p`pPM p֓P0:*C/o" R; 0  S  L 80(0P  Ѝ ; 0ЍY @-"2 0lM0d000RP@ C 00  "2 0 d0 30lЍ 0`0S p0Pq L"L p PR00 ppMPP0000S!$p@ Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 +{ {*{ 00{t 0SP ` 0j ppp  00 pHhP  Y X X p@-@0MP200Ta9V( ?0T!R O⃜0T!R10`$ 00UTX!\!R Ѝp@ \!00Ѝp@00UX\! X\!0 000S/T tp@-0 00PUp@000TQU0` TQUP ֛pX1P0X1؜0T0`X1T th0h 000S/@-@0⻛0X10CSX1 @ⲛT1O0@⫛ T t0 000S/gS t0 000S/p@-P@0⒛U0 \AQ\ X10CSX1 p@ₛ`啜0T1Oۛ0p@wS t-X X0 04M 0,008 00 0 ,0 304Ѝ1R R  t,@O-MHP@Q@0@U P0 `8 `pVP0STA 0ST@!0 0 $0 305,Ѝ 7 @`1( s0@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@5ݱ: $: d`9 O-p`M@ P-TP +T@`00T W Xp p 0 0  ?0X 0j 0   P @p P 6 Q P  S  R-!P 00Bs ^a0BSW0BA0BS(70BU%| X[  Q P  S  R!"00"00 0S \0F0 0 Ѝ@`p00XS00 C R@0 p`0 A BRWvp pup@-BR"^< p@0007@P0T0Pp 6 p@-BR"^p@$@Pm0T0PpA-@P`aUT0p  R *$P @QpR JT@p@@Bp>@0 000/4 0</0 000/4 0</0 000 /H4 0< /0 000/4 0</0 000/3 0</0 000/|3 0</0 000/83 0</0 000 /2 0< /0 000 /2 0< /0 000@/l2 0<@/0 000/(2 0</0 000 /1 0< /0 000/1 0</0 000/d1 0</ @/ /H-M 0ЍA-`pP@(# W@@@@-@M/" R Ϡ?#0! P O, P!Ѝ  0S RP/0?c0 3??oP/G-QP` pS Wb PRSW Pi 0Ct ?oo0CS00c<@SÁW B  sS& o?oHX@@ 0h0P<SÁ0Ϡ 00 QX@P0WP@0BW00R( 0b /ob0 5?oo0CsP! X 0h0<SÁW W fo0`05@h>0Q^@<Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /x 0@-@ P  000輡 / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R R  // U /Q R 0 0S00/0 0/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP Q  00S@ 00Q0 /0 U0/Q0@- S Q0CP S  @P 0@ U00Q 0000@-Q @ TS Q@DP  ST P 0 U00Q 00S @Q U //q 0/  // R S 0Q00S0 0/0 0/0 /R  Q 0/0 U0/0 0/0/R  -/@-\00 @@0S0s R S   0 /U/0 0/0 0/R S Q0 S 00 /0 /U/S0 0/R S 0Q00S0 0/0 0/0 //q 0/-Q S Q R  0S 00R 0@-Q S B @Q R0C  SR  @ 0U00@-0 M0| @000!00؅؅00҅ ԅ4 ,0 0 0 30Ѝ! d! 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/$ $0 00S0/ t@-@p@-0@ ,ppP(s0Ppj|j////// //O-qPp@`T4M z10 0 $(, ( 05/4Ѝ0S-    q!Sp0S S9 3S0SQ00 X00Z00q[0 0 \ 00!" R 0S@L RT\00  L00 S00kkjjjjjXjDj///O-˟ MQ 0 x; 00$0h;0 0 0%SS``S; P0p  0GZSZXWUTSRQPMnJ~}|{zyxw?>=<;:9876@43210/.-,+)('&%#") UP.% .|x`\rIRW P 0,p,@``P@^T V Z`4 ^ \ [0ʄS0CP Z0404 R*d 0PCUPE_ [ 00ʄPU*Y00Gp00G S`   0 00Sp0-`p Hp `@T u  0P 0CUP0 `e Ep xp `700 `uG 0SU00@P @UP0Lz 0V O   0pp@ p*W 00G SPpQP00G S+`p 0 pP 0`ppV `pP ` 0,@, `7 0``0` 0u 0SU00P @UPV0LP0/, ` `u1 QU*P @3 000 0 3plWp 5p倐2 0 0u`` 0 @.10d0Q00 S000D0@@CE @B 00<y ` `( 0& 0`uS 0@ 000 !0d00CE @}d< `u ``f P00%0!P%: 0@PJ0 0 i CdT0* 0P0C@C0CE @P Z  04t Zr* 0``[pʅ ^kAQAf [0ࠃʄQ*`AQAU0 [ 00ʄQ*0M` L r 0``0 0|0 Z0J0@"(2 0 0 30Ѝ  b 000?0 ) `0 `l ` `` `P0` @$00> * 0 @p` ` `4 0  @00r   0 0@ p0@@% 000 0 0 @p0F@D  0: 0pPUP 0YT0 0 tߧ $d\ xA-`T0T 0pP@PU J0PES 8/`uX@pW x 0SS S 0R / 0R0@o/ @-oG- @ Mp<čP`0@  0 @0 <4 30*ݍ 08p ` 0pVP t 0h p⪎L+  87P   aG-0S0 S,QU) X&p`@V 0`S  0P0 S@0S 0S0S0S  @P PU@0@\  R!R  R0 R RO-- PAM_uP MUčHd 3 p ԰PE @PU*:0 mP @ V:nn0 @YPqOPL @0 0 4 30Aލ Ѝꫦ|  O-PP AM @ MT0č?2 Y.: px (R`5 Ps0_uPU"UPE/ @V: Nn Jn0  {P PU:t 0  mPP D0 0 4 30Aލ Ѝ x (RPH < O--MMΟl h . 0  @TL 1SI 6 Sg`1  0 $?0X0 00h l3 @0D0 >00S/ SB`vP⨐0pS EP4 p 0O 0P)0S1Ss/P @`TP00ST`0v_Ⲡ0Sqs`V0@  ^  0S< X @, \P Tf0<0080v?@0h0: 8 0T S<0#H 1S0 x00S S00L01< 021l0:ATX0D0Sl00h040800*SAT} H0@P| @0PpPPwz 0;4@ 徥P @0PAP& 8 <0 @8 @ 0 T<0@ 0P  SP  D0S*,0SU < 0 h0 S00D0#*p㐚x`tP6 0  0P4/PYt|*h: 0 6 30ݍЍ0X0 040T0 m pW5 A8@P@0Ppw !~@0Pp/0 = 4`0 @$}P V0 t P> w<0PSP0S  .P@0U  00P`F $0?kE0(0 萰 Pd1 0ူE0( &||PI [0Z  QP `1  0 80 (X0,05&  R ,0~10,0~$0 0 A0 SQ@0b0!0p?A9c!|P 0S @0P 0'0@0'0  (,0P,03 Q#  #64 0 P0`1  0 70X0 ,00 0 0  ,101 0,0`1  0 60X0 ,0p0 O 00 L5xP\0,&0<  X+Q80x00S;0L0@dD4  e <H O-ß BM M`$č@pPP\@e[; 0.[@[VS5.K2o11T. d1 0T 1 #R T4 00iP 00S 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 QGwPN l"PH T4 00a0 D DR000& 000SG .SB T400P`0=S 1SA S5 S6 T000SB 0sK0SP0S e00d1  @@T>00& D DR0 0 ! 00000S0000   R00S0000< !0T40 0P]d00W@;dQ x   p@-@P`vP p@Mp/G-p0xŸ`M P@`#T V k$"!3 0p!100UϿ@0T 0 `Ѝ10 ,00w, 0bV`0 0  0 FcP0swppdmd0SUPP   B R`00 0 BcP SdPdQdJd ⺐H`Ѝ0 `F 0S0 s ;dw8d 9d0s1d0S  0<H0P LЉG-@0`P p%@D T@*) dWpd0`  c c0 ?0@s0?0(pl G-@`P p崒Ḃ E0S@P0WU! c@cP , EGpcE<O-0P䱐 M0S5 @@d@t@`p S S0  YP&  SP0 MPI  FP00^ 0  SR 0  SRS Ѝ%Pd1 00d1 H@$P0 3  P  P060 $P0  P  P090\ 000<i0:0  P  P090090| P010r  P020h  0P0[^ d@ ?R? #  0 2M$ 0P0[C @ ?R? #  0 (32 lP+ @ dP010  ZP010؆L܅ąKdK JJ 1(0ȃ@-@(Mtxt% |Ô0{ D   0  x{ 0tx(Ѝ @-AMT  t0000 00StЍ@@t(0@- 0 A0tMT0l00  s 0P0#0 @ 80 0 l0 30tЍ0@@

V%0VQ\@ 0\!R p Âp p "p O--Px+x; 0_M M050\;@0$0ia0`T 00 m01(0`,4 05@ d!A  d!. 0`11110`P  J0@ʏtz( p d10 d1s4 P- `@ }`0D@SH _j S\  S S00 Q@0S S\ 0CQS0 C0SQ00000`9`P ~/0 8 * 0}0+ 0NP 1#S;S 0(S# 8 R 0(S> 0(S 0(S 8 R 00sS1 S S 0( t8 R1 S S0S 00 S S SS@@ `0 p}_A0P0@@ 0Q"0A'A+S? 7R1 S S00(R00S 0`0 S S00 t@a@0S S 50@ @@@@@00@00807uO 0bA*0HPd4@ R`P 04@ 0R``L 0d!S 00 02d1 A Ap0 |3[1|"rpA τx0`0S [ `0`SH@DH .S0S[ P`.V00K[0S 0 0\ZP L% 00<%004 0 5 30+_ލ Ѝ0, SA T T0 S400: 0弔 ᐪ P$P,p T T@ TT  ;T RP@T \$ ` p ;T 0s000@@T  @P 0 0 P  80  qh1-P! @@T;T 30 0s000@@T;T   nP 8 l! X@ P,ph3 Rw1 S Ss0S] 00 S S SS@@R ``  | _AP@`0D`SH  \R?* S S00 Q`0S00000* }O᳗P.P `Q| 1x#|#DQ aD@`}Qq0 SQ  P 8 -0!! 0 h13?S01S 14l1k 7h!2/R!0R$ l!^  `'M 2 r(^pҖx T S(~~ <+domasearnamesortoption|inPer0{8hy\y xxchluu\u!1 p@-P@hl(M QP T 000(Ѝpp Qx#r cmpV p 0xP00spPT $000(Ѝpx,4sA-P RP0p `V pP0\\C\ `@`@ ꃃ `` O--40OMP}0P:  |0P 0 0@`         SpP zPV" RP0 5 0N/!I`#Ve 0PP zP0S V000 R' 0 I0  @Q1 P`   0`QUI #V  @Y* P   0 ~00 Oߍ ᐪ@ P` 0 0CQ*00 0 S  :C X 0 q:H00ᬠ@ @ p`R    YpG:0p` p` R@ H:T,  pX:  s0H`V  0 M~ :V 0 jB~} 0 v0 &  0 lDv p@-<0< 0@P @FK 0 0_| q @-$0$ 0@P00 00/$q @-@P @ K009|p @-@Pޥ000@- @P  0 p@-@@000M   |PP ϱP 'R0P᭥  0 ЍpᥥЍp  0 Ѝp`p @-d1d0\!\Q Pp 0 RpGS`M, `Pep5 Ѝ  NyP! 0 HyP 0S@ R :yP@  0 `(Ѝ|| | 0 ЍXX X 0 ` HAk@jj@Pjj@`j0p@-0PMU# 0U#0PUP!@@``FL|P $D|P `$0!E1(`P 0Ѝp2P\''  O-Ff@0`S M, 0 4 & $0( |V|FP@RB 1ȖqYT0i(1<0 BRO#)16:  50(< ܅ 1 c0Aş0 p('(p4 < P 0(0 PR hup40SgX% 1S H 40SkH6S (% 4 0Sup00S S404 RR 4 w,00,000Sğ0( 0 0X B2*3Q Pq Q^P( 0D$ Rp (40$1%40(8(LiP0440^# 0(p Ѝ! qQ 0Q*# 0$|3p040(P8p!@(%01Rx$#30<!^ ^ ഇrp S:p 0("< !0(0% P\4+|20(  l20(<  X20(<  D20(< 020(< 20(0 208(  0聟0(0( 10( 긁(0(10( Q   x1x00d10cp (4p Ѝ:p P5p 0s^$psp_4  Z 00K }p%L Phidi  h ,h    hg@ \g  f < (f  e@  0#0 $0T` #$ 0$`1,hC@ 01$000b`,0v,0 PY `F `$0 0,P (JvP 0SJ P( 01 (0juPP$ 0`,P1 0,P$`1~PVy @` P $m0b$0`( 0$`1j(,@@ P $vP, 0` 1R(0 `;1!0<0 ^ςS0}00@ P +.000@P$! /1:^0   ^00 pp<^t ftfl,f(f^ Pe|(l@| |`TP<xlP,<\4\\[\\\l[@-@P200Q  P   $00<0 0@ ($ xp@-l@@`VpPPpR0U1pPE1PSp ( 0$ 0pQA-pA@PT`QV0Vt@P 0 pPP``p`(`,`0@YA-p`@9tPP T  0 000P   XX@-@@0/R 00(/000/004/00/00/$R 00(/000/008/008/xA-x``PU pqW@Pv404 0 ,(0`lQ s-u v/-< <0  M00( $ w ЍQ 0#4W@-@N0`00@Q@-@Q 00 2 * 0 G-H`P@pM[ 0㙫p TW 00K 0 000 00- 000 0$00vPP: 0 2  <R 2"  "V &= " 2I 0  0 qppn W* W+ 000@WV dP@Ѝ00@T0-00,PP 02 2 2: 2 (fP)0? 2< 2D10 04100(10 0 10 0100100100P 0 R00   0XT 0 2  13/pm0SW 2: 2l 'P 2 @0 2@001P,00p <@p0SC-@`pQP M 00EPEUC\A@E=2 2 X 0 R0S 2 +13/PP"?o2R03S HHPA (0$( p 2P 500 Ѝ(0 $XP ЍP00 Ѝ(0" $X000X "X00"?o213/pP  Ѝ@-@`pQP M 00U,0`V( 2S * 2 P13/PPF `P 0 p~ 2P 00 Ѝ ` Ѝ0P0PC-1pPS M-:b V%*AYp 凛pY 0 S P Ѝ 0 H P`V: ЍsP `W 2< 2 ЍO--rMWb9*0P:A̱Fp V [KDr@P+ Á @1@DT0 @ 2< 2Ѝ0 @D* @ P0pSЍ0 P ЍC-"1`S M2:rWB R"*T$* RU  R00U00SR u0  PpX U"B Ѝ 2< 2 ЍsrP"! ЍG-rW" RbM"*R* 0 @0\ U@D0 { PpY  U 2< 2Ѝ"ЍЍG-邀഑@ 0`P9  Ip\1v`wV0`F1v` 0 \ 01^` |0N 0 L|\ L|0S00s060 R2N0C2p0@- M@W0P  PP   Ѝ0Pp@-P`@Q 00T T 0@0p0Q 2S@3:A@P p(0 2S $A@P$00C$0@ 2:0 2pC-P`@Q4M 00 Vu 2+ R2 13/p) 0 0! 2$  00 2 p`0 9/0P 0 9/0P  Ja0P 4Ѝs$  0qp 0 喙P 2: 24Ѝ?p`(0 0,9/0P 0 ,0S0S Q #$ 000#$ P0A 0S 0Cs0 Cr  0 Ѝ ,  0#, ##$ QA A0Ah@0@c@0@hO 0 1Sp@-@M PmaP8 \,0YP8ЍpoЍp/G-@B@M@Mȍ qŸY w@`P_ 1 R2X<0*%@R[ZZP ? B2< b5<R P0ipF YPhX!8 0 2 K؍ЍU9P`J8 ᤫ8000S "! !.<L0L.8.0LL\ Z0J  CQ"$ C|[pp곣@0⭣@0O 0 8Ԍ  tAO- P `l@P H1嫲p0q1 G JC  0000N`ⴜAO-40@S M0S0040000 P`D 0$p`B17v0C1f0V0N P V NW 0 ^V!B! 0SP|  R 0S  p`s"`fRΌ 0!2!$0 Q0A$0U @ UY  QRQ2QqpeWa 0 NP 00000 pBA0 ЍVD $ U D L @ppB W PUgp1 PD D00CD0 0 10CR= 0 B Qs "00lRwp31pwpP!@ A 0$ 10C0S  0"fSPW1 i] 0 Ѝ RpP0Sʅ `P1D p W D wpPU PH D p BD 01 $1 1 =X<H<8<O-P@`Q M%0᳀Xp0\[@0TᏢ P> @Q 0SQ} 0P @P0S 0P%@P 0S0 0000SU 0 QP 00080080ЍOЍ 00008(840PЍ0000PA qC 0 0@q  0 ᳀0 00pG0 0p0@ 0kPP p@- @`t051@0JJ@0D @$ AR3@D$0@N0!PR T00t 2@@lRDAp@2 O-0- `ş\MV@ `Pġ0P 0Y 0 ἡ P$ Q v`0 000 00p0S,`G80 @:`[ { J [ `00K00Ჰᴠ000 R@ڴ R2 J 卜0 FP { 0@0<80 :y洠 0B,`s0, 0 A0 0 p000$ 000\Ѝ 0,``$04@At@Q 0$0(00`0000CSv@@ᴰ[ pW(swpQb@@QDQH ZPu   0  w000@t@Q@00 pW80S BAD  @ 0 S0QDQ $0P0> 0 0 0? 000  0 6  01Q00S 00(0H00 0 00PL0S0 H0X0 P0S(0 `00n 0F40A0A,s0@TL000`( 0ዠ0P(0 p`W 00wpS 0,p}(000040C(04,p00B00S$p(04000p,07 O-\\p0@S`P @L$P k jP' Y  0z S40  0(10S0 1$10$10 0S0)P 0 P0S 0P  00S 1$10$100O-@P M BXp0rQ `pV`!0 0Csp ௻0 p r Gp p 0LPPHq X]0p00Qd Q 1 !r[ `ರ K{ pG~0㲰F0F000 Bೀ0@ര0@000  BrW. `0P1! 0{ \@x HxR0 pWq0s00Hೀ0@0ഀ0 00000 Ѝ0@000``Fv`qQ 0 Cp Ѝ` PP 0@000 @pA-p`P@0R"  0S00 07U@ 2T8 P0X BPR RQ 0R0Ӳ00 00R00Ats0 0r0 B 0000UU800C80O- @T @P@D(0t@S(,W K0PPI# ОP @T @(0@Dt@T `pV T`  0 'P``p@-P@ 0^\ ^ P0Qᒞ Pp\ p pG-@` 0PS 0S  0Qq@PS#  00S p\= 0 BS5 P@ 0 \UP   00(!S%$! $! 1Q0 @P @0弐p 0p 0 S 10 B\r ἐP  $10$1 !( 0 O-\0@0C@LS`Pp M P ^i &hP& 0 0  _P 0z S0  Ѝ0 0S0НP 0 0P000@- M@ P p10 Ѝ0O-M 0`p  0@DHPpB ᭘ P. X  z0ᐪ ⌰ ⻰r ^Რ N|ᾠര0 `p0`000S XЍ 0 ^P  Cr 0C 0@00P @G-plŸw?`0 (MR$@p_2 S?:0JS< "P| P崀2 Sk1L PU: C rX0: L|0∀1  pȸ 20  2T!L1 0 $0 30J (Ѝ P? ZP崀 Z 00C @ 1x .p# 000 p  ` 00 pP202 p C~o n A-@pPQ` M 000 2   Q a:1QI0" B!2!0 0 VJ XGFZCBH@0PU; "R!* 2 13/pX "P* 2<00@0 PFP: 2 J0 EP VP V$P "0* "  Ѝ 0 Ѝ0PU "R:(0 $P0PUP`" +eP  x ЍfP 21 m^g@--M0 @ 0 0lVh hP 0PSP000S 3/[ TVW@hj 8 80 $0Q/ $0S/ i D <<0 0R/$ 0S/x i L A-@T 0Sp`/XP0P@Q0@ @@e^P 0A/P%A-`MPx1hqA jp01A,4QSX 0 0 0UpL偢BS b0CS<S9ꬆ((̆(((((؆(((((  K(00000 00 00,40000000k00} dЍ 0 0 0 0 0 ؟0KP\q h,4%ċ%(%6%O-@PMp`g3#gp#3H RPGPP/ H@ Pꄉ@@@@@@@ PXP f@QQD@@@@@@@@@@0!C!-\\ R0C0`20pW WT Z( Y 4塡PPPXPrPT! h`P   PPc 0+0V!YqPPp9Vp`@ tr% B Rꤊp@@hhZ V  X ˆ 7/ P  R I $ f  1 $ f  t1YnP0S @"-aq T$,ċ%%P?O~YO-`(IwMpP܇f`` `` hp8pGW( 0RZ S 0 0 vPePRP&GP$f0@SꐍH0@ STdt|aP ` ` `` ` ` `$(,S4 0S000 0S000-tT0~TpG4yT` '4 P C`P/V  00010S U0S0000 C C0S S/R LUp}0Se (&t Um0: S (00/V%*00pJ`V  bPpR cPP0S6 0|P0@ /Q50CS\p8pp8pp8 $e 0 0`0SE 00   B R\ L Q,Q p / 0 pPpGp` 0 o Pp K/R  S/R/    C  R:  4H#   30SS/Q$ 0S% iT0sX. @D!R\0PT!R\ `/0X00: S  !CC7T0: S H1: S v : S  Sy  Sq ᱞP9 `6 Sf S0 L0S !(0尵0 [ </  ['8Ÿ0 S802",Q SP,0!SQ  `H1: S 00[0S 80d!0CS80d1d!dPQ X0R ,/0S !0S ! ^W(0S0S 0 Sp!˞0: S0 W d%qq ċ%~t$ |$ Y~<^%b6 |!j?,OG-@Pr\+dH&}fp@<6Ⱥźºx~@P5 Th d@0S\cT2S  D\00$CP@T #0p/S[/ P 0 S:  I(`p ' P`q &ċ%A-`P@M\~ D 4 0W SLP  K ILP  uK ?LP  kK 5LP  aKPl峺h3P0`3P P$PD3( 0P+( P3( P7( ݷP;( ׷P?P ( PϷP( ɷP [P8$@Ѝ(P (⻷PT"q(0S (⬷P(0S (⢷P(0S (☷P(0S (⎷Pq0S FJP_!0S0S cp X&`PPa D1R`*PU 0E /R XP(PU  00,0/00?00CS̵P0$0u00S p劖k0s00 lc'%Pc'pY$Q͝ax&ж&;A-@P<}[`p E^p 00S VPOLP PP ``P $m 0@GVq Dċ%(%Б%O-`pFMP᜖|[` ` ^p p6 HX.0S ЍfP WP! PP p `RP dP vP iP0p0 `rPxPpp0p0 p$p q:X 1S ᦸVDdeddPU JP$0 S<500S5->*@X*/Q /P.QQ .QQ[J&  Q00@  0P0SP$0`S0S@ pP PP0S n50C SWT 0$S P [ %00 $ [ 0(?0S $ ?RR00R0SV1 $0SX  P 0 0C0 =IP 0S 0S {=0S 5S 0S 0SIP 00 0 0hzX  PsHCP k0S k0Sd g0?S` c0STS Z r%000: S Re%  S/o" R 0: SCHP 0S  P SH 0STIP 0S 0?S 0Sd'(q ċ%O)~(Y)G-P@G{DZ`8q O\p 10S PAq@P eTpP vP0`lHP<P0S V / <P 0S 0S0P KHP <00S q ċ%d'Op@-PMg 7 $ 0[GGPG@HUHTD qGP00CYIP30 0P 30S S! S  3H \3! d3 00L30S  R ,#6 R #!SR3*I 3 2 LT20S (P+ 2 20S 0S'002@T$#NP0"+@0**xB00CS00 dI 0 < FI0S60016 R0S 10S<*M0PR<+0 01 10SO 10SK(*p1\1PML10S H10S d1 X1 0S })160S 0tIH@1 &H0 1xS(*=0L0S0F0S 00)s0SL0S 00?)@`|P@eETochk'q @$e'e'n'e'e'e'3*6@$$@@q'$te')@D*G-@MP ymX2br@@0 S l 6X "ZpD 0 L1 0壵P8| GPh;dx GPP;L8 GP8 ;T< 0DS 00S8 @0xL[0QaD0@0 0Q)@0SZ L PU〒a0@S񟗶PX@ꀁEP `h@@LX dZP MXP ZP 0@0 00 LQLQ0@0 00 0 PLX|"]D0S hx GPT:-Rq ȋ%ċ%=YCYIYBt @SYht@^Yt@iYP%tYzY,O_VgtY@-xHERO-Mpx Wm@0o0C?o`S20#3ܓ @@@Wp#33 X XT 0S9 Z`7 [``3 dǑRPGPP I]H@ PD`hP vP  fP@``k0T 0080 S1 : )P @E] A0S #S<]  `PM 0p#?. t0P0 pp0hp ]Fp U0S40 080050C SC4|P0S v@P0S/ * $Vp !0 3/P00S }9 $V t!p[h0X0 0S oQq |s'(Z4$,ċ%0ZPOs'?Y~xO-MMM`34Jp^5 00 5=5005 9p 00%P \ PY P㴙yO `P \PQ|㦐A@6P񟗳PPP PPl`\PPPPPPPPPPPPPPPPPP8@PPTPP\htPPP|PP0USxP OXpQ PQH 0(<ȟS SS{ (M055050050505 P ߼P2\ M\ p0"S d p ꛿0"S  p0"S P 0!p&]0050 00001 00 00m0k0i  ^@ ^  ^ QS00 00055X -coOU5SPP5`FV5S UU0U%0;spPl%5S 8DP@0: S055PEU`DL V05_V!cӲ4P$040Pp7zPP "Cd$iBXh%hiv{\D00 0$00( 0BPP#2 (B,CB(C=C喲Pc`0 0S #P奎p@Td꨾0#S (iB7Cs0E?o2? (VBX<tQPPd7f/3h_{X bPPC`P00CS0 >{P Pp PNU0 P00CS0){0 Veb0S:00S:0uf1V51Sb1S(1S k\/]Pdh!iBg%piV|QP 4i^P,0V0< bP(x0`FV} 妎P  f/崶0 ᠽT  N\PIbs'=kl^k,Ekkk$ldkVkgkkkT$ċ%\u'͝6loaO s'Б%Cl1k\Jl Ql(%mdkhs'PC-ʂi 0P !@㐐`p@XPO Pl`00CS`0 P@T ЍX0 X @lꐙ'Б%z?O-P`@dMu$P(P,P0P4P P  Up4pK[lTT1Z03rTdT00 07Ap0-t$tčSPPP@S$$$$a0@Sl3P0 0dT5 RT ST# QT040  儍pT[ S0lT[ 0 0l  $2H$ fBp8 dЍ $$$ XBpb 88 KBp( 8⏼ 8U  H[K ,O@P`p xv `[X\@T8 "BpD]<@[<P,",$!$ %"0p"P22U!  "P Q !=0P 0[`&e?Y@|NtN Q2w08$hH8 pP0 @,U TS TlQ` V8 20P 0P<@P0 P D%H@  Oꛁċ%<,ӂ~DD{D΁ہ|D(!}D2@M`OKyaratcid%0O-XO-222422223220p _aM 000 UTpr>`PpG PC 42"S 200002^S R2SW10 dbV% ``L0np LNpP  ``L0appd2S P@PX0: S0d2232` 3`Sd2S|}0 t=ڇPp0SP L 03PE/PF1@PCx9P<hhhhhhhhhhhhhhhhhhhhhhhhhhX(hhhhh hhhhhtXdhhA@9Pl007000`컟 ,b,,000S0?# ㌋0d204202020202 @d[dk @EMTaߍ0220202;/`P000S Plp, 00[ / `P000S >lp 00V /کP000S ,lp 0 004*2j000 0B BP 000S 3 S;3Ť)00i 0 P 000SX"\2RRX2Xi/ ᓩP P?PX0: S00y `P O/~P 0  >P؊f=>`P63VI>J?p X:{\10a [xt*>[` H3!14@(S8>̲03%703 7廊pm7037 P ʴ0 S 0R& 2S# 2St 0sd =pD2P0 P$5 f/塲H7w0L7TP'\?S@<"820,"(2 jPPO0 0  RZ$ LP$ `S,d2S+ ?pX2=00RX!\1 \1X! 0 \gj02T7,2P7p]2%>pV%Q=p` H2]=`P%:kP mDi$yRБ%'ڳ1 SR Q  RQ!R!RS !14!8!04P)`CQښ. .a0C 2 0⬅',ċ%edA"^Oب%('۪ '2W$q '6M{u(I0'zd@'ZxǫO-`@p̑́Q lMp%W㬑 0S 0S p1`VA åP `徥0S H帥@`V-Z ЍyPmPPP fP Lvn0@ S<P$ 0 0000000000păW 0P -vPvP 8XM,'Vċ%oO- 5 %$MpP 9P!!9`>80DĴĄĤ00``` Lp6Y00S 0S 0S l``4pWQ* 0S00%P ( 0S 00W30S$ЍzPOPBP4 FPt P@*Pllllll$llllllll,|0lLllllllXlllllll0000P02 P20v00b 0 t+Fj0 0 P0 0^ d P0 0U 0c@VPN,I000E00B00?0 m?1 >0S 00000'000#00 00000000000000 ` `0S<5_P`  0Y0S 0 0P J,HPpG 00XR7X''k,X'ċ%o'dk02b$$8KO--MP0zj,_H H PUPEǰ-vPlP*HP6 TP8 N8px@|p `,  Jrqp@p!0S  4 40@Zpx tem@ P( 0h`("?Kp2 R Y R !$ Q P$  R  0*8P8j -RH 00@00 00 p0@P@Ѝ0 0y ,@,?0,0P 0000R0S f```07pZ0S{0S ~ 00 0@xp` @@@ @P Pn  03/p T U%ċ%d\,G$@-(@(@'',$lO-P8M -pF,8 0f`^ p p 㕂6 Rl,0 P8 /P0T 4P0\808fpHP,,F U86W`E`hC0IPHPU0 BJp0(5O005SO /5,* 0(0,00(00 0GPl1PPP%P5tPzS `SNSM *AS> CSP 0Xp0j-aC Q @ WSL4$  8$ ,4RD +K L J ~O c{05xN 0Vt 3M pH n$0%0!0 0 c  $0@S. p㲁I (3V``R zS NkS CS BSHLS aSDcBl0CS>D  D b+b)Zim3PeH0SbI0S_O005S& L#P" T( ApH (0S  0C#P @P!#@p``Jp! P! P|! 0S1`!3/ 0ot@ P`/1PP0A@&1P414!4=7 HR #_0 pt)#7 P 0 %700 0S0 pVX$'%0`%0'$0x%ċ%+,0H%0$%0%01'2(#171*)S1 /#]*i^1n1iui 1m@-MP 彀@/ X'<p@-D@DP @( p@`'%p@-D@DP@( p@|'%T A-|@|p `(P,0`8P@@@4,A'%P<G-`M^4P(_yP(4P0 p) P4T4@P D4@28ŸP8"0 0200@ 5 Hp HQ (4P ( @  p1a 00 @ p0 @ t080<0@0D00P0 0 080$@P  803 HL@P@T@X@\@HP H{P3N3L3 0400,0@@,0( 00PpEPPUPh0PP 0/`Ѝ?(?e>??????-%+x+**'O-`-Ph6MddF(`0  nGp<6X0K (V0Sv`@@0V}P 0SЍuPfPFP RPh g@P,P000P0 D90#S 3P00 $^($00S  $R($00S f`P 0#S (P $7($0(0Sw P $+($0(0Sk 0fP ᕫP@q @q @ i@` @epKWwQ2@23@0 RH0cS pS: bSAJJK[0 0\Z9W W, 88 0,3/8 RfV f@2Xi C2P!0 0C?oR20S` htZ|WJ% `z~00 0 00 00$,0 $00S WZ 0 %0S0:10Sy1 0S  0P0 0  Q00s  `1000L,0 0X282PX& S R 0@0@0 #  R S 1P(00s  1pp&2X 1 0!21A,ċ%'OAA`AsA%AAA&BP%B9BO-P@p'M Mfট$PP Ep6 @DT T/ TX 唶x`PK'ݍ ЍAP? a@PP񟗡H05P50S $PW }e `pP%000P00` P LP < P P  P  P P( C}- q;qPq/?}00 000#0 00$00 0P@i(uPPLdD%}(00 P(X@SW  2 P qP( !jP( (m~x@P` Tᘩ0P` 0(Ȑ⨀ qpP 00 00$0 00p@P Yx@P  (x@PQx@P x@P `hP cP ^P !g`LVP X  P( (`m` pP( !qp@PP WD Pa>/pp+ 0S > +4 /yPm``ڧ 0V@ r0 0/pp` `  F1P/0S` 00 000$000 e( .1p//ឧ0Pa0SJ+S'- 29S!S 1aV`BFċ%NF',F6M{uFO "cG,GNG`Izd@edAp@-P@b' p@-P@b p@-P@b$ @- p@-P@b p@-P@bp@p@-P@bp@0O-nMM800䮟p4`TWPI 00 >R㸎0 00>^(00㠞$000 Cp@:x>P10?0S@>D$RP$r R  $t Ӫ<4tA؀ @0<4x00<$ 0/p0 {P  Pp`FB@D4TF@#|#|#|#(#|#4#|#|#|#|###|#|#|#$`$|#p$|#|#|#)|#|#|#|#|#|#$$|# %@%t%%<&p&|#|#|#&& '''|#(|#H((00@ۧP d< $wҧPr Ltt  0< j <$$r $b@<ἧP ;$0 00 0 <L0(00 0,z;0@= z \;$50 00 0 c(;(0!00 X 0 V: 0(00 ( 0*I:$0!00 0 <:(0!00 0 /X:,0(00 0 "$:0:0S .P0 0H: 000 0  !00 0 :0!00 0 :0!00 0 (940c 00 0 (: 0!00 P 0 88괸@0S 0 mP7zm}ئP0@4v ѦP@p 8(z ŦHPD40 彦PD40D4Y  8#0P(0O \800 1 D1 z48C?  /P0 067000 r* G: PuP/ pP y0S 0T4000$0 <4 L!H\;9PFU [U  z0LVp0`R 4S<4[0 H$L40Y.p`r@?HL480S $I?I5HLY  $?᳤ 5YHL0(4SH$L4R0 &,p`  J.p  4S@ FmP ?Iyk uP `; u`Pd%d$.p X1: SD : $R,@P  4qP   ƠP [Z3$R  $z?0$@0:!p!$4p = ,0姠P,0 r0 4P ⓥP$$<03}p4p40S0X44SH0S4x2S, "20# pPr 0T40S ePp*0ST4S x3H#t lTP `3 `s'x2S 2H$L4P*px0 $L4H1#"0+dpL2 C  yx$0+ pĮt   >P X 㟧L$H4#"0$R 0:0_Y }p@$ P& 0d!8>0]RϓP8.X Q(041$4+T4S# < 3,d00"8:+***T}+\4$H1H4L1x0<$|0@ 0D+p^\⽣P Z > ⽞PⱣPJ  <Ξp  T< : <.00 <O--0p PDMM⼓c4, >pP^3`4pGs04WY `  XaL 4S<44S $$4R0#*p @ `+p : 4S P,0S pdq''cc d%dnd0*00 +0 0*00 +0~0!00  0r0c 00 0 f10!00 8 0Y,00 1hO410(40Ssu;!CqP!ju`V*p 4S (PP!$m0P0!   $(@P<2(0(p00S0 Z <00&p$T"x$` =0P0 r04СP ʡP"0u3m`$`4S80S4 1S !10 #4 0SDj⨡P T3P#X\cUf000  $$!0#`p3   t0 $ rWpԑ> 7P ` 4 t$$嗃r'4S 006?X  8 $tR $4&S 4%ΠX0; 4 44 X  0'p0tX㲠X0:S Q4S  0 ᷟ  '0Z00S 'z4 $!࢟㇠X0⫱〠X0+O-GM MPh ⌣똔D嘤 .<p40PEPEUa&@@5P@(?4@@@(?(?T@(?(?d@(?(?@(?(@@(?(?(?@,B(?(?(?(?(?(?(?(?(?(?(?(?@@@(?A0A(? PP00S0@S p0K 0!; 000, 0! 0 000P1 P00S s  nY <01 ,+d +P 0: 0 @>!.v8`X2[ `2`2VȌ0 V00̌ ň p+< 0 3P< t q 0@ @ 2 0@TePg 0C Sd0400000,00(00$00 0000000000 000000l0 0|0` RB @@2뤃夓VB b2xs8;p 00 L0`%p/8; 00 L0R%p$!8; 00 L0D%p`8; 00 @L06%p 0  | x+ y+ z+d+{+ + + ; '0cy;0z;(0x;`+  @Ř` L0 %P8q;"0#10@00 0pKpQHE  p   p 0$PLK0S `` K0$P? 0  00 6$P 2d F0 441868v``0 D$P`d6d&d$lh!2`(10kkkk,a0a4aV 0P````娐O+V<;SV$>@ )tz{  A 7䛟:S}$@ tVz{  A 7I:`"2RifT' 9*{ @p30S 0 ,' )*@MHIN2 X0弅"pX00 Ϗ@+X@0V0 00 D\1@0`" *00S O ` 02$P$Gy82AQJq $`,okfik{{'8Nj@A@G)@8HIN3,V ({*X"P"+U8 ̞0S4 Q+@>0x`T0T00`0p+t"pP 0S <+S#t;@000!R<  W0 0 $+|E 0d2"SS 0  -C6?8~A$@@@h()(%@)`)ڋH)%&(%!G@ 1PS! 2R``@pv)V\\0!Ld0 0 d20 !  ,  `0[)0hl0V)?ph){{7{{{3{{ {  M@ @))*3`f03 0h 0S h`h2d0h220Wp |E)@0 0H 0 0-2 0BS* (S2; , 0P;&0pV*42(!00ss0S 0 0@ s0r 0 0 *1币;    0;/ 0W |D(@0 0H 0 0,p0Y 0(1 JDfP@0<0SRW  )0 0RZW |D(@0 0H 0 0, 0 H0D p/lph0Zp/ / (%Kƌv@)(%)BO10CSYZZ]]D[[[[\@\d\\\\\0 +P Q:YZZ$Z,ZDZLZTZ\ZdZlZtZ|ZZZZW/ )p`|(E/|x0 +PL X0 +PC Q[ [([0[/5(/0 +P$ '' .0 ~+P .0 t+Px 0 k+P Q Q @<x8v0 Y+P ~0 O+P 0 F+P 0 =+P 0 4+P 0 ++Px 0 "+P T0 +P 0. `` ')p0Sw ESm S W |=CA'@0 0H 0 0@+p`.>Mj͍,BYizo6XЏ DN^rߐƐ)ՐԐڐS<0KX0C W [B0C<0<00C <0H|. 0D0H^'D0X0  <0K+0C;#<0 D01(D0 <0 RKX0CWD0* +X  $[dPWD0 D<0-<0 \帋]W(t-p 0D0H'D0X0 D0'D0-W-(O-M`PsG@0P-S@ዘP0 @04 $t3p$+4QP a`F0pP[N-PijQLpGK PL v1 kUP@ X3\C d@P abbbbbbb@bbbbbabbbb(bb0bb8bL@0Sd* @HGG 0ݖ 0p+ +Y  `ckZ'd`PHx!P`4b2 R '1 @10 S 1 1U+ 0 ,1!u10!00o1Xk{xuro lp8 0}p0S X@` kp0SWu@Z0p   0 0j Vpۗ`<*?ċ%O6/:HUgq Sz^‘O-PAM Mʮ)@`눧P |Pt7tW00-S% ,P ,Pj @ p H PZ .`F0S0 ` @DDA@Dv ^2p ,0Stb@qQ 61 Ql ǕE,P -00 *`@Z-00  D0B5S񟗌LhHeHeHeHeHeHeHeHehhHeHeHehHeHeHeHeHeHeHeHeHeHeHeHeHeHeHeg@hhHehHehhHeHeHehHeHeHeHehihXidiHehpi 500S iPi0 0y긄<4P i00k00ht400d t4 `0S \i X D4 T00Q0>,P J  300S P80$030(000,0-t0C?o#2p R0S0$0PlPP63y0@*<@DT,3a00@`FrS= RS iS1 )tS xSF37:㠢Ȳ+ )H0p 0@00@00S J 04 T1150S 2F3 :)F#R0 B(0/S 9x3&.(0S  0@4/B0l01510S (0S x1 0p04X9S <Tv9H3(0S 0l 0@49C44:0S1]51iF.39Pp+(#H 0 ps4PTWG͝a*,%=H/*_%|͔ċ% %G%"%(%2M_Q3xp!O-PTM)@pP4,/0p ?,#@DRQ0I @@0SRhvP cP SP- TP0(3 LP Od0@Sn4nn4n4n4n4n4n4n4nn4n4nn4nnn4nn0D003030800H00 30$30,3I<0@DSJ $3S0S uIID0S4 @p`E07S BI@00 st  8ؔ0S7 9 00S5 $0S2  Q. 8   y000`"VJ I&F8 30(#0<  OJ T`᠔03S0S 00gS' @H0S#hZP0\!\ & 00S <&[V[ 0S80;& q&4)8)<)@)D)H )L )VTЍ@*θċ%f^kq  E&%(A*@*@*A*A*A* A*A*&ʽ8A*@*A*>KYgx˼``G-`XMPvKP y I  ~,p 90`FVJʇNN* dDP$ b0@SS~}~}~}~}}~}}~}~}~}}}~}~}0 60$60(60,6006046060860<60@60D60H6$&R <&4  <&,&R 8&R 4&R <&R 0t't7QhqQ L)P@87=CP 巐PW0S  fP 0000hP&T60 !%\P P061 (VUvpdU)#0+S `DX.4% `3 @ P\\x\(\\5 000M><00/P 0T& t5 0 s000:XP00F0000 C000C2#S0d000 C000C2#d v>C 0C0 0B 0 B "00P00 C0 2#10C0 00C0P00C1# 0 00C0P00C1#0 00 C000C2#0N!qp4 0P 0PQT+8cꥎJZ2V w`'os`F P$ 0SU030#:U 5%PXP H$1 0(P&T6K/r0M 3PvTS0 0R3# G@RPELX!EK/r0wMP"E0<6S"46S|" 02Q|" 42t01(Տ\?6S L:GMP W0`W 0 P0 Lṏ,6S m/PP %&$㢏 <6S46S;P1|Q0@6D&Sl1 0 00R\!  H&PRL! $&R@! 8&R4! 0&@R$!  !Q   @%  @R(@ t0P0TF*,ċ%Ab*b0M*SJG*G*:P%Б%/<65Yc{)C$&6G-P`pIHM )p10PEU& LHP h0@ S S@PX|`pHHII}00pa 4吉P ` 1!H#aBPP a L`$@@Ȁ`(` `Cb! 2lP P?0S PxW dP Xa0 0000 6%,ċ%"^8M*OzYyt @Ct IT0G-`HMp0XH C S c)p 2B1 `FS 1S 0$  !RS@$ P+PTH#PQ|ZaxP`PAP MP2 La0@S`؋܊p܊܊܊܊܊܊܊܊܊ȋ؋܊܊܊܊ 00 04044041! 00101@30@3101101101101ДY 000 0THЍP k#PPp  `0S  'W%0 `PMPV q V W`FV R $Sa (08 ]V ZCXM*,ċ%Q%X\M*O(%C-Mp`6<R@PV (p-6TpF`F5 VE@T T:P D5PT\0F,V j(p6PU 5 `V V 50S aP tP0S h[500@V 0S qpG [P`Va  \\" TL"tP9@PA0@3Spppppppppppppppppp0pppppppppppDpXlpppȐԐp  zP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0[ B0SZ<0SU00SP`P0$0-:FU 0SA 0S 0S;`V UU5FP tAP |<P& UH U U6PEU2 $̎ȓ̎̎̎U( Q uP! t_ U4 @U U0000  \  U QaZPJ&!0000 0 \P  Z Z$0S \ Z 4p qp埽*z@ T ᕽ 0r"600"$0 $P @ᴋP ᯋP` g>v,R*ċ%,n%POE,E G-@PMaqM &p10S `A⼑P R ލЍRP fP74f^RP\ ^X@0JrP1 JkP/0: S2  S)J M^P0 JN@~p 0 4S00p?y0S p J #^PJ ^@PJ(`=TR*ċ%OZۉd@C-PGM M\#0PM$EH=H <8D=8X@8DX夁P0=0D80l8"=`{C0X `XdXhXpXtXXXXXXXPXHhLhPhThXh\hxxx8}PP   ӅP:?# 0l ^DL X hPP< L <b@P <#P 0X `Xذ0P\ SX C#0 XkP"#P9Tz 8#P 9h(r#P 9T(X(h dP t9h(f40GDS$ddddTdddd(dddddddddddd̜d<ddddddddddddd d`P|dddddL`Ğd08WT0X8T8P0QMe},3K)OG3 ?iExX^OZX 8 * $ iG-P`A,E7h-6 JP03_p2S l  PZUU}PH p 㘤嘄9PB/PE0@' s ^"p`40pEWQU D4 000`΅P L,PE0S#3 4# 3PzzzzሦP 7ZvP303 `pl d#`}PX34L 4S 110101$1u/-+0)z$"$2Qlp`e Pb Q1s0S Ɔž`qԁԑ*pl0V0C?o20S lpP  \ᙨ=p`S 0 0000 l61s0S 3S P P=?o20 P P l1s0S 0 P `?oP20S 0P֧ xh:+-ċ%P%x=+I (% )%)%#t;+;+! OH%3q C-@`4dPP P1 LDqH !p0,1QA= 1P5 00ÅP 待P 0 cS 9S0S00C0VS `  dS lS0 0T TTN /塰0SA+,%ċ%7d%G-PC0`@00p0P 0S00O4LlP00{ m Rp0W* s/RSP0r0"2PP 2밂V 0+0C0SPP y +P`F 0S P $2  XP 0S PP 0S10FP  0S1 0$pW tpV 0SiPOPP_%pnP`FoPd 10S 10PF0S0径P0PFBPZqp 0000rPP .(A+5Hq+Y0Hir+@HCl:kGHPH_HA+$r+vHpq+L%SJHq+O-`pBPᨒ>뤂堢b` p2 0 qQ p]PpGz{uP`P GP( IP) EP 43 0 a@P0lll<lll̲llllll0000 fP@ CPA \`UpPB rP pVc$0 P80: S0S00弉`P pCP 00SpWᲇW  _ `P  3 t3t C`@00PPPLs0@ H⺇$P bPR 9ttt2s됕- @LP0@HUP4PP.@<00Vn46P , ,8J_00)$2"%21QY ߑ뮎Dc 1 Ѝ 0pe/40TP 0n<0S0h<0S0bP[(C0`PTe`PP= 0O04 0!00L1QX C0008ssP( pP02 0P- 4P(ePP$ A# U A$R m !RVQ 40@4>x0p 6RPh R _,h*,ċ%O]*s*~****%ht@*9+*+* *pE+%+ r PR0S \0 0/X0  $ P0S ί $@pР970  Q   S  R#4spځ0S0㬯 r yTOUP@Pp` u0O-PMp0 0Ph~@P\ T~@PHHD剰ߍ@P/M ?/x1?0$20H"2@2<211t122tknlhp00m10㘎`&$0 001 0 p.0 h>yp0\0J00 JR1810 J1!1q匡0 Q@Pb}0, = J0R0 =+00-181BVPMP 6P^ ?PU 4P000p=` 0N@P񟗭0=` 0f@PP񟗚p <0x1<,|0$0yu|<` 0q131k0$0001C` 嵯0<` 0W 0 pP 0yP 0%$P~ 嚯0 JR30 @P 0 p0\ 8d&`@0$01@IJp  P "100 01Sq@(P =,4@>q [9 G8:$0P 1@ P 1@ tp  $p 1$@ 0S  Q0 0  P819:0  0  @0|) t pPd r랾P ,4L '11X {P`0S9 (Q90(0 0+(1 @ѮU``B' p 8 P !pL V 6XhVV`` 0S 8)X0S @V$0 RS 1S !10180X7"/0 <! <2s7"/0 <<2s "/ p<Y 10广@` P:嚿!1 01 6 `3p-| 囿 APVV`` 县0 $``#6800*D6p $00cS$0 H夿~<Q04&< 塼p !P$A#0S ~1 0S\Z0SV 0 SR 1011'z?p~0S h%dY``2p~0S @%0L@I6P q@ B' J$k1S $P1 t #(0 p% m1S #00p bpW P x50,A>0 (0t10T$t m1Su 004p10($p  k,0(t10#t m1S 4Np 0|4zpl1S 4:pl1S |#TTPhɾap P 101<0傾0@@00 5`P  <i0 10 ZpY !1! !" 12z5TpD W+mpd~`"0 劻!R1411P,% 0$0!$0R0S"RA1w1t!WP$0!  R !I$00$0 Q[ 0GGF.-XKiKKh{% &G'GL.ċ%q K)EAE,E1EKKR-NNB@KKK"K&QIX-K!LVeLLLL4LOLLNLLLLL MMDMБ% ZMhMM,$sMM(%xMMMMuGGGMMN,NNWNqNN$1Y8 1 1pW41!( < V ?= :0Cղ1`@T 0S 0  @@ 0S   ሳ 0S ?XP`p P ( RV  R   1 @X0 S   0ҽ`Va  Q/0p@-|@0Ptt@ P T0x8Rep@ 0 0$010  l|/0@-hPMP@T Ѝ0@ 0@ 剁 0 @h|h0ƒ S'* 0@- P@ R P@ 0\ R^H00"@ 800 0^$00"@0/,@-M @Q >  ЍlOh  0S/ -PM00 0 p 0 S 0 0 ЍQ LQ r\p /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/0*/)-*/=**/'*/$*/"!*/*/*/*/*/////^ */ */*/<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/ت */*/ */|*/y*/v*/Ks*/+/jn*/Ok*/hh*/ie*/vb*/_*/ \*/Y*/V*/S*/P*/M*/!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/ 4T*/ */6 */*///*/@-@z@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress|܋=HV]̤$d Trp$TD`>O  x xDep%h P)/< 4 IT V\ Z| b n t 8h4>GC/``<``4e~4eȇ|m}T/xC PP*]ttxhL\ %6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory Vh' @@l@@`eKg| $@@"$@@`unblock and -DNO_CONV?(̾ԮDoflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-pv] directory ... 7 888(858(858)K8_8s8E8Z8888#8 8_8^8F8<8>9?!949PATH= #bth.fBdBBsG.c'BBm BBl.B5Br L=p=B<nEBBv MBhb    EOF reading here (<<) document;%G-G1G5G:G?GCGGGKGPGUGLEYG^GeGlGsGxGGGGGGGGGG GGG?GG!;Q??od?}-+?=pN@OIIIIIIII@p?~Id?g?j?m?}I}IabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'r'0KPr'1KJ[>\U  N`rcrNN$\<!Nv'N`lV)NԚ/Ny ߆ V 6N2Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20251126190142Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedUU dUUvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.nno@m@ o@o@o@ o@)o@.o@3o@:o@In @?o@Eo@No@Vo@nn]obohooowo}onoooooooooo@o@oooooopnpppp"p)p3p9pn?pFpNpUp\pnndpjl{llllllm&m3mQmmmmm&mm?qCqHq.PqUq[qaqgqnqpuqyqp_qq1okpupppppppmpppFpppppp_ppppqqq+q;qmmpmmmmmn nnnn#n*n3n;nCnInMnTnhn^ngnnnwnnnnnnnnnnnnnnnnm?qCqHq.PqUq[qaqgqnqpuqyqp_qq1okpupppppppmpppFpppppp_ppppqqq+q;qm?qCqHq.PqUq[qaqgqnqpuqyqp_qq1okpupppppppmpppFpppppp_ppppqqq+q;qchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] {%}Usage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c' ~ÚE     '7NcϜ3Kg !#$&12345689ȝ9ϝ:;< =8@GA[BCÞDEFGHJ+LHMYN`OpPQRSTʟUҟVW\a)c3dnefghipqstuԠvwڠx Edqȡ$<YqҢ#3OioȣУpݣ"5@JbtĤ֤===Vuޥ/KSԦ%P(0ɧ=Pco¨/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]:u >uokpupppppppmpppFpppppp_ppppqqq+q;qreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock4444        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-$-V`SY,@N4$$P$h$$$$$$$$0$$H$h$$$$okpupppppppmpppFpppppp_ppppqqq+q;q ~ÚE     '7NcϜ3Kg !#$&12345689ȝ9ϝ:;< =8@GA[BCÞDEFGHJ+LHMYN`OpPQRSTʟUҟVW\a)c3dnefghipqstuԠvwڠx Edqȡ$<YqҢ#3OioȣУpݣ"5@JbtĤ֤===Vuޥ/KSԦ%P(0ɧ=Pco¨SFH0eC@SFU0eCpHah!IdontNeedEFI(s*K>;|nQn- q+ |nQn- q+%|nQn- q+2;|nQn- q+LW|nQn- q+e;q=rGy=iG}it;Mt?mWC 3KOOyD<#*=(3Dh&ǿ\ M}--чHp-чHZIчHu+IчH >IчHI2IчHodS'@ )Ѹpw*1@ )Ѹq1x )Ѹbackupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps)))setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatusmDprintallmaindo_setifpreferencedo_setifcaps}0zi%yi)N)N)Nx%H(%~)N)Nx%%]%_`%@(%S1#%*0%2@x%/%2Xx%2%2%2`x%2`x%22222 22 3@3"3.363 ?30H3@Q3Z3_3Vtd3 o3u3 {3@Dinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstI5GT5I5a_5XmT5X I5X`f5n5@f5n5T5Xa_5media_statusmedia_constructor-565=4@%B465=4@%6565%@565@5-5%?565*4$%2b652bp%paddr_matchlDsettunnelp6x%v6%print_link_addressessetvlansetvlanifd7P%7i74%77t q setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchan==@=C=F=sethidessidsetapbridgesetiffragsetifrtsl=%k=x%s=%r=s=x%:`%::)* x%%x=@%~=%}=Xx%Y%:YD** x%Q@%c8%=X)<<'99H(77%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAHuH&HHe%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsunionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]Only one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@asynchronousautomountednfs4aclsposix1eaclsextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdup KK6M{PG8"K|E GG E^GtE@)K0K5K>KHKLKQKXK bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegjo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a relative path.using "%s" instead. KK6M{PG8"K|E GG E^GN@OMG{tE@o@GGspecified device does not match mounted devicemount table fullincorrect super block%s on %s: %sreload KK6M{PG8"K|E GG E^GjG sGN@OMGo@G{OPEtE@GUsoftdep KK6M{PG8"K|E GG E^GtE@usage: mount_kernfs [-o options] /kern mount_point kernfs on %s KK6M{PG8"K|E GG E^GN@OtE@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %s KK6M{PG8"K|E GG E^GG{tE@MEYJY: or @ speccan't get net id for host "%s": %s KK6M{PG8"K|E GG E^GtE@GGusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o {eeef@fzfffg3gPgwgggggh 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @|B}C}F*}IC}LM}NZ}OS}a}b}c}e}f}h~i+~k7~mE~nV~oe~rt~s~u~@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp ]` @  $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot() WWWWVVVVVusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY˾9c˿IqUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print / .@MSbp88p#3EQdpQ}3Igoggg #18IDDhszbitmask_scan~E^ejq%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlItsendrequestrecvrequestq ***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gzA%A%lA%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataq MLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i"p,Z+q X+q + +++(|+ETY+aC+jq ;+sq :+}q +\+++q +u+[+0+Q\+QX+ |+{+"*z+EP{+cCy+lq +uq +++q ,+C,q ,q ,collectCTzokpupppppppmpppFpppppp_ppppqqq+q;qNAME=> H:mount_disks>      !"      !"#$%&'() str_arg_substget_available_cdsokpupppppppmpppFpppppp_ppppqqq+q;q edit_fs_type_ext  x    x 1L( _x oh edit_and_check_label okpupppppppmpppFpppppp_ppppqqq+q;qdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdth, H9 9 < T7 < 3 0 0; 01 3 / / J 7 8F 5 3 X+ 2 = @ C P+ H+ DE 1 0 L0 4 $0 disklabel_change_geomv={outer_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default`,@,,|,pm_from_pepm_whole_diskgpt_freegpt_create_new~)X)*|(L(#$#0|dJ 427(6+@7xuo  ipp e!Q&oE n&$&)&u ,&2&5H7&H>Hp;&_H&HH@&qI&egpt_get_part_devicegpt_get_part_alignment$VS Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC@SFU0eCpHah!IdontNeedEFI(s*K>;|nQn- q+ |nQn- q+%|nQn- q+2;|nQn- q+LW|nQn- q+e;q=rGy=iG}it;Mt?mWC 3KOOyD<#*=(3Dh&ǿ\ M}--чHp-чHZIчHu+IчH >IчHI2IчHodS'@ )Ѹpw*1@ )Ѹq1x )Ѹ L(_(w(ȣd(pA(\((( ((mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newv|T<_X4S: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.1_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv6hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv6hf/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICdtbgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************q usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2}1Cdhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionVb ctdVePfVgQhQiIjkVl%]mVnUoVpcqrVsVOtGRuvVwJLxVz/yVAVBVCODVEWF WGWHRIH(JWK%WL̦M.WN4WO=WPJWQSTRWU\WVfWWpWXzWZC1W4W6)WV|~W}WWWWWWWWWWXX XXXfT(X1XS]T9XAXKXXXbXsXqXzXxXXXN5YXXXXXFVXVXdefault_configread_configrt_compare_protort_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrtrt_buildrt_deletesa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initF0]K]#],]Y(Q8@7]script_buftoenvisX'W$szX ]make_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os92_6_;_?_F_if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CD@DCget_leaseread_leasedhcp_openbpflog_dhcphhhlhdhcp_bindh8ghh_fia idhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASfwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B{|!m!{!{!!{"{<"\"{|""{"{"BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~{X%{px{tx{m{{{{{ @{{ {Tm{ܹ{ d{{0{t{{@/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist