'VHWh7/0OTNetBSD/earmv5hf ramdisk 08[h<  [h,?t t[h@@<@T 08[h<  [h,?t t[h@@<@TU [ht`A[h[h[hA[h[h[huA.[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hC[h[h[hA[h[h[hA[h[h[h$h [h[h[hmD< [h[h[h (08@HPX`hpxp$|[h[h[hL$I[h[h[h (M$[h[h[h08@HPX`hpE$v[h[h[hx-K![h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[ha[h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[h![h[h[h4![h[h[h![h[h[h![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h B![h[h[h B![h[h[h![h[h[h"![h[h[h"![h[h[h"a[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[ha[h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h ![h[h[h![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h?\![h[h[h>\![h[h[h=\![h[h[h<\![h[h[h;\![h[h[h:\![h[h[h9\![h[h[h8\![h[h[h?\![h[h[h>\![h[h[h=\![h[h[h<\![h[h[h;\![h[h[h:\![h[h[h9\![h[h[h8\![h[h[h:\![h[h[h7\![h[h[h6\![h[h[h5\![h[h[h4\![h[h[h3\![h[h[h2\![h[h[h1\![h[h[h0\![h[h[h7\![h[h[h6\![h[h[h5\![h[h[h4\![h[h[h3\![h[h[h2\![h[h[h1\![h[h[h0\![h[h[h2\![h[h[h/\![h[h[h.\![h[h[h-\![h[h[h,\![h[h[h+\![h[h[h*\![h[h[h)\![h[h[h(\![h[h[h/\![h[h[h.\![h[h[h-\![h[h[h,\![h[h[h+\![h[h[h*\![h[h[h)\![h[h[h(\![h[h[h*\![h[h[h'\![h[h[h&\![h[h[h%\![h[h[h$\![h[h[h#\![h[h[h"\![h[h[h!\![h[h[h \![h[h[h'\![h[h[h&\![h[h[h%\![h[h[h$\![h[h[h#\![h[h[h"\![h[h[h!\![h[h[h \![h[h[h"\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h \![h[h[h \![h[h[h \![h[h[h \![h[h[h \![h[h[h\![h[h[h\![h[h[h\![h[h[h \![h[h[h \![h[h[h \![h[h[h \![h[h[h \![h[h[h\![h[h[h \![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h\![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h ![h[h[h![h[h[h ![h[h[h![h[h[h![h[h[h$![h[h[h4![h[h[h![h[h[h![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h ![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[h![h[h[ha[h[h[ha[h[h[h![h[h[h![h[h[h![h[h[ha[h[h[h a[h[h[ha[h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[h?\a[h[h[h>\a[h[h[h=\a[h[h[h<\a[h[h[h;\a[h[h[h:\a[h[h[h9\a[h[h[h8\a[h[h[h?\a[h[h[h>\a[h[h[h=\a[h[h[h<\a[h[h[h;\a[h[h[h:\a[h[h[h9\a[h[h[h8\a[h[h[h:\a[h[h[h7\a[h[h[h6\a[h[h[h5\a[h[h[h4\a[h[h[h3\a[h[h[h2\a[h[h[h1\a[h[h[h0\a[h[h[h7\a[h[h[h6\a[h[h[h5\a[h[h[h4\a[h[h[h3\a[h[h[h2\a[h[h[h1\a[h[h[h0\a[h[h[h2\a[h[h[h/\a[h[h[h.\a[h[h[h-\a[h[h[h,\a[h[h[h+\a[h[h[h*\a[h[h[h)\a[h[h[h(\a[h[h[h/\a[h[h[h.\a[h[h[h-\a[h[h[h,\a[h[h[h+\a[h[h[h*\a[h[h[h)\a[h[h[h(\a[h[h[h*\a[h[h[h'\a[h[h[h&\a[h[h[h%\a[h[h[h$\a[h[h[h#\a[h[h[h"\a[h[h[h!\a[h[h[h \a[h[h[h'\a[h[h[h&\a[h[h[h%\a[h[h[h$\a[h[h[h#\a[h[h[h"\a[h[h[h!\a[h[h[h \a[h[h[h"\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h \a[h[h[h \a[h[h[h \a[h[h[h \a[h[h[h \a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h \a[h[h[h \a[h[h[h \a[h[h[h \a[h[h[h \a[h[h[h\a[h[h[h \a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\a[h[h[h\ ![h[h[hi![h[h[h![h[h[h![h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[h a[h[h[ha[h[h[h a[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[h![h[h[h![h[h[ha[h[h[ha[h[h[h![h[h[h![h[h[h![h[h[h B![h[h[h B![h[h[h![h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[ha[h[h[h![h[h[h![h[h[ha[h[h[h a[h[h[ha[h[h[h a[h[h[ha[h[h[ha[h[h[h[h[h[hbpf![h[h[h $[h[h[hv$>[h[h[h$[h[h[h$s[h[h[h$[h[h[h$[h[h[hA[h[h[hm[h[h[h$[h[h[h $[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hA[h[h[hsO.s2m°10a(?XO"/|T0,Yo%yH{WklM @fJUe~p Rhɋn]`8,XDBZI$IopwDZdDc~d6_;AXSD6qN=nEO%eP 8G_5y)/,njۘDJZ*Y}cAe{2Xhcw{SjSsq7V~/4suLju\ LyVO2p0OQvV(:8[XoA;sWt4gcI&^}ZѶBnp cpb=AyY9=e *6,* do{$@H-FI"}QLwntV 'P nt . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4 4 (JJ``$`$uLL``$`$NetBSD@ ;PaX NetBSDearmv5hf3D0D 0p@-,4 㚵# B  d44+,4 ㇵ8p<@ !0!/0+0 /+\ dp@4w4 ,4 fЍ&MbH&B pn    S@-PG- A `00P4 82#&P0P( 1/qp $ |밀娐pUЍ80$0( 3/P 0 `V`PE0S0C0@T0  Z$ &8&% @-MTA P04 00#!8(  01/qp$ 1P: 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p p0h( 3/pLp #U0* 0P`/RP `&m@-@L M 0Q   0   Ѝ&&F(O-Mx M0@S. 8S+ #='0|0S( 0| 00" ! !x00# #|0 t&l %ݍ Ѝ4'|' 0 X0 S 0E0WS06  S  S $0S0 600000S60 060 00 6R* R0r0C0C00Q0 0S+ ,B< PMH6Df0oСP`0Z 00$0(0, PU 0`0(0$00,0 0S $Y# 5%ȋ(0S%0 %00   05 A,0S 50 0%7x\pWd54%`X= ?X09*+ 0  "*0+$0 *+0 *p(0, 0 00(00 $0 @<@0 0|@ ph&k+X:)00 ?X 0: 0X㐳$0吣# ?X 0:v'00S. ,0S#$X  !40S 廿\ ?\0 * 3+0 ) 0\娿 &+%6# ^ (|0♿$[㠒5 0 !y0 $ , p0  !j(0, 0 00(0@0 $0 <oxm1,0S 4a0 Q0Z,@a0Xp00- ?X0)** 0  O)4*$0 E)*0 ;)0000004 0 0 t**X9+40 ?X 0:* 0X㐣$0吓# ?X 0:*5!@<$ 0 0$ P `5&+ 3b%)M8!WC& 2#31@}%Lf Tm@-pPP@`D *P Ѝ`3MU@~p@-XP8@T`@D p %P<opQ<Pp&A-AP0$ P0 0 SQ ( $0эP h- h d`P, R3HHqU``0``000剾PK- 00CS000 g   0,`0CS0000 (00[/U R -8 4廾D 0$00 0$ P&%xP& @&T0 S 0SP/P/S/@-+P&Lp@-HAHD0040S*0! PP P0P`04 PR@ V04 ^000(  0PPU 40PE`PP 0P4  P P0C SRP40 0P  pP&P&%&&p@-@8P0 00@0@00000p&&A-pE@P0 s,< 84 0 R`Hv  Q0S ( 㾌P U, c@(?$00 0(0 H0V0? 0"5,ؿD @ԽL"`  0$ 0o@ 0$`Ꟁ% @P&x 0s@-?0 0l@ P  R' 0P 00S/S`X8P4OЍppP \[P(ɰD8吣<:&&5P&&7@-@(P P8  +i \0XdT Ѝ08PP(P ݱ8ʽ8P 0"P&%@-P4@(P 8P ű8岽080P&HH @-uP(0 00<0   R&%P&@@-<P0:  R R1S7'P P 0SWA吡S@ @@  ѻP<*6T P2L00CS0410& 0`00 S'PT 0@@00S - P- P  P 0@0CS0\00@  % H&&X&%&P&% @&2ILp@-Pd`d@000 PPPP>0P0CS0p(00 IpP&&&G-@0` V VHЍpPP 0崀 尐R`00`@0SoP 0S  0 h0 0 u?o2S @`sPH&`&&&P `00CS`0p S00 P0S X0X /X%G-pሒB刢`0SS CpP[ U\ XLDV00 0ӺPZ 00CS010a U0Pd 0@Z )$   00CS0h10=0PUPP1 ` 00CS00 P0` R0V00xP:)ݼ ٺp00CS0p00 VV0  000  @00S 0S XH&&P&&%z& @O-`-M  R 0000100010S ر@q0`  0.0P0 0':T0J?o20SS SRO g0S  RZ@T  Z     00 10S@@  0 : 0P00CS000 Ѝ S "0P  BR l  @0S Z0 0$&&&&&P&%&A-P0`!SP@e( 0KpP0!S P J(P 0HH<00S0 ܹ$00C%&&A-Php@`T0S P(弻$ 帹OC&%O-`@ ؀0SP ĐĠİp0 T T R R 0pfP Ѝ PP P   P Pp@&&&&A-p0`!S@qPP'\ 0W @'7e P0!S P '?X 0P:PD00S8$ .T@G@Ѝq$%&O-@bp00CS01pW PU>ءTpp0pp00喸P"X'  00CS0Hx10 t@p@P0 5 0p0CS0100 S00   X 0000  0 0@ '峺 t寸F 0 `00h0 P`0W0$0T P 00 %&X&P&% @&&&H&,7O-pLP0 SPEUP ЍE P C0 0X0b U000P&` \ 00C0S.20 & 0 0CS0T200 !Z( 0 PPE CP 000S S  `V%0 V00孷P n&| x t 00C00 0CS0D100 0!X 0PFjP 0 0ZPF C V(崀VPP0PP00jP ,&Ϲt p˷lb 00C0m0 P0CS0<00hj00`6H&&P&% @&X&2O-P@`p P`T !. 0PS%dP 0@^S00\P0S \ [ l P @P@+0P00I%NWh%<7@-T @0H P 0S( 0C00S 0C0 Ѝ&ht@%P0 R  QQP0R/@- &LG-`PP@ X 0S@ @0S @T@@DT }pP 0S  0 0 PЍ&`G-@P tp0SW`TPUP 0 @+PP @L&X0000D@-] 40aA R    0/ᐹ%i&40000 0h@-> 萹%&iO-R蒟@ 刀p00 pWp#s) 0`?VJV$ V 000 0S0 =D $ B1@s4$0"S00 @∀ FQuHSUUU UUUlUUUUHSUHS U0UTTTTTTTTTTUUUUU0U^V^V-Vk @ 0000@^V-V00@R $ p1@s@w$0"SR 0.V@0 @R R /Fo@P0 R00R  G@PR 000;V 00 X@} T0Sx&%H&L@-0@00 005P 000 000 ,R;R 0S  S   0;SRp&p@- L0PQS@@R0p`VP0C &p@-P@P #咷, (厵$% p 00Ꟁ% @Q 0Q\SA@-o/`@-0S* 0@ 0S! P]pP PP ⁳@P q0 S</R/    ʲ0 &q$( Q 0@30/@-&00@- R 0C30 &A-ppA1S0PR a  R R 8S ` ` `0S 00 R0CS .R R P000`P 00CS0"0 l W  JU0圁0CS00 pP&%G-PA 0pR0pG0WR``0 0`01S 0100CS0H89 tP00CS0' 0S  dP 0Sp`0 0`0R0 000C00p0  $`p&G-p0A 0RSXPB0GBpPPp`U,000P 00CS0'0  W  pP 0圑0CS00`PU*Ps`&G- A`0P00 P 00CS0-0 o& 0FSLp I1S  0p10EP0CES0&O-`PBp0SP UC0S0001XPPPP-PE 0Q0CS00LN BP[00`F`0WP/  W P) 0100CS0G'(;P; 0堑0 S-ڐ  S   P!L H00CS00  0堑0CS00  0Py&% @A-`AqW ڬQ1ECe R10  C0|00啲PPW! 00CS00 t 0q0CSQ00 \R `R `&% @O-0D0!105P` Ѝ0S/T SPPP  @P!奴X T塲P800CS00  ^0Q0CS001Ѓܣܓ! P 0 S*"Rʜ0Upppp00P 0r0CS00 1 Q !@o!S/ %S pW U 00 0ұP 0帱0CS000!000\Q00pPR# QUpp0pp00壱Pb 0q0CS00ik0p 1 1S 0S11a0Sڐ  S`l  vP5 0a0CS00<>10P!pE S:`00  1S `^qP ʼ10PE pBR   0 Pp|005P 0q0CS00 &% @&L( Q 0@30/@-G&`01S @-@0!S @P /P /&7@-A00 S1 RUWʐ0\00PBE A00CS00- 000 @P R0 R P Ѝ00!S JP `L0 Sڴ 0R0CS00000  \00sP 00&%% @?A-O0 Q .#p WU ! GYQ]YRZ~~mopHuuo{kPllmnopphqqxrrshttuDvLwz{o{H}}P0 nR pR lR 00 S P0PP1S (PHPFPP0 nR pR lR 00 S1S 0PP0PPPP0 nR pR lR 00 S1S  P0 S00ЍP0PP!R "RP  R4 00@ `P P0 nR* pR# lR$ 00 SvP TP PP0S!S 0S 1Skd YP0PPP^` ,+0100+0 R00@ 9PJ 0!S 5 P0 nR pR lR 00 S&0S  `JwP0PPQUX )PG@oG`GoobPVWP 0 nR pR lR 00 S101P0PP0SOP0 nR pR lR 00 SX)0S) LL '%P0PP0S/P0 nR pR lR 00 S20cS2 P0PP 0SPP00 nR pR lR 00 S1S @PPPP0 nR pR lR 00 Sr1S P xP0PP  P  P 0 nR pR lR 00 SMXP0PPYPN 0nQ pQ lQ 00 S - PP8 0  7P,P pP'0Sh `Vk0VhVPPPVPU0 p0 nR pR lR 00 S1SP0PPP 0nQ pQ lQ 00 S   0  P 0nQ pQ lQ 00 S   0  0SP0 nR pR lR 00 S2S040S402P0PP0S 0 l0C0S30 Sx1SP 2SqWPP00@ 0S0 0c`Pt P0 nR- pR& lR' 00 ST1Se1S0!S ` 0S1S 8c PL 0S0 1P0PPPr`0 gRG  R: 0 B R `A@p?0"S;bpR1 rR1 Up020 R 0 S$ 0U0b0 ' `P$00CS00 P00 S2SP00PP2P02 P P 哭0b200CS00UN !2R00W0#220# 020 nRL pRA lRE PP0 nRE pR> lR? 00 S1S"ꐹ%&%%3G&%LcxD,`&&_q$H&%-4 Pr" 0"0" " P0PPePZp PPU0S- `V0V PPp0 nR pR lR 00 S*1S;23P0PP0SP0 nR pR lR 00 S P0PP QR000P0P0@k `P 00 00 P0 nR, pR% lR& 00 S1S0!S t 0S1Sp bWW 0 P0S0P0PP1S 2SqX<0S 0 l0C0S30 SL P0010CS 0nQ( pQ! lQ" 00 S3 00SK-` S`嗒@p!0"SZ`u 0  P0 nR pR lR 00 SN0xS P0PP0SPLP0 nR pR lR 00 S,P F2S|$P0PP -P"  t -@-0 0_ ЍЍ/'&-0^S0]S0]S S]S[S .0A0S>30   \  R]\0G-`ᘁPp0 SS'PG(!RJppU``0``0,0婪@P.k0 , (00CS010 [S@ \S@0 S @@Pp 0(a0CS,A0p00,A P0  0pS  0GH&&P&% @&&!p@-0 PJ@p P@01S?0A0S S n@P P0P 00S0``0 0P0A l0X 0墳00a㦨P`0v, (r$H&`&0&&'% @O-bB0  %R R 0R0P   BR  t   R ( Qp B  RʼqU``0``00巩P@ 0A0CS0p10H0 P \RI0P 0 S 010S P/ 00P S)  R [ U   w0P8۫ שn00CS0L00} T0`00 p<P PH&&P&&T&X&%% @A-@`@0@P X0@ p>P" 0 R00R000 1BQ@` @Y@p0"S,@gR000H&&O-cSp圳圣M@00 0GS T`SXsTP0PP00PQ( $M 00C0-0&SM0 L\  DQ<Y 0C0@p \  0忨 0P"l hd00C0S @Ѝ,20   AQ  \S9 1B\400 BR0ˆr L\ DRW B @ \  f P AQ 0 T Tp p pp  CP p BR   @e0 P0CS0,000  r&P&&% @O-M0@ T0P0ߍT40S  0 G0 000(0 QpPPd@ p0 S pSx 00 0(00Y1 Y   $ ا$P< 8|  B Rd30    BR  300S 00  0 (@P#Qb 0bppG XxlY 00 0偧P\C, ($y00CS00 Y(1 Y   c1P #Ʃ §Y1  B  BR p100S 0  _ @ Q 0 00"2 00 (0~P1 0 0CS000SUW#00 X00S 0 G $@  0S&&P&% @&DO-- *0AQ0C Mp`01 00C S00`Pt :  P Ѝ5 &P!` 00000`P00CS000  [  r0S00CS0x00` P  P&&P&&`&&O-MRB000bsp 0s`Ѝܑ܁0S1  ,0 0 0P@ 0##੟ɐ Y Gt10S 0000000p0CS0D41<  \$ \  00#0L\ 0C000@000000 0C LN &%&_ &P&\&T&&A- `P0 0Cs 0p 0l0 d  0C B R0@pT oᓦ@ &&%&G-p@P0 `R0  Pz(S%u0  d EP 0 ,(_ &% @@-0 ݥ㈣o%O-GMeM0PS@p$Q403/P ˋGݍЍ0: S00W +  P8:?0;P0: S 0S#P0: S 0S 0S 0/S&P700ppP- xsP #0vz PvO+ 0P ]@#Pf]ٙP U/!)/P)P 0P,I [)H Z& U9..0 0ⲙPT:..0 0⦙P@D!0Q\ PT1RP  oR00S$ 0ST 0: SPژPO 3  0G=00 04K G=00J0SP/ HqXG< XӤ00CS0p Pp  pYW YQX0 X p00CS0 0 00S PP l0  R;c 00&)N8Bh%u%%\\0\\X X0p@-@P@@DDT` U H H0Rp@\\ppX 0Xp@-@P@@DDT` U HH Q\p@\ppX X0p@-0P0@44T` U 8 80Rp@\\ppX 0Xp@-0P0@44T` U 88 Q\p@\ppX X0p@-PPP@TTT` U X X0Rp@\\oppX 0Xp@-PPP@TTT` U XX Q\p@\TppX0@-t pX0pt0\@ ^0@\\?X @-0ptX pt \@ ^ \@\)5S %R R S R SSh -^L^S R 0/0/0000@&O-Q-MTv u@ 0 `0 0L0 @@@@@ @D@H@$@(@<@@@4@8@,@0@5 SS$Z\ TXq0 !00`V0SE 000L0刐S{ ,0000D0400800$0S00( $0(B? $p9p ,0S  @?C0000D00H0X$0p!p  0<$ Dpp $0S00<00@00#pp ,0S  @?C 00 0S 000 # 0pp |#0ppz 0 \ C@QC003/040 0S 0YT RS0 00 R0!0L0S XP$0x |S(0D 0$ 0(PHH050D5[<1p0tQ@<0 @ Q (8.Z,.X , , 0  0 4 04080080 0Sf QA 0! XxX0:Q= 0! dnd0:   0S0  0  R 0  P @P0@ 0S00P0 0P00cPP\0.S}0S 0!wS0P: 0P: 80 2 R P0)}P000Ѝ@&VUUU'.X%fO-@a!80S [PP" bpW  ЍO<0Sp|倡倱G@P ,@(@&0SL H50CSĦ\o $屣 o00L0S \0.S0S m@0S40S  l <0Q?o20S X  040 Ѝ@&G-p:EP0L0  P0S%00D0H0㈅` PP00  pZ\5T H0J0P 0 <:P B5X0 s0X00 00dt |  ` `R`S Y {( ?R004(0x |0R S S Sp4 L0Sd4 T0SX4 0SL4P0S@4@4Z 4 00Ѝ1@GPܫTpīԬثЫ@ ,@dd|Ȭt0L0PP P 0H0PPLP PTPFX0s0X0 0PPLPTPHP<0 00PPLPTPHPX030P0LP0T0PPLP P0\0`P%0`0\P!0d0``0<0080 `000DPh0lP 0DPhPl00004@pl0 h000  L00S   %8"&&&$0\ 0S Ҟ Ϟ&80L0S/0 000/0@-M0S 0 00!p|p嫞Ѝd0d@ `0R@X0 0B?l 0Ѝ@蔞L&P&d&&@Pl&'4h&P `00CS`0p S00 P0S X0X /X≟%: S@-  S  S/ I* S  S%|@=1A-`@XPTMp !\K@T10S H10S. 00 00,10'6p /@0 000) 0@0S00S 0: S@Ѝ0圀 h0R0x |B? 0T00S H&bP&d&&@&&&&l&Zh&&s@- ៙@P@P `PU00S @GT CЍp0t  Q \0 \0@-T (P@$Ui&&p@-P@Tp0 0C0 ,A @G-@0M4,3(30S`V0Ѝ0 0C0| 0XPS !,s0S 20Sn 4 "; $^p6 x W⃛00  pNL20S 88F ((B$20S  $:0 : SL( 1"6000 0@001<"$0&10S10S41 100H 10S|10S : S0: S s`w818q 0Rp(1 B? 0 'Q p{ 4 p֜P^4 ͜00S &&H&P&bd&&@&`&-&&&&&&l&Zh&&1O-@0S,0010S 10S40 001q 1000PS ЍO\a0TQ ᣜ0P  00`SpǵQPPU& Ѝ  B 1`0 |0  ,R4   V 0S[     H&P&d&&%&%&010G-S,0@010S 10S40 000 0000PUG`먠p{0PUG l0 0C0 W cp0,S4  `YpP S`H&P&d&&&%0G-P@0T,@0@S 00S40 00@0`0娀S㨐@pVG ,0 0C0 W ,#p0 00 S p0,S4  Ep` H&P&d&&%@- M @ p ЍT P 0@  QQ 80 nT ᏝP S  h%0p@-P0S``@P PX +A@P8# PHJp&_C-CM@r 萟P`   T *F0 ⮜pPPCߍw ? @P w0S ?@eP?oP@%@-阴 创3% 000/&@-釴0 v!%@- M像0P ! A00P00!0 1W (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx` TpV  Ѝ "$ W0P @000 l0l2 3pX   DH+i"$  (0$i&"'7T/;ZO-@Xe-MQP hpPp a 0St  ptP 0S mP  t00CS02p1pЍ0S MP PVPDpPX d)8$ Q440l0po0 ! 岚0 X ̓00CS0 p YX 0 P 0S  tPP X0: S `P<P P X0: SᗍPX ᑍpPk៍`0S ㈲  x P= vPPჍ D R $AỎP :0 ¯S , ! 00 A '! 0  A {{zpH00@0 yP @p lvP N0S X0;X0XjP eP 70-S PVRPtpW  D2LpY@&p+%%7&Q#s@-@ `PᱍP0P UᙍˌɌЍpU 反㌍\@彌廌0 ?P4{x@x%qt@-~MQM0pS  0` 0 ` P`! p~,mP 8!o1@~܍Ѝ00 `P ~,Q@Pʆ ~,HP 0` 0 `ҍ PW `  Q \00 00ọPZ 0( '1%m@p00CS0 m0 /O-`DLMp T0|$|t00000 0000STTLV04`0p Q 0SI\#ڋP#00V 0030p Q  #ὋP0 0l#00V00<30(#ᦋP#0030002PP0"0嚋0 0LЍp(0: S !0 S%l P000`P3)0-V'V|VЩrX2PUT  ? 0M1PP S0 00 0jqpo0S0 0V00R V 0V 0d1\!00X!00@@D!S9~<0V 10S0C ^:ˠˠ\:PV0 0~, e~\P0 P ;  0 =\U0Y 00V T0<%&&L% %%%,'&m8@'',%}D00S/@-~M0@0S~, ẊP~܍&%@-0p@$0l00S Ѝ0 000Q , /P%&5L0@- R<@Pڄ0  Q @;;S p.@P00T@ ^(0, +/( .%&'s@-R@T` Va0@$00 ?00S 0CS1P120 S7@.@ЍpPڀ;;S! 000 0Q P?P@@00" 0S @@0ES TT 0$00S0S 0S 0S $0STڄ00Q VQdU.T( LN.(04 .$%&1t'f`!0SN@-MLQ0SB @100CS4:Q000SS6@0S0T0pS 0pLQo 0p T0QSQ00 t 0؊P00 0S L-Ѝ00/ -&%L%m PG-PP0  Ѝp@PڬAQ9Q` 0Q P 0@@(Q.< -P 0S%&@-PlAMP \1`0S0 SU0<900U0p 0pQ -Ѝ P0S(0S 0Q  Pڌ0U 0?0 dJ-0 P 0$P 00 -%&5'@mVO-Mr4M R0`RX0@FP^{0 0S ᘒ0 0 F0 S(0S l  \"@pT20 0@"03>("00#,Tq "  #>܍4ЍT 聟0S =! !!0#`## 0S1p1 00^H!0>0H!041 0 00,q(10`(00C0  ޓ ᰐ  ד00(  ,0$ 0$ 0  œ 0000 0# `幓#K# 㧇TL%h%&t''{*'&&'%C-LRLb0HBS0000 Ѝ(( 00 0S  2 r0S |1 i4 0S pP (0: S)0ڈ p10S10S Pw儇P A 00 0S q4@ 1 00 0S00p0000 S(00(000 P@0S !000S x0P 0+P0p0r 0X%&&'@'''' &L%\'G t'N ''S A-MM8 P4 #,H ކP("+bR$0@S 0@̂0S2e+p)P| $Pw 0 t S( -xQ+tO+p2Tr0h0CS``F+C+PA+L?+H=+DK+P4P0@0@,+ 2 ލЍ#+0S  R  sS SS YS~P +yS+0q儁+x*H +P8P 0SD @P4 (1P *0S +@(*CPP P0@0@**'` z %&'' % %  L%!^!!!! 0n"'!4!*"I"g""""# :#""Y#s#00@-@Rp]p`P%O-Lq l0S'P6@``TPP&PV,L0 R4T0S *@ET  A0d#0V`@P@UPn*PT0S ha*Tꓢ"D 2/L0P! 咣#, 0:@%4%&L%#&#t'O-@㤁0報`MFPp @fQ PPPU3PP'*-PT,010S( $*P@!0$0 3/0P% 0 R T  A@G 80 3/P{0Pp00St p) Q < 002/0P " "Ѝt'&&#L%$'$&M$s$@-AMMP/@PAލЍp`pP/00P U`0` *L0_" /0P0 0$ 00`)&$&$00CS0 70 /O-0c$M00P[ P$Ѝ%P0,03/P000 0w`30S LCL<P<PPP 00 30S[  P U P!P r4 CSR pPt hS rzGP8D"l)B0/ShP AKW | 10S  P0S !S 0!202 03/pP XZ \'h1  0S HQ0S 01;00C Ph0D0 3/P7 0S 0 R 0pU0403/ ރC00S ^'P0h0CP0PPt'h'&'X'&%&& ''&''''@-<@P( (;&4%@-Ʉp @@ (Q%@-@ጄp 0(@e%p@-MPp@0S  0C0 `p 0: S `S NS Ѝp@C-MpPЍa0H03/P0 03/PLvpA]pP@ 0AS0 @0a3/PE0 01P)3P/P dP0/S7P A00 006@ Op (0(03/X \ Pt'&&&h%%z%'O-MPЍhe0H03/P0 03/PPu,50Sp 50P %'40SD]7P 0(03/ 㪂8P 0AS0@0 a3/Ph4C000DP 44 C+P40S  P 00  P 0R S "`Qd 03p Qt 0pP`P H@SP3` Qd 30/S]P  A@ 00  ⯃P0SU 0S "`Qd 02p Qt 00S "SBP 0 4S P X20SlH20S Po4S S/ 0CS)0S%  Y K0S$ 0S 100"`Qd P x1 ,` T RP (1r0 R I @ 9/0 S0S 0S 000Y\0C00-4S 0S 0t'0'P%%h'&'&'d'&X'P'@'0'&8'4''''T%'G-Q@zP@ЍT  T 0 &H03/P0 03/P0SB0 Y Phhq 009XaMP P: 0 P0(03/HP 00 @0S 0# 00PP@! iAP0 l0\0 0S NPY Pt'%X''@'&''G ''%T0@-0S^PP 00H03/P@X't'O-MMDp0$0 PP0@4@~z=0 Cxzx8 o6 wv PF@$<P>4S(40R(4p l$hR\00 X0S 0(4} 00H 0KލЍ0q'6H'(','`%N ,\%+0'*++/O-Mp@ W 0DP 0S8 00<000SPP0C080pG0S `0S * 0R 8 00 x x/  P8 o@0 X2@ ?@ZQ*`@0 -0嘰 R ኃP` hЍTT  @ ` `@7,,''),''Rs@-Ѝp@ 0@`PQ< 0$ vP 0O,'7,0@-@MPPv00<00S =  J" Ѝ0'G-zM@`Q M Y #P vP P 00P=! SR J(@ݍ ЍxPJ8| = $ HL0RP J(DP 0PQȄJ8 f,{,,G- AP ]000qPU+`00CS0pU 0 0S U 0   zP 0 SP P0SP 00S 0 S P ''%% 0 0 S@-0@0R00000S0@000S `P PP40PH'L''<' ,'p@-PP 0Sp `р@Pd H@P0/S00<0 fR P@@@@p,-'h0 RX R  H R/< R/ $R/Q/ >'\'D'l'l0A-0S X0XPX`Xp@0T R S+ P0@''%'-G-@c- 0(MS 0SzB1@(Ѝ0 0P50C S>t%%%%$%%%%%p20S X00 00!P 0 000! " yPPP  0!$!$! 0!ꓭ  X(4 : SB  S<  S)  S08 0P! /0'TS+<  O'&-.4y. .S@-=XM"@p:(~0 XЍ.07@-s@ P@P Q Ѝ00 1 `- Ѝ0@Z-0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//Qq/@-0CP0%S*0 ,  ^Ό!0W0CBPBb 0~  0ΌC S*/ P@-*0S0@P0 ? SR@G:@  SR < Q R 0\ 0 B^00 C@ T A C@T   \a0C R  0C@-0S0" ^":00NB\Bb 0  \@ 02W"!N ^*040@-@T@@  T'#.A-P4q4`Q VA-QQ@@TQ S AAa:TP h0d?@ 0:S@ 0S00 0@D,'%^.%u./s@- ` P0PQ!0*0S @mR$ bR kR% + 0*S xS SЍpwR! /Q0@P0$+* & #P00PG- 0SΗ`P .}0P  p T@R 00T0\p0S ,"=@PpPP Q..'.s@-@XPP0p C30@0Ѝp0  R R00`|@P$0  `F s00'@-F+X|%.0 Rr @-/L%@-004+$(1+ .+ ++=|%i/001O-pᄠ儰  @0 P0p`4 0Y/   `Bh2O-@-lM/`3봯PsFPP p/刯_0 p00 h?h/~pP?L?A0s 8/S XB\    CRX 0F>{zP񟗳97\479777779799997777977777777777777777777777777789D977P9\97h9t9777777777\4l8777788877779877\487 9797,97777777677$7077l77x777777788 8888@8H8P87`8><P p,PM>J=0 -R,Q0 000;l= =p, 4h4C4L'f4&H'@'<'8'4'T%'D,&' G4A9%% 0.t'%%4'0% H&0#@dyL#ty|&$0  0 W Ì1P0 ( 08,W7H1 V 2(1\ CVP00' gP"x12PU1 U 1 T 1 1S1_PS2PR82 R H2 Q X2 Q h2 p x222 22"2+S002p007 gyBbr0e0?o S c00CS0 y# R003XR0 B{Sv008300R :y0 d0S3# S*SSʤS|0Vy PK000Sm30VK3`F}PLP20000S@4 P0P  /'l0P/`0p@-0T L@LPP@0@QP' x3't'565%'6A-` @PA?\. \ *\1  Q R+ ![\SPQU  !\@@]^1!Lo \P0/P0SP PS QR S0*S S 0PS 0 P0^ p-W p]WW UU @U l'0p@-@0 /SN00N P`(pPQP`Q*LC T0 0300Q*pQc6 1@-M MP Aaq:P/P 0P0Sۍ Ѝ.S@T|`l @ @T'6 7=7_7 h7 7777O-cM M33 "p5@3]P`W,0 00S 000 0⬒P{ 00 ;R SY 0 0 @;T* R  DY<5 cݍ Ѝ&R) \R$1@\ 0@R R P BRCR0 t 0@&P\P   H >(0 0CP;TC 0S0TP* R00;T 0S Y 0 0tYpi Y 0 0Shh -w0S X 8 0Q00 wKЃ' 8%8H8%^8C-`PMM RP s\SP RW P0S #  P0S\`w\SP R1 PgQ PQ' SQ GQ GKw(0 0@pQ sQ00000Q0 R @@@ۍЍ00u P wtt@P p P ; ,0 iwh898Ѓ'88A-`P 0StVpt@PP P`P80Pp P @ @@ @939Ѓ'X0A-TPT`Tp@0T  S& Kv0@Ѓ'%`9L1p@- RE jDTA ,PU; P8 \Q Q 0T + v04#ݎP  0S/  00P0S/  P00 @0/S000 0DPpR0 Ѓ'\'l'99A-0j40@TPp 00S 00S0 00/S @Tt0oPL0D0S sP040 Ѓ'\'p'x2A-@0PS' 0`.S0.S0S/S 4=P 0 Q CR S.R  S.R0S/S S 10S410S 6P:4 CSR ! xQ`V 0/S0S.00 p k00C0V00 `V._ XP:$0BRSR;  IP C 0C0 0B 0 B "0ꐹ%A-@QpW :@-<@0S (oP舄'=f>C-M``0S PPp0@T " !(@PUЍ舄'O-`0-@XD%   pPZ 0 Q PQP (0S0n@P  5P p `(Ap O5ꈄ'=>A-0@T `pP1AT  RQ( QP (0@ 00pp舄'=/@-`0M0MSPp 0/S 4PP ۍЍ(9n@P x T ۍЍ@vpĈP 00$$`!#!0 00  @('>>'A-P`@p娀TЍ000S$0S  00 0 00! !B<00S y5p3p@ꈄ','`%\%X%@QC-@0A`@PP!@p WT  0q ! 10_0` Ѝ T0p`G-MⰑ@T- `!PApT |0S! @T m@PO P00 0QB )P4]"` 0! Aލ00!!QP  z P    P] $ 0\0 D Yo( $ꈄ'Gd%?0?H?h??1G- `V@0P RpY  .m@P) ćP! ᾇP AZ d@P`^P XoᦇP< NoLo@ꈄ'???d0A- @T`pH P AT3P @ꈄ'p@-Qq@@,C\P \0@@ \ @0@@0@ 000@@@S:Q0^ACBSbB 3 300pp P <  - R0 R:00R:/0AA-M pa Rh1MP0\p.@Q 0  C0/S' $!$ 0Sm -P3ڍЍ *\0@C ?\0@C ಀ0 pC00 C0  0+m P d X 0 m P 8 ( 0m %@  @+@9@p@-`0Se\p@ 1e #L@ HPXn000p 0 @-D@ .00S  /ᨄ'x000@-^SQ 0Q00P䨄' Qp@-!0PS   ph P@t Ll @@T@p00@6h%n@@-P`p@P   P 0|Dh0` l? Ѝ0 0 P0AQ$ 0  @2L%@@ A'A-`PPЍ@"L:J0840K0CS 2  `40 01  +  d] } (lT <tO @|qp  A=L / $  04 -B2P" 1P* 0(5P/S00*040(84K0@SKP 0 040q;;00004(4 :(40/S04084(49(p k$' 'C-j@EM0@S( {${@{{p{P{`{p{p{30S EߍJ(dJ(J(J(!L 0\ ` @ 3 30|QJ(t S7000-00 s++  10>L  Rp0<x P J<p0@ P J11  = 0upP Jx<Id@жY   EeXM  e} 0 PpP J} 2P MP$PP P  0$p pPt s0cR `2Pꨄ'CCCCC6kCCDUl D8'$D&*D0@-MM@Ph  =X X 0P U+@0  $ $ ,  ݍЍ0$ c'p@-@= PP hp@+1DA-p0-S0S) hPP%|j 0NЍ0` S0 BP@P,0U P`GD%ZD-@-0@P   &zЍ@Ѝ/Є'p@-@ATp@0 R PA6P ` `fP`pЄ'-P@-000  x0 t000 h@0S \ 600L0L < h ,y$ 6 Ѝ@ Ѝ/'@'''%'p@-x[@Pl彐hPP \ᶐP p兑 [000S  p{Dq$Є'h'D -P7@-000  0@ 000 P0S | L600l0l hg XyTiD 8g0 66 Ѝ0@Ѝ/'@'''h%'%ȡ@-飀 g>eD%@-M@P" 0/S/P/P \p \[p 0RP 0RP @ލSD90n 000/؄'@-b RgdD%@-`q,M@T xxCgpAPD 00CS0@@Da Pp= @Y@DOoB0S@,Ѝ0P: S [P v0S d Q 5! P000/@ 巴0x @ATf0 @00CS0͐0 ؄'D%%D7&!EO-PQAMR @ <R =R @ |R@ 0&S@ 0=S@y  0+S@'p 0-S@(i )e&c#a@ ^ꐹ%ą'"K''%R'jR0 @-먅'R0s@-P0`0V0`0S@ P 0R@P@  \P@0S00S 0ST P000 R  Ѝp訅'Б'@%R`C"KR@-L ^xdТ$D ܢ\T @@~, \W R1#P?0 C c0à?00à cΌ SQŒQQP0R0R0P0QPQP !RR SO-`ps딀 %RP@? &R X(3! /[00  @ PP@ Ѝ訅'S p@-8M@ T 0`  P@8Ѝp @P R 0 0 0SP@V P@ 0 F/P@( P@Ha qTꨅ'p@-@P0)Spꨅ'O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P   !,Ѝ'0DSYA `@V@@P'0ISV'Y  ` `D ` T! uz!P n0 0@@! b0 @PYVP'T  `@P,  @` ꨅ'PS'S5SO-M8Pp`6! @20 X@0DS '00S^^* PU@  0 S 0DS00SY Ѝ` pUU ꨅ'EC-`p  0BS00@SP! @00P TQ@@ Ѝ訅'G-`d0SP@! p000 0PP@訅'@-$M@` P31PL10P  IR NRpp "0PPEP@@0S@ (} A1$Ѝ訅'bSPG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P11Sp0@0PH0P@ 0,O0y1&8%0%'Б'@P/- 0/SSS00ȅ'@-@PMލ0/S\ Tp Tp 0RP 0RP0np@-`\80@3P &0D0p@d0c00"SP Vp4bqȅ'~Sp@-T` RpH0@Q 8 PP /pp@ȅ'%SO-pW,S 0S)P z` C000000000CS020S @T  )R %RT|b|/\h2@000/SpGLL/pDPR0S 0/p0CS0p@0@ppW000000pA0P00 `00/ Qx Q00CS0P10S 00CS00W0@0 pR0S/S0@D00f00W@0 P  R*0000t/S0S  P 00CS0p@C0@pK0S 00CS000@200@0ȅ'''SS'8%0%0nA-p`0@00=SP 00CS000S @ 00CS0PX00S 1X @06 R0S U$0$p2N%''@%ȅ' 2G-p`BM6&0@T"ZR@P$ 0SM .S00.S0 00/SSC10 + PPB ePpZ% ``VT&PP@ ^` [. E`m0E[L@#\`0-S0S0@T@@RP.SP0: SVP >PЍ@%S؎'S\GSȅ'SS0nS@-5$0Q @ P@ȅ'SSp@-L@Q50P000S LTPP 0S{@@L 1018M00CS00 L 0 L0pr`R؎'Tȅ'TL%GU:G00CS00 F 0 FtaU000 k&PE U8q0$0! ]#$  B CPP00CS000S Q@00CS000S U0S0S<0<0^1FDF0G_FUp@%'H%Б'UUV'''V,2p@-FM000000 10S 00S 1Q1-1 `FF0@TF1'FˡPP% t1 1@=0S @T D1ʡ A@F4}F1F0S 1 $ FߍpA 0 000 0?P00CS0 0@ 0 00t0 b=00CS0 0S JFlHFD0EX00S M@00S G܅'@%'H%Б'UV'V''&V'0@-`0000 00o^0SP$M4P @?'000P? pV%0P 000S ,J<$J000 p0CS0(00S C'$Ѝ@%'.V'?C-@0mM0$8@P0?_00? 0,@0X@ & 000 0d@@`PჀhTh0Ho@ 0p 0l@PpT 00/Pp 00,0d0S,{&d0(S( 0L0>60S >0S,0S(00L0, (01C(0t>0S,0S l@XnpT@(|X P07S 7S6 >0S7 00SC - 000T 00400$0 0t00P 6=&0S(7S% 00S 0 0St= @ @= , >Jp@B PT @=8 J,=@ =, R , n4 0 m$Pj$00$0<<0SU SV0 0 `@G\.P  @J, 0 , R(0T@<@<l/D$|lP=UdPlUH 0k PUX00CS00 pD 0 ;QDCT 00CS00 ZD 0@@ڲ`P E00CS00 BD 0@E @PT 00CS00 *D 0@wE @P ?PP @07`:0P ᳻@PPPP,: RX00X0, (0P0S `-V`-V P0E0R9pPP, \ B, ( 1(0 P,0SX0077S 0C8#8S0,,)SS @708#8S&@P$0 Q A!Q8 R06(00 R -Q,Q) -Q R0S!0 <,(00CS0 V880S  P 80S',0iIS77$7 l8 J`74,00 9$0$00$04 0 0"G0$000S4$ 7 70S 6,0S tGxj:&060S 0 @$0 ?PF\< 00<0,0 0C0(000,F000$6@ `9O00CS060S i⋞P% 60S)\0S`%OH5@ t5 p5 58倞E)00@:@5 8 0S '0R$C$0D4lmI00S0HM$70$0C0000NbH4@ d4 D \4  G)00P48 \0S,$00CS0 3 R   $03L0S#8$mߍ930S 000$0S 3  @  000000H0T300<0h30D800T0@Pf@3 3P 00RL 00 <,0SX0077RSlmF(0#000(0002 "00"0$0(02, (10103/$d28 pC2" T2" AT0S G$2@ 1  H R- < 0 $ ( $A0@"SS1 @0@ T0P@H10H0H0Sl1  H0S1 L1$ H0S 41 H0s`1 R#$0SJd1   B ?H0S H0S7SHD0 00S 9t@,0S 0  [;,0Sl@P zC<0,000(P D@T$'ԑ''В'Б'@%FD''.V'܅'''H%p0x?V'0'!' QVd%؎''<,%L%4%P%B [z00S t00xE 40 0L)DE0/'0 /' 0/'0/' 0  /'P@-@&P<80PP cR   pV' 0S0/'00@-/0M0@0嘯P FP 0: Sp  Sd PЍ0FP0 : Sb" PP$'ryEVp@-Px@x`M$P)00S ["0`H000``0"!`"$Ѝp'؎'@-P\@$M&0S0S 0C0BS00 000'//A-PM)@s @(`0p8D@HPL pPP  0@PЍ&VL%A-@P`DpWU PK! 00'p'('O-pWC R``%` P0S:S29EԐ @0S,W@  @B0T/S/00N 000S00P R:R0:SPPP@DOP!S!0%8%,'P@-@/` 剮P*  0 뢿PU0 "U# "`VZ0S  0 o돿0S 0S PN! ~pP@P> ER~    0],' @-PM@Rqh1p000 Q`!pWZU x@?U `?T?U<@ 04AS 00CS00 ~? 0* 00CS00 n? 0 ЍU ??U P000vJ00CS0L00S <??0,$'VVVL%V''VVVp@-P@@Pp 0S%SpP @Pp@-P8@Pp 0RٻPp@,PP0P- 0S RP P\ 0%4'G-`@嘀0唐0P0p 0S0 S0S00PPP|U00CS0$00SG9p'4'%'0G-@0`0Pp Q :RQ :QR``R %Ru 3$PPP0T:Sp0<@ 0 /PSu`P$''W%A-`P倀000p 0Sp00J>P@T`|V00CS000SA'4''0A-PSp R+}h`a@T"W p000@m0 @0 0 L00CS0H00S `P `@,'''p@-P$@Pp0@P0,P@-L@000@00 O00CS000S@m',''O-PM/`@ 0P @@@ (CP00š0 0S 0S 000y#   P@ AP @cP< R R R 0S  0  # R00 m P B0000S - Q p" R[0 RL"00Hp0  pP[ X 2@` 0=00pЍQ 0S/Q0S[q "P  P x"P R  R ( CP0 Q<Q 7 0@D\ P Q  qP@0000S R p  BR 9D R5 ]3 s$'W%','H%WW8%W'O-@ 3M`p%2PP*0S*[ "0 00 `0p0Rz0#| 0Z8 RhB<01 P =PЍbPEU( (0p  `@Q XV  00X!W QPYXV E1 0 0 W0S& 0s1TP P*W 00SY0 [  P 0StXT 0s  P aw=T4W؎'4'L%>W'$'%p@-P|`0000S S@:H000 00 00000CS0p00Spp@\''0@-Ml@ 0P0000P0>00G 00CS000S =Ѝ0'@%'@-aP 0SGO-`-|MpP@$P0cS    @:pP` vPP VP@ - RsYcS"  U;ܢ[*P VP  R񟗆tHXh 0R .PU`D;%U 4; P& ;;[ 00S A00CS00 B; 0 0@ T Ѝ;/ᴩPVd!     [ZU!Z;;@PU;U~LNU U UUC;0 f@000WWW؎'jW&WHWWWL%X$'xWXW~X1XFXcXO-$M,,R pC0b@  @T- TT:T"  T /T" 00CS0@  @0D S$` F$Ѝ0S R 4a@T00000@0S?@Pg?>P@ @ $T аp~X =W 0 0CS00 S00CS0 0 00CS0 0 y00t008%''@%&MA-(A0S 0PS0 0aqP0S00 P000K00CS00S tP 0SRh`hp0P RP000K000CS00S O괆''''s@-0!S1Ѝp*S@SP``00P Q0C RP00C S@c `1@\0S00S=STT00 D0 R 0AD1U0 0S 0S,%''A-``pP0@S  R R00PH @괆'O-Ms@0S0000 0000,`آ<000000000C <` 00@0000$00CS$0C0S00CS0(20S  P=P(0Z00(P= P J(P 1X0 DC{0@0CS0t10S mЍ詸0SJP$ 00[. [`+ V , R:@ 0 C\A/@`F 0SX  BR  R  B ~   B `FAQV  R@ @괆'8%'<%'''&M1O-p0PSp0 Ѝ1嘱 @` 00Y :[V0S @ xQB `P V' Q`:00Q @ @% Y0S" SئP ӦP@˦P PƦQ DoP @@` 괆'8''x%KhA-XPX@X`P0p00I0p0CS00S |괆'''@-D@qF?0 @ Ѝ贆'Q@-p@0` 0S*00DP`@姴P@0`SP Ѝ `P0@P0`S@0S0O- [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR3@P0P/P 0S xPS@ RB0$x RP  R \$Ѝ$;PX:$P 0U0/Sl 00E}pP $0S/00E0S``0` xQP  0/00S hV/00D x00SR00Q: 0  R@?м0P . B.Q/o" R  0P V 0 "D$괆'0nBh'0  Q0@-0 @QC\0CC/x^ࠑQ@ Q 0 A-@QaT0S 0@ @@?S*S  [S R 0 p00$0SZ P $$$G0$000CS0L00S 0S 0P 0괆'''p@-@ PTp 0@ @@괆'G-p @00 ST@D؀0P `V z`RxP VP V V@ S`` S =RR QU  U0P @"KG- M⨀0`@GP0 _(q000e U00SV-00ED`PIPE@T Ѝ00CS0@̼' RO-@@0M-S`P S! C R\?So @Sy 00C ShA0 0,`90S\ 00S=SWV70 Rڬ7 RN0aF1@ 000U00S pgpWpG 00S; 0 0CS 00CS00 ~ 00CS0 0 00 6p즟ؖPW@A0S 0f0CS00  P6FBЍx6P6l6`0000Q00S 6 pR &V(0 0S 0S/0e0CS00 w 00CS00 v 0S 0|e0CS0]0 !00w0000v00e: 00S 0 0CS 00CS00 ~ 00CS0 0 00 00~00 0  0000CS0 0 00 0S 0  000000v3г 030`3 RL 0ppUppWㄣ~0m R  R9 V} WHs 83 BR  BR j ~  BR s `2 BR  BR  ~  BR   g ~ a   0S  QAQAQ   Q61  ( ~ AQUd Ra 4q BR  `VaQ~p 00S T 00 S00CS0 0 p00CS0 0 00 00~00O 0  00400p 0  00''&M''`GdG@%'',%8'x%O-0-$M00 06 0=``dVdp0  P600`G6 @ V 0@P 00@S0(00 60P@   R@@0% T A*% R *R@R Z  JRG| A@ TZ  + V? [7 0  BR & [0CSV0F V``f` Z74 00BC0A000000S1 0@80-0  [ 0 + Z R CR 0S00[F00[ 0@S30S 0@0 00J S񟗸<$#"## # # # #"`3 BR  BR  ~  BR  ~  K R  BR  ~00  BR ~0 0 ,Rw[B0mT@ 000ST @Z$ЍT TL aQ00CS0)0 儁00I00 : P 0C A 000 1 1 0AO0000T00 :LP 0 00S@[@R p R0 Rp Rp B\T   R0S"K'''8%@%sX'&MO-0M  P0 4400̴̔0@ 0~Q  d嘤0 p0@Q Q#:Q =Q Q Q     BR  P AA  p A P񟗁(X&))8)X&x&' 'd'X 0S@ЍQ Q@Q =R 0p(0  BR  pwp w    BR  u  r u  BR   a ( R  0BQRQ B  X  BR  v p}= v 0S Q AQ~@AQ  RX  ~    ?@@ M  7@P)  ~R&=Q0S! 00   @8'x%'8%'Б'x1G-Pf0lAlS 0000X1Xq0P0L1 ` (V0 S000`0`0CS0!0 0@ p  0    0  R 0s00k 0p @%'8%0%'Б'І' @-0l@U8%O-TAT`0$M`F:0PEPE000PCP$Ѝ0000괆'8%'Б'O-aX P0@ 0p R    000XP X 20 E0P0C0 Ѝ0S LL . 008  @D0000D 봆'<%'8%P%X\GXO-@ r  DPR0400 ` R}먂 R    00h2TP`8 T_ T@-@FT+: fPR0CZU * TR Q  S0D2@ LP80Z0Y0S@@T: Ѝ@FT: 6P5 DZU *0TS0Q00R D2@ PZ 0S@@T:@PF0D0 0 C00PE0C`F0T000@ D00C0CS0 000000C00000000<%''8%C-M@Pᬐ`! 00000吀0p0p00CS00 p0@ @6Ѝ00p괆'8%0%'A-Pp@-A00CS00 ]- 0 ` V-00CS00 F- 0 ` V-`-00CS00 )- 0`X%L%@-X@-X00S/ R%T0QH0 0Scq o/P0//'%0    B /'A-@P堀0p000` R$ 0 `0T    0 0C@ S000SA,'%''0A-P` @0p0W0 ᣧP 0X S S0 000 00 0h0    0 0$PT T>00CS0 00SA%'$%''A-4b4B0 Qcr 0S \,Z,r0S@0PP0/0P2b000r0Sc00CS00  0S 0X0#S 0P  0P,0  00P0 P   PER SP   BR 00E0CS0000`0L00S Y,80+`Q%'4%P%X@%H%@-L@00CS00  [p00CS0@R'@-8P@P 0     00000 0$00%'A-P@`000# 10V |`0Pڝ#p0PS H0  0000CS0 00SA'3%''@-p0a0M0P0/@P{1P(0: S$0  0 /P  _rP/00 00 /h#T/L00CS0,00S Ѝ'XXYY7Y'A-Qd@P0`00 PHpP<0`00CS000SA}''%'p@-`P@00P0"P < 0S00<0X 0000CS0p$00Spp@N$%'''0/%p@-@,`,P0SpSTp[%'OYp@-P@0Sp%'p@-@Pp P0Ppج"0@p% 0 R/% @-@0@1^ P   U`p W Q Q 00 r B"Q q A,PU 0  0,'5rO%A-R0S20SPA`R p U".pp PpW*1 N !/p ")"7P . 0P @|&&&. qP ,10S0000000W@00CS000S 0S @`VZ00萠i @N0 Z7@Ꙃ! P00B R @,'''@%@-@S`!1pP@! [$Tx1@WV2 h1N0SP U 0S0,+V $13pE9!p"m"060S% f"c"`"Vu$r$U 0S P Y*`A*P PPSWT$0   ЍV긌'܅'','@%%YgX08 N R S  0S  P @%O-pRBM0P0 p` 50S0S ЍP$$0 000P@00 !T):U 0S0 10S  160S  0UGE RE C100CS0l10S 0S 02   \ P 0Q R0 @|. \ ~  ^Lo \ Q  P 000 QWP@~  ^Lo \ 0L'',''@%H%' G-pPJ@P DP1N0St `q2@*T @*^2pt8 S㠠`@0S0S 0S0S;`@Y 0 X 000 E@%%jY,'A-@P| P PT0Q 0S XlP@ pP@ ZP@X|06 R0S@@Q`` 0pG  0 0 SkB[؎'@%L%O-@Sc$M5 PT  %P )P pnQ pQT P@<X Y(300S P P$Ѝ0PQZ`pP00S XP pjY  \   0`P 0S00Y 0STP  o'$260Sg0`00\  \ 0?o2? TW K'\0#Q 0 !X R5  p"P0S 0S00 0 RZP S  R 040Tp/o" RP 0 S0C0 3 p0SYX X YPPVc['g[}[F[,'؎'X%@%p@-@(dQ000` R 0S <10p 6!0S 0 00D1  S ~0 0P0RB o` R\ `` R00 㒓0S00CS0000S fp'%DY,'5rO'D1@-Q80@S s[#qP`0SP00CS00 " 0 $0T0p k6.J!P0#pP000T00CS0@00S   Ѝ,'ZZuZL%%Y''@-z 0@0&؎'@-@ o @&p@-`@00  p 0Qp\ PU"00p,'[O-TbTPLLLr 0@0U0S  U"0PE0P ЍS S =S\ 'S " C 0CS_@`x_```x```_!$0PU0 R$ \S0 \00 S0 @ P   0@ P0#P!"00 P  0  @}00 S$0 )0!"0T 0@ 1 }SP0  :0@4 "0 ,'[[[%[[d[[A-@dcdsdMTZ 0SW0SHbdbbbb`bpbcHcpcxccdd d8d|daXdpd@dLdddddbbR 0S  "%#00CS 0S2l""\@H<80@P bU0SЍ0S PЍA 0S  ztp|xt hdT0La8P dP aP ^P [P X PU @,,'X%\[f\[[[[Vj [[[\ \\1|%\n\\ \%\[[e[[0\Wp@-@D`PTpUPU 0S G@7p@-Pt`t0PP6 R@N0S@2@@0S@D. 0    p0 p,'@%A-0P@`Tp R@ 0N@T P 0S@@%W\0HU 000000V0@ 踌'@%%@-@ p P 0 Ѝ@30Ѝ6\O-Pq 0M00S 1a Ա100ȡ 0000 S  @PЍ0SG 0 RS/Q V C%P 0(ͱ0Q0000X00S) R@ PP0S:SU@!00S-@.1 @00CS00  0 ( `0SH0@ 00P'|'X'\G','G\0%'U\H%8%A-M`& 1 000 0 0A^?0@ 0QS$ 000QPP PpY-00CS0H00S UX2. < m ''؎'"]L%]2]%8]W]w]O-hsMf@PS`P>Ls0SC<30@TDUP3X @!0  @ @ythX   X 0SB01 `ЍSVP aV HVP@ 0S8X0S UPїP= p 0/S9S W:00C⒋+pÿS  z P 0 ( : p+.L 0 d @0(IT0 S Pb.0Syuz0tS xztg 0 ) 0P]]F؎']?0]L%K^g^] ]]^^'^'@^ BR00/00S/@0S/ R /0@-@0000C S ԓ RR R1\0*Ѝ^^000C S0S//QX0 0@-^ @P U@R000/@%p@-`@`P6N0Spv@Tp " @  p@P @%'[^G-pPR@`Q7 S`r@0S 0 g `V@A00CS00  0aq唁 @ Q  R  D@TPP,aHqH0 R R .@TP@00CS00  0 Q ]P @1@ST@Q@`Q JPGB`V0@ @%^.;__^L%#q __L_3__%_80 \#P0@-@%;_>_0S/p@-@PPEPp@ + +A-@1S`@D`pPU 0@P00` P\'G-@PPaP000 Rp-Q Q8 -Q R8 P+Q, 00P T00T 0P 0T0cP0 oP0S TPT40@@T0SG'܎';_R_@%A-P R B0– 0`0Ճ0S 00S0S006X pWbP ^P6p60S0S60N0F S60N00 BS/o" R 0 0-S0F0 1  QR00SQ 0S!0P   000S  00^0 PA. R   R0 0@%'f_('PG- @@P0Sp` 0C  0XZO0A0C  R0 0CS0@00S ~0S )t_'_''P0 @-X@000D00S 00CS000S Q'''000C S/ @-P 0  'G-0p PR 0S6Q 0S!0 CB10@?`! :,k`` `@c0i `` -R \ -Q0S `0@T0:SE 0R@/T/:Y  @`2@T0:S   @`#@? `0 :\00Y00 X @0 CB!08( @ ЍX%____P%&P@-HD0P  Q 000CH Ѝ_'Ў'!@-$0S Q,0S-\\ -\\ P0 ^:P0S0\HP^0i@:T($' `_p@-H@HP080Sp0u`0CS0` 800C80$%' 0R @-@T o( 0 B   B /@-@0S@p@-@P0S0ڈ00@0B2 ! ! !!  !!p@-@    @$% 0S/xQS  00 S/00 00 0S/00/"K04 00 0=S0/S 00"K0 0 0@-$%`p@-`R`@PP t00P pd0 Pp0-S0S0 0pV ($00080@p谋''`$%O-MRp00 p R pl2l"lb@h  0SXy XR00CS0` 2`@@20@0@Ѝ\Y7R @@ P*  BR @@000p 0 S B R @@ Y000p  B Y Y  YR  Q P Pp P  Q  R P000<00 { d Ki%|G8%0%'$%0-@0LM P R0070 Pl l ".UT 00T<0< A 001 0 $%`a-a|GBaa@-$M@ 0Q 00SPp@`T*vpPT @T%PLP @0 P $Ѝ@0%8%'Ra`al000S p@-XP@T T D0T@p8040@p 0/$%$'&ta'%'0@-@$'p@-d@dP\Pp P 00008  P8  p@%$%UG-DR0@T @ B 0S 0 @0r 8 0 00CS00 `)V*V V v va G ` 0F S(xxLxxdx V0@000 @\V. |V ;V&P0 @ ;P0 @ E@0L Pp=x&P0@ 6@0o|P0@ -@00@0@.p P  00P000K0  $%%''*OG-pc00@ T T+P,0S)㰀" PP @֎ n@@`P  0RP @FDA@@T 0  $%Hp@-`0$P P e 0R$, (@R   RP8Pj    Q  00000S@p 0 BRp@ U080@ p$%a@-y0 000$%@-@oPp@- @fP P @0 000p` P 0`@`$%O- 㰑`P0  P㜱@APp0 CR00S00 p0@X ',10S @%X U \@P@W W- V- L0@PpGWPV VoP 0000 V p0S 000$%|GG-JM0 5@0 000$04 00400D0(Wn`P $0S $$ 4 0  |4 Snt$0000$`SH4 `$對,4( ($00CS0! 0S$@PU3 0RPPS p10PS Pv '30S l3p@p3ppL000 0S 0 s`PPA P5 \P p'200pd PP0000 0 0 21 B#20#"U0"P R \00\0@0 $P00CS0 P`@0000 V@ "00CS0L001@@PsF n@m1000S 1 0 A0 SGl!|V@0  0 @00C0,000#0$000CS010S ;0 0 0 0 02 P B1 0R @z0PEu`0PUZJߍ6{00CS0`R {00$%܅'8%'%'0%'aO-؟د0ϟM0 Q002202280?_@? 00`0"00/20S@0Sʴ@ 2P8XPtTȭ,@0 0/Q00S .00CS0.0.Q00S 00C00000Pa210S0xPVTP"P_ SPMpMxU0@#SG$$$$$$X$$$$L$T`$$$$$$$h$$$p$x$ p00@ Sr0pG A0@Sr7pGa0@SQrWpG[Lp0 S00C0t00" P *'P 0p@W00@S p p p p p pq0pG00@Sq0pG`0@? @?o2;R0Sp ( \\P\Pp ?PpXWX 6;G S 5:0 S@ W*00C0?0'3?pp000 S0 0C0~00ĕ0 0C@0pW'*00C00'60'3?00  R ~ B   ĕ?pAp000 S00C0~00•00C@0W$*00C00'90'6?00  R  B ~  ĕ  B 0'3?00  R ~ B   w$00C00'<0'9?00  R ~ B   ĕA0'6?00 Q~A•W?p00C00'?0'X,UP/>P0 |P000P$@90 ЍP0 ,  0P$0 &P00 0_<P >P &P000p0p0 ((0 @0(0-P   p 00 H$%%(N'0%''aKbbb0bgbtbb''8%%'"KbmH8%b*O&M$L {P B@ < }  h p {S D  B p/#P0p*0}P$  @@   ? 0 }PJ0 p 0C$  @ Dp0H! , @ BR #@jx! 0 = BR@ Ĥ0O0@Wj%S` :S/ #S0[ 0 p;0C Q @ BR @:W0 0 @ R&  B 0(0:E!p0ᜲ ]{P H02!R1S p0HS2@p0 pXp{  X0`2  !o,!!j00S }S Go᫲[| p'P023Q w0 00`"0 !`$0 0 @ B "  $0`2  !G-`ԀԠ0@T@@0PU 0@S 0 0   B/o"K`0 0pS 0 R 0 0 0&$%(N@-.P20@-_M0$ 0 E1< 00100w1x0000gPI1x 1@Q  @<00 do 0S $Q. 4QG Q 40 1(0  ,8  (V0000 0 0 0 0 S00_ߍ0 t0 `0 H0 D0 H00SPgS,0 0܅'@%ԅ'$%(N8%'&bG- Vp0 00 P" 000P6ꈿؾؾؾؾؾؾDDؾؾTؾ0$00p@ [P 0 R 0`     u00S 0 00@% P0, RPU 000@ 00 00 R, RʇP4 >00300 0000    BR   00n` P 0000 CR Sm0  P P` ~ ``xs 00008 @0C 0 F009`0 SpsP \0 R   L000`0S0 R Ӻ0 0P 0 R000$0  oP 0@S P 000b `@` 00P0`M P0 000000S$ T 0S y0@00000S0P0S@0S 000@Ѝ0$00pV$%b4(%@%A-QQ@`` p @00 P 0X@p 0P R$@@`,R ( W% R"pk0` 4 kP %/Zx`P 08 000C0%04`Ѝ Q  0Se0 00 00 @ 0$%%bcA- @0P P/ 000`P 000p0@``@@xP 0`0 U000 PPe``0SU (P$%@%-cp@-PP @0 @LP P 00000Sp ˽pp$%@c P/0S/80 P/0S Q/04'p@-@ `P800`Pp@-`jP喽 PP  Ѝp @P| .y+y(y%y "y  .V 0P/4'RQ% &Pp@-@ PS  P i`I   EA pdA-P@\p`T@Q00C0V P( [@4'p@-T@T`0P0000H00CS0p00Spp@'4''P0p@-P@TpU@`V P `4'p @-@0 S000C T D P ,0O@dA0 T @@@0%gfff4'p@-@`0 Sڌ S  PPT  p҇0S 0 S  Pć0S 4''p@-P @20Pp 0  0p4'@0@-@ P  Q @ 04' 0 P/ R/4'C-@S0SS|h R 00CS0K0 - tHX%ep@-@0T PR R R& 1S#0 ΃PpR!Q QT " "D0600S0T0S 00S0nD'''@%0P@-00 "80P  P Ѝ"fX%P'QA-@ 00CS00 xpxP ` C?U U P@U00CS00 `A-@`xPx@0p000S 00S kp`V@40`00CS000SA'H'D''L0P  A?Q Q R:///D'@-@bM0pS10S 0SPP10S WUT T TP160SPPP0SP1N0SPPTP `16 R4T! R00SPP0Q7 sp0 0S" UEonsp$ W`RUZ7@D0>T000 0Â00 p Pt0N R  DTR 60SЍQ Q2 1 @D@D''@%Ԏ'@PO-P@p P `P P 0PEpSUpUX@@&` PP`Ppl44wPPEpU]X (d(t(P 0E0 10ST@ T@P@UT @csP1 R 00ST|y@ TL@P@UT ,0s0@Q0S 00S iX@@T`X ̢嬲pG`Y P& P?U*X? X, 0Sl <20S pP@@0-S0S@UpP  MPP 5PP1 ~` a0S\  0E T0 S R0T00 @1 R  U@ ^00CS010S >P~`PPP@q0S 000~T 700CS0t00S @@T007'f"fL%D'/fff@}'hH%ff'G-PP@0`嘐 ?pD 0S 00S 0DE0@o000CS00S ٵpW@UGL'D'''p@-PD@`02S@20CSpqV02pD',0T0SP/0S//D'C-p@`1010r!Q0@S10C1 ЍqXPU X2ѿNPᔸĿP 0S ǿD''$0@P/!!R /D'p@-8P\2Sp@xur\BpD'0-MM 01`"R !R X"R   1 1d"1!d2S 0_\Ph10 0W\P L!0000O\P(10  I @T0d`0P0 U @T 0S ;P00CS0 !!p0 0$0(0,00D>S 100  "!031D''܅''0@- `"d{D'p@-@H-'Pn PPp0B/U00p(Ip@-T@TP0 0P0 0 0000CS0p00Spp@襴'4%'A-p`@PU 0PPEU` XD0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000 00 00CS0h00S DsDP`00000C0 ꬑ'''p@-@P@0SH00Spp@00CS00  4%04%04%@-@P$SЍf-@-  Ѝ Ѝ/-$0@-  ЍЍ/4% -p@-Ml0, @P(0 0`0CS0a0`1@00DЍp@Ѝ/G-@'`mP$ 0S! lw0S00CS0>0 " u00CS0/0 " 0S pW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU SPP 00CS00 g(I4%0R4%@-@@4%@-0rS(g;g0G-@0 p0R(0帀P0=00 m=` m`F@V@p@DR000 S=S B`` R`ť` @GcP8%'0%0@- 4@ 00C000 0Ѝ輑'`g0P P PR /0@-@LP^ ^ R0L00/"KA-' 㴀0S RP'p`@PU pWp0 \ 0S 0S   3/P@P00ؑ'0SeA-@@vPxU p`pp0S'SSP@HAL'VlPP,  EAfhggg7A-P0@S`p    3/@P@PX "W p0@=SPU0P0 00CS00  0 00CS00 w 0 T XQL% uO-@0Sp 00ЀP0 `V S0 g@PU* ЍY   R Q ʁ f @0aP`0 l꼑'ؑ't'@ 0R S=R/=R/A-Pp0S=SRpGp'yh0h`U!0@a`T 0S  CPU``@꼑'ؑ'1@-`0@S @ PPV 0 ` K d_  `C Ѝ@@q   R <0 2/0`v 0R , R  c0a0 00000@!L @UP U0 ]00CS0\00S ЍY0#L 00P P @%g'''@-@P= `&P pTpP Swpp0  BR = T   `\ Ѝ00@0g\0-GM0000WP00$0 0  Gߍ܅'p@-6X@0`P @0U<,&0 `00$0U p@꼑'gg[^-!0$MP00S 0-S00 0 R0   Rc  | Rf  l 6QiFQlLQp Rs    ^$Ѝ'gԎ'('@%'p@-@XP`000T 00CS0p,00Spp@!@''7@-P@T@ PP0 P00p Ѝ0 yP 0 @%00000 00PpI'gA-Pp` 0  3 0. @TPUA@ 0@00`ؑ' @-;@P 0S   3/P 000A-P@`T PP 0    R   2/P @@@ pP =i@@'O-p@Q0`rSP W 100S V'>nP pPW`0I?o2V0S Ep`VD10@T0  ЍOf 0P=S@7 P( PW0 00 0  ᢯`U 0 X  ЍU0 00 U 00S -W BP0&PPPP؎'gg@-` pk@P@ Ѝ0  R@ PR000 00S |0000    0   @@DT@00S '\G'A-`pĀ@TP0U0  Du  0 R R   0 02/0  00 0000꼑' %@%A-pP`@P 00`PPEPvT` eTp` fTxTp`X @V Y@ h؎'PP@- h bhC-pԑ0P000币-S`@TQ t@ 000@0CS`0d10S  Ѝ @P=)hP 0 @0 0 0  0 00 000000  RP 00 00=S l0T 10=S100C0 PPP'' %@%'  'p@-@PTpv@p@-PdP@ \ϭNP@ xP@ IP@P(P0 P pWCh1h؎'00@/0 S0@/s@-@x0 0-P`x0S x0"S U1r0p%!*0S`0Xᆭ000 @0C?o2R0SЍph%h@-M@ P ލP@D0 SQH0PP0@-M@ P ލP@D 0RPH0PP0@-M@ pP ލhP0RP 0RPA-@`P13@ 0SC P UA  PPPpPJ! 0RA @- 0-RS# 0S00 0 Ѝ0SX00T0 S00080 ,tP$JJKhJ0@-P0M!S@0SPЍ0P{ 0SxPUo U U jPo U P? PPEUR   ( 8 H X    x         O  P  P  P  P  P  P P p0St00@T @20(S0)S 00qop@-@`P(P} 0Sz00CSt   , , , ,      0 \    &tooptPttP/`@+TV$@` VT`@V0`@ P0`@P0`@V0(EbU0S0!SPpp(S0)S0S pp@-@PsPPEsP.U)     , 0op=Pp0\0!S0P p(S0)S0S 7pG^ghh@-八0: iH%(0@-0 00 ,('H%Bi@- @o R1P\0* 4ЍiO-PM@( U0pE `-R lRF 8R -R| P)@P 2 000J @P V*pe pGW` sPpW `dd`F %RX aPPx8pW3sR RP3pUP`/ RpE@@W1 000 ~PPP@U\ *p #*Pp 㳪dl㑪X1Hr@P )@P0S0Sp@u  Eo Y0Q  RP!|0*QPau R.pu`  xTT{w&%73h4yjiiL%`CB&ji0@-DMh0   0@@DPU# @0      P xtt, Ph DЍ0=cP "k','^-X%jx%l%_[^jj[p@-ު00S | 00t 0tl l0l@0   PU L@L0L D0D P p Pp'''$%'4'd%L%4%H%P%p@-Ơ0@@倶G0 0@0PU@000kd @0PB0S00CS0400S Vp@i@C',%4'@%'\''P/p@-@PTp000@p@-@@aPTp0   SC00000$$00 @p@ o00  }o00@ pQ0@ P  /7@-@P4 0 P  S'Xd0 0 000@0 Ѝ0O0 0  0 000  00 2  0 000  Q0@-@PM  0  %  0 00P0 0v@Ѝ0@-@`PT@ Ѝ0000p`@PP000/0P/  R /P/ 000/L' 0P00/L'A-@pP 0` V  V @00CS00  0@ 000CS00  0`L'L%A-p@`xT [TP 'T` *TT "T[ RLPH\0DSxxxxP xx\(xxxxxxx0xxx8x@xHxd7T /T@Pp+ 000C R&AET@ 0@P 0 \ pR 0  R0 p \@@aC\BW0CAC\70C00C@@ @ @ @ @ @@#k%jL'j@-@qP`P \P@0 cS 0<0 Ѝ0S@00 #10#7Q00A\ @5/MS0-S@5/^S   4@^S@0?S0ꐹ%L'0 0('AkH%A-pmX@P@ULwP00`E ,V`j00@00L']k`'@-@ R Q@@Y80  r"P LukkL'l s@-0@T 00r` `PU-ЍpL'k@-p0PU@` Ѝ 0'R"R@@0 @`0 0S D 00q @k@`L'kO-0xd-0d4P ,M1P0@1%`P#p3PEAULPE@ꋟ0s  00P@`V0 S 0S\V $SxS@00CS00  0$ P%V0%S@S00CS00  0`l0*S>`0.S0@*S4@YLt<Q`(K@0xY0WY BYR +%Yw AY* X0I Sp'l"l"l"l"l"l"l"l"#%&p'###l"p'l"l"l"l"l"p'l"l"l"L'l"p'l"l"p'E0IS0Q[  $0'S"S"Z 0S 00吪{[v' t  iTP  lP T" l^\s00v t 0 }&%kk,kk%8t'L%GTL'k\\0LS%%%%%%%%%%%%%%%%%%%%p%'\ \\ "\ 0 \ M0\? \@-ÕÅe0\fnrtvabXP W\ PX Q \  P\  xo 0vs  t 00 p{ X0,  0u @ Pt  p0 R0 0C0@00  B+ 1H 01 *t v0 t  to0$y0$  [ 0t 0wNVBT,Ѝ3 忤l0C-M`q 0P` Pp (@P 04 p @PC 0p W  ) PuY <YlPP0( 0ES P Hژ 00S00H p^YPH0?S0 -S00H0,Ѝx( ll PDoT<†pS Z Y X W@  U PCT<p S @[  Z Y XW   PT7pP  X W P T;%S( < S. &S)  S$ 6 CTy"  W(  * /49>T`P($F$V0S:ЍJS@ThZTcYT^XTY5CTT5CTOTLp5CTGX5@CTB@5 CT=(5 CT8U@T44CT/4CT*4CT%4CxT 4 Cq$ B 0hT 0S`\`TP4@CYT84CRT[KT 4 CDTZ=TY6T1TW*T3C#T3CTx3CTXPL T@3CTW$ TW@T W@S@ S2 CTWT2 CTx2 CT`2CTH2CT02C  0 0 d @CpԁP0SU ttrT   Q  %0녑 P0t  UUtSP ptu-u:uFuMuTut[unstbu liuusssssssssssssssssttts#t+t*t2t9t@t?tFtMtLtTtSt\tetdtmttt|ttttttttttvsjsrsttttttttru@- Zwu%00@-( P 0 0 J뼓'Cu%vs@-@`i0 00#S@yPi0S 8 700S 0 7Ѝp|v0S/#Sp@-@,P(p0P 00p輓'Cf@-PRP@ p`Ap 0R" Ѝi0"S0SO 00SS  00@Oꐹ%p@-Pd@0S 0S 0SS <<< U   S(000P0pГ'2̇ ~@- @Q|H7 wf P X0  P        Ѝ@ @Ѝv<~Г'0@-@MPP 0SPH00Ѝ000 0pP0 0 U~'m~O-P||Mp` 0S ;$ , P 0S ߍP/1 Q 0S s?@0   P P@ P@0ST WpU: 0S T p 09/PV/ 0` `Г'~~U~~@-h0S S S8 4 ЍPS$ ЍDD~7@-lP$ R`t6;@ H$0S p0 l6  `6 Ѝ0Г'ș',Wp@-@P 0S Da0PS P00 } 0R0p苀@-H@H H`HpHP0S00 y%@-T[PL0 p@.h0"S6Ѝ裀Г'@-T[PL0 p@h0"S5ЍҀГ'@-@MPP 0S00*`0 /`7P$ /Qp0` `0 0'PT 0`2# 0 0P!00 00ЍU~'Г'0C- @M^ R2!<#U( |hQ, pXM0 dHI8 X8E4 L(A#4R4" 08("4S 1 "4S *!4S #!4S !P0S x!T0S \Tat唑Pp8W4 (ЍCW0S@ ᒥa 0   0 (0US. !S 13 0U SS0C SHJJHJJJJJHJJJHJS 0U À0 ppPh%vIPW^el&u~O7ʁ^7O-(Q ,@Q 0QP Ѝ4QP\PQH80S,00 80<0S804 <0PApPPAiP1 QB">_ȑȡȱ`p8W0aS R L <0R DP 00< S 9P0pS:`(cQ +(cQ $@P0S0 BS `a 0h R R* \*a  `0(SD0ԁ8xГ'b5KO-;$M `*R 0P$S ߍS 밲@pĠ$ˌp@0 0뉔ᨛሄW YX( 8$ f Pf/j]a,"R 0Q RR !,"!R !` !`!Q Q @p 0ꨑ!P#.   P," Rx `l,a! $a$"#. !$$("(Q* R `Uj 0S 0P R ` 0E 0! 0Ro j+ 00 @1S jF f/j`01T T%Hb ș'Г'߃VEW}}փWEV&.h„'h%A-P@`!pP5S$ Pv $0f0Qp 13%R 0R00000( Г'ș''p@-@, P  P$p@dR 0@- 0S, PГ'@-P  'O-@- CMk M:P p00*8P 8OPP008 800S : SP  @00t l0S aP,X@ (\(0 0 ( P C:PHHἂY90 $0  P$0S F$02 aP,唙唩$ [ 0S$00  P$00  P$00  P$00$0 @ aP丟$& $ 2>P($0S  S;ƑZ0;s 00 0P$ 1\  h@  Y= 0SX8 0(S(0 (0 0FaP  \) P$0T0 < a P 00 $0.P$0`0  ` P 00 $0P$0X0  ` P 00 $0P$0\0  `P x `P 0 0 $0P$0d0 8 `P 5 0 $0P$07  ` P 50 $0P$07  ` P @50 $0P$07 r ` P 50 $0P$07o bD ` P 00 $0P$0x0_ R q` P 00 $0P$0|0O B80 aH0 S0S  _0Y: Yx0 *$ 0TPSH H 2 00S> 60 0S @pCލ Ѝ30"0 000 0 SD 0@^  RQ<0 B*0P4\  BB! +^ 0S 0 0SO 0C RS]R]RR]R]RR]RRRR] َ 0 0 R0 00S 0 <0  d2000"0$0 00$0 P =@$0!S 530$0$ 2 B 0S P 9 0S$  _v. 0 S Pl $ 0S$ ^ 0S[y 0 Sq PP  0S$h ^E Г'm~v\ zDYdi?U'w_'”'ą҅b'4?Sn'U~lz%ކ0s@-`PU V  P[@P hЍp`PD!T]<0 L0@ݎVlz ?$00S 8@-a00%p@-@5S4 0PSP p@WPp 0S 5S 1S /Pp5S X `Pp@ LPp(( Pp/Г''R7edArdAUs@-PA1( (000;ge( V 4 5S Pqa0S ma0S 005S  P0P(5S `ЍpX XkPH`4bPГ'WEVfdfmdw%4b'gd@-@P f/\@' 0 D%ę'md0P:/ 0#-3@-P)X P 0S S@@ yvP@Ѝ0@ Ѝ/%p@-4@4PQ#p@`  @%@-Mp@p0l Q d P0cS CS SS 4忍sS00ۍ0ȹ'b)@-MX@X0T Q L P 0nS yS0 $圍00ۍȹ'$Ry0@-MMd@ PP 00YSP ,~ۍЍ0NPꈎ 0 cꜙ'h%@-@M,0 XP ۍ踎V@-$ $0 ЍB꜕'h%'@-YMMt@ hp\YލЍ<0< S <f%Pژ10YS<0<0CrdA̎*@-0gj z gz z4 'z'&z'z{zgzzz{Ѝ5(7@-P0@ 0$S0S Ό0S7 TQ,BQQ, Q9210S 8@0 [0000 ! Ѝ0C0ASgggghgggggggggggfhc0A Rtpzg{{' Q{ zg{k Q{ { { @ȹ'<KP `00CS`0p S00 P0S X0X /X%G-` 0pP0zY@P r-pGZT@Y @0 @rJH&뜠pPF[ 0  Qᙝ V ZPUP P pX`Ѝ菏eh%O-M M@P`/%u倅倕0S0#!pO P ?\P88 P(p 0 p3 P > dtT(p  P 0 8P Z.Pd⋾08Hd8tDT( p P 0 8P 0(0csS, p P 0 8P 0,0cxsS0 p P 0 r8P 000@csV(\(,,004488<$"444$"444<D$"444$"444$"444$"444DPPTTXXQp`pQ(P"440E("440E@`0`V@P ~ {0T0E0T0E T"440E'@-@l40Pm08Ef/UWEVP@-@P TP8#!00@QWEV'80@-@0S C08f/Uꔕ'0 \ P0//@-LL@LPL`0 @88P R_ 0`4%(%P7@-@ P 0PPP 0Sp 0 0'(WP0 Ѝ0й'vd0@?o2P0Ss@- `P@VP VP0 VP0 VP00U`VP080DPD p0 ('Ѝp>4q$PTй'udP0@-M wdPd@ p Hz' 0 400+ +Ѝ0й'zd@ɗחs@- @p Z'0  v0 p0`P   g0   `0  hY0  PR0  8KЍpй'td@ #;&Y̘p@-( PM@`PX yp  ( XV V h PЍp ( QH( ^p 0&0  й'}d(@)~d(;MP0@-M @  PP@ &4P4 6p0 &Ѝ0[й'{dЀC-P!a威0,M@p00 4p0Shh@@@  p  @&eP qP pP $0Q `0S*@P t&@`QUW U0 {C R00t` 0S,Ѝ00* *  tP@<,%й'|d͙$~&jO-P-MM )@_UP40Ss40}=$0(,0$ p P/4@,`D8V (0, 0(000SڍЍ!# С!!(@`F #%UP Bcp %U@PdR8QppV @0: S \"\\;040}=$0$0(@,@0@0 9p ,4p`V1(000(S0P:*  0P3@@p  눁刑刡T !  h`!R0$@(n(pP%(G `F@ @p  0Q` 4; $oO 0qp`p ,/ P` X G<й'wd3fxd W7l%֚h% ~PA-M & @FOPH  >OP( %2W  堶00S `P$W0"S U1r0%*VW  H00S p W0 "Rsp$PdPd `尀pVp0 <$0Ѝ0X֛й'ydC-p PM` Q$ SP 03/ЍC@@ R;  d p $4%"й' 0 @-$й'P7@- P@TSP HSP804 p Ѝ0$й'wdP7@- `4P@, p Ѝ0й'd@6@-(0   %O-,M0@Q0P`p0000 0$0X,Ѝ MNP p-$$  P  p $0 S T㸐帠P@$0S" ; 01 00SW (  0 S 0 @0D37XQƝp@-@PGP01P' 0P, 8>0P " #0P 0P 0Pp@ĂYp@ 0xQ@dp@U@@孂jPptcidyararbmngntsyZjP0 P-  #B%B$14!8<ؽ'p@-π8Q a@Vp&a  …?/.01 \ @0`0 P#3pa  …?/.3P01 24P5 ̎ @ؽ' 0"!#/P/'A-PT0p(,`IR@ER,0T@@DA?@?@@ؽ'@-?0<@< (20,20%PP0  P*0 002ؽ'> 0R//G-0`p(,BP P E R@PPW ,20CS(20CS G0ؽ'p@-M@`42S%^  E@ 82<" 0 (2,"Ѝp@塁<"82El@`唁,"(2H0X"\4Ѝp@ؽ'% 3Zhris@-P`T  0SЍp00S@oT0"S1Ds@-,M$O0$ 0 0 0&%A-`0~ @Tʴ+"Ϡ<,pP 0d  ? -Lqp  RЍAL`0S`@D@,O Ѝ%4Jؽ'@-`  ppP0p@l Ѝ!$LR@ @dQRQ$ ᖳ@ZSgUؽ'p@-P0@0S( SB01pؽ'O--hE%KUH1\"A$500NP@\2S@0x0XR@x0 XP@x0 XPU@x0 XPU@`4`$0U(0000[ 00S $00(00 0 l P @<Ѝ P @ؽ'%@'%B%Khb8-s@-@00CS0 9P` Pp pt 0 P00CS0"0 Y@oЍp@Ѝ/%\BG-Q pk @`/|2# d0? 0kJ 0qpЍ  RЍGx 0`) 0R PJqp `D,M 0S %bؽ'p@-P@2S t`0n/(2M1!41#41U @0&"UU  p@@PC @Q@Tpؽ'P''G-@r,L`P ` VP`Y0TLE J$6,Q0U !VU ! [EPsO@s IMX2I $! (! "4! 1"8",1!#$sO(@, "!"",!00 0     y 0  0 0 04 8 < 0@e000ؽ'A-@PXPAds 2FL t B B$:600C0ؽ'O-P0p0Q`@06 0 4 Q %C?C0V$ 021S 02/ .0 1  Q  32 $4 (5 , T02SlN Y) Q'PL 20 0SR00P[# S 0 2S Y 3PY 2@@P00`A0S Y0S S01S 2SL+PD Ѝ`b/. $0(1,SR[#ZY  0S^   BN R@1SO148<$500C0@@PA`d!R 00P !$(,     Q "R. Y 00a14a8a<0#d1a#h#K` ``GpP0 0C0,,,v\ yOP('ZS5 "R 0S /ؽ'O-M@D Hb\ QʤߍO|qtADxH| \P}0@0P<5< 00 2! P0 0%p@0) 40 ?wJp4"RNX2 PDTS-P K) 2Q Q54M 32S !1?  <!0 #9!1? < !0 #, 1tS"0@R>ʇߍ@ hQS/2SrW#, `p 0 ಟ00  0p`#W0 002Rp`" p qp <T"QP20H"NV 0(1 RS Q0S!Q10! p12S  ?01DP& |!Qp10l4!?h02S02S 0 0S>0)S $zZ0)S s "Q  R hQ !P800 0!H0@ Q S 0S<(ؽ'qؒP\z&%ʬ,N2dPLTtU @dЭ٭@-M4rW@Pp@YЍP(0P@`  B1 @PP$SDЍ@ 8 1 48< ČȌ P!1 11< 01 1 ?011< 0`1 P1 ?0<Ѝ@ؽ'ؠ&VfuЮO-p-蒓Y`:X& "!R &/ .0 1  Y 32 $4(5, Y \   Q R ` H2,0L2000&0S- 1S* &, W000P0  00SW0!14!8!<!14!8!<W0,p0,0`\T (`0 S( 21S$ / .0040 81 <W , S  PW 32 $4(5, W0\,0000P`$p 00$00 0PNxS 0S00$00 0P P HWT $0P0 J 0S pD 0S 0s X2 0 RS $0 @DkoO@((0 F 4 0 8 0%4 0%80 %< 00p P0 @2S` RU 0`%PX 0 1<Ap 0PP,2 0C0P0PO`x(2? 00PPpTpp0`Fa ?`1<A 0?``PP,2 0C0P0P`(20? 0PP`Fa?`?`` 0S\ 2S@X @TVJ041Sؽ'ؠ6&('c,iWU'ί߯C-pHBM42gS4Sw0r0bP42Si 0P7U42S 0S :w؁ؑP 42RSgP:+w42S^1!$1(1,ЍC;0S dS1tpdt 04rW2S 0``p 0LP"R S0SЍCv@D> 0ЍCSP 0Ѝؽ' S'X^e>zѰ۰@-0@M0@ pp`Phpaߍ\ E0  0P \ WIt02S 0S " ` PD!SR n0PZSؽ' @-0Xa0 0LAP d2S8 P($!p! 2SP0U  $tp" Rp\EU$p0 00P d2SP P@ Ѝ0P0!!1 %ؽ'md}'G~P'iA-@T2 @P/FP *FP %FP@ `p@T 00S p`V@FPD00S @@F@P SP'%A-Pp` @j g 000 0@@@@-`@PT  Dp D  , 0@j@ ЍC @ZaO-MM0t4 P@ T\D EP @ <EP44 00(04QT(0 ,0; 4@# 060@,0S @@((,0@`00P0s唃0C@0ZP@P0 !0P1P83l0 (3Q,# ( _ s4ZT0> p@: PE ,0S ,NL<(00S<(00@1 $=PϿ'0FSʆ` P0S -S@= 6P00@ @P孿,0S ,܍ЍA0 P2P E8800  0 R00S' #,10PAPQPa40C 00}C(G0S0SG0S0S C ^0S C TCOCJ$0# t PS<(0 ? P2P'&+-!P /3%84G0/D'0/D'0/D',@-@-   㔧%G-P`pWG@0S a 0S XX \U `MY 0S 0S  <xЍD'iȡw-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  GC-M Mq@` @Pݍ Ѝp!rddPp=0D@@rOP,0: S0RP00 05PPP81: S`P% S  R  rIPPtPPPU r_PP @PD'BhT'@-KP 004 0,&$Ѝ  T'*0@-4S 3/ D'@-XF00 @ 0 $6LF@D'@-FF@$A66BPƤ- Z #@P ZG Yp Z`壤0S<   f Sp Sm pWp 0S 0S @W 000 !00S# 0S,aQA400CS0"@ T 00CS0! P @YT Y@DOoB 0Q   @OoB` 0 @0  0 0 SNT'%h%$@-0M 03sc000@Sd0 SPP RPP u 00Uy `Ѝ0S 0S @  x0S\0Sp\ 0/2@ t\0Sp0 "@u 0@kp 0S0Sep @\0SZp # @"  @0ShHp @D @P@ @0 @ `0x P|"%   T    P  @@``L 0@` "G H D''' BXz%<nG-0@  0GP 0S< 0  Q* PPz   0P` d !URQ <e l qB0 p H0 0W40p P O u 0Q40   040 04$00 00$0 400X 4 0048<(0! 04"8#<,0ZpP SP 0SD00D0D`` % $0+4& 8' <"X0(0R* 0H0`-0, 3$.0 (/0,8 001 42 00$4 `03:00 QP  `Ѝ   0P z P yt `P1S1S1US1S 3S3S3US3S, \ X`P0`$ D30@31<313 00` 0`900 QP     0P`00S !14!8!<<0!14!8!<@040  0940  QP <  x 0PA0O  A0P 4F 0R  = eYXpW P0E> 07#;;S`dXX $ R,0T ,0T0T0 R(C=D0P 2L0#1\0\0P 0P 0L0000P 0L000h00Pdl0d@), &Bd,RRaArrAaU<_w@-p@`P 00 P0P8 00QP  Ѝ 0P< !@ !0 P08 00QP 4 0P),d7@-@P L0 R0!0!0%^l00l0 ~p00p0 Ѝ0^ P ^3# ~\ L ~H00L 4U 0LP000j]-+eG-PXp ` Z P@ Ѝ0:!0㑘0 0q8Q P D/ X0 4X0 PnO-@,M0p@$0l@`P P "  pP $bPh?$0 LR0- \)̌ PPP;p P ^^^^ \\\ \P PŸ Pu p/  P@P L0!$@S@ s@@P0S$0p  00,Ѝ4( L0 Q$2 q(@,"  P "  @P*"*  P0 SP "!"0  0@PP  @ 3   P r0 r// /;?-O-`MP@0P0S Ѝ p W 0G s 0C0A s 0 0 q s w qpp h`P0P@  `0P 0 00 P 0 00` P0A s `0 Pt P0 0X ` P F,z7KR0/0@- PBU02S0P^0A-p`|Pv@P  PlP P0R*"R0R0ePO-0p` \PPX Ѝ$P  qQ 0 Q0\@T(2 R0@ PQ SC0 BTX t0D s   0 TX Q  0 0 n | P [ P J BPTQ2P PE0jO-X`0Mp@PPdЍ =0Yl0L 02 R0 r00 P葟P#ر 0 STR rH 0/BP 39  0L˜ Z,$ z ,(  \l  ,΂0l\ll 0\l lP 00Ql"! CClX0!  050 QP = &PnO-ḡ帱@`PpP0S00S <q.p@q8WO$0S  0S 0S,0(  0  P0S P  MPpl Q P l0p<0P0Q*l0S 2Sp  l\PP 0 RQ@0 P 01fl, _@-XP?`\@#@3P@T@TpW @@T`L'O-@HHM8p1pP0 0TP0S<0T D0S Ѝ1@ 00`0 D2"0㒡0 04 Q P vP 0W:00 04 Q P PLU  =P<0T 0qB'O-M@L0S<`@DHp S$!P PJ V_oR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:T '0@- %B?@kP/p0S ~70FS `C 7p@@0T Ѝ?  C0'0 PK %/'O-`-aM 1V  0. SP0 S@0P`(0<@@0$0 00@`D0$ R! X0p1#r#88  ,0380, QP r0P@0`(0<`@0$0 00` p0C##   PW  q2pG40DD04 SD00S   408 24000 ,0380, QP (100  RR R0(10@00D0 p0D0G > /&P2 (1 0(11  J   0 0B0 @0 Paߍ0@ S100S  S:I@(1  0I@0;+ ӗ P(10(10@0 00 0Sb 0@ K <0(0/os" R$ 00 ,` 0:0(0 0$00 0<0P `S<0! 0C<0< 0㓲" P 0P  P P :P R: U 0`$00`P0 4g | U?0$00`P](<\Q U`V  $   P`$ PK/T: `0p!Pg0hQ P P0S*0`Q`  01 U$0 0 `H0h H0 P  0 0 P @`  Q .0 A  L L G?L @0CLS \Q*V 0 $L0t!s0<80t1 0V4 8 e'!>30nVj=jC-P02S@daPX pP:0 ЍP. ,K/7D00 8QP0Q:" 0PS00  Q phxPhdP80 "8 R 00 05 !${',PtIp@-@5%SQ%5 %SRP UUQQp  0Q Q0'A-`hPp5@ @ 0% Ņq@ŕ\'O-OMPpP> b5S5夢05ET0  ~4P05 ET dT 5d 05 !dP 0Oߍ RR+ @ST$5" R$%P0S`0d B2" 0/ JQP d d0P Eh0K/0h0 60D! ,qr0d 01( c2 j  6  6,10,1#40L0sK?000/1001001#40>000310 00 000T0 C.(%,5QP Hd ud0P{ M'8'Wk{.@-@ P 0 5'0/8'0/8'0/8',@-@-  ! Ж%G-P`p6@0S  0S X U `Y 0S A0S  xЍ8'iȡw-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  C-M Mq@` @SPݍ Ѝp!rddPp=0D@@rO:P,0: S0RP00 0qPPP81: S`P% S  R  rPPtMPPPU rPP @P8'BhH'@-P 004 0,b$Ѝ  YH'*0@-4S 3/ 8'@-500 @9 0 $!&5@P8'@-5@`0&&x5@O-MMP@`pP壻P0 P: S3/JP 0rS [500P 0#0@0@@ U  ^2P  jP PU 8500@23MP@ S @X帰张OP60: S)^0 "PP@ThP X+ S R"P-P U "Tع@\ S㼹P@`-㴹P @UBPXp!t0#PU000 0} Ⓓ@P P40SᚹW PPxl0 PPPP V80% ܍Ѝ FF F@ 0`( "4`#/ p@-"440 @"440 P"440 "440r( $0 $(/ XX/ddhhllppttp p@-"440 P"440@ 1.+DD%@@HHL`LPPTTX~X\{ \`e/p` pa/ p@\/p@-`"Q@Upf@p@-@PpA-P@M4Q->C->?n}C@X=X\:\79>9>:>C:>CF 0? AC>C>mGFE~EnFG 0X J~ pXW}m  $$((,S>,zS>GvFsHHLLPPTTXX\\O-P@4pT` !"441!"441  $$((,,004Vܑ\5 S L5sTԀp0,$ $Q p W wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P 1 RP1H X0  P=!`3 H0S$00S U Ǻ!0S V0S G 1@ЍG_Xs-P L0 ЍU '','s' %my' 0`( "4`#/p@-@HP08v200@ 00 b/00 @a)p$'00S 4 /' 00S/' 00S/ 'P000R0S /O-@("`0 SMPf0SD S0_졟ď080T C/ S ! R 0C00 0@qἰ? 0m$\5h!Sp 0 0Ϯ00 ?@U '  ϬR 7 R  0A \5S0 00/70/0 0 ,Ѝ P L R  H00 0000P'$''T2KPO-0P@:1 R0* 0딑唡0 `P3Qx 0 U0B: 0:0Ï|!1\%pR 0 0/.p 0`0 C c00p0S   0 J.0x`0 xƃ1!0x 0n000(00SH'p'$'T''O-tCM0 RS !R0*< 0D`X 0:3 p 0  ::0ï\!2\%PR 0 0/. Px 0`0 C c00d0 PS CQ c$ :R, Q,040(p0p`ßp08`,10SC 180Y@`0!X (e! R<`?0 XXK&o[H PEp1 Q R>KI/V08:‰ V/ PlYFp8 0,80<00<0S<00<0ЍF`FFFF V   R0K Q  Q'$'Tx'p''''t' 1G- 0pP `i0  0^0@ 0S 0 0 80PS `P` 8UH0ZP000PS#`4z$Q$,$ (,`(PwP8)$'''@-@8P U080'G-`P0pS100 B?>" P@P 0@8@Pt1 ?`10pA G 0  000 Z`0 0 p0 `1 `#(p"(,V Zp`0PQ(d#0S\1@@ 0XP\   0^P0d000 A'$''''''P0p@-P @?800P( 0!SRp''p@-X`0SpL0LP@1D@A0S夸墸000p䜸''' 0 0 /'O-H0MS MP` 003/ ލ Ѝ40 pP죟00 ,0H000 t /0 @ S 0V 0)0X0x3!0S' h3QgQk  0   0励0!0Z0 02+ 2R720t0S2ڤ2 Q o   Zh"$⨶$+<2PD" R{!  { ! t R1W+졟W000d1 Q5 10000S1H Q B/o" RK h!B0   ,BLD>)P: ! RP, P R 10S0Q 10S 03/     0P  0p`V0.$'l''t'Dq5'Vz'0O-S㰄0`P0 V0RM#@M(, : SL \p(5R,<R  P  RSV !0 ,| |0 sB?P0`0  0S0 00 000Z_ 85x @5D0LT 032 b< RP1QZH 0j 0q0SY "00  G1+Gf(P0S00Q )Q2 <P U`P80 00S0` 0ƯPPQG 0 0H  0 !40t ?:#b 0PU p0Y0Nh0SK  gV _08001(P Y 03/ RލЍb0 1TP+U0H 00R00S 00  G*Gq'PK0S@ PX(QT0 P'$'''Vz'@@-@u!SP80< S0 80<  D ep@-@@PU D!P RP 0 R0:ppH'@0@-P@80\U< S0 80< 00p@- P0@ܴU0p81 R0p8P@ʹ00S 0Sp몧P0Sp巴岴00S rt媴0S 0T塴0S(Sp@,喴H'''XQ3#'@-@M`p{WP 1!  P p`V( OP 00S0H0S 0 0 P0L (-00Stt, u)00Ѝ@L&P0S 00`Ѝm4y'8'''''0@-MP `"@? K)Q Q0 $0ASЍ000d5O-,Mp0 /@PD` T00: SR) 0Ḱ0 倡 R09:` V `3 V `!᭳P@P(0S @P(0`S @P0!0l0 0S:R 0年40  `(`!\Ő\  ? 崣 ? (0嘳 0S30m Sm p3 R #R XH3 R ,(03  R0\ 0㵯 =0 " 00C 0L40S$40 0C$0娂*2)|20S S 0: S ( S,  Sg000 00r@( %2Zp N *v0M0`S 1 00|10800 0ˏ I0X0 ⦙Q0T @ 0`; C >!000O00S 0C&  ,Ѝ*!P( 0ˏ d n 0 T @ 0`; 뫴 h'H'$'' T'p''U 7h'''8''O-lM2@ 0p`kP!\P  ? 堒 ? &0 t2t0S0 S 0X"S 3S D@X  !(20p`Y2QpQ\tQ`Xd   X 1 R, e'00X0S 0 0 `0\ *L!00ST06 0 !S0\ 0㵿 0 " 00 04$0L4R0@ 0$*00G(0S WP8 P& PlЍSq tl$''T'p''U Z'''8'h''O-`2|2PU@PpU00 Z0 0 Ѝb0 Ϡ˿S 4G g@ WVLQVg TU A0 ;&00100 @0  @T` T0pIT Q 0@`L @Q 0 `  T 0E0 0@닁 0 &P 0 i0 ^`0@S 0 000l000 %[P00U0 $''|O-P0-p,MWtWhfp`0 00`?00S \A3@30000PT Jb ? @00:o @TT00T S @@S  T 0  0 01 0PV pP 2 000`?0p20SA 뉑  0 04 Y@ ;  10> Pq 1 000`?010S) 0A0 0000 p 0@0S 0YlhA W *%p 0 0000000 $phQ0 0 0WCq 00oq00`P h0H 0HB0C0 T04 OP  ,Ѝ'$'@- 夰O%s@-@P `d0S 0S 0 ЍpfO-M|E M`P0S 0S P pP P 0SPލ Ѝ000S  P i0S 0S 0S M0Sx 0Sx 0Sdw0SP(0S 0S0 08Sd s/2#' 00 " " 0D@!1!? 0 0u 0rd!! 0k0 pPd`0SS "04 0 R0  0"? 0 ,¯ R( 圠*,4ï0A80/R%'<0P 8` V Y0" |%0S l hbPUt ٮ@0S HDb@PUn ή, 0SP@PPDPSH0S  `墕Cn* lxlB%|0S llR0p00S00Y%P 0,0UA:000S 0S PL1 H0S 0S,0S P   P   000(%PP 0S8P ᤮P ៮PP P'}2Vt`uL 'Bh-'O-@H0pS`M W0R0: 0P 0 H"p`/<"0 S0 v20SW .JЍ 챟쑟P  BR 0S#/  !.V  R.. P x!`T  R0  D lP  @@" 8 < P`8 <㷬P0v P0  b$* RP `  ^ V UV U  p''3d'\' H@''b?('00S 4 /'00S0`( "4`#/' 00S/'O-M,Mp `@"Z:$ 0 0S`CZ ` pP# 0`VP!0 00؍,Ѝ0 (P  X0`VPh0S t  0uh P  N0SHH, 4; ([(+Z054%00! ?0S S00:00/0S 0 S00 :0V0 0#03 R00S :0S; 0  6t: 0S R` P 0[@4< S0 4`?0: :R00a0 B? QP%90S 0    0 0` 0YP0  90S00, 3P$0  ZP00 0 S_8Q<90S8 0 V0;R02*h0S/ 8((d0 #0 (P el80S (00 0(00x 0`剬 ~ (@(-70S 0h0!7'(5S[/V V:'<V  3 #P  RJSQ< !0E D U0$000(p i0 U87PP0X 0ZP] D'000s0@PP6@P"^h0S0P%Q_!1Q 0PQ^100 U0 EPP P00t ?@1#R 10S0@P0   Z$0S 10000S p50S $0S 00 P0 ȫt ?w$Q  40S $0S  孫 Qa 04 0 S 00 0 0000 0=$000 0 #600S040S T4P P g@pt3QpQSLtQPXd00H00S1 0S p30S* \P00 4 0C(P2 2 0Q\00&& :000@{0S828040/<0a0#QP8` QP`U`00S 00p@3P0p<`$\5SQ%Ϡ<# TD ?=0 (40S 40E SE 4`V0x@@0`S y0,  d/0 70030SC 30S? 0 S( 3 S? T!. 0 / s\@T` 0 Ń># 0S 0 S\00T0  @T`0VT? @`1020兑A0^ 1QS  0`a 0P0@ W{ 000 Y 0?* 0  000VT pW  `@ @p \WV00!03SR @1:0R@4a p0  00  P C0 TS YQ! 00  0`P Q00* B  h`'$'Td'Dq@'8'l''p'''X'@%','U h'p'O-`pܐܰ 0M @ 0 0  BRЍ P PU QP X` {{@ pQ RP Q @p'\'  0`( "4`#/O-lMX 0X0X10T1p LL1LP` 0,0SlЍ0S 0,@ d0 @ͨ00ట@ 0D R`pT0#:#P 0 ARpQ R\tQ `; R  @Pt('$''X'%'' 0000@/00S 4 /'00S0`( "4`#/' 00S/':O-M`@@VMP`90S 0P )S0*`00#0.吉Y pP 0 WP X)T ,PL9p`0S 0S ) P00 8 #R0p0,S00000l8 00!"441#0"q    0P@ fbf}00C0U 100 0Sz H 0PtM0$S 0S '00`PX7}`{60,S00,000 7 00!"44'1p0pp00ppP*0S  zPe 0 1`]xnPY `@   80< 0 80< @00C0 şr0 00 R.*0S  2P  0" RVލЍ0S 80< 080P5 0< S <wB0 00$001 8` P 0S 80< 0804 0< S YB0 00`S $`!  B("(p  ᴁP 80< 0 80< 00C0@'80P<.\SP# .P #P*PP3P`080< =D3 Q035;:,pW P0Sp\\(?0AS񟗮`ddS3 0020S04000yP |2 H#R02 00eP026 0 03#R0mQ" 0S0S@0 xGPp  : S000 !0 #R0 Q  x 0 FQF?\!\  ,10 S$ DkA#R0 š!ʡ0S  0R 10 0 %00lPd0`00C0WPpo ) ''H''0no''"B0'-=N','d]YQwO-MMY0AS񟗀ꔖ$4Ȗ$h; dPX7 V@. <P j$7 00>@0  6P 60S 60̆V6 X  0h06`$00嘦嘶100V3:6 Rpttt0S.`@aViPVohݍЍ( >P:P   u 0S i @ FL100 @$00@(0S Shhu`%sp(P* 4 0  B, ! _50SW 00(000_/0y 0S =@p(0G0S(F GQp(Ac,xd4p0(S9@0W78Q,0 S1 #0 R( S000000!W"!#-W l'px3  (  _/.   ,0 S1 #0 R S)R ) *V { { x 0 S( R , v"2 pR)@ W(,`0@'a V!W#W lp Fa V @0 (0S $ 0 s00Q P0S"0`10S x10!1!00C0!% P0 00000C0!" Up0S@0 0 0C0 00@'?'''0X''h'(A]%'`',''' 0`( "4`#/O-Mܒ܂Pآ1EPQ@Tߍ0S `@EDAF@D d~0 |`t卣00@   B 0    S,"[ "[ "[S[ P0:000S1 a 1 R R@0 S 00"P X100CD<(P X ? X ! ! Rph0QbT0 e R\tQ ]` h00!P\ t00f 000''X'%' ','\''wlV''7@WO-`0p(4弰 @$M? G $P\P  ? Գ ? 0 y 30S30W SW 0 S 3 S x;@ 002 P00 00CSFTY! P 80R0L003030 000? ` a Q2!,S Q0B*2+|20S P9 PHB P$ЍS U Px?00 1>!W 00S>>0Q#c ! RR 3 T0 0 S`0?000 ? S  R.. 0" !00S0H0S 0 04040c/0 P0L 50 8 QT $  $ $ $  L30  ^\ {0{< 0IPp0$''T'p''U _h''d'('@'00S0`( "4`#/'O-lMX ℒ`|20xB0,0SlЍ`R0S 0,p d 0 ,p$嘡000pP1@ 0 0D R`T07:!AXpX\tX`Xd  X  @RH<ĨX %P 10S  0Ỡ@PhP 00S  0M0S  RQ {{00坡|  0X! 0T  L  <0PX'$'X'%'''sO--oMM@P00 0t2l?0SX0S $5SH0SY<PZX0S $XnS X Rg>`0V\2 PT20! X" \" B1\"T000B`X$dPp0A^000h21`l2\B1d2>2d2V0C:=SLq QT20B   0S 0@$5H> *$>3>0S B0 0pS0  B$511  !`0P00B1- 00 S $|䌟0S$ 봀 -⎀Ḁ$1BP`R!B@ LPP p bl 8PN 08S <P| *堀-<t<0S 0 0/X0bA?:T<5A?T0 =80T0.H0; 0VHQ RX0`0@ <0 8 84<ϡP b0{ S Q,0 Sa?^< uP< ,;0S < A>+<B<  CP: <@ [ 000:J*:L|:0S [0 0؍ߍ08008``!.Q  R  `0" i0S ,p@dM  0@ PpH U008y+\0#Q  0 ` ?옟 0thS 90y Sy 80S 0)S 3S  0S 0 0 80S 8 0SD(0 08( 0Y (8H8o;\Ş&"\ ` 0 0Ϣd h  pBnj `b"36'+?D "@ D @ 08L<PLRPP07L `V=S؈<0D 2L0VpC p,00C S=Sy匷{S +\0#Q  0分h ?xY d 6J0S <jP#50h (60S 0%\Q\u5P50 S555;o\Ş&"\ ` 0 0Ϣd h  pBnj `b"36~*@-  S>p@0 \\L5SVPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//'4O-P@-TM t圴圔pqx-[?ldp:0  0@ @P @Ѝ`\VP0S/ 40S40S  ?3:0 0 P`\/P3#0S #S5| P p0S d,0CS Ds*0S 0\%R#\\5 0C"?o20K`h0 0 S`2 0 ᑣ#0d 4:E 2  ? :010S?,A!Ϡ\<# P  0b  ? 0SQ0S 0ġh A0S 0x\%R\P l10S%`yXQ5 L!0 0@! 0 * 0S p 0 0 00@@ 82`h0̰00J00V* 0R A C''h'x']p''p'''$'8 T'' '''-'''|'j9O-@*@M0M08x`'P 囘 ލЍ80S ᵉ:P兘 p 0: S X gP@888X04HSP )000S ѕ008 78   ј ̘8@ Ƙ8p [WppTp\7PpWL P 7@T KP %|BH8P 00} 86F R>0 0p 0<&00P @X7@0@$60@w>0 H0p,gp2S )MP )HP ).T4PZM-`Y 4[ 0S0:<관X V.+0g  0 ,P %Q$ f Q춝C ?yPu` 2S<404040$4X02P#W20AT2@02 Qr0GL F 0 lH ? 0pl3& 8 S20#"20#202P` 2S d#0\P@Q=S00 5P@ ) 2RT0 S @x0S IC 5*< 53 30S q0 0@20S 0W|3 0 S@ T 10Sd"d2Q`d 0D^3" @=؀C2,0刂0000t @DO.0 @7'p0 @S葟0S0S0=S0S p(8000J p 0L%000X30P%,q  *1 10S @0 0|'''ԛ'''`'''X''>-kt<Tk7PTr'dby' 5Z''A&VM''''h'' ' 1P'd'I'n'H''''''x'p'$'t''?'=S%0S& <0p 0P%<<00X30*0 00S [0 00S5 0 >0S WPLq 5*N> 0:#: 5p1y $10S 20 000S(3Pq00*1Y 10S h0 00<cQdzP\r 0<0*p29 $20S H0 00S0L%r0L%r0H00q" P 000cH00SPGP$s*k43 20S \#0 0 00L40q"  400cL00SPs*C330S #0 0 0t4pW.4E  ^  \pWR 0SPt*4T40S f$0 0 0t0Q,%R0%45S R! lf004E0S|PP*`5}50S 6%0 0 00(0Si xQ$ =0S0x < (%0S^,P*6Q50S  `8&0 0 08%<5HSR$  H00850<S6bP*6#|60S 2&0 0 0@%D5LSR$ t L00@50DS4Pp*X7470S '0 0 07 70Sa0S0SZ0L5sV0SN PT(00070L50P5?T5V>X50-00$ő0!00B\A`0PPPB 1@500L 0H000*880S W)0 0 0T PYd P4TQڨ0QXڌ T0 0S Py*9k\90S $z)0 0 00S3 6 ,0S0QQ*P "0 0Sl xP`z*p:9$:0S H*0 0 0 ,0S ,0S  ,0S0+ Q^ NQ L ,0SQLd ,0S{v<Q ,0S ,0S ,0SH  8%L < @%D;0,5S0SO  ,000;0,5<0(5H04E0/85L0LL0<%/@5D%0*p<$<0S r,0 0 0<0S <0S(L*<<0S T0 ]h < < PRL PM\= 0S@ ?PL \  `\堭p@PUWʸ- 0 ?001>0.P6  ,PƏ0>P<) 3D^ SH.;00 0 S 05t>|> > 妏>p堏>PWppY>@@5008PEUPHLd  BL 0b03",P P Y) T?0S   p?8 H4L0d P B b"30 T?0S   q0`00p] P?宍 傒6P k0x& 5000h60S 1S P [PD6  <6@ ᯨQ$ V @ 0`P@@  04 8 <%c#!$c4"%S 50S :P 0 0  ``Z0  0 0 0 05a(!"4a#Q  0SgwPh0 $"448#8 S  0SidPj0 $"448#8S t0SjXQPk0 $"448#8V:QQ  /Q R 0Sf4Pg000 4000 Pz c0SdPe 0 40#40hto*0S 00 0 0 00  $Z*0S 0 0 000  0F*0S 0  09000 0  0p-*0S ``&d``0000  0`p*0S @000u0  01 1Q1Q,+ 0S A 5< 0 !00!@0|!0pCS #0p R0 !0B88#80WP `@fᶍ0Pᰍ0UPQb R E/ !0!Y pG P',''k'''x'LBAL'q6Tj]M'`'''0'' 7&|00S!4!: S  S :C / S : S 0P/@-働''^1A-`0S lhy@ /T L10S@10S4c,1 10ST00S Rp@K00CS0᳷P U 00CS0᩷ P PYU YU0 P0  0 0 SNU'q?'t' ''%h%@-@P ƌ$ P<Ѝ'?O-p,1 p$1p 100 P1 ppP 0P  ppPPMP(㇋ @ ߏPT`00 WT V Ὅp pXP @@ 00''$'''H'O-1P0- Ϡ,"ʼn$MP   p P 0L x &4僌`,@T ; 0`P$Ѝ?0 0 ?     P 0 00?QR0 0# Ϡ?N0 8B`0@p 09''O-p- M0P8؀:0PϠ,"  `ᢇZ0 Ѝ 0|@Z ЍOƋ ?   兇P v ? 0@`'`'1A-`P@U ,1_  U0P PP0 0T3p䀟`+0 L@D0T@S    8HĒL d  B 0b<3l@"y0 S  0P00`0@TЍ'&@Kh'$''t' 0S/A-@p d`V F0P f02Qf0 SR P00@00 0` PЍ$'$(t'x'@-0P0@T@T$d pL `l0̠p `V W @00 0 0 000P@0@00 Ѝ$'H'qp@-XM`P@X  `P @XЍp0@-S H0@S  T00S H&004#,~P00'p@-@8`8P0 6$00Sp p@m$'''0 /X'\@-^* 0<80@400 01Q0H''$'x%O-\MPpSR E00 00S` tp@ [00CSD \ЍO`T `.0XYH`o`00E0 0PE00?0+0F`F B\ЍO000D0P p`  x00PpD@T  0F 0/ `@V @:P pBh$(_VlV\%2R/C-@=MS}QPH 0SVPV.10S &10S0 L5as0|pS净  [0S   0 0"W0S  A0S  # $ $0 \# 0$$ 48$( <@$ D?>L H$C0 5L5s0P500ߍT'p''\%0R/=S/ 5004 030304040 5 5L5sP%P% s,,8TPC-<40S 0$0,DP$440S0 40S, T0SB 3`3 30S@=S= ٿS*330S Y0P 0VhSXSBTs<P`UU00Q AP 0S ?@?#`P"hR0"00S7 lr002Pb0S) x#0S) 00RE>0X4* 2920S H0 00S$WP10S $1 TQd1*p\1 P10S 0 0P10S D$41 P0*O000S 0 000S 0d$  0偈 (0L| ЍCH| Ѝ''t'x'h'|'''<$'''''''H'uZ''n%''''$(O-PPMp80S# \/ "C / Q @aV``  [ΑYP ើd \P  ?88  ? }0 W2r0S0` S` 0!S 3S  0V? 0!0! !!0S`0 0 0 `U\/0ϬL3 80S30Ð0C03` 0S300CQ"À 00P*d00S ` ` `Ѝ kS  *$0 0C$040S 4 $ P@ P V$'P'd'T''p''U _@'h''t0A-P`p`ATR +@P<:0S @ 1p0A'80 0 1S/ 0S/'\0 5< ÒH0\ Ò3S\ Ò3S\///$'^FPO-0(P,0@4p8`E P P0P` 0S 0 S   000 00 00S 0 S L0 w0    p p0'$('Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS lp Q 00p( 08pQቐሀ@x`0SP/100 P000B00   @-@!`0SxXHo/0! 2/B1   P"/   @-L!`0S 00/1000/0B10B1/101/   @-p\!`0St00/1000/0B10B1/101/   @-Ji!O-$5S[  l@P`hT00! t pbR$ YB,  !$  p  R !U101Q+DP 1 @PA Cό02 R&@@00Z   T   @U   @ Ѝ ^000 0S0 B0O-RMhbP   @PHZ@<  WPpߍP(  zppZ0S  l<08 (00,0 0000400!4 04$0D0(0 P gVph cr 0 p HNX <X 0|X $xX tX  vzp pzp   1zp 8p?pq8SվPr   00**0@0司  0* *=d@edATluzd@A-CMMPPp`;8 sp@P  0P;PxU00 ## CލЍO-MMP@`pPyP0 P: S3/ P 0rS 00P 0#0@0@=@ U  P  yP PU q00@23MP@ S @X帰张yP60: S)^0 " PP@TyP X+ S R"xP-P NU [yTx@\ SwP@`-wP @U{PXp!t0#ۭPU000 0ⶃ w@P VyP0SwW RPPxAyl0 1@400    0P@4P@ 000/U05:00 0"000P00S  Ѝ00 ?0pp%&` + X|yd0  a'%o0 S    '''$''p6O-PhhVd6d04MCTH@ Hr` pr!0_ 0 CR(D%%$$D%D%@ 1  50S fT 1 19 1  @ a0l  1\  P 1   x(00 0x00P(0 R. A00!00  Y40SF 0a!(00 0`M00@P(0 R4 4 0 $4$4\0P 0S 0P *0S 1  ( 000juPl3 @ 4ЍjP|30S01 0? D30,083@,[0 S,0(,0h Pn@P,@, R)0,0, 0R0( 000 [0A(r|2 Q,, (,0!P7Pm,00,01R0 00 0Cp"3P0 ,0W7! 1 1S2K T10S# E, 0R?R0(0$0 000$00?y000P$00S  [ P0,00|$0 0 d 0 0, ( 0S     `Pp@+0C$'=B''%Eu'F^^F''8(MO-0P⼁!QPP!a`$Ma !S@r0!!1  `00 0p000P 0S @ ~D$pPU PU 000/ 0`P&P0[P    0S ~    RP P@0$Ѝ$'0C=B'0'''_R'p@-P0 % .  @Q 0S p# #300# #:>00Tv0SpP8P}p$'^F'e?R/(G-P `$ 0p@V` 0@`` V`@&!D`( G-P`0 4J Y0000008#8#$48#8Y\dp q00! ## ?@Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- 0X$(p,P0`4@*^0 *^0 *^0*W040P/ Q\/O-@p0P2#U 1!I ` R J` U9# c! SV Q V3  P! I P` 09# c SV!Q V3  P 0 P$` U P `` Ѝ2 0A-1àQ`P |0| ||I0@Sp࠱ P$` p@QL ࠁ PQ e p@-@P0080P 4 PR*SpL0L LS@04 <<^I0C800S   0~!  ,0S/`0@-@0  L,~0,0080S 0  4I0@~<(8! ,0@-S ,0, ,,"I@TP ~@~Q. O-p-LMPU`@( %88S80@ @4@D2@D1@DS@D50  00 0Px} U0#03?[[[UW'|@D `0P 045Q ,\}O0 0 \~;D 0 XR @}"<p!8pL0$0$0 0H(0 0 `,0`4  0 4$HHP 0 .PL40  $00T 0P}, 005RSUSP3S` 4$`UQ{V  `F000,040000 C3 : 4`C#,0PQ(0 $,80* f@P,Ph3Q 0Q+ 0CQ 0؃SP` T$P$P@ }T@P P0{TpW@ ! }P` !T@0`P`0?: p0T @ u8< @D0RP P|v0 `S2$0$0S@p :0 P  S Z 1!A8  B`40%{40 040 00Q800800pȯ0T0 `S2$0$0S@p 0B 0 P 80S0 0C800S   0,}`#|O@  D e @ LЍ0 0<(jLBAW@|Q NBAWU"d v 4G-0,0S0 hGPz@`00qW40S*|Ѝ! 0 W@P   l@PpR$ A-0`c,0@Sl0l ll/GPpQ L0< H 0P@DT@R> u? C-0`c,0(PS0 Gp@Q |0l x@PEU  0P !  0 P P ЍRO uQ X0sC-@0Ђ D`P 004 0T{ 0PЍp<(t'X0sC-@0Ђ D`P 004 09{ 0PЍp<(x'0A-PQ H`p@0P R   T0! {@P 8%4PEy+'@(<(A!?@-,@P,0S ;00@(@-,P ,\  D Ѝ@(p@-@Pp0p 0 SX0d0RX c#!$c4"5 D006.8 Q#3SRpp''$'27@-0S S2+, R0 ELh `Q tp"PCxaQ* Q( H<P 4,B 5*< 50d30a30210S ᆵ0 00@ 7.Bp#x3@ Ŝ & 0P xtX|PA 5*< 50d301$10S Q0 0@ d3S+ CQ+aQ# 0AS"HP M@0a3d3*|0kp00S $z0 0@S Ѝ08'<($'n?h'''@( @-8oO-0-Mp ""#@0` 800/؃ @pPs0S8P-# 00" qp*z9lU tU bU(Cp8P)J 80 00 P 0 80S $00"+C `E P P0V ~ЍVp FpP`@ i pp P`P0V:P0V" aP pH0P0[0$$0 I+S* P l2 0 +S P@  8{0 00$ 0S Y(0,  $ 8 yp C 8p^0 00$ 0S Y(0,  $ 8 \pq ` 80Hh L  H0 Pa%|%0DX%G- 0pP@P` V  0  0  G `00000O-0mM` $P0@004080 0 ~pp40S+ mߍbW AW LW |8y4ycW iW0p8 4@0 0@4: S@ @0(0D0,0000408`0P  P 0! QT| mp 0Q= $ 0! $刡匱@P 0V$0 0/S ᅑ<<Y, `+y`0"<P0<0$v`P kP%< p y kw <yVD @"$Kx 0#$0@0P!SK `VH.mp 0 n?C0 < n?n/ k0Pp < 0S `0S  Q B/o" R 0S! m0H $8HP`$0F00pI $ pC qp:0S  (, PQ S RPQd T %%zd@6KѶ8n4O-`-d,MPp$`` |p@($0S0$020S'$00 P W 00 PSk0  0"%fT AT PT xZ@pT$jp@,Ѝp00` 0pP , ? o0 000 00 p p@00 0`*qp p V@p@`%%UG-Pxp` |p@<P10S<  p o0 < 9X $$ 9kp@- `&W00S $$ (Zp@ Y``V @fT rT GX`$$  =p@$X6/%.K%g @-閬oA-@P`pP 4\ XvT DD v8 ᧈU  AvA NE걲%@- R0ЍpP`@ zDP0 0S 0SS 0S $$1!BS0S `P D,, P/00#01"$#O-@`V p?\ `@^P6 UP@ @ @7 TQ @T*  V00 Q *@T*!Ê?@T*, ? ! O-088P@p[`@ S Rᷠ000S0 0S0 0S0 @S" ?@0S^ :@T*.@A6 7@RQ0BR !O 300G-`$(Pps@P 0'0 0Q P 8v@Ѝ hPC-P$4 p咓`㓁(`@ 0Q P Ѝ  hP404-0@-  Ѝ Ѝ/-@-00@w 0 Ѝ@ Ѝ/-@-P 4(t { tЍ Ѝ/ᱲO-MPp`@PЍ P P 4S P 0uT0P$ Q$YP 0S 4S $ X0P4 S $uSG0!!p`000  0 0  0 @P 000 00 0 0 P 01 T0哇* P$(` ,`$`V$R ڜ  0`  O0 0  @"UPb 00pP0S$pO-,MX\Pp@Po 2R 4S  0u,Ѝ@ 0Q Q0 '  PS[  "S d 0000 00  0 @Pt4S 0S6  00 000 0 @0P 0 oO0@$00SS `ᾠ(`` (ἠ#3 # 3  1 # 8 0$0@S4S 0$R  @0 RS 00 0 00 0000PV P0P 00000 0  P1p><UHdoG-`MpMP s@PYЍ#TC^t E@0$4$ 00; ᶫp+ p ft@ShpP @4$$: S R B., Ghp $4S ($,40(B. 7hp E0dR04<$4($,40 K>؀C$$0 0E 00`d؀E$t0  P0`P 0$4S    0p 01p 0p p}p p 0pp{ P P 0"Q Rp5M*pIg Z0" d@/d@F\r@-@P 4B BRP gp <\4( fЍ@fЍd@p@-@PP PP \.p4PS4 PPInA-p @PP0T ` Xp4@ p@@$$ - Q EAQ0 "(  0T 00 /$4 0T0 / $4 0T0 /O-`P-p M@7\P䀟䰟`  `P0P00008r V:Ѝ 1000*0 P'r`P10 0 rP U P&%OB.C$$0A@-{P@-@ p`R`kЍpP İP 4 R 0 VD,O-p!PR0_o|M`@R(0S00S "R0oU |ЍP dPU 0SIQF (0QSB!RS R9"R S R0A +00S000P#  7/p  7/p 40   m0$80P P P 's@-`@P0zPЍp 5/p 4  5/p 4 7C-(00pS4`  Ѝ$T@ 0 0 h 0P 00 ( 0PW0AUO-0 0`Pn뤀夐嘠p@T Ѝ0  0]P 0 0S Cp sn@ 0 D,P A-P$`$p@0 1p@TO-`p lP`@`T吐  00  Q  x t@ T&^O-M Q8`<@  00PЍ  P P0S*B PP  00040  0004 pp `040p` 04p 60s@-SX`@ P%= ?o2R0S ЍpD,@- iR sR aR p` T~V7@-@P ,P9P _ Ѝ0D,p@-@T 40`PᮈPVppD,iR@-. 0 aR bR LR) BsR& tRP 0P0S00 T(p` Ѝ(h0 D,p@-M `@P` P00͵00n0S n nЍp&ȡQA-@ MP Q   ЍA~☀ p$0 n 0`Pp `B~ `PP  oZSO-$MH@P`P 0P`$ЍpP 0 0 0 $ Y># P0*Q  p0 0?Y S0STp Y0 p G00 pW 0np $ 'nP 0000 0 lP Io4  $\ P  0U,S( 0$`84 0sp{ $Ĕ'{!#,  RP P{ T P R*L0Sg 0p^ L004 0 000 0PL 4$$  > $ 0$$?0p6 4d00S 0@-C^M E@$m$$E0 0  P Ѝ0 @x("(!m"`#XT 80  @mP8m%%#.?Qf}X%0$ 8O-LM@Pp4 ⴑ崱 1D0 rp  0S$ ! R t!LЍfR lRJ  I@1` 0S  VP mP   Gy Dn蠟 k܀P 6 6nZ `  0Nm@   #Z  M 0`` P` pf% uD,%%A-p`(P@lP 0p`P @00! 0$0@-@P$0S m@mO-$MHLPPDp`T   V  \ D@=x` @SR00 Q ^00S P UP 4 0 T0 0X0P$0sP UP000 P1!!U111w@^P 0yPPJ T0 0X0$0QP 00  R@P TP0 \ 0 0@;0 0ZS  R@PP0 V00IP  0 0   0R00 0P0@SP@@(4($Ѝ6O-4MFpT0X\,! 0  0  0 ᒴ1 p 0 0  0 ᒄ1 ,0dVL 0Sk     R b A  [  ]00[$000(00$ 0S 0(0 0 0S 0H 0S0D 0  T0  0 0 1%4 00$ ( 00 000 0,00`4ЍT0$(p 0(00$ 0 01!$00R$000``O-M<Pp 8EJ@`LU 0S 0 0 0  0@`@ `000Spa. 0 G 0 J)`VT `@ T0 0 P'@` 0T0 0@ ` 00 S0 00 Ѝ 0  0  J)` T'U@ ` Q  R0P  UpP0 0S 00 0 0 RU Q T0P|  P0 T@ 0000Sp@ `Gb6 P/0S//P/0S/C- `P R Q  0X0 RU@-@,MP@p`lP<g,Ѝ, p`iP0  46@-XXPX`@RL0 PDDDj<<l@uTxhOB  !%5!R R R D@-R R/////! Rp@-0@P! R8dԃԃԃԃԃԃ R\xxăxxxxxxx̃pp B R"Sh h@i\0X pppppp 1 pp!D(!, O- M0`u@PPЍ0!S R j8P(P0p \4S\ 00$$88P44 8S jQ QP0 4S ڠ0"S1 @i0  <03/p 8 H0 0($ P 0P 0 0 $ P (, Pp!WEV"2"=", !D(O-0-,MP`p$0  np@d30S$` vP 0" $ pT AT fT E@,ЍsT0 0$Op00 00*:@=qp 4 `0}p0ᴐ00004S 0 0Q-$2!0  R8 +R.R+ Rh!h@Eh\1R R8 0S8 0S$1 +10` 0`[ppr pn 0oO@@ *:|Cp@@[hW 8 H00 8 Y$ (, `\"%b"% , |"!("`̂"A-@ĔQM pp A^PP`|t`QPd PЍpP4 $0 'PZS""#G-@`pP& V4 t" An⸐帀 ` $$ F0 P ! p" $ppP P 00p$Bn  0 PZS6#S#G-`-M"@'mp ЍG20SP5`pPx $R  4SЍ4S_P R 0a $ RQ  nSMP 4S P P 0UpL0 08  0P ,!?o  0N0 00 [ pP2?RP P  V0p 4S 4S  0,%%s####U"$@-y 40儛40P (, \   X \ (Q,6(VV,,(X Q&ZH!V0p` 0p4  V   0 P\"V_ QY QV Z 0 0 ` 4p ` 4\ "$p0 0S 004  $ 0$ R40H Lp 001S0 S 00 sr/0±0¡($qpP4t 4$$  ZzZ~wU%%x%Y%p%%%%%&O&&&|&&&C-P$M0@ p` P!! ip*0S00 P 0SP0SM \^H 0T' 10S#!Q `2.NP. a@ P P ꐚؚTXpT T ],$ЍP`'%%@-MQ a@P^l|,Ѝ@c0 |cxtplh 0 @cPc q/@ 0Ƞ0 0#30 \S0 P pc $m0 8 cЍ0 0 ppc1S1S|pЍ@c2\PL  PЍ@cl's'}'''''''q'X%b''&+p@-M(@,`6#,P X0c P00͵00]c0S Wc cЍp&'ȡp@-M ` @T $:D0S@ P:c $$0 $$0 0 0 'P  ,c 0 tcm0 $8XcTc#H  ݍp('(>()X%\'(6)b) (P `00CS`0p S00 P0S X0X /Xc%C-YMM P0"0b,"  b $r@TYލЍ b  b Q] b   `!0!0 P\ LbDb0!0(b$b$ ! @<#qP$ !<#jb ym0 $8x `b^b# *7@PQbMb   F V,D(WJ(\(d(X%\j((((&)A) (G-0|MpP `@ P! gpD20S!nP$@1 9lP`Pa@ P \@@@@d@l@@uP .@ЍPP :pqPP0S007 P 0S0S \^ 0 Q t a a븀帐帠pW a  a Q a   p ao)%x)%,D(WJ(\()@-LM@P`4 p 0D0 fp T$  ᨗP 00S 0 TR lRxLЍT pT8yp))%X% @-0$Mq` 0 0@P!! fp$0S00v P 0SC0S@ \^; 0T 00S!   0*a@ P |ħܧTtopT eT " $Ѝ-*%%-,M0$00 0 00 00 00 00 0 00000000 P`,Ѝd*7@-@ P000 00 000 0 0 0P  S Ѝ0C-M@pP ` 0 00000 0 00sS̀@ ᥖP0㓔$ Lp0lS|p@ ᑖP0㓄$ 8p Ѝ@T r@Tp`G-pP8M(@ 0S   wP8Ѝ70 060050040030020 0100000.00,0 ɨ P #00R R 0S T `PP0c# BXP*`p@-PP@M <@` @ `  5/V@@Ѝp`A-`(@(pP0 _PU@`*4p@-@$P` Up p@`A-PP` 4  04000 00:#:900 @0<<0@ LSp@p Ѝ 7S PXKS@@ R40ipW;S+**+%+@--Y-h%q$yE*e-p-}-v----------X%. .(4.I.S.<.,O-@-ZܚܪM`p bp :0S ЍO~0FS iSPpC>؀C$dP W D(ЍPzP W00 !9PLpP *JP$$05EP:?JPP JP (0QEPd&?T0  0P 0$e 4 Q 0 0 01P 4P0P 4 P]  P00 00 0 00[000000S$000(0IP `I0P: TPP DDD@@`P'@@ 0$g\PP  0`sqp R$4=,, 0bqp$0`Ay4 .1Pa 4`9P `⪒P @ o/PP HH i/PJ @0 SD00H0$ RL0( 0A| O$4P `$$O$4P` VKI`P GIP ^O&v|=IP bTP+8,0 ?`P ?@&?  0`qpt p $/P3po  ./P   '/P   /P   /P  , /P  `  /P qH /P  0 .P q/  .P r .P 01S 0r/Ss?Ⲱ, ղ Ѱ  .P s/ .Pz$$)O$4P SPԣ{ )?`P)?$$  0 ``qpS p0|< *0Pi <p5P < @[< 0PY <%P .PN  .PH P .PB << /P <$ 8 W.P2 8 Y* 0&b$ Bp v$ N P$4`  0qpt$ NX$ @ O800$0 0(0$000N(040P08\ ,` 0$00P00T0 X$$0`qpY$$eN$4P000H00 L0`$4+` 0qp8$$DN$4P`fs.D,%<%w.s#h..Y--.4.-.(..S.I.v,%/Q/w//i/y-U/E*e-p-}--------///000@-M@ P  ᱌ }p@ @18 Op()0Ѝ0X0C'iD@-SM@P, 0H0P0X0`0h0p0x00 00T 0 0\ 0$ 0d l 04 t0`@pt 0 \00 DL`|`p D Sߍi@Di D!i,D@-@    D0`( "4`#Ѝ1p@-M0MS1`0`Sj@ A. H015P A!AxYP 0`0?oS cP 05P PP,Y0 0A. 00`0P A AYuY0 0A. 00`l0P AX XvA\Y000D 0凑8vYލЍp(G(&8DADHDUDcDDs@-?PP ;P 4 ^@`TЍpPP  00STV : X@f0D4S0 R !O-@-MPpGp#`P"   'FP+ >L FP8FpP 2LpFP +Lx +0P0&h 0R0 0 p "( +Px 0SuhQr @ Npgl K 0 00  R R R[  0PW t [ h X (oDvW 0f0S, @ hMP@ `Mpd HQ L 40R !n01Sp0S 3/p\ R 8 XMp \ 0S 0@ `Mp Ѝp0CDDDjDEDDE@-`D@P@ ЍEPU ;P GpE P k:@;T DEP@- ,P ЍA-MP p^+@P000p`ЍpP  L4 CMp !0 ,Di@-@p @A-P`DpP00KP@?0K  FhA-P`DpP00JP@:?0J  FJ@- $*P00 Ѝp@-8M@ (P*P1!#DP# J0 Q0s0S00GJPP"  D@9$`8Ѝpp   ,J8 PD`9V"E-0+ElEi0@-BM M@  [p 0S 7  /  (0iP(@0S700$0/ (h 0ZdP(@0S Bލ Ѝ0WC@W;@ivEEEp@-Mt`DPP JP@ T0T TVc"J  74 p 㺓ЍplEE0+EiE@-M@  p pЍi@-M @)P0 C."x p 0!Q0s0S08 1p`Ѝ"F-H1)Fiis@-`P p@@@)P0 !k@PlWPI P@ LNDCP 4 nWЍpmF-S1)FwFFDF7@- P@;p` `.XiC PH08 DD!0<80C ` Ѝ0b1DFF)FD7@- P@ph h0TL:C P<0( 88!$C ` Ѝ0q1DDDF)Fp@-M`CPP00Ѝp%IP@UxT@Pd̒P0 &p@㻒8 P@PP VNFFFiG@-$MpBP00$ЍH`~T@Pp d0 pP㋒HP P`@ p$ㅒV[L!G6GiOG@-BU Ѝj&\Gp@-0M 000  PJp `9T@PU `@Jpt 0 h`RP00S $UgVSU UYUPxi hGGG0@-M@&PP  )p$ h0xSGp@-Php@@@HBPH0H HH ZHQ P$ VpF1)FwF@-G@-MX @(PD0D DDv 0< 0 p$;Ѝy-1)FiH@-MX @'PD0D DDU 0< 0 p$o;Ѝ|-1)FiH-M0( 00 P 㚑ЍiG@-@8A P,0, ,,% ('B `FF1)FD00@ S/a0@SW@/A0@S=@/@-~00@- M@ (0, 0 pW ЍiOGp@-` MP@AP G Ѝp`    .G( PA@6$`qKvi 0@-,M@ PO'P0  p,Ѝ0 0R0 s0S 0   0$ FPP 8 A@L6$` H-1f)FqKP@-M `@ @|6Z {< <G  SЍ  M?&j&H2H^@- X@&P@00Ѝ  p@@  g:7H1-$Mdm@@PP 㚐m冱`0LP00~ 0P   P 0@p%@-p0( 0`P/ R/%O-04M@@ !T10* D`Gďp P(0$!pSڰp D@T PoS@ڀAP`@ ,p00L\pP` R  P Q R/6 0TS $P\(P  1/ P tF@0S Gp "SR(0 Shy\0 2/P W0 [ 4 P(Jɚ;6e4SJO-MMPp  Y p` % P pP$ 1000$ s-aR ⬄ Gp8 ⟄ Gp Q dER R8 p$<Q ,5R$_X@T xX00@0 0kGPRh 0 @0` ,0@4@TGp 0P0Px0t 0d 40,@EGpPj 4HQR00ЍP-u;QP(|%P0@-M@d<P_<P Z<PtU<P d0P P P Pн< PNp$Ѝ0QPGP(7iPs@-@}hO ~P L OHPH`~ P! ,OЍpN@Q0P QO-M`@PK Ep pP"㾋(  ွ  * !Dp% (r( px" <@T t8PNl2P\N UR TЍ0 P<uN@P| $@Cp U}Nt 0R Nk)EN CNP `\|q|||zN` R#Q\qN .Nm?P8ЍOkOP\ 0P   1Q   SN0! RS} DNBN" M0P R ` V 0P`p`` `DX<C8i(iQ+Q;5QX5{8 "10#Z0 I00o 8 ]@pG 0YP@T 0CS0 0 xC0X0^ :T 0CS00xC 0xRaDPW@DADP7@D@S 00@D@ TSS0Z`>@MTh l }9P7.U8 @ 0 0 0`0P `CQ=QFFA-X Pp@`Pʺ00s'0P 0 p 0 `P0O-,Mp`@ PP 0[Y: P X 0  P 0` 000   0,R2RJigRa%wR1A-0%MS@F/ p p<8ȷ Gp- 9`08N/p`S^ P@8o`px0 pfd XP0,00N/P0,0T0($0`H%ݍ(Ki`CWR$ @-&p㽅IiRp@-t`tP0S s/o" R@ ps < =p@@pP@@H&%(O-0PU` 00Sp1 000xSP PLD1p@ Q Y d1P @ `GR B.`U     @ Ѝ W:UUp@G  @ TA̠WL ΠL̠ 0 B W B,B,  Gꌹ%%RSRQA-@Pʰ00QQ00S A9H00Sp0 000xSX-HTp`V&H`   @0ꐹ%)SeR%l p@-` MP@ ⭶U U( P00 Ѝp00 0TPTT@ !ᑶ!0P!!`FPP  @/ 0 `A-p`Pp@ @P(㥄 z A =CDp@-M@P` X `ЍpO-MMpPP!〄p`p!t pX!` F/ 5  <1W@4444T$ݍЍᄳ0P0  R P 8忱)0  !4  <0px-@0 "' R R00000O/ 0P<1S O/,DG>DC0Si(?SHS(p@-`M@Sp 0+SЍpP  µ  ly R #fD ]<p 01S 0/S -Τ i_S 00S/@-@FG(oSA-P@`TpP @ 0SP %~SA-P@p p`P h 㭭PX0 000 @ p`WㅃS%:iS@- M @ph hz` P00 Ѝ00 1pb>SS9iS@-(M @p Q -P[00(Ѝ W00S L kP02 0 p+>CTS9iS@-M@ lp 0QS S  7FЍSS/ 04 8 <` S $S HHH S/< S 4$0 ,/(/$/PP_!TPP,T'TTT 04 8 p 3Q? DI0P 60p 2Q8D8 ⡲  p 0S0 C8 pu p t  p 0@\  zPpD2Q <CBߍ10S C10S CC 0  `0000pCPU0``0` Rڬx1000 0:S RL P<C`(PpQ CV pWP ,ViEV@(OVXVbV) mV{Vi8iii?VuVVV%TVVV#qVV0@-B-B O-MM`@ 4bP04 lP7EgEP|7U 0'S`@0 `F@( 0R tPy['V:0:0: 0:0 :0:0 : B(@!0! P T0 /C BRV  0  00=C$0Cɟ"!``F 0^l d9EIcCP S@BA`p80P0 p` :B!0@"0$0$0S= A0 P0B'S 0؍Ѝ h(S   BS>C0CH(S  $ȟ "!! CR  ##9C0C"!% 'S>Cǟ>C"" N=C0C00Q0g*S SS$$#T%###p%2SK Sp 0SC R< )SS0C'S񟗶**$*X*`**********h****************p*x*********0S 0 tht0 `A0$ 0 B@$ ^ R 4&S0p(A$$$p`W>AA 0R 0 xA`0S oA0S 000 dA00C!圥娀`pXP0  @ PAp` JA0S 8WD 04 8 <%S84A0S 0,A%A ` 0dY)1 pG(  `0,0t4判pY$( 1p, sgqpW!ևӅ|H@yW-0S\ ,  W ((I @3 $( P  #P# ß P# @pl3I#S0S @0S%  l@ ST@0S @@p {ЍPv-?UTY0 /d(%/-@- M,00@(000 P  Ѝ@Ѝ/P00  @@@@0峞-@-  {AwA ЍЍ/@-@dA㐨3Z 0S/@-(-@-  [AWAz ЍЍ/-@-  MAIA ЍЍ/l0@-M0S@ 0  0000 0p@@Ѝ()Z@-@h2H52/2p03mpZNZ`Z@-|MPڸ2P0PS 0P@ 0 000 0`⣖p TiP@H 00@4P8PSu`!0310@- Mx 0 ԕ@P \Nz +<LPP @ , 0@@P 020Ѝ0h(%$(@-V4@4 = y =;%\\]IP@-d0 !X !T@0 60\ (0000/v\\\Ph0@-d`  !TD0 60\ ,00 00/v\\\P-P040#^4<\$0000/v\\\PD0 40#\00Q 00/00v\\\PL- 0:# ^4 0Q$0000/v\\\PL- 09# ^4 0Q$0000/v\\\P 4 <# \,4Q00/00v\\\P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00v\\^^\$0@- 00:P Ѝ6p(%A-P~q@p`WЍ 'P !3M@P p7@-0P@U , o = Ѝ0nXaA-@0nS0oS@p ptnhP`:P<0nS0oSX>PPS>PP'P @-sU0 a< :^a%O-MM<(0<,0p0PEU!+ e@ PH4HH4H4HH4H4H4H4HH4H4HH00000000 hPpquh00P0<490000000p0 Ѝ%eg<,D,TeZg-BMM]@0 P@t00dx  0,pL0 =ux0 0/ "  0ep" 66lgfp@-@PP,p@0/Sp p@ggg@-Q 8o65g%O-`@ Pp(,娐Ħ뤰0 0000 }=p0@DTq oP\0 ShP@tDh9 O4% h<,%-D,Zg@-M@A> 0@0D00 p0W,p̦0S SH Ŧh: 00,0 0t6"iiiip@-@PiP,p@S0/SpG p@Cggg@-HQ 8855g%O-`@ Pp(,娐8뤰0 0000 <p0@DTq oP\0 gP@Rtg9 O4%j<,%-D,Zg@-M@A> 0@0D00 p0+p@0S SH 99 00,0 0t{5-iiiip@-@P݇P,p@0/Sp p@ggg@-GY5%mO-`(,p崐崠崰0@P0 o<p00@DT oP0 FgPTs7g  -5A+۝O%-D,k%Zg-MM0An @H 0P ,0@D+p s54mp@-@PkP,p@U0/SpI p@Eggg@-JP :74n%O-PM@ P0:r`";p+x2 0S00)0x0& 0 x`1p0 +00*`&0`k +pY =suPfPMP9 9P$ GP g@PxRQQQQLRRQRQQQ@RRdRUP|0 0|00|0|00|00|00pt`x 0cfPrTf|@Pw[,0p0Z00t0X 0;;0x0U0$00|00|000ЍD,Oo%3DmZg-MMJNP0 @P:00 0M*pl0 r0 0N/0 4 m000@053lgnao7@-P @0Lo S? 0 wr Ѝ0o@-@&0P @C@-@M(0P @0@- @0S 00S0?  KrЍop@-@PP,p@0/Sp p@ggg@--rTs@-N40 0000,00(00$$0 53sss%tsps%@-  @ 0 PR\  rЍUtp@-@ \0P 0(pnNPP,qPM3p@6 (LeO-@H `p堣<H J000V Y:p60`FVQp 2@FPXXxWxWxWxWxWxWxWxWxWxWxWxWxWXxW@YLYxWxWxWxWYxWxWHWxWxWxWd\xW|\xW\0]xWxW]xWxWxWxWxWxWxWxWY Y4YhYxWxWtYxWYxWxWYxWxWYp\X\\\(]xW\]40S =4 40S4 0<007aE0:8d$0000000D309@0;g)04 0I 08(0@0080 dP(q0@B (Q  Q@        d20  | c000$0 X c000 0 4 c080$0  c0:0<0  c0:080  c090@0  c000,0  c00000 0c0909Rg01ra00$00 0 0tT00,wM00 xF00007000+0h40 F Ѝ(%tH)%D,%< (4 (@ (oZgq8 (\Gwt}ttttttL)%A-RMMI>0PC@(0L P@Bq吁H`( L0`'p-0KSh0  R<( Lh0n1T0 *3% 0 o( h0^/P  0%kPP 00,@ 0.0T0 @fP 0$00 00000|00x00t0 0p00l00\ d0XP,2RݍЍ4 (ulghrttp@-@PᄃP,p@n0/Spb p@^ggg R R @-o/u@-@M0P`p 0&000 'PPЍ0P0 0 0'0 `&0P  Ls@-`000/@P 7&P0 <Ѝp 0`( "4`#/0@-MP@ V0 0P@h00SP P @8@6 0E2@Ѝ0 (.sv(002P0/p@-BM`Q+ @P41010 0000000 0P 4< 82H00BߍpBߍp@o꠆6sO-M8@@P`ppЍ8#<ă Ƞ,Ƞ D<删4$03 00<D e4408< _0\,YD0 0(0@Ep000K@`p PH00@AP= PD 1 (ha8`Bs4vO--M * C@P`pP0FT0|p<00Ѝ 0  3/X0p 0PP 0@ `J P* 0e1H D@0 P3/ppGP0pPTP@`P꠆KsDvC-MM`p/ڟ mP  P@1L#d8$#4d4# N@41@xD0 0@000 @pߍPHڀ@Td$ d 4 (O-[ 4M`P@὎@P :V@P`z4Ѝp p 00x 0 @P }@ Pb0D 0800 00S X0S00000 tpp cP@0Sp!0!D0D00X 000 0  L0b"!4b4#@0@@ 000<0 (avv (@-J 1.w%-0-M 00H 0@qP ,7mp zg qЍ]xjxO-PM$ 0䰝 @00@"b0"p0@@@" 5p2 0BPa g@Pjjjjjjjk0kjjj`kjl00p00@iop l!  0D`Pl5` ҖP    0 S Q l tl@zNz d!!L ᯖP    0 S Q  0z @z'  op 00i+厖   $p|  0S0<S0@pS(@p @Ѝ?B<,D,%}yxvZgxxxxy0ycyy@-MMCN@80 0@ 0(00 0#p 7l 0 V/"S/!P/(5"0P( lI/, 0P , TB/0L?/ލЍ48/(4/yyyyyyzyz7@-P @0Lo S? 0 k Ѝ0o@-@5 0P @C@-@!0P @0@- @R0S 00S0?  kЍop@-@PP,p@u0/Spi p@eggg 0`( "4`#/ p@-"440 @"440 P"440 "440}( $0 $( XXddhhllppttp p@-"440 P"440@ a}^}[}DDU}@@O}HHI}L`LPPTTX~X\{ \`╘p` p⑘ p@茘p@-`"Q@Upf@p@-@P}}}}pA-P@M4Q->C}->?n}C@X=X\:\79>|9>:>C|:>CF| 0? AC>|C>mG|F|E~EnF|G| 0X J~ pXW}m  $$((,S>,|S>G|F|HHLLPPTTXX\\O-P@4pT` !"441!"441  $$((,,004Vܑ\5 S L5sTԀp0,$ $Q p W wTsTXoXp\k\`h`dedhbh`l^lp[ptXtxUx|0[ LIpF``$5S\5 S ` 0SP%P Sز , '"TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 PlV0@@TNN@D@` @00C030S30 0C0 0#0030 3#00030SUd  0@ `?5%0"ST0T00  B "0PSX000Y0.d  0@ `5?먠ʿ 0Ϡ:,0 0:1#  0 0! ?ߑ0 00C000 xS p10S  ' dϠ 0@Ì `0 1! ! NA(J40A%^80 C 00 080$0C $$  $ a40 040 @08@T@d`T`@O@?00`1>Q@00S 00` 30(T(U wֆ%P)%CO--MM̵p, 51N_R0ePS yqሢ儒 ?D 0Sdd/~D ?0?D4OP p؍ߍ51  2@ŒD 0L 04;20d04 0[0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#8p 0>4`0S7x 000 0p0 0 0`  0S 0X 0 0`S`a ,L 0#\0Q ?,040<09(080? $0P@X  0@Dő$ L00 /4;0^ 0 d0@0o 0P 0r ₱`W3 pF{S< yq0//~D22220OD0? 0 04\0hl 0@DE 0L /0d4;00 0@$ @` 4 <001x?{\0X0`0d090?,0{({{{$0 "@őDL  0?$+4#Q 0( d 0@Ì `01uP)%L ((*%,%Ao(T(TO--M M: c>0?0 0 0D0Dp0S3 80`V/,0P0 0 $L (`(X(((w 0@P`P84"p P@ 4 pp] 3T@  (CP` *2 (P S((0S0,5 S<0x0(5002 0,%S0022Q04j%G 0Qb%?b" 0 04 0A T%1 040A `K%( 0 4Q@B% 00 Q$*9% 00Q(0% 004 Q'%1 0 S0 C' \1\cX[Y1X0S| % 0X RR $%0 bH4aLBϠ8A<Ń@ϠPDŃPT\TR`8\PR001$ `4P[0 P c 2# SQ,Qd0Q38$Q<4R(:#((T)%X)%al(x(>ip(P(ψ(FTz(P)%(T|(\)%h(t(((D$u PT0\5 ?>C00`#!3x00084$0<0D04t `@`Z000`XcL5P5| P4`F   ?n8@pD ?g ?ZZt0o1&"  A00@&"n@0  4%8$05<4R@4$11 p84000 0<SoPx8S @⟏P0@? @P:PP0* :  @PP(5#R0:』P@0$- 000Z0 a``8 !0/  !.1 >0Z `  b0 R[ Q[" Ϡ  ! 0   B0SB00㌃P`0*2"0$ 0 ?xV`1V`#T0`10F 0✍I :  0B@TPἐX 嘀 00B1  BZ!0`0Y3B 11 0S B!I0B? l0 `4똀 0 BZ` S2 B Q 0Sp H#%\u @P`x1 0F<Ĕ84CP0S`84<$-0BPQQɑ,`RB1ȁ@L0 0 0000L60S|0` ?L4 40H 00 6kmp>'/\#R2\3PPT``0 S  _(7\5?>C00!#4t x0VT7(T0#2! a, A3 31  0 ῌP 04 P Q 0H$4  $ (  B, @%LV.  R*h ( < (R X $( \ ,( E.?.XT+BA.B,-0 HUPcx8 @40 PKX ,p8d A YZQ XZ 0{X RA pW $4?.t{ 4 R?D4P00@$04 0H4( 0Āp@2 R 5#< 5$23dr0S+c됺 zz000d0S CQ c6Rc`P z'z {'+S! @ z0犸 08z'(mXȊ (+Sl,! 0  R0:1P000\hP2#00Q@@00 Alp00 R00好&A0 _0S_` R! PP0 t`y6 K  XZ⋰>(^FÉ8(S{(k'%ht@h%(TP(U 7&TX(L ( (P)%%T(\(8 `( `00Sh  0 # W 0+ V.㦋|00S  - 0=S,0S #0S0 0" ,0 0CÁ!$!\^   0 0 0/d! A, a3 1 !0  1@ p \PP04SP0 0R0 S  B S0 8:0,0 z0P0B 0,0SdK p开8嘥ȿ+" < Q \%|0R@.$00 @DU`@,( 4AAW2( R,0@ `0```0T0D啼(s 0 M` p`3$0[`0L I9pQ004 帀 P0x0 0Sx0x0t\00\ ⨁  B`[d HQ   h ` lS2  B±dd 0RXN%J8U0   $0 C00 0 0 R R` ` = 0$5S  l01` p00040S2dᶋ0<%ST0T00! !\%0SP5bX0`P5`S$0d%먰 !  $0勋00080` a9Q sV@0+@  P+@⌎ cV@0-ᴐR㰑 ,  BU (0=9(000T0 10X0岁0= R\ ?0  0  B  R\ ?0   00C 0 080 C  C 4040CS T0C0@pw 0`4 8 0 RT:  $5SʸG $`$`(0V70S ,4 ; d,04  0,4 $  00`  Vj௉X80S   0帀0 Xx0#`Hx X\># P 0d? @Œ `0 1o @h9\%R tI0SP+i\`/ `ƌ$  $ k0)`S`0 0$5S  l01` 000:0S/dp0T*ST0T00! !t*0PSX0b``[d먠 ݊   ׊H00080@$0C40 0400T#*< Q`?0@$00$0l0h`0@ppT:S $S0p0S $S00pW`@P_뀐 H)_ 00@T8p`0x1 pZ90J@Y!@_0@0  T: 呵@$\ Q  @080$0 徉 $0d O@L LB l; p  o0ST=0S0 000S.08C =R= 0ł."\5S 00 0 d 0/ @. `3,0 0 (0000P0SD> 0,@0P0 l>0S 0S >0S  HT 00|:x*0XP>0SNc C>`?0S3030404040p3pGVW*PtZV.PhoV.GV80S n?0 PS?\5=S,$??^ E?၇0 0S 04 4 dLĒH 0@Ì `04 1,$0S0S 04  d ,04 0h 04cލ Ѝ\00 Egp@nSaZO-RMhbP  9Z @PHY@<  bPpߍP(  Wpp0S  <08 (00,0 0000400!4 04$0D0(0 P #Vph  0 p။ H < 0 $   p  p Y X p 8p?pq8SpVPr   00**0@0*P ∃ 0* *=d@edATluzd@A-CMMPPp`;8 Up@P  0P;P:U00 ## CލЍp@-@PmP,p@0/Sp p@gggR/2kG-P `$ 0p |@V` 0|@`` V`@&!D`( G-P`0 4Jᴊ Y0000008#8#$48#8Y\dp q00! ## ?@Ѝ :F^^F: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- 0X$(p,P0`4@*^0 *^0 *^0*W0O-4MX00\0p0`P`w0 ,0, 0S% P 0 LXmS aSMSASB0C0b0C StlllldlllllܽSSU@@@sS@ @ @U00T 0DS d9R$ 0 0"P T 8 0U$UQUDT P 0 @@@ X 0t0  PW0S00 000 000 P4Ѝ{{{|G|@-4,@, '$6%|@@-0 @   9 O-@0p }tP`G0 00000B_I0V W `B@ ᴐ(T(P0  /PPP\!1cQ\ P/p@-TPL`(FV@ d0 P 6V0@ \0<@p(0P  C @-RWco`/$s@-PL@` 000V  @=WЍp((?s@-PX00SL0@`ă5#0004V @WЍp(((^d10 PS/C-@LQM8MP`f8 a᥅ 1 P0p8 0 T:86S/⒅ <6ۍЍC+ 0 P \ ;0 S a8!#4a4# 0^ ;0PTj 0+ۍЍ(((((O- R`$(HU2+ k [S!Qq 0BG 0콟0 S 0008cS05=0:ԃ0ᓊ 0σ0UC 0 $ 0$P   BQ 00崃  p0F੃0L  00060 6嚃< 0 p$p0,(@ (X20740x<080@0h U,<0DHLP\P`PdPG   0T000i/p ݍ ЍL0@ S40@0w P xt 0 @waOF@P!Dp b:P Y80S 14L : SRQP7  wPPPj VPrPE_oR0: b=p 0wP0U p  |P  |@DP$ @3m`Tb:*0 P0*0 :w:*QP *:&s@ .,0SPD`Ap0 S1|0S1t0S0x0S 11011h0 01,0Sp0| RSt 00R0x R0S /ǔ; P0@S 00 T @#P U,  ;,G|PD;P0 101000BT 0`S`Sʈ0S 1S 0S 1S 1S4L04 0@w?0 0 lp^ p`P`C0S\*Lp` p1S?V?`#0*@pT a1S *6pJ Q 1S A0 y 1C0 S Z000 Z00 000: RS3#*:Q 00S+ PY@00T Q!tmP@ T0 k" p d "B?;;@0DKP?`|0 QZ# Z Z  G ZD0S t5,0S D0SX0\ 0D0 @0D00 (+\0S &X0S    T*,,00S0 Z0S000S"  0C 0T 0#Sz0S0T0S SL t 0S 0C( 00T00D0S0h0 l0Sl000S1\0S1X0S1(0S /l(0P: &C(0P:  p`b)0P!* RaQ xV000S(dR00S00ZY` 1P00V`5U0A $ 0z$pY㤢 0< g'J%zU0u<0z<00S:Yz$   zU e ?y0 S:1SL5 R 1S *(0: 0`000 Z P011$S3#SQPPQOU Q1S 3 #S RP RM Z yP3UP1P Z 0S<00C<0y`VZ0D  y*10$00A00 @00,0d0p 10PUWP1 Zd0; S9:Q0C?o20S P PR*> Z  2Z$ 02#by@ d0 Zp0#d" Z΃6#0\0:Pp> 00@0Pd0S!0$0$03 qW 5q:$ *R" P    G$  sm Zpa ZdabV10A0 yd0S$ 0@R"0PP0Gy1 d00Om0 @P!d01SW*;1h{`˛%Ѡdą!2ҜGm&Jv˝#/?IaО{L|j&pr)T)z%gfffg URRaArrAa#,4JSdQD.k Z0 Z00Q* 0R P ?o20 Z0 Z00 iQPE0! (1,QR0TL 1 00S 0S000 Z01 00S03 15p5 1 Z40 d00 Z01 h0_ ?"802`q PP I8?C"Y$ @0T2#D0$l Z00D 0080001l0$40P0<0#40T0,0#40X0@0$0   Q*" *  H\  0d03Q0Hh080 S (s0S 0d8w800T0 ` 00(0S( Z0q@#W030#W 0W00S  pR:`*p"s0V0S ` pL T  ~ z0S Z1 S C/o" R P0 00 000$00<00T00,00X00L00p01t01x01 00 Z40 @ 0 1$00(01,0F?03G?03 )001 01100 04L"/@!b$ 04v 08 0#$ #(#< 0  0%` \?h R(0S00d00H o00 0 ST u&?   8p T]  H R 0 Q  !R R S 0S60610110D @QS*@ C~wQL000l R Z  R   0D0 00BQ?o20S (0 00 25 010P C0024 01000pZ40S2 $00 @0+ <0S % 0,0S  0,L0 ?Yp0 L  <0t0A?0x0! 0x 40S  Y!  xhXQ  Q  80S Q39,0S$y 0`( "4`#/   k B*@-{S-K A 8 /eAD00@- 44@4P\P 0B"" X)-@=B'%)@->$ . %G-@P ` 0y!>0P V0 0  APP GhqPpP`0 X 0?G0S < 8G0 tV X)H,Ρ0@-@tPM 0  T\ \0X PЍ0 P 0 0C 0  X)h)@-044KQ     Ѝ@-$MPp  `t @1 @00 !0 0 )) 1 p `P\pAT D TV@D:$Ѝ 6Q] oWQp@-0M,AP`  t 0 0 010R  2   $0Ѝp@ R  #   $R s0S 0!$$("( 18#! 0Ѝp@ 0ЍpX)v͢  @-pUF)ޢP@- 0 R * 0 #  @0x%)P `00CS`0p S00 P0S X0X /X` %p@-`3x@8!RP#<10<10 .810CS81V <1S 0<1p0 hhdh`0 xPp <10C<1(0 810S81X)5%h%%)0@-@-4MT A`dhQ `"R d2RK d2SA = hk0:P{PST1B k? * +['Hk<[E{7  (+S PPP  0 @@zj{ k[@  k[+S4Ѝ00B:k{{'*k[+S@@?-C6?Y@)X).DU5%))ãxo@-gi0d2SìX)@0@-0S0@d2Sg`2"R25%X)@ @-@ 8!<qH 8!s{  { ,00X@ᚙ?333333?X)5%O-ppDpd&> ^"44-"P40MRP=p3 204q Z! 0S 0q!2RT00$` 0 x@ 0ЍX)()sG-`P-@@(pn 0!0 T |x  0l  {\{(+S 0@$@7 ,G@@X)%80@-0 Q,000 0  <%*&\%@- X@X  D 8 , %JG-0@  R R0 `堀p 0 RS000\RP 0SP0^'R"R 0S S P0V%3@-@ P l00S\ 0@ !0R3 @00SP P990\%*%*p%*p@-`0000@PL?0@ Q-00B 0$10S !0 0C!0R3^0  P 0*0 00 Rlllxlll R  C\\= 0@00p=0#0%0%P/0ꐹ%p%*\%*%*b%uA-@P`pw P0 SR 0S0B0P3 4@0 0  Yp%*\%*%***P 00CS0 S00 P0S 0 /e%A-@PpOqP l (lPXro`ooP :00]o0/S:0 R/Sp/Q  C0SP 0`/SS 0FS0.SP` FRkP PEU0u/S`@ /R/\ 0n9&%O-cM M000@00<0<0<0 <+00 1&P 0S,03,0L030S3S3W|OPl Ctl d I00 <<3 S n@@ 0T S S00 0#=0@C;;@0S+  ;[O-0S3/S:+& 0 @ 4@Pd[=d 0tP  tD  t8 4 0S  08xS`S,?S DS #- {000!4vC *0@C + 00C +k00CS004a0CS "@###$t## 8n # jP 0@P# 0@09  90S90 0   T# nP # jP 0 V P- Yq# m # jPm  P 0- 80 # m # jPdRd \80S7 # m, # ljP:8<0880 8408008,08(07$07 0707070707 0707070'74# m # P0S0S `0S  &@p%*h%%*\%* 1*2%*P0A-0S iP @`pT V @\PT$@ 0S$p$00a`@p%*h%h 1*O-!1 0RR㤑S 7q儡@P  P0: ЍS DP"`P( 03_ v000m PP@:SR  0am Q {p`P0ti0 000&_000`%*p%*%*h%)*%*Ÿڸ%"8D2O-0S 44忪0b00- 6o 2 P+p P@ 0P 0pb: P0 *@@ F W0: R0*0 S, 70 R S U0!:W00#03RQ00S &0P0000  0 S 0Px0i00` \0  P@ Ѝp%*h%P)*%*%*%C-MM Q@P 0S  0 cT000@T0S  Ā@p T0:ۍЍ`PP@p0 > sY 6  #000PU* p%*h%ix%*0A-0S Ωp儀P` U0(@TP`0  RF000S 5@p%*h%%*A-p`P@P pVpDorPT 00 0CR?o20S $P 겹%̹p@-/0@P\ 0Pp SRpD1*@-8&k0S$ $00  0 kH%*[<%$0?S/ @-ZPD1*.5%A-P0@0/0000 Snڨ/0>+b!T0 L< YP0? 4 O00?D1*+b!L< ]XP L  D0?0H @L $P$PD 00C 0  R + | D M@D n`0 R  0 D m2̥W6 ! h`V5VW L@P p0 ?0@! $ 媥姥 ?0@ 喥哥"tЍpJ`10xSiSP@P 00@ 000 0C0X10S 0S`$Y\ ` `X`h0SS  80S d00X00\ `0U0P!^c 08d5p%*h%`%*%*.5%H%* %D1*ITd%*h%*n̽%*,6@-AMMP 00 pPpP'h!h@PX TfL1Wfa< 0]AލЍ QD D<Pq`U U + b p0P 5f2 t.0S+p T0TP 4 wf8 [EK%W0S 905 ;#;S X% IK\+ AK*P%*\%*h%<%~)*t%*N0=%p%*Y%*T*47@-M0MS@WPP P P `ۍЍV0S60S 00P 60Si ] ""442h<h<004488<<HHLLn<k<h<xx||P<9^EL<EI<:^EE<E""442""442T0ASyyPxlxyPx f Pi PJ vPb|T0Sp40S ddS00eb_ \ Y!"441RO""44"2"44"2"44"2"442(<(,9,T6TX3X\0\`-`+[ 0# #100 0222#0 2 0 (0#(0/,0H0T0, X0/X0\ `0/`0d 0,dW20h0005/(0, d20=S" " \" R `LrVCDS@"@ <)#3 (" 㯻!0!x30=00 1R # |00# #X0/80\ /`0d 0 %0L0<040h0T! AQzyzzzt9-0CS  Y R0 R R 0N\ \0Xx0- =09!`ET%*lTK*p%*h%k\%*0=%:9%Yz9 C-MB2P000R0 r 0M0 0S a쑟=聟0=P  RP 0AS^$}X|}{}}=0=ꀁ`0VddaP  RP 4!=0=0S `20000000H00%"4080&"<0<0%#L0@0h0D0"$000 0@-Rڌ 0=ۍЍt0 h0P0`0\0S H,@堘)*%*TK*0)*%*T&*%%*3GXpO-AM30L(0 "S d#Cr0(#͡ A5/0(0#R00 Q#00Уh Z0 (0S @(#C5/0(0,0S3,00?0!P#0,0@* A P Aۍ<ЍP(0S #Cr0(#͡A5/0(0#r0#͡$0+ $  BRʠ0@SP (0S 1 P@0S& 0 $00S  B( 0S 8#R00SR 00S \0l 9P tlx3  P8P0S%*TK*T&*0=%)*J\%*h%0 )*x\@-@0SS%*O-M@ 00 040<00 0b@P 08  b 0@ @ H0LP Dpi* `P` R  R  R;  R  0 PL RM  R"  R`60S TT L60S 868PU),-P"X 050S  zP% R P 0  t% R hh ` PЍLU000L%LHW0S50S ( C40S  PP 0 0 8a ^   W00 040S t 0  $ R < #PU# R ~ :  0?P JX 0x t tW 0 0 8  \30Sc X \T 0 kI"0#P00 020S  2PU-20S &PW 0 $ $W 0 0 8  20S 0 0 "P{00 0f 10S 403/  !TPYW00 0BX10S00S 0 0 800S  0 g4\p 03/PU 4   p0,P )*b%p%*h%l%*d%*K*S}$5%@]8^^$K*h%*pn/x\!2NX%*(O*_`oA-1(   0 !S@ 1 1R 4S8 !4|q04|0`a@00S/ P0S  R+* RS-<P- !0 010000 QP 0PW 0 $P g P ЍPE"0P;C0P|;0S050 00 0 @ 0@0 0%*)*TK*}%*@-M|c0S pplClS0S Yx0SVJ0#00,E R0e3 6r 0500K rP5"0C590C990C9000lP|n x媔0S \2d"`2Q09T09 <0S 420C90S 20tS2"CC2pP4AV 0R0%S  P -V H;#;S ;0``1 v0@%S ) <0+C? R 0 0B 0S <\)P 00S )XK0STP=S 000Ѝp%*h%K*0=%P*%%*P%*L%*%*T%*RkTkT*I`%*@)*%*%*0n;\%*B%*%*-@-  3 ЍЍ/%@- 0\  0P U? 0 849Ѝ(Q Ѝ.d%*'%p%*Lh%x0p@-P@T 0P vU@ 08p,00S   @d%*]%p%*h%p@-@T`P T0:pKP 0S 0@P%*p@-@PT0*p3P 0S 0@TP0@-@  D0  xh>0 dP80 P820 < ,0@ (& X*WX*@- @P @0 40D0Q3Ѝ%*%A-Pp` xCE00CS0O@ T 00CS0E P yTnTyDo0 @00  0 0 S%%*-@- T L00S @P@0P9Ѝ@Ѝ/%t%*R@-p`P0@T$qP!vT0  ЍR0@TtP aTh0 X@H00S <U8 8 00p@d%*%(Up%*h%n@- @  P   P  P  l$P l L\0QX X , H@0T%۹0@-@MPPPP<  P$0$ $Ѝ0P&6=\*0@- M@ \0 00H }^N; ۍF@-@0S g,00S x P 0@00S6 H0DЍ@/800S ,,Ѝ@&Ѝfd%*z%p%*h%C-/`QB@P @Dp/0S Ѝ/SpPP.0 0P000@-@0S  0S  0 000|00S  P 5S H0DЍ@800S ,,Ѝ@Ѝd%*z%p%*h%@-@0S 0 000x00S . P S D0@Ѝ@400S ((Ѝ@Ѝd%*z%p%*h%@-@0S 0 000cx00S  P Rq D0@Ѝ@j400S ((Ѝ@aЍd%*%p%*Gh%C-0M.S4P@A`p0/SS ߐ0 0<U  ϐ  ɐ  *  $    p  xX  d  㙲00@ @L Ѝh%*9[&P @-1 C-PAx@`p P P 00 S00 ЍW00ro`*p@-BM @P`0E CR V U RPN0FSd0  AS GMP0P S00@(; 3Bލp`*A-P@`,M<0 p$MW A`*p@-M4 BP  ZB 0SP  P0PP 0@ 0@PS ! 0C R: p  d!  `V$@1@a0T0 0d Do Ѝ0`*@-@T T  0H ,y(Ѝ@@ h%P 7P P / // -M M? `yۍ Ѝh%4`00CS`0X WX0 X /%O-pQDMDЍO@@x/`pP W200 RR00u0PS0C000@@ Rp@T+ W-Y* U U %   O  BK0 .   O  2K.0 o p W8h%`*/3<0S/@-@PMQ PЍ@ p31Q``X00CSLLLLLL HԨ"2PЍ@M !0S S/   ud0AS&ꈩܩHf <840\ 0SPЍ@4| O K G0J1hS fS5004003001 2003j0CS PЍ@=0(0<0$0;0 0:0090080070060 05004003001 2001jS$ $Q Q ( xVPЍ`*'RX&augXO-@R%_p@-P(@P IPp@T=%0S $  R R90 @- ?0d*@- (0 0$000 ЍXP P P {@-(M0D #\S@3@#:@ e(Ѝ DP7@-  QW,X=DP Ѝ0 @P . ;PP AIP_0d*0e*0@-@QPM <1a! 4aSaD@ @$0d@Oo@ 1e% 4eeT# ! "Q  R P Q ,CЍ0T%<ʔ @%(T h X%T @ ,P" $ @0d*_  p00@-Q @\.P!P@QR00 000d*D0f*0s@-@ `R  MP.m:P ,C0S ,C|Ѝpp0 !PU U H 04#Ѝp@Ѝp@?%0e*_0d*@-@T T 4 0( ЍЍ@+Ѝ@#0d*p@-@"1Q0P Tp@@K   p@A0  p@;-LO-\M00@0"0 0(p0 @@$@,0@}4PP PP 0 @@j4P``wU]\Ѝ`P0  FX y RAx   <y0P  byM 4\100 0 S0C000  Q4P <0p p 80pj0M x`00CS`0 X 0@T:\ЍOX0 X @-Ef%?%T@-00; Ѝ@-0  3 ЍO-4 P@pa TAD -Q P P PPP@D`FRPP00SP Ѝ]@-0@ 0 0 Ѝ?@- (%@-ϩf@-AMa Mp@0WP0`qT1T!TL0P 0$10 Aލ Ѝ`00 ! !01 ?t0 !R 0G8]@Py: Qp:<T0 <`<@D0L0\0\ n0 DD g*q$z& ,pE,0 4/pYЍ  0[ H0S  E0S@0 /poKpT 1S!1T p 0  T 1!0 00 0 0  $ ( 0! 0 d ,, 0  0$0(0!008 0d, , 0 m*0C-,M80P 唐R/ ~!! 4P`,ЍCJ`@ @@(0`0$0F= :P?%m*m*BhLo*O-\M`R@@PQ% 0rS P @0  00000 0 x0P    RQ  \ЍS @0  0P@Lo*A-0 S0!4sP40S$ 000    $ $ 0 `000`40 0 0 S 8pz'0S 0R 00C0 0( 0R RX,( XP ,( 9H0 'p0 1wH0 'p0 p g;㨀H0 H0'ppV>0 SpHpP H0 'p 00H0 |W: O8pH0 ppH'p0pH@P0P pH0 pp'p H 0Hm*X?%0n&z0P?%m*W$P `q*7@HRZd]hr{~y-p*?%O-пqM`=P`,@Pp Up#*0Tp?SpDp00u(x/`P0.0809` R   1PS<T @`  g=00 14@`=0 ,&@@<@%@, pP0@ @00XW!3X0 S7 JRE(x=^,`@P 8   8@8@:P T ,L,P  :P+Y =y - 0S%T Q= 8ߛ80T  0S@=0S PQ:PY@8G:P,T @:P ;:P0p40 3:P0p40 +:P &:P0p40 :P  : PT  < 8 მ80T4L  0S<0S 9 P"T  < 8 E8 T  k R< R!P 0:{9P:TZ 8@80 Ro aBQ*p  `080ikklgj   p5p3p1k< 8 ٛ 8X<  0S X<0S 1P00: <00140k0!S0< 2  x 0G0u9Wt)  5< 8 ᣛ 8Xl  0S "<0S R0* 0%0%00140k0!S0404@kT0P74L7T* ; 8 _8X 0S;0S `  40k0!S0 (S01W40Sv  kW01Sk4@T T0G?o20ST0G?o20ST0G?o20W0S lNW`J 0sWp0;p00?&&0@A4@P900.`d8 `aQ P8B380U08080S@00 @ c/4 4 6@ @$58 80 p@ @0Y 1=@ 0  ! `0400<0@0,$pF; !105 "J04qߍ 1PS 0 : 0H0tc?D`D0H 5p`l$pH0SX Z:H-0A1 d! N`0D00 0@`qk$p: !10`100CS$$1" =)@P qߍOdoob4S @0404(0 0,0c?0040(00000, ,4p$p;W,{W RT=00D@ 2`P0=S "8 R  2P 0=Sd "8 R ` L 2P 0=S x"8 R  qߍO( T V0@4,0p@[VD@70S 1S X'  KPP `V-t T 0H 0(00,00 p03A6/00 HX$T $, $00( ,p0,S(` T'& : Xqp :0"S : P0 SX0T R (00Sc SW S0G&P00CsL =" m*9?%-k5WjvhtPt W]+DX:y[wWX?%L{,5Kmp*m*0P LPT00T0pP#pW^m&&P000&00' T00.hPT090SY@@T T TQ0P 000L @C0' 0 0& 0.00000h 04؂`@\PV|#PP\0 pP"p WqߍOW>90S0 0\0q000 j0000s@-P@  | p d X L @ 4 J%9Zht0p@-P@T`6 P  =p@4ᆰp@ lr*>4 +-M M  P(P ۍ Ѝp@-IMM @`yPRIލЍp ʾP0 =0 p7hP 0S 0S0 0S  ؽPJolr*@-M @ ;PDۍ00 R  㸽Plr*H-3MMHp@uPPXY P0  4N5`P00S = B5P P``V - ߑPt2  ]` Ց`P_ H2P @!5P ,&PP00 eU,00P`0S喗W J1! PJ PP ႗J1! @P\10S P 040z 0\4PPPUqoWP P  0 V_ֽPiP`ZZE_oR0 A$P  4S J P x-6hX0 $#lr*0),4}4y%BbO-M M@`;j/@p" DP@@ ᰽p p0Wp0Y:Z0S ᙽ@Pm ލ Ѝ0Wg@P @p>40P 0Z 0 p 0V9 H1Z ]P Z.  pZP Z. 20Sa00Z00 00V9 0Z 0P Z. l@)0T:Z_P Z.  p$|d0edAlr*B@-0` 0 08PP }0 P@P8P Ѝp@4(PP 2Ѝp7O-@-\M, ($0PPʴxc\ЍBJ0P0  һPp^ U ` T] T` Tc<3@00S@',0, 0S008':(***`N+w*C-pQM4*]% *m<*2"$00S 00S/<* *A-X`0S L00S @P@@0p0pP004**<* *R@-PtM` ((E  P RQ ğE R`S% 4p R`F0\ R    TBP ׇ Ä CR ` 0S $ L24 \ P000ß3@P [P\ \PP $P  0R0F p1 B!$PlH D RB D^a R @T$P \P! P 00^@\ 1Np$$ l  T\pH 0P P0 P p00$0 R   DR%00 0 $Rk f 0P !F0S 0P_ ]P \PP0 00DS000S+Q*`tЍpp1@$pWS l0HS D^\P! $P( " 0RF p1 B!$PlH  R D^  DR R P,P ]P B DRڰ0P0 0S0!C:P 0S0=PP 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0Q0 00S0&04 Cf:PHN+W=\N+BGPN+LN+LG-MPW,04 ލP 0$CG:P 4@@0 PY30S CSc X5PP /3 cs@0S0S PU~T30S4 0 P. H30003 0E)$3S3Q 0Q300?o2^&Q20S 2 0P0002@0 0R R00 R P (2<"00P0 22\ Q100?o2& Qy10Su 1pP0001ph, $/$0 QP$0S0L猏$4PU Q 0S 0S 0lP 0 00000Q Q000?o2%Qx00S d0 0EP00080HN+c4* v***PN+8*LN+\N+GB<**TN+oG-PJMM0 000 0``S&+1 @ JލЍS2 0S! 9P 0S0Z<PP V0  t1t p1 R0 0S0QZp% 41 @T (1(m! 8PfZ@#P͡0 2/0S ٦@$00 R   R 0D p't0P04qp %R0@HN+LTN+LN+PN+LE+*WpN+0 0 0 0 \pN+_0 0 0 0 RpN+q$C-KM MP*|2 Kލ ЍP0\"Co8P H2@@@2000(+P 2 0S@2l". P0 NaQq0S 0S 00 b3@P .`1@0S pl5PH1` '0P 818!0001 060S ◴P+ 00 000T   /o" &t0Q00S 0@0P0 00d0@`HN+4*pN+LE+* v***@A+LN+TN+PN+q$<**@-PAMM )0 AލЍ@ͿPP0 尿` pF x &t0p 0hphp0+S7P;0S 0 `XHN+*pN+q$ 0P/#qP@-0@{)000 q0HN+* +Pp@-@PoU p pQl0l0 UpP `@3P00 ,P C)p#q*;0 @- 0C$*HN+P@-/)(0 00S/0kHN+P**M0 @- 0*HN+Pp@-Q !0?o20@0`Q  0S 0 k0S P (00p`@tPX0 LP80 4P400 0;HN+dN+#q*p*T*0 @-R 0P*HN+0 @-H 0Ԧ*HN+@-(@(0 = 00S0  T*HN+dN+0 @-- 0 <*HN+P00P0SA-$a (00Ѝ AP0q?oѣ2 PP%\P00\ Q 0Sj000DP ,$7`0 P0R00D00$\(  ,AHN+X***%#qx*4*\0 @- 08*HN+0 @- 0L*HN+P00P0SA-@ (00PP.p`P0 `0 S   S  0S00hֿPL03P < 0?o20HN+***#qP00P0S@- '0 ЍP 5P 0Pd00}S`00S T0TCj0HP80 0 00( 0HN+P**hE+@=+<=+p@-0PP00008@Ppp hᆣp@P p@x'k2@ 0S80 0n00jHN+ܦ*@A+*,EP00P0S@- V'P0 ЍP8 G5P 0 @P0 HN+WjhE+@-M P5'H1 ЍP0! &5P 1@@*P0P`p :0@P*0@ 0 S0 0S P Pl0  Q0S P0 @ 0P000$0@HN+4* v*j*hE+<*@-P&0 ЍP 0Sx 4P 0S0TP0@P00 ( 4PHN+|hE+rO-P@`pHoᩒ @ (PM10S1 ЍO#iUpqI@\5@ 0, U |&@1 TD  ЍOpX(PPQ 1RP &`ռ5|0 @0"000 0#P 7@P ?PU x'p0ppPpUUU@ @ Ѝ*LE+*fHN+q$A- MP&2 ЍPO0S! 4P 0 1Ct'P 00|S F7P P 0t`'l1@h@) PP!8Q@a@q@0S 00CS0S )0 0 S 7 3P00 T0000^! \"Q|00S p0 00P00D0@HN+Lf4* v**q$_*<*p@-PPMM~%1 ۍЍpB)` @PC@@⪮T5),b(A/P@7?+P!00S `g00CS0 ͻU000 0;D|0  0 )RP(Pt00(%@HN+j_** *q0@-M0P 0 %d1 Ѝ0PL! 200CS0,P@0S0PPP P@$ (T T 0qg0S0 @ʤj@P @Pm$ (Ul0 ,0S0D @X$ (HN++4<G*O^h*p@-0p@P0 p@$\0\`0XPS 0S/0S0p@$g $出00pHN+<=+@=+*pp@-0`@P0 p@w$L`LP0Se/0S,p@g e00pHN+@A+*EP00P0S@- S$0 ЍP D2P 0h=PL00}SH00S <0<f00+P 0 HN+P**hE+P00P0S@- $0 ЍP  2P 0hPL00}SH00S <0<f00P 0 HN+-P**,hE+A-MP`+ ? p@pET` P=+ W+ @0 ۍ7hE+@-P#@0 ЍP( 1P  HN+4&@-P#@0 ЍP( 1P  HN+Ic@-P#t0 ЍP 0SP q1P 0S0,g c1PHN+Wi~Pp@-\#@0 p4@0PP0 KPpFHN+P*z0@Sp@-A#@0 p4@0PP0 0Pp+HN+P*Pp@-'#@0 p4@0PP0 PpHN+P*QoP@- #(0 00S@+HN+*QoP@- "H0 <@0S 0S ㊶HN+*@-ザ0P@-000P0S "P0 ЍP@ 4Z@P@$^" &HN+hp@- M P"1 ЍpP! 0P 04#p`1`,e0S@1D0 0S 1( HPI&P>0 0S 0@T 0e05&`m@P " d@ s 0@ 0 @ 0@3/H0T 00S00 &HN+[*w*T *8*`N+0 @- 0TN+HN+0 @- 0#Ц*HN+PA-PPPPU㈀ "00Ppp@h0hPd00P0` 00]T,0PA SHN+PN+*=5N+$N+P7@-A P000yd00 Ѝ0P!0P%0SʰP 0 0000S@ 0 S  @@00\+0 S +<4 /PHN+LN+*J **$J+$F+UPp@-@ 0?o20 0P !00pPoP0 00xP0t tS00Pd \s0DTP(0 4MP 0HN+D*H*#q*\#000 0@-S$000 0 P**HN+*000 0@-S$000 0 P**HN+*p@-@Pp@0 @- 0\N+HN+0 @- 0XN+HN+PG-rR@PpZPYTP`Q -`PbTJ -@PP[$$ UL1`H1@W <10S $1$!0$$ S ! ܶ U1`0@W 00S 0 0 S  ¶ $ $PKP`pᕸP `ᐸP PዸP Ѝt*x*P**#q|**' @-u0HN+P@- |0 p|P \00}ST00S H0H c@lP40 , 00$ 0HN+DP**IthE+@=+<=+P00P0Ss@- T 0 Ѝp0` 0S P@P  0Q R   L4 0Ѝp@b$Ѝp@'HN+LE+*pN+yPp@- (0 p@0P0 PpHN+P*C-P H2 m@r0S424bP80S20S 1b0@ 唀 E0ܑS C!!"  A   㒃# P0 U0CQ00CS0F PI00CS0J PAT! -PS0 p` 0Eb0` Ѝ0 `` V`0 㓂" Q000P UQ00h0PEP00P0 0 Sp(0L{0 0 SHN+**<*!***%]P@-00P0S`  Z00ЍpPl  L-P 0*)qpP@ 0 $0$<U000HN+W*P00P00@-SM@  '00Ѝ0P  -P 0I)qp P0P0  y) 000S0000HN+W*P@-$0 PHN+@- (0@P0 @ڴq$*P00P0@-SMp  00ЍP  ,P 0 0`P PPP 0RPS@P   - @ Hq  m 00HN+L7P00P0O-SM  0 ЍP  r,P @P@ 0R@ p`-|0 `@P00 Р00000@@0 帴HN+WdN+pN+P*PA-p 700`@PP P  P@.*p0 ` S P@@ @00 0(0HN+(u*Ħ*Ȧ*#A-p`P# @Pd0 `AP ^00Z-400SU0 Aڳ*NP*dA- PP   R ЍAP   R   㽳@0S00Ѝ@`pHN+@%*&{A-0p`P0 APPp@P @A蘳P 00 厳00HN+*NPp@-L0 p@00S40p@,`(@0P 0lPpHN+LE+*P*0@Sp@-dd0 pX00SL0p@D_@@0PP0,JPpEHN+LE+*P* @Rp@-=l0 p` RT0p@L_H@ PP0 ,!Pp HN+LE+*P*.6 - BR0 R  P R 䅳O-M$M PQ |3 ٍ$ЍP 0\#C*P H3HS`@pX ,3 (ڲ )PP@) -0t'` P0S 20P @B 0S0BT00HpK\"l@_<"0SP$S \S00P$ 0""  0## P00C   BR 0 D)b0 0@0SPiR 0PS 0 D )b0 @P$18^1 R ! R0 R Ȱ^ &   尰2/ R 0S `0) P0 0000wX& 0`SM!HN+***8*%**P**$*@-@P s00P m00Pg00p0- lM X00S H d0 P000p ۤ(***y*-lMT00S D d0а P,00p ~**y*@-@OP p`0 0C0S03  y.P0 S 0C0SP03P  0 0C0S03  ЍP s@-P@:  P, 0S1PS !,tЍp@,*` )P %P008 ,ựS!0R[ p@-@P 00PU  ;Pp00p@-@0`PP<  0 ].0Sp 0h R0 0 Ѝp0 0S0C B R1"  긦*P/0S/0@-@\0%\#0S P   R   0W7 0C200W70 0C0ꐹ%C-pPM0P@ -PPP0   -P 0 0P010S&"p s-P0P 0 U ))) 0 011P  z~9mЍ/ P @)`@ P 0PS1  `P):` P P)^P Z: PP000S`U' *}0S 00S0 @Rđ.0 -~@  x) ` 0S 00 0 ) 0S S St0 PUt 0`S{)H0PU r),P 19@H*X0*Bh,*& - BR0 R  P R \O-!M M@0$ P<@8@4@@0D@@@,P4`0 p 0S 0S 40S 0S }@4k!ݍ Ѝ<P0S ;r3@P D|P 8wP (rP} }0040S 0S 0S{T0sX0s\0s`0s0Sd0s d'P>0S|0 /v1P '|| '>|0S |00S(1S O 0 0 -=0S z_|P' (1Sh=- l)0S zOQ)P$-$?$O 0 B)00 Q /h>0S->@ R*p` @,|0 Rd|P<0] |00|SY X|40Sh<0K|\ #ZN H> = { L,c<@0S  (1RS  S ";+ 0qS 00S K? 尐0P{ 0Sx P&|P}`%y@P@ 0S :0PTmV :F)@PU .h@h0S(1S h0S\ < 0 P[$P A% P  0P!Q/1L1H1D10h0p P10D1S 0S LAT# 0S P  zzQo0 0 ]y0S 00S P @Ԭ0L1%LGSQGύ00(!0R _@@Q a0000U49_/01010l<pP W40 1zPdPd0S !(ze<<Tp`HPVu  0g_0P0/1Pl90S だPP<g/` $Y U00S l g?/80 S00?o2$PP0 P70S P 0S9%P 0S1%878G`4W)@P3) N707P 00@T @ P 00@T 1 P 00PP ;NpLFDF\P<00d'('P<#60S'Ph@T)$!&G&&5u`V;f 0( FW & |;@6 h46@T hK?00,%14&@($!&50SP  P4$& &`h$4Qx&t&px0S``\4TTPX 40S `5l @\ Z&V 40S 54 ت@$ J&T E&&p АL40S 4VWCw0P:xP0$ 0 PG  P  k0 R$ @3000@ @p`P@ Pt# @p`P@"0  UP[= P 9x`3Q00S I[ [ 80$0 PDP 4P 0*S x`Q0-S xpQ P0000 /R *R0 w0Q@00000S(2 0Dx*y* l v `*  d*hN+  fh%$ / z*HE+[QE rO R s  Bh * +  _ &@***% 8***4f *q   *-h   D S _ *   ; N  ^ 5  / I eF%%^ n *}      0DJ\*1 P*IW_q$ e Ȧ*y*t*hdN+@B&HT*p**uxN+h*pN+`*P 0, o<0<0oNP 010Sol DP "PdP tP `wPXwkp00p0P P xP 0x0 "xP$0S S 0SX 4$0K?CS3 U 0Sp1 0 Y ᆩ 0S ၩU }[H [ !"2Sv"$2Q0S G?0 0l2< SGQ2h ֨x0SD30= 000Q00SvzL30 00 Q 00S% 30S0l03BU0st3@VZ | Pr|X孨0S40|xq|V`R4 RTʬ4$^s4R P 4D! 44p\0ǟs \-0\0:(EpPU>  ;%PLQv0 t0  2t RP 0"0C?o2?  "t"0A0:q0t0t0 R ;R tP 0t0t0 R RU 0S;0S(0?"( ,0"-p0S ?0-U0-͡P!͡!--R0m "0R0-͡ 0*$`P#PPp0Sp0S60S#PP D&8000-R0040# -0 x(D @忚@D pL HHL P #P V | R70S 70S7P #^p0S PEU0S PhB  1Q 0!PZQ= 0 Q0 Fb#}8 8pŸp U00R0SG PsPq  ?$P   P, Uc e<90Se49 Q `\) Q0l9 FU9#A  9R-sr VOᏛ-pQ!03/P|ɚp:@~  : R0 4:QD:KQd*d0 0 S0/T-X ,\+`* #0S-:| 0R/G0S :00x0S x30x00S ,000S %00lݍ Ѝ0S 03/|0S |0|0Y @p`@Y@p`@s@- P@e#P  _#P0P JЍpn`P  L#P 0 FU 0S S TP 0S 0 3#0PP Ѝp@r1@D9Q@-M0h 00P P10S 0S00 0 Ѝ  qQa @T0 S 00S 0s 0 :BP 0 S000Br@T hkP 0|S b00 0S00 0000**h y**`*f@-$MP` @3 0000000=pl0P/S:S Tc@.   L `&8  p0/0})@P/:x)`P s@ P $Ѝ@/000`0 ?@PV`@00l0@@DcT@@0 0@0CcS1S@BhuHN+PP00/@-,0 @  000@(*{*@-x0 @ d00S X0X0 p 3<0000S ~@(***{*@-u@`00S T0T0 p 8 10 10S Z@**{*l0 @- X00S L0L0 p 00 101000(***{*4*d0- lM@ Hd * <000s  ŗ(**|*0-@lM@n 00 00 0rS sS tld  `d lT000s  0W(d (*4*{*hN+*|*@-`PP@ 0@s8#80@U 0s8#8000@? P VU 0A0T00Ѝp00CS0 S0 S 0 /ĤO--LM|00?xp0  W`"?p0pW (╘`PPV0W B8⇘8 (0,0R< @ 0PZ0S= S0D0Y 0   @P*T0S P0#S L|0Sp L1 R 0@@0`5 pP`5刵P<000CS0K0 S(P50S5U <% 00e %0We S00G00S,+  0S 0 S Z000S800CS0PP00CS0 l0d $0 @P00CS0 00 0 s`83 ap0SS 00   00BލЍh3@@<30S VW@@ c030!Ԣ30 V S$ " R 5U Q Q$Q V RV"d 0奢0H"0M0V T"  0 C " T! RBd@Q@T [ ! @ S)S   @  @R04 5T dT(S@ V-S R !   A.U PW040 01U0    0ZR@0 RX P 8/ 1X YS P 9/0E60Sd00S 3/{*` HN+**P*****SX̦*D`N+HE+%*-A-` @T o0 ЍAЍ/p00$  Pijx|Nl0 h P oB0S@ uP 5/*dHN+{*` ̦*O-FMs M`@  @  00$0p3$ 0(00,@10P S 圣0 ,o$3 @10 @,Q(2@@ಟ@aGT  }o2  1 0 PD0P2d 6'P x"xdl 0S 00S DD 0d S ˕PP dQ@0S00?o 2yPw  06T16D01@ @凕pp (H1pZD0(66S0d000 d0d( A  a0PS nP P 0 00S 0 0OP@ 0 @020@p,, 0@Fލ Ѝȁ**HN+HE+P*+ _*  ؁**q$*O-JM$GMs~0`0WXg700S00p ݓ9 P垆X 660 9Pl勆`60 00L0 Δ97S\4640S# (X6&0S0 0]%Q0*P! R % BR$5L00E0S P,97S9 5Lx00\h%h010 RS0$000(0000  0 KPV 4 5X O0000Y4L40܀C XSX t4000C 0h00d0$ 0`0 lT CP $4T!>\ 0h0d<` ((0# $0$c#!$c4"($ <7 $ &R 30 R0S R3""4408'0PT3Xi97S JލЍ00000 0S  0 p吅J8'דP\20 00H0 ̓0    ˓pt 087PTg97Y^ SЁ 0S [R0sO0010S ;70:70?70='>7<8T0S0,< 00 00,1 $P!1 R  T 0 0ZP 0S 0097S0 0S} [[YX  SS00000 EJ{*D*\*Ԧ*؁******P*!HN+*&Mi*%}*0H*RЁ*>h 2@-`pBWLM LЍ@ pPk  pe 00011 0S<0 |q?!( ( 0R0 0SZ=9Q ='/@#b?!"/p8 0S 0#S 0(60 8ⴑpp  0S 0#S n塑 p哑p 90S0 000 0᧒LЍP4Il僑00D*\**Mb<{*A-0Pr@L0 @2T ` R]$B P 2 Q  ,x00EE?AA?R1 $!$! 1 (!(! 1 ,!,! x1 0!0! h1 4!4! X1 8!8! H1 d00CS0p0 dL\0凸0 p P`, ^00S^0C0\Pdp0S    Cb"c!   c# 0hS<0\tꙢ*N+e*&HE+u***% P**l0@- @0S-P  " P 0  00@|0  pPX0 P P40  0P0  萹%LE+u - BR0 R  P R ~1A-0aS0P0P3U P!00.SP l`1hۍ`L T1@P H, P0T0!0!00(1   !U 0!庍A0p000 000000P 0pS0000PTl0l0  @U x4 P$0`#:갦*P*****_@E+DE+F+F+LE+*( p@-@P | 00t 00l lP0h @Q0T0 L0P@D0@ ƍ80@0S, 0p**DE+@E+8=+*\*****P0 @- <00S 0000 p 3(****A-@~Qp0S `0S 0s g尶00`P]C00000S x`0S 0s G吶0000<0sT $ #:p**\*`N+(2O-AMp2 M0BS t20S Wt tW bpt W` 4S4pW  $Aލ ЍtWh1P+;004P/S +m+iPrꌡpU0們p| 00g000000000S H1o;81! 1 R100CcSppW000S 0o 000000eЀtWU00EZ$@KZpP۵x opP00~8*4*O+**BhBPP*dN+T**q$_HN+*uA-@Q0qS0`00S Q08P 8P Y0 R 0000@ `ЍPl00}S0s00T 0S$@,r8 갦*P*LE+**%HN+O-p葟Q0AS0`00ЁS4M Q 1O8`4ЍPF .P00lP00XBP"LD P$4A(!0友20000 0凋@, %P 0 y@ P 0$0cqp`00P0}S0s00W 0S(@87 =갦*P*LE+HN+***7 J b @-0(@( 2Pw S+o  s@-Pd` T @P @ @P,@Ѝp3   @-@P@A+0 A- 0@0PS0p`0밀P" %P 0S 0"S0 R S  p`"R"^ 0 00<=+*P*HN+S@=+*p@-MM P  6`)PۍЍp@Plp4/SC @ P;0@TP/P0n!O-@`pPV1@@P`3:k`Ef0టP Y/  0 PT@1SZ 0 10S 060 R :0S*00 0-0 ЍN+*@-P0P0 @p ~pP0 0SP0 0@Ѝ*ht@N+P  P @-]Px0000Q/`0000/0S <S0C00S/ S/0Ct*|*'!x**0@-0 00' p R Q 0S0000S b0C("( R St         p    Ѝ ꐹ%%@-`$A0S0 0 0 0!0~p 0S:S50P0S0 0 00 0}p0S:S5000l d0T}pT~o000 $0$}p(roЍpȦ*Q!Ħ*q!!!G-@㌠pA\`^ P \T1:00"^ ^ N W\^ \ @2O-pဳ@`A0S00 Ѝ%S V@0PcU9 &/U -U4%U V0% V @PMU0S2 2"0S00C R mU.R T* @mU nU0Sl2`200C R T* @0S 4cU.U   0' 20S0S /R 0R0P 1@X0@LP'*S/@oP0\  R  JR.UTr*PP?* RP?*@P0C Ro Vb @0CS/XP0CTT*/ P *< \ R*9Q*+ @ T =*>@R *0@V1@P9@,@*@(@&*fHE+8=+&<=+@=+/A-p`P @NVP0  T  `00T  0@ R   `FVx`00CS0  PpTL000`000 0 ST00!!%!A-Pp `0崀 @T4 00)a@x 0 @P`0 \܇|L0L 0 P 0 Ѝ8*?*""%$"."**O-MMP @4` 00T X3  @`| P 8#8T ,  30S-  pQ pWp {p@0E. P00002Q P E"EPtmލЍ zppDD0T pm@ zp@ Tcm010PS  { 0$ 0/ 0$ zp@O0$S*F>C0S  {X$ (0Q`$0SZ=9Q =)/@#b?!"/0 0Dzp7v0S r0#S [k0AS  T0 0000 0W{p 0S R0O 0 #zp@@qX80T lkP<<00_ئ*?"PTR""*Mb+ @-@Ѝ@{yp@-P`L@5P@ 4/0P@ 0S lp%`C"@-҄ P  Ѝ"@-PP"@-P p  Ѝ(#P@-HPI#o#@-0lMPQ@00 00 T  40S P ׆00 P Ά0 0 0 PIcsPI 30S @@@ `\  P `(%P@ 0S  建@P@  &  P@ TN T T2 @0S 7 x@p0P @P/T2 P42 P V00 PU   P G0 0PU r P 8lЍ/m0S O@P@$S 0S @P@E T 11@T 0 0P`pVPP)000uk 00 0@Q XfP@ꨦ*H**X*c4<G#HN+#%h."#^h8=+****% 8***@=+<=+7@-PB1 Ѝ0Q0S 1 12Pʐ! (0 CRtA R hS0R L1P 0S4T,S 0GP 0S 10S 0 0@ @U0@0 @M0 @G0 @A0 @;0 00S 0 PHN+*HE+#*X*4**#,*P* $zF+F+0$E+E+E+:$E+E+E+E+gpE+lE+@*00S@-0M@, 0 ᧳P0S8R@0Ѝ0@ڳ8*o-A-0000S 00,S 00 S00S 0  P 103/P H0Q    000000P^+4_+\_+]+# TS+$0J%L_+DG%$P_+^+Kh:-3V$$ 0-`+@-( 0 ( `+@-8 0`+\T+P `00CS`0p S00 P0S X0X /X━%C-@Pp  l18C8S t`y ts0S  0\`V $ Ѝ]+0J% `+$\U+@-, p( P@ P ЍX0/LA P00E-,?-$$0J%%$ %00@- @Ms1P8C8S 0S - sL s@0 s0nS Ѝ0^+0J%m ^+_+%-\M`P { P L00SD0\ \ЍetP&%Z+0J%,%$@0@-@tsT K }_+@%E%D0@-|AT 0S  0 ,sa0J%]+@-/8 LA 0 P Ѝ0J%q @-@0S S S 0\ \ \P \ @P0PA-@` ?S렀  ?Np  ?Ix@P ?P@T*\ЍA01 !QTUQ s00'dG%N%$G-AMMP`PPB|R p2 h2h r\2\ r 0 0 0 0 r 0R  0 S"*Pn@D`ePpᨡ0S1 r10S00 0SR'@@T  ZrT HD1< ȠLȠ\ \e P0 \!1 Ar,urAލЍP0S S  S0 0< ȠLȠ\ ~p 0圠0CZ rZ <^0 @]+Z+`+^+E_+h_+^+\T+( [%0J%j%[+^+W%0@-EM,P rP2@P7Eߍ0 ,PP r r rr x0 <  TPrq d|%%%%( 0J%%3O-PM t@`hqp`pT#ED3D qUPE,dp S00CS03ep 00R0S eP18C8S5 P1 P8C8S 0 0 X'VPp2d2l18C8S  {qz0 P\S,18C8S 2 0 S 18C8S <18C8S p}l18C8S 00墽t1 Bq RK\1P+ 㔽 X 0118C8S V`F(dP`ᤧ <18C8S0 p ЍS R   R`SP0 U0A0QLLD^+`+Ep( ^+_+h_+0J%]+W% `+Z+^+[+%j%%p@-BMd,@P4P1 Hp,!N 1  pPP`14t0J%%(D,k+8+uZ+~+?+ _++R,h, @-/Y+@-@M h2 ]0P0 H!00@10S " 10S0S@ЍP  㝸00SAl0@㑸P_ 0000SFm0S <r> 0嘼4Ѝ0Z+0J%@-`0S@ hP:0S 0000q20\@[Z+-E_07@-l000Ph@ R R l  R  P4u03/ Ѝ0Q P0J%Z+|G%p@-P(A(a1S 0SP vRAP00pPP0P P0 P P0 t peuh00X@X  "  \ p00J%Z+>4tS"-%I%]+00@-18C8S 0P ۞r0J% `+(0( @-5h0@ Mh_+h_+^+p@-BM` ChP@0 S`0018C8ST01y0 !u0Pn00x0 hBߍpB/ BR 0h00P y0001^+0J%_ `+_+ 0?o2 0/0J%H-AM M$r$00000a0P01 gPھ0  gP 0SS WS BSq1 +g P  >Sq0S $ 0 1 0S0PY g18C8S Ԡ0S  Q@ |PY 0@^ST00CS00  S00 P0St^+TX ]+h_+0J%Z+ `+p@-PH@P@pP P P @0J%10/@-go/A-@PP" p00CS"P] ] ] ] ] ] ] ] `V vPPntἌP0 P00TA@ 0S P0000 !0S0R 00 ..< `00CS`0p SX0X /XNt%7@-P\A00C!Sc0000CS/_ ^ \_ H_ \_ \_ \_ _ 0 "S 0S! ss0 0P0 30 dr0"S0P0 Ѝ0@4r0 0P0  Ѝ0$`+ R.0@- R RR \R ^R^@N  @0 N@T 0N@T!0N\!, n0^00@ 00S@.G-@|P2 pqp =`P`VPP2 00PF 0P  V @P 7@0S@0SG00@dPP?P PPP P  0!SP:r'.$`+0J%A-M@PP\1  q r@P `p崀  @PIu00u0ۍ0 P 0@ 0000S q  eP00 Z0J%.]+.p@-`@:PP 0 Tp(PC@ps@-@P`@TqЍp Ze g R g| f(R( dae0PsP @OnP ,KiP ]+f@//xt yt (`+0@-M@@0(@,0 0 @P Ѝ00,剱x0 )eႱPPPP0S 00@SPe (`+0J%]+@-Vq(,˒ 0(`+@- @f f+nkP #n d0P3P x-qt+qh of\ dn bfdЍ]+xt yt (0.010H0f@00@-4MP3P4Ѝ01<18C8S pAU  0 9 0(mH |d<O4M0 td0E, R  id ed8P 41PP m0(0S"=Rp00ESph h h h h h ppdp`\XT HpK0J%0]+h%000(`+0h00000@- d@2]+-@-Y0 R   ЍЍ/Ta+-@- Yn-@-g?0 R   ЍЍ/Ta+A-ARp`P@1T cpP `@DO-P-\M @nPn0P0 0 ( 8$@ P@ p P @ `00, $0S\  R?$0SUXN LH P00P$0o0$00娂0000Uk Pl l l l l m "80 )PI  0S(n xn hn pn n n n Ln 0 0(R00S @` =#X0 (r  6   P  0@0o 0[ #P8,00SX d P80C S  R$0PS  P0C [$0 X 0x0 (c xbpl>@` UX 1.1I1f1Ta+1111111 2$2E2]2m2221O--lM $ Um`RmPVPP 8@ 0,|  0<0hh2 @0`2 @0P 004@P 8 @pP ;6pP@0S( P @p ]o[o$0 lЍHp<`@40S(  a Pt  ( 6( 0PŸ4 0.P,0.P<  B, ( ( ,0pRQ@p(S<`@ 03P%<0%800%4000 0(<0(800(40` 00m  P$@p 10XL%12E_'222C-paM00PS@ p 0 00qp  ya?sp >@0 m00`9 Ϡ pppppW0@0 @ 8@Op`6t00 }>?@` -m00 S @.  C< 8n0ЍC{m0XL%3C3]3l3s3h%@}p@-MbP! 0: S0 0 S P@` 000vЍp ap P @TPT0dHS 8$    7Ta+y333O-]M0 M-SP0S 4P ]ލ ЍOv/x]ލ Ѝ謄@p+bP$ 00S0W0S 0S:\ ` kpP@ F B@pl0: S  SГ0S `PP Vu `W ]ލ ЍOmbP `|B0v: S+( `P@`PWj Y`P p  00-00 0r 0S0S`->`P```L`vL`0S 0 '4`P V ,`P z{ RfayRw`pPT aPx!1Z[ h 0`DaZAaU_p`4 0S!P !000vk P: v?b ] 0S -v_pPv1*P-U_ 0S _p<mTa+XL%334 33.13 4"484N4s4404%0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00XP0@-@P@@0b0S 0S Gnt5Biha+@-fkPE6p@-P@5ip 000/a+@-@uP 0S`P i i fnPЍpPU P$ $S00P0ea+CeD:@-@P @r 00S@a+@-@P$00SЍ@Ѝa+A-p `P@P000 P P0 0&@-@P P0P00S@a+0 R a+R A-`0QS`0@S@ P^ ,KPX #P1 2P1  0X00\00`00G?000x000020"00D^ 㸱 P0ЍpnP\1  KP4 P. P01  P1  K P1 K P+ 0P$ P0  P0  P! 0P0  P0  0 0 x0 l0 `0 T0 H0 <0 00 ,a++z,7@- b_@PP0PS0 P ; xP0S00UdPPP ) dd0SP0d0(Pd Ѝ0ht@a+Qe; ԋ@-0@ ShS0CS $ , 4 < D L T (S 0h i0 hЍ\XTPLHD@{P0ih0(a+WeZe]e`ecefeieleoe$b+@-MM0D0TP GP00P00l5}zw t/P0000S000000T4 L400@0)P04 , "P004P00430S 30S 4ST4STP 0S00P 0S P 0S00PHP 0S00$34P 0S00Tb40 0P 0P00404 0000404 0000404( lp0$0`PPTTPd D25<QP``0S PhfP!DQsPpp0S   BPJfPta PXTP`H eNP`4`H0PSe 50S0  ލЍ04,.P 0S {aa+\&re>$uexebp+|b++x,|`+a+{ekvF%[-f+~e.Ab]s9ses5tB+p+G@-T@5SH00S< 000S  05a++R + 0 a+R 0 a+R 0 a+R 0 a+R 0p@-0x@Sp d00SP H00SP 1P0S05p +a+R +p+/ 0 @-@ a+R 0 R/ a+R 00S1x+ 0 a+R 0 a+R @-x@5 l 5 P 5 4 5  x05a+R 00@`/L%p@-hP@ \ ` D Z , T  NEpa+R D0@-0S K00ET@YKU@+a+@-@05 0@a+@- Bo 0 a+R A-P/o"`bp2qp .@P UA1p PUPHXU`X8/pP V@ P@T*U  AV eeeep e 0 0A.0 00S/f+pp@-@ P 0s 1@pL%eO-@`崐0尠T$0P ?990 VYvT00S[   [1 RP 4Z@f+ fpL%P 0S  R $ ,0/8<//f+\5O-M⨔`VЍ0(tS,  RQ0$R00:?002P?00"2 Si@V !sr% 0S 4 30S $SfP 4 0 40!@0`000 00 @ ` 0 0 000 PPp @@0,t(dvyf`p{V0 Z$4SRA 4? 0 qp0dt2 0Cw RQ&0$0@R*0S 0 00@0 @ 002  @@04 S*0LPe1 qM   10S 1[0?0S  CB/f+A-`pOPP#@c0 DBC.B $-0DBt P 404)0$rdA{a+f+p@-`PUp4 @ P@ D4p SWT 04p 0 ~d|d0@p@f+a+ 0P/f+@p@-  @0S p@P B bS .S 00CP U2"cS X- P:80BS f+g+bfrfp@-PP`@ 01S E"0S *Sn0S 0Sn0*S x0sR  dR  kR  0C^S0SP@uR @ @pf+L%0S B- 00P!P* C\/p@-@P& PP`pQ P @tPQV`u-PPN0Sp PppL%M%fp@-edPP0P 0S .40!0`,@$!$Z3dP@P|@Px@P0 0 @ @P0+P+P | +Pl+P PsP &ffffg+f gg+fff%f+fffff 0/f+@-  01SP 0 Qpp_h ЍR @0!00P< 4 aQ 0! Cf+?0gg+g 0S 0S 0S 0S P////// 0S! @-@PPR0 `0aR R S R0/@- @Pp ܤ  #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* @!A-!@RQp0p0!? Q0*=#=p00 !f?0Q 0*--p 0!? QP *!p !\q`?`p`ĕ @?@@f+0p@-P@P QT4@pTT@DQ`V D@T0t0S :@f+ N% S% Q 0/f+P@-44^,P@P @ $P0 j`0! KP0!T@0T0  T03:T03:T03:T030# S,,A #c!8,!0S ,1 ,!?  $C gh+gf+ 0a%00P0bA @SP//D%A-R @Pp8`TЍ`lP 0T0 0fPP 2P TP00T0 00h+s@-4 @P 0S 9PPЍpt0P Ѝp@T @P 0S R `~(00$ 0P_kfgk8p@-@pP Pd0 S P @<` Rp`@!0P  kkP P / l~_0p+0@-@PM    0 BRЍ0@-P , `@ 0P FBЍp0h+@-`@ (8R808Ѝ< 0 CS  8 0C 8m0h+8p+p@- M@8S/ 0  0S R(0 (S8`0P00 0C?UR B( 0 8 80C 80 CS Ѝp 0P)0h+ b+s@-P@`8 R8 R8SЍp 0b 80 S08^) 8 0 8 0P0S08O)0h+ b+p@-p@XU 8PE``VH0 p8Soppp0h+a%p@-P@`8M0 0 0 00C?UR  0 R 00C8.Ѝp 0P00S0 00h+ b+@-@8 R 0 0 ( 00R0 8 80 8(80S Ѝ0CR80S  0S(080h+ b+(080S @-n/0h+p@-`|P@p Q0(0p0CR0R:(0 p000h+a%s@-@@`P@T  ;A@P Ѝpp@-D@0S PX8 P 0 pp0h+a%(0 ((( (8 0 /0h+a%0 ( ( ( 0 /0h+a%C-@SȀPp0S Ѝ @`0S 0S  80 8808'P oPg (8P 0 (g+0h+7@-P@@@@00S Ѝ0 P0h+0P$/0h+0S/p@-P@`P P !@'000P @@00p@- @$P$8  0h+<7O-P00GS-M`(X/ Q008(X 8# 0S0S  P0S08 Q00((XʜP  PЍ0 80 8XU080H?o2P0SЍO$Q 5Q* PpP0@Sꀷ t  8 T $ x x    l eP 048048TPP0480488080 SA?0488S0S S 8S0S S ec0488A04880S} 048x048048048Pk0488S 0S S8S`0S S]8SW0S SS048(04880 S 80 S C80=08:$0X483X3` @R( B H W`X  wP`8ZH80S 48PS8P ]088  80 Zt2"8Q WD 0`48 wD(<8RqDPp4@P 0480 QZ`Z ` 1 币0 0 K 0 Z@P40U \40U h40U 0S P0P 0 /7PxUUt0E SpP t 8 : 0#0%*U @U !UW<50SQ07SN < 60SH07SE ;07S0? >P 0#0CS>P;50 9e`0 S &0!R0?0m60S  G e`0 S '0!R0?0R } !R00 !ıFp70S!R0 !R0 0!ı3 !R00 !ı*70S!R0!R0 0!ı !R0c?0 X80S `M0 S 080Sz 0 S 0  G&px!R0 0!ı2n!SeR0d 0!0<0<]P0WV0S\9 qMJ$  C@90S0S } 9@  <P- 00!R0 0!ı=0p:0<0!R0 0!ıw?`0000!R0 0!ıe-``000<&&9`S:4  @ `0S T \+\ rh;0S`D; P  ;0S 1 `+` 0#;" w,P m!R0 0!ıP P P v !D R0D<D<0QV,Ph L!R0 0!ıP ! R0<<09!R0 0!ı,P . <Pq+qpm < { i!R0 0!ı,P$ !R0 0!ınPP Q Mh=` PBEP h? =000 0g000 0SG- n0% @>0SP >0S $>0S P P 0 `(ih>0SP x>0S >0S P P [0S  % M>0SP >0S >0S P P.P0P/ %$Pg0 b!R0H? 0SX?0գ?0/0 p/0 S00C0? !R0? 0S?0գ?0/0 /000S 00 00S080?7X+00S/g+p@-@/!PpO-pSPM@`PUP800 `@0 Y:X80  #1  X RH W0H 0Ѝ 0S  R  P R  AR  QQQQ R  X180 R    80 HUP VYZKI  P R:p@-P\ HPV@^^'P gP dP fPpdpT ^gP PP0  0SA00p0   /O-PR p :SPP 蠟@PU40PPp0 Ѝ S@0n00@`P` 0S ``F0 S0S P B 0 0R R@0m @-P@p+m @-P@p+m 0 Pp+ 0 Jp+@-`@ CP 况P  0S 2P Ѝp+G-,2@T @Ѝ`FPSU P0pF@R`P 0@夹qpS kFF?Y W S0 R MR +R GR  SR 0SSk SER SnR0SdSP0EX`P 0 @vT cT eT @ Vx@T@ @ ?   @P |a+p+mP7@-@P KP P@ `P, @ES Ѝ0U*n@-qD@q0 $$ @ a%+n=nJnYn_n1C-P0MSP; 00S7 00S@/ `p PP@  0@Sd@ 0DSd@ Td@ 0DSd@dT P PEUЍ@b+a+b+@-  tPsr ;X@,`V . qR000 00 !Ѝpa+p+O-@Ԡ԰޻`Pػ0FPPPp R ЍWpV R  0p0P@p U  PPUP@QpP RpPa%a%p@-@QP ᢻ0S R SppQ0 QA QR P/@ PRP/@-@P a+P/@- p@ "0@-M@ 2_ @DP D10S@(PaP! DP OP AP dP cPoP qPRi0|00SQЍ0 DPP0 00ѷqpD00@a+gnnpL%nG-Mh0S @0SP ^0S`  IP3PT{$&0 0`pP 0S ᪼PO200U p2PWhR00@p PH2  0B,2P 0S HEP"!! 1P NQqQp@000S _w!1W10Sڐ`WQ tUP00 XMP00 ?P ;QW  3Q=/Q-QTrЍCP00S rP|P `` YP Ca+a+fp+a+a+ta+a+a+pa+T5+nd0+ oP 0@-@a+00@-ܱP &@p+5ofA-`pP`VPU@JTP0+ 0 a+ 0  a+ 0 a+ 0  a+p@-P@@P Pp@pp@-@K`PPpVU Pp PpC-M@̐p@PXЍP`PPNPY04Pu0SEa+@- 00S T Ѝa+@-(@0SP00p+_omo@-@%۬0P 0sS@ @G-`dgd@p00CS0 gyp PP 000 P U 0D IS  ELOp@P@- 0PoUA-@+0 0Rp@`0S00 R0S@00`ݸP0S U  ႵP@00a%a%O-MpG@ P 1 !`Q[ Z@ᴸP[@P* 0 000p0NЍPP P : (X0X P VP/P  KP00pWpa%a%o@-@9`P 0S PP Ѝ@ue@b@@L0L 0P0pM!O u@O Ѝjq4}@-p`P@ Ѝ0S 8P5PPM@P T0P 0p0M#PAPN@NABhoG-p@,,`P@0S 8P@0S0# CV* UR@ R %S #SP @# C V* WR   R %S #S 0P BKȷ@a+a+p@-MPPލp@ 0@bqp `,+A `P|` 0S:T  K0S 0S   A 0S*PkP@4+C-Mp|10SP ~s`1 RPCNЍ44@P,A 1R@gpdpap``0000 000pL N밐@@H`V 4` NV @_u0SM 4MMP|a+fooa%a%ooq@-  R@@@0T PvL@pԸ`PM@MM Ѝ|a+o1G-0S" 10S`pP 0 @C|R0 -R L᧸P P,J@1 ʶPǶPP0 (L A` MV T" P uX%X*@P tT@@P@T 0l000@Ѝ`4PR@t0S+|a+lfon00S/RC-p t9`P% &Pڔ ЍCjPgd PP@0 PK@!MT  ЍCwt Ѝ|a+oo0@-MC P$AP@JIDOo@BMЍ00@-M1@0SPP )V@II @Ph@LЍ0@T@0: S *5@zI0+d%d%@-M@ AP͡00 0ᜲЍ/q@-@P P0@/R00Sx+h00S /pp@-qp HqpP@ TUppf+@-P4P03#0 R/ p+O-p4`08@PV `20ST20S / R 0200CS$0S 200CS ʲQP >)QP 2`V1 }`_`P|0Z0KJY)Y @ PVL1L H100 ut 010S1 10000 0000S"qp@PX  PPAP qp Z /80 ЍO0 `V a+H+p+d%p+a+++pH00S <0P/000S $0@///p+L+p+a+'G-p$@` P*P@T 0@T@@XJ0ZsP`X G hTio T 00Sja++G-p`P P @P qp@PV00SЍG0AhP00 0@ЍnP@P 0qp@P f+a+A-p`qpP@VЍAm0  0@cЍ0P  P/d%0P  P/d%@-P@p@-@PplPW 0S L0 0S8 00C0Jp@J  B 0a+d%q+0/q+A-p`P@T0$@*0 "0UP00 00(@0@000 ᫵P @   0S 000d%q+P// / /00//0// / /O-@0MPut@PЍ30Su200 ?QfPp0p P^R`V0TIp@ P P``0t TV 0S@Pm!! g0P@_ P10S 00 P0P *3t10S``V P PH p ЍO!(100pW r 0 `P `V˯[:p T` P0PPڔ0[00S0O Ppw\0@Pp@P_}@z0 7++q+f+$+hs+ +T+\+O-@-$MpT0  $Ѝ@ p20S2T0T00 02000T:0: |PP20S 21P U U P PB p $0 P= P`[P P p 00 000000000 P00P+H1 D100%- X#*0 S0˯0 zpP` P0 0P00S00Sڬ0 0 00S00 PXH00SO 00*:PE * B++q+ +T+$+hs+\+qpp@-@P Pppp 0 P P @0@`@@PP60@p@PL%HxL%O-PM@`P"@@T M00000 0 `F?0  20S1 ЍOppP ЍO$  0s00U 0SqE Wp |!00t!`F0`!H00 0@Ѝ00Z 00S 1 0@0000@ 0qpP@ pqpP@ P 0`0000 000CS( d00SWL0``00 0@`U+ pa+p+p+p+@-p`qp P@P 00S p0 Ѝ@3W0 4@P80 ), Ѝ@} p`x Ѝ+(+Bpcp@-  Ѝp@-2P p@da lT`P@  Bqpp@@SQPpp@pa+p@-P@`P) P pGP@000S  p@I+A-`pqp`bqp@PA40 P0T0A pp(+@-04 ,    00lb+db+tb+`b+@-04 ,    00pb+hb+xb+\b+$1Pp@-`0 S@pP@SP@P%P}` P@@R 00SP 0S@pP R @@P[00SP g+q+G-`  傀E@E PTPppP FT F     F F @ Ѝq+@-xt@P 0S\00XP 0S<00   ;0pq+ZppP/<0 4   $ ( , 0  R 4 /q+ +O-paP0$MS1A0S 0 !A   W  R ! W @  000000S k 08PPP ,`P ų04 `0 `04 4 Z `J P0 p0PWP1 P#P3*0  Z0 0 Z Z`S ``$Ѝ 右 ዳ0@+ +q+L%xL%P 0@-奢P/q+P @-@P$0唢P/q+O-p8CM4P0 0C BS0S0` 00W[0`0C00ppЍ Q0 QP[` 0SP00 `0 P + $20Sm o0Xv t0 CPPP Z p   `PCl10S900 VQ X ҷ P P  X   P X 0 C R p Poᩒ SS0C0`J 0 q+4+g+0'q+G-00pxB4$0`0 00P P U 80< S 000@P8p<0S+ 00 0 p0S5V@ ` 0 0CR; 0 0 LP6Y pQPpL 0 0 0 0R* m0S$ P0S0SpP'0 0PP(PjP P~pPpPP 0 0 0  4 0 SP0C0Ѝq+4+ b+A-P` |prt0@ @ @D@L00@TpGЍ `:PPL%q+ b+A-`HPp@@EH0S 0P H@@Hq+PG-pP|4@T pT04S Q   R0  0@P@5T T @, 0  0p4 R0R000S0 0  0 0C 00 `0P0C0p0 0Ѝ P0  V1PU(0S 00011C(PPHꘑQ 0 (Q20H0@` 0P `2R <10?Q 0`@U 0S H0S0S q0(R0SH0 Q0H @`ʈztPP "E E"ETP0(0E7PH00C10H00PP(0q+h+Xs+hs+g+ b+Hq+@-(@(0S&>C0(0q+G-ppA0P 0P0W0S %> 0`S@U `0PS mٞP 0 QR00 0R 00S W 00S0S0   000    0P00SX 0   00q+4+ q b+Lb+Pb+0 0@ /q+d0, R X00S P@0~0/0P 0/ 0 /q++0 ,  /q+qp/G-`P@P_p p倐x X 0 B 0 V 0U@00CSʝP 2P 0=@q++PG-P0P`oPp̀@ 0@D P V 000U00C@C@p T aP0 0C J0 Q@ @D 0@DRCq++80P/ R/0 0S 0 /ps+ 0 R  @+qp+p@-L@ 0Sp0dS 0p`$P `v PUp 0ps+'qT0 0Q 0<0< (., 00/s+ps++A-APU  ^%(`P, `(,, R0P`VU, ,0 0 P ^PQ p0࠱ P 0ps+1G-P0sUPP@PP0Ap`@`V R0 XWA V$ 0 0W PS 0)lP ` AY0 0 v W0@TP0 0` &qp .@PCP tA ` W0 0M0 0`qp @TP@+ps++P0G-dpPU !R00 RS@ U W0S Q0*P @P P`@V0 0 0 /000 r  0@P`P`d@W 00 H000 r  0@P`V@ps++G-`S 뀐P@p0Vs 0SP@`@ P@tu TUPa+00CS0 S0 S?0 /O-P0-SP  v!'Wi2p2\2P_2D:P0S0@ 0S 0S%@T ;=-?1B21*YX CA 0  ЍOr`P ;@8@ c@C8 0 A=>-{Djb@qp+4}G-@ $`PP,$zepPPw F@yz  0Z`p@f 2d0 y(p Tt lp@ pQqq$8b-p+C-`qp p9 qp@@PP1 .Y T0 0 Ѝqp 0 p 0a0@S0  /A0@S'0@@-蠌+oq.Pp@-1 $P 'P6 Pp srpp^P@<P@050O00pPt\0,\ O  B%@ $,P P $0ON0@4ppq+a+pa++ 005S /᠌+@-o0@-M@P P)  000Ѝ0a+@-t @ sr NΎ004Ѝ蠌+a+7@-~P! 00N.P ēO.|~@P@BT  $@ P Ѝ0@  P Ѝ0a++(+@-SP ,0 0R Ka+q(00@-5 @P0QAC R0蠌+@-@0Q"P P P0@Ѝ00St T0-Ѝ@D00S<Ѝ@ 0,00|a+qa+qpL%qqr0 a+000S/$   ?A9c0/l%a+C(+@-P M# @0.S 00S Ѝ 0S0 0 0 R000l#.P0@  0R 000@0,0rl%r,r(+@rbrhr000S/$   ?A9c0/l% b+C+@-P M# @0.S )00S Ѝ /0S0 0 0 R000Kli#ɥP0@  0R 000@0,0[l%rr+rbrr@-@PP  @ЍnP P/00S |t0/p@- `eP p@qpP@ 0 p@|a+r+(+P0@- S S00 ЍY00 0(m%sP/,0 @- 00S@++BhP7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P;\ Ѝ04@P,0, 0 10l%l%+l%l+0/08+P/ @-@P @DT@e\0 X PLHD@<840pa+)s,m%i /s6sLstssstPC-PM* 0&DQ@0 0 B \ D!R1@0,S T0@0D@D!10C 0##Tߍ` @80Sڀp匐ᛤ!P4"0Sᑤ\8ጤ80H %"< @ Z8Tq+d%d%LtX%P WtbtP@-  0S 0 0ЍP  R `ЍL P0< 040800 0000000a%a%rttP @P/ 0 /ta+0P 00/,+a+@-PU  @ Ѝp`@JtpPQ 00S0\Q0S 0S@V ᙗP 00$Q00t+@-0 S 0,, *Y9 Ѝ * Q9광+tt@-u@ y!ޑ+tP/0S/P 0  //_ 04P/ᴑ+ 0@-4  4 Ѝ䴑+ts@-P@`0-S0 00C  S0 ` T00V L ` !0A0A ^T00R`ЍptO-P$M c4P 00S S03/040$Ѝu40 @HsHHP 0 R @@-PG 8$PP 0@0 3@ ZFdaD[@T[0SO+P080N0 P 0+S \99P/Pz@0nP0Sn@z@-P00 0+P0P0P aK[  00  @ =RP    B  daq000000 CR H H H I H H H 4I 0U ?o200S 3/P^ U [ RR00S4@:0 S 0 uP,00S 광++a+[u"ut@-@PM @PUp`0@ ЍU  x  B U R  #00 CR TK K J L J J J L U0S U3/U@pr 0 W`00SXSX 00S000JU= U U 0?o20 0U. U U V `Q``Q`V  `R``R`0ESU U U ; 0S00 liPS Ud 0 D0  ^000W Uuuu vuup+@-P`@000C Sࠑ0 p T00V `-0## N0 B` VQ L AQ T   Ѝ Q 1t 000S/P/`++d@-CP 0SL0  D@0S0S  0  03/$@;v+d% 80S/S/ 0CS/$d%O-@\aM0  R S? 0S 00 ЍpW/$`  0 % 0PP AAQ-P $ UQ@0  U  0@@OoB Rp 0 0S 0Xd%@- M劁P 0 !    L* Ѝ@}01X*t00S P1T 10S100 P1{0S w0#S |+f+@-b|+@-  Ѝ@-Pb9`᧠@ᤠ@@ 0`p6 Ѝp@-P-@pw  A'jw Ak{{6 Q~wpY@?h@-?2cX@4$T TwJ [{ A{&k{{6 Qdw.A?Q'p@-D`DP@@Tp80 0S)PP0  pl%+pa+p+p@-@LP4S 044`40 R:0 @0 4p脓+l%+p0s@-@@d`D \0 Ѝp0U4@PP8++p+@-@@PC-?O M@T!pP0`0 0ß00  f 㻟0@pU-00F`IZ3ЍC-o M\0PpoF @ 0 O(a0dU-00D@I=3ЍA-PM@0SЍ%S pj@0pnS sS dS  ᡟ@`D@P O @-  R$00320 P00S@A-P p 4@0T` 4 0@T 00S0@0SP h00SA XK|P0@00@m400S,0 A ꄓ+pa+ta++\b+l%`b+ b+p+@-@_r%V0 $Ѝl%+7@-P0S x00S Z 0S@ D00S  Ѝ0 00S0 զpa+ta+ b+p+0C-p0`SP #000 Pj@l0 /o"@@P 5DT@U 5 ЍP ~D+a+J@-@P ~00o/C-MD8  @@Y 0 0rxY@`Y LYK #BYf DYF  @aIY a a a 0b b b a a a a a 0b Lb tb a b a a b a a a a b PY0 P00QQqpp40SPLE0S > P ; Pa4 P3 qp P0 P PYs 0 0TY@AYhBIY df ` d d d ` ` ` ` ` 8e ` ` ` e ` ` ` 4f bI0 SMY Jd 4d Dd ` d ` ` e ` ` (e le ` ` e ` ` f c ` ` ` Hf  Q0R 0 )qp  82~P0$2 R P B?ᰛf qp]0[P P01P 13P 0 0 S0:P0PvP4 0P \ 0 0 S0:0P SA Pu pDPDD,P,|ꜗ+a+@++hs+fa+a+a+T&0Sl%l0@-@d00SOoBL0L0AD0<00A400AA9$0 l+++l% b+\b+`b+a+(0$00A00A0A! b+\b+`b+l%0@-0  0SRP @\@R @ TP @S@ @  TP@PT0@100s@-@QP`@ P$P 10T0 ؚJ.`@Κ@0T T0TR  QЍp c1P  갟+D+O-MDH RQ. 0`0DPH@0PE1p?J 0@0@QZH0 S50 S  0 000H00D000  0CPЍJo ^P DBZ@pP갟+l%0 @-oP/0      /ᰟ+0G-@0S >PT X0 000Sx@/ qpp` j @00CSp++f+a+1O-`wv@ !00S ЍO00S @00CSZ# ЍOcqpP [ S |V Q @ ЍL%xL%f+p+a+@-4@cP@ . 0?o2 0@n갟+Zp@-@P$0pPi0갟+l%m%p@-@P800 p UT 0Sppl%O-$ "ut$ `100@_0 rs Y0 @P0s00V 0S (0X 00 000 :000P"qp P 0"ut R0 @P`000@_ V0`p80?V `Vp ` p갟+q+0@-MXP @tu 0 PЍ0@-0 00S@갟++0QA-@c MP 0SFIP2IP  .P20S 0S   Pv|r0S0S 0S 0 00 0`pP! VN$qp1( Pq0S 0 0>0Sy10SVJW 0 Vda~|XJ7S V1p0X  ~| ~|  Ѝ000 0000 0 d`PP 0U0C?o20S 880 P갟++X5+yZt+a+(+0@-骋$ 00000S@z +|+0@-陋$ 00000S@z +|+@-J,㇋$ 00000S@t{ +|+@-@P XtPqHn@jgda{ z z 1A-@TPP1 PqHE!~?0 @ `Pp 0S0S 0` 0?00^80 (00S+z p+ b+a+a++A-` pP@ᷕ))0Up0P ᨕտ)@-4@P(0    0 _, m%+O-AMbM+pO,W Q x @P kU0S0000AލЍ0!S   PA>04S S S0E0@S  00 [Q30S 0 C Q ? 0   ^R000 QR S$R0C00 0S00`000\R00000 m%+O-pQpPpWCM Cߍ@tcPSTp`3`C`# \\Hs NPZ PUA $3T SpP 0S @DT2PƔ@ Ô @@ 0 SX + R@ y+T@"0S 000❔P @B?1P SQ@ 3 Pp 0Q 1T RP 0000@ PP0 @0P @ PQ @000 0Q @ Q0 @0S 00@ 0 S 0S 0S &P"? ^00p000-+ m%%+%d0@-@ؕPѕP ̕P pǕP `•P qP m%Ɂρց܁f@-@P DP P P,@E T1O-M0SM A0 ЍOn` 100;  0p `wx@PЍ0S  0 |00 0႓ 0 +P 0S0S S @P@P+@++\0@-PP P^0S @T  0@ + m%\0@-PP P^0S @T  L0@ + m%0/+0/+00S /+ @-0P {D+/@-H@ p P0S00PЍ+FP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`Pp?P@P$ ?0P0T0S@ 0s@-P00@a0C`S급 ܉  P  000@@0Ѝp 0 0 0 0 0\/\\G-1!0 e \ Q [@`V1!0 d[\[0F?o20S7 @`^V0`0]QQ! ]Q0[Qp.GQ 5 p`0W]Y0`QV0 0 d\Vp0[W` W nW \W`Rp0 V04+,+/`7@-0 P @R RP L L D> D   Ѝ0@M{ @ꐹ%4+,+1G-QM`딡@``P0pW0 py3PK P1 H1 000 0Dd\W R T R 00P@0  p0 [R .BQ  [TS[Q@]R  00000T[@T[T@  ST  SR,0 R Ѝ +,+4+ւ+00@-M00 M/SP $S, +S00, 0 0 9S$\S @P0 0 c0IS0@S0 W00ۍ Ѝ00@00 S00^@4+,+O-@((MTЍ0tS bS rS aS @{S000`V Fp` 0S0QU 0W0 0娒 0P PUP @0@ `<0 fc2pP'+ĺ+4+,+7O-`-M蟟_? @}Q ;Q <,0 |b \ @\\ `<`,0 t@T @@ (<(,0 @\\\ \0\ AP@000J S  4 P <40 @ R @\T;0S00<+<p( b  R @   R @` @ R @S 0R @ Rt AT0 1p @ 9)0 4" X 00P0)9 0:@@\QQd9d)0 f$ K@P$9$)0 pV,1S0 K$,04 @00T0S@ 8 00@90>: 009 Q00A0 0C S0 00,4 P8(0 t\QG THP R,4 R $H,4 00P@0) 00A  0哾0+0 0 0 00)Rm0I gRu b9RZ0RR R 6&0 PT   9R/RRA@ &R- 00P @  y\R0)0\ P0 A  R(6(&0 [Q 50)0 0)0\ Q5%0 (~0;Rv IRpR wR9 iR0 R @ 0S <5<%0 \000) 0)rS00 00 9@ᤒ0"S T4$0 ,=09@0C09@0I0)0S 00@<40 0)0  0) QQL4@ S 4$0 <$40S $1p5 0I,1pS0 KT% 0S @;S>B0110@\SS434#0 ~ P3#0 x4 @P 0S 00@0  p$pp_p2p"0 0 $$$p W 020"0 20S$000 S 0Q 0Sz @;S> }S Sp 1!0 0w$ 0 0$ (0 0{ wpm$p000p WH 0S  `$p U_$ U$ppXP 0 $ 0     囱!1  ! 00$$p ( $ p$p|! %++4+,+U0m%{ރ'G+ ”+Vk҄+S Å:ކ%4+,+0 0 (\<0< @0 _00܍<ЍG-`@p娀@XP䘐U@T00S Ml0h0FX0 0S0 0 # P+4+,+܇ĺ+x+++p@-P @(000P @pn%@-@   0@0n%0p@-P`PUp"@P 00CS0CLp ^Kp0 K+G-plBl` 0S2 SQ S$PUVP(00S S < I"$0P, u^0000 00!1!QP8$00P0T00, PP (00S(0 #R nR0V ,0020#00$0,0$0K P( T0R #R nR   PH \T000(0V0(00PP P \$0T\ 0$w 0(0V0(00 000TPr+R8+و@-@X0  0S 0S00CS0xKp X哃0 o+G-M0DMX0`Sp00S 0S ]3X0X0#\030 `00d0̓XSXP 00CS0?Kp XZX (pP0 ]0 X PލЍP2 Jp0S ,$0P 0P 7p4S 0p0p4S \PP JP "00\0sPp0`0d0S0000d00S 00Si P00  2 023]00S +I+y P0 "]0+;J0+6S_ J` 0! P*G\PP _JP P\c 0 p, 1\0 r! * 0`PS(00 PX2000+|0\`0P l000S S0P@ 0 P00 00l C(00(01+߈%(1/ t+l+t+ 5+_Mq$@- P \ ЍYP@- Ѝ P \ Ѝe@-0 P \ Ѝr0@-@XPMP   0J)0 B)Ѝ0t+@-M Q qM`0S000@03 0@i0S d" 0E\ 0 0S S ` 0X}l @P *0 { PI0 D}00ڍЍx+`+d+@-P@   0S \0 R `p`   :0P S t [ЍЀx+߂G-pA嘁00`PU , R:(,500( &U# \U   0 R`Z &R\R`P , R:(,00(P    "pr P qu PE ,  R:(,00(   Zr  0x+%A-@P p0R`*W0 0 :r 0P P O-0/OM00PЍ080?PU 0PH0\\e R7 0ST?0 C0R 0i Pi PS4 0PS>0@oP 0 R >0R*0 0HP0S40P 0 R 4>0R$>0 0S > 0RR0S0S4 0S=0@oP 0=0C>S񟗐x Ա Ա Ա Ա Ա Ա Ա Ա ( Ա Ա Ա Ա Ա Թ Ա D Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա Ա  D Ա Ա X Ա d Ա  غ $ l Ա Ա ( Ա L0 R: L ` 0pȇ0080800400S\<; 800 8\4 00o{<0S  H0SPP80S4PU 0`  EF}P080 A E4 p0T P 0   004 0 0  0$;_{40 0:0R᠚ <00s 0P 0S O0S 0T( ^P2S 0 H⫋` 0S0`V: )$ 00@ 9@ދ0S ً| 0Y H0 $gP x0 H$0x$ [89`0V:, $ ` 00C 0 0P0 80 R:`8 0 z `[ :p gz`80P  R:L`LL8K D`(1 S:` 0  0(8 0R7 800 g4 00]z<0S  PdP0800 0 TP80SXg4 007z<0S  [80S0p4  H|`P <000F400<0܆4 0z<0S  <V 0400<0,6 800 |V4 00z<0S  $sL0 R: L -` 0pX00pY R  Q T5 50X4000  P 04`Z Z 0Z 000 G 00 00 V,شZ0 0RP  0 0 0 PQ@ `VpX 0  `E0P  ßH`<(LpLHp<(L(0000S c4 00Yy<0S  }` P/ 000Q00  0  0`Vp P\   `VXp0  `Pa 80S0s "p0 W04 040P0 P 0S 00P80S0s"p 4 040P |P P R`03D0`<pL0p<q80Sn4Xk 4!p 0`R$l0004 0V^*00000(0S!0 ( 0Z0  0<H0 0 1 RP0P' ,+x++++Ⱥ+h%n% ht@<7d+'ʉ4++ &%+,+`++0 0$ ( 1 0X`PH`<(pLHp<(x0h0<0 0R,,0Q 0{Q  +&Ⱥ+p@-@P`Tp0wS {S sS 0p P 0 HV0`@p P `G-`PT3pPW00V01 R P @~s0PV(AGU !R <BPQ 8 $ P 8   V    :R 0SP0S X00 0P00 0V 0S`: dwPP 000BS »겈+҉ى0p@-P@0`T P ᄅP# 0S| d 00C?o2S Pp0S000S000V0V@+z,0@- MMP @P X "V  p8V+   P ۍЍ0H0  BR R R8 /%%@00CS0 S0 / %@-(A{0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@_+0-01S ^00So^ P0\ S0S Q0S R P0S0S00QR ꐸ,+0@-  `Ğ\ @ T\    %R    +,A-\A0 5S <0S 304!0<:$a$q$P0U&%0 ! R8  (P %0  ,P 0  4PP |wA00\P 5P D 04 0P.Sꐸ,d \+%X+p@-@0`  -T  ztEwh pdPPT p uP000ST @%%+s@-P OzP>:@P-0?S0SP`@ ᓮp Ѝp/ P@IP 0S S &@w0Ss00]T{a\H+@-1 d%0@-@<TQ T00 0001S R0Slp@~TX` T@0$P@ 4T(8  0@+ɽ%,NJЊ@-0 j뜋%7@-@P   0S 0@T 00 Ѝ00"S p`@-@*P  p SЍd0p@-400/F00/ 00/OB00/-00/ᜠmI)gb@-0  0Ѝ@- @ +@-P%, 5A0S04c@-+@-P%,e @-0!, , @-,J( 5A0S04c@-, @-襠 @-0, , @- ,. @-,( 5A0S04c@-z,< B@-r,< @-j ,< @-a ,< @-X , @-O , q@-F, e@->@, e@-6, e@-., @-&, A@-, @- ,  @- 0], `, B@-, @- , @- , @-^,$0Qa A@-`,@-@DTP d 0 C& 0@- 0|1堉$,p@- P PP P$[vP P1QSH P y~1S(ʰ1 DH P yt~P 3 00P1 RF40S 3/j PPP |j P,Ѝ0R0 3a 0SpW 0| 3/pv P 0`H P y Rj `.~Mj0010A\70 b"P 00P000xPdP <P >P qP uP P ʰ0P <@0CSV <000C`FqP Y$P P 00Ph+Y% ,RS%,1% 001/h+P0 R0//h+O-PPp`*@ [ !  0P@ Ѝ0x00 0\"<$ P 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @h+^P/D0 R/0@-A1 P i< @wh+O-0Bp W =l0 00p0G Ѝ`(Z 0S rP  [00010P@P 0S 00@ Z 00 brP  [0S  [00000 00` Z0S HrP  [ [ 0 0 00U0 P0HS0SPP+r 00.r0S )r+C P t[PU n0X!0C0S8 3 000 PE\[|+VUUU% @O-@-$MPZSQ0 T 0 (T`D ;0X0 0S 0h 7ovkwr븳@q qq0P@0@ 000000. 0DSDU 0 E 0U00ө?0U0 CR C 0E R 0 0kqY 2 zk0 B@AY Pp} PC ! PZ P P#0STkpD E[PE@ Dkk0 k@P002P? P AP7 0JSI1000 C 0 E0f[0@Pp1P1 pW 0p00@0p00@pW E@DE[PE^|pGT@D¹0 X@P vnqP@U@§0S 0 B0FZ00000S 00 0 0On$ЍO]0XS |+.F^g%%A-`PlPp `p@p@0T `P@ P 4P0000|+@-@PMp 09`T` P@@Ѝ0 00mpp 0 0 @rQPu 0r@P   L%|+I'Pp@-@*TP0Ps D` R : P 0S@@A@pL%|+@-@D0000|+0n|+0n|+-@-0 0  Ѝ Ѝ/-@-00   Ѝ Ѝ/-@-  z ЍЍ/@- Ѝ@-@p@-MP@` ,0 0( 00 0`Ѝp@- Ѝ&O-P0-M ` HpLooUs\0 0_X[ 0 YPc 0S` T00S\ mpP@PT00PXP@ 0sHਏȀ0 0W 5p cPUWpV`JЦo`0 S`J 000 tPF 000 `@P\0 0X 00T00 P0X CZ  }u Hf%zCfAfЍ@00Y00S 0S pT00P@#@3@pzuP 0 Nu뜰!JI3h6h C 0 E0G]tV`PJI`hh|+Q ,@-,, ($ Ѝ&@-`$0P@ 0  00 0`Ѝp@- Ѝ&p@-MP@` ,0 0o(k00 0`Ѝp@- Ѝ&-@-00X T $Ѝ Ѝ/&p@-Pn@np|+@-g7@- @g8B$RC\PU % qdC/00h@PU o%T ad3/00000S$$" Ѝ0,,+%O-CMl@`P \\\ ~P/Cߍ@ & @` ҟ0P0 bP@Q n :0P0Y pW    察 0 =RPᦟ P4l0 0 k@%P1@-[O-0MM 0p@0v`P2 zPP* P :P 0S0 0   r o 3PmPZpP 0 Q0 0pPtۍЍd0P 0 0  0  Bh,00S/ 0P rE@-],,X@-fP P <)AD(T"P@BhC-@$M S @r00dA%P-   rF0S$ }P 30Sm Y0] )Pf \BPaD' D* TB^ ($ЍP@RA4P@ [A`P'='P'`20S Ap0$A PA  $ X$P 0)AT 'P P  AP  p@PP0 +Q !X0p 7'WpT+ApT3 {@p 0T3:X#  VAPQ  R@4Q p0Q  R@ 6AP`,Vp003/P,00  h0S  R l 410!8@<,$,,0@-M M+@(i+([\B+(iB+Q\(Y@PP BT@PP l0 @@@@@ @@@@'Pލ Ѝ0B(+?T99_-MM+ iP+ \+ i+0\ @P  ?ۍЍT990@-M Bq1@@@ #P @  P A0$*!PRU)QW&Ѝ0RL00S 3/P 0$003/0$*@P3&P/\P+X@P'@P# 0P ЉV@  0S 0_ Z'P @P0o,m&)z*00<,$,[f ,,@-M p0@@@2?f#P* (@w  kP 00*!R00$Q 1*@P  M0S 0` 'P%(4*Ѝ<,$,O-`M 00[#*0S ` 0B00 SS@@@kp(@ 0 S0 0`0@k 0S :hPP @B 0p00Q %Sg0S iSD %S* dS $$0T !PsS(200P 0 倠ಠ@Z4!@ P %Q0 @0S0 aR7 cR0 3/P Ѝ R R P10 R @ 0QR\P0S  S 00@Q0 @R$R0PPR@ $$ Tl 00S 0 ! S 0 @S$SS0P @U:U 0 gꐹ%7@- @PU W! I`+00 Ѝ0llP \ ?!L y 1`o`( (0[,q$q07@-@QPT80800 S    0 Ѝ0@:,,7@- @GPU ! +_*00 Ѝ05PP | _d00S ho L L0[_o0 ,,_,q0%s@-`4Q@e>m_[}h cgamch] cgC:g_c:}i 0An@PxxTf:`P DEDbb ᗇW}Ѝp,%O-`-* {MPp(b0 i"p6@ E 00S  )P R m 0S l dP #_TP _Qp@T Pc mKV|0B? 0F?.P  ')@P  )00tkPdkP; P  @; D;0S @;P <; 00|3,"0{ߍV3 ,m0z"!03ˋ1,0ʋ H0,0,L0 L  0P,0 0 pz?"!!03  PM p WU $ lZih2P ll;m0S$P0 T 0  <SR 1P C^1 X @U,2 @voPU ma ]Pz?0WC(W0P 0[ 0R0SQ ۫ ^0SGW 0Pa{0SP @ v 00TP@@ ,2 @@', %ptbt8f@,,gIFX ,[;m,'w~0@-0,M 000000 00P0 00h0 PPP@P DDk@0Q ,ew,Ѝ0@$( %%, -O-iMs?!0Y6P 00iߍOЍ/Lx`P81P ,!,0%`P z[p P@P)PY-!(U0P 0v0GSW030#[0S 00pP@ Pp00!&,-O-p-(MT@X  ppe`V4  @Q'U` i[PPgP@P i:H E0W6PU 0'SP0U*S!/ ߁P00 'oX/0 0P g0@: 0H: s1P0Z ^ m_p`PUQV 2S022SP0220C2   S`` ᵄuz000 0 0PDU  @0 0 PA fsf0 R` ! g`U 0 V0C?o20S `d`d`fnzU @ v 0P| vf@B`Zz(00CS0000G'VP a0P /]0S  :Wj:z`PWUU S  0%S @S, B B*Ik& 0.R> 0*0cP6 00Zp  @P 0A0 0*W! P:iWy00F ASz d_#dtV P_y0fe(ЍO Ѝ/eR07ht@,%30@-CMlPP 0S .Q Z@P8 .cCߍ0 P'c ++G-p 夐夀PB`A@T:00Z W ,/Z 000 YP EQ 0 @:%A-`Pp p@ j4 pb 1P@袾+A-Pfo@ft pb0S DQ0Q.S>P @$ $$U  U褼+0n+@-M4 0PDP  b 0PDP  b p@ ( .j zb PQUV*p@ l`lp gb @*PPЍ T T`!i+%i++8i(+{QP O-p-MQ ur@cllP0S neV:=80$d w-B0$0B. b B b0`Q>d0 b@400De0 ,a40P,   TTr>@W R?2, 0/pkp x#|3 R0:P$P o P <@Xݍ<ЍpP<\J.̟ 0  0/P `d< 0 B0 u`````- \ 0tD0D Dq i@>0a X|a la@P  faP;@ 1sS1lSD;"00`&a`P SP@;nf@P,Oa*0x*0wrVfP\8 0\8TY0 yV *0z*0}\8t*0|_\:VT* Q0:$DR@* , Q9ʟP \ʟW ^/H0U>H B0C   APT  8T@Y LY0X649 @p A\)0p HA0jp H0S[, ,)A0$$ @P @0H0 H0A@jp AA`LVp@fv& Sh! HOhH p 4P p0 0\6S 0 D888@P ]5( .+( %" [7S  # l7 P~P7'AA\@P G@P 7X'XP\8<'08\8(GP8 )`8: V&8P00P8L `8( 4V&8P0060S\80\8P8 _80S \&8P8 _8 VP000S\80\8P0S\80\8@nN /N B0C   [0S1 pP 2@T `s\xHHp#p00S X 0S d"<WV"3S3 V\ #C?00N?C0C Y`0  0@F0@`xIP;A?p@x047 $eq$ (EP++_0X6S/᤼+P 0/Ḏ&A-鿏MP@(p>cP3S0 `0 0` :0 00`@00`Fo0/0 0P 0P/S/00 0 /S 0/0 P0% R $b@ ` @0ߍ9@H@-pCM`x@bPlP#d0RXPP @ W<00040 `(PCߍ&U, ,Y ,@-@( @`,@-0  0 P @0@ t28 0/P  ;Ѝ,,P ,,800@-@XMP70  0@ P x0x t0tPEI2@/Q  0 LL =2 /R@0 @0(Ѝ0褼+,

1S$ FoP j?x%0J?``0S `0SAT FP r]P @`|̠p( p$  ( $0qY 4 P 3SS X 0` ,`00,?p p؀ܐ0jP 0S0)#0C?o27 #3RR  0R67\ 'Sz?0C'Q0 zpR0ЀG(Sz?0C0(\F 0C Q@ 0@$YP UP  P ,04! @F<#%pZ[2P  @000@"0H@0@N?@@T@0Sz?0 C,04! p@<#!0 J  _ _T I~_00I? 00111F01p00 84p1<P( s1S%4p ሠ0!i 0Ad 0_,0! <#@  0;,0! <#@t 0p(t!-_n}}D+QNEFX!v&%!!'Q`!@-@M`p 0 @@HpЍ PP t 0 @@HpQHt<@P 7/PCe`7@-0 0P Ѝa @-0 0PЍ|b O-aM,MQ0=@PŸP6 \ `P- |\PP- Vl"dT+"_ILb+bWI`&ZP@``V!aV+"GI+bBIO-P P&0 Q%3`VK0$P 00S 3/p0$aHbb>0Ep0 S aݍ,Ѝ\QQ0GoG`F[P 0000!N9`P 00S 3/p003/NaV $P 00S 3/p $aV 0P p PP pb.x;9/0  PPpxP".;5/0 #X R1   H 8V0 0stqttP`V b ,PPY  Ht}PQy+"Hb+?"PPi[P# [P [P [P  [P [P UxT ZH  VHP ,s`#Bhhj;$,,!P  S# !00C-$0pMP `A@P00 >P C 0 1/PP0@0 @P@00003/Ѝ003/$Qg"O-UMMP|x.`@4P6].z2]Q_8Il(qXpWp$[ Z T  7 00 70 0P0@0\⠗z#P40([Z4S =U?h400C2<7\4=1 W =7h400C26\4=1 0 00 0000 00p㠖p  \0440h40s -14s[w0 00 0000 0 0z|pp 0440F40s -1tPw003 E "T5@ UݍЍP =2 (XL=1P⺀N0c ⺀  h \ p$w00?00[000ӧ?&N?/'"T`4`( 4@ TP40S N?/$"X4@pWH4 0}10  A hT "cT _T04 1p$ ,01(.8,40001A B7`$ 1(11)1S04 $q,0(84q,0$1Spy 0 0t ^ pWn, @p#0$1 0H0$4;B|2P p>{` {$10 $! ,,0 :0G80C0(1}1S 0}1$1S! >,!  :6$40`040<,,% R%$,, ,@,&,H"YPP ,0 0/0@o//BO- M@MPAE0*!Rp0)Q`U0 $0   P  Pp ,z*,(0$0 $(pP l4\,e ܍ЍD4p F80Spp0 @0 4p0SW00y , Rv  000;x8,9/Pc0  x08,;#"W#]#"(p#"#"##"#""""O-MeM08*QU"U&m'u@& r X &0x0 UT 0Q LC0W )qW e4p nP: FPQ' NP @ @ P* @H0 pX 804pVp4 80P<1 P U d@D`@ V p PvU 0  $T0S-    0S # 0P00P F0][P #40p80 P 00 ,0ST0 S00 P0 40040804 0SS40  0  0 x;8:/0PST0rԢr S S h \ < < < < < T ؄ Sb  SU 〲xr 0x <0U<0PPLpLL"@ @ 4,RP Ÿ ,0$ 0 ( P g 1ıPp UP0 0ꜱ5S0+^Px1x J t0 S\ rT0? iD%< 00 014s10 5>*+ %%}%0S x%v% HލЍ$,#q$0,#$)$E$&$b$,^%w%%%%[#gWBh########6%(-#$%$/%#%& &&&"&O-BM@MT\\p P`   @P`T$$  P```PP@BލЍ؃cГCг @Y3(4@$80 QDP@T@@< \   P  `  ;443 0 88@4  ,2 0 YĒ  P   똢嬂  8@4 t20 h2@DDAT T2T"TT$P D2 <&PI020  ' 20)ATp !0 $  P' !P%0 Z#P@0SW K0S04@ 0000@;x8 8/P6  %P !%P 0   @$$0 Ip@.W:* p%@p+&#:&-o .L&^&d&v&&o m۶&&p,#$,?&0@-0`M2 pRЍ!,^04P0 @ PP@4 xp8;7/P  (PB++(0 @-@"!P0(@+@-$@2S  02+O- PPPBlpPP   `PP Q@Ft$ର@P`V* ЍD P P    R0SP pPBNDꐹ%@-@00 zP Q P 0 QAЍW C-JMM bpPU 8U@4PTdHP`YP8 Yo`GFWI   zo& 0@o/b 0  11/+10/Rp@-@4P0 `L1111p+O-Pࠟట@p`0* C  !0  PT0+S   +S 0P,SR0B `p@P X 00,0 000`00 Ѝ+ X H 0@-MP@*.^T1( 00 0d000 0X0@@@@810 00@0 $(Pmߍ0L +O-P4M`@p 0SpYP pPp 0S00W0#S 4Ѝ0L0 3/pPP0 L03/P+ { 0 Q{ 0S  HL0 0P  P 0 0H  , R  T  X $ \ ( ` p, 4@8Td A- +R0 "P.STP T!$S000: SP1 t0 0T1X00 P1 X SP10 ,0 e 0=+8% + H BhȒ @-M M`FPWoۍ ЍPp@ !PP?+&K P*T+= P*+= P*.P$SBhp@-Mzv@q(.M`P9 k< 008!+N P (/9(/ jkY!(aD @P qލpZ[1', +@- L@0,SP@ +S 0   +  O- -M@c0 z 0v袟p` W  RpP 0 0P0SXP W%0]PeJP 0 a0CS0Sߍp( `8V2p0:08V0S`p R S`0a 0 0   p 0U? s [ 0\+ P 0 0p0 0  0S  0  @00t00 00S 0  0U0P 0 0`![0R@0O b% O 0 R*? 01BV4a0 i'? d@edAh+5t'+p@-@PuP p@!pC-pPAK L1`90D  #R `)0 S 071DH<LHa@LDP LU `1<P1 LU `1LP1 LUP1 `1LT0T U`1`%8 ЍC# (0(0`9`90 0+&('@-M@ P0:CoЍ@-| 0S pP`0 X00T T0PL008 80<, Ѝ Ѝ,z', ,8), ,,@-Mp@hl900 0X0.0 B00 0 y:h $0l !Ѝ+؏@-H2@,$  E@@\'-?@-@P  } R4 (0@(Ѝ0@ Ѝ/''@-0  0* P L0L D@D @08h( @0 aЍ,d ,8,,-3M MX ;P0  4MP Mo3ݍ ЍBh>e-3M M :P3ݍ ЍBh0@-M0  0 0S@Ѝ0h0h h@PX0 PPP00L L0PD @00, ,0P,@,,', , ,(), ,,@-0  0 P <0< 0440000 0$Ѝ ,(, , ,,( 00S/ /+( 00 S/ /+4 00 S$0 10 1/++11<0@ Q !@-0 " !/+0 10 1/+@-7M[*.O( 0lh6 0X 0000080 O(@7ލ<%L +H 0D *Q/QQ Q/+<%@-@0 0 0@QPЍ(@- @0S00,2(0@-AMhd@ `P uG  1P@00 0p9,(/>>Aߍ0E(+L%,T(X(P@-@ 0P  Ѝ,-@-  Ѝ Ѝ/-@-0XX0@P D  o  Ѝ@Ѝ/_a(n(-@-0XX0@P D  P  Ѝ@Ѝ/_(((a(8@-P P P(((@-@.JP@ 3oN.@-@,KP$0  0P0, , ,@-@,KP$0  0P0,,,QA-@@1@#PP1P#T|p|` bP (B(Ad##/B,B::\A\,,@-@SP  }N  Ѝ)%(0@-EM$@D{P fF <=P0000U (0($p:@Eߍ0L%,+_mp@-MTMPA DFI010$!p  '><H0 0000 H0 0 P 0PP`HRv0H2*>Up:d JX (E((Jߍp?)+L%,0 $ T), 8%{)E(@-@P !0`RpzJP =PP x 1P`pZ}X &01O@0HPF@T 9 \ Ѝ+3 8%@-@<@-0 0 Ѝ@-0 0 Ѝ0@-@M00 000 00Ѝp@-P<@0*SpQ JPp@<%@- 0P ,,O-$M@p`P0  P(  0PP0P00P|0 @P P0PySa00ͅ0݅ 000͕0ͅ$Ѝ)\&,0,), ,)[O-`-,MOH$v@v;[pPe $;fPe@T10S@ .HPPEUN X1X!XXd$0 0  @$0 VSS00R00S H 0 C HC$;$ 0   0l$ 0VRR  P # 2R @D H@ Q\G `P$ q;@,Ѝ))A-`pP_@P!G ePP 6/ApO-@ M$C;`P0 Ѝp0P0 ` 0VSS00T00S$!;-@-0 0Ѝ Ѝ/ -@-0 0Ѝ Ѝ/ A-@PMM``P `G`ep~@ F43T0(3T$$c3T &j 0So 0CS+PDS0 ) 0X 0S9 0S r0S 0S QN@P% h0 X0 @oH2@P 000C?o2 h7o00`1D(0SލЍ!{h7SHPg1Q! F?@F@Uoh!H1PJ0 H 0M( ' 0S 0S| q0Sx 0Su QN@-P 0 J0 @P_F? Q. QF Njw*ikD*(**P%,l*7*@,,*8*+8%gU&*f,,*00-MM P  ?P tۍЍ*-MM P  *P _ۍЍ*s@-gP' P`bP >%`]0S ꌻ ( 0 8 h @IP Ek@TT/Ѝp0n+x0t+R/ @-dt+\0X|T0PxL0HtD0@p<08l40+2+(%,:+T),D+,%,P),OBH%,qX),P@- ! 0 ЍX,p@-@M L(@H@?J0 #H ,0@,0@03Lh@Pp0: S, HkBP  qB   mB܍p,J 8JA @@@DPPڸa4 <UPP?8 1!˦8<UDQi`1 08808@TT OoBQP@10S nt<  R t00 00000 000lpP@ mx(Z(0@tA! ,, ,,+ N+) ,, O-EM08qSP @ ` 0!@vN+0S`PW!000 @@3/@P EߍW! 000Z 0SX 0 @5T W  00 0  0S h00S \  L0W0 ! ! 000, ,h0%,_+++,++@-Q0@  R < P0 000]Ѝ-S +Bh+O-PDDUMY44Q (_ H$ğ0*S^P3sC00`*V`O# 0SPCUc@ A@ LPtsFP `AX>P;@1 U,1$ PP $ 0RP 9P .^ 0 10S 0S= 0 1S900 000S MP,000pG 0&2F4V 00a !0 0 0R R` 10 1000pXR `0,S RB  0 P a+S  *SPR Uߍ` 1 00000000 .UQ U@P@T xTx y),+0%,<%+,&J,,,,Bh,,--Q- ,,+,,+A-Ph`hp@TURU LP  @P`褘%O-MMp`\p pP tPP6P  !@ڍЍ tP tP kPb@P aPZPP4| s0B ?P0=Sp  8 .PW@  ꨠ匐 fP aP  \@P KTP@wa(-c-{-q$*0p@-4 P@F 0Pp@@-G-P`4 F@T$ `V! p0F&04 p0RSP pPp Pp40Su p _BPp@V/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PhFP  p@&@-@ (@A-P@p`p0S 0pp RA05#Ph0020#X00Q #"0hPhp P#"4`V000S 3/0Q #"04P4 A-0%pЍP@` pᏹ pᆹ ္ 0ᱩ`xVS뱼0 t@kT d >PLAP <=P @_n}}D&--@-M M@`p; @p  PMpE`E`ۍ ЍA-@P ET`p P  0QP|d zd@@-M M@p; @`[p P0 @aR`VE`ۍ Ѝ edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP@00/00/4\80S0 S001/\80S 0@- ``@0!SR0(SS QU S!0$0S\  01p@-S@!0a408,08 S0040803/P,000403/,, H0 , 4 T 8 X $Q P 0!SR:p040080SS P Q408S Q0  040S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4  B(B(Rt0! 408 00803/P,000403/,, H0 , 4 T 8 X 000/0O-p4M@ cPPp`+04ЍO%0 L03/P Ѐ 0P p* @D Z[H * R T Rp ?8``pp 0Sb0P 004Ѝ, [ 0,O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R0!S,0S 0 p0p02#000000S SPH P00P0  R R00R0S \ S 00 0S0 0 K`03/PX   0O-P-t(0M000`S@p0( p00 ' 80s$(3 0>(h,@lQ@3p, (0h@` L3`R0000ЍV0V*8q 8 0L03/P 2HR b0 ( 0 0 0080,0<2  ,04 j>D@04   a>0p` ,04 0U>P23W 4Z0( 0P0,000SPH0 M L00SI0SD000i h0,0 0 90 000(000  i0 -0 00000PY (08O09/<>0 PhQPQ Q*:p `YXT]h ,0a P0S h^ 0$0h0 0  H*:p ` 7 0+8,e.+.&.C-`FtM0pSP^l =0SL=0S4=0S_=0S=0SG=0SH=0SI=0SJ=0Sx=0S`=0SH|=0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 tЍCL ( Gg=0SWCW@ L 48P Q< Q44.0 $b4004 0=0  tЍ3003 0<0300 0$3 0<0 0tS(` 0  00 ( (SH P0` 0SH P0` 0SH0\000 SH0`000S$H0d0S  0pP 00 (H" /  h0 P z R>0  H0L0  H0L0 ~ H0L0 w H0L0 p H0L0 pi H0L0  Xb H0L0@ @[ H0L0= (tЍCR !SH0000 0pG P d 9/0 00(040+yz{}~ X   &..,8,. x . ..../ //!/)/./ C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``50 0pp07/@-M0@0 3/P 0 00000 003/ލ@-`,MHP 8@0 0 0PP@00 RS THP pW |=P00P00P0,Ѝ @T@0/W/0  0J8H P00P0ꐹ%f0@-$M@D0X  0P 00 00a0PrH0Dd$Ѝ0.O-%,M@PV `@\q pXXP`L7p@3,p VV !R "2 V pP vP`!V$Ub$U p 0 f0 0000 0 0000% 0MaPP /,Ѝ 7/B/` 40C-S,MP80S,ЍS S S !S S z@P p萟```X 0 000  00000 0 00 0 0M`PBs T ` O-P(AM@0pP U ! `<#G0!(p<#<UP <NP &700 P DP )0<00P7X@10 p0 `@AB$A  !@pP‑00C  X!0-  4!0DP ` :P@!@3@:T -`|>T@D@`0@@< 0 0K-n>0 0@`0 Pf.㨠嬰p 00@` PWHzAߍ!00PRPN&,+v//l5O--0M 04`00 0A000 00```,]0S @8"P 0P40 0H03/0Sp0`P, p p0C@ 0Dp0p00닟`@0SuOP 1x'x0p(1@P ! B B2%":" ,0R B"*=, = 0 R80pP 0 Rp0x1Gx1p#0q000ЍQ \2 0@0D  V 0$ p0pC 0@D @00ZD 0S , S00000@1<0X ∡0L0 3/ 00X00=C0H048 <0 2$xU 0S T0 Pc0 000H0P0 F0_PT0S x3P 0S4 `Q00Q0S 0 L0aA3/P Ȑ0 0&003/f0F0P  !E 0 11( $0Y(00$0 S(0 0R0$(@0D 0@ 00 RD 0S8X>"a`" 0(0'0000 ꀒ  M 0y1x 0 dC0  0k1` 0,5 F0a1Ȑ 0 +0l01h 0 t0hp++ +   D [*pV 0 TcU 00l0 Tb0@ TbT0P0%0 Q030#Q0S ,0 A, 2F?ip 0$(&?0 0L 3/PL 0`P!Q.VP S(0 0K$0 Y(00B8p C 01/P 0 Q$HL Q>0$0 R 0S P P 0$003/0$a$,M$0pQ@-4tV #"T R0//@-(@T@Ѝ0 0 0003/@PE'/@-|MPP@" @a1!@p@P  *0@T@pT 0 @p|ЍT0| dp0p p3ZP T D  ش,>1BhG1V1 ,l1P1x1p,11/@-] @1d ///@-0@Q0T˺@o?0 \ 0P000@-4M@0  /P0PU,0U 000 00 0B4Ѝ0 ,//A-pሀP@`VT0S0S -PH0P$1U,0U0 00X0`p@P1 ,0SR00/p@-@P*<0<`P" 6D0# A0$!p8,,A-`8P@,pP( ' A,@-0@-AM a/0p S0S XT@P00PU 88 0, Aߍ0]^, 11 21G-`1!MP@11P|!M/  ppqpq{l+`PdLt i/ H 0[㺹!ލ  @P q[>* C'@P 0=S* !>A@>@}T@  P p0 P L <  53a([K02,+2$2221s@-P1@-h`11PX M/  L L P D e 00 eЍp,3M2W2o222p@-M00-0000`0P06@P @T 1X 1T1D 1 SP1 1 Ѝp256$0 @- mP +C-`CM P@ `Q.[P pܐ܀0` 0`0S1 1 Cߍ5S  Jt tP\ ``\0S H <10 1,2 ,6[*,23383U3G5QԸp@-P@1 1  pL%,17@-@Pf@b0  Ѝ0@[v3p@-P@᰸P $~11P . p321p@-@P|1(1 fP1.1 p3@-醸@W3G-M@,p-T+Rr尒@`T5 TH Tol20$0@TPt"tt0PB`pPp0Sh Sb  @- 0 0`P@MP2 0PP ލP ʿ:P !080 0)P !0x1X 0 , (, X020 ( ៿X0101L0d,b,0!0^P P0M?0P0@; E;   & 0F 0 0 p000  @ᱱ+$%8,3L%, ,,[*,<,/33,A427 43 ,,- - EA-P$p3a@P-@T ( "äP( 0 4P 0 ᩾t P $@oЍW``/kX ᒾ1< 0ȿa4q$,q4$545K4445h//B{O-04pn@T Ѝ@T@T( ^& P@ U [Y  [ XY P{ UPE P P$@ @$0"/\+,O-4MpZ (%t,P@ P @R000f 000V0 0w'0 V0 n'V1!U@0P@0 0 000 0 U0 00Q0#02S4Ѝ;0 0Z   R% S  P@0     0P @V0V0 ''V1!U@0P@ RM RJ RG  R ࠡ࠳$( , [Q$[3UU [ 0Z0P@V0V0 &V1!U@0P 0@ U00U Q Q 0   +0@-4MP!! 0 P P P@4Ѝ0@/@-@ @訽B5p@-P@/AP `@ H{#0P P `Ra BQQ pQQ 0@S:p @-H◹0RH #@-]#0@-@P4M0SP!1P4Ѝ0 P*  P +0R0#@"*S Q 0Rd+,p@-0@ ^T00PUPU' \$ST ^/p 2@Q^U@.P@ @$ $ 0 00C 0p0 R5p@-,@P*0P ;pA-@H`HPpFRT0ԗ@0"T01 PS茒@, 00S@- /@,,C-ẋ(pX,`0@P( 0 XWaV V T0   G ЍАYĐY R  U:0V @ "@T0  &55i'n'@-@P 0  z@w550@-@0S~h 0T0"S D0 <00R( T4 0@,\+,`+,G-Pሑ`0S.p@Q 0Q02@1;1':X 4DpB 2 SBpPTPRTP  R T R0S0T0S @0000(Q $~& Q 0S T v! 0@1 00 0R"01d+,up@-P@mP000p1O-@0pS`P  0PQQQS SK0UȰС0r 0 $R 0 0"60(Q $ &0, 1QX#  E vQ 0!0  R [ R @R L0L L R# Ѝ 0W1Q:P @,55p@-PL@0Ss!U @ p(0"E0P054 3050 0(2#p@,\+,`+,40@-@0SYDP0@Е@,A-`Q@0SG!V P p0 ST  4V(Ѝ0=PP 0P4p0@00 (d 0`p㢹L p P@ `0ᘹ0('p(0,0P@,`+,\+,.m86|1A-`0pS@P 0 PQQD R<0 n(2  0 r!Rv?000 ( 0RU$0X3,000 1Q\RP 0 00  W1Q:P0@,K@- @00S T $卲@Ѝ7@nX0O-SMM2"ׄ\0@S2"`0S2"bd0S2x"h0S2\"|H 1 0SX8 80R\ , I0pQSPPTPy  @@ɹ`P. @  \00`0d  00h X 뜱;S/ʐ/!@0;P@_oRݍЍ RQ8 R  0:S 000a 1 00 0 j0 0C0 ^;0CS||WPp@6֒5X6q66666q$66 7#747f7v7%?7W7<7p@-@XP0Sz Q0 >q   R@Cpd+,O--BM MpX\0;@P 0` ;( `pP^\0 ⠭P V@Bލ ЍQ   d 000 0 00u$0!`4X00 v`$00 00; S PbP +RQ 0P \Q S0Rʦ0S R6 S 1 S S"0S000000 000000#P 0S   0 R$ ? ! 0$ S0S 0$ `edA7O-$p6# S0 ! P`;+[0!p0 d00`0\ h0|00 X00 P$`P`l0(08 H⒴000 00 00p;6@-`X0S0 g΂\0@S0 h`0S0| id0St0` jh0S\0D kpP0 U &Q Ѝ@6ؓ5X6q666{O-TM0(0 0,00$0040 0{P{ @p{00@{s40PX^ TЍ@`DP S S !H0401R < 80 80< 1#4 0@\D0 0L R0HL0( H0LR, @ D`(`,^  ( (0 p S `S(0q0S( (  pQ ʔ10Q02p1;1':X t庯$0ž0\CPWPSWP 0S0W0S0G?o2\0S p2 `$(0 (0(Q $![  0S G vV00p1 0$ 0 0 0S  0"ıR0S 0$ MB"01d+,uO-M00D@TЍpܠܰP`@D0SW0@    0 0 `1/Y  S      Q R  0@000Q0 0`p1/P l+,A-Pp@`0S  R 8p0 S7/P 0403/P 0D03/P0403/A-ぴPp`@1S 3/P P`VUd0PiT0P0S@000S4000S(0000A螶h+,l+,p@-@4`4P0Sp@莶10S 3/@l+,h+,0 @\ \ P0000S/000 0#0/0@0/p@-P8@q 0X0S 3/0P  P  01 00080sp `^4Q Q0 0`40$ Rp `083/< 0 2 `P   ‚ 0S0P000ll 00//00/00/00/10/Q@-@@L 0A0003/P@g  @ C-`BGM0pSP;0 0S0Sڭ 0Shӭ0SP̭0S_ŭ0S徭0S00$ R"000< R&0pG 8d 9/0 0(0 ` 嘭 |0)( 猭0SWY Y Y Z \Z Q 00000 0\0 gGߍ0000 0L00000 0Sl0 0:0 Q0 ,yz{.f,8,.G-pPM 0S1 %ߍ08 L03/P H0 8 L00S4A 0S 0 0 0000 0P@T 4/H1@ 0  0` 0`hA0 R Z/00 0 Th0:/P h00S0V0S ZZ? V F 3L"? 0!CZ? fh0 010@0`&F(,8,7O-MP塬0@坬0` P8 `(b(0  000 up!@ 000 g!ȁP00p@k 2@p@Rtl@l[  \!0 fR  8!`0ֲ(H$! 0pͲ0 R   P Ѝ 0p!+0i `Ⱳ ` p OT0 0 p@- Y NT R ` @&,8,.E(,777I,70A-@\0P3/ pW@@P@`ᣲP80BW  \W[0 V    ! 0  0 1  |   p  "d , 000SJCT L0L LL~H0D@,kj 0b oV 7y"8m s@-@,`P傳01Ѝp,0p@-0M0P,03/ , 7, 0@ S:000 00 00 0 Ԩp` ᡥ0A0J0Ѝp0l 8W O-P-M@4( PЍ PP 0   <   `@V0H03/0S`pPI`pB 00, ͱPP x, 0 S!n?2\I0C 00000 0A000d3孨޲0S 6(00P L0 3/P X0P`Tp`\0p0 S8㋱P[ 80 S (, 0( S001w40P ≡0L0 3/0 0P0 000000 060 00 0]p`ٰ@&ᠦѰ0S @, 0H03/p,T@8@0 0S001Ѝx%$,8,W U @-@80q0  003/P3 04ЍP2 0@-@0GM00@3/PP$0SP  u`p0 000 `0p0S 00@03/PPPGߍ/A-xM@`D 4P0l00$pp0Ph@P3 tP 0h$0\ \+T „P 0X*08 L03/> 010100 060 00 0埥pP& 0eߥp0S 0h 0Q*08 @,04/P,qP 0p00 0S001xЍx%e %W U 0O-@-lM0$3/0H03/20PqTW0pZyP`U0 ``ApP 0(3/P\ LU"##$ 0H00 40R! H 3/080 L3/p@ 08 L03/PP9 0 R6  #1//L"P#0X 80T3/L0 083/p 0倰$0Y 0㙮.8($  pP `;/P PlЍ$,5O-P0MS J?0SZU 0S\5\%\\y`VM L%@T dO4u45@d  0$50 505 0F000000q0@@埤p`)0Ĥ8 @p!,0`$0`4!0 (`40 0,0000 000 _0$100$10\\0d00h0@ 0l0`po00S<p0  ePÁx ,p3 000000 000 0  0<0p&p`  3d,0il0S= S@: SN@`$P H3/P 0p0072|0 00p L03/P '0 00S 00CS@` 0ST 8Ѧ@P$2Q ZЍ @P00SZ 3/@@OoBS h0&00V 10@!R|!@!x|pPpt|t0S|0X*@F@P TQ 0!@x 0T:x0S@ ͣt@OoBU@|0xT:@$,a8""8<,,Z \ R&08V W h+,W ol V ,y8>O-Sh- 0:\4UM@08 p D 匬P ᇬ`Pḭ Uߍ{0P P ,0Uᨭ᦭,30 00S 0RD 80S:(1SK 1400J ,HLAP4#0A4  H@4#; $s別< 儥< @0P=P11@T 2"B ,04 P0S 3/P|20 SU0%0c@D0ps `2RR1Y N JH@pZE(HD! @<# PpT@3P p N@ K0H00@ @040Ū @ᶩ <   0 嫩 10 墩&40P1: 1 !  \w @0 000000 00000 0Xpp D%D0S, 5#7Q[T Y Ĭ¬,徬w ᇢ䷬fh+,l+,&j8(W i83"8G-pJMM/0`@ 0 ppPPP+\P) Y0S% Ut"`0!`!` p//0P T 0CT *0C/Q 00PQ@-m+N P:F?0  xP+0: S `V7>00 PJ>00C0/S@!0Ӫ+ S ǟP+  P*P 0/S`0oo`bS FpC & 0 PV|+e P*+_ P*ŸP@@]ỞJލЍ0n80BhI@-(@-M @P(0 : ㉞@P ~ P ꒞ "88S 00b"!4b4#$("(RSЍ O-p-M P]@P` WȐȠȰP` 0PVЍ R  q0P:0*  TFpP P W` 0  巬 ty988),G-Mx\ `P`P PP<K+Cs@P@?  0ኬ@ [Q@P +J!J.0m+JJ.X0^TX WPP~D4 NPPu$+JJ.0>PPe+J J;` 'PPN+㈁刑PJhp0 0J>mP 0. P UT ލ͞P@Y+JJ̞PP|pJ.@0+ ثP h lJ>ѫPR 88888 9829_9>9Q9#^9o9n9%8%899p0&9/00/00/00/00/0@-4M@0#|0$P 0TP` P0T0760 PW P @+<4Ѝ08,',,O-MAAd2(0!P0B(0 0000m 80sS0`p(00$00 0?00$0 s 0$W h5 0\%X500L%`⛨0,0W45 # 500 0`00P0 00倢W D4`D 0S_ @X%SYeP X:000`@ @`@0S 80< 03/P0p80<P DЍpv'80s D@0 0 0Q:8`0S}0` L0$3/$P & [P Tp|Gork 0$ Wt @3P3 y0 D Q%0C?o2000;00H03/WH0L C   a& 0X` 0W 1!`00;000Q!|  (P R`q02;0H0@20Lp,!<1H0"``,P R0$ 00 00S P V[0꒘ 40P+ 40S|p , S,0p  08q ^ Q  Q0 0 0 , p0㓒"000;0, 00^00 `00 (0 0 R 0 0!00S {`(0`Spp8,&3:,0%$,+BhG-QM|0`Sxpp 00 0 P  "  "  0@T0P S"TPu@"&0P@@@,0S\|X@T"(0@"#r4"P@&0 001 0Q!00( XT嵴XP!0(ަP@0p00+0@080s 0=0 |0 =T (XЍPU PP@@P ()$!X@0(ᮦ 0 h000X@0 400t0S00XTf00P0 00X@0x (ᅦ@l @8q 3/P8,::aD:.3:P:A:I:0@-)@M00 p\*3 +ʟ ,ǟ 0 PXM*㽟X [-㶟 F 0:.㬟0  01Ѝ0!0P8q0 S+P ,㑟P Xi qa,H_:@, A- @"(0M( l0PQ2X1200500@10<1 081,01000,1800$ P$p 0@`PUp 0S0p\'Pp,P(FAᡜ(F@0Ѝ0`0 PCp0 L03/P 00P 0p0 PUp0` H` Д O-4P`pp00W)ZYp !!pPR 0p  0 @ p0Q 0S   00,0 84 $0T0 0X01@G$, R,R P Q   P8q008TPR40  R RP  P Z0000 Ѝpt2O-M04p@$-P`RPP $0 S{n?2@|x 1 0100 0A00000ܛ@l嫘l%Vx0ST(qPPM p0(P噑!1Pf0P(0A x 0`R b ",0x  B   000 8ԣP0h l吾(0, 040x0?o21000Ѝ0~\Yl$, o O-pᨁ娑娡,M@0 S0 0000 /00O0S,Ѝ/S  }/00P`pU0(`P p㘁!PP PP%0(` 1`S O0 `40T 0 ,0X08`á0100+ P 0 0壝 jPዥ`<,QvO-p\M@P4 `儰0 SpU  0  Q $0S  0 0$ p#P$9\ЍO*. P0:0pQ ",^T ^ 08  `00000Y(0S`l ` 0 RH03/0p``0[ 80s  P!\00000 SPU0$U00[P 0RP  0  p0P0   RP P 0$U$p0p[PP00[}p P 0PQp0[x?[00S' q !P0!:0p00 0RP  0 1!ƒ \ 0 0PpX0 0S( E 0R 0r  0 !0 SP0 0PU pСZ050Z0* Z%Q Qp 0S S0 0 0Q0000 00000000 \Ѝp  0 ,4pP80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S yP 0 0 0 , R 0S 1 `R <$ P` $ P 0 Q0``T R T  R X `( 0S0( L03/P <00S D0SS000(( vL0( 3/P 80<00S (0, S004 Q00( `sT0\qAQq0[[m8qiP U ^[p8|Sʜ0 :0 F[p㜀 SS 8q 0PUp0pp R 0S  0  0p @ 01 2 0,$,0,(Bh+O-@-M`,p4 00PVY p༡pPT Pp0Z:`PU`J6ERUA 6&Km00#h R 0  80s0`F`pHU p  h0S 00  80spHY pPp  h0 0l0L03/, 00Y:pPp团p0b0P805ЍOp0H03/,08$ $( 0RPP$P(0<00W]:< R3*,0pp0PP UP`p0$0$ PS(0Y (0$ $2", 0 Sn@DS g0S 0 8P`p0V`:40S00004000,0(X~$0( 0c1!$08` 0@<00< R:8`ppLp < p00<<* `8q ,0,( 0L03/0 00 0`VV0$0$ S(0 (0$ $2",P p0a  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0Pr0H03/u8P0@0p0D00[p*p 0<0 `80s^00[ <0 0RU40@ RDp0  0H3/PA $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/00  000 80W 0 >  1!7400000Pm۶t:3]:,0 04 Q000Pp`,0 0U=:8廟  0$ $ 0S 0 p0p SUps`P p b"P0RTp YT Ye:PpW 00U0#Sw p`Ѝ #"08,0,0 L03/P p开8 Q 08y\ X W 8P@DH P0   8 rp08Hp0!8p 40X 00 0S 0P*` p |80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPx 00 80sh p QPop@-@P(M;(0S⿝(`,`{000P 0F0 0(PP` l P[P,(מ(P(Ѝp000 ,嚔(˞0,`(P, R ,O-phM)1$AS TP T(!0 "PPPЍ00> @ C 0 1/@P0$A Q 0 > 1/P@P 0U:0@!R( CP$ 00S H @3/X|$HLPbU X],0( 1/( ,0P, (0, (0;P0 L03/P 00S 0SPX003/PX70PH03/ 0! P5/P%$%$)@0 Q0TpYI@/Q P, (01/(0, Q 2"gX$Є  0/PP  0 Hp0  @D@儐 0Y80Y> APPm}Lb,0S 0P p@H H 8LP (08/P `  ` @(08P 4/00@D@H,p\ 0,QQTQ  @DPT QQ0p p@08L0P 3/P `00`00P80P 5/00P  P 0000000 0P 000$,<,&p408h h+, t ol Bh:D:m@-} 04M@Pp`#@0S $d0 L03/P 80< 0 ` 80< 8PWV`4Ѝ R00S 0 //O-`XP@ <b"080 0 c# p002    0 S R( 0S% p q' R Q0 2 T 0 p < k+800b"0p00S    $0!0R!/S01/@,0! /@,$1p@-S@ x1SP $003/p@ԛx1ћP$1 0SO-KMM@040`DpPH(00S >I @Q  0o- 0<0%"P{ 娻 K@T8p0 00U 0 00000@00 ,@@@@0ppK܍Ѝ(׍Q(0S*o< !80a&@@ꬒ o'O-`MxxM0@0pP,0 0S ( 0R> 9 H00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000 00嵐p`ލЍ,~,0S*< !,00C#X0S000C0C0000S0 0,0A$P@, o-@-@0  !<$10(10,1P001.@-@0 0! 0O-4M`@(0TX\d0hp`P 2"\ @ @,0;/,0P R7P ᒙF2PpC [p W 2 R "0  00 0(0 0 0`hᙚ(04ЍO/Pս4ЍU5p@-@Q-< X p P卒 0  P冒40 Pp倒<0h p@zPw80 P<q,0 P(k00 p!:"#:%&p@-PMV`@Y 1 Vh  @ | ( P PB0 =P9 3ލp`.00PS( 0` 40PlP80S80  V 0X0S,!┘@0 P\0 `0S ~@`d0Ph0Sڬ n@l0Sڄ d@tp0SD Z@PL`ȑt0P3;;567v9;(;:;X%=>?@-PAMV`@ᮑ  V( d D`qK0 @00S    8`V@勑 0 P僑0 ~Aߍ(0St  @d,0SL  @00S,  @7);*X%+(;-@-0AMP@0Q*l x  B q0`N   0S (0S  |  x,`VL "Aߍ8 q0`N   b 0S (0S  X  T,`VP $0 P 0 P0 Pt0 P0 PHݐ0 P4א 0 7.,;60S O-@MV M,Pm 0 0x R#p R0]娥娅qt8`  0@0S D` Pș ` ™PC H   pW00(0S%$B00,0S$$B0000Sڤ$$B0+ 0 t0B/すPDdp᭠x 00 0; Q <0 Sy0n0!$Ö B0#0 0=,0Sy0n0Ⳗ Br0# 00;8Q30#墖 Ba0x#0 ᝉ<0Sy0n0⒖ BQ( J 0 R $#⃖ BB 0 R "u B40x 7#0= 0Sڴ"e B$x 00 0=$0St"T B0 ᝉ(0S<"E B0x 7#0=00S"5 Bx 00 0=40S!$ B0 ᝉ80Sڈ! B0x 7#0;! H! B0000B/㟘pWxX0 0  @8 PQ+< 0 \x S0L@T܍ Ѝ/P),`;,w3;N;i;q;x;;;;;u0;2;;;;;;;; C-`RGM8 C"U0S1 ` ` ,}똣0p⇞ 0S    `,pYV "n$ D}`P 00" `12ލ@= 0   0S  "| `PV ( 0  "1 S !  N00S @0S"@ 2ލG<0040!0"0偔@0n$ 0DL03/00 Cp p q r0S !0 gLD` 0S " "p8`Y a0 x 0QW 8 <0RN  0 8 0 ".@+@墍 0  c R0Ul 0"  <f(<i *=7.3<9<G<wO<7@-x @+0 @0p04d㼭@ '|Y<@-@ @000(0,0000d㧭@ |ꐯb<p@-`xAJM0Psd!   0娊1SB lJߍpP@0 00 PP@z`(PVU@@ 0 (⛓0 0(0 00@0a(6P(6,P#n0`0PP`L%o./X%1p@-0aPM,0$0Ps@!  ( 0>$1 SPx X d p | (1PP$PЍp1  , ,0S$0޷`@VTPP 0 0(0 000 00P005P05X`@P`@@o<` @`@L%o@, X%   O-`4  ( H  ( L 0 P 000 PP 0/S  \!0@@ 0/S  ލp1?o21QUx1N0p,!@<1(0@`1?o21P 1?o2 1 1S 1SIOoVTPP 0 Ƒ0 00 00P0ጌI4PE4 1S 1Sp`JO 1S 1SP`KO 1S 1S0`N $,X%O-4MbPp@ᐏX Ȳ XZY  D p  d 0  l bP ׊ X @@04Ѝ<Ppʊ1PeS`# "1S "N !B @ b 尊 P0Pp妊1PeS` 㟊|0 1S  1SX!0 @ b< 1S 1S$1! @ b 1S 1S(1  @ b 1S 1S,1  @ b 1S 1S01L Ԑ @ b< @,fX.8,'X%O-0PQWMu01 `%0@ 0Vi40Sq 4000S4l`V$P |X003/$}1S}atd4x 002"+Q:  Q 5 0,$XwY/X({0.}1{.{ K#%1 0  &(18!X  X" R b㄁ eb/HZxXXP0}11P }1aS 0S`  1P11UTk p弲<W2f0S20S D 00D0Xb 00020S 2D00H02`L00P00 0000T0D010S D 00D0p` 2R!P0"t!  1X! 0 SL!0C 1ġWߍ 0 `2 0p0 0 0)1S080H$0X80`$P8 0 S5L0X 3/P h$ V `V 00%$1/`,@,i<P),`;, 88 , ,%,|d;,(%,t t t0S _P V 0S0q001 000C 0" $!   8 0X L03/P ht0S 0_Sʚ 0  0" 00080 LG-0ĠĐ(MpP@0 T㤳(Ѝ 0 ^  ^ 0S0 @`EP aV@@z,C-4M@T2P!`pPP 0TL0 3/P  Q000T0SX0`pS@,YT $0Sb S L L0S004Ѝ0CS@D&4$( ,@;,+30S/O-@SMP 0p#00x\{`P HH ^@3P ( W  d  000 [X,pP0S* XZ'0 RPP Tq 0 x0.0I1P/S <(⬋0(0 00FV0SvU `P  ( 0S `P $ 0 SX2vU Z xY $1 0V7! 0l!  0pH1@!Q$1S  0Q p $ ㌏'pR ハ00!15:% p wP p Q 0, ($! p h$ cP]0 0 8a4Q101S/T),;,,Bh8&=Q9]==0S@0@-S@00 0S/;, O-0زEM 02@PT PP0 2P  h|1S# $P| 003/P \2PX @Eߍ$0 R P 01/0P 003/P A10SV aPD  <0 040000,00800 َpPP2@0S- $P* 0 x0D 0G>y>>>$1S/p@-@ PPx1`S x1xAfPpۋPxp0@-\M@P, ($1 00T0@000 0000(00$ $0$P$@\Ѝ0;,,    @-08 S  (0 0 0Ѝ;,,    10@-2cA80!0CSM PU 1S 3 'P; 01l1Ph1P \ 88 0 BR X  d ~ 0  00 0 0 0  00 0 0 Ѝ0 0  00 0 0000 00000h00d d0d@,$,,>;,T \ $ ;, t x d;, 8 @ ;, ؽ A-PM@L d`PD2P0S% 4 PP 2 00 BP P<  4 "0 0!Pⴊ sH0QЍ10S.  PP(q000C` R  R41$0 000"x8` P08/0 !0 00P`0|m V00S.  PP(000AC, \ \ !̓0P^ X^ ,0 S` $0PK ">SP,%, ;,>T),ݍ;,!(%,+;,>A-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R(p1@l1@T@0SP.H1D1^0P@@T @ T7 @pW4dpW1V 82# @ R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0,%,;,(%,;,P),`;,\0p@-T00P DPPp0AS@  1SA ,$,,0@-P$4M0@L0 3/P T0  P   R4Ѝ0 ^@ ^T  RR""p+,p0\ Q0/\P  ^U Q0000@-p+,O-GM0M40d2@`TL2 00V 0 0000000@@@@ h~0p@c<   G܍Ѝ$1SpA08 L03/P H0Z Z ZT0S p$ 0ST0S8 P P0  K,0h 0 t0`@W 47 4U|4 VH0G, <0," B,o @,0@-DMP@T P08 @\0 D@  d  0 0DЍ00S@,0@-@DMP/ P0, P\0 P  T  0 R X  0S0000000 0DЍ000S@,p@-@Q@M`P<B@P  T0 0SP@Ѝp@t0@00 D0YU@Ѝp@,17@-@SW  d      Ѝ0!{P4PNP<<0HP0<0AP0<0;P0<04P3P<0 S, 0<0(P<0 S@  0"l{080#f{0,0$`{000$,=4@-@PD x , t 0 p 4 l 08 U,0<    0 0x` 6/Ѝp@IЍp^F$J@-@$P04ML0` p3/P $1 0803/P $ 0@`0 P4/4Ѝ/0@-|M@8 P J0 $V< B <U< ܯ0$#P0 |! ٫|Ѝ0$,[80@-S`4M@Pc00 0P 003/00$1U Ut  4ЍS0  000 xp0 7/( (0㜉 i'+ ?&p@-00MPQ0@$ 00x` 6/< }`Px17x1a1S0C€10Ѝp?p@-@<P P $ bPp0S@}p P OPp0S 4! B! P  :Pp0Sp P R P0 &< !Ppp %?ݍ5?+E?S?h?O-uM M4p Z-eH0cS_ Cڪ0SSyB0S 〆PBؒ0SyȲB0Sy2 P    P 2     PT2 LH   @  P00002 @@K @xP@ PHPP< ,h@ ,D@51 0101010R0 0K000PP0 `|p@  P3y} 0S10$1S10 0Suݍ ЍP`HPj߅Pi1S |!R |tGP L%@,(%,;,T),;,,%,;,P),`;,;,;,;,d;,;, d $,,Z@-(00S P  Ѝ ЍX),?@-@PЍp$QU 0 `P > PP C 0 1/0P $1$00 HL Q>$,80S 0 @-Q/Zj̗m ?G-`ᔐ唠@PX0r2%S80S00 00 S80S0|1 P S$1S00 0OJp@-8M`8 @ T P $QV$00S U  0|1 08ЍpP ?P P Q i P + s P @,A-M|8 PU`ЍEP $A003/0 R   01/`P 003/@P$a0H03/0 `pXM@080 3/PDG 0!!0#`'  03/P"0#"#0 03/p 0` L03/<p p` 0SXpH'  !0|1 01!P0<0S P L3/00 L03/P @0D t0Rv`p00 L03/P @0D t0R 4 d00`RP  w00p 0Sw`X@,Zjڗ ?O-RMhbP  a @PH@<  VPpߍP(  ypp0S  j<08 (00,0 0000400!4 04$0D0(0 P KfVph &q 0 p HW <CW 0?W $;W 7W  9yp 3yp   xp 8p?pq8SژPr   00**0@0R  0* *=d@edATluzd@A-CMMPPp`;8 6p@P  0P;PbwU00 ## CލЍ /O-T 0 o 1!^ 0࠱ ^0.0  ^࠱X p 0000 @00R00000 ^ 0(00R0#02S<Ѝ\ 00$00 S00)0R $X' S    0 ` 0T0T 0  1!^ 0࠱ 00S 0 84p< P ,04 WR,[6^ ^ [! 0 S000T0T 0  1!^ 00࠱ ^ 00^ R pR0؀0@-4MP!! 0 P P P@4Ѝ000P/S 0/D0S D/0- 0S^ 0@0P00@0$^ (( P@  @ \/A-`@@

@? 80R*@-0M@"P0 0! 0!  P0Ѝ/A-Pd`0SU@ @T@p  P@<`P pW@P,S@-@P ' d=P  Ѝ<2P (`P (PP )0P` P P(  P` D|PppKPP 0SP` P `P @00@0S@Z@`@f@n@t@{@^0@-M  㟀Pڔ| P p@tP|PЍ0K0S  (0f@@-M0 0x 0@S|( 0PXwT x@08&~8  P 0  IЍfmM?@-y0SЍ@-M@ yT0  CR$00SЍqA-@lP0ST 0S` @?4P7 #P.0'% D0S(0 D (zd0{S  0 ( 0 0{ ~@00#@#000@4(0 0 0{~d@@@@GAgA@,AAIA`_Ap@-@P} # #0S S b}尕00 00$00(00,00p@-MO0`0QЍ S 00W@0Ku ##0$P (0Vp s P0W D @0W  kW0S U0ąA-P@\^ 0  `04pX T u0p04 4`X \^  R  0  `04pX ^S@-Pp`lM8V00 0! (! 0 &PV$8 80R:V t#@RD$ͱ`{@PV008P|0 00$00sP 0   080 0 0$ <0S $ 0$ lЍ00000S S   0uAA-`0Pp@ TR:?o2R0S%0   @ T000P0 04 Q\* zPW000 n0 0004P 08000 <0S $0R 0$ A 8< Q\00, \/0p@-@0PS\ UR00p0PU 0P0000 04P 080C 0 0<$ 0 0$ p{A@-@ 0S PO--UM M00 5%F50S5%  P|PP Uލ Ѝ5 %:@0Y|PHRz@P T@x0 $08<0(40PP$xPD 0 ` pX0,DFGP 000 0SX]PD0(00040(0<00a@08`0S XU D 0   z0U0Q0SpPX X X0S  X X rz` lz0P,0 XP(00W80400<0tXP0 000$0,0S @ XPcXyPP @z 0S$00)zI` D0pp0<00008``#004S``V Pp0p`00S00PP 0P0 0C50   0! 00$0080 0<0$0500D0V/;`50PpUH HPLPnP P`0HxL`PH-zTm0S 4 R 000 0#ᷯ0P 0S Òᝯ뼀8 0<$ 0S P 0$ 08000S`H nP`T0S0P 040 Q\8<0 Q\   (P`?B?H%,JBSBP,eB'7''-|d@-< 0P 0PH%,X),-,M0$00 0 00 00 00 00 0 00000000 x,Ѝd*7@-@ P00>0 080 0200 0 0 0P  S Ѝ0C-M@pP ` 0 00000 0 00sS̀@ P0㓔$ p0lS|p@ ݮP0㓄$ p Ѝ@T r@TplG-pP8M(@ 0S   wP8Ѝ70 060050040030020 0100000.00,0  P #00R R 0S T `JPP0c# BXP*lp@-PP@M <@` @ `  5/V@@ЍplO-M8`@ SFf* "R]  BR^rq/P X" 8CRC@- Q1`0d1@@Q`q4Ѝ?BnC>p@-@tP0S0SX DR00T0SR$D0 p"@ pd,<,08S^/L,U,p@- @ 0(  P0R0PS 00S:i ppC-NMM@<ЀP`u 0 @ @ @``o@; @咨PPD Aepcc NލЍ@ydG-xM` ✠堐@p"P@J!0@P 0S PU 0 R<\1\!\\7;00S 00" !PP0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍZ Z Yd   pZY < o @( o(PPCh C?`;"A-P`@(P0 p P  ^ R Tl000 L"Ġ "Ƞ", #$ 0 #(#<00 0 << 0,O-`BM Mp@P/0;( @幧pP@0 Z@*0j0 #;$  j P!14"S; Wbxo@ U01U01Bލ Ѝ 0mP 000 0kj RZ0 0J$,$$0 0o 0 RZ 0oS 1 SR 1S  RS1S1S `2?B冏@0Q E0STE 0"0S@0S@@`nP9 Pn 04 8 < QR@ Q  "r" " Q|  2!  "Q RQ" 0埤밇 劤 00N LURX@-04MHpL` L1L!LL9Pn@P* T00ᐇ 0R0 !?020 20,P000204 po@4Ѝ 0S" $0Q00 L03/P P P003/?B|C>A-P2uSvw_10000“b\œҁ@FL@$H @A- P@ \T@@ 8ž\ @T8f `Č `Ȍ `̌b` ` p PČpȌ`" " 0`q`1~``Pa n00`T08BGP08}?0@ T\ Qp`82S40 @0 8lŽ~?`?̌p0hx0R @Q2T0S X 22040TP 2SXbCO-P`@p\M(}4000PS2 0\  \^T 0SQQX W@\Ѝfb(0,F 06!!S 0(0,0 P PQTU Q8b0 RW(4 0 P Z P\ T 0ZbV0V0Z 21 SR 00(,`80400Q!`00 $0rq? 00((2@ 2S 01 $  0hPMW30M@2S P  SR q? r?Ⰰsό(0 8 0 R    X 0P@TP@@ 0S$2$"$i02#38( R,00W? vLe< 00 (0$0尰S4 ( 00q?0" 2o0,@4@@P# 80  02 S02@0S qSP m@]D0S 1H R0!0Sq?r0 8 S 0o s, ( ^\  Rx0 N7"0o~ς,ఀpȌ Q 0C0Ʊ#80±W,0CCZjTLlCO-40M@`p0PV00PT8T(TT7bPV@8:Ѝ}  P 0 "UࠓࠃR^PR\ "ς~Ⱀ, 4  0S 0Z000[ 00S 0PSVX7 00" 00000 S00 0$0 0$ 0(00S0( 0 0<0 0< @000,0@ 0000, $0S(00 08BV6u? v?( R BT@240r/q?0840s80 0(8  R    T R,08 S000f0D0jD0P7V50Qo_P0"Pyh0S SP kh+8 @UU 0 o?0 R S+ RQ  0^/o_ S㴒P!% 0 8,0 S0000IY0X0\04024 0P*h0S PS kh܃B I $)<1! R02 0C00"@P0 ^(T0^X0\0Ph0S SP Zkh娃0T2S2Z 00jPR?" 01@22]UV 02w?0"S0 L    L H0H0P LY0H0PSB 0D  $1!R0 P TP XT\ 0 S 0SX0\04"o0P|h0S A<SP jh-<PR#38H0 41HP2S 02#38S0Ro_PPUPo/ @T \ `TV R \ Qwτ0 8\ 0$00(0{, R0 V00/7DCND,ULO-dM∐@Y`p 0P 40 PP<Y dЍ003/00S 0( 8"V0 2P0 4  0 P!P "0#"#0 D00 xP 00SY0 0 #1/P0(@#R 0P 0"P25/  # @1/0h,O- Q-aM M:0@ 00/;㊡`PPaލ Ѝ 3^p H6*P:0@ ~r,'W 2S 1S<2<"<<@4u0   &      0S!?⧻t  0 d T 9 dPTRUa\L&HRQ  0 1Z!*??  @~0Y!)? 0? gpP  c?XT D , cJi?X T Pd@ZjCUs@-RU0 3@`d0T `Š P";0H0 `04 oЍpDƟ CDs@-@P04P00 u3o0S  `VRUp [0P 003/8_ohVhЍp@h?؟k Cp@-@0AMP 003/00; \pP   g`P N[h[AލpO-p0\M0SQ `sa8Q0 P?g P0,b 0@>S@0 P.g P0b 0@SP0 0HL R ?  w ?t/Z[\ P @10`d ἐ 09/0P@\ЍX%$,G-p0@PHL` R0418S ^ @Z R  0\ 6X0?Pࠡ࠱000^ 0 G/$,>00@-M 410@810!Q`0 P00 0LPU`0 I0PU ! 5/᜸Ѝ0$, ,@- jI3\@ Z@-{  0fge&dF%@-@@0sZ,00p c0Co蘛%,,-?$M0 0  [$Ѝ-4M0 00 000zP4ЍO-p-MM [ " @[4 `0 P`0p PU(0 0CSPU"R0*P(ğbD0S 0s 0SMߍ0S P 0c30S #1e#S006ы0 A'J`# A0i{ {JOdTd@0e03 3R - BP  Q BRڒ"B 0"  i"2eŸ 0 R#3SPmS010000 l"ie 0 S$0(00SZP=9 =:vk{1 AP09࠳w A { Q챾 P  # 3^   ŠRˌ!531d10 0;#;, "5 0!00`!i Ie,1 @P0&00 RdP*!."%+0! U6  e@0S00d e@0 00p X Y@.A@,8, ,P,(,,,0,Q&`E ,,@~a&7P0 P Y0  ASH0 A k{I{7{ZU 0P |   d`~|fP<㝛00<@~0 d@   d@-@o@QRG-PP @ R700Lp`P:X:00X 0dPm@-Pp@`P0S -S :S S 000`  0 P00 ЍU0S00T   LPꐹ%p@-P`^Xp@  RXPjXV@@700pp@-P 4`FXp@  XPRX@p@-M@ Yp$ ЍA-`p@T/  P PP*JP. @P0 @ R R0 RR00#R0;R0S Q \Q  "Q0# #Q S 0Ѝ0pC B 0 @-3M M xp 3ݍ ЍBhp@-P @@/YpPppA-@Pp p` j 0W0 t0WpX U`0\0P P  0H 0hcЍU0 0  g&__$_0n@-`0tM0FP?o2p@ pX XpWX@tЍWp p2SXp D0V4 - Xp"Wp0 p@- @ p0 S " 0PUPUp@}d0 S  0 0S rdpd0S   0 0S ddbdG0@- @  "W@0@-MP@ 0     Vp||XЍ00 S   000 00P0 PS0  Y p;A_GC-M0Mp@PU `0S@PE8  0P00'ۍЍX700S @ Q@BPE@C000 p 0S 0#S u@UX GK_]_o_@-M< @  rV0S\ۍ p@-@$`PeaPp0 @ `P0 002 0pp@-pMj0P` 0aVp@& OVp!  IVp CVp  =Vp  0P <  p(pЍpt .VG  p@->@P`yppH 0s 40 lp  0f pġp@-P"R q@ d U01p@@@dq T U02p@px0@-tM0 p@ 7 UpPU@tЍ0C-QM M700ۍ Ѝ  Y0+` @V jU@pP`A-`R000Pp@STa@PT  Q*R@00 S   0 0S0 S *aP `bb 0000``0` @ 0@ @-@ @G Gp0@-M0@M0$+p Ѝ ] H{_p@-P@ `S 0x8 , ?U\( 0 0 008 , @1pp@ _r_p@-`D1P:D11S0p0@Tp 0S  00:00T1p@-S@\1S#l1S.RU9tRUpxbV:tatbp1CaT10CT1T1XSa0X11Ca\10C\1\1`Sa0`11Cal10Cl1l1pSa0p12,P0C2bVabx2,P0Cx27@-@0 PP! P1 0L18@@ @   (   )    ,  Ѝ0@ Ѝ0b@- @8TP p k00d @J 1S_70sa'_P 010 @ !H0@1/@-@`'L0S : P 080H0S S@'__0x!@-RM@ Q|x0 )+ Ѝx1S_0@-80@@N@ P@- @SP p 004' @ Q 0 @& 2H-MM0+ Sp06S , ۍЍ;04@  CH%ap@- B@Sp  PSp@ P 11P p1@ R  &lQPEUQ T`00CS`0X `0( p@X0 X THh%%@-@T 0S h@C-MP`HQ.0$ :0 0 0100 & 00 0sD00-PQ 0a(!"4a#   0 >Q & Pp W  g 080 P040Ѝ 0b"!4b4# 0 0S %/%p0p@-8P`J04  :0 DH0 P@p@P@  @Tp@p@-@QDA$:01`%p4*0  HPTJ4*0 `VT0: I0 ppps@-@7 @1 ` l!1P DQR0$ L Ѝp@%P P 1  p Ѝp@ PU%P P0pPЍp@ 0F@1)#90 -1S S _ 040Rp\ @149@1 4KR041 Ѝp_G__t `%E_p@-@d @11P`PUp@0 0S%P4@1p@uJ_p0@-SLM@P 0$M0@(p\ 00 p0 `P  LЍUtP @ tT  vU`  P10L1#H/`A`@-@MPP` p` 0R  p g0 0 VU  Ѝ@:<ЍY``0P!LA-@`x0 P  ЍA , 00  ` 0  01PU 0! 0SHP ЍA-ET 0S 80 ړP P  Ѝ```A-(M@`k P-H`$pc PD 0Sr PPUn 0 8PU,P c :Ep(ЍA$dW `$X;080SI $0P   A p.0S \ U6 A(ЍA U. 0S V ) L0S p`MP q,p R\P 0S Le; 0S )<I$(ЍA&(Ѝ``a_`Ha7a0 0@-@ 0PHH0S$ `@n H0p@-S`@P 08PU $00P   @1 08006? $0080S  p, Ax p p@H@-@M@O-p@찟P`T(  P 0S!W 0 8Ќ# } 0@ X(00U0X0S @HX   ` La@-M@aDqa0@ 8PP_ p0 P 4 OphhnЍP& P P' P, 8kP5 P!5!.P@1 0 P P` XL!d10B0P1]t tLHmp\ PʦIA_aaahaXaaaxaaaaaaa @-@4Op X00D1 ЍP 0\ IaA-` 0S0 00@p*TAPP8 0S,p`p`\P/IqA-`@  @P|00Ѝ 0S  m%0 S   0` 0 8 pPd` @P S`00P@c\  PP 0S 9$0$0> > >0S **V  0S S`0 S   0001  @  0S LBP0 S   0#b:bAICbYbC-MM0000!@0Op00%́P+ NP`pQv07S 0 S W \00d!h1`P1 ލЍP  P" R؀ؐPU [  0 S   0  pP 0 P1p  P  0S 0 PXImb|bbdD@-@+pi07S@db0 S ^0VS@lIA-`R@M@p PP U H70 0@ЍAsP"R 0S 0 Gr>XU$  *⁐P 0S <0 *. p \. <0$ <%V>P  *@ЍAm@Ѝ~Ibc cO-P@MpP   P 085 ЍO+P4 `001x@Tx  |MP1L@T@11@1Ѝ$@P000 @@T X@P`@   ` 0 00V`t`JZX3`#`\3@``\,#,3pd @11@1kQ NQ@ 6Q`4Q`UQpQ xQ nQ 0S0 0 @| 0 jP 0  X S B p 0 0S@h0 0 X S  + p@11@1v 0 9P  0 `` 00b : 0( @10S 0@69P 0S 08  * 0000ST 00S W0P 0S 0000S#0000C0 0'=cGcMc]c%mcvccJ@->@T( "44p P`0 "@"44 0W R?L L0 b"!4b4# 0@> *>@D Ѝ耼x1p@-SMPD<"`%@P/ T0x18"V@5t1;0%000 `p 0%S pP  @aY@ F0S T`s WPHl|A|ЍpxA>0S$ V01@T t1S L j@>0S@ ?`t1S  Y0 @QP 0 @  B00.V%p(4#t1S bkvkkkIkk2ll 0 R/ 1/h,0@-@T0\@@^0S\P*\@0\PZ 0Sk R0@-M`P@L (0t`p`FSЍ Rp5 p5 : B\ *R B  0L ʚ;G-P p$P1P!qL#W@14!<41Z(@`P 1!0S0S0\,0 0 @T0@T"V@P0\400 (P p`P,00@,@0S  0 S0 0@@YlIgllʚ;l/G-@PЂL1L!LL"p0`81(!4qP 000S5 \L0Q H 4PPL0H0L0 \ 0 S   000S00@0P `pP0P0 UPV `pXYlJIgllJ@- Ѝ@- 0 ЍP@-0 3"q0@00Q 0S0@0 R    R 0700@R  0@00@YlJgl@-@^s00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@u,p0 000"# ЍMb@Bp@-P(`0 !PUPUR PU PTP,PP@4P`P4\pQ@ Yl-J#glP 0  @-!0TP0/YlDJ7gl0P0/P@-$0$ $$!@008< D0YlOJJglA-(MP` 10U@0$00 i!0@p000 0<0S Ip(Ѝ8010C>S@( ( 03(00@000 0<0S80 ⛵p @PYlcJnglp@-XU@P JPpV@p0P@ P00(P,000P400T0p@-@Pp0080<0P  P(P0PUHVHPLPp0 S   0|V0 S   0sV0 S ,  0jV0 S 4  0`V@-@@YVC-@PM r`P0SY 00C01@0S D3/H2H"HH (PU0ST2g0S R,0 S ,  003/40`0P4P!0  P0HS 0 Pp00S `ЍH 00S0`   R 0q   QR("( `  PP U 0S 0 SIr 0S Yo P0S 3/0s0S 0S 3/h,YluJgl@-4 0g$@ #p t@Ѝ%p@-0`AM$MrP 0I0  Tp@ H@AލЍp$F P ڢ!PQP"@ 80 00@$   Vꠛ%%-@-  Ѝ Ѝ/p@-MMP@ +0 `SV  0`ۍЍp-@-  Ѝ Ѝ/-@-  ЍЍ/-@-  | ЍЍ/-@-  ЍЍ/-@-  f ЍЍ/-@-  ЍЍ/-@-  P ЍЍ/-@-  ЍЍ/-@-  : ЍЍ/0/᠛%0/᠛%p@-AMp qGp@ PA>0 dSV @00Aލp$P 0 4Sd%0/᠛%0@>Vꠛ%p@-@PPjN; @`'m ,VT nV00pp蠛%%!V@-@P:.@@oT@-@p 4Gp 0G1Sn"@]TH@-M@    =0  Hp1$0Ѝip@-MP@`   $0X xHp 1@ R! (0 p`Ѝpii$00 H0s P/0 #  ///A-XM>PUV0P0XЍU700p@ `R20 PU B0>00 0<0  ,> !PP> *l@-@T>@@-@TQ?@0Q/ R0 /RG-@P(M0'0S  凹P P ္P:T`P $0!00 0  $0S80 b$00(Ѝ080 \00S # $P`p  P`д0 P 0iS.S  P`4$P 040:Sꐹ%O-`-[M @F/P 09`0PpP$E Pcp<Sp[ߍ0S00:Y 0S 0S_0PP0 $ P PU0SB 0$P 0PSP0SPP@\1S<@d1Sh1 $P=d1 S S RP@T1SX1 $P-T1$S@COoB@TPQ!P"d$  a0s 0$尽PD1P `1 $ŋP@\1SPö@@00STATl p1$狽0P0; @T$ P p$]P00>Q@PD  ` $ X 0[$0E  PO h0 S 9`001P d0Fp `0 D000S0 35S S  CR0UX P PS y R 02 > 0*k@1 U48#88 S R p )S 0 S U  R P 0?D0{ p 0L0D0}>D0 PN 0000H@@@J4S m5mimfm0@-@PDM QP@T 00p@DЍ0U  P @0SA-p@M`PTH@Ѝ 0S P 0S0Q   <@P @-o000Q/P1P/$0/0@-MP@    TUP 80 pЍ00 Ei~i @- R@$M`0p0 PR  RU U 1 # ჺ0PP  R@T!@T00$Ѝ R @'E@-@p !p !p`ND8- 8Q  8A Ō8   "  0Q5ã0ã0A-`Pi@P─@Ѝ P\PP0P qP hpP ^JO-@Pι0"Sp0W"SpGP Y 0@s` Pm700 ЍY\ T00W YT X0#0%: T X3#: 0\Sf0`xSmS0SD bS S\ Tn C RdxT0 PT 0 0T 0T 00 0    00 `` 0S& T  g60P`0 NRU`0S  Q6T P00T0` ꐹ%P /0 S S /S/P0/S 0 S S/0/@-`R$MpP 0S0U00/ᅬ@P 0 00 0  '0S l$ЍU 87PP0 T/00DU C7mmO-p gPPx ЍO=E`PXX  ЍOuO@@壸 Y3lOgPP   ቖP9 Q0A0 Ѝ YO@ ᇸ`@ჸp oN0P! 0 @ 0p00@[    P0S zg@PAJmA-@ O`P,p 0e SO$`P,p PP(0e S$ O0(0$0PPO-U  0 pP 0HRP,U H0}H1SzePHH0P00U L劸HP0P0  40 00 0 N40SS  PU 40!00 0 خ40S =  PU D13r8`&d6P$0 PP``Pp@`@P  RPU\ D1r8`&d6pP$0 hP``^P0@` H0P:0H *P P0P<0{UH# 0S /ᯩ`P /㪩`P00  V /0P0 P0P0<0T000H0P60JU 40 00 0 XM40HS  P3h7 0 apP $Py 73P@H08SP7SPU ,P`P 0SP P UA 0 9p PH0P580x0 50408$ 00 0 έ,004XP uP ,8d `f PV(7008 A ,;⁵84@AK0:9PP880A ;p PPH0U4 0 P 4P 4P*0 06S 06S0P90U1 40 00 0 L40HS PqU H0X U PXdH0P;00]H0P90WU `| PO`,ረpP pI`PP<0&MJ AKP0H0Q7;0UtQP% 囶P0Pt1 哶PPtQ 匶P0Pt1 P` xJ0PPx1P|H0P00UH10P2dPH0P2ZPH 0P2PP KPHP gPH0P00H0P200hU3 0 00pP>0S;7P0H0P20H0P60H0P;0H0P80U5 D1r8``&d6`$0 BP0`9PP@PU D1r80``&d6`$0 P`~U =ᆧPxPCl ᖰPH0S P P10P<00+ P   vP Pm  iP  cP  ]P  WPP`P  0p,p 00 4p 00 pP ,8 05 H481   P  P;qm%gnn2nG@n_n{nn9nnnoros-o>41o5o:oBoYobo}ooooooooooooppIpepJppqpq,qV Tq7zlquqE*qqyyt2Hq@qrrzyyyyyyzzW zzyp%z.z?rq-?rJWrqr ᷯP  ,p# ypP 00 0 H,8   P   &P< ᐯHP  ቯP40-00 0/ >J40Sv P nP$/N`P萄 !PPV00 40 00 0 J40S P  P 0,P/HD P0H00sP D6, H! 00D&P0 0,kP/H< P0@00TPu <6, @! 00<&P0UT H0` WEP`H0P20H0P 000$,PH0P00H0P00H0P 00{H0P 00u(076002P ~ *y450S00T01=5 =P5YHPPUU D10@0P@d6`&P 0ShP:U HTH`PTP,U @1 800P00 00 0 .I00`S46`( "4`#4 4DZH0P800 P P0 0P0 0P0 0PH0P10H0P10H0P00H0P50H0P50H0P00H,P';,UfH0P90AK&Od0h0UV Z7 2`P?PAK⚿OAK'OAK⡿O/P  400H40S  LPzPP lPq=ᩤPPIP PPp`PW>IP`PPph /IP jPPpD P6PIP fPPp P$ IP lPPp PHP` HPi HPlHP!`Y <4  0x 0   X:` ml?o2=y x fW wPHPc HP HP` HP` HP` HP ` HP@` HPh 0HPd DHPe XHPe l p}HPe wHPl qHPg kHPg eHPl~ _HPlx YHPfr  PgW ZP0&, P$@ FPRhPP002HPbp  _pP  R3  R0 0,PSP00,0%00 0$0(00XH`  p Ư@ گ d(Zh0PP ʎJZ d0PPXZ Z P<ЍU  `P004000 0` G4YpdzPP$ 0  p` 0S:PpPCP  0PH| _0PQ4FP`&|6xvaPPUX HPH6P06H0P"800H0P80H0P7 00H0P70U2 6P0Pp2p2SIPxH0P00rH0P70lU `P 00`װ@P аP ˰PPSPSpVPp ὰP |ḰPqPpP8H0P402H0P30,H,P 4,%H0P20U  0pHP9PH0P00H0P00PV 0U0FQ h  PU d0@T$(@?(Prr(rr:r4ppO-p@Ѓ8`P P GP PgUD1P ЍO^B$0SX4 ,0840 ЍO' ЍJ{n PD@DTD`fd6S?`Dhfl6S@hDpft6SAp~D|f6SB|xDf6SCrDXpDAmDlD1pPeDcD1pP\DX  oP T0 ST&d6,`0Cd6l6,`0Cl6t6,`0Ct65D6`0C6 6,`0C6O-MDM` 0P@ E 0%0  8p 6 +8 0 X 0 00 +0,0 P#Z1HD1E,BP0`d60,(@ѩP4: ؍DЍD@0p,0@04CYP0/`6hv2@d6,2`dl6t SMhCpv@,t6t SGpC0&h6l6p6t6t"&x"6688@ p458! 0z0P 00 R @0<   C 0 0 3 嵬 @0 R R R P\R p@O@L@@000SS @3@ P4400  C8 ?o2@0@0<@8@,0@p0,0P j00 R*': APR0PM Z8 8@pPp@04CP000#Q00Su t 00;$ I$ @0 R R R P\R @@* lp @Ph0pAlqA[Pplq @L P 0S 0P  ܭP 0S 0P ҭ@pPy@0 #0S  R  ­P W@0<   C 0 0 [z0S 0$: 0000ꀀ,@/Q!Sr;n\r0Q//Q :///G-p0@0P `P` Y 0 0 R:CS@"3X HGU( HG褫A-TpW0  T`@V0 H0HS @sP X X| |00 S DD0P 0RS ;u@P PpvQOuP@-,0, ,, Q 0 TxvQOuCup@-@P,0, ,, PP pCuQOuP,0, ,,@-o T0S@i◥xvQOuA-PQP0 Z iU0x ` @T Vp 0S 90S @vQ3Ou?v5p@-@Pp PԥPpT0 p@1@-0@JT 덮@00T0S0 @-  TvQOuA-PQD2D"DD T0@ pR008@10 2T T'ἤ@Pp t0 t0 x x0R`5PP P PT T0R88wP `(|0 |0T T0RfPt05 t02 88[`Px x0R p,0S ?p0S 4p0S l)PV H(P`PwvQOunvgvvvvA-`PP e_@T T0Sp@Qp@- M0 ? T0S0 PUx0d tPe_`@P D 0  M>  ЍpxvQOuTvvvO-4MPp ޣۣ  أ 9@1@0 A@1'P  4Ѝ B ᔤ똣嘳@T}   ዤT0 RD1 0800/ P T8p t0SS 90SS☣PT0eᐣ| `P7 |0T T0R   P  @88UPY0Sx x0Rc ^⻣T 00 / XX4P  PP T T0R88#P gP$p٬0VS teo \\@T000wxR wwp@-@PQp;RwG-PM@` P `bp, 0 b ````b 1 pW0p`W% b봪 0 0 /@ bT  @PЍ00C>S`"P!@03@000C>S`"P!@03@0IIII-3@- P Mp @ p@Ѝ0@ Ѝ/R A-@Z T  :p  #:pP^  PY PT PO P PH X00S 2"Q`` Lp  Fp %P /%P01`30  2p X00S1XppW@0h1S0rPSYp@Qa a! pl%P`V%P ps0S  ph !xpap0S  H pT 0,8!pKPpE 1 R 0S  P7 Ѝ 0Sp poR:x5x_0_`Dx:b_LxRYxexZjy\4avxxxxxxQxSx&x.xx7xx yxx:9p@-@Ppp p@DRRA-P`p@@H0s  S  U@ p@@@dW0S  R H R U@ p@_0DxQ/p@-P0U@ST` 00p ᰟP@@T:pyA-`PM1pSBT  p@Ѝp ሟPЍA!R @80  @z @p@ bp@V 0 !p@`P pU0S t|0 0 0#40  DPH SP   : 0$R y%yR\y/:yQy @- @0P PT00Q  +DPp@- 0S 1 `@\0S4 SP U \ @ 00p.S0.SӦ0_S-S,  00  ?Rڿ"0T0 00p萹%P `00CS`0p S00 P0S X0X /X8%p@-h1@SPPQPPE @p B⒞0.SSPP \ឣP LᙣP < rP 0  .OPPl yp@-@P'U^ 0 ps70 `n70 Pi70  @d704,,)$&#  @       270  -70  (70 #70 x7p@ P NPypD*yyyyyyyyyV zzzzs$z-zU 6z 0(ƒ -\ tx Q^ ,\ ,@-QMM@pPX0p0 0r6QލЍA. !. t l0e6p`0SPE@Ep 0S:0@D0GcAzHiGzO--4MtpP $02 O끋`( (x@P74Ѝ0S  m l,P@d 0,pP@$0,PGY ]P,p0[.r7Y00 P,p, R dP 7, R, R0S x R $H7/0 DP p7,0S0S ,P! "xB,AQ !!!^Vz]z P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-Mp`P@VV:U 0U00E0S00T@D@@V00ЍPW"0$?S 0[ `W R``V?R0U  P~70 0 ۟ .0PI0 0IV:D Xk0 0 @UR  ES`O-p0 1!@` Y*QP T WE700 Ѝ%PpG@`  100T W 00  $P     \Eo   ' U/U$\U0 T WPPT W\%0P00PPpG@`T W pGP`ꐹ%SC-RM MPLHp`p= @=p5 ^5p V=p < |M5pT=    T0 Ip P1 Ip I/   zRލ Ѝ   #  0I@  p@P0P@T*p0S4 p `@T*T 0 4p @ up   ▞0#$$("( 4pw @  ⃞0\#$$(B(   v0,!c#!$c$" 4pW @@  c 0b"!4b$#  V H    .0I/ P4 I/ 4p. 0S @00SP%<w4p΢00%.X%^yA-p @MTP 徚ЍR` R 00L0S 0 -0 0p00#M0 B$ 0V 0  0I3az{zO-`-4M`@d00 0ShplP (0S;0  `pp30"4ЍO 0  ,   Ep0,0 ,0SDX ,P5 p 00"0,X44ЍP U0 00!00  B, `0 Mp00h!0xJ p PE, 0 S(0SU $0$00 (000$ 0S *ghP @TP@-@P@`/0p@-` (M00>0@SP  '0x Bnp0 ᑠ0t0 0 y0S00 0 0S0S|0@0|0 0  Xc00Qx0 ?TT0S (Ѝp0 8P 0T0S 0PTK!A-@`儂VPFPPP2Xp`E1P 刂"20 ՛V0  2PRp@- P`}&p@ F? &P5%@p@-Mp@`P!  ( (BX( 8p&PU@ T0700@ ዛЍi///@-M @ z/PЍ00 3"p 00000)%pxx,0000X0@ %p@D 00 0 "%pk{\J{X{p@-@Qp $101p@1p@-FM>`V şP00Fߍp@PF/ n9  0帗P01 0 `  0C 0*> P  9 ii@-@MP4@ $⧜P P@Ѝ\Q@0@ @@@-0SSL`///u{\{$00 Hp//M @-@ p000p0@0M00@-,M@P(    KT %p 0 00S p,Ѝ08i(p@-MP@ ۞ ` ֞ "  (Pv%PЍp:iC-PQSM M 3 #  T0S2"`V2"@p@"ᩞ0B01801T0t0H0 0C@L0@T0H 0H0L00L0@ P T0X00L00L0PL0 0L0TH0| 0H0H0X<0 x H0;H0R `0p 0`00t0H0T@L0 0$L0\120@ 2T@D@@@0@L0 X:  @L0  XH@L0  @L0  XP ΙUPEPPP@ D$("(#p`Sލ Ѝ  ⲙXH@xv\{Tvv C-0M`p" 0 0```$`嚇p@Ѝ P@ -PP 0 ``冇p@ @@&00 ( P|`Pl1 (]ᯔV 0@ T*00Y00/ @T@\@-DM`@ pP@  ፝  ٕ !> U 134  4R2$ @0 |DЍ0Ui@i'0@-QM@ P bPp 202 "#Ѝ0@-]MMp#P^"p@ P@P -R 00@]ލЍ0S0S Sz SS wR@T Hqph@V@T@S  CRPS @@ @p`P -$0 Bp 80Sr S~ S00,0S  R000@0S  R00@ H ` 0ޜ H*!>50H \0{#pY0S 01S XXC0S0 0 0 00 00 p/wPq>S Se  f@gPat@PU a jNPK 0H HO@8#Tw?0SG H.M P N0l<00S6i@\{@- 00 000 0 Ѝ\2S/2S00/@-@@嘜V002S00/@-@@剜V0002S  c/\A-@MP`p @@#@M-@P= P2!p  "p X0S p 3!f.@! M "p x "p 6/PL "p +P Ѝ@{qB@{lBpBfB@0G-0 M@p`0PU   0S1P   gP弑 0 0S V1!o0 P000OP0 PPP0PU:000000x  Ѝ@-  0" ЍgB0p@-M2S@P`x ( VP@0  `("ꨛ00ލp@  ]B@-P`2$MS0@p0  0*00%T0PЍ 0p` $Ѝ@-@Q  -@-@-@pp !p`~B 0`( "4`#/p@-@^P TB00p``0@D^2"000œ\p@Tp0,R0@-0 \!Q0 # R 0@0O-QRM@@0@00Ѝ1`Q V00P,p0 Q :@QpSI =B\> \ lP lP U  Z4\[X\T p Q*S0C0 +P 0 0r  0@ S2T0@cSc@-@ 000}P 0S00Ѝ@-@ 000jP 0S ˕Ѝ@-@ 000UP 0S ⶕ Ѝ@-@\0S \0\0@-@`q0 `0`00@-8@T@[0p@-80P@$ >Q! &Tx01 RpR 0S TT0Q  >0S (p@ ;080TlT{A-p`KP*P@00<000S@ (0? >@0K0cScO-0GMⴀĐ@pmp0 00KC*`PPS d0S  GRW ( Q  R `)Qh 0 0000200> 0BS0*  WW00 RS00T+ $0K0`C80$`P0 DQW Wd\ h P FZ <(/$ ⸔ 8 FQ @p$Q DQW R <0S @FT60 <0 嗔 @W 0FS80 0 |劔@WWW 00S 0 84S 0 FS+008$A 8p840@W]0  0FS20 0 ]@8 RN  FR3   I 0FS 70 @000", Q2`6,0d&Rj I0Slp0 ?0S<  FP081#<111% 1+ WZ W(,  PW:@QT; 0,S P T(, "   PW: ART ,000D0C00s W00FS9000 C8#< ஓ@73S Y 0 FSM007# 730@(1S 0 F0S=00(  ≓(100@ 0S W02S 0 FS<0 0" p20@W00@1 0 Z00 FR P0@ Q2Sa P 0 FSQ0[02 0 0000[00  W 0  ^0 0FSst00pp95SG 0 FSg^009% 9E@@6S _pp0FSS|00xK |6S @000DKP8:Gߍ0P 0"9 ͒0F R-0   ْ @  0FR000S0 z)   徒0 00p000, |cSc25#||79>|W|A-PR1!@ `ᕒ0P p@ R1 0R000 N 30 00 P0 0:000 P00;000 P006000P00ЍP 0000t |00 0gp00 0[p0 000p|]~||@-0`0i0 MS$MPp 1 !p zp@0S i `*i@ 0 P` @QQ0500 0pPQ&P4 ݑ ۍ$Ѝ|%$|]|p@-`\@T  PP\b0S \0\08  p88 $ 0p4y%|]@- 00806PP@ `V@ @T %@P  ᎑00ЍpO-IMPp7HLPL `PR \%0@P9IߍO(0,0(600 0|400 0 P` `p00,0S2 V30a2@0 0!,0 |T:`0 P :.@@PIߍ@:0 P xVT` \`00T:D0 ` e:P}]@ }}0}O-P`@pQR帰,P`,2,ES#PU`,@ ,&P &, Q 0S,  y& `,P0]=}E}RO-V00" `pP@T:}p ЍT  X ⢱00U *7"0 gp0R0  ≐ @>:0  &p  {1: @ &pv/@-RM M00`@PBT Tp@ 00 0!p"  hp ۍ Ѝ D@9 |&p UPU p@- 80SQ S   000 PЍ 0S 0# 0O-S-,M@ h@@ p00_0 P? 0o0 00 0z`P3;0T0 @0P000 0g`P 0   X^pP  $⾏X U$8R `P@00 y0>`P3 00S0@ 0M Y5000⣱   Q**"00"P 000S0 0 {0 i `  $q$0 `S  S S0t0 0s  $8 eP@ 0S0h0 0h0  030,Ѝ00 !0`PR @ MYL $ $ $0`S P@$0S  S StPP4 1S 2S0 0h0?p  $8 P@0M}&Q}O-MP`0@0400`p 0 ##p#X; X8l0S,0S0㌒,0嚘 2S08`,0嚘 8d6S0t,0嚘 x"R0,80,0H00`2 S,0d6S @8h 0pߍ00 0 $p $  0p 00 0 (p $08 0xp $ 8 0lp$(7p 0_p#0z0D,04l0u040 Mpl#0k@0"04,0c40 ;p]]dk,0 !P !,d ,hS  R,  P ,  4! 0  0, }R, R 0ލ0&0P ,  B, 0 0 !P ! SP ,0 0L00 0 ,u}}}}}}@}yp@-PUp@0L0pp@- MP#%p@ 0` 0 0 `p@ Ѝp 0 `p ` 0)`p  ໑0U 0;100pG-`@p 0崀SP$H` $000 0 0000 ``0 0 `  $6 q 0t000h4H0@1v XHЍG<0 $6 0004@0S4H000s$80406 S 00080 zS!G{k{'{z40S& zkg{{'{ z0S+d0S( $0P$h0!600 ,m*S:G{k{'{*z8 S zkg{{'{* z~$n600 `H0S0SZ h W 0R<0S 0ST2P2H000s8040 P424 P 28 P 20 804 00@0S0i  000. gp 4Ġh` 0HN0  P0dh0Ѝ0S4141 PD1 @18   00S  0R`V dp`ЍGH0x ЍG??}~5x~;~B~J~e~~~r"x 6dz)0_ ^hA-P@T R0A A0p8` l0 R 0i0pP 0S <0S $5  y? 50 ` `m" ``i"000 00`800`0 Hp  W"00 0$008 % d0h0O-Rp@\MP`@P; 800 #3P 0 RT0 00 2p` h@@L p 0  0 0@P|D ""X P 0\ЍL0S0 0@S@0L0L }bI00P 800 "2P 0 Rztgjzzz{T0d0S  $ P $[ <Y- y 20; 1C<18#<410,00000400<00@0,0D00 <$@(@ A8`L@P@T@H06pt wu hӊ&h0 0<108#<48#8 10 ```P( `(1" (> *>Q  0*⹸   ЍGl  ЍG80  0S 0 0h ß Q 040 PH000s  i`P&qp 00 P R  \ v0 00$0C40 040800 8ꬂ0S06 PU R ` h L0&0 1P DЍGAp0 G|0 $A1  40Sm 0Sj 0Sk$11  $0  d0S  0R/.0/`O-M000PS㴐 @pT0`S 0 iЍ> R*RP 0S D6S<ƚ Hƚ [  S50  @!  Q 0 S:500 0yp00 0  0 S 0 0Cs||00S\0 S0L040 !p 0 3 0 0 0@P0 [0S?60@ 600 0:p0 0t  ``P L 0 S\ 0@1i6@P "P0S0 0<S<0P0B!0 0 3 0 0 0P 0S6[[00S40S>L0 0 PP  ucl00 0P0SS0$KSK?30500 [ i0 H4 @SS  00Cs00Cs 0 > $P 0 0 0S  0 h3 @0 R@ $  D 06 0S:0<0@ 0=0: P0 P3 000 000 0[P00S* uP )  p @ 0RZ600 0<P0 ^0S * LP ;  pԄ@1 000 0 0000H 0 ?\ 0000D!0S 0   0S S0 rS 0 B0Sq0 00 P0Pc0 8[ 4.  h=dт}4 `E\w^5x|RA-P@` . 0hA*`0R. 0D0BSpb 0 A $.O-`pw 0䜠1P@T ЍT 0S R T0 S> R* PP  0 O@]C-,Mp@PP P0 ,ЍCPE GmUZ`0@SV 0SS "448#8UL:`aVH0UE: ΃1#ĠČ Ƞ,Ƞ\9 U6:1 S31C S0 0 $0 0  00,P   ⨃aV Q Q% ! V I-  Lh,Ѝ "448#8 C!B0^@- M`p\@M0P000 p 0S LL . ۍЍ0 S`V \@T$^p@- P@ Pp@80S0p@\0Sp0p@^@-M4M0pP ;@p` @ `0v0<000C$00(00$0CU,00000`$0@` 4`8p0h p ݍ4Ѝ^p@-P@ST  (@1S pRq \ 02p V 0202p0S 0Sp 7@-PX0C @P 0S0>8 Q'Q'+  A R "'     0 #0 Ѝ0@}6Zz  P<gjzz+S$0@  Ѝ0zD0p@-@P0 0Uph0Spp@x0O-`@PU Q Pd0S  0 40 d0Q{ ЍP0.Q 0S 0P +  08p|0 ?봐8 R0, 00C0 0080<0  P`00 00 0S $0 pW ! 03 0 0 R0H0@S~ 00ppW\0H0H   pȁ00`~$ `8 #$`4" S /0 @Rp@-M00pPQ0`PE `@@d @DLd@pP/<0`( "4`3Z1S P///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0S1@-@T P@10S/ R0 " /P10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cSc1O-`@ \MT. 0S pW$   { |PP@0Sh0S d0S4$ {d0 0S BPP\Ѝ|0d 0|00 0 05d0  0 0/090 W|P }p8PP q 0|0} 3|PP$0 00 PP 0  0 d8dXW  |PPk ,||0d 0|0Xx{U 0S qP 8plP   L U`  P < $R R0 0#  Q  {P h % <  dpP> t0<0t0|00w8sdQYx Xi {P { U {P {ĠZ 0$8 0  h % < =  [<}Qx^*مp@- P =p`01S 0S 0S 0S  ;0 @T 0Q0 PSP 0U d0S0h0d0p@^0d\/08 /   0S/ p@-@T PP@0p^G-Pp`P@Ѝ0H @P00 4m@P 00000P00 000( ,0 ;$0  00 0(0  rpp0S t00@ |6P  0@R 0 0000@@^vD7s@-@T`Ѝp`PV08,*:SR h0S LH~$` P (0R ,0R   `P G800000( ,0AP0S 0 h dd0S  $0R 0h0d`Z0SH3Ij0S/0S/   O-MPRD08<`@H0!R00ЍpP P0 U@ UP R R R0 2P!4b@PЍO    p @@0 0'  0 *0S SY000000000Cs [@UЍOn_v0S/C-P@$M T 0p `! 00 0@0 0 @d@$ЍP/@-@TP@<0S   05p@-@PPP ,pY}P 00p0000S0p@00:S 0S @\S000@:S @ꐀ,%P/:P@-^@S :RS:SP:P@A0 ^S:RS0@S0/ᰟ% @-@A0S :^|^  ^ R S \0L:\\ |\ O-`-CMMd4!SP  I SLEpWH `0P0B@ @Po 00p@@*; 0400S 00,0:= ypP 0 R0 :R00Hd4 0000pPP u0S  OCލЍ P ; 000P;PV%00 0y0PpP@0S!+ 0P R $0$0SG @@P `P000 P00 SWB @DpW:SZ @\Sp S Spp0 0T:C @D P 0SS Pp0@ 00`Z@ S 0#SS `P@?0U u:00h00>P0 0Q :Q0, C B  RpG:R:   H J B[$0 0 PC P[ @D$0 pG HP  0S O0 @p P D$0e$0 e0n @E 0S 0 D0A0 0T*P 0P:SZvꐀ,%#@-0  0 Ѝ@-(@ P k;0 0萀,C-MB0M00pS 0S`! \0S)  R&    RA^0C R[ #t0Pv Ps @ 6; Q0P ލЍ t0P P 0@P;0 PP U PP   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0S@Z\R    B{:R|R  ꐀ,%@-@DЍ@MG-p= @P@ d0Pv_ 00@^S0S:S^ `00A\S`0S:SQ 0C^ @ 00LT1 0L\TS`ASBC\ |bC ^0 0 0 0 R@AdCPPd @0:SS0AR0@A (P Pd : A-p= `P@ dP`FPd0~ 00@0S @AdPPd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P 3P言,pG-Q0S`pʯ PV00c `a  6mP00CS09 Pp0 0 S  6W00S@( Q{P  ( , $P P00SW  X\00S 0 σ47,P R   S@T P R  ` ЍR ꨀ,Ѓ,,@0@-0S tP [P言,Ї,@-@RP08G言,p@-P@PPp9Pp言,@-<P  J(087S@TЍ言,Ї,p@-SP@ P@p p@-P  #(087S@TЍ言,Ї,O-pWP`ө@P @ Ѝ0S K P 0z0PT  RT1@ S //////@-04@0P P,{O-@\M08S DbDPp < PU00 P~  kP00CS08 Pp0 0 S0 |W00S zPP |P 00S0WSXP dP 00S P P P P P P$z :kPuPЍ,X0@-0S H@ ;000D@SP0DЍ8P, ,@-@`0P0`Sp 08P P ЍP,@-@P08D,p@-P@PPp7Pp,A-P @`pP 0 0084SPUP@Ѝ,@- 0 00B;P Ѝ ,A-P @`pP 0 0084SPUP@Ѝ,@- 0 00B;P Ѝ ,@    /A-0@@`P@0 ]&p00D0& SQ,O-@P DhxpDpG``b0Y:0z  Z # 0@@ DNx 0DA\0:Z: [=0 S: p` Ѝ `p$,A-@`Ppv 7v 1v +vA $0p@-Q@T 0 d `on2 0$pAT d Pon $ !0p0Rp@-0TM00`p<` @PVp0TЍTT0 bp0{@ r,0@%$0$ 4/00S ˨%$,A-@P 0s P0p`ppGWp0P ```pT  @@P $,p@-?04@tH R|YJy 00$0S  ğ0 R 0  80>H@`@C3^A40LC32 h  02l 3 p  ! dC2 ttt 00C0'0DS 0 000PxPP| ,0 & 9 % 4 @ P B, * R' \  B\ !\  $   R B @ @P R B @ @P '  (  )  *  0  0"0 0U`Ph0U*P* 0`0?o 0c  `o `S @P U 1d*i88 U$P030#P0S d 200301S%U#2Q FZ*0U00S  En@P 00P@P0 0#  0|0S0S ; p,ll0<0 0 p@  Z@P! 0  L%U#2Q JZ*0U00S  EmT LP )@T @0@<0< 4/᠛@Pm 006$,%,&@-@H0'0S 0 00 0T Ѝ@Ѝ$,g////ğ%/ğ%00/ᐹ%00/ᐹ%00 /ᐹ%00/ᐹ%00/ᐹ%00/ᐹ%00/ᐹ%00 /ᐹ%00 /ᐹ%00@/ᐹ%00/ᐹ%00 /ᐹ%Q P00Q////////0P/ R//A-`pP@0 P @U*0Q R* /0/%bP0 0CS0 S P70 /p@-P0`@jPp@ Tp0A S00//0P/!R/P/P/0000Q/  /ᐹ%P/000 /ᐹ%P/ 0S S//@-!@h00/ጹ%00/ሹ%7@-@PD@P 80R,PPl; 0 5 Ѝ0&.%PQ 0S///% 03P/&/g0 AC\ 0AB0\ CSo \S / //00S00/ %&00S00/j %;///@-@HDP 6l(  b@\%Zȡ-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A k00ЍQ@P k@0p@-P@ `0S  \*. Q  R R  ,  p 0 B##ꐹ%,qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00l Ѝ0S/1>3 !/0S 000/ᰌ,0S/A-p0 @RP:``S * VDP` A0 PQ0S/0 0C@-@0 0  (  ( 0 S/! ^R/0 @-@0 0  $  $ A-@0SP`(0aL T  $ T $ Q 01@pC !O0`0A-ŝMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SQ u P0( R, R)\\&|\#00 |R 0S |0 3/000Q R R0SR|\0 Q QQ Rt0S 0S   B 0  BЍ 0S 0 c >0000  B 0B B00 "0 00 0T갌,A-@`P0S<0R"0!31<0S0 0PPR0S! !x000S!!!,p (C0P A, (0 ,P%%%A-`0 R*S\ ]\ tpPB@T Um aPdPp% @-R@:0S000000 S*Q[Q.Q000 S :0S00D000 R .R ]R00谌,< 08 C800/`Q'Q!//ᐹ%A-PRp 0@S` * tBP 0!d PPA-@P`p0 SV1 V00W W0StBCCCDDDDDDC$DDDDDDDLDhDP 0 B  0  B  B " A A`0 F  B  B " Az  kpG`P  B0  BZ`FpGP|S`FPvA\p@-P4`@e@P@p TpQ 00//,1p@-@0PS<0Q1,1 R40S"`$0V):8p1PS580 p(00<^ 00^ 0S8opU 0! R R0 0P`%%%O-@P 0RM ` P&   ` P 000Ѝ 0@  ?AP ЍO 0P  S @ g 0 00<00S*^Q000800R ]R00-R Ȗf0 S*]Q -QR\V0]Sj- 0 S{:0S00L6000S8`V 00000 60S|p0@W Ƞ@bS ,0Sh40Se$0Sb<0S_(0x[ f 0(` pc0@`F `@ )gUg 00C0b-Q [QR:Q =Q 0Sp: Q 0R00`S00`00-S]S0`S00`t4 R*000pBW R:0`S00`0 S<*R9 :R6 ]R300@  pb0 ppBuP 0SK<0[$  5@P    qP p$0  0$ 峠0S00``0R00`S00`00-S]S0`S00`=  R:0`S00`0 S*R =R ]R 0S0 -RD QA]Q> -Z00  W3 0S. W0`S 00`0S<0W00Z0S Z40 ?P   pxbGx400!0pᲠ40 P0`S 00` (B(  P   P: [i 0]S~! R, V08C8 0  EB#ЍOQX%,% 0p@-@0(M! 0 0  |  p 0Q 0`0]00000P0`P(Ѝp (Ѝp@ꐹ%%%A-@ `00P\UC S:0S004000 p4\U R[U*U .Uy 0S0 S xeP JU @0p W1@p(` ~0 S *R \R0)S ) \ W 1L  e0 S *R \R )R00J 0S00300B3Ud !0CUU0Gqt0S^  <t  3 0 D #OU &)2U  0  4 000p0^0 0 0 0]0000p0S* *Q2  0  BG  B   B0;  Bu  0S> 0S 001006PX\QV {RS0050SP<* ,R9 Q 7 810000  U0 R     0 S *R\Q}Q00 0RR \P 0}S |0<0S 00,000$EoЍ[Ut`갌,)>{%A-@0`pp?Q $0A  R SWUUUDU0VWWUUW^QO [Q \Q PUOO{Q |Q020W:0S00500 @0P U1@P(` "0 S*0)S  ) U 1L  0 S:0S00400P 0)S  0P  $  $ RK*0?S{S*C\Q@{SP H$ "!,Q  R  $  U   R  #  ?S l*S +S 0S* *B?RP {R  Q  3000 Ѝ  0  (  (  0PP 0000^0 0 0 0P]00P w|o0W:0S002000 <Q >Q x3PP jT &UO F^{S0 SPp* ,Rm  1000< U0 R  !   00 S*}Q00g 0RL}QF  ] 0  BY  B   B0M  BD   B0@  B 0  B5  B  B " A 0000S 00000갌,%0S G-`Mဠ PQPE)^PL@P 6U: ppP PP $ @pxpsb0  pt0^ 6up|0pp P   $ ( , 0P4 8 < @ D t000Q R:0S005000 S=:  ]0A 0;P  H00Xo p0 P>3S, 9S $S S <0RQ00 p< 00u04|04040 .  Sc S<0RxQ< s00 p0QiS S S>SUSQP>3S S/ "S 00 0\ S:_00P  B08B0U0 RB@ Q U B!U  E1U, ^0C \!1L0XRU!U! 0>Q% Q% QS 00 080Se 0S  00@0000 0H  @  0S N<Ѝ0R 10C/TUUT,,O::Ee,1p@-@0PS<0Q1,1 R40S"`$0V):8p1PS580 p(00<^ 00^ 0S8opU 0! R R0 0_P`%%%0p@-P0@SQʡ@QD8@ p<0S P pP0@H0DH@P(00Ppp@%%%O-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T 2P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  &P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'ꐹ%O-PQ ,@`p+ V >\# (\ \[ \G \S `P \[ \Y P @\` \ \L \06\ \ \; "\^ \K \ 0M \ &\y.\) *\ \08#8S00 \ yN ^0s00 0@0s08#8Sy[Y00>@4N5>5. `F`FPV0@0>N>0> ^0C|0>@01>3 St 0O-4M\00(0000 001@X( 0 : 0R00 0 Sd 0 S0^ PZ \00$0000 S0000``P00S  U E0F V pR p#08C800_U0S\ v D#00000_V0Spu\ 308C80000_U0SN wpK vI 0_V0S\p?Pu0 0p$ V 00 upv00w(0ppu0 v0X 0 p,X,w u08#8S0 p,,d1u v? 0008C80000_U0_V^00 0,^,000_V0;0  R" ( ZP $00 0`,@0,Pv00_PU0PSPU R S 0 04Ѝ萹%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0800 0X7  IS~ S F S 0>#0DϠ2@ 0p800 0gX I0  0]P 0 p @0P  0K 0TPPP@ pP@07800 0p.X G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  "P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'ꐹ%O-4@08pP#8 W Ѝ># R, .R`" Rl RR Rd pP Rs RZ  0N0P BRz R Rb R 8R R M RG "R Rm RP n R &Rz$.R7 *R R ("(R8 R z  ȠLȠ \    r8    r ("(Rz  SZ > E    R P RpG pGPp   >  e  ># !>c V  >  !># RHO--,M , l0*4 0*0 (0* @ Y   0 h  R0   T0 Rc  R ] PZ   R    ``R   0 0P 00 0 UE F V pR p (B( _U RQ v     _V Rpu[ \# (B(   _U RM wpJ vH  _V RQp>Pu   p$ V    upv  w( ppu  v X h p]X0w u ("(Rh pK0!u vS  (B(   _U _VP  h *0  0_Vh P R  R5   0$ 0PZ& 0$  S0 S 0 Sh `P0: 0v  _PU PRPU0S 000S00,Ѝ萹%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0v800 0mX7  IS~ S F S 0>#0DϠ2@ 0P800 0GX I0  0=P 0 p @0P  0+ 0TPPP@ pP@0800 0pX G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO--,M , l0*4 0*0 (0* @ V   0 h  R0   R0 Rc  R ] PZ   R    ``R   0m0P 00 0 UE F V pR p (B( _U RQ v     _V Rpu[ \# (B(   _U RM wpJ vH  _V RQp>Pu   p$ V    upv  w( ppu  v X h p=X0w u ("(Rh p+0!u vS  (B(   _U _VP  h  0  0_Vh P R  R5   0$ 0PZ& 0$  Q0 S 0 Qh `P0: 0v  _PU PRPU0S 000S00,Ѝ萹%O-`MP@80U:Ѝ0!>3S S Sp>spS: 'S5 S2 S0 P>p> \pS 0v800 0mX7  IS~ S F S 0>#0DϠ2@ 0P800 0GX I0  0=P 0 p @0P  0+ 0TPPP@ pP@0800 0pX G 0 PE >#P   0 0W  0Q>SP!>#"RPE P9@]0>#" 00D0 TO-P-MLP$@p0H #W # 2RS Tr p!>3S  Sp S S S] 0Sj 2S0p St & S *Sh &S0SK 0000_Q0S@ 0S00 0S7*0T _0S 0R0SC.Si S0 S 0_0S0Q0S(T00P0_QSP   0S0_Q0_P  TЍ(0B(R T @0 T P0S00 0S000S00z 0S*0S0T S00S 00S) 000_R0S 0S00S 0S *0T_0S 0\0S R0 _ R P R00S* T00000_R0S0S 0 S  _0S 0R0S 0p>3p1># Rr 0G  a>#RJ RT RV R xUR Ra R >c D2"H00 0 P0 0 8>c pr/ pRd[) A T0#  *P0a !0R@pH00 0 P >cp0A0!RH|AH >3 0G  hP  G>3`0 @ \P01!># R 0 p`>c`1>3"S`F0>cb 00D0/H0 0 0 6P0  R'ꐹ%O--lM $PQ0Z @$QU ``R     Q 0R S h  Z5,Q 4 Rz 800Sv Pm 00D0 ,pp3P 0S 8 D0I0C0? 00S,0 "@0 S40%0 (1(01 SP HP 00000D0 ,H0SPH`Sh  Z,Q~ 4 Ry 80 0Su P 00 0/ / 00 0 0 0/////0P  P@-( /,P P/ /O-$MPpWL0H0_ `d@P1!$/@ @ T0030#`W00SP 0"@Z0* 9# 0  0  @Wp  p $Ѝ 0?d 0? 0?@pP;X p ` 00 P@ $Ѝ `d@Pꙙ<\(\@-PQM(p,`@ U00 V Sp0`sЍpw`Sp 0E`e-00Ѝ r00 r0p`VO-0M@hw0h[ PA  9YAZKW  9  9X%  9 9V<  8 8 h 8X 8ЍVY PZ, P 8 8Z  8 8Ѝ P 8[  8W PX PV P PЍO\t,LH0O-@Q00R0M00嬄嬤 04`0P p 0P R nR a BRrMT1   oRl JPM Ѝ  JPY U000T000 JP[Y U070T070P JPY U000T000 JPYU000T000 JPYT000U000{ JPYN U080T080j r@ JPY9  wJP  qJP  kJP_YK U080T080@ [JPp  UJP  OJPJY8 U000T000$T080U080T000U000T070U070 T000U000 ЍT080U080T000U000l JP T IP Th `$@\\C-0@dMPH`@>SHP@@@@ P$P(P,PPP PPP9"`!@p03 @0 `p@& 0 =p@ ~=p@  Lp@`L  0P}=LPL 0P8LPdЍL00|ŸO-1MM   @`D00H "( 5p C.$ PpW?@D;8 (@0Sq ءرp pQ00P$ %0!p t0p@ !0 l 0SiP 0S R$L@001ݍЍL0S PEPU R Pp 08D<4! @ P0 00 R 0?$0h,R XG@1ݍЍhL1ݍЍ.FtHgt0@-M0P  Lp@ .p@ P 0 0Ѝ0 l Ѝ0A-@@`v/ PP0P  0npp pp`{00pK`pVp K``ppd0`0p{K 00(p@-@PCM2 /L:P4 47p@$ ` *P`K00?u5 :{C>P F0 @4EP@ F{>0S@ VS 00 SCލp@@0S@l0l 0P@0  P@1:*K?0@0@#K0@0@$ p@-MQMP4@SY TD /9PA QP0s* HP_QaP` 0pP @ 0@BqpG H =p@ ۍЍp(0si/10p" +Bx@0 P@0 r P@1:J?0@0p04@J0#S0p@ J00J@PJP4L%@dHP@-qP`O-$(Y,PSp@`3U-00ï  0W;X0 0 0O; 0R0*00V&(0 `#{`0q0 "4x " 0xkP@r`Up@-@M@ gP, 0`0#L` QCZ/P FaS 0L@U/1 0S2 0 "#@Ѝpꫪ*O-@4460 `$M00@=+@ I\b-0@?o2S00/ 0P 00d 0u QS 0 0000S 0 PW!#ό000 0NY [ȏJ0-0@\?o2  y 4YP$Ѝ0 0s 0 P$Ѝ0@Pb (P bP (P0 )P0CS 00}P Pp\ 0 41000.P0S0 0S #  00000S 3R2 x 0S' lRe d#S[ DPU PL @s@p.AP Q X EFP  Q000S rp!~Q #FP  jtFP4 ``cQ  FP0.S000S00F R ࡟  Q EP  /- D@ 0sS9 ||sEP Q 0S 0`0 4a4`nEP) Q .S0 0SQ0 EP` QA EPv Qs0 0  pO  @ama.m.pmp.m.&8%%H % $dL$DQ|A-@PU 0U0PUP!A`FFqP ``zP 0!Eq1pP 02P''O--MDDp  (0,4(00p 00: H0T ㋟L0X 300@0 SE  !o0CVX f‚!   3Sf,"!]ZY ~"!{81*#bYI@21&%#tQ <200,1SD(" 0=S 00S1X"R 8 [9T  1@01S  OX< A {{P XPL0QEaC 0 ?L`XP0L0000X0"t T 04!0SSQL HX a PA&*021,1S\ U1X2Q SP0\XL Sp |0L0X P LX1/ @KTIЍ0 Xq\l'.%""""8 Q !X"RL P0R:p} L t[0 1LX Xp SK@QV,1P  PV  0P0V:pQ L`XP1 L 0 1X  @PVH@(00(0000,00,02XP0,^0# <P0  0=R%0@Dh0$0SXP"ExXP A PPH@[XP H@RS@ XP000 Q0S{8< {XP 000 Q0S{8< { &XP(0$S 000<\  =RHNQL0X \ 0@0DhXP0S <\  NRH LX\ 0C00000S ^  0@D h0$0XP0$0 0XP0 0$0S}XP"x(0XP0(0,00,0x(00(0sXP 000(0mXPP0L dS`0d 0 `0d E0E E0E00#OXPQ0? 0LS0$%3@Dh=X0\ 8# PF p0v> 0`0?d0l00P0?T0h080?<0d0@0?D0`0H0?L0\0X0?\00 000XP#XP(0S   R $ R`d D& R  000d 0@ #d 0@d 0@ %&0@XP 0dR  X \    Q&PT8<XP0 SE P\0sE `0d XP E !XP 0 E!XP  \0000 Q00SPT8< XP000 Q0Sv{8< {{XP  0 Q0i*0^b*{ r0s{P T80<_XP 0 !X0S(0SH XP90 Q00=:c 0 ?0" R  #Ό " d 0?  \00 40*XP0E0$XP00XP00XP9 0 Q00:($^0<P0$ 0=R%0$h00@DHL0c 0 ?0" R  #Ό " d 0~?  \0 4XP:0 Q00:P0 0<R$0h00 0XP0  0C0  BQ $0 h00$%XP h$ 0$% 0S 0000000XP00$0S{"xXP}XP0(0y0XP(0u$QhXP0 S P^ " \01"?!x"0X$0XP2p rp t t NXP  0 R< P9#R4 & E%9H R*  \Q%8< &"# &0(0 0dX D D00@$0 h00% 0A0\0@Dh0 00 0 C00 00S ^0  $0h0 0$$% 0%#P " R01"?! r0rd 0 p>d 0 j>$O-P-MpICk`0 0DC0U0 W 0 2c1  删?0 0|@P/ 0v> 0`0?d000P0?T0 0804 ?+0<000000000000 000P :0\0P@ 0TP 2 dP 0 P{0Sxʴ Ruʠ RrʨQo001 0Sd `0?#0S/" ES}> `00d 0B@P0D E   P`d`F0p0t0Q RPx0|000H00`0X00\080` 0  vN@h 0)Q @D P \P40dPl`p@8 SW0 S S0|0\p0Tl0Vh0 Rd0U`0 R\0 Ry{  RRzP8 @0>C 0C0p0tR@ix0S QBpPt`0(00(, \0 :rPJ p'?0! P ό 01l"?! R1 R?U0v Po 09=87v~@ pG0/ QPpp 0)=0hRl Qh B 0  ?qp`P  0qpA0S [R@Q @T A 00 ߍ0A\ 0qpK "'pR01'?q 0S?P; RTP\0 P0,P0  PpFZP S 00@ A0\ 0`A0S0000 W\ ZR0``o d` PT\ 8<\߹ @D\׹ HL\Ϲ0pX\0k RA0SQ WA37#p3gS:3ß0#cP3: 1PN~0e@P  ሠdSdh0 `ZP 6pz0pwA P\`@(@(,AP ? /& Rß%0Q0wt W0< 0" Q0P"0V#0,l`V10& Q#Ό3à\!=30S ( 9L^: 0( 0qp3 Ppv@#00@0SK B0\|0" R60"c01 2c1[ß sR @T00@0S"0@0 R 1&`P 2&>`\3à\&=3i@0 0 0[@T00aW@T004XlP)\(\ ףvɻ @-@T pTat X00 R 0 R 0Q/  /  ,  DQ p@-0l` SPPH 0@#  T\  Q p/@0H  Q j.0 0#  Q/$00Ɠ\ 0@-o>tP 0@" \ 0 0 /̻A-@P `p@P@0% (P PPA-`X@@P pjNP@0& P PPĺA-`X@@DP pH@P@0& P PPXO-P M `P8 P npP P @ @ % P P0Sp K Ѝy T p V p:  #0p`0pSйA-PpQ `@Q P 0@DDB(000S   8@- Mp``PP( >  V00S@ >0"S" 0`000S0 6/ Ѝ>0"S1Ds\0`T000S @ Ѝ1Ds$  $#<,<@-@ @O- MpPW  pp2S^`PL P@C hPp G ,P P6 0nS# p= O-@P00Q Q P ^  \0 HB" 0A 0@00oSp\000S \Z` Ѝ, ! OM`@`O-@-AM Mp(>` 00LP:,PP , LPp0:  Y90P: CP@@0K PP 0k' 0p  00P: 0 *PP['p p $@P# \\ 0dQ `k`V`~ pP , r{ ( :P @PP 0 PbpR wQ mP  =00P/U` P cpB=0SU  5PAލ Ѝ 50H00 PP&p@  'Pm= Z000i5t!: 00Y=P 000V52P`K=0  ! #R0: !2= ZZ000-5|&= Z000"5qPo=d HZ0005cԒzd@t<(- M 0  ^&PЍ- M> 0  J&PЍ- M? 0  6&PЍ8-0M  0>PЍ--( 0P    0/ 00p@-P4U@p<,0,0? `0  6/p蠶p@-P&U@p{<,0,0? `0  6/p@@-@P 0003/@-@P 0003/ꬵp@-PU?o20S@ 0 00 3/p\\A-P`UV00P00S@$0$0p0 7/p@-PQU?o20S@ 0 00 3/p萴p@-`P5@Pp;( ( 0 @p@/Dp@-P@P p 0 00 3/px-@-M  hp@(0(003/Ѝ@ Ѝ/ᔳ0@-hp@0003/HO-$Mؤ @00`P 3/0Sp$Ѝ;<0` (P@6/$Ѝ輲`O-$Mؤ @00`P 50Sp$Ѝo;<0` (P@6/$Ѝ!P񏐇#-}yuqmiea]YUQMIE=951-)%i5 ////|/t/l/d/\/T/L/D/</4/,/$/// /////////////////|<`xhP(xhXD0 ЅO-`-0:p0*S0pG0 005PZ0G"` 0 `00USXU Y p<0@0`0 p P(V ` BPE @@R> 3P 4U * 00 0 00*G0PPU  <32 7[`; YI Ii XR3"^P<^P `0U 4@ YEX; Q8V ` BPE @R> 3P 4U *00000 00*G0[P % <Y ` `0<S Z>0304p 0R 00<ЍPU 4@ Y,PU `14 `! Y@@ Yh;0:+\;0:'Y , 0<p0A FQ P  0 $0( 0p0)Q!*AQ S P @0S Q0| FQbQ0 30 `2 @10 0[0 X 3 "R Y 0HPE000$@ @S>03P04U *0000 0*G 0( PPU`<03`2070SE , P=S @ZA 0 `( *Q)P 0 BPE0$@`S>03P04U *0000 0*G0VP 0PU 14!`Z [PU *`0Z```0fQi 2  , L , `[,4 l:0 @220 , [  X 3 "R0 L Y @HPE   $@R> 3P 4U * 00 0 00*G M0(PPU`< 3`2 7 R FS 000S,0000G0 .P PU0`00 ``<0( 0:4P<PQ$$ U 4FSY00@,000S0 P<R00S$00$0 00U 0 4 @ZK  (*0S)P 0 BPE $@R>03P04U *`0000 0*G0XP `PU 14!Z [PU 4<0(0@Z7  (*0S)P 0 BPE $@R>03P04U *`0000 0*G0XP `>PU 14!Z [PU 4[1 0S.Y 00HPE000$@S>03P04U *0000 0*G 0S (0RP`PU*=00 <0(0PU=0304,0000*G01P40PU`0 X00S3 0X*:Y 00HPE000$@S>03P04U *0000 0*G 0 (0RP`PUZ*#00,0 0PU#0304000,00[) 0S&Y 0HPE000$S>03P04U *0000 0*G 0 (0RP`PU*=00PU0#0%=03040305,00 ` (<00i,00|,00x-M{00{*Ѝp@-MP`@0 0q 4/ЍpG-PRM^  `UpP*a@/%P T1< 000pp Ѝ80S 1 00< 0 pp60S ЍĠ 60S 0 < @0< 000@ ppl60Sg6 0 a6 0 h PtȲ(@- @MЍO-EM MqX@`+pF<. K0PP@+T! 0 K@0PT 0 0FA`    V0Eލ Ѝ 6 0 Eލ Ѝ6 0 4H@-`@M pP-P+ /hK RP  rR' rR  P   0@ P@Ѝ0rS\ 0 @zЍ0 Ѝ@t5 0 ꨰDLA-`@ pp@ 0P/S /KP @0 Sp  0 SQ 0@p@-IMM@`PP ᧻p 0: S p0 0sp IލЍph5@O00IލЍp@IލЍp[50@0ꬫp@-IMM@`PP vp 0: S p0 0Bp IލЍp75@O00IލЍp@IލЍp*50@0o- M 0  PЍ80Q 0 080/p@-@PP` Y PP u j%P  p@)PPp-40- M,0   ЍЍ/@--M  Ѝ Ѝ/ -- M9M<P 00  0 ЍЍ/@0-@- M@EMP  Ѝ@Ѝ/O-`,M @RPP00:A!0@00Ppp @P PX P@ 0 @XP LQ!,ЍP@-0M@ %0Ѝ0 0 @p@-@`PLpp p@808 0@-0M @%0ЍP@p@-MT  H P 00@`Lp  Ѝp@oЍp@0@-4M@PLp [%@ \4Ѝ0\p@-@T0 00M`P Lp B% C0ЍpP@C-PpPEUP,M` 0R@@t0 0:2 0U P@ 0 @T IL ,ЍP@-0M@ $0Ѝ0 0 @p@-@`P%Lpp p@808 0@-0M @$0Ѝ@p@-MT  H P 00@`Kp  Ѝp@|Ѝp(@0@-4M@PKp $@ i4Ѝ0\p@-@T0 00M`P Kp $ P0Ѝp@ Q 80 p8@-80@08 880/880 00<P 80880  t/p@-@0@00S 000 X[ t PP `00EA.L00p@&P,:.x$$  @xO-M@P SD `\H30 0p@ P P00U pp00C lY 2ATT00  RG LD@D T]:[ 2 00p0`K &K0 V0 W8 P2ATT 0`Fs 0RB  K  0\ 0 BV0SH J@0Ѝ V0& 0@ J 0 60pHXB0SG 0) Jv B 0  B 0@  0 B  BJ`FtZ  B 0  BJ 0 v 0 m 0 0S J00 0 0  @p@-@PwJpp p@0RS00 /D0D0p@- P@ [Jpp p@@808 0 QR00 /T@p@-`@P;JpT T   p@php@-P X @ 00`JpTT  p@p@1!0O- M  D`R, H1?0Pd 000PV1!p !q1 W0C@8t0 , @@KD Œ Č Ȍ A`|0@p4  W0S 0 ? ^ \\ Wt ,0 000IC1100Q0, 0è Ѝ0D 0 00{L@404 0@-00 @?P80@080,@-@?P80@080-M0 Ѝ-M0 ЍO-@?iM0Qȡ̑qaP 0 Pz? `K͌U PnP? K͌T Pb ? F͌(Z PU> F͌(Y PH|> C͌ 1S P:0> JB͌8W uP-= ̌V cP = ^B͌`p=@ 0S708T H0P, `P P P P P P(` P< P@ (P PD (PP PH PxP'( tQ780L0x100CS400 00C,0000h000P000a/ ,00P@`U 0e1P U.q010 `00V0q0 `V, 0U @ `dp少Wl` 0 V `Piߍ`0 1 S ,0 0 0 !1S 0D 0| 0{>p00Y,0P,0 @$000< 8P!P H, $  B@  0S% 00P00C1 0@S3 00Q !1 p WQ  pW,000 p0S,000P$0U1p 0 W 㟾pP~80Ss004 0R0031800P0X000<0P0$001P0, 0P000B0T0P00000P0X00Y,0 0CR0@,00`0QQT d!@YP p00 0W0 pW0T,00` pp少W䀍 0 [ +P 0080SG  !< !^ v : !' !_ !| !o !* !! !Qf ! R |1 R 0S8 ЍQ <0 0 &Dh0  T ЍHJ\J`ID0h0  S/HO-`D判@ M[p +(p($ W㻺0CS0S(౺3㽺ºP*30H @08p|尰tl8 `%TPLH(D@P<8x40,($ sß弁q03=ؒ@30`h3:|p R 0S1810S \ぁ ЍQ P2 0 AC(qpz@ <" ^v#x:'# # H# p--`_|opryz{@|h}J7u J%G+!,!-!.%0%`&i%j%k %l%m<%nq#s%t$%u4%v,%w%x#p#rd"ye"o{|z#`"GDlE$Gp@-_(@@k( @S!T(PpE ǟ 7O- Mp 7Jm&0 &0ᄲ ` SW[  p p PP  pTPIS  Pr  aRR$TL&0 0 O 0 ; 0; $QPBPq 0 ;0 ,pt 0S 4   0 s 00bR44 $R % x5 P0Ѝ p PP' 4P 40 s 00bR % 4 00$$ !P0S 40s 00lR Ĕ4 S4  40400T0SW0yS ypP 0@    $ `004S 4 0 q 4Q0PQ40@ Q  0r0  cR0$0W0< SS+ p: CpP 0@  N  $R `004S 0040 s 00bR $4S4]00"P 0Ѝ0 ;0cp4S  200 ?cS  20|"0` py P20L"0` p 0 $ P 0 s 00bR 40 ;0 %p1 P- p 400s440040 s 00bR44Pt1 $0$ r0  aRCo $<100 p 0140 s 00bR400z 000 ?c0`000`00000e00`00S(  t0t0! 00u XXXW0WVHVAUTQRR,RR i80p@-P@ 0 P# T TTp\QO-`T4P8 0$QDM@h v :Q{#R3Z 300S 8 00P @P`@-@P% HP PFP0S)[P& mR R@0R0 1BQ;RS S0 CmS  ;S R R0 S0S PS0 C;S  Q0RRRccO-@0uSpM`d`Z|P DU0ɍ <r("( 00nI|"0R 3S(0$00 0tPK?T0 ယTLP wX R 4$40T 4 |2`3X 0 4S0300S5 p0S2 4S, 4S 0D#Tq匑Tl"2 7PR x3l2Z& L[# `P P {0`ճ ӳV 0H5S4S 4S0?o28p2Y2t2 PV 2t22Wx2 P/ |2x2hЍ0 D $l h $ <% p 0$0(0fW P 2l2Ym Pl2<l2Zk Pl2?;~0l2Y yP1x2Z qPx2?;~0x2T gPx278x2W  \P@1t2Z  TPt2?;~0t2T  JPt278t2|200S0X0  r("(bH|"R1S0/ 4S+]L%R(SZH0t28p2d40t28p2Y\baa,]0 000 0- $   Tt Xh h T  lp0tx"| S,hD8 80 0P X0 0//0O-\ M0`pP@T \2 !0S S0SXT Ѝ 0 C-\㠁r M Q Ѝ |Pl@P QR  *PK ,0 R "00 Ѝ 0 ЍPa t Pp P F Ⱀ帐 少帑 QLvj<0<0 0`g[0Y YYA-P@pHP @P `D`@D0 x0"P0VP@0 j 2P p@-`\@PU 0S1 RU0S@ٱ0@Sӱp@бG-lp@`S0 SV0S"Q0S 0SV1C-M0M`@@ZP0 , 0 @S@0@0 J~j  唐0p "†0|" QU  P* g YTۍЍ ಲ㦮?WP?WX X0@- M 0^  @ 0  Ѝ蘤`0 Q0@-@L00S :T g/4 0 A-`0S :#CRPQ# # p:0:@P ##sC# B0:#!BQ##ģT0T-0 M \ ʌ0  - Ѝ8 80 0P T0 0//ሢp@-P|``p@0@ 0SP0P0:3S 8 80 0[0 :L#p4,O-``3 0Xs0T*PL3B0 `p (VS p p PO p   r  `R  01Q @R R3 RV@ X d20\2#`lpv  @R `  R i \  lp P ` @q lRQ1  X6N @{? ` 0  S, (q 1lRQ    ?p  q`RBos000 ?c s 0`0`0 0  @  0 ꔡL;H;X;;Q:99 P,8G-@P,S,3P`e 80$ RR a ʌ3S23pSzW " Rp *8' PQh100S 0   0P0Q 00  00 0z#0CW3Q  rP+p gPpTpir` `0 00 :\#3+Co$8,0 00$ꠚ@@-@Z5p@404 0@- @K5p@ `@ ,0G-P1`AA0Y A p!ԱaW`F p孮W0 p R i i  T * @ T:V:p0D 00 H |0 +pq@V*00C  M 0 00@@-@4p@404 0@- @4p@ꤘ@404 0@-0M @ 0Ѝ`@X0X00@- P4M@ 4p s |4Ѝ0@0@-4M@P4p a j4Ѝ0@-0M@U ^0Ѝ- M0  ЍP0P 0-M  ,0 0  Ѝ@t0t00@- @MP \4p , 0 00 0 0 PЍ0谖@0@-M@PC4p , 0 00 0 0 PЍ0-0M 0,0 000  Ѝ000 00:3S Ⱙ/ጕ0O-J3\p00P  M2pa`P 0p PD3nτ`3 p  "  _ͭ `hi bF?Yn 㴲 `00s  bmP` Ѝ,0 #$ 00 0 Ѝ|p@-D@D0@Ppp,0 $0h0i p舓|p@-@0@P:#R|  l ^- # 0p "P`p:p(8pp@-@0@P :QthQp- p #P`pY :t8pp@-@0@P:#R| Ó \ "R-- ( p #P`p.:pȑ8p@-0@DPSP @p (0008 <@%8 pp@L0L 0@-@0:#R#R"#0:`0` 0@-@0:#R #R#""|}#0:d0 0@-@ :QQ σ #p WP :0 0@-@ :QQ σ #p .P :P0 0p@-@P :QQ |} Ãp #Ppc :fp謎0 0@-@ :QQ σ #p P`: :Qp@-@0@P:#R   Pp @8 “%\8 --  p #P`p:pp8 :D8@@-<@<0@00:3S 0 0 X$@-8@80@00:3S00$0 0@-@ :Q$Q' " ""“ "\`#p̌ƒ“ \`##ƒ9P` :Q踋p@-@0@P :Q&Q)  "" "`#\“ `#l \pƒ  #P`pb :QpЊpp@-@0@P :QQp “!h"L phƒ p@ #4 :pp@-@0@P :QQp “!h"L phƒ p@ #  :8pp@-P@0@` :Q Q# hUh“l ƒƒp  #sP`p :Qp茈p@-@ MZqQp* c0 |0 `00004| 0000408003 Ѝ| 0< 403 ЍT T0 0`0` V:`c3P`꜇D, 0 000:P/x 0 0@-00岱HX0X 00:3S 0p @- P`/\0\ 00 :3S 0- p @-P`/ᰅ$0$ 000:#Ro/D$0$ 000:#Rq/000 0  :#Ro30/܄(0( 0 :#Rq30/ᜄ 0 0 0:/dp@-@P0P`M00 0s p 0S|000 SC q R0 :#Ѝp R 40,00 3/Ѝp,ht@,A-MRBP0@Sw R `P 0Sb 1 P00p >!1pN  0Q`31p0S0S  hx100S0S  \030p   03, p .H$ЍP Q  `*P 0 :# 0`x 000 00k0 0@ 00|<`ht@, @@@-,@@0S004@-$@@0S00@-MT@@ 0S Ѝ< 000 00#0 0Ѝ @-MX@@ 0SЍ 0 R0 0 0 0P@-,MLBL2@PQ :3SX0 b3p `' 0Sha` 0SR1p0SC x0 00 B)1`00|PS 1 20 0Q 8H 20 0X204 0 :3,p 0 P`,Ѝ0`00|P   0 R0 0 0 0$00D  8 20 0 tp@-(MP@0 0@ @$@R8 0X`@ @$@-<0`00:3S U (Ѝp | 0 000:3S/B|X0X 00:3S 03p @-UP`/P|D0D 0@-0 03, p aP`{@0@ 0@-0030p *P`{p@-@QP0P000 |P t0 1h000*QpxP 00 1(000*CBp8{t00p@- P *C T |Ppd  10*p@ xPp,  10*Cp@zt 0 p@-P@0:R P( P PpQ 0 10pht\ L0 r10p Qyt0 000:x0S,01/Q'0QϜ!0CS Q0@-A,PN Q (@0 \0C 0S0U0//Q'0QϜ!0CS Q0@-A,PN Q (@0 \0C 0S0U0//\ , 0 B0/\//0@-PU,NQ (@0 \0C 0S0U000@-PU,NQ (@0 \0C 0S0U00Q>@-\Ӣ5L\ ``Q,p+@ ^PP^P( @ ^PP^Q S(!@@@@ PN U  ^Q/0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-PU,NQ (@0 \0C 0S0UP080@-@@a!80-^\ , 0 B\ 0 ^O-J#d-0RdMbZSUd 3,p0CQB8 ?3 Q:SD0:pP8  0, 0p3S00 Pp #@  p, , ӥ3,  P 00 0  0 JdЍ|B 09dЍOU/O-*,M0`P2U 0!  @Tg `p$@ $冥T+:0pS`KP  0 PP,Ѝ@`00S S@ S0PV%0S/00 04S,ЍO:0@0S A0Q  B20RP 00C P0V 0 0 0C0i 0PS  P@0 C`PO-PQM 43P S-0S*U= 000  0@ 000@ Q k`@ p 8P @0JS 0TPЍD P 4A " 2  -ЍP0P(oP0  0 /  D0D 0M R *P ЍЍ/mH0H 0 M\  ʌP ЍЍ/Hm404 0  R *P /lH0H 0 M\  ʌP ЍЍ/l404 0  R *P /Tl\0\-0 M 0@\ ʌP 0 Ѝ Ѝ l0 0@-0@T J#0R4 |B0pQ $8@-P @Hk808 0  R *P a/kD D0 00SP:P4@//j000 000S :P /xjL0L 000S :P @-p @/8j0 0A-0`V* Z3 S$P! #Rp@4S@pp3Tw A|B0tQ 7AF-i((0 -0 ei000 000S :P j/h00A-M `V$ p@0pp   PP 0pp@  0 *@5Ѝ@hP  P d/p@-JP }3S P`4`30PV  03s$ S"0͠P |2 $R 0X0S P03 |20X #$03p03ppp@(p@-jP 73S @P4PС30@Sp@ɡA-`P\ J3S%sW" P2#@P03R4 R*W LAQ , W00p, #υ B\ bL  | WP3PSSpP4SPkpp3Upp@-@P X0P:|"C0T0XppG- Ѐ\-P@p  `gP LTL!VW R T VW  L000S3;0 R0 0DdO- M0DZ =p`P@5P ( T9 ЍP&P T$   P 0 0 W XP  RXd P P  Ѝ Ѝ0 g00Tch @-?C 0@   @ ,(   @@aPA-@PQP% pW# 0 0S0叠,占000 R   R   R  P xv4r`T `TX *P Q Sp QW02Wap@-`P X0@:|R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S LT00SpX@ |'(@ 8Q 0@0ppp@-@PTa`Q X0P:|20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \PpP00008P@078@0pDp ^T0T 0 R P@0?30Q @ $080///\@(0( 0 Q /L\@(0( 0 Q q/\@X0X0A-`R p P@?`,GH[@T0T 0 R X@0|78@08Q0@0/p[@0 0 [@0 0 (Z@0@-P0P0 M@T X0:|20T1S@0?;@0`@000080S@078@0u Ѝ0Z@P Q@0?30R @080///RY/R/p@-PS 4H `@?DppP X @0*|"7 8@08 R 0@0/P@/'0@-@PP MP X0:|20T1S@0?;@0;<000080S@078@0 Ѝ0X0 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/XX0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/W@-M$@$@0 Ѝ@#xV@@-@M Ѝ@p0p 0p@-@ QP00R ^ p@ p@V@L0L0p@-@ P $pp p@U@p@-P@$pp p@p@-P | @ 00`#ppT0 T ^ @ p@@T@p@-`@P#ppT T  R @ p@p@Rp@-@P00S ^ p@yX p@rO-`,0 0D000D0   0S` (@2D000h0S80@080, 0 R0X>$ 0(0QS, 0!0 8C8S^H 0 ,  @HDHT&,0Q0 (00SE0 R  (Q (,Ht h LT,,R(  4 ,!0 !8 <  , !  <$ 0pH D00H00|00gp( 0H SL01HP0< 8 ,    e, 8 Y Y  RR A P<08 0,00 1 1 01IY0Cڸ P0D00 L  ^/o" R 0YP@r00PPP 00P P p,0 0S0R0S0 \ ɟ`V0JZ 0Z k p 0  P A RyP0  P 0`p PV  Q  `$Q^D PX A0 S04 ( R(  4  R( Q4  *#r LQL 0  P0  \, ( (B ,P ,=P 0!!!QY@ڵ00S5 80q  b pX$ `V \R JZ @ 07 0@NN Œ Č Ȍ N LL\nɟ`V?;p80cT 0P TD0D0 R 0 R PP! YR *Y; $R   0E0 z0p  0E y D000P $ 6  \D000!R@ 9t <000V  0A B $ P=0X *1d"0pC5$  Z< ` 0PP8, ` TpP!Q@000 @0pI 111QU`q 00S4  <0pD P~ 0X *1d"0p<0V @ 40S pV0A0 0C0 R d1SCdЍ 1PVUPm 0 0 e#$ R 00S0 ?3xcQ@APL`@ 0?3T 1HX1QEP @?0D000L00@ 0@0 @  X X [{P7 0L N R @(080 { <00 $<2 0 p`dЍ80 00@ 0Cg00S1$ 0D000h0S(00S5<0 (0 I<00m< 0080@080^Q00C\0 Qʔ@t% -0$ 0, QNp! <,\&`@VP  , ,h<8Ēt V@P P0@, ,p`Q`J @ <P,Up@WP  WP@ P0 @, A`,\,P T ,qDEq@DPP!@X   `  Y,00,0Q0 0, BCR4 R<0084 00C, 00S<,04 00@0@00,0 0400 00 S @`f` P 0, !Yp, 1@S  Y@pL bP0000 0S0000 00 0S 040C04 R00CQ8( 0 0, `FvK @A`j0, \ p(@0 <00  z 0PU`@0V0S 8Q004CQ0V0F0<00DPB  lPp <0P0pL V H3 D|p|4$  D0 00@Q. R+ dP(  % R d1S $ 5  DuPp:U U6p` 6`FV EPEE(0 @,,` 0E0OB0pu 0E B D000P DVP00:  ,0R<00Y,P 0A040 0 0C 0}ʴ& p 0&: 0:6080,@ 0 G40ᘞ 0pSW!P0S00Y0SH 0SLS)0 S+ 0PUa8 0a0 lFP@@D ,HVTH lF@ P0E0PE0PEQ!F00 00C,0W<0p0,p,00 0R0<0 0,P0,0 000 0 0Wڭ@ 0S 0 PCD0U0 <000`p]P4/ pQ, S4S Y4SQV H5S4X  H9$@ 0 cD 00p0 V00P9  o0D 0 B00 c0P P90 0pV0 P-%PO p0SL 4S 4S Y00Q0S8 L5S;  f:$ @ /0 D0 00p"0 D000P D 0D 0 B008  00Q@00 0D000P  T P" $ <@ 0   D000P X<$  0 q R! U <$ @D0 001S U <$ D@0 0PL5S 0 0RU D=$ @D0 00LUDq 0 0L}PhoSPk4SP 00 0FD000$ >@ ]0 C0   0D000ȔY  z G0 {\oD00 H1UPy D00 " UP   @?$ D@00  U00 0D000H%RQC   ?$ D@00 HU0P0PU# 0``U @P @0:0yT0T TT0 CN@, @0PV딥 ĥ ep@-@P0P`M0 R    80x t000 0 00P80  H000 0 B/ 0C?00  Ѝp 0 00(@C-M40\` d0hl8p@`Pp\ P Ѝx80 800 0 pCB`Po_`PЍ @-@P @T1!0G-` 0 DRHpp?spS-, P !Q@QT :!80|0[p@U0 S00? \ R!R0 S  , 0 00@ 0R 0R0 0#0  PR\ P/ PR 0Q //0/p@-PP @0 @T $`U0 V P`巂Vp`f0P 0@PUpT` @埂T @pp  ! !@-@P@刂T R/0A-p,SP` @T @rT0`SP RQ A0@ ", "Q//A-Q*`@pP 0D "! "U0 "! "TQ 0A ", "^Q`X@pP@-@@@0S f$0PC$脌O-:z-*0pM$P( , pPw t00^b Ss @@lRXaoH\0 04@Y @A@0 @TH Q@@[@T@P i``FF\V0^0  | aR\ x`Q'hQ"  @CP(H ,4QT S I@0S $0PC$vX0C,4Q| @CP ^_ S]ʜ80,40SmʈhH`@0,0] $P,40 P@0(@0S 00 CR ((   pp' 8 7@00p(`Y ʞ| `nR`F`V00P0S\  q$0PC$D' 00Q6 $70,'0 4(0P0L0 F @& $P)0S|600S00l0S% 0 S" & ,40Q%0 lP,0S  %$0PCP$,60 R(,Ѝ 6 0( $0(0\DEe@` % (00 S7$%P0C (00xP0S $0PC$H%  <0@ 0,@(@Q 4000XV 0Q[Q $ V 0$0C ,0(@  00 0CS[ pP40,H41 , ! 10z d 4`000 P ^$ $@$#@ P(@h0 Rv ,,Uq  P+ #  t# (@$@ ?#R WH( , #\ $6 (@  P 0(@$ R  2 $@PB lP " 20,,40 SN  T2 0$  4B@0S $0PC$ $ 00P0 ! ı 00(`S7A@ 10(`0 V0!0`Fx P(`0S $0PC$~,@% A@0S $0PC$ j,@(<|p|,ԉ<,XTTDpDІ, @ L`dṔO-PsP3pLC@00 S }4004c`(,P Zh34@2`0T6"0C S402P00S00h0S000S200ʔ 0@DS(00S0 0l0S R H"  4204@,P0T0hPr RP0 @P 0( 0CS P1  P1040 ,(  P,P@ @1(`0 R&T !P  @T 0 R 0 P'  q 00l P ~@T00,P0 0( 0  04@S\CPE@DSP4@,L04Pk _00SL004P,TptP ~}}}P}(@- 004 (, |(@- 004 (,|`1`!0O- T *⤒Y|20d1 00!Q:|20t0`1=Q,00S|20lE0 0!Q:|20h7h0 s0!Q j0!Q n t/|0| 0p@- @00CS0 S 0 S P00=pyP00p@-0CS@0 S 0 S P00pyP0000 0p@-00P~z@ pp@-Ptz@p 0 @-@00J Q T\,Q    @@0J0P\@-\,AP /0S/p@-     @ BJR@P`,PTa@@@AR  Qp03O-0PQ`$MlC@| BzpP 0 0C Stlp ,0A100A!R   A BQ(\ !1C K" Rv   IK4 T0?3Y00 Pq 0 vPP{ 00Y 00 W0(@p ڼ T D H0W D@ 0 ( 0C P7U$Ѝ00$Ѝ8T0 S80 D 10@  B@DT [p`$ЍHȏ$Ѝ 00C! [ @ D0| 0p H0001K [ @T @]xT @ @kX{ 0 0 L@p@-@Pppp@@0@0p@- P@ ppp@@O-@dMpr0P H  0 v00 0KP8  #8 S R0?@P5/@T YЍ0H\8  #8 S R@0刀0@P5/@Tꤶm \l Q" @-@M  R ! R "R pP^ 0 0 @VЍ /@-0QM   S S PpP$8R@ @ ,Ѝ8- M 0 ЍxXD0D0 - 0 $M Ѝ4Xp@- BPP0@\SY ^S9 @% ,S'Sv{cSc\08ŸCA\C110D000000}p000%0>C0{)^A 00NS841@`00A 0 100C\00C0 S\S:S '00pP@0d{%tꜲQO-M  qDPP 04'p p 00R0pp 솟즟 0@P` p ,R&Ti  \@  @  RY  QS%R +NG\ TRQONMqpJIHGFEDCBA3?>=;9876543210/.-,+*)('&%$#"! ?   R PsuP 00Ѝ %@@ i^ @ `f`00 0 "!.Q *Q0 0 0RS@  RP % p0 @  d^% @ @d   R }@     A6  R< g@     A   RyP  % p0   @@ % c  RYP % p0  @ @%@ + c  A 0     B0  < @0   0 @D@   Tp P0 S\R$ W 0`C0@ T0  $ 0  <  n /0000>  0 0S0\S 0 S0 ꨯ0g ,g tc p@-`@0@PM0S PS   00 0Ph 0 Q00QH  < x0  Ѝp08LM8MMLA-M0TSP!00@0@P0S? `40 +0Ã!1!1"b2c0A @ 0L0L  00210BqP 0 pW$P@WP 0fSPЍЍ 0 0ЍD^ NgA-M0TSP!00@0@p0S> `0 1à ‚0  @00A 01! 0120BQP 0 pW$P@TP 0nSoPЍЍ0"0Ѝȥx] kL>C-M0S!0 0@0`0S2 Pu0 plp\1G $@0!b4!b Gr1c1c0@ 00  0#3c`10BqP pЍ 0<0qW X $`0sSP p`VWT 0S mPpPPЍL[ -?L*S0 O-LM l nPL $0$  0h0: 0 P@P:  @P 0S  R `0V G #V =V =q`Pj z0000`tpP[  [Vp p  RR oP X,     P mV m0PSkp@0 ᠳ 3 112cAp3L112c0B0L0H3#0210AqC0P0 `H0 1 $ $@b`Hp, `V @T@plPP=0`@ @0lDVP00LЍ`80 ,rp/"22 Â0  @00A 01! 1120BPQ 0`0@7`  0qpl1#`!L04A 1c1c$0L2!b!b A0 0 0!3ca10BP 0tS0cS0Spp pk0@0`0c`@ p 0< pv0S~op0Y X NgW kL>LV -?L*SA O-p`@P0\ %\0pS sS lS@ 0\TT1DW 001 CR0@CUP$O-(?qMpQ00 P` P? 00S040H $  l0H [ 0  R U0 GP@T `%%T 400 R,B*Ph  4 @@pTP, 40,qߍ@P%T =,0,p:T TI 0DSECB@?>=<;:98543210/.-,+pmP" 400p,1S* 0C11ऀ R 3@4 00Q,*P 0 4mp 40P4qߍ00f0\!0D]SA7Tf  ~x|{|x!00D R`@0A?S@:T AQ: AA DR3@D1p@-1 1OS 0 $pjP 400p,D0?oq2tT 2 jP 4 0,T 2, jP 400,@ps0p0@m 0 p f0 0a0@0\0!T0 ~T00<';N00K&@D0q0VT񏐨S}tb\VM:}|{zyxwvutsrqp(nmlkjihgfedcba_^]\[ZYXWVUTSR000p0w- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/h'A-PQM`p@ 0S! WC iP X( 0x0 X T 00Ѝ/PP0T0j 00ЍT cT]p 0 0 R T| OuPp0S T< >, ^p 0S R 8(C8B((0 000ST00P P00@(P P00@TT@4,; PW W @W W ht@%V tV HU TU U 0R@- MA0S@  ЍA-pPP% U) .0S`$V  PR |@P0DV !o PO-`RM pQ  0 Ѝ@ PPb % UPc OPd \%I0 FS  hPM  p ` p pp0S  p  p0S  p  0S 0S 0pSa 뼐Y$ PT [i$%!hP !hPhP 뼐 0$YpP " Y) $ @ u (B8BBxnS0 sS fSS0pS  U R00000 0 + [ @:B L뼰p[ qK +[p  :뼠 5 8C8Rp 0U  $pWe ?o2P  pGx?'x W !8   X P *   0S02 0C8#800<p  0 0U QP‡ W0僰 P000 0pQ pU00 0pj0X0   0p /U  R00Wdh  +gP$) p0(C-PA!@M`p 0f P *00'0S@ `Ѝ|@P c `0 p  R 0S 0LP` >Ѝ` Z 0 P  P`L004@@@+ P*6@P%N D$0$O-M M0p0:S%0:SS@ 0PS:S``E[ P* ;0d@0  jP 0P:S ۍ Ѝ@ۍ ЍC-PŸM Mp@`t%P> 0/SN P gY PE SPP 0 ۍЍC`0P P! p fP40  PۍЍ0P 0S/S pP pJgX0 ۍЍC  p 0e3g XW P0P 0 $ۍЍ404 0 $"L K K |K pK J HJ J G-pP @P  ^`gV  UP l``@`P @T P00@0A0G I 4``-@- M@00 Ѝ@ Ѝ/4 Ѝ@ Ѝ/@-@fff@ff f0f@f 0p@-S@M 0000Ѝp0P0 0 0 0` 000Ѝpp@-@(PS:pS eP!p+dC- M `@V pᬐP0fU@@`V   W0 nU sU  @ `V@0400 Ѝ R@@@O- M PU' `pfSPU  v *@8C80P 0nS sS  b@PU00 Ѝ 0S00PA-P# P 00`p` ,RR    0S,S@BcP  , (`p`@d C- M@`P(P@pW[*nUR sUI fUH0D Y)RD @ dP% H0D@ pH0@0 H0H0nUp@0 H P6 sUI fUA L00L0 Ѝ@P Ѝ @AP80pY D8 0400 "c 0S00 80 @H0R# ,0 0H00H0H0@ HH0@ 400H0@04 H00H04 0H040, R0 0wH00H0 b b O-0M @0NZ P GY p @p(080H0b0PC 0 `00 P0=0  P 05 P⺀/Z P  P ' P  p! Y    p p 0@ 0 0@Ѝ1!00@- 0 @S/ 0S0Q @\T 0S0 Q000@T0:PA_oRET  \S  R 0S0@x0T00qA-`P0PUM@p"S& cP !   开0V00  p000 00 0ЍPЍa  p000O-@P 4M #P "d`Y`4 p|  PP p B.c 0P 0O d` -Pc0P c0 0 4Ѝ  04 cc,`0V (0 0$0,0$ HP,p", P AR   0S00XPr `V   [㼢  P"0 0cL0@ Z$ H0@0D0L0E ,pf[8  ` 0 `P+ Z+  RXEEhn[EX s[ "`0S   ,P` `0 0$ac 4Ѝ  R`0H0 0H0 0PVZ Z A-P`0`VM@p(S, WbP$ A  往u000 Pl00 0d0 P P ЍPЍ`0@-P pW M@`R bP 0 `: 00P 00 0 ЍP Ѝ`O--TMD0 D:0,08:0,0`P| |,|zPP00ᆿ@P00PQU P^T 9POPtaP  P T 0U 0, P  H)0 8 <)$0 @ 00 0hFhvZ 0s 0 PS , P R 010#.R00SOR9 = (@P# #PP @ oHDHt 0n  P LHL00SPP P%0 ! 0S t 0"000 0000 n0PM0TS0 PR$0pW0(0 $0S 7aP: $p  0S` 0@S  S4 p 0`  '\S  R}WC%Y^SY @Yw 0` 4 0&0HS 'v 0P_ a TЍ @0@S hFhvP @0f  FPA P;0`C RE C/RVoTSRQPONMLKJIHGFEDCBA@?>=<;:Y^76OW3210/?-=+*)ESO0PpS@ Ss, 400 @ 0 @P$,   P000Pp^3( @ 0g 00P0p0 00 00 0 0(  0B‐St 0 S00 P50 p<0P00L^( 80,  T<0aT0`FPV``0pp 000 000000 s0 P`P hFhv XEXu3 @0n  OPJ 0S00 HP@  08xP0 000000 000 f0 P XEXu0 0@s 0  P0P   0 v` TЍ?Y O  0 0u0 z0 rydD kr p&hP|@j@X X PR P DP O O O N N P/f$P00//O @-M@Q0 J0!1l!1"b2c N0L 0 0@@0$@B!A@C0PЍ赁NN g P0`0K?//0N @-M@0 0C B0  N\00L 0"2<@0$KAB@C1dPЍkLM >$0P00?//DM @-M@0 0C@N $@L0B!b4!b N|1c1c0L?AA 0 0P0@$D$C!d!bA@C1zPЍ-?Ll *ShL p@-0MP0`2z@P 0Ѝpz[00  R 0S"0ЍpLb 1!0G-@q0PP03 0 4`S 0`02,0 PP00|Q``  VPe`EȄQ  V|0`0ȇ`H00@\@@-@P _^^ ^$^,^^,00!R  ! 001/001P// @--@o \@\ @ 00s@ H dPJI HH @HZlp@-G-(M7@ @`0@PS~lXiV2B=*ufN;'p(\x_~wmYY7$Co7i &SRQPO]LKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!  " kU{F{{!00 (Ѝp0P0 P 30 0U f U{kka!00 0P0 ~P L30 0U 0"P  0cP0J30{U 0kk yP  0cP0G20U 05{kF{{dPr  0cP0t20U 0x 0"RP=  0cP0x0 0U " @P?  0cP0|10mU 0 !a1""YJ)P2  p0cP0%ژ 0U " R b0cP0$d10U 0T1"" P  P0cP0$10U 0 1""P   >0cP0@00U 010""P@  ,0cP0@ڜ00U 0 0"P  G??Yl^ ^ \ [ P[ [ Z GdZ Z Y Y TY X 0cP000{ 0kF{U{% P  0cP0uڠ30{U 0kk Pd  0cP0\30{U 0kk5 }P  0cP0n30U 0_3""kPH  0cP0L20U 0=2""YPS  0cP0ڔ20U 0x2""GP  0cP0EP20U 06`2""5P9  |0cP0 20x{U 0{ $P  k0cP010g{U 0{ PF  Z0cP0ڌ10U 0`1""P  H0cP0H10uU 0 PE  70cP0k10U 0\1""Pa  %0cP0&00U 00""P  0cP0ڀ00U 0t0""P  X 4X W DW V pV V U V U V T T S GdT T S 0cP0(,00U 0<0""P  0cP0l00 0U0"/ |P  0cP0ڰ00 0U0" jP  0cP000{*Rk 0F{U{ UPr  0cP0`30U 0q3""CPf  0cP030U 0<3""1P  x0cP020U 02""P  f0cP0Wڔ20U 0H2"" P4  T0cP0HT20 0U0" P  B0cP020 0U0" P  00cP010fkU 0{{{ P  0cP0ڈ10U 0d1""PP  0cP0 <10@U 0' Pe  0cP0Z00U 0K0""P  0cP0ڸ 0U "7 P  0cP0qt00 0U0" |P  R R @R R GhR pQ Q P PP Q O O O N N 0cP0_(00U 0P80""TP  0cP0h00 0U0" BP  <P  00{kF{U{"00 t3030vx303 U" "00 aH30@303 U""00 Q30\3 U""00 D20{Ukk!00 720202 U"$"00 'x20p20c2 U"!00 @20}t2 U""00 2020L2 U"!00 1010$ 2 U"p!00 10b10101 U"G!00 `109X10kh1 U"o!00 (1041 U"b"00 0000 1 U"BR!00 00400g0 U"B"00 00N N N N M M PM N M L M L TM @M TL L L LL tL K `K HL 8K K K K K  J I dJ I I I I ,0 U"T !00 bP00FX00`00.htp00Nx0 U"!00 I00{Ukk!00 9303 U""00 ,30{Ukk!00 `30vXd3 "ZI nI 3 "U"00 30{Ukk!00 20{Ukk!00 20S"00 "00 t20 0h20 0A )y :PI S @ p"00 k"00 f!00 a!00 kkZ!00 U"00 P"00 K!00 F"00 A"00 <"00 7!00 kk0!00 +"00 0Sk #!00 {0S6 !00 s0S !00 k0S !00 cP  ]0S !00 U0S !00 M-DT! @I PI ,I I H xH ,H J J 0S "00 50S !00 -0SV "00 %0S1 !00 0S "00 0S !00 0S$ !00 0S !00 0S !00 0S !00 0S2 !00 0S  !00 0S }!00 0S u!00 0S m!00 0S e!00 0S ]!00 0S U"00 0S M"00 0S E!00 0S =!00 0S 5!00 0S -"00 0S %!00 } 3 H "wP !H H 3 "0SG !00 c0S  !00 [30 0c|30 0u"00 N"00 I"00 D"00 ?"00 :"00 5"00 0"00 +"00 &"00 !"00 I vI 2""2t0 0໳2T0 0ಳ240 0ੳ>20 0࠳d20 0@20 020 010 0|1t0 0s 1T0 0jI140 0aU!00 X10 0TQ410 0Kh10 0B70 000m0 4I0p0 0+?(D C ǸC A A \A `A A B B @ B A @ @ @ dA ? @ `> P> X> ? ? h? ? ? > > < h> 0> < D< 0P0 040p0 0.X00 0|00 0߲\0 000 0 Ѳn0 0000 ò180 0າo41X0 0౲&X1 0000 ࣲh!00 10 010 010 0@2 00080 uH2 000l0 g 20 0^20 0U" /L+SC @AQ0@-OQPPP 00 QȠ\ 0{ +C 7G 00+C03Q Q 00A@@1 0^\nk 0+C {6F{7+S 0+C0= = /P 0S $0S 0S P? @4@P//A-pP`8\* ,0S( 02 ,04 0 S4G0CV@1@! V @D8 ,0400 G 0, 400 (@ 0( 3/P840, 0S00R4000@-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?0$ R(400  0=@0U 0PE@T$0S0  0 P=@0U 0PE@T$0S  ($  0  88( 90,K  @U 0PE@T$0DS, 0 G0+@\<0Uz 0PE@T<($(<,000@00<00SE 70T<0 00CSW0S; 08@;0 Q;0(0 S0(0u080 t0890@kL;0U2 0PE@T0S ;00;0ILQD0ʆ;:0\0T 00T :&0PE00@SU0 pC0 0,0 S P<@@B0S 00*S30 PC000000 00 00W0"1<0 S<@0@0R0 p RR<,0 0PUS0S00)D9 0 <0 30DЍ X R S R  %P$0 PpB 0Se 00 0 C0 S 04j0U 0PE@T 0 B00 00 000R00SP 0S($<,(<0$(0 0R 80080 00 80B4 R,5@0 00D 0R1 P! BD A   B\000D0Sx70t7 UR00\0 0 P<@@ *0|'S ʆ0  P<@@ ;TU 0PE@00 S  S7 S$ 6威@D00@T80PE@TULQ{X60 Ql H0 @S0 0CR*ʆ+R 600600 pC00@500 pC00ld h ^X0Pt00001p0T :0PE01p@W0U Q 0SU 0PE@T 0S 400l50U 0PE@T:0D 1ʆ0+8@DD0\Ux 0PE@T:0!H0ʆ0H0;8@DuDp840W U 0p1Wp!WZ 0 0C 00 00D0PE0CD00$Dpl `R*$0ATU< 0PE@0 0Rl @D⨁:R (0,00C 8 P0l0S>0p0P00X0?0X00 p0tP 200T30/ R=0 U 0PE@T20H?o20$0S0E "d2$($B0#22cR:0S 420020 0F$Q   R D Up1p!W'R0! D $ R! D $ R$!  $ R40,0000 l100BU  PE@T  & !X# 100\100+0008@D;Dx00 R 0 B D  0T005-9 9 6 6?7?8?=?>?N?O?5?3 J?P?'M?1 H?A?L?d/ x. C?`+ B) 9?:?;?0@\4 @Dʆ+8_(4威@D0A D0B L4p(8#W" \40040SQ  8@D;D _ 4 +04HL0$ 6 400406 0@S4Dp0H Z0PE@ZU8tgx|p@ ⨃p ^&:l0 0:00pZl0 0S50P0;T0l50 0X00\0, @D5威005@D0 ;@y 60050 0@0h(4890(8 (8:0;d600D60x6l 0ZZj0PE@ZdU0L0Sd  0 6  0p41q岠pT*Um 0`4`UU PE1q岠@pW0`8@DQ{8@DD-8tgx|p@⨁pV7L00 PpC? 8(89i0+@]\8@D 0w@D(4l8l0U0 0 000P0<@@O0 0`pC( (0R@D0+S(0,80080$S>0p0P0 0X00tpXp04040P. H900 8( 89heSR: 3@ 0@0I9@0i900900 pCp T  d\ 0  \ h gP 4:000 威pC0@D0d:00l:0 0S|:0W0 pCp@-@PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S   0S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /"2 C- M0P000f@Pp`W2@ R2Q <00 00S!B <@0 Q00cS R#2^ S3#Q0S1 R[ @ <00 R<0@ l0pWPV H R 00cS  Q # 2R S 3#R0S  l0pS0pCp)x 000 0P,04D0p0 p0 0 0 30 Ѝl0Sl0@@@cS???|P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pPWPYP 0!(`3/@PR 8X8 (  0(3/PI 8 Ŵ(!P S>0Rp:oRS B P T  B T p X0Bp (0 #8ᣴ8@p 0BS.  p 8 ᔴd ᐴP S>0Rp*p 0BS.  p ($03/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?00@C/O-MP@ @㬰(0?U 0C0 0$SP $C`0p sRpW(-0 p p0Ѝ0` Q`V00p=J\S 0W0T0S30b608#8P0U 00CP R"P @U\! V0! 01 002T 0 T 0SЍЍ 0D?o240%R00S020,0@0000,004@0D?o280(0 0  B<00 0$ 0 0S03@05 :^N , %0! ' %0 %`03!305(0<9P0C1P RP@00F3 0S C 0 $Q B("(R$AVG  ` V$  \ F ( Y FV(*Q BR  BR^ : 8 Q  Rb4 %Q  R\<  BB!   S @@ <01( 00 ,0, 0 00008@, 40S  0O-0CDM000 C  2 00!8ӗ1х1&=  x l0tJB H0Hxt^Hl0:8HpXT`!4Dp`ᶐH@ᰐ00Rx0 Ph`0l \0S8 B0l0\000S[ tAP`tx0l h Rl R010#P60 6SB \0P8 B_l0\00PЍl8  R&0&0& PV) )h0\0P8 B2l0\0{00SЍ  O-T$M t<4Yl 8H0XT0#D04@@QH0  ,0BA?C0CP`PƘ_p00B8#( Ƙ#<0Ƙ@l30 B0(1I>R<30+"8ӗ1҅1&=  `tQI6 Y0 60Rl00XP80tT@V` l H 0U#@H@0 Sl \P8 B0 l0\000S}$Ѝ806&6!ƈ9096tl I Qtl 1Y^ 't1QX 0S Q. Ql kP (l `f@ p400D`H0A `l @5!0 PH0  ` 0ll R1#:\ 6S \0P8 B 'l0\0p0P$Ѝ\0P8 B l0\0^00S$Ѝ   0, 0CSO-0! M00@p0U\Zi6P*0U 1oPEo:l0\`匴`C 0 S[ P1[SEWo᫲ZSW 0 0 0B % B 0 0B 0 #40BV V0\ 81!  ᔬ\` 0  PE 0C ` U0 \`  Z  BP  P 0P `S , 8Rr06Ag,0l06\00P `Sl0&R65UP    R\ S#P Ѝ<``FV*\,\8 CLl \;6&S06l0R, ` 6V`!VW\, Q* 65@ 0CP!P 1RV G/o"S W  R  PR#P`1`!WG80  =\00\0YPl0<AQ0Cl0 6&S06l08R6 J  ޫ6,AQ  l00l0&n8 j, l0B0Pl0\P`1`!W 8 0 \00\0d  PR#P" 0S $0S 0S P0X*SES[SgSqS9 CS0//O-MP@`?o2P0S}@00Sx S t0Ss0,0S$ RiL0Dp 0CpB ᭯,0lp\pv`FP0*SWtpWT 0k ,0V0pG**0  00 P  t0S"l8PLPXTD@p4`H0 9*0Ằ QH0岰0t0lt0Sl  l \  60x0`00 th  00Ѝ* ЍA-@P 0S $0S `PcpP l0t,@0S@1VTU@80C Ҫpp@-@P$ 0S! $0S ?`PP0 S0c```,0S`  *00 00(0p`p 900p@-P@P pP,0L D0<00 B@C ۮ0\ 0 10 |0:l@\@t@Fx ` h@H@pp@-@P 0S $0S PP0 RPppp@-@P 0S $0S `PP V000U0:60ppG-@P( 0S% $0S" PpPU0&0R:k`@`U@40C00 0 &PUWtPPA-@P P 0S $0S p`|P0p`P|0A-PpQb!Tc@Te?P0 R7 R R0 P0R SP1S$V$W\U!1\  R R bQ$ R bQ, Rl R O- M`䯟 0P0 X  0@S P X0 SQ\ \((PX\ L\  RL/Sv0S[Q gQ 0St0S 0Sx RH R .0 103/0@S0S>0 X0S S000 00#400 0 30  0#400  0 p0S0c0?o20 Ѝ0So= 000>Sq *S/0Sq00 0 0&S+B{l0S=  B0#2 2c0# 0l0Sm q000*0S9QI B0 00 t0  R 0,0S0Q0Q0$ 0Q00R 000 0 0 0#40 0  0 0 S0 S 00R01 0 0  0S 0 0 0#40,0S0 0E00Q P p K 0S  0PESPo p W *G $0 ,0 SR0 B0Ztp 6l8&`6&6!ƅ909&tpl0pG0Qtpl0` Wt0SX$ :Xvy 6S \0S8l  B0 l0\000P0S P{X: X!0S0(0 Ѝ0S 0=0 0 0 0 0 0 S0 S 00R01 00 q000SEQ0X P7 R #0SS@ }S  y 00#  #800#"0 w0  0F ,0 QR 0 0I000S'  0 0S0   0S,0SQ9:{ RY,0S  R0 0[00$0S,00  0$ 0S0   0S,0SQ@:M R+0 B0`00,0S!  Rg  S 0 Q*0S 000 #4090q000SE 0 B0+0#  #800#"0 IQ"V\ R8 C0 l0\000Sj`ptZ(l 8`pR B 0 ^L 6ƅp6ƅp6!ƅ9096&tRl0A0tl0 Qt QX Q Ql 8`p0 w X 0Sq0 B000 B00,00I ^ ^<00 Y Y Y Y Y Y Y^ Ioᩒ#Y0C0KS`00`S&&p 0C0ƅ0 01I>  0001&=  &6tR` l0A0`ptl0r\ R8 C0 l0\000S500 0*0[dB  :XF 6S \0S0,000= h0 0000 B00P0U0S_8 `ޣ 0p!(3/@PU X!@ӣ 0, (P3/ 0, z8(3/ 0L @(3/ 0 D(3/80S. @ R+ D PR% , 8 ᨣ, @@ ᣣL DD ឣ 嚣0 0C006& 0&;> 0$0;/ O-QM R0  \ " !#4"  `P `p  *@+)0 @$ %q 0 1Q`!;  Č ` 0#:  Č (9  Č p'4 6" Č$ !Q P%D R`  ! @0#   R#4,  " "0 0S"$,00# "0 0S"$, 00#0#   R#4  P% 0#  R#4  PUTp @RR.0R$D. R$.0#0A0R.$ AR.D$0#00R$D. R$.0#0APE.4$ AU#D$ 0 @  P   " !Q#4"Ѝ` " R !L -Ppp P l D ( C-`R! p `  01D0 ^00# PL  "`@P@1\0 C @$!p C-`R! p `  01D0 ^00# PL  "`@P@1\0 C @$! @-@P xpxPp`@` 01ē!0Q0 0#B   @-@P xpxPp`@` 01ē!0Q0 0#B  4 0@-18P@\0 C @$!0 G-R (h Q R@O(sR$cW-mPVMD0@D\\\ \ 0\  \ 0\\00 0\\0\00 0\\ 0\0\0\ 0 00 R8΃7` cVV- 2T0HN0 T"R @0Q1X1H#H7cN1P @@1^NNTUD0 P P, R0R0R R0R0R0R0R0R0R0R0R0R0R0R0R00U0 l@D B @0 QD0'7b"c2HNVME1@Dq$R'@-7Fc20B c!'b "0C0  L A R,A B<P C,0@P @@ /qR'@-7Fc20B c!'b "0C0  L A R,A B<P C,0@P @@ /q/ U/ 0`0/ἡ47ς 1O- p:PTU$1` Q U @ σ1\KU`0 ẠZ 1 @1: 0V: Q- ^ pQ Q Z @00O-DM pPjp5W@T4PPTQ=N0 PP0\ˀC Y Q 9ʶ 60p\0 1 0Q-p qX䰠 60C6Y 0 QI 0CAp P0 Ȁ  gXQP4 !\˒0C`K P4`ˀY`;T$Q BXKT$T;往P PQ͌Q-PP ^ Ƞ 1 ",ȠA  `{6P4pSTP I0`T$!\. @   p֣ 1Y㲠bQⵟPP 0100W0 [.0^A  װ& 0А##U60 6<,Ɔ0 SZP. Y> 0  JJ0RP LGP 0 QR0C Y> 00 B 0 \0000C01 LR  0P0N  @0 00T0 0s P\ R @00SC00 R0P\DЍWP 00YQ / !0@[1^PG65#6pQZ p J0 0=A-@1^PRPA@D@0+}nR- R1>000^ ^P0T0 S ^ SΌP^00 P0P0 S0Ѵ000°0Ѵ0O- MⲐY``00RCJ!Pk΄  R7 Q. R2 ৎP01nh Q&80pNFh0`0#4``06cUQpPv R0Sz P`0 [ ЍYf0q 8YC8 !.P&pe(WB(0 `p0p00`#4pp06PE`0cQ38C8f6PaUx0Gx#800P``pp0P't``pvApg^xGx B(Q"(a0APP0#4PP06cR!0C 60S 0 SP`0 P`0 R+=ʲPpeW6y`p8C8000`p#406PEP0cQ UAVfN.0 APP 0#4PP06 c^ 0C6qpPp6gQ0#80A6`00Gp`p!0aUQA6 S, N.0 APP 0#4PP06 c^ 0C6q`0f /P UAV B("(PV^ B("(06VʀO-kn6@SMN 3003P0030 0300300%10 Jb ^@$HN@@p@p. BnS.HN@ἦ6S&00H DH4P  p, Ḁ! @b T H DH)& B @@$D @F @dXDHDH&qZ" tqN.r@jTHp DH'x&pp@@p$D@F J @d^DHDH&0CS㎀ޕޅq᷀ಠBj^@$HNI @@ @"$ &J bX.HN@ἦ p#Rs `D0C8#8JO6S@ἦj 0c Q.AP`kNP!``0C0aR! 6Ѝ@ἦk. 06Ѝ 6@-S k>@@0 #400k.06S0 k΁0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&ʀA-Pk@8` R.; pNp "$pp &bS0 B0&0  8#̠   4##<V0 0 {    &*60@-S S00k@@6 0C60k>@@@!PPƂ0k΁6 0@-# SH$(<0  PDHP@ 0@#4PP06 c^ 0C6 S0Ҽ60k.@@0@#4PP 06 0C6S S00k.@@6 0C600 6 k>@@ @"$PP Ɓ0O-@ MPp,0S ᔀ&]P+(+%0 N. 0r?010S!@P j600&6 0!R1Q  S030#Z0Sk 0("( Y9>8C80 00#40编0iR#8 IC8἖(+ ,K("( Y98C8k0 00#40编0iR#8 IC8἖ Y("(98C8k0 00#40编0iR38 IC8἖ Y @("(98C8k0 00#40编iR I!἖T30M>0k.꼖ό YȠ,LȠ἖ ! Ɩl^ LƆP | y 0x"0 P0Q ;S ;S <SE S 0R  , &] Pj0S  Z R, 0G.0 0R0 0xS0  0LSI>W&&&& Ѝ ЍO0 &k0! R2 ʸ006N.V g 8C800 0#406 cQ 0C6@!!἖:8C8἖8C8἖8C8἖  @  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF 6@o0ƓAƃDQ  !I.!ѕ"х&  P p@-@P`d0P \0P 6@T @@pVp"(@ pyaratcid@-M @PoЍ苝@oЍ@-M @PЍ|@z@Ѝ@-M @PoЍk@oЍ@-M @PЍ\@Z@Ѝ@-Mp`P @P K@Ѝ #p W/Ѝ;@P/T 0A-S ` 0@ Cp'PS#U P 0 0A-S P0@PCp'`8#V `000A-S ` 0@ CpP#U P 0 0A-S P0@PCp`#V `͜00ʜ@- MP !#p 0S p@0@Cu'`"V ` Ѝ譜0 0 Ѝ覜 Ѝ@- MP "p 0S p@0@C]`"V ` Ѝ舜0 0 Ѝ聜 ЍA-Mp@P `P "p . 0S P 0 C, @"T@ ЍW`ЍR0`0ЍK@`.T` Ѝp@-@lPz0PPptcidp@-@`Pn$0P p!00ploobp@-P`!@P   @ap@-@>@@-@8@@-@2@@-@,@0@-@&@N@-@ @]@-@@{@-@@@-@@@-@@@-@@@-@@@-@@ @-@@"@-@@8@-@@L@-@@b@-@@z@-@@@-@@p@-P`@P   @pp@-P`@P    @pp@-P`{@P   @pp@-P`i@P   @pp@-` PV@P   @pp@-P`D@P   @|pp@-P`2@P   @jpp@-P` @P   @Xpp@-P`@P   @Fpp@-` P@P  z @3pp@-P`@P  h @!pp@-P`@P  V @pp@-P`@P  D @ pp@-P`@P  2 @ pp@-` P@P   @ pp@-P`@P    @ pp@-P`@P   @ pp@-P`@P   @ pp@-P`p@P   @ pp@-` P]@P   @} pp@-PZ@h(0P p10P 0pgntsp@-P`@P   @Z pp@-P`@P   @I pp@-`P%@3HP p6P U %00ppatadp@-P`@P  c @ pp@-P`@P  Q @ pp@-MP@ d0P @Ѝp  x)`P  @P`+Ѝpgntsp@-P@ (0P p0P 0pgntsp@-P`3@P    @ pp@-P`'@P   @ p@-@R  @ p@-@"P $0P p00ploobp@-P`@P  # @ pp@-P@P ?#@y p@-@"@@-@"@@-@"@*@-@"@H@-@"@f@-@"@u@-@"@@-@"@@-@"@@-@"@@-@"@@-@"@ @-@z"@$@-@t"@:@-@n"@P@-@h"@d@-@b"@z@-@\"@@-@V"@@-@P"@p@-P`@P  k" @ p0p@-P@P "@ pp@-P`@P  H" @ p0p@-P@P "@ pp@-P`q@P  %" @ p0p@-P_@P ^"@ pp@-P`N@P  " @ p0p@-P<@P ;"@u pp@-` P*@P  ! @b pp@- P@P "@Q pp@-P`@P  ! @? p0p@-P @P !@. pp@-P` @P  ! @ p0p@-P @P !@ pp@-P` @P  u! @ p0p@-P @P !@ pp@-P` @P  R! @ p0p@-P @P !@ pp@-` Pz @P  .! @ pp@- Ph @P g!@ pp@-P`o @P   ! @ p p@-P] @P D!@~ pp@-P`L @P   @l p p@-P: @P !!@[ pp@-P`) @P   @I p p@-P @P  @8 pp@-P` @P   @& p p@-P @P  @ pp@-` P @P  ~ @ pp@- P @P  @ pp@-P` @P  [ @ p p@-P @P  @ pp@-P` @P  8 @ p p@-P @P q @ pp@-P`y @P   @ p p@-Pg @P N @ pp@-P`V @P   @v p p@-PD @P + @e pp@-` P2 @P   @R pp@- P @P  @A pp@-P@, (0P p0P 0pgntsp@-P`@P   @ pp@-P|@P @ pp@-P`q@P  z @pp@-Pa@P @pp@-`P7@ HP pP U 00ppatadp@-P`l@P  > @pp@-P`{@P  , @pp@-P H@P e@pp@-P X@P T@pp@-MP@x d0P @Ѝp4  $`P  J@P`;'Ѝpgntsp@-P@W (0P p 0P 0pgntsp@-P`@P   @Ipp@-P@P @:pp@-P`@P   @)pp@-P@P @p@-@Q @@-@R  @p@-@0 P &&p@PPc!0S ^!pW!0X$@- @@>!$ `P 0R @-P Q o//\ P 0S p@-@L`P`PpwP p@' ' P e0 0 o@-x T @-P Q @P@ @0@ 0 a( (0( 0 b t D x 0  0< @-뤭 ` m@-0P M`0! #@P 0P0 `  Ѝ&ppp ⠊P`   %@ Ѝ %]l!@- #@P $0 0 0  ]A-pP #@P ~0 0 0 `w#PP  P `0 000 ,0X @\ h @-@P Ԏ@ te-@-M(pW ,P0  P$@P?#`P  0 P$ UЍ@Ѝ/Ѝ@Ѝ/ 0 0t 렪 p ܩ Ec @-@P @ 1"p@-@P x0 00R0 P#0P Q ! p@^ppZ p@-@P `0 00R P"0P Q ! p@p@Z P/0 00R /YP/<0 00R0/P///Y 0P p@- o QP  QQ !/HY P/ 0 00R/X@-@P \0 00R  p"0P Q ]!00X P/00 00RP///X @-@PM 000/o"P R Ѝ R0 ` 0 `p."PP 0 S  R L  # `PP b$  00W @-@PM 0 00R ЍQP! 0 s pp !`P 0 S d  P" pP` )$000( (0( $0 V \ @ + P H0-00/o"^ R  R/UP/D0 00R /@-P ohU P/D0 00R /@-P َo U| P p000/o"\ R RP Q  Q೎ /T fP 40 00RP / T f$0A-SM`"P@U Ѝ0 PP 5!pP 00 0wP S o# "!@P d0 0 0 @Ѝ4 PSP  ((Sd 0 //p@-@P& R 0P:P PpW" P `0` `0 L0L L0 808 80 p萢 < P  l p@-@Q PPpQpp@-`Q4 @&Q P Q) <Q >QP&PQ PphPPQ Ppp@Jp@-@<PEPp/>P Q 7P Q>/P  p@) 0p@-SP` @ 0S @Pp<P QQ P/P >P  p@p@-<X@P@(@Q Pp$pP  p@ $@-@P@Ğ p@-@P  PP 0, 0p"@"p@-PQ@` .0 S S   CQ R 0 S S CQ\<S0S !S0-S 0F?o2-R0S0S -S 0-S >R/S `(` 0 S S  /S  >S   C\  R `Sr 0 S S  /S  >S   C\  R0FU0 P[ VPV0/S_ 0$00>Sc Sj 0SI S S   0CS R` 0 S S   CQ RS3 `0 S S  =S   CQ  R  S! 0 S S=S CPQ`B`0"S0S  0"R. "R+ Rp`FV0S 0(0k(0S0$00>S`0`000 0`pL L0L H0 0`tC  >R00pX P\ @-Q RP <PG &P@aT lTtP6 @mT) pToPsP;P'gTtP;P>qTuPoPtP;P"@pT@;T;P<S0S/Q /0@- UoO-p-KM `Y됊0:P10 0 0Q@@0 >SS @S@P@ A-PRM`Pp`0 @T- 0@0W  WV 0/RA 0CW /RW  CW0  B/Q p!@C@T@!  ;@04D .00͈ 0 S* ވ7\p@  U o0@Nh0@ۍb? 0 ۍ[ 0 ۍ S0'p PDnp %Cp;@Ԕ C-`MNmP@P4 ,p`F ~p@ pEe0R8p"0 `hp)    000hp! 0PPЍ 0 0 `shp  Ѝ@Ѝ@@- @i@@-2_P 0 0 A` ܑ O-IM  @T V 6/ p0  PS @Tv 0 R 2/0P`_a P0 p0 3/V@ 6/T ^T T @@T. 0S2 0 3/P V 6/^0S @0 R 2/0P`^ P V 6/X3 003/Iߍ 0 0C/ 0 0C/ 0 0C/ 0 0 0 |0 l l0l 0C/Bt P ؎ ,  E l l ; h L p@-P@PP  P $0SP  R Ppd2SP P ZPP , `PP\ , Ѝ P0/O-MM(p@ T 000 000S+`P$  T%0 `P4  0@ 4/@P`P@003/0 @PMߍT00 0^P $ 0R000 Mߍ R00 0 0K/Č p L  0/0/@-@@XP 00#0 0 P 0S S R/P/ R0/  @-@<$ 0p@-(M{P@ | { h``VP (ЍpD { P j(ЍpČ X $@-@3`@- @@}(,L9p@-M@PÊ` `00Ps0*0 00 Ѝp譊0"Sp@-M@`ᣊP Pqp 0 00 Ѝp菊0"S 00 S 0 P:\03#/S 0 P\0///A-P``Ḁ@P  (pP ៀ@P sNW@(0( (0 \ 47` d 00 S 0 P:\03#/S 0 P\0///0@-M @P  @ Ѝ00@-M @P  @ zЍ00@-M @P  @ lЍ00@-M @P  @ ^Ѝ0@-@P ,0 00R5 /P/0 00R / 0  Q 0R* R0:/- ^ : P *0 S0*/@@/ / 4P $0 00R //3P $0 00R //3P $0 00R //`3P $0 00R //(3MP 0 00R 00Ѝ/ 00 0 S *  0Ѝ/  \0%*00 Ѝ/2P/l0 00R / 00 0  S *0/ ɒ\* /@2P/|0 00R / 00 0 S *0/ - ^: 1P/|0 00R / 00 0 S *0/ - ^: 01P/@0 00R / 0 0 S /0P/|0 00R / 00 0 S *0/ - ^: L0P/l0 00R / 00 0 S *0/  \* //P/l0 00R / 00 0  S *0/ ɒ\* / @ 8 > 0P D- ?o2 ^0S 0 S./p@-Pt@P IP 0 03/P ZP @vpw@op0S /p@-`P@}P $0S p p@E3 p@-P@PP p qPP Gp,u0@@'u@p@-@P "0@F,3 011/A-\@`pP \"1S 0 €  P 10P !`p P 1@0@ @0 Bm,0, ,0 Ae> > ? > @-\@ ^ \)QRS  T00 QL R S "  T € 00 0 0 Z > = = 0@-@R00Q,MP! P! 0       LVT0?o20S00,Ѝ00 = = 0@-MP@0  0o0 0o0 0o00 0P   SЍ00@- M0P@o o o000    S Ѝ0 00@-Pb"M!4b4#  @ 0po "44 0ho "44 0`o00 0P   UЍ00@-M 0P@ Ho 0b" b! =o "440 6o0!$$    SЍ0p@-@P(MP`/ 0S, R00n$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 gM P0V00(Ѝp@ R 0S V00`: @- @+sT00@-@Zp00T000N@-@"T @-@T000 000S/@-$dx000 000S/@-dlx000 000S/@-d,x000 000S/@-cx000 000S/@-cx000 000S/@-clx000 000S/@-c,x000 000S/@-cx000 000S/@-cx000 000S/@-clx @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^  \#|001/4001/0 01/0S@-@1/00/h0h0@-@ M\P Ѝ#cP ?rЍx/@-c-@-000 000S/@-c xAo//- M0 0p Ѝvt- M( hPp Ѝwt@Q- M Q Q q 0 Ѝ K Ѝt E^t ($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@p P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P l8000 0@0 !0#2 /UUUU3333  cT: S- d S V Sb00Z r - !=w- S ^ >S-00 @Sx00: r0-0 0w0-000 SD !S-00 Sx00p!r-0w- P8 P2 P8 Px 0    Ss00 ! Ss00  Sp00  Sc00 ?00 S&  Sw00 Sl00 S00S00t 0 T 0 - 0 A00a0-00{d00xs00uG-bda`pP8 peP3  dpP$ 0A0bd`@@T gP0=S AP`0AT CU! oOe?dAo 0 pp"p2C-hM 0 PLP T0X\m ``P P唐嘐圐堐夐 `p@Z xp  `p@e ,P7  $(0Zp@] `0<S0<0x0@S<00<0@DHp'<''0'd<1<000L0 00d`'X %uo0S ep@ V` R` @ЍuOoBЍ@Oo00 6` 1` -`+ + + d* ) O-pM`@ iP-TPk +T@` 0 0Th W p pǯ 0 _ 0 _P !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ nP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@Pn0T0Ppp@-BR"^p@?@Psn0T0PpO-pM`@ .iP-TPk +T@` 0 0Th W p pǯ 0 )_ 0 !_P !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ nP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@Pm0T0Ppp@-BR"^p@?@Pm0T0PpO-MHP@Q@0@U P0 `8 (" 0@P`$Ѝ R4l"0P`0le!0 n$ЍX000T0 0P00 0vP00S< 6#R0P` U03[0:P 00$Ѝ!0 =P`$Ѝ?/%1R5%%;R:*%6R1!%?RP`\ ` 0P `8 ` 0P `}  h |   @-M"{ @|d{ @0S D <0 0 |0 30Ѝ  :_|0t -M{(, {Ѝ 0 0 9/@umNA00/uG-pAB`PnQ! @iQ Jz3T1P@ V B  PA@Y0@O-,Mȟ08 00p8 @p0S00 H8`0S 8( (((( G_P@0+0C< W Pp  q 0 AB000 S 00PU- 0X0F0-SPUP_P0-S0!000 ,Ѝ ,Ѝ60p p -U0 Ц` :U`< + B R 0!Z0P0 WU E :Ro 0S000\6\0P60`u0v` 060  ,Ѝ60Pu `00PEPCP0 S000500S 0:S 5 ?0P;R0S00BX0@\5 00@500S 0:S 0505W 0 0+ C :R :S?k:i 0S`0  :R 0X0! $ 00O|40p4 0$  RL$  = zY0P0| C000Z p p@P`@p`W  ub0Se 2 PR z PP  0pQW`0S p @Az `T 0RZ0S" 2 00S 0:S  X0 S2 00+ Cd`0JS0S:  00 SP0 S`,Ѝ p @ de1 00S 0:S  <1 0? 1 00S 0:S  Z 0 10S$000<1 00S 0:S L 00C 00 S 00 00+ C0 0 0 00S 0:S \ t00P0+ C108<,sss Tiy8i,i> h\> D xxth= #n@-@-Q Q Q  0Q 1  0 0 0 S 0 0 SϠ @ ND^0   0Srh 0 khT 0 l t 8  D  A-P @` # 3v0 aVp BT@! c 0 0R ! 0 vpP   Fg0 p `QPA-M! P`P@ pP& 0`0  000 @P WЍh@00Ѝg0P @gPg@0PpgP|0 0 X^  ((0 @-@0X @h  Q0  A0 AQ;  A@-0M 0@6PЍ0 Qp@-@ ڃZ00QUPQZp vZ00QUPoZ00QR !/A-pRP`@ @T T !03/pWG /p@-@PT 0p@/pA-`Qp@P RyxP0D00 00㼀p$`,@(P0RJg 0 A-P`p @P> 0U0! V WppP`P`HxP) 0 0 00㼀@D $P,`(p0W PpPpV W dpd`p`TPPH``g00t\p@-@0`M1PS ,0S Eb$0S >b jpЍpO-0M @!c`pP 200S 0S 00*  0Sx "  }(?P` f0S{ 03/t"  mPf0X S 3/("  ZPf000  P     @ P 00  00 UPX Y$p1UAhh1pP@$T!0,0 H1 ( 0 0ЍXFf  03/.w{PP 0[Ѝ)f0S %fhVfd!@f0@0꼰f @(  P f40D0@-S @X0 P @0P 0 0001 1 00Xe 0 p@-@0`P1S ,0S -a$0S &a<@ppp@-@X00CS00 PXp+!P--M  d?Ѝ Ѝ/ -- M0 0> ЍЍ/0P0@-$M R P@0S#  S!`0  B0!  0 0$Ѝ00`L0 0 @ P ^0S$   [4 ` $  ZP 4000S$/00//TZh 8Z4 pA-`h!  8MPP 4 . D<  Q S  @2 "]e`Up  ] $@X`pU 0 0 40 30#8Ѝ@@p pW  bP\ 0 P  @2.`p,@p@H 0"  t - M ЍG-0!MPD!004081 04p0<801 p`(|@P !0 0 <8 304 !ݍ  Xd0 00@poP@T Cnx` P 0 P8T{PaP @T@DAx4h C-!MM  !0 Q00 P <( 040 x1@`{0P@4p 00H1p{ P4400 $ ( ,  0 0 ppPP"@T Cnؐ` 0 P8T{P?aP @T@0S  ޅd L0 0 <8 30 !ݍЍ800̅(< f  eteO-@FM# M3 0Y㐤T`p0d40X ( 0Kd 00; P0S 0K 2 PU  0)P(00FP $ jPu ePp$Ug ,\Pg(,FP $U ,~  =Y "2 0 d4 30Fލ Ѝd 0P0D `P`P9 / xP@ @U  L<V< VF ! 0 0 0 Pll0$0SH / x8! 0 P  01!0  00 0  }0 qjc6 ||>( 0  \ l < $  t  T 8  @-@441M0 `Pp 000zbT T) b@/00 0 0 0 30-Ѝ0U000 @@P@00vP "448#800U0Pb0Pmb@P 밲X O-P-*%GM: 5M $0ĝ0l404 0P@`9 @@0D`H`L`J500p@> l5l(000(ph 0 r@P!   Pu;b00S/ 7b0=S0`S0`V`X`V `ሀ]P$b0#S PU @|$d4 0 l4 30GލЍ(00C(08a0 @h00000 0dyPa @P0h00000 0PyP 3 z  Yt  Y0S(00C(0p  0,0`P #`p(0 f\ UP\0U P0000@8`a cPzھ0w 0hPC rlY0i0SO SM \ $ \  \  2P\, R"J0  ]a 05 0,P(0,0 S  P (0S 00000,  pxPj Pf Pa0S $0pd(8 <԰ | ` , L (  X ( @ C-PT!`P1 0\M.0T004,!48@#8 xp|0000000 $(,0呂P!Q ,X0 p(@ld T0 0 T0 30 \Ѝ Q @ 5 4 8X -MЍO-`!p1 Ƞ0,̠dMČ!0\00< 8P#8 @ 㐐刀匠0$000 0 (,048&P80Q ,  HXIP 0S 0 @ 0 0 \0 30dЍtS0  @ρ@ ,೿G D V| |  -M|ЍO--M*$04 00200: زEog0 0-0pP NPf 1 S Sh x#@ l# Sb  000 S SU S0 R R R R B RQ@  BQRS 0 S1@+S8 -S\QUp @Up0S Qr : 400_op`R0+S6 -SI \PPUpw^ WPZ4 Pp@ S S 0QUp @U50SY Q; : 000+S_opR0S @S: PP  e_opR0S @S': PP`   K_op`R pPpU2 t0 0 2 30ߍ \PP    d+ $@R"O-`2 0ŸMM080 0y@P6N 0AM.0 ;~PY 0SV ܰ + V0+ 5I" 0 5 0  0+ fP @ P3H0: S8 1!0 &  !d1 0 8 30P ލЍPP;P 0 `P 100S1!0 &w P \0S  S 0 0 &0 0 &H0 |0| 0 &0 `CtP l O8  ?O` NT N N$ A-0M0@`p ]00 0 P @T@T 0 PP 0Ѝ @P0ЍPL -$Mxx0  0 !Π0 (0 0 0 30$Ѝ  О-$Mtt0  0 !Π0 (0 0 0 30$Ѝ댞@A-` @pP BS]00 0 0L ^aLQWLALQ7L \  R AAQ  R C`0C R0 ą S: C    G-0\AP@`?0 PR`7U !/*0$A$$q$$@ p ?@??p.Q  S*!" P* V  R0*S *0V000?0R*00x?R1?#p@0 ,0S0 ? S*: 0 U: PtPpPlP8 ( OOp@-PH@H0@`M000 3@Ѝp(@-M 0@@ 0 0 ( @ {ЍN -,M$0t  0 00 0 6P 400 $  ,ЍP `N@-0M,0 0@(0t 0 $00 0 _6P ! 0" 00Ѝ}\ 0  O-`TM0  000  0 ! 8 L ! xPPS h@ pe0 p9@P= 0+S+0S((j P,$( 0  P 0$,$A,0S<h 0 0 L0 30TЍ0 sP `#PK\ 0 9 !1 O-IM0p0103WtlPPQ \@ `0 `@P; 0+S+0S( P   0 " P   0S 0 0 1 30Iߍ P XP[ 0 8X 0 4 0/I 0 0@-PQ0M@000 ⱆ 0 @" 0S0 0L @0 0 0 30Ѝ0!#PP l  @-FM0 M 0 `@p0d40? PPd@"B+ P *[0@ %[ R@@ 40 0 d4 30Fލ ЍL눔ܓ0@-@x lMt0 P 00d00 r0 (0 0 d0 30lЍ0&넓8}3|3@-M8@8@ R0 zЍXGp , `8 #4`43Z!R // 0 0@-PQ0$M000 @ 0 @" 0S0(0T H0 0 0 30 $Ѝ0)bPP l G-p!P1M 0砐 040 E$eCP;0F W08p;t0' T C,PP!  T0@To0VZ0@5QZ@  0 0 4 30!܍+?Z0@:ZU@ 0P P&RQp x@|`d^|- M0 Ѝ0@-@x lMt0 P00d00 =0 (0 0 d0 30lЍ01및dϟ? O-M0@@ \000GU\ `` T` @!?b"`!P+d+) pP b)͌h P%d P @pgbx"n.'t*|bt'Pn* )dA, @PL`lp` iA$@Hi!h(Df& +e,)f)h+ t . 'M `k(+x`eq "$p,k$"eq'f& ! p*d (+ fd+eQ,P)P|Pe%}(nd.eT(  "d)͌ g. dA k(+ "$,@k" @$읉@l @&`g!,(@@ fH&g!"$D ! Li,fd$@gA .aH!*$DLaD$p*+匠- `j*i +j+i(P% `&b  0``ian, ah!&d .lad&.'. _%@$,Pp_$bq.p4PPbq'͌pe%h. ) }eT)l. +,*+. +@**b!d($"$(,dD"$ *.,/"+.0`&.o&+o&4(`+ha. ` ha& ` _%_%_%, PgQ,Ph P%PO$O$m`O$g @O]g. fA @͌eQ@$gqpfA% @?fA$f1ꯠ`*!`!$` .))@(**}*,la%..` `&gq.0l'`O.P=OP`'].lc1O `#.p͌p뿠+`'' @++O+4ea# @O `&`꿠@m/+$/"/"+++lOe, 0(O0n,= eQfan&P@) ] 뿠坌+@++cA&+(,@$n@. , ,.4eQ.믈`$.c% .Mꯈ`c1ia% `&dAꯈ0ia$`&P=Pm P8_% _%_%_%n$,P_i+P 쟠_)(_%_%PP*)P*))c1ៈnQ#@P%潋韈PfA#]n @$k쟈@f+.00$.!!(.4..M0e+f!`.,`)8o)`.`.=.dAea$ `& ` ⟈c$m.eQa럈P@c!.鏈@c1.'鿠'p0/+/"/" $ ,.].f!M(v.0! "0%q0 ?p0%0?SP@@g PQ0gS@pG" ` # *G0S@@:`F APp@-@10MP 0 00R00113 R0 0~? S `` 0~? S U PE "001<3 R08 (0 0 0 30Ѝp|d H { 0 0@-PQ0$M000 @ 0 @" 0S0(0T H0 0 0 30 $Ѝ0)}PP zX XzG-QM !P1 0稐p 0 500E4e^P<0G 0S08C;t0' T DFPP!  `T0@To0pT0@OkT@  0 0 5 30"Qލ+YT0@8TTU@ 0P P@LQ(@p p@`}wyy- M0 Ѝ0@-@x tMt0 P00l00 ;0 (0 0 l0 30tЍ0Jxw {40444 000{ 0/#EgܺvT2O-tM@@ 0RO P?D @`  0 p, .`h d` 4   *d,! L꫅appl[ P8 ` P%lk.0`&P p``{[d[ ppmܼvmzNSdK P%P[`[h0nbk*@`<nbk& @`'i` .DfinlkajK(l @%LjK$ @g a,`dMbKh &͠iˌb+h  .e+ "8 j f$jlf!  idah d  b-g+d)h,n h ) g{T苠fp`! g|e{D`)fk`" l )e[Pe]n[fjLdka( Ha)dK@ 'b )n8M X`Kllˉh& h)` h0a a0%g;0# f;$0f;#`x2@ahhlʠebˌ *b+ +g+bd )@lhf`fk $0n )g{Dplxe{`!)*e[`PXm]dkn[dKea()@dJ`KTDbhn)( h&L. 隠gllˋ *4 jabaj+ f+$L "dˌah(,d+.e  " , P -8f+fkl̠i gˌ g{p8ye[h (e n ( j{ pp'` d ,` ph"+H`knn0`lkk,`H`gz@h`i{`!ik`mb j !jk`nekh` `&`fj$lkfh (@`+.d@bb+T@gnK(@<@ @!l˄ k(! ɠb-je[`` \!0ag;g{S 00 00//\U@-M `P @X<ppPU0D>S 0!31000 @<Ѝ>SL 0!31000@K000S 0 S2*- + H  @ LЍp'}C~p=X   00$`H PBH0S "2@$` yq$`H P$BH0S 0$ 0C0`1DsPH00LЍ 0Xp+P-@ +0B XR R  +0B 0+R XR  -R  X@PPQp4P -0M   1p`ЍP 0 @-G/o`/00/00/00/ 00// ///00/ // /A-@p`e6+P6U PU  0  )P@P PPr6]P \0006p@400G0PGP h 0p@-P@`T v@T0rS nPp5p@fdP0+Spp@&$VXp@-MPr\@`   0PBD0P0 ` @Ѝp  0P0h@- M00b0P0L10 0  <100S}<p@( P <0 0 00S3000 Ѝz0 0 @/UG@i<d0 00S dF00@ Ѝ(lDx x 8@- M P"!0(0040000310`0d0(0040000' rd0@Y0P%Q%00AA0$0 ``00@E,0 `0@0 a`M`M`K2@s GzG 4 SQ d O-@́̑!M0 Q:Tf PU# U* U T 0^ S^ЍTPU U U\?^ @0@ 0Pp`WP PPPP& PW P`0T`Pp0W 0ST:0S#`@0Q @ 0pP W?[*!]-kE0@- M0MK04000S0 0@ $03/P H0 0 4 30 ۍЍ%P$7P7G-P` ``a V00"5Ep@P5  PI 0SH 0 R0CÐP0P1 U  \   1`V*o`CqhP Y !GCC 0   1  şO-px- MMM㰠UE0 `jC05T004*0U@@ R R 40B?o2 000TU$00 S0E0 )0S}0000Slp0+(06;(0 @  (02/(0Z 0@ 40000:0F,00 3/ P   0S00*  0.S 0S RV: R R   (0P8 (0* R $ (0R(0P , CQ/ 3 C1100 0 P000$0 000S  0 P80: S 0" $2 MލЍ Rv 0 R u P (0iE(0Zu@T  R e0B04/P 0 000b$00 0 P04 j 0.Sg0SR 0.SaN Rg  0@0*  2/0S  00.S7 F (0Pr (0 C 0 )P$ 00:B0 Rs C00$ \Y'B0/ 0 00[X5 5* <d2G-`dp`" KMM\ؔܤ $ 1 //\P @ P\/\   W!1 0 4 30lKލЍR8/\3^*P`W0/\ \@ @PP 0   R  = V/R * R( R 0 0 00`  0P!K R @ (03/P 0: SW/00Ɓ00Ɓ TA/0P0P/(/O-PM@$$M; ~^0` M 0 p ^  圤*^1 0@^ ?^! [^ !R 0S0^@000WS 0GZ 0< S H@V 0,@ \< 0 0\ S #0 @ 0  p G0 R/R00B0 4[S 0G*0 ;P4S 00C PJR*00S;R{ W @G 0Gz+ @PV t"; 0 2 ۍ$Ѝ@T@0DjSq 0]S2!R020 ]R0    -R0]S` 0010 ]R0! @, ;  0LXm 0\ Sj0LXg 0\ Sd0@* 0Q 0A  001A0 o+Q Y;P\@0 0 p030Pd0G*0 ;+PU 00[0!R0 0@0SJT@ar,-?***[!-]\ O-MMQ8@Pp`9  @ };0S @}\ \ [\ {\^! N\]\@ \ ~ލЍ @ ]RRR @ QP+[S0 S]S*SP[0 P{S &,S^U ' B00S0 &0[ 00ލЍ0]SS 0]SS }S^NU  E B   :  0A- M`Pp 0 S +{\ @ \ {\@0 pGP  Ѝ Ѝ0}S0S ЍAW? 0 A-MMP    ,  ` P \  ލЍ`` K RB ^ \^ pWލЍ\@p@-`Pp@0T1@D 0CP@DP t 000p0S. *S9 ?0C R#S 1  \0S /Q0 S 00 /@-0SD @#S@7 S S$ S" 00S "S.0 ^ \S 0000S\  00"S 00 CR S 000   !0@- QM MP 0   @ % 0 'p @EO0 00P p \0 0 5 30 Qލ Ѝ0D8  0P0Wo n q , Hq |G-Mlel` p #S$>0 P@$ 0S %P @ 0S=0SЍt `p+0@S 004 0   0Sy ltlpp0fS0fS 000#3R0 $ 0000@SX 0oS 0oS0nS 000#3R0 # 000 5P 000#3R0 \# 000H p5P 000#3R0 # 000 Z5P( 000#3R05 " 000 0#S RP@0 S00!,P0@@0Ѝ0 S SD *5P 000#3R0 " 0@00o 5P   5P0 000#3R0' ! 0 00R⬴Ѝ 000#3R0 P! 000<< 0@S 0 4@  4P =Q+00P 4P=Q 0 0@ 0b +00P,p<m m Pk k L$j j xj lj i H`i 4i 8i 00 A-R` & PpPpr@T 9P $P 0S 0P@ W0CQ0#R7 L0CQ0#R M0CQ 0#R N0CQ 0#R 0S:V 00'@T R B K 6P= 0p'@0000@'@ e0 ST@;' R P@ᐺ$: 0'0%':Z0ST 0 :00  w:V   Pᐺ0S @:0'0吿'P:P0@[0 0\ 830 0@0@ @' 3 0 00  " @'@2 0 00  " @'@0'0c=p08400P00P08040fH 0S X:0'07'@R:@ Po {g ' @^+v?:000`00R 0SCN @@H Ծx0@' 0>0@:  ƾ@' 4@2@G0 :Y0 P @ᐺ0Q P@ᐺL0S0  ा' `00C0  '  P㐺@. P㐺@) P㐺@$@{ e ` e @@` @D L_ |^ H^ -0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpFpP sP ЍpA-A`@0S(@@Q0,pPpPR @P P Cp0 @BA QA3M@  -p0 $p0 tXTp@-p`pP`P @T T0T0 R@@p̾P00ꘪtTlA-`P@P@p0S |@@j4 R"@`w4@ᠾP00 90@ĩ@-r 0 0 ,C-`\MP,@P- 0S8|0V $"$  UpЍ G0P  $ R%ЁpYTl 0N꤁|0`\|||V0R1 0QG B&Q&R-.4 ꐀp0 Wtqd{ SzڙHvhZ <~ Z } Y } Y Y lY L} h| w 4X 4[ @5O-0-4:050u00%AM M0p0 0 $ 000 0000+0 ėP0 40 4"P P @\ P 0S p400#S \ P 0S 8d84`0`\ P 0S d4`0`\ P 0S 3 0   \ 0P 0S k30\ r0P 0S kd30\3@E0 +/DcD3`0P0@\ W@P 0S 2P0[[ 4P200xS0xS0Sc 0`" $2 Aލ ЍdR @P\ Pk 0S 8200#SB \ P 0S 2R0P\ PV 0S 100xS0xS0S 10 0sS(0wS%0S"x! t1tQ0P \ 0P 0S wj@10\ 0P 0S jj!0 ! 00P00 $ූ 0000 00?4P8X pld = = = t8 X$ 0= = < < hPL} D< ذ; ; ; Xx; ,9 $; ԯ: : : : : : p9 ȭlWEV07 p@-@PA 0S, +@T :T7 0R/Q T&*0CT$ /R0C0C/QT :0 BPU0P!Tp00p`@@PX; )08@/S@0@@(@@@̬ȓ s A-MP@*T0PC H!0C `0 00   ! 0b0C S0:.-,+1)('3%-`^/0 0ˎ0S@p 0S 0SL/0"S 4'Ѝ T1r0:;/ 0 Ѝx@ p@-PP7 0S0 k*@U3 0U.  /Q0C U!@# *0P/S@ B=>@T@!P;P 00pUX0 B@T@!@@4@0/S @ @( ؐ p -0DM 000Cp 800S DЍp@-`Pp@ P p V U ph yp` UROV@I@4 o Q?o 0?oA-@c^?c%^& ^ `@6$6T&pc@c$0GCH6(0c1C  1. "0;:(0C0 /0 @- /(0  +C0 @ 7+C 0/0E0E0C00 {+C$0 G{6+C{7 Q/0E0E0C? P!Q/o /oC-@@bT?b(T) T `P6&bpb0xBy66U b1r1 . "1;:( B0 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J@ @-p A J@ @-p Ji@ @-fp J^@ @-[pPP `j@--00p@-P@` <Ppp@-P@ <Ppp@-P@`D <Ppp@-MPP`V F@T |00(Ѝp 0 : p@`$ ㌳ث. 00 R Oc,@-f-00 0S@ /"br1 0!@0lR0cR0A1R 0< 0 B``C/  `Q0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`( @L;P PXY  P 8@-P@, $1M`00\7 00@|p\ 00#30#^0#02S000R0@ | l0 0 2 30ߍtpP @@ @5(@$|4tO-`P⨏DM 00 ?0000 P 0  R X4p@p%Rt @0@0S 0R`0 S S0&4//#b!!"AK/ "bQ3:bQ#3P. ! P0 !>?3c112AK? .##.cR 3: .cR # 3010!00C0 0 0R PR02R0kWhp`% FURb,`_^]\[ZYXWVUTSRQPONMLKJIHGFsRq(9(<;:865 +*)('&S2on ,{sk"f  ; 000V `DЍ0@@0@000@ $p (Ph`8  0`,pC@& P9P @ T 0S $p ` 0`(P,pC@o& P9P @T 0S  0 00S zV0@  000 GR +Ro -R 0400pp\:S 2a2c2SR0c$00 0(000 50400nU V 4 00000 @W^00qWZpWV8  9 0N00 494 4 W B 00> c0400@0@0W%S.UW+ =0 00v W\ ;0 0x0p S00W000 [ 0h00  0Y00A c04N0S00C  4/"b!!!4    (0 404c030S4 !!!v.B B4 00 ǟa@ 4  0@@0@000 0 B R0`0` W G $0 0` @% $0 0@ t8 0P `2% 0@ h8 0P0 00 Qu4 W ! nWl 0 Rp00ZXW^ 000O I 50400 4 04 4  B 00=4 40444 v.B B 00, 044 00@aa B + WP  RM 0s 0v0 @@?3J⊡j ` ?A1c1c B  B0  UR ZRW R   @M 0 0$0t3 @0(004X $p,(P0@W00  $p,(P0@W00 #/#b!!"A0K/ "bQ:2bS0#03"10 !A 0  4 DRd 4 0 MRU 0@^h  @cQ 0 "#^  z F 0/o"#PzVt 0@0 0 B8 <000C Sp10^S10L0"1 `GO0!0 BV 8 <000C S 8ִP 000 TR RS p @H0 CR > A ALA p \WOJQ @ 00 0b$00(09P)\(\ ף@* ) Q$ n$ # l'$I j Q00P00C4\`000s\qT0?2c 1A;S40f`2ca12T @0@000@-W@ A\N A R$ M a"b"b"@000$ (0$p(P, 0$p(P, 040 @) R& @" R 00@ p40 p  0P 4 @0000C!( .$0`00 p  0P 4 @0000C! ( .$00 0L"0p  P l24 0!0@0c( 0$0| 0 0 0O@p@-P 0 00M`0,00 @ P00Q Q Q ' 0 |t  , 2 0ЍpP ڭ0< ԭ0( έ0t,t,t,0@P/ P @/G-X# p`"V@P0PES  R  D 0PEV R  SS0@0D@R@- 0BAs@ @Q 0CR &@O-` MV8 VPA @bP;  pP< L"001Sp YX Ѝ0g0PMP 0 0P 50 0 :"=00 3"& 0 )0@-RQ M@@  PP TU &0P Ѝ0 Ѝ0& 0 Ѝ0G-p!|1 0MM050`1`P L` Pfp> @P<@X0^00pAtA+0Og00 TAXA\A B7qύˠ$@P,0  (@ @@P P t `0 0 5 30ݍЍ@H&0@0C&0@0{0 0 -0 D--M  Ѝ Ѝ/ -- M0 0 ЍЍ/O-R( M @p` R00?yI00P @ P 00 P ! !  :1XP<  6VP WE V[X0 SPpp` `2(!(1 00 Ѝ`ᒵpP2 PPSPpp`00ʷ0XPC0 P P00 Ѝ0`f0`fpP V _pP `갿\@-@ M[(0S2 0 `(0` 1/qp0Pp  0 0 PUR <0PUA ЍPPTp 0S  0CP,E%P0p0@-P M(0S< }0 #p(0p 1/qp0@`3  0 0 @ToR <0@To1`VP ЍP@T` 0S  0C@o%T 0 $ 0 0 R/p@- @Tp0 Rp 0R00  P 0S P0 c ( 0P0 ݶ0 Sض,P Զ4P ж8P ̶p@ɶeEp@-P$@@fRp@_LX@- @@XR@RXp@-,PPK S@DpWx1!0C-M P@00S   0 XR0  S= `8)p@ X80CS60I0 S0QT-*@DT)T' @00TX   "Q T #R.S 0a A 0C "T #R Ѝ`0@p4  R  *4 8/ᄆ 0X\S 040:8 R РS /QxB@-Pp`P@P@0@D尀 ჵU  [ %   - MP@ #0 Ap@- h` PPPp P p@PP3f]UJUI1 \l00p00 %00p70000   70D3zJ |I z3,v\E,EuDD=A-PP| @`Px qp Pf  00Rc<!#b!b0CaqV- pW PWV $00dqp0ST100S004 T,1003/P00  $000``0S 000S+ 3/000(P`0003/P 003/000$0S P 0$000ts$CBtsB\BSR: G-P000pS` 3/0Y @IOP T0 0 0 0 Y @IOP TT0 0 H H0 0p`P   /A8rrqq@qSR; G-P000pS` 3/00 Y @IP T0 0 0 0  Y @IP TT0 0 H H0 0p` P $  /@qppp?pA-@P QP 2P@`p\Pᘯ0`P "PpW S0"S fK@00@`O-PM M Q0` 0 Q /QE P.00G sPP7p/Q/ Qp @0/SS.Q8 0E00 0C S$/0 D 0l I0 0 ; p 0: S-  S/ A/o" R_/Q PP?0V0/0000 ލ Ѝ DR .QRV  u/R0W01ʨ! ቢu0P3 00  R'0 (/QpPVP/0000ލ Ѝ o`P `d00>0000?0000  p@- P\QMP>  HA@00? P@ 00@T' 1`0@@:T `^ 0 \S 0@ S @ 0:S@:T T0 0Ѝp\0P MH0 0Ѝp+ 0 0`X|lklk0P/:P-0 S\ S:RS0@S0 S S@\ :R \:\0P:P 000/90A@-@\  \:^|^00^0S R B|S0 0:SS O--MM '7 $0pĝ0<40t4!S S TG@`V 0P0(  nPP 00S < [ & D0 00 P@ 0PPv00 ` R0@p`0 S Wp :S \Sp S Spp p0Ti*R0+  " P 0`0 SWZ@p 0#SS  \ P5000S 5P0:00,0:= pP 0:RPh PR0t4 00 04pVP/ pP* p):00e00Z  0 Sm00i:SZ @0T:H ,@D P @P4 0:R` ` R,0 F C 00SpG:S:0 0E I0HZ 0 D0 04 @PCح00EpT@DpTgH @DpGPEP @pPP0S ဠ$ D0AT0: 0P#2 0 <4 30ݍЍ00 0xṬPP@ DPP} 4|2@00@S0-0`Sz`0SRM Z0@nU@00 0  , :@Z  4p,P0 `0 6/p P0003/004`X80,`0C0000e p PP 03/P$0p0H?o20 0Pm0@00@c03/ 0  0Z0S 4$0S 00 ῟ ἟XTi$ 6 3-M 0 PЍ@-4@@ P 0 000aa3O-p0`C M M\@` 0圓S S P@T 0S l @P 0 0 C R 830000#30:Q0#Q0S(  0R\Sz 2@0 T  P iP 0 0P0 P 2 0   >0S00S\S00 R{DAP 0S7\S5 00S1 :S000 0 Sc4S\ A 00S :S|S@0@ A@M0S't!H1 0 8 30H ލ Ѝ &@P 0 0 C1 0 Y P @P . @@PP P % @0 0   0P 50 0Pm  @j`a4aܑa`\` __p^4^^ 0@-@PP MP 0S 0 0$0 0   Ѝ0@4]]G-`= j@P dTPP 0:SS   d: p \S@0* QP 0:SS ^S 0S:S 0Q0@P PBd ᗪP 0P:SSd Q0 B@A0n0S:S 0C\6BC2PBYU?PK<;:9876?432802.-,+*)('&%$#"950+000C^/000C\@& @0 0 @0} @pz 0 @0v 0 @0r @o @l0 @0h PP@ @@ @ @| 0@0wA-P= `P7 d㉨pP9 0S:S@@c0%0:SS   \0@Ad۩dP pA\@A p`ʩpPᣪ@`@@ᙪ@~ 0@0p@-P# VP 0Q @0XS@@<,00A ^a AR70AAAW0A^TppO- AM M0p`#S\3 00(0 0J @`/004 PPO P8T   .00CS4%210/.x,+*)'&%$#"  㵜4$ 㱜` 㬜0:S 84St0S00"2 0 (0 30s K P( BKI8T 0:SSa0 44 440$0<4 0 S BKJ4$; T44/ $0C 0$C0$#<4 $0C 0$C 0 3 30 ߍ P0 P 0 0C 0 S 0 B `0 zR1fPLKJj]~}|{yxhvutsr0p,+*geJ`\[Yv``YBR0000C`0 PB 0S 00 0@@00S0  @DT> = P0  P 00CS0000@ 0D S*cv00D00 SL0`I4 @<0 L`  H4 8 BPR '+[ 0ZpC0P M:jWp!vPP p` 0P + @MR^f\dZYBTSNMLKJIH654321A@?>=<;:987654321)/.-,+*)(!   XM P 00CS0!000pWP0 1S XR    0 b $ 0$          00 0P0 0C0000 S000@XT @0 !P0@ S0 B0 0 R P00S000000S0O >. #RR 0@00T0C0 0 >. #RR 0000C T0 S P Y 0 00+ E   BR P X *P@NU 0U00CS0P\0X 00L*P@ XRo  BR  PER*P  P0@@40 > P<D0U0S00CC SP00[ *@@P @0ESH 40SH  P  0@0CSPH00 400  0T0y: `8 <@DV*T *T@0 PT0i 0$0` 0  P 6l$00 p400S P0Sr 0$`0 00000S 0 @0CS0P0T 00*P@+ E  BR P X <*P @  P 0 @0CS0P0 IU00CS0P0X 00*P@W(  R H  R~ WW BRpP  n 0@@N 刀WiU nU00CS0P0X 00*P@ R8P. ARJ p BR P@ p; jP4W2*0P@(U  BR P @p$ SPW*0@P NR p BR P @p 00@<00 0D     SLꈀX@ @@H00@900 0' 00  $  0$  㰀   +  00t|O, { h xD>h < 0  P 0 0C 0 S P `00@00   =00@<000 0P0^U00P0@@80800,H0U 0$A40>>4 0@<@pD#C8`0-S ]Sm Sa P>>4 08`#C * 00000@ 000 0@ 0   +   +    )     00@90 0 0p *  + 000@ 0a0 0@0[ @40S@@@XL  M ;PK ?PS40bS9  P 0@0CSPH0  0 0 0CS0P0R%*P00 P P04X X P40@0  P 00CS0P0[ *P4X 9 P 0 0CS0P0R*PdSiv00D0?L0@`0@0CS0P0T *P00E PT* 0@0P PT*0PT$0XpP$0P50TP`p00  00S0P0S)@T@ 00 0$@P >. #RR  PR  B   P 00I P0>>03SS 0PU0C0000P0006 0S PP PYR Q 0$@0 0000@00C P0BP0 6PX*0 @PV 4 *P4 R*0P  P R*0P00 `SP00[ J*P @Y\Q$@`PPP0 - P `V0C0P0P  0S P 0 0 0P0$@ P0PC PT*0@PS$0xxPp$00400TPpX` P @0C >>I vw 0 峡p P p0S P0SY4Y 0S0 00 0 ᙡp ᔡ>>3PS 0pS0P0C0400400S mPdXb*0P0@0 0 > ᛡPD @0C >>`F  vo  0 N0p. P p R`<@pD8000@ 00=<@pD` 'PX*0P@P 4040P S@ 0@00$00 P/h$00 PaX_*0@PA P[*0P PNXL*@0Pb800C08000]S ,0 P 0 PP80H`0vp80`Yp  P{P00 rP400P PT*0P004 PXs: `8 `8<@TQ @t YJ `8 @< `8 @D<)0S@F `v Y?` 8<-P$ 8<@`Y` 8<`@0 `8 @C<0 S@!@30PUG$P  04P 00 0$P:U$0X`$010:0 `pP Pg @0C >>p G 6 0 vrpS P!YPE" 0pS$U PU WP0 T! P@DJP UGLp YPE`0pS 5P W P 0C P0 )0@P, 0@-@ MP 0[0 0P\ Ѝ0p@-`M@P@ G4P0 PFЍpY2pA-0P7 !@00S5 (0`1S010e C000PP! pW@0P@ k`PQ 0 0 @0 C PC0000   Q  Q*RQ' @<08 0  BP0AP00`0 㾛P ; B #A ?#@ 0# B0 PX4p@-@P yPp0 $<@-M@ 04/@PЍ @Ѝ\0\ 0@-M $̜0@4/@PЍ @Ѝ$V0@-$<M0  $@4/@P Ѝ @ Ѝdd0 @-M00$  $@4/@P Ѝf @ ЍXU0@-$<M0  (@4/@P ЍL @ Ѝdd0 @-M00$  (@4/@P Ѝ1 @ ЍT0@-$<M0  4@4/@P Ѝ @ Ѝdd0 @-M00$  4@4/@P Ѝ @ ЍSO-M@pD0X`@ P$ 0SP  $,0  ;/0$ 0H@ 4/@PЍ @Ѝ$ (@- @MЍlR0 $<@-M8@ 04/@PЍ @Ѝ\0\ 0@-M $̜08@4/@PЍ @ЍQ@-Pp`.t@t0@l@ U  @0 r $ ᰙXQ `  0O-,M`PP tE@0P0 00E00X5p0ʿ00 0  P @0 0! B1 b80B p  U\ @4B 0@3A0S0 vTvtsrqpogfedcba`_^]\[ZYXWVTSR]PONMLKJIHGFQDCBA@?>=<;:9876543210/.-,+*)4'&%$#"! #       0 D R R Q  R \000!#300@ 00@00 @0`PUF*,Ѝ R\ 0M$ 0$ 0`P S^?0@00 0  ΊP 0J ZS 0  0J ZS 0-00h10000 ,Ѝ0\  r  `0\  s  `0\  a  `0S\000000 0``0\  b  `0\  t  `0\  n  `0\  v  `0\  f  `| @\ 0P_ Z0\  @`oPA- Q@Pp` fP=0D! D?o2]R0S h0$"0 !@1= 0 V V 0 P0 Af긨 H A-p@P`P$T0 AQ_T !T '0DS(0$"0 !@1% 0 O-pX'-SL7UM 0瀁0L10,7儱0001P<0 y @[0P(0 b`S0P,0 00S080p 9P40 H  T. (`000P@Tp` U T 1 # 0P0?0S0e PkP P6&0 d(0@FDA T @! Dt` 0P$0 0 :40S V D0$ 0C BP$0  T5? 00*R  05` 0$0'R` 00` 00` 00 `"00@`\00000 tpT0 (`,$@T+ 0 7/P@00$ۙ,ٙ(י8ՙ($4 0 L1 30Uߍ<0SP@- M(@ @0 0 D <0 0P@ 0 30 Ѝۯ뤱 `>>0@-@QMP0 0$  PЍ0Ȱ @-R M@0   0$@ Ѝ` p@-0@Q0MP`0 0$  `Ѝp -M00  Ѝ䬯 -M ( Ѝx -M ( $Ѝ4 -$M 0 0$ЍO-MM⑞)< R 9 Bq Pp`0 `p@ yrWy `% W `! P 0 R@@ W U ܍Ѝ00 S U  嚔PP@000@0Ț @-A!!!!p@-@P0P0 @p$0A-S`P@:T0 @@T(0  0U  @@0S! 00( pnz0S$ @-`QM@ NJpp.  8<0RP@D0RP [P00V Ѝpp ᦊpPG0@&B@ЍPPЍA-`pP@P \0 00X0 0 0P `$05%0`@P0\X0@5@-@M0SXPK06P[0: S S_  SЍS P P 0p`P$pB0` \0`.S0@D`H08< 0L R%0L R!8< \P@D V^0 0U g:0Ѝ]0S \040. SЍ0$0 N Ѝ ,0 O-04M` (07Pr ( R ,0pB Ror 0@P0,0 , !0P 00,00, 0A /R ,0   0 00 $00 pK0L0000000S 0 050$ 00Y000@@ PP ,  0.Sf  0 @P [@0 0L00,0 0S% % R R,  B $000S<R\ 0 0  0 , R0@PS0B0 0H00CPSP00@t@0,0 0{0 &P0 S ,  0 000 0KR 0\00 050S 0.S000,00 00/  00 0W 0 p0Sg,0 0 XS 00C 0 00,0S (0XS 0L0S,00S X5 (0SXq4Ѝ0@0,0 0  0,0 0px@W p劔W @m@,0p <%,04Ѝm 505[0 0(0SX p4Ѝ ,  @/Q  , 0S  \R   B  0SL0S0 \R   B   R00L Rt 0p0@1 4ЍOi(0S@05  p0$0|St0T  Pl  0p5lԇPa 0$0 0O- MPp0Œ@Ph 0PS(,P~ `P0UP1S Q3PP]L, 0 PR `0VL0{ PPP`V" 0PG  ,r`P5 ,\00 LP05XU0P```PVXY000P!, MP , 0 P51 Y Ꮣ ЍP剓U ᅓ僓ၓ@ Ѝd00`@00 Ѝ  ,0 PPXp,00,0,0 P Pꬡ ԟ H 0p@-SP %#L R/@T@8L 0R2@T @,TP &$,@ @p(0݆p` ܅p@@҅T @@@- M@Tj P,,f5S S%* R| ` L0Sy 5S0S@`T`ْL0s ,0 @L0S,0 $0@S005` Ѝ 0BSR@ @D 0R\ 5`V `嬒V`05`V    ,`園V`P@,0  @ Ѝ P@ i50 $ 5@T 0   0S00,S,0`.P00\` ,0/P Vv p 0p0 00@ ЍSR 0 , 0A/P0/0 \ @ Ѝ5#W,0T! PM ,0<,0 P,0 p(W 505t,0(ŅP;(ń+@弅P% (廄<, P 05,0@<,0Q0S ,  p( 505̑@@90 0 1\0(`冄`,0<,0&0 $ 50 $ 50 ( | R%/@- 0 A-LCPp`w@,0<0"% R0 R@T @~T V,0`<,0L0`S00/S , @ 0t pp0@ P06 0 0T x0x 0p@-@P R 0`00S2p@(ҋ(ϋ(͋(&$x$1$0A-P (M\`@ @Ppp 00 0@ P& 00CS'  p0 0 0 4 5;1:(Ѝ 0<080"0 0(Ѝ0#  0 0 L"0Q/0S/S/O-pM`@ gP-TPk +T@` 0 0Th W p pǯ 0 b 0 ZP !ˎ @00D \a0DSW0DA0DS70DWUY :Q P S \ JP"00 0U00S 0pS 0F00 Ѝ0S U0 Ѝ0@ 0`00XS00 C R @0` p0 A BRWp pꙙH0BR"\04 0Sp@-@P0T0Ppdp@-BR"^p@?@P0T0Pp@-LMp`@$0 P 00 P LЍ`0 2LЍC-P!1 0MM`0p0<0l! @PS `1 0S qP(/ K  {P& 1R P$P yPP 0 0 < 30&ލЍ 0娀R 0 P PqPo0SP 偏f@P((w0nSꖧXP\,xnfsuniop@-`T@p@  P@P p>0P9Pp`@-M @ቃp 0: S  p  ]Ѝ 0 ЍЍO-P-$M$@p @-h300;#;S0 000U00Sx00w e00@P` U *"@F `PP@  00 ᷂p P@PE0S: 0S00 "  X*0 P  P 1T0PJUPP6mP@0@D`@0 @@p$ 0$Ѝ0 ៎000 x00S0@ 0DP @  0! 0 0 t0 1@T 0. 0 SZ@ T  i 0P S ^0@ # ppu0 7P1p@-P > @T @8T0 0p  0O-P M Qp 0 `eV 11* @ 7/P  T VK:00S0 0 ЍO-RDM4~Q@ 400008P嫋 P$ x 000T0(0u@D4` 0  $P00( 0  :/@PppV*000k000 R`d `,@0P@P U` :/PP 0Y` ,@0PES*0p P@0PU* E03/P P 4 0pE$ 0pZp 0  S ^ 0* 4@ 0 ,?0( $@40, S ,d@DЍ$4V  PH PW0P@ ZV 0p'Sv0( 0S 40,000,($ 00P<0 00  0( 000,S$  C000(0 0 0$ P0C, 0 00U00U0#Sz `:/0P @@p`pS:/PX @Y0V0 S0 T 00T0003 0RP00 R0#03Q0S P0S 0P 00C0C 00000 00( 00R00  00y 0SPp 0Z:0  J3/P4 0PJ$ 0PP 0 @Sp'HW0 `0@  S`^ 0* Yd P @ꉐ 0TPU:/P@ P [00P50P1p1 * @:/Pp [:P0@V0US[ 0T00T 0003P 0RU0 C0T 0T0@D @3000@  U 00< P @IT @00:/P 0TPP@pE tᛀ) :/P p PU0@P00 C0T0T0@D @3 P0@ R 0 00P R P0 0C0C0  C0P 0PC0000 C0P0 C000<0, 80 S( , $0, $ ,0YP0( 0 H$@8 -,@j0@0$0,040$0@p@-@ PU 00S  RQ QpP{ 00P{  pH0H 0 R@-@(0(@P xp@-M @T TPT @TЍp0 Q 0QP ``0` P 0 RЍpA-M@P`p0S$00;0 0`  ~P- p0 P' 0 Q 0 00CR0 0 U S R 0S$0Ѝ$0 0pP0P 0 R@-@(W0(@P xA-p`@PP0 00S (:P   (.p0S `nP   _0S[(V0SR00L xp@- M00 ?P 0`PPp@  Ѝp@.0 S*@` ЍpHŸC-`@2 08M000@Ϡl1?2c A1A11A@@>a\AD00ä?8P=<;:9ZDDW7/.-+)(5l_#$~|H F-  U [n 8-(= 0 |0 30}Ѝ #`!!4A ,P0 P $0(@:, #"0,cR:,c2S <  @@͟ 00C L``C@ @r  ^^A!/3b112A0 <  ̟ 0 cPp<5: cP` ;0!3b112A0 K 0 S 0! [ K 0P Qd;Q0 0dP   [ 0 S  R    BtQ1:0/A!b0dP   [ 0 S  R  0  ``:Q0 0dP  ц [ 0[  R  0  `i 9Q0 0dP  ᨆ [z 0 Su  R od d9 / b !QQ0 0dP  ቆ [[ 0[V  R P8Q0 0dP  q [C 0 S>  R 8 0   ` ,0 S0C0  B1D8Q/0A!b0dP  B [ 0 S  R   1 '(0 dP0  ( [ 0 S  R |'1 00dP   [ 0 S  R  [ 00[006 Q0 0dP   [ 0 S  R  001?2c  1R11Aãd0Sâ/d0CS0c0(6dP0 ὅ [ 0 S  R  08   8  `S80S 0R05o005dP0 ᒅ [d 0 S_  R Y4 0  `*M0dPS004 0 n [@ 0 S;  R 5 [3 00[^, 0  ` 0S8 qp  qp 0P3  0S! -R? S30 [ K  S Q X# L "`1aa!B! #<0 dP0   0[ 0 S  R  0  `/  0  `u`0 0S  P Pt [ 0 S  R Ps0`8 i0 S  1h [a K 0PZ QT0S 1 [L K 0RE Q?UP 1 00 / b !Q dP  T [& 02x\QlP)\(\ ףm` L` @R _ Q _ *^ 8^ |] ] \ \ e a 0Z $a Y X $X J I U T S nA A pA dA $I$[ Q P `P S  R \ 1 00dP   [ 0 S  R  0L0800<00@0 0D00H00L08 0X0D!dP Ѓ [ 0 S  R  0n0 S0Cڜ [ K 0R Q0S  [ 0 S  R ~UPUP(B 30" !8$08 VS` gS 0  `\ " " P"N$0 ϠB!l8 0 040c1?2c!1!1!L1A0#/"b!!P1C  ã/ d0 S  à/d0CS0c0d3dP0 F [ 0[  R  o~P 3Q00dP  ( [ 0 S  R $4`0?ꊜ<ڹ< ׹ 0< d0 0帜 0t$d 1<00 A- M@ |> T> <> ,> > P00/ሁ 0p@- VM0PP0T10p! 0P1s`@&s 's0P`` S 0#< ,0 0 T1 30VߍpVp@-M`P[@@PЍp ]P S[P N[P 00000 PDO-(,p`@T[PP pW0SP[5 WP) @ :/@PWP0S 'S[ WPPW }P@@Ud P~00P WPX; ; G-`R p@P8/PPV @!1 G-@Q0MP`000S UI U tP.00!1 0 0 30]Ѝ 0p  )0P00S000 NrPP 0 CrPP :r0SP<Up$0T  7rP/p0p  P0p  $rpP  0P@៳00 0 rPF|(~/ B/0  Q B  /0S %0C 3 0% %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 Pp P Pp/0S :p@-0C@0 P^ P Pp/0S P@-@b" M0Cb! 0  00 0Ѝ/0S/p@-0C PM @`0 0b"!4Pb4#0 PЍp0$00$00  /00X8p@-P@9[P 0S S pp@,[ZP p@Zp@-P@[Pp> <[P [P 0S SYP p@Yp0p@/p@-P@ZPp >p@[ [0@- MP@YP Ѝ0ZP 0S00 c[ܾ00000S /p@-P@YPpZP YP YP p@Y0S S  /0S0/ R R   /0 / 0 / CR  0 / 00/ 00/ 00/0 0/ @-/ 0SAS/0-$(0@# A  A A A0/P @-@^ 0S^ S 0^^0@0D@P/C-`!@1 0MA030p< TP7 iYP P (! 1 0 3 30?ߍ(3@ R. R  0 z p0S Sp0%  0 | 0 z  R4P  R(0 |0 O-IM4M@PJ p`$ PI=,0 0S S  pH@$I= ,0 2 Iݍ4Ѝ RJ- RW# " "  J= 00岰p +4# 4J8#8  -z J=00PnJ=  0o0SO S UVZ J= 00p,$3 00$00':00J0 40PP @'0Sn0S  0S0s S0S J= UV 0 ( J= 00piY\ O < SPa iP m 2b"!4b4#"R<J= VU 0 p[pYpU<0J8 J- 0%$ 01Pj 3J=00P00J= 00lS Sm#< iJ͍ 0 pp p 00SSL2Sp S SJ= 00Y0  ISP pJ͍ fPpԒX0/ . \. L + O-`$@4 0MQ@pDH 00020P0CS,w6)('&%$#"! : QWX00 R04 0S SQq#3 0 0 30Ѝ30030H 0 D@pЍOgWX= "44 X#8#8 xpP'T%0SR0S # $$("(4 "8#8 DxPT QWX00VTDpVT 00" 0  x -X* P00Sz "0 xT@@? 00y!D txPTp!0 gxiT 1i #Q\倡們P0P p0X! 0 JxP030#?W@D p0W0 0 7xP030#?@D0Q0 0ĠĐ P0 pUp@D 0m   xP030#? \  xꍑ`T) ) ( 0( ' ' 9 X' h@ <' H8 & ? (& O-p!`1 0IM010> P@p6 .P PV 5P&VO ]0@S008#<tx'4'< 110↶  0 'xP 0 0 1 30%Iߍ [: J@ Z"448#8WX 0S #P 0 I0P$ 0@- M@P 0 o 0P  Ѝ0R Ѝ0p@-MP`P@@P@T 0S  R0S 7P@PЍp/zPPЍpp@-PM@tH$HPp0. AAS0C .S .R Q P-S .S .RQ P_S /S /0 SFRT@-@\9 TI S RI@PTZ 0S`_ D DpWE U _ R` DPD0U& `V0, @@@0T'\\^\ ʔ 0 0 0R0C?o20SFT R/T `V0 DPD@U / 00& SU R D0DPSDPSU 0S R U R D0R0SS 0Rd10@- $M#B 0( A S0 0S  R lQ  hQR 0S0\000$Ѝ0\ 0S S!0S.  R  R R R0 S 0/0S S S S S00@-V/ 0  00S S00/ 000S00/00S 0@-P M@P4 0PC@,0S0S 0S Ѝ0/O-P-M@"4M0 0$08 ,0 2p0:,10`0(000  ```   P:1000 0 P@ 1] 1#X 01  8 P 0 00 000 08J P V 00 8,01)؍4Ѝ !448#8S 0 0PU 0S $0S S S ~V0 0 0$0괎tV0 0oV0 0jV$0 0긻@ @A-p! 1 0AM`@0 40VP PPU( 0@ `t # 0 0 4 30Aލh0 RP P@ .R@ @A>PdEV 0 X  dA-@TT!0 MS  8 S* e`V" pP Q 0S @ T S   0S QRp`Vx p0 0 0 30 ЍL0 0 0!  "봷ж@-`QM @QPp Q Ѝ RR dPP,8#<8#8U R R  P0R  Ѝ  R RD0 P 0  \ 4 G-`p@ DtPP  p @  p@!O-@-hMd)4M40= ,0 080&<$00P :&< 00!S90C &, R &, R(0 0: "448#8S_n 0F @0:0 0 piTP00  03/P &< 00@&, SS 00R0S00j 0P0<040'4tx'xWG [7 0D0$`>j,P@ H0( 0 ZPE0 P'TpP^00  03/PU @TpTTZ 00S W+ &< 00SWWW !WU W<q0@P0S(0S<80ZCW$0HD00S S80 C, 0 0SP, @0(PS$`E @T ȕ@ pPlp htT7 @0 0%|%x% %% % 0000 00uWP + ,0"!0 R R 0   PR, 0tTU LE0Sw T00R @p$= ,0 2 ݍ4ЍS0@0&< 00SQ  G'WR.0@Y: T:30 0<q0@PN0pSpW 3$(%$50 5s (0S: 80ZC@$0\RC.@&< 0@IPF #40 0%u@00SD@sS00<:04Q < } y$0DRC.@<0H %mu00<0\2z0 0 R@P 00  03/P U 0R 0^0<@j: @"448#8SPPGSP=(00(0Y >Sz :S7S@\10 0 LRPP00 ! s@ P pPP !#@ L0R4  4 S Q 4S @00@PRP@0@0S 0R $ R R $R 0P)x@ (t  O-`$4SM 0@0D10pPP pP $p xY8P00[3  P00 000 _P @pPY 0  MPrr@P#3 0 D1 30Sߍ0000~R Pq 0 .P0P R R. B/o" Sa d! S8*0Sn 0 00 DD0Q 0 pp00 PaN0=S HR0S4 S* S) p0S 0se[j0S 4R00JrHrP0  Pr$R0S00G 0 k000  Q000S000 0 2 30ߍ0 0|0 S0$00$00 `P$`4>$00,0@(z `\6< l2 L;20\0 |0 S   S  Q  RQPP  XPppWS|0R0Q0S 0P^㄀Sg : P|Q ,0 z0S Q0zS %)0P40 pᭇP8x 4  B0 pU0P00^X[ 40 4<@D@P@`XG 0S0pS 0S S 00S . `P0 0 ;` R R R`0S0S`;0SX: 8`S0$00|0 P4<@@`D8n00SzXz\t0zS0SC x``>4*4: 0 ,*@ 4 *0,`$@ 80Y?@ <0V 0 f362 F;2P |0SM0 S F SRCQ Q : \Q^3R?o20S QP`0 `P0 000804 e?0<00PVX@P񏐒0S Y`V `tV`Y(? Z 020 P @ 0@TPU  m0P0 gP0`ภnT0:  0@@P@ PP'nt0S 0S n  t0`0| 0bP)`: 8P| R 0z0S Rx0z0e  rP : 0P00z0S z`p,@$P00u`V0 $P,@P@@p 000 Po`V  R R R`VQ $@@`P mmV$@D 00Swr 00`|`z 00 P 00 :0P00 0`z@P {mymX_`]  Q P $0 X 0S 0A\?o20 P00S>0S Y p`5 P 0 R   L" l1, 0S = 00 8*mz`jP  0 @@uP`H`ZPjP HJH YHT0 V@0T* m3z0:0$Pt` P@z X`@o `X輐Y0|0D Y000 000n 0 >: А `P _P3D0L  L0`P00D( | z0T SR S ^  Q 003 Sኡ*0 S :0 SJ O_@$P1 0 ez0"t0R00llPP @0T 0@bl@0T@[lt02`zp,@$PD<  Ѝ  Ii . >⣩4 s`P1x00x0 #lFP@0T00T0@lP 0`zO-LM XXa `@  PP00 0PD pp R R R0 T@}0Pp ((0(  P00 U pWpW 00 pW0S 00SU$@LЍT G-`M  P@ΉP p ` @900  0؉P <0S0- `ЍqP~k 0廉P mk@D@PP <`P>K 0  L O-`-M0P 0@0SP $00S(Ѝ @-@ AiP 0  @0O-p"|2 0M020) `@1 p! GP SPX LPPQ BP Qp!1 0 2 30`ߍ[0@SPX S0@SZ00 01P S00 0 P ZY0 S 0 . 0P0 Y:   X 0S  XS  P 0 8봈܇ 0@- M@P 0 H 0P  Ѝ0D Ѝ00A-.L RO-LMP `0 D@00p840 <0T 8 0 ȟ 0%00#0(<  .  " b* . ,@Xǂ@# !p8Ha@@ 0"00#p0H<@@ ,  " p Gb*@ @!@@$$ @ǟG #!(p ǟa 0"00#,p 0ǟ<  $ 0p " b*!){G OpG@,4pTGǂ@@# !84Ga@@ 0"00#VP0p: =T0hV@Hp` J0S@@:p`F A$p@-P0M0`@ 0 00 !? 7R8 bx b   D 80 0 0 30X Ѝp@E~\z yG-M\\Ÿ T2T"0 `00  p6 0R P  0XS PP031  (0LЍ1 0 0@-S@ 3/@_O- MP@X Qs 0`  @`f&AA! B B&"`F`F"f&AA! B B""`F`Fa&AAu! B L B \᧗" 0\ P3 L0 1 0T0p0`0`Ff&pGpGt'PEE!0F0C!6# G B("AA!0C0C1# B B%"AA!0  Ѝ QTr0`   J 0p Z K`f&pGpGt' B B&"`F`F"f&GA! B B""`F`Fa&AAu! B B0᧗"Z P Z Z 0\ 0X0 T0o0 pj0`Z$Z5 Z1 Z3 0 pY0`|\ \x 0L0 10`p0L0 1 0p0`fZd Z Z Z 0`[`@p`G0|0x0t0l0h0dy7 (E ! 1 p@-`P00 01000C 11.Q   @@P0: S@"P P p0 P 00C1 000APP 00LDL@Z@ ʚ; d4 `ğ0A- 0@P`@V @0`C0APP@`@ 0PP@`V PP`pV p0`C0qPPp`@ 0PP@`V  0`C0PP.S 0`00@000@ 0PP@E0C2S20/.-,+*)}'&%$o"! kf ]OK@2S2[0/.-,+*)O'&%$J"! I; /*)000 @ @  @0BdABdAdafAAFBdABdRnAA0000paP00` O 0PEQQaP00 E 0PEQ`P0兀ಀ00PE0 0` 5Y0@- M@0$BÃ!l! A1!1@DL 1D0]PAD0@% Ѝ0 QԺ O--(FM@ ' M8 t d$ `!0PP006RPPU0@06Z0P40 0 060: 6 0: 6P0: 60: X0,0h60< P0<0 0  UP0 ?oR20S 80`1  <0` 0` 0V T c\T0P0S50:,0e?Ⲁ5`0x0 `VJ X,0p?Ⱀrd50? X& Y80*2\PT,0? )R d4`0   NP,4 *40 eᐄ40 [p40 \QT4 0 `HI0S\\P Z0P40Z0 @#3 0 d4 30Fލ Ѝo`: @\0S 00SU80`1   ]@ [0#2 0 d4 304Fލ ЍO\X$弐,0!?0"( [YZ2DP0H@PJ[IIY:`d 0!$4$(#"(R(. X f[` _[ Z0 Ᾰ1@ 000 .)ZI0 I⩸YDPH@ ꈡ0   ᛸXh0  0 ㍸<`L` [ Z0 ` Lu0@ 000 .) V[\ ZKsSShP T Ⱥ @ h ? l?ȸ `, D hD 8P| OX d  $  h O-tM@@ `UVPPk0P 0 p   0 0 4`18,SἴᲕ0   46< 4 0(V 6< 0A>0PPU R800 0Z`1S   ;`1S0 ط0 0 PL0 0 P9P P P&0 0 P0 0 P0 0 }P0 0 qP0 0 fP`1Sy40S{ < P5p0pW  0R  0Y$pW 0pW  0R| ,0YpWg 0pWb  0R4 00YpWHpWE 0 PS 0 Y`1S   0 ` 0 `@0 `0 `,00 000J tЍ   40S _2P 0 001p0 001p0 001p0 wx1p0 ZV[L QYtЍ tЍ 0 શ/0 ࣶ0  0 0  00 x0 yKLز 8 6 d  4 `  ح x X 8  @-`0 0AMM0 40@0p0 0 8PP0S sD 80 0 4 30AލЍ./aqD4D0,@- M@ pp Px8`PYP 0S@ h Ѝ00S.S 0S ЍHp@-Px AM p00 ` $ 0 @P  8 ,0 0 4 30Aލpq4CB0p@-S@` P0 @S UPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 Ѝܨ p@-@MP`X0S 0 @S 0S@V00ЍpO00@0 PhV00Ѝp< 0@- MP20@0@x0 @T U Ѝ0l00 PEU:H@@ Ѝ08800 P@5 Ѝ0l. Ĩ 4h Qp@-`M x00<@P 0PU  0VЍp_40P0 ` Ѝp @@-Ц $-0@- MP0@0@? @T U Ѝ0p00 PU:L@@ Ѝ0<00@00 0P Ѝ0,, < X 2 0@-@ M T ' T2T7 0DS3m~0s.-,u*)('&%$d"! ZTO #TC |QTP  Ѝ0 T6 XQ TP 3^H1P0( @T" QTP Ѝ0 T" PTP @T PTP  T P TP PPPPPPPPPPPPPPPP|PPtPPlPPdPP\PPTPP x $ Х إ h ȥ | x   0@- MP O@'P Ѝ0 0( 0P  Ѝ0@ 0@- MPl0l@0A>@0 @T U Ѝ0O,0@0 P Ѝ0 ), H Mp@-@ML ` 0 Q0PP@0<00 00. T @D R000T H0 0 <0 30 @Ѝp@Ѝ/.0 TY/n: |:O-PM`@P P 5 p 1 0 R ЍPv SPPP -\00 +\00 |3P0 0  R0N1011.\ 0 @T@ ➀( P 00 S #3@  PR Z 00 S # 3 #T$P+<0+80+40'<0'4 0(<'( 0(4 0((0P p 0S 0p X 0T00  0R00#3@0\SP   0R00#03 3TP ,0 T P00 S #3@ \RP 00 S # 3 #T 00P 000J00  0L   ;9O-pQ- \M0 R Č  $Ȍ (̌ 0,l8,#4\ЍXZ HY 8ig MbQȜ ܒ & ́ @-@P0D .R S0*SQA@0T.S 0@-MPp00P@OO 0v. 0 0  l;Ѝ0 C-`@P@ MPpOP @U QP@ W @ Ѝ @P@p0 0000 Q P J0S0Y@OoB@# D1 C-`@P@ MPpx@P @U dQP@ W @ Ѝ @P@p0 0000 P 0S0Y@OoB@#x 00 p@-@P̴00CS0 S  P 0` PôpT`00CS 0 S R 0/S0@-M@0 0ᐴ00 !R !PᎴЍ0@-g  0S0@0Q R  004S 0@Ol@0QR Q  R Q -Pp@-@@P@0P`0pp 00,p@X0#,P D D0 p@-@`P0pp0,p@ ,PHH0 A-@pP0`p0 AL,PC-P0 M0`ppp@ HD@ <80  @Ѝ 3+PxC-Pp0  M0`pFp@ (0  =@ Ѝ 2D+P0 0 /*P0 0 /*P0 0*PXA-pP0 M0@P` p 0 pЍ\*P 0 03)P|@- tM pP0 `p@ ( 0  !@Ѝ2)PC-Px0 M0`pp@ 400  @Ѝ a2L)P8@- @  M0 Ѝ(PH0H 0p@-@0pP p@I:2p|(P0   0 (PH R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/G-M(@,pP  0L1`PC0S P0S7@000  0``0A 0ЍX 0S0 S.R 0 R.00 0  .S 0 \ \  0꠿00p@-P0S@` 0 0C0p脿 0 pO-0 M@`PP)X1*00T,:Yp* ԰Ԡ@  Tp  6p0 @\  P0 PD000000 Ѝp00 PG ЍX \ @-R M @ 0ASPAA`0 p0SA0qp0@ ЍD0hP Ѝ  00P`X O-p-MM0/,0= <0 =-=80< 0 <000=004080@?͍0$0=P.M00 P 0S` @0⯍P 8P(0@0 P0:= 0 =H440`P= 00- 0C0H;0H; -0 0<>h0d  0  Pp*0LPgZZ 0JS񏐺Exu>rt:xc7TxRe.-~}|{zyxwvutsrqponmlkjihgfedcba`_^]\[ZYXVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*)('&%$#"!      T0 P^Y 0S .Su 0Sr 0So00S.Sbjl9ZD =<00S 0H)0C ( 0, 0 B QP5D0Sz@  0D;pD+00Sd t`【0`Sp[ 0S @0D+@T 0Y4  0d  0  uP@ (= <0 2 ݍЍ词@0 8P(00 XP`0 0P:;=<00D S.d D; 0D;t700  5P( 0, 0 B PH 40@寍@0 8P(00 P D;0B& <Q060d  0  PD; Rx6 00 B(0#8 ,0(00,0D+00pCW``W$p@D+ X5 V@ p I 0 PSWrʰ0 PI0 0&PAt5 000W#80P5$ D0N 0C0 .  . 00CS W0 A0 PD;`0DkV:U`D 0 PD;+$0F ^D;pd0`d 0 00  cPD+0D  d 0  RPD D -0D+  D+d 0  >PD+0D;`V  spD;`V0D;  0d 0 00  "P(00,p`C 0  P0  P 0  P=<00SD -D; D+  D `-0 D;0D;  \20 Ed y0  PfP:D -D;b0D;`d 0 `0  PMD u-D;0D;0d  M0  P:D Z-d D; 0D;T10:0  P'( 0, 0 B :PD `1 A PpPLZ ؐ `/Z 00 FxP0J 0GS U0 kP#"X Ȕ  h D t  0 $ Ԁ    < ȇ *  < 8  ( x 4 ܀  d 8    T ~ } } H} P| { tn z y y py Hx pw VUUUw XTw pj u u u Db =<00SD ,D+0DD 0d  0  PD `41 Aa pPWW X `/Z 00 FPs0J 0GW Ƶ0 Peap`D D  PD :W0 PQ+ZD  =<00SD;8b0`d 0 0K 0  P8D0D d  : 0  P'D;p0SD;j*b`D;0SD;b*0d 0 0 0  P =<00D SP%,d D; 0D;`30 0  hP(00,p`C 0  PE003d 0 0 JP=<00DS+ 0$0C ( D 3B!?C0 SH0 ,P=<00D S0$0C D 0 4P D;0B$ `D  0 P( 0, 0 B PD; pBqW8` `V D;1 Z2  0d  v 0  Pb(00,p`C 0  rPV0 PN 0  bPF0 P>D 00CS D& =<00DS0h&0C =<00DSx 0&0C D; D+  D `9+6*D;媠0D;6Z0 yPLD "+`D D +D+(7D `(`0(  0 ]P D D7B!?C0 SM0 KP=`D <<0l $0 :P =<00SD *D;`D *``2 D;0D;P80 0 PpD 0 -P D;h`D 0 P0D  0P D+0D; 0P}D 0 Pv D; D < 0Pj( 0, 0 B }P`=<00SD; R3-< R i0`d 0 0P 0  P=D+0D  d ? 0  P,D0D d  . 0  PD;D 0SS( 0, 0 B #P 0 uPD D *D;D *D H[D *0 0D;H[0D;?.=<00DS 00;d 0 0  EPD`VD'  1R̠p`0 0000+= 0 0H+f"H - V00B- 0D; H D 0Sx 0  P( 0, 0 B P 0 PD )D;l0D;`d 0 0  PnD )D;0D;0d  n 0  P[D {)D;`D v)D;pD q)d D; 0D;=0P g-< R 0B- -< R( 0, 0 B FP*D  Ro@>B!?C0 S\0 P_= 00H+!Hkd= 00`C= D  0HkD 0 lP= 00H+!HkD= 00`C= D  0HkD T? 000#80y|7 D;0B/ *0/0C % D;0B/ 00Q0D:H 0 $P3Z 0 PD;`DkpW@ 弯 GQ9g D0 10"3t/ 0;D0000;D020!20;D00030;D0#100;D0100;D=0;D0  P`Dk`Dk0S>0: 0D;D+00SP p〠0pSG 0S `D+`V 0Z6 :d  = 0  P) D0 10"3- 0;D0000;D020!20;D0000;D=0;D;D;D D0 10"3d- 0;D0000;D0200;D=0;D;D;D;D D0-10 0;D=0;D;D;D;D;D;Dw D;0B, 9` pPWW  `/Z 00 F7P0J 0GW 0 *P00,0C '`D D 'D;pD '`2 D;0D;;00 P` epPWW  `/Z 00 FPw0J 0GW ʰ0 Pi= 00H+ HkṰ- D;0`B- Hk D;:d 0 X0  PED; 0SD;.*t*t * ` D+p@J Z0 P( 0d  `-0  PJ`p@ D;S: 0 ~PQ0)0C b9d 0 `0  jP0SG PyD;p`0`SD;0D;; 0d 0 00  MPD 0 BPZD 0S 0 QP D;0B( 0 (PO 0BT( = 00H+ZHK= 00H+&xD;p0D; 0`P7d 0` 0 ` P~0 [Pv|0 PnD &D; 0D;0`Pa= H 0u0PY-  B H+ 0H; 0-PH0 P@D h&vD;p0D; 0`P1= H 0E0P)-  B H+ 0H; 0P0 PD 8&D; 0D;0`yP= H 00P-  B H+ 0H; 0P\0 XPD  &D; 0D;0`JP=H 0`P= 00-0C 0H;0 H;0 0P0 P0  Ph0 P`D  0 tP0 P(0 `CD;t0pD; P0, 0 P}D; R0 Pp%d D; 0D;p30q0  P]0D#0C W00 PM0 PE 20 P9̒ g D;0B" Wvڤ0 Pn$` pPD;WWc \ `/Z 00 FP 0J 0GWM ^0 tP0`0DkV:?0 dP j0 XP Z D;0Bt! 8 D;0B`! 2WP0 >P410d  0 0PW0 %P4v Xv Tv v  pt s s q r Dq q q xp 8p 4p n o to n pm =Q| %P [ W0@0@PQ 00@ =Q   PЍ`@QxZЍ`[P` W`@`_][`X`Q 00@=Q ؝P PZ` ZQ Q 0@[W0S `QQ 00@=Q` $[ [ Z [ Z Z Z Z Z @-0 a0S`A00XS=P 0SQ.C+S^2. @@p 0000   0 C R@0 37 #0CT0 \     0B ^037#> BC, T A-Pp<U00 P@W0`x0`W0 H.p\p@ R0070"200 0 S037#0R0 \00/o/p/// @-DM` @ 0p0 < 2 0 RP<00P@0P< 00 0 <0 30DЍ5X T | O-M葟 0q娂)`ᩒ A'r0 i C0pqB!QP C@$Ah!dP@@C3.*T6W>YFX @00 SP$Z R 000    00 R @Ѝ0 W rP0 DhPW 0 H^PY 0 M SPX  ꉈ%I$: @A-`pPᴨ0S.@ ŨT$ 0D0 .R T  S\R C @D.R @0. 0T  S\R  @@7( 0 0@-M0 M 0 P @080P Ah PS<o8 ,0 0 8 30ލ Ѝ0CW  0-@- M0@R0  =PP * Ѝ@Ѝ/ % Ѝ@Ѝ/*WPR0@- M P@$~PNP0 ? Ѝ0@2;Ƭ00 Ѝ0PR0@- M P@WP'P0 ? Ѝ0@2꟬00 Ѝ00@-@Q M P2PP0 ? Ѝ0@2z00 Ѝ0p@-P@x2P  p@ p@p@-@P 0P   L  S P   pL 0 pQP@- 0R R  7 0 p@-PPE Q@+ @Q8 Q' Q<T: 0DS6*)3'10/#-,+*)('%$#"!  rP  T@T @pdP y 0 pp@-PP @RP g T 80,D0S ϫ 0 p T@pp@-@P Tp (0":k0cSp: A pO-0-tM@@0p=f`P60S @P000<@-^-+*)('&%$ r 0 00^00 00N S_ 0qQp00GqQ0N < 0pN WpX   PEUDpPP <@P :QgkR࠱ࠣ @E Rk@ڐ g{[{{R EP_ EPL%b @EPBP E ʓ <@[<00tЍ00XS <0^ ^y 00V006 0SiWM IWJ NW , 8P0 p)0 X03/P+ @ U: p  @T0 X ( R W  R 0G'WS8Z :U X0  A@ pP4 R 0d80Q L0R00SK h@` pIPZO[P 0 000S !烡 Z(B(U /o" R WS0\` PT&00X 40S@0 I@H 0SSQڰ S"@UP0S 0 0X, @C 0@0CSX:0,P Ɩy-80@ XC 0 0CSX:@@嵖 00 RWZ5}0 0 Pe0  TNၖ 0X CR00ST1X0$0X? R R R 000XV*00P R+W 4 XpR000pR00p  QX$H 8 Q*p 00VX 000X0408p040,00$0<0t3}0 0A P0 R  TD ,01Q05R*X@@0P@X@ 0 CR00XẒX0 @00X00 D p@|00< p%u. P[<`ޕ 0@X CR00S᎒X000X0 03/P X,@ 0(D0+P 0,0C0 X0 %=.| P00•04!000H8!rEnX$)X0P  A pPm0 #  TV40S0X@@ვP\@X@8p @A< T%.DD ,01Q *0X@@0X PB WD,@ 0(D0O+P 0,0C00 ̙ h  0A-@SpM07 S20 0)PP: `P5 80 0P偧P&`   0*0P+U Ѝ 00S S Ѝ0 0++ 0  G-`0 00" BMS $ 0. SA~ P @ p0u #0GB*0P @T *X<<" 02P 0  "2 0 4 30wBލ 0    ! *.)@PH ppPC 8 0 0@寥PAp 000 0000 0 0PZ+U8 0 @ @IP  ᓔ00S 0  0@T(   0 0C 0  -+ 0  &+3 0  , 00S S!5C D  L X G-M0p`@P0P0 0   0 p`LPЍ 0 @PP A-M`pP՘@P ,  ( 0  P* @٘Ѝ, 00Ѝp@-RQ M8P@``/0SC 0S 0S0sA S 04< 04 0 0 0@PsP00 ЍpR R k/ 0 0 Ѝp0S ` 0 0 Ѝp0S00  0d|  O-P-| x| L| O-MXX P@QpL 7(ZB U U U Q 0 1`Ѝ0` Rz  ?0Z& + y`PP 0:/qp  00P @ P 8&00 0 00Ѝp  c0P  * R + L UZ p  0MP 00 0SM   00 0:/qp 00`Pÿ\ <`V:X0`v R0D00 l0P :/qp0` c 00 0`VÿR <`VpX0PZKS 0\T 0<`ÿ800C`V0Y !QJL`0`f? ` :/qp@ 00  P  @ P %00 0`Y 00 NP)0S&:0C``09`ЍP`T 0S  0C`ÿ 00C`V0Y  0CI `\A @0\ =% 000  `` 0y 4O-S-$MP  0 0؅`0:p#0 B0S0 Q6  R00S 0BQZ  $ P ; `0p0[] U0 00 @PS  0SRRV  RR00S R Pd  D0 P0Po ^U T~ U\  C0 P  P ATq ^f S 0 WP02 0SV. EP) Q0 P@P 0 Q ^@T T' T. T6 Y@@ Q  再p0Sp$ЍZ P 4#00\00 0%W T TT T S !$ `p@-@00PFG p 00p0@@@p0TS 0 pp@-@PPeP P 0 03/P Up@op003/P U 0< 0p@/p0  0p@/xP- M0 3/Ѝ/0@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0 R R R //00/00/ R R R //00/00/0@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0 0@-RP M0@ R R Ѝ000P3/P P Ѝ0003/P PP 0@-RP M0@ R R Ѝ000P3/P P Ѝ0003/P PP0@-0@ MTP T T Ѝ0003/P 00S00 Ѝ0 0R0 02/ Ѝ00@-0@ MTP T T Ѝ0003/P00 Ѝ00 0 3/ Ѝ0R /C-`QM@p Q) Q PЍ0 03/PP WP:UR X$ ЍC0 0  3/P PW*UX !0P0U URPЍ  PpHHBP0SPP! ;A-Pp`@P  R 0 R 0\A/W 0A/0@-PMSp@`  SW- ᗊ P R`V V V Ѝ W` 00 R D0SPV=!00Ѝ4!00Ѝ  Pp (#p@-P@MT` T T Ѝp0 03/P 003/P 0  Ѝp 000 3/P 003/Ѝpp@-P@MT` T T Ѝp0 03/P 003/P 0  Ѝp 000 3/P 003/Ѝp@-M@P0.S00Ѝ@-M@.p0CЍ R? ..R0) .Q -S.S AA#Q0L \S' .S 0 .Q AAQ0B Q AAQ0B QS  Q0L \-R 0//0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C///*0 0 /h_ P$ $M 0 0Ѝ/D_ H0 4 /0 48!211!A1A!0 A]P㙳p X0`0@\s0X0}`@X0v@@&010( R003P[ 0k 3 ""pAk +\p6게 0 L0SE*.00:pQȞO-P,MX0 p4pt0@p` 0)[X> b{P @Qa W{P @Q㈀ L{P @XY P`Xy V\Xr .X 0D0C`u Ys0 R S.Rl  P@] #{Pj  HZ$M0xSJ3  000 A P0XY /Rl ]RRP ^0/ $$ 0 ]R& PR " YXuP   Z J b" R Z A @Rg .RP`@0@,Ѝ P` 0D0C  [4:ދ( 0 ,Ѝ׋ 0 ,ЍP    Z"    R  PXY  ^0R S0 Y Ą0@DT0S @YX(@ Q*0@Y ÅS Y`Ą0@DT0SXYyY 0G-paQ`=*0 S) \5 0P0S/ @S" 0W*U  @000@琐@@ P 0S00BAU0SPQP!P0W*( 0 U @O-`VP3P# M0 VP3U0p\ @H @R9 R R% (00 ЍW@ Ġ[? A @ GRPR@\ 40S @[A  Y*@T*0P40 A\ Rɑ!" 40S 4 00- M ЍO-S,MP  [  0S 0S@0P0w @Pa \rTp000[000 0P0$@0C0@TX @0S @S^  0 XL*P΅T p@0T00S 0 Sh*`V` ^ N Y[ R0P Z PC H(00P0S  0R* 0G S 0S 0p$00 0AT" 0eP@1\0[ 00( 0 ,ЍATX0S ! " 0SPi4?<00 R```V0 S000R0 ABQ AAX QS R0SY 0R?0)4@0 )Ɖ 0 ,Ѝ 0H p@-P0 0M0 10 `00p !@p < 40 0 1 30ލp@3 10 p!0 0 4 302BލЍ᷅P ൅PP  5/P Q Q 0 0zpx0 00P 0 0 唅 PT/> p> x@|0= \ O-MqQpP  v A@pf a@0` RD0 0]x1PI 0SP p Z [ @@P 80[3pP .0PU :Y %`P`PS@P TP 0@U:W @0@00坜5@Q|00p@@!ЍPЍ<00 o < zydy8y$ 0@-0P $M@P P0L0 0 PP $Ѝ0px G-RPL 81040SA a q`p@ #)/0@S-00儑 000S 0 000 00 xx0 00 \p0 0 @hG #(00`D4̫G-耟0S@P$0 @S 0plP`P0S PU @@P 90U400 h8@ 0@ P` `vuO-P-dM␐0YS3RQ0@ # 000Sc`0S00 000x#x3 0 0  0tP W@3@0 083U0 @ 0 Q  Q P0S-   3/0 0'@W$U 0 L00L9PL 0SI 0<00@00 0<0)P< 0 S@W@ RP00S-! 00C0T@dЍ.A@@@, 10\U , 00S/  R||1$ 0 @ $(0e@$0@S( @ ( 0[p+ p1S `bPI 0@0C00$ 0 @ $(0P6 @@$0S( @ ( 0@$  $(0@7 x4u ttx `s( s r  r @-0N \0N@ T \ڂT 0 \Ђ 0 0@- MP0 @P# 02c2c200:S Ѝ0;0 P 0 2c100:S<0 P0 000@-Fl@040F. "lV,h PTQhLl -R 0 P0R 0R R0@ o@- Ÿ 20#Lc\*0Sl S| 0C l l;Sàʌ͌ec\*0SZ SP` @ 0cϠlT 1C@010|0CsFno2ffaap1@S@ 41N?@1c1c0^0B0P0B\`D4lL S( 0S``Vàڤ0PA0A0R002c2cTÌ l làL l làP)\P ף*Qgfff$I|(0 P /0S/ 0 S/0S/0S0@//O--M0@ S 0 P H$L(@0 48<0 DWTŠౕnPnnAD(@,jP知GNΠ౔^@n n@,jR柵౐BΠ@N` !B0 4 jQ柵౐AΠ@`0A8j`0csP\0SjQ8v8V8F88f80Sj@,lX:lZ1! R4 Ee@PϠrllq q qC C Q BP^WoPU4 X%80 c s<0 <j( ;RT0:`@Qq( $Pz  UTZ WV^ V0 P@` Pp/  / R0AͱV0 aͱ 0  F"F,l Rl0l0U"R*P;<Ѝ"R 0S*0Zb/ 0*P;M@@` P P00C RWUW,`㸠  `PPH 00R 0R0S V00oW2 z6 @S%VCL00S R ;S,S SH0\- 0(\ 02FSPPE4HspP>0HmpP+ H00cH04H9 l@V|@hƃlhpp崠x|:… ᴠራ }r|ЍPo  0j [   1 0!0pS0S >S0C#1 0<P0:P 0,Sd0:P 0SH L$ )(l6 0 $ pbhƁ p60(圔ax|倆0*ğp0;lcXh4 1!?p00c0["\ L   cX*-S +SL P~L Pv L00cL0p p,0唃唓 p|#cR 01:d#cRp3 0! 0  cRp c s S R 0R㞁# 33 p0j8P@@D,@P 04p0f΂Q4p8P<@@00HS0Ű1Fp p,,0s 1Tu00H2~~)\ ף{(\P3p@-@@0S p@JPP D@P x0 h0@TH0 0 8 9[u@ ; [H2xD; xG-@QMP `VC `Pb 0 00T0STK0SE `V LqVLg@p`_dPV`VF|pp 2V oPOTR hQ8 X1X!0d0 P000U00(a]PP`F U0P0\  RP e?PE  PE0P0U0S00#  1 @QPP  l 0 0W@ࣦTD,u 988uܢ h7[u 7DlP7@-^F=<;:9p7l3j10/.,+q)('%k#"i PmLKJxh RwtLIzS WWU0 W   0Q񏐩00@0C \$SjPg u0Sq0W p1!PL  u0S0W p1!P<  u0S~0W p1!P,@@@3 1u0Sq0W p1!P"  u0S p 0W p1!P  Z u0SU0W p1!Pg uq0S?0W p1!P `0*S1 0C P@00C P00@ S0`a`0`F0@ \$P0 uA0S0Wp1P 5 u20S0W p1!Pu%0S0W p1!P * u0S0W p1!Pu 0S0W p1!Pw  s u0S@0W p1!Pf > u0S0W p1!PW p <Ѝ 7 u0S p 0W p1!P9u0SJ0W p1!P,pn  u0SC0W p1!P  u0S p 0W p1!P u0S0W p1!P p] p p0W M*0P~ <Ѝ@@@@ dp6c ]pz\ VpU OpN HpG Ap@ :p9vP/p. @0Wp10P" o  p u0Sj0W p1!P^ B u0S p 0W p1!PIu0SA0W p1!P<$P}0`P00 pu0SO0W p1!P)@J u0S p 0W p1!P p p pur0S p 0W p1!P p ypx  uM0S kpk 0W p1!Pu:0S XpX 0W p1!P00@ S5@01000C0@ \$P u0S7p6 0Wp1@PsP  0!0 p Wp1@t$P@0O-@-oMMX /L0? 006000!R !0s0e 0\0H 0SE   RJ D?Xp00d04?00h00ܐ$00 @@匐H0`TPU @%Ug PU 0T  `J 0 R 00S0U`O0S #X  YP)    R0s P=*X1RRzXOXTQXQ\Q.vh0N@QD,TDl(8PD 0<X ``P`YP``0@0@00 0T0pP`r01 000 0GZS.oHGFEDCBA@O "s:0f+~{zyZwS00G@ pA@00G S$Wh @_W000PAU`{*`(;$0 i   S5 0SP|-0r0[T0$ @ 0PU[PPR00S@ryP(@P@,@8@4@W000P @0S @0@0S0000PP )9 0 6 30( oލЍW @q}`r(@PP,841 S0@R00S<0n00000`BVpQ 0Qr0S0Q 0Q0G0S00 R} ( PEU \(  0 p R0 /S1 VPPPz0] 0@BT%S<00e007040[0$ SL0100 @  | L040Sx00t0 `7| R1|0PP @x0P0CH0 0~0P@0 t0$@S-0r0|080s p00 00  W xP?P0p0XS0` > 00 0 R *0    S20    \ 0 R   0S{0|PUQ@ H ( P Q000PxH0 0Cp0H K[[Pdp` K[{0\p0SD @00NSD `Wrid|pP0@0(@PP,P8P9Sr0zsQ\0p( P R Rmdp R 0 ,"0΂!0g0 Pw0Q 0P&Q000P0 c@=:_ T $00]u@H:q T $00o<@1 8 PL $ L 6P,PQӯ$84s0D `hP@, pZRӗZ,  B, J0 K0Q 0 S0 P0P( PBUPU ڐ0QpP0;U@A@TT}ڌP  @DT0Q0S@DT 4 0^@0}P000 P_0S0 lP0PNS0yd\(mdp!0 ΂00  0g0SP000G PpBUo ` 0@@`pPEU 0R`0 S !P000P0P000P 08 10R0bB+ S- C S!!/΍ L!/A!bCcS000@0 @00L0@^B0. ^L0`0`0[0r(0t(0P0O@p(0PP,P8PO0PP$ L L    P  T $$ @ NSL$01LS-0`r0͵[$ 0@ 0BT $$ @ 0O0Pnr0@ p ,0 Q P 0S000T(0@pOT0P0P,040D0  m  S $0  j b  SZ $ O  PL $ L 54 T $$ @ T $$  @x{(0p$0`Wp`{prT0S 8  B0S0S S8 ( 00PT,(0(0PO@p4PzpN 0PKR @s0 Qp(00  `$ @Q P040my?80T0吊,0844`` 0ZVpJ0  J 0S U  S  RX0 Z0P@0,4`吊 P<ps0(0 0(mTp  d@pN 0PpN4000Pf4 00 ER0 ."!.00A`0p x04 ZS 1 0(0p@]N4000P?SH 8 K B¿u Peh` (@@`p PEU0\`0S j'N 0P {SL0$@@L00m J T$L@$ $ L  E T$L@$ $ L PL $L SG $Q0S$L10L$ Te $$  @ pPL $   L T< $$  @ YM 0PupM000P MPPP M 0Py0X 0Rp 0SL0 L0$0  PP0 |PoM000 PQ0' 8 O@pPP , >ptp(00J0S 0&YpJP@ p(@T8DP@( Wp!w0m40c0 80 0N00 ! NP@T`L$ L L$  L  L00LL   L L$  L L$ L L0LJSL0$L000$ |?  pX 0kp@@0 @0 0T $$  @^T $$  @TSG|P0 S $_P $L0L00WX] 0  0|Q] 0  0zL$ L &L$ L  L$ L L$ L   fL 0PH|Pp@8 S$L0L000$  0`0i T gfffQ ### 0L I L0$ L00 L0$ L00 @W0P0,0! 3 S$L0L000$ 0@00p00G S3@A@00A S$Q0S1 p+0pS p$@$\ 0  0S$L0$$L00X 0p> p$@@$ P@ `/0X 0p) 0SL0L0 p@-`M@P@ PO4P0 %POOЍp8 0@-@ MP 08O0 P9O Ѝ0O-pKU/ M 0`PltbX  ЍO{KE{&{0:0 SA. 6b@0c 0c33:0$0G{@+S6L0[(000X0 Z ,0Z0JPC0J_oPåRS 0S000[(0000 0 0pW00`P 0SZ00WPPU0 Q1 0 1kHK!"0 1 0{0KR {0k& [( R {[2J:Wk{{+S 5AH k+C0PS3{01;:00G{5  [ kDk6k+ K R4['k&{;:000C{5{JG[2 k0U 00 pW0pp0 Ն00{00:k{{+S 5A{+CG{5{Fk{PJ

p`Ѝ -- M0 0U ЍЍ/0p@-@Q r  P p0 S 1P po PP   ! ]P @0O-M` p A Q P*5[$ 80Sy SP  @P Rs Q)Q0<0  T" $W `W `k Ѝ @WTQDQD@ Q A[ <0 P   N <0`0 <0 QCW   `V0BSTQ; "!` b <0 V 7T P a PPl3 j P! P T@@b   2  ` 0  0@ ` P !R/0S 0C0/ 0RA-@P)p`B @1S@  C BS   3`S0 pg3wp1V@ * C BQ   Sb R PPO-p-tM0<0@0  O0\0h00dp` -R-+*)('&%$  C8000R 00B S 00$00lP@T0PA T00Bd @0B Q\;  EPJ dpd+QS -Q,,d0A P0Qdd0Q 1AP*0Ad(d0A Y d0L0A Y( @P (,P(`(0S\ 0p\tЍd0W(XP  \(  AR  R /o"0 ZT@g{Xpp XGڐ: P9f01k5[X 0S# 0Sk %0hS 0pHpl00XS `d` 0R RKQd000S\00\0R  h 0 0SiQ IQ NQ(d@g P 0 00d0\ 0(S 0h 00nQ 0h \0dp{I:ț\0H 0\00S`0KS0 h Ph  l00C l0  09 7 5 D3 1 0 l0RA 0 00S S S+ h! 000 @h BAR \ *0    R 00  0 b3"  0Se $0S 00P0\0=R"00h YX   Z BXTd 0A P Pd d0A P lpHpWh  h501{'pH `" PhQ ` l BpYlp  lp p`lp 0 A0S@0,0Q GY  Rh` rA0`000$0, Sl  @00Sh3,0@0000 00 0S?˟80(  J ( ۟ 0:DD@ PP   ! Mh0 `P h   !L`pl 0G00@P S( 8 B p,0 G(8pS BpGpp W Y (0RpGJISGQF 0SZY  @P  pP 0S0S  00SPX 0 S #r Z $@0, S0\0 [ht 0So 0CQ 0 R00SqaJ400H0000` l0# R00S 0<0I XT3 Pc TQ0hSQ = h  PhQ 0S A ^G@0, Sl`0A0`  XJ` l0<04 CRoᩒY )K{8Ik{-Zɋ10SY }?@?AV瞯 ~dp( pg  D0Hk01{p W'"00{0z?C0C'zp:0 0:AQ'0 0!:?C0Cp4656:RH k ,10{0  QH ]000d0 R' `00W'"610{0z?C0C'zp:0 0:AQ'0 1!:?C0Cp4656:RH ( (20{0  0Q l d0Q 1AP d0A `  QP d@PS d00Cd0 Pd00d0 00000h \0 h  Ph9 `0 0`0 s P300 (  J1k\00 {0G GPlP H OZ/ 0J4H0  aPh A ^0S ` 0Q0`0K@P  P4 K4 ` 8<PP Z" PPhPh @0 0C@0l00Cl0- +h00 Z 00H0΋000H^4U@Z{00S相 zI8 S ˋ2ahDPA\00Q00\0b @000h0  0\08O"0 0 0000h Kh aPh~ l0` 0Cl0H9P@!0\0 0OJ4 H0 ,  b0   0 10<060SN 0000 h0dP\0h Sdp0p @00h@0l0l4000H 000\000  P ?N 0S 40400CPh@0`0Cl0 Ph1L0L0LLQʰ\ (_l00000,P0 \0D [:S0 0!l, h:6 l0\, `0 Q:00XS Q0LR)Ao^& 0 0S  0c1# 00Ѝ QN0O0l1 c 0R:v00Q )Q 0[ O-Mp<0` H8@P00S 0 0P  B0@0P 0SQ^ 0G PP0 0Q DS ^^ 0S 0S S SK pPr@00@0 00W@ !CKpT0 Pe 0SUP 0@00S S 0 \Pb R  BPPa S@ 0D0CSڣ0SpP[ 0[0 0  RYd*0  TDQ @J \ T   @ T 0CC10BePDP|0S0SCU 0S S S KP@"00ЍRu  BPP @+P~ -P%  LP ࠃ:L @^ > L@YPl #@Ѝ   PL 0X@0Q 0S00r KS S80S #0p00 0p b@0J"00@@~P  D21 2 Qn\  B\  ^   @Y 0Sg Sh S @0p 0ЍI  PePgy0S`YJ@"00Ѝ@ @QA@E|pPJ 0H0Y@HT  21@ 4PEC@80SjU U EP  000b80S80S800c8080S Tp0+  RP!@L80S L80SH  @X \y0l 00f@`  BR"@^"1P 5"@!@V+P(&V  /A-`> RϠP@pl3 ^P 0 W`00 p 0U@PEPU 0 BP `@ pVp  0 BP0U@98@-`- M p\@KUW0  C00C2S6cА*ZKE̐* Q A@{ Ѝ@-@0AC^ 0S R0A@-B @SA *@Q0A0C00T D B @ H0"S1 1  !2R / 3RS/00 0 c R\0\0 a c R8080 A c R/A-^"PbA1! !0T2, lp(  T2,N10C#10R! R 0000T TN0NC1^0 !P@-@M: R @ 0S R0y@ЍA-P q 1p0S2 U`eO@T`* 0S00 000AT !0S 0%x`e@!0 0D1S  000S 0 I xd 0p@-@P0p R pPQ`00App@ID `0 S,00App@xH xd\0  0#10/ P#8 R#4#2#10 0// /A-`P@  1,0@Up00p 0S1pP@P?pP   ! -C`} 88S00000P0 0/@-@P0@0O-M0[pp  @S0P0= PaU*0 F B  9G 0 X 0 *0I0Cp0Y003 0[P^  0 p>0 Y0 0[ PT@T 06S 0@ЍG-0q@p9$A QPiV= @ PU `  PP+ @ h10S~PP= 0S ,11PU 0C  P 00Si`P! 00i0000000S x0d0iV0S 80 ,0R0i D ̇xd8q G-P`0b@Tᡢڃ0T&P# Zp !pdF0 n .  P2)0@R0C`0P003 `LpG  P`B-0P!1^$23\ *G-P@0p@DTG !1PG*32^ =:P  @aP @0 0S 0SQ 0 A BpQ3 3 V  0 0S3#V0 F B S 02NS @0@PpP 0 0p@- @APG0D ` PR @*P `1<P0DR 551 16 +CpP56 +Cp4R `5<5#11 +Cp0?C- MkWPAP @4'J66V0`0 T 0  CND@D@5`@ Ѝ P `!30  0S  T0 C@1@` Ѝ00S/0 R /P1@-PHQMPB@s`P4 XpP.0S  Q6 p 0: SV0P ("( @0 $ ,( ЍOEO000Ѝ, DE 0 Ѝ=E 0 = 0DUp@-@ 800CS00 P8pP  BR  /p@-0rSM wS aSOP` E`00pLP`0S e C+S/ ^R$ L0S@@p0KS0DS0ES0PS`@P`0p@-S4 @7P00 P! !& 0S 3/PP೼000P @ P 00 00`aas7@0`` 0p4PD 0P000@-@!R !P 0C 0 0 S /4p@-@Q1P00S2 0  EK 3000S7 0!$0 3/0:0P-p00P @ P I00< R 800pU0P^GY`4P005p 0 @0 0pD0 @0 0p8 4-Ѝ/@- QS S S C00 H0 @ ,0 @b 0 @6@000 0 0000/@\SA-@M{`p$ C_o᥂  P$ (P G SS (\y0၀Q  0(Q\ 0 p P Ѝ谀X (P 0^\ P  X X%8SPP[XA`B`($1 $$(0XQ0$$1((Q| 0 (0 ^S:0 # P9 ;`?4`8@A0?>0BDp=%|E F%(%I0JC`GH<`0LpM Npጀ K`OPGDFPEDEPFGPKJIP`HIJǐHPƠOKPƐǠNPMDLFEPG`P`P SR`PPDE`GPQ`P\F0` pP 0 A/p^ APM_Āmp[Q 0pfPM`Q 0pfPBQ 0pfP8 Q 0pfP.Q 0pfP$Q 0pfPQ 0pfPPQ 0pfP UލލAOA,aQp@-P P4ATp  @P 41S P0p@A@A-4!@j pP31S L @P!4Q x0P0W0S!R MoPPP !Rp ExW[ApXApUApp@-@P 0@a@A-@`"P] VapPPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V @0@A@ @O-,M R0  1 sp3/,0 (Q0 P `@P@P0S$Pp NZ@ PU@XX 0 y`P] @^0( PUJ[d`pp,Ѝ 0 kPPu@ $`XkPZ $ 0 P`P4 @^0  0 0PQ QA Q  ᰠZPರU` K@(  dP0  fP @,Ѝp0  p4kP ,Ѝ0  f@P00,Ѝ$`  cP(@HT 1SX$0(Q$ (1ն`o0@-@ 0! \ @?,?00,1S@-@0 @ ?00,1R@-@1  0@?,? ,!G-`(0S M# pPw@P3 Uq    ?Qv 0 p?`?P`ލ Pc  0p '0 VN pWK A/ q9 ((x 0(p**x* ..p.,|,,Ġ  !! !" p "x#"$#Ƞp  $0#4(, ))x)Ġ000#.'p.*|.*Ƞ*+/ 30 !!!"!"$p%"x#̠"$&##4)*,-p. 0120(48<@D )7;4)x).<.,.?C5p6809:@A0HBDEF =p|L 'Ġ**<*pB0BBB嶌(tǀp*<**0LLL尠p*40G **8H*0HH岀0(C **Ƞ*4 0pp' **Ƞ*4 0pp'**Ƞ*40p 'R p p APXl^T JRPPğ  8/@0PH(p'pP  D!B08 !0N⸑V Q UQ`PP4Q$0q$aPP ||sxx3xx@tC  `p `pލO` ß p$> >Q{>Q r 8 8 40D ! =@ =V Pq^4Z X!3\@ ,2$\ \@c4x:P3u0 uD H  p$OcP!82CG<,0(PX QsPpY =@`@q@8  408 D ! Q=@ M=PP '=0P0pW p=PPy=P^v=`GPq= @l=@8& a l\O-@(`X 0000 I;q00& Z#Z! 0J/S  0 00P0: S 00 p0 R I R0?004 <0 0U! -p"00SY `0 S00R0J Z  wP0000S ῶp pỶP 0ppGorr  4l0kR Q0P:Q0Q:+@-  @-@@ $ @ p@-@pPm#,Pg$  p@p0@- @$M0@ P U 0000P 00 0 p 0S$Ѝ0$Ѝ0XP0 0!p 0S00000 0 0045hོꄐ O-@-dM\0P T:U+\   O+\p 0C0.t%01 U* 0`b僐@ X@ H0B$HS񏐊laW~}|{)X0Ƞ,Ƞ PX* 0UU X !    s     jT     8P@ 0X%X@H[$H8#8A[08#80 1$Ѝ00 0   8    8`Fh&h08#8K08#8E0 ` P0?2YC-Mp`@P' PP"  0   Ƞ  ,Ƞ 0 !! 0 04000000 @PЍЍO-MPp@Pm 00 0 0(R 00㲁1.@@ ^C  0`PI  10岁 0@00D0 00a!Pp&#P@Ѝ 0`P!   10岁 0 P 0 001@0 P@Ѝ ЍA-pP @` 811 X0  P 0M0S@   L Ƞ,Ƞ Po00 000  0KЍS)!1 0C8##Ȅ00 P  I0  %  P 0 0 0XA-PA A hL &hPp a Ƞ,Ƞ\ L Ƞ,Ƞ⌀@@ X  !00 0F B0 Ƞ ,X8QQ#8P("(R  B("(`` @@V0,800 000 0O-P-0DMSx0"tp`2$ (0:*@p P 1"pC 2x '811p 0 g'Ȁ 0 C000S_ , Yp pp 0J 1$(P`P[ 0Z 08 #8 B2R񏐶k: 1! BRG*0*S00:\ ][\ `` 000CS񏐉~}|{z7!qW  E p SR008 1%0C00 0 0 04<00808 7/ 00Zp p10 0P 01! C1ğ0C0  B0 *811*(0  V; 0S 2$ (0 00 pP  뼡 Y9$ ( DЍ2 @ 00  V  ^ 0 10C08#8S 0C8#8 0P0!0 B1 C("( 0*R0岡ᴡ  B("(0 P 0 01" C *8 1W10  *(     k 00d  ,$, PM 0 0 0?T' Q 00S 2$ (0apP $ $( DЍ C !P *("( B0@ 101`p%[  p$ 10C001A$x 10C001*x      z00 pUG- `P?@PN `V8 2 X 0 `(  pW' Q0; R    P@ 1`0C08#8 0C 0 P0 0RpW 0 10C08#8R p jW`0 R  ]`p`0Q ` P ` AC-P@$M`Pp  300 WW 0GS ( S񏐥U|R0GSe'00$Ѝ( A  0 ;p` 0S 1  1 ^PO W W W(0XW p  W  BP3 H⨀H(弁PW) WI,0t110C0 8#8CS  (1 01崀  P,0p1! B ("(R[ 0 Hp0| P 弁pP ܸ0 00(0 00(0Pr?⸁p (=` 2 00$Ѝ0S? 0S< 0 X7弁W[ t 7+긁0(0弁-  '(01ḁ0C08#8(XPW+ p  W  ~PnH(<꼁, 1 lP] 0WSAqW 0G ,p弁 1 RPC 1ᴀX0C08(#8XX 0H1崀ሀ!0  1 -P pp 0C 0( 각 0H⨀H(0!1 p 崀  Pp@-@`PP 0 00(0`00Q(0pO-,0M@0 1 pPC ap`F`h&hV1 PXh%XV @H$H  @\ 0F 8`P 00!01@0 @9 0U @EH$H 0f0@ 0p0Ѝ " US ! B ("(R p0  PЍpQ zP `  ἀ @P| 뼁0S0  $c뼁0@S 0H 1SpP 1X0C00C\   ("( Q  " :QP .P7 !@ B  B  `P' Q0S0  V@UT@ Q 0R `0E 1pP p` pPm P_ pxa A1@D@@DH$H vP@! @1 0P` `FP@D!H$HV@ `F! Hp @ p `1 0p1p`01/  P @T0*p/尪000/b @-@P , @ ($ 0"T:2O-$M p0P (@`$ \0  0p0p pP@`  %Ÿf#""0`( "$ `$"     Q!  %&d!"d+" !  pp1p0`00\1 0`P P@  j.. @\ !)!Š`, !, $0⦠b*b*, 0 0 0 @ 0@P0 P 00`0` 00$Ѝ:8iC-@P Mp' $Q`?PU($8 V#0(0 `8`P` b8"#4b4#  0V@h 8# Ѝ 08R(@R )@ b(#8 !#)8 b# 0A-1?`@Pp @f(XI P 0刁$0@pG0( $0p ?W?@`G?`@`` 0$ <@P U 0$ ?pW ( 0$ qp0 p$0?W@`G?`@`(`@ } 0$ <@P U 0$ o 0$ q0 0$ `R @-/ C@-@P 0 S@ (" 0"t4R @-}/} &@-@P 4@ 6 P" 0$$4O- -\Mp (@$@,@A@<60@(@4@0,@8@$^_~?L P @<@H`40P08`0 P p:` p@0(00,0@0P`p@P` p$0 0  0 00$)$%Ǡ07")%ɠ7" ; ,40# (000#&0/'!!,  "' 0&$ +$ (̠ Ì  " !,# ,. , 0   4$000 P(0, 03 00#a`8`pIF᠎   `!7p! q9ǀ #"Ǡ"97Ɍ,;(4%(0#4 `,` @ 0(P0#0p`+p ?,P)1 ` @P) ?+1 p DP@.̠<3Ì` P0( .@ 0,0# 0, $<P0P\VL 0 000 00 00 00 000000 00000 00 0$0P(0$P0(0,0 , 00 0008 40 040 <08  0<0\Ѝp341Jip@-@@DQPP`U  0pRPQp b p  0P0H `@ \p@,R Q b "p  @0A-1`@Pp fPXo :@0D 0 #@0D  H00H0L00L0pGPpP3W_`G```@0D ;  SP@0D *H0L 0 H0L UpW P@0D qp 00#0@pD H0L 0 H0L W+`G``P` @0D ;  SP@0D *H0L 0 H0L U@0Dq0  # @0D`R @-o/G-@PM )PH8 I `p ` U@ Ѝ@-@P 4@  P 0$$h)R @-7/PG-@PM PH(  `p `i U@ Ѝ 0` a!, a c,/@-0M@Ġ  00 9 00Ѝ0@-0dMyP0~P@xP񏐧}gpjZTNH#  vChgd}b|{d]\[ZYXWVUTSRUKJQPGyGFEDCBA@?>=<;:9876543210/6P ژ6P 0P$0 000P0?CP 0P 0# 0 0p dЍ0+ 0  +0#0 0p P6 0 # 0# ,0#0 000:P 0# 0#000|0 l F0# E0# D0# C0# B0# 0#e3Pk 0 030pY <0#d G0#_   00 04p[ A ?O7 *0#B )0#= (0#8 &0#0a 0#) %0#$0R 048 0 0# 0# 0#  0# 0# 0# 0# 0# 0# 0# 0# 0# 0#08P0 0# 0#0'P  0#00040 0# 0# 0#0w0rd 0#`0gP0b* i)t(@((((4P&`$4$\$8$G- M0`p@  000 05HVJ QP0S PPPL W`A 0S7 DP= Tp8 T 0S: 8P8 @V (! 00S1P0PW 0000 T 0@0 @  Ѝ WPTU U @ U U X00YY =: @6F xHtF \F @F F E p@-̩0@T 03/@T6dPP 200@T 03/@T\఩p#H00@T 03/@T$p E E D D D XD @-MX@@P Ѝ  0 4pЍO-PRp M ഁУ@  `980 S# 0SK: f0  0Z  0080 S 0Q>0 O 0 0 Ѝ 2  0 0 2 0 @@8 @ Ѝ  P00 0 00 0 sP00 ЍᕭP   ꎭP  000 0@-P RM@PQ   0 13/Ѝ0sr? 8P100@-P U1!^ 0C BS \ L0D0p@-`PV@1@!T 0N B@n\pSVpC- MP `@(G C``0V#pؑI@ T`1 `! @D s T@ p PU Ѝ ЍpP p`O-p-M؁ 0:PH 0F PU p  @P 0U`1`!000 0FW0  PU0 ! ЍЍ@- M` @  ~ P 0 q@pGs @DP @PPT  Ѝ Ѝ ЍP/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-@R"2 0|MP0t00\ 00S80S `h"`2 0 t0 30|Ѝ4P  囩P8 0 1\ 40v`08 04 0  0$ pW`9 P%8X= 1!0!` 40 4PU 08  R88P@P`0X A@8垫 12480Q8 :{0 S pu08P剫pP8p9P 8 ` 0 `P p8Z00V08PjQP8mM0`0h`e0  @(7 O-p-M *0: @$00 20D2 0S{ `Vu 0H"4SkSi90Vm ,0:0`000P . S\ ] } S`PI \0P 0  0CX 0 !>01H0 (0p0S(00S1!R00:X Z c/\ H c/D0p 0S 0 Z00 0p 0SZ0S00H2S708 R,0:, 4P,P0R\ ,0(P(P뀐4`0c 0 @ p  (`VP` 8H7(047_V04`8X00 S  0 \ V Y P& P PX V0"2 R8\((\ 9P00S%8Q 4Y4 @ [`@- X`D 0SX 0 EPZ【PX 0SPc/  00 0SO ZD 0 SR@T T0S $0S  !a0 0S 0@T `6  P0 SR@T ,0S?00Z【 c/\ H0 SRs@T  R 00"00($4 0 2 30 ߍ  p 8Qc0 SR@T 0S00Z【 c/\p0z@ v~0 S ,c`\ᎩP((\X` `0ၩR48 0\R408  \P0` @ V;0 SRI@Tc `^X P2 `0 R(S VPR V`Pa `8@4080 SR1@T _0S00OM0 SRc @ c@ ``¦ 0PP ` O8@P@,@ Xs q@ =@ 0 SR @T 0S@ H 5 3 2 P . - 0@-P`@$M@`@ 0^80040000 00VPP$Ѝ0+ O-M\C\@qA^5SQ`Pqx q6 @2 0@T`0  Q2@0"B   R R @Y0@"2 0 0 30ЍhTŸ <qAЍO膜T 04S:`W ~> P Pp` ) l `X  {TpK`PYH  T  QX Q(   ` T 04S`WA @~p _X` `H`pK`@ T W`@Z~~ @-@0V@p Y ! 14@pU VYp:qT?o20S` P@c0 0 ^똁 t tt s r 0 ! ƒG1p@-S@P  0P ! "0 2pp@p@-@P` VP p0-P@  P 0S RP0/P*0    PP0/0/0@-M<<1 0R020* ^3 0 @TQ*QQ P1D0"A^ R QQ*QQ  Rl d0 0 2 30ߍ0D800230ߍ0@ =| { { O-p$M"10000 00 P0@@ ᠰs#P@ (P P`# 8/P 8/P8/PY  0@00 S0 00P @c8/`PT*0 0 @T:8/PY Y}  0 SYz0 0 @`TP* 0 0C0C@J BS0!AQ RS Y B10V T0Sv* S:P 0pC00000g0SPd0P@t$U[*`c⃠@W*0 0[ @ 8/P Y Y 0 *  T [0P0U:$Ѝ0  0SiY 0 0V~Y 00 0 `r0 0S0 e0/R $ЍYu  S` 0 @YF PSe  B[Yv  0R08/P8/P0`P08/ P P8/P0 PK8/0P p8/P 0 J0P 8/ PT  8/P 8/ PP P S*0S:  00S  fP0  @a P0 W 0 R0"! RS  B#10S 8/PU 8/ P PPL8/P8/P8/Pu8/P``n8/Pt8/P``_0 0S 0 0C0C @J ES0!s 0 0C0C @JS E0!hR Q0P:Q0Q:@- 4C-S MP@  $3/t`  0  QP `R4P4S  $3/000 Ѝ 0 A-pd 4V:@T@T 0P R 00  0R 0 00 _@P0`0dp@A 0A-`M pỘ@P"0: S:PP P\ 0 ` tdЍAP00ЍPЍ( $$4/p@-P$0r0" @`Pp4U $0000C0   0R 1  00 0p  0% 0 ? p P 0@-S N  0 0R 00A0 4O-SMx`A`ↁ0P@p T0? S+Pk $ 0  QPSU$R PWTf000000S@` 0 a 0`4 S   $3/ЍS   00 S`0a  0R` 0 0 0  0000Ѝ j 0 d 0 \O 0 0Q 0A00/0@-S@  R   0 Z0SUp@-P@T @T 0 Upp@TP`p  0S S/P/$(0#   @// / ////RQ3@-P # 3Q  RM@`Ѝ0p 0 Pp Ge pЍ%S 0T @0p 0O-0SJ 0P|  Ry p@a) \T B,B R`  k V`!   0 B0`@ 0 p`BV` T0p@p@T T 1 !,03/Pf0p0CS@D0R)  0 T`1 `!0PVQRi,03/`PDY l 0p0CS@D0 T0@pT0  7P@@Ps00S *V *  000P@D`V?V    R !,03/`Pʼ0@00Vg* `@ 0`V:60P 00 ``F`0`O N 0Y0C00 00RP  < 0`0C0000@@ `/ 0009Pr  0  0 0% p@-P`V @@D00T`0@T` ,0 3/0Pʼ0@00pD0Spp@//0p@-@P0 b0 Pcpz 0P0, @ᯜ Pᩜpe  @@-00M>R@ 0 000P001 3"00 =P0ЍH00̱0@@- 0M@>S   "0!,03,0 P0Ѝ$00- Mk ЍjH-M  0Ѝ$0$0- M 0_ Ѝc R  P 0S/ /0 0@-@ R 0  R 0  0 0c 0     0R0K0 P @P נ0 0 $0 0c 4@-@`pM`pP   P0 :RCo; 0  S  L 80(0P  Ѝ ; 0Ѝb #0@-R lMP@ d  C 00  "2 0 d0 30lЍ 0`0S p0Pr P"P 000PSp p MPP0000S!$p @Pa 1 0FB0/Q/K-,+*)A'&%$#"! A+ !!p00 +{ 0 0{'{{s 0SP ` 0i ppp  00 pHgP\a @a a 8p@-@0MPi00TanV( t0T!R O⺚0T!Rf0`Y00 UTX!\!R Ѝp@D\!S00Ѝp@;00UX\! X\!0 000S/8] x0 0p@- PUp@000TQ0`U TQUP  pX1P0X1 0T0`X1 ] xh0h 0 R/@-@00 X10CSX1 @OT1F0 @h\ x0 000S/g[ x0 0 R/p@-@0PəU00 \AQ\ X! BRX! p@⹙`ʚ00OT!00p@⮙[ x\ \0 -4M0 0,008 00 0 ,0 304Ѝ [ Z  .t,@O-MHP@Q@0@U P0 `80qp::0P0TЍp 0!@-@!0!1100 000Q000 0#0, 0# 00!R0Q0  0R0000@-@1 MS 0?P"1$Q 6Q 0  R& @  @1S 1  S( P  P    Ѝ0\ w100 Ѝ0@m0000 0/A-`Up QU @ @E 7/P@G-PTp AT P PD 7/PX PPHPG-PTp AT P PD 7/PX PPHPG-P@Up`L\ @ P@E 7/0P/@S@@@ ;X; 1Q`0000$ 00@100a0@00 0 `PT1S%  ! 0V000 @0 @10a@P@@ @@0@` `010 @a1 S Do @000Q0 @-@"P 0 PC^0  0 R ^P 0@/0p@-P`@T0M \ [ Rv    T0"k \ ` ``R```0000000000 0#0 0#0000`0`000T ^pp@N ``P`  T2 0V0pp@:R /o"!T0#00#00!0 0PT 00pQ  T \0 !g RC/A 0\R#R! R/R00> B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/`!`1@- @0,MT0$00> `pVP0STA 0ST@!0 0 $0 305,Ѝ  @`:( #<@$S V $ C0S 0S ( !0$ R0 H 40 0 $0 30,Ѝ@B2D 8D tC O-pM`@ P-TP +T@`00T W Xp p 0 0 ?0X 00b 0 0  @Pp P 6 Q P  S  R- !R  00B ^a0BSW0BA0BS(70BU%| X[  Q P  S  R ! i"00b"00 0S \0F00 Ѝ@`r00XS00 C R@0` p0 A BRWwp pvH0BR"\04 0;p@-@P'0T0Pp,@ p@-BR"^p@'@P0T0Pp@- M@P` p eUT 0S*4P  U@p Ѝ$S T@p @@@p Ѝ@0 0 0/> 0</0 0 0/t> 0</0 0 0 /0> 0< /0 0 0/= 0</0 0 0/= 0</0 0 0/d= 0</0 0 0/ = 0</0 0 0 /< 0< /0 0 0 /< 0< /0 0 0@/T< 0<@/0 0 0/< 0</0 0 0 /; 0< /0 0 0/; 0</0 0 0/L; @0</ @/ /H-M 0ЍG- `Pp@ @T @'# 000@-/"Ϡ R@ ?#0! PO,M  P!Ѝ  0S RP/0    P/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*AG-Q `@PpS Va p@RSV Pg 0Cs ?oo0CS00cÁs4V " rS% o?oHX0 0hs4ÁO@0Ϡ 00 TOOXp0VP0BV00R' 0b /ob7 4?oo0Cs! X7 0hs4ÀV pV e0o`10@@h47~t<ΠQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ /| 0@-@ P  000蠥d / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/00///Q R R  // U /Q R 0 0S00/ 00/0/00/Q- S Q P 0S Q0  0P 0000@-Q @% TS$ C0 P @D^TPPU0N QP  00Q S@ 0Q00 / 0U0/Qp@- S @ Q0CP S@ P` P 0U0pQ 0@p0@p@-QP" US QPEP  SU @`  0U0pQ 0pS PQ U //q 0/  // R S 0Q 00S00/ 00/0 /R Q 0/ 0U0/ 00/0/R  -/P00 000S00/s R S  0 /U/ 00/ 00/R S Q0 S00  /0 /U/S 00/R S 0Q0 0S00/ 00/0 //q 0/-Q S Q R  0S 00R 0Q@-! S BR0C  S  @ QR 0 0U000 @-M0| @000!00͆͆00dž Ɇ4 ,0 0 0 30Ѝ葪L) ( 0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/$ $0 00S0/`' x@-@p@-0@ ,ppPq0Pp=<;:9876;43210/.-,+)('&%#"# UP( (|x`\lCRW ,pP 0,@`P`@^H V [`4 ^ \ Z0˄S0CP [0404 R*d 0PCUPE_ Z 00˄PU*Y00Gp00G S`   0 00Sp0-`p Hp `@T u  S0P 0CUPe0 E `p `70xp `0uA 0SU00:P @UP0Lz 0P I   0pp@ p*W 00G SPpQP00G Sp+` 0 pP 0` 0ppVp ` `0,0 `6 0``0 0`u 0SU00P @UPV0LP0., ` `u0 QU)P @8 0  0 9plWp ;p倐8 0 0u`` 0 @.10d0Q00 S000D0@@CE @H 00<y ` `. 0, 0`uS 0@00 "0!0d00CE @~e< `u ``g P00%0!P%: 0@P"00  i dT0* 0P0@CC0CE @Q [  04z [x* 0``Zp˅ ^qAQAl Z0ࠃ˄Q*fAQA[0 Z 00˄Q*0S` M t 0``0 0|0 [0K0L"42 0 0 30Ѝ  e 000?0 * `0 `l ` `` ` P`0 @$00> , 0 @ ` ` `3 0  @0("(0  0 0@ 0@@@) 000 0 0 @ 0I@G  0= 0pPUP 0`T0  0qꗦd$ T l`0` 0A-p`P@PU J0SPE 8/`uX@pW | 0SS S 0R / 0R0@o/ @-ooG-`!p1 0M@0<40P0쀟@  0 @0 <4 30)ݍ  08p 0`p[P ዏt 0 p\P+   87   h  ԵeG-0S0 S,QU) X&p@`V@ 0`S0P0 S0 S 0S0S0S P PU@0@\0  R!R  R R RO-`-AM M ! 1 0HT0400#DDH$HT1  Р @Dp@T):0 lP U: XmUm0 XPNPL @0 0 4 30Aލ Ѝc D O-\!X1 0AM @ MT0407 0Y4:0px0(S`;  !4"T4T8X#8%XU"UPE/ @V: m m 0 vP PU:t 0 BlPP D0 0 4 30Aލ Ѝ0x0(S  O--MMh .> l0060 @|>T000G 1SD 6 Sb`1  0 >40X0 00h lb1 @0D0 >00S/ S/vP`㨐0pS AP! p O0 0P0S1Ss+P  @`TP00ST0v`PPP0Sqs`V0@  ^ 0Sڨ @ \<, XP Th080v?@00<0h0: 8 T 0S<0#H 1S0 x00S S00L01< 021l0:ATY0D0Sl00h040800SAT} H0@P| @0PPPzz 0;4@ qP @0P-P g 8 <0 @8 @ 0 T<0@ 0 P  SP Q D0S,0SN < 0 h0 S00D0!*px`tP␪60 0 P4/P t$*: 0 6 30ݍЍ0X0 00T0 h  pW A8@P@0Pz !@0P0 ) 4`0 0~P X,0 P: x<0`SP0c  `@pV  G0 0P`?t0$00(0  i0$( 00  F | &}PP8 U0I  QP `1  0 x80X0 ,0 &,0R  /0,0$0 0 F0 SOb0!`倠?A9c!@00}P 0S @0P m0t'@& 0c ( ,0,0P1 Q!  640 P0`1  0 6T0X0 0 0 0  +1 01 0,0`1  0 H60X0 r000O 00x5L Pb0%0< t XW80x00SA0L0B  00 @00D00,0oQ @U`D 100 p 踠V@00uvWU1 0#03^U1#3 1 $03 Q0Cˆ UY10#030 LP#D @EU e Vʐ$0 @ 0 @0Y0U  L ˆ0v`100@0P y0#@4#4 0o W (0X00,00 T3 X0@00$3 @XQN0"@" 0D0 AQR % `1S 0  Z tP, ]`!!! QY   T20 @t X0Q E.0D RZ X AT v*`tPh lx0Pp4/P?W0+S .0CS,P@N0P_IPq0 p1D@X0 H0,0d |P0q@ E 0D0,00 0@X0 )0`!`V A X ( ܰد ԬȫCĩhܦLdHܤxܞDtLPԚ`h  lԙS0P01SH 0T0T00S S00 0堠0 f$0P1C WT0 |P0 T0{P(1014@ `PD h p0 00 <{0PypP 㸰D TP B("(RD D I{P~0X0{Py0@:t@ X0 6S$0S 0$0whVPK0g(Dp"( D T B("(R0D D  {PI0X0F@D0Pf 0"@# 0هYW 0 0R` 0`1  0 30  X00(V0   , UP  E("( 0R00  T B("(R D  R,# zP0 3\0X0 0,0ፉ0 $@P$P 0⃇0 84 X00&0R  ,5U 0tP> 0 E@`P V@ 0 2ˆZ00P `8D0S<0X06 X 0 p0 P| # 0Z (0X0@0 0{PTAP 1011S1i= 0 c 0 0 46d@X0" 0`&0R  ,0 x6 X0OB 0 0 0e݈0&0& ӆ06 @ Xʆ#" P0@K@0X0@0P4 ᱈0|'@' 0⧆'0+S .0CS@0P ᖈ0'@( 0⌆ P0@ ဈ0@(0T(T v r0x(0( h/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@kzP$Ѝ0 szP0͡"c1010$Ѝ00@-$MP@LzP$Ѝ0 TzP0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-!1 `0AMMp0 40pPH d຅PC @ + 0SP7 \4 !P00\+ @ FP0 @R  R R @ J@ @ @ D ,0 0 4 30AލЍ  HD O-@#<3- 0BM M0$40103Xd0:3@0:$p00S000- 0p   P?QP0\400 PN0d04 !/ S L 0  e\40 0P 0  0 0  PP P03 5e S1 -e hP10$430KBލ Ѝ!448#8S0Q Q/ Q e     d - "448#8 $$,  P("(d \W$@ @ |,G-`\!X1 0AM0 40004p@ V < 0心VP PP U.0P@ 0E8ĝ 0  0 0 4 30Aލ PP P@0.S@L0 A>PdE4  tdꨜp \@ O-p#3 0BM M`P0$40PT@@Ud[: 0.[@[VS5.K2o11T- d1 0T 1 #R T40 0hPY 1T0) [ 0 '0s"2 0 $4 30Bލ Ѝ0 Q4xPN t"PH T40 0Y0 D DR000& 000SG .SB T400Pa0=S 1SA S5 S6 T000SC 0sL0SQ0S c00d1  @@T?00& D DR0 0 " 00000S0000   R00S0000< 0 0T400 P\~c00V@;vcPꫛ    p@-@P`wP p@Dp/O-p0dM2吐0@`P&T V  0 ,#à  #4:U@  4U 0 dЍ!0 +*0  &V`0 0 F 0 ybP0x 'x#c c0SUPP   B R`00 0 BXbP ccc b뺐HdЍ `F 0S0   b b b  bY   <H0 LtC-@0 M(p`P/@D T@/)bX b0b b "440(",4@0 Ѝ  0j d4 G- p崒Ḃ@`P E0S@P0WU! yb@ubP, EG kbE4|(0`( "4`43Z1S//0O-䱐 MP0S5 DdDtD`p @ S S0   P&  P0 PI  P00^ 0  SR 0  SRS Ѝ+#d10P0d10 H#0P   P  P060 "0P  P  P090\ ᩀ000<ࢀi0:0  }P  vP090090| gP010r  ]P020h  S0P0[^ d@?P 1? # } 0 2M$ 80P0[C @?P 1? # d} 0 (32 P+ @ P010   P010$8PP$ TDON̈`̇dX,NN؇T4t3@-@(MguxQu{` |  0 %  { 00 xSux(Ѝ0@-$MAT t0   0% P P00  0u 0 0$Ѝ0@@L1 0@- Q0|MU0t00& t 0p`0# @0  @ 80 0 t0 30|ЍPPꮘ h p0A-@PJs1 0!1n0SvOPpPp 9sp0Sp@-@QU x3s|p [01P U01000psctVxsP //XP //G-p`@>W`PW00V0S@ 0PS1S ` ^ Z `4+4;O- -0_M MP@050_0* $ [T: 0}`@',d!0  d! . 0`1111A05<0~P  0ʏ0J( @$zp d10 d1 ;P* `@ {`0SH _D@X S\  S S00 Q@0S S R: 0CQS0 C0SQ0000 09P 00~?080:} + 0LP 1#S;S 0(S# 8 R 0(S> 0(S 0|(S0 l8R00sS1 S S0@(  (8R1 S S 0S00 S S SS@@ `0 >{_A0P0@@0Q"0A'A+S? 7R1 S S(00R00S 0`0 S S00 ,@@0S S 50@ @@@@@06@uO0 8?0H*Pd4@ R`P 04@ 0R`y m`L0d!S 0 0 2 d1   Alq| է1|rAp x0τ`0S [ `0`SH@DH .S0S[ P`.EKV00[0S  00P % "0$004 0 5 30_ލ Ѝ0, SA T T Yʔ4 P00: 4$P000 ᐪ,p T T@ TT  ;T RR@T $$0 `p ;T 0000@@T  P 0 0 iP  80  qh1P- @@T;T X30 0000@@T;T   AP 8 l! Y@ P,pk 2Rz1 S Sv 0S`00 S S SS@@U `` y _AH P@`0D`S \R?* S S00 Q`0S00000-/}O5P.UP `4z1 x#|# |[DQ haD@`r|QLM0 SQ  P 80-1 `t @ 0- ll `7]2  (-]b0  V8 D.domasearnamesortoptioninSer8~<(x|l| |{chxxpx!1 p@-Phl@(MP ^ T 000(Ѝpp Qx#r cBqV p 1 xT000000HqPT $000(Ѝp"X"v!A-p RP@0`P  R P  @R0P\ R 0  0 p4lO-0-OM >|0P: pKz0P0 @  0 P@@     R`P yP[$ RQ0  0N/ !pG00#[b 0PP {yP0S [0 0| R& 0pG0 PQ.  ` ~0PaVpG #U Y@@W  * L 0 | *00 Oߍ ` ᐚ0 0CQ* @ 0 ,0 S @ :0C S : @Cp  P`P @pR ' ` VPE:p 0``@P R @DpU+  T: 0 @Dq`V p 0  { Ҥ[ 0  { 0  0  0  u} "@0@ 0@-@P @I 0 0{$ x @(0( 0@-@P00 00/x @-@P @I00zPx @-@Pv00@-@ P 0  p@-@`0   0MzPP `P P0PE 0  Ѝp=Ѝp 0  Ѝpw P!P @-MD108Q0pP SpG0`S ` dp4 Ѝ xP 0 xP 0S@ R w@P  A0|Ѝhh h  0w|ЍDD D  H@ EnDXn n\Dm3 0$  T` # 0$`$1,hC@ 01$000b`,0Ut,0 PY `F `$0 ,P0 ( uP 0SJP( 01 (0.tPP$ 0,P`1 0,P$`1~Pv `@ P $mb0`($0 0$`1j(,@@ P $tP, 0` 1R(0 `<1!0< ^ς}0S0 00@P +.000@P$! /1:^0   ^00 pp<_X ̻ (j$j  ii$ lf h   < (  <  dX@xd88_L__<_``8`,_@-@P300Q  P    $00<0 0@ ($ p@-l@@`VpPPpS0U1pPE1PSp  (0$ 0pPQA-pA@PT`QV0q@P 0 pPP``p`0(`,`@\A-p`@qPP T  (0 000P   d\\@-@@0/Z 00(/000/004/l00/X00/Y 00(/0000/008/008/A-x``PU pqW@Ps<0< 0 ,(0X "qrjs/< <0 44 -0 M0 u Ѝ8X Z&@-@0`00@@-@Q 00 2   0 G-`P@M@pZ 03p TV 00J 0000 00 000 0$00-PP9 0 2  <R 2"  "V &= " 2H 0 p000 0qpn W* W+ 000@V eP@Ѝ00@T00-0ṣPP  02 2 2: 2( fP)0? 2< 2D1D!00<1 0001 0 0$100100 1 00P 0 R00   0T 0 2 1 3/pd0SW 2: 2l ȚP 2 @0 2@001P,00 <@0HWC-p@ MPP  00EPEUC\A@E=2 2 X b0 R0S 2 +13/PP"?o2R03S FUPA (0$`(  2 P500 Ѝ(0 $``VP ЍP00 Ѝ(0" $``V000`V "V00"?o`213/pP ` Ѝ@-`@ MpPP  P00U,0`V( 2S * 2 P13/PPF `P 0 p 2 P00 Ѝ " Ѝv0P0P2!C-RP Mp-:b V %*AY 'pY  0  P Ѝ 0  P`V: ЍrpP 21`W 2< 2 ЍO--Xr M9* 0:`Q̡@p@ W ZJ̱ PEDpPP( ̱10PEUP 2< 2 Ѝ0 PE*P@ P Y Ѝ0 2 P Ѝ"1C-S` M2:rBW R"*T$* RU  R00U00SR j0  PpX U"B Ѝ 2< 2 ЍoP"! ЍG-r"W RbM"*R* 0 @\0 U@D0  PpY  U 2< 2Ѝ"ЍЍG-邀഑@ 0`P? pp Ip ("(R1 B!8. 1!` 0S001 V 0N 0 L Ƞ,Ƞ\ L Ƞ,Ƞ0S81#810 R2N0C2p0@- M@]0P  PP   Ѝ0Pp@-`P@0S  00T T @00p0Q 2S@3:A@P p(0 2S $A@P$00C$0 2@:0 2pC-@P4M0`S  X00 Vv 2+ R3 13/p* 0 000" "00  0$03 p`0 9/0P 9/0P &b0  ^ 4Ѝs$  0_qp 0 -P 2: 24Ѝ?(0p0`,0 09/0P  00  0# 000  0   0Q00S 0(00H00 000 &PL00S H0X0 P0S(0 p00l 0C40A0A8,#8@TL000( p 00P(0 `pV 00hS&h 0,`r(000040?(04,`00?00S$`(00004`,04O- @X1T@0 pS0P`@D%P h gP( [  8#8R40 0 S(!$10$10 10 0S0㔞P 0 P0S 0ᄞP  00S 1$10$100O-`@ M BXp 0Z pp ` XP !PEX%X . 0("(8#80EP 0 P CKpP{ [e0`00pQm Q 1 !(c P PEX%XpG0PK0K000 Bೀ0@P0@000  B W2 PP1! 8 #8 P0C8#8 H(ɺ0 pW0!8#80Hೀ0@0ഀ00000 Ѝ @  ` ಀH(eQ0 Cp ЍP u`P 0@00 0@ A-0p`@PR"  0S00 0ᑝU@ T: 0PX BPR P Q00S000Ӵ00A 8Qx#8 0 A0 0Ƞ,Ƞ000UU800C80O- @`0 T @@DH( $HR(P.X`࢜ 0S %(JPP# @0T @@DH( $HTpW  TP  {PPPA-`P@ T0@ Tp Q Q\PTG-@P `R  R  Q0@PR$  00 SᲀR> 0@S5 \A R0 ᤜP  0 0(!S%$! $! 1Q0 ᏜP 0 㼐ᲀ@p 0p 0 S V10@Rx ἐl'xP $1 0 !$1(z 0 O- @1T@0 p0CS0 M@DP`!P vf >eP' 0 0 ]P 8#8R0  Ѝ0 0S0P 0 0P-000@- M@ Pp10 Ѝ0O-M 0`p0 DHP@pB  P. X00   0  \ @ ಠ Lᱠ0  `p0`000S XЍ 0᫛P   C("(0C 0@00VP @G-`x"t2 0(M0$00w?0 @Rb2 SA:0JS> P Pp2 Sn1C PX: A  W1: 0C8#p#ȅ@*” 20 „ 2X!P1 0 $0 30K (Ѝ P@ ZPp Z 00C @ 1px'x Ⴗp#    0  ` 00 pP202 p F}v t A-p@ MPP`  00 2   Q a:1Q婷0" B!2!00 VJ XGFZCBH@0PU; "R!* 2 13/pX "\* 2<00@PI\0 : 2 J0 EP VP V$P 2: 2 0 Ѝ 0 Ѝ0PU "R:(0 $P0PUP`" hp01A,4QSX 0 0 0VpL㛟BS b0CS<S9괠00ĠԠ0000000000$ I(00000 00 00,40000000i00| cЍ 00 0 0 0 0 T0嘌Pٙ&D,t%%/ h%%O-pM`@d3#P\e#3pH RPGPP/ H@ PꐣLLLLLLLPXP f@QQP LLLLLL LL    L  @0!C!-\\ R0C0`20pW WT Z( Y 8㺞PPPXPrPT! ᆆ `P  PPc 0+0V!YqPPpVp@`x ㋞% B R갤ȤȤ$Ȥ|LȤȤLȤttZ V  X ߅ 7/ P  R H $ d  0 $ d  t0YmPR0S @;_&%HD,%X4O-p52/x |@P5 Thd̯0S\cT2S H  ([wPePLP PPp FP f@P8LTLdltp000p0 0p0p0pp p|߳eW 9N@P0: SpGP ɳ@&%&0n&O-PM`|\`[DML2LLp@ X^p0$20Q1S 0 0?0PE`0pWWmS pS ٽ}P 㪕}@ YXJ   00Y0  0 R  M P 00M P00 2?`  Q ~ R 0/  0S LpRMP ?`0S Lp&D,%BhO-JM M@|ZrR` ]p1 @DTC qƷ0S T  絽wViP fP0 hP CvP0000` 0 `01D5M`P0: S$! PP 0P 0X/S J>00/ P$CĠ@T ,0p/S[/ UP 0 S:  r&`p ძ OP`&&%`A-`@MP$Dw{ 4 0 LP  L LP  L LP  K LP  Kp"l30h3PPP P$P( @30]P+( WP3( QP7( KP;( EP?P(  P=P( 7P P8$@Ѝ(P ()P7T"(0S (P(0S (P(0S (P(0S (Pq0S JP!0S0S p X唹`PPa D1R`3PU 0E /R UP(UPU  400,0/00=_00CS(0P0$0u00S t㡓0s00'%*:P'Y2:L%0nR:5x:& &:A-@PXzYp` \p 00S V PfLP PP }``P _$ڵ 0@T&%h%%/ O-FM⨖P`zpX` ` [p p6 HX.0S ЍfP WP! PP p `RP dP xvP iP00p `rPxPpp0p0 p$p㨵 qX 1S VDdeddPU 1K$0P S<500S5<3@X*/Q /[P.QQ .QQ[s$  Q00@  0P0S$0P`S0S@ pP PP0S ㅒ50C SWh 0$S P #X !$00 $ X ,0V0S $ ?RR00R0SV1 $0SX  P 0 0C0 IP 0S @0S  ;0S 5S 0S 0SRJP 00 0 0zX  pPs IP k0S 0Sd 0?S` 0SNSS W #000: S R# S /o" R 0: SHP 0S  #P SHI 0SIP 0S 0?S 0S؄'?E&%yEIEiEG-P@cxH W@q`  Zp 10S A q @PP RpP vP0`GHP;P0S ^V / P 0S 0S0P HP :00S =&%'p@-PM ӳ 7 $ 0GHPH@IUITD0 00GP007CV嵶3P0 0P 30S S! S 3 aIh3 ! l3 00T30S  R 4#6 R #!SR3B3 3 M20S ($2 20S 0S'002@T$G0"P%@#$B00CS00 C 0 D B0S60016 R0S 10S<l$G0PT<$001 10SQ 10SM(g$x1d1POT10S P10S l1 `1 0S # 160S 8C B@$1 H01 M(*$ ) F0S0F0S 00J#q0SeF0S 00P9=#@P`@>Toꨋ'&\@%''Ԏ'0'''\G\H%P%\Б'%܅'\FG-PM vwUb2r@@@0 S  ;X" dXpD 0 L1 0P8| 9HPh9dx 1HPP|9L8 )HP8t9T< 0DS 00S8 0xL@#UQa0D0@0 0Q)@0SZ L PU㓏a0@S񟗶444t|@ꀁaFP d{@@LbR SP QP WTP 0@0 00 LOLO0@0 00 0 TPLVR @WD0S hx GPT8P&%%uuuBt @uht@ut@u%uuD,rgtu@-uE|PO-Mpu TkT@#` @@@0o0C?o2039U#3p3 X XT 0S9 Z`7 [``3 hڎRPGPP VH@ P(((h((((`hP vP  fP@``k0T 0080 S1 : ᒯP @V A0S #S@V  ᴾ`PM 0p#?. 0P0  u0pmp VFp h0S40 080050C SCX4444444$t0S o@PT0S/ = $Sp 0 3/P00S  7 $S tp[h0X0 0S qO&'vD,|%%v0ȓ'(O-MMM`38J^ 50 0 5;5005 900 厳P V 剳 PY yPO PLVPQ|㸍A@6P񟗳@ x(xx4xxxxxxxxxxxxxxxxxxxx`hxx|xxxxxxx0USxP VpQT QH 0(<ȟS SS{ (_055050050505 |P  vPU U pI0"S d1 p 60"S  p(0"S P 03pV0050 00001 00 00m0k0i  ^@ ^  ^ QS00 00055X \o0NU5SPP5`FV5S UUU0%0;mpPl%5S 8EP@0: S055PEUl8tH8V05tYV\<4$04P0FOMp66xPP Cd$iBa%ldcy\D00 0$0( 00CVPP#2 (CC_CCCd0P` 90S #P巋p@QdC0#S (B5aDq0E?o2? (BX<OPP5f/νYZyX \PP5D`Ox00CS0 yP Pp PNU0 P00CS0oy0 V \0S:00S:0`1V51[1S(1S VVPdh!iB;a%pbV|nOP 8iXP,0V0@ [P,㊋0`FV} 帋 P f/0 ;T  KVP[Г'zD,:X2̇χ%%'58q$'%4y_qQh%mdw)'PC-*c0 P !`p@X@PON PUf`00CS`0 XO@T ЍX0 X @>fй'%TO-P$udM`@$P(P,P0P4P P  Sp4pK[lTT1Z03rTdT00 0A0p-t$t֊SPPP@SLLLLa0@SUf3P0 0dT5 RT ST# QT040  㖊pT[ S0lT[0 0Bf  $⡴H$ Bp8 dЍ $⓴$ Bpt 8↴8 Bp( 8* 8vU  Hp[K 4L@Pp`| v `[X\@T8 BpD9@90"0P:"! %" " "0P/U!  ' P Q ! R:0P 0[`&<Y@|)Mx&M(NY/w08pfH8 p0 @0PU TS eN` V8 (00P 0P:@P0 P loE @uM%XD,;~DD({D6C|D(R_n}}DȞBhyaratcid%O-0XOX_-TaM22242222322p0 000  Rpr>`PpG PC 42"S 200002^S R2SW10 dbV%L0 ``ͤp L'KpP L0 ``ppd2S PtAPX0: S0d2232` 3`Sd2S|}0 t=ԄPp%0SP L 03PE/PF1@PC9P<< P$0H(A@9Pjf007000` ,bT,000S0?# 㞈0d204202020202 h[hk@ @KTaߍ0220202;/`fP000S ep, 00[ / T`P000S  ep 00V /BP000S ep 0 08*0 j2000 0B BP 000S (3 S;3Ť)i00 0 P 000SX"\2RRX2Xi/ P P D@PX0: S00y `P #L/P   0Pad>`P1V>d[ H|1!14@(S8>̲03%703 7͇pm7037 P ʴ0 S 0R& 2S# 2St 0sd4 X>pD11P0 P$5 f/۴H70L7 w?STP'\@<"820,"(2 LdPPO0 0  RZ$ $I$ P`S>d2S+ ?pX0%>00RX!\1  \1X! 0 \d02T7,2P7ѳ%%@'B1 SR Q  RQ!R!RS !14!8!j''O{tO-MtU M-0@ 0d0@`0p0@@0 0<%LpA0000050`Vq P jw/P PZ4$FZpP?Y/o" R 6 PZ jwPP@j/̃yPcP PP4 TP9 `4 tGEd0@S \8D((000000 t)0 00000u Rq : rPw  [ l_ ᜲPlV0S09S RnR"oQ090 0pBp$0QP@2 tl00,"($2$"'oލ Ѝ YP'  TP"  OP  T.@; ~p@. ?!y;P9pAn00  _lX`V b;p. 9C)>04P`CQښ. .a0C 2 0㾂P'D,y%edA0@Y%h'C`'%P &X'$` Sp'zd@ '/O-`ؑ؁Q@p "Kp%W㰑 0S 0S Cp1`VA +P h&0S P H`V.Z ЍyPmPPP fP pn0@ S8h$|P00000000000000p}W 0 ~P +ZpPVpP 9XD,'%XO-$M5%pP j:P!!9D`дЄФ8000``` Jp6Y00S 0S 0S l``4pWQ* 0S00P ,㇤0S つ |00W30S$ЍzPOPBP4 FPt ɔP@*PPX\x (@0000岰0P2 ᫰P20v00 0b㉔Dj 00 哰 P00^ d 劰 P00U H 0ckPN,I000E00B00? 0mT1>0S  .00000'000#00 00000000000000 ` `0So]P` >0Y0S 0 X0P *EPpG 0Q0X7 X''D,'%x  '2̇[M@gdj{~l%O--MP0gx]H ޯ PUPEǰ|vPlP*HP6 TP8 8 `px@|p,  Uoqp@p!0S 4 40Z@pxx vm@ PDTL\`0"Hp2 R Y R !$ Q }$ P R   0*8:P8g -RH 000000@  p0@P@Ѝ0 0y ,*?0,0P 0000R0S f```0~pZ0S0S ~ 00 0@xp` @@@ P@T n 0 3/p T OB@![!%g!4yD,{!X%@-(@(pvo@(t%O-M -Fp,傱8 0~f`P8^ p p 6 R0 8 l,/0P0T 4PP\80 pHPF U85WE`hC`0IPHPU0 Gp0(5O005SO /5,* 0(0,00(00 0G#P.PP8%8FPzS `SNSM *AS> CSP 00pjaC Q$"!"!!!"!!!"!!!!!!"!# ##!!l#WSL4$  㠤$ 4RD +K L J ~O c{05xN 0Vt 3M pH n$0%c0!0 0  r$0S@. X~I 3V``R zS NkS CS BSHLS aSDcBl0CS>"p#     "   $  p#b+b)ZimPeH0SbI0S_O005S& L~P" T( p0 (0S 0C !P E@P!#@=p``p! ZP|! UPd! 0S1H! 3/ 0 `@ ePLx.`P\?,o.P1!4 HR #0 ip'h4 PP 0 i4 00 Rp\%(H %L %MH( %'M %%1LHD,@M %QM %` %x %bMoMCDMM*)FMqKF1iMM2iui Mm@-P }v@p<(p@-D@DePj@(b asp@y(%%T@p@-D@DMPR@(J I[p@a(P&%A-|@|p `(P2,/50`28P@*@@4$0%7,A;(&%8\$G-`M4P+'zvP%'5P0 ^p) P5\5@P L5DŸD2D"0@@2@P 4 5 Hp HQ &h5P & a@1  p0T0 @ pJ0 @D @080<0@0D00 0000P0 0 80$@0P  83 HL@P@T@X@\@HP H333 0400,0( ,00@@0PVpPPUPh0PP 0/`Ѝ\3.\Z@\[ \bE\_I\`\d(%1(0/g@PH-,,,,l.-,,,,-,,-00@0P0 DN|0#S 0P00 $&$00S  $&$00S d`P +|0#S (P $&$0(0Sw P $&$0(0Sk 0fP /P$?q ?q ? >` @epKWwQV3@T33@0 RH0cS pS: bSAJJK[0 0\Z9W W, 8 80,3/8 RfV .c@"3Xi 2P R00C?o20S`l tZ|WJ% `{릭0 $0 000 00. ,0 $00S WZ 0 %ꍭ0S0:10S1 0S  0吪0 P 0 0 Q0s  `1000L,0 0283PX& S R 0@0@0 #  R S v2P(00s  i2p$S3X /2 02^D,6%$((^^]]]8^X^^%{^^O-P'Mf M@p$PP sCp6 @DT T/ TX 唶v`PK'ݍ ЍAP? a@PP񟗡d455353555555553553540484L45P50S $PW ze`pP%000P00` ᱩP P ᬩP @ ᧩PkP P  喩 P WP( Xz- q:nPq/Tz00 000#0 00$000 P@i(rPPLdH:z(00(P(sX@SW s 2 P  P( !P( (mu`@P T20 0P`(Ȑ⨀ qmP 00 00$00 0pG@P ru@P  Au@Pju@P9u@P `P P P !g`LP X  P( (`m` pP( !qm@PP WD aPa>}0pp+0S > +⦣ /Pm`` 0V@ Kr0 0S0pp` `$ 1PZ00S` 00 000$00 0e( 1pB0@0ᥦ0Pa0SJ+S'- 29S!S 1aV`0_R㸎0$0 0^>娮000(000 RAp@:x>P10?0S@>D$RP$r R  $t q|00<4A @0<4x00 <$040p0 xP 座Pp`FB@D4TF\====C==P==========0>|>=>=== C======>>=(?\???X@@===@@(ABA=0B=dBB00@uPh< $wlPr tt 4< j$< $$r $b@<VP; $0 00 0 I<L00(0 0,<;0@= w`; $500 0 0 %(;(00!0 X 0 : 00(0 ( 0* :$00!0 0 :(00!0 0 X:,00(0 0 $:0:0S +P0$0H: 000 0 $!00 0 :00!0 0 :00!0 0 (9400c 0 0 (: 00!0 P 0 88괸@0S 0 jPLwj}rP0@4v kP@p 8(1w _HPD40  WPD40D4Y  !0P00O \@00 1 D1 <48C?  , P0 067000 O * G: PP/ ۗP v0S 0T4000(0 <4 T!P\948PFU ZU V⋨  ᇨ0HVp0`R 4S<4Z0 H$L40V.p`Hp@?HL4@0S |$H?ţH5HLX  $?ᷣ|5XHL0$4SH$L4R0& V-p`  V.p  4S@  DjP = ]v  r`; P r`Pd%dV.p `1: SD : $R-@P  <n0P ,0  7.P ,00S,0Z3$R  $H0$ p!|$ L{ =p40P40 r04.P  )P$,03}pL{ 40S0X44SP04Sڀ2S, "20# *rP 0T40SPp'0ST4S h38#d`P P3 `s$2S 2H$L4P*pu0 L4H/0#! 0pbp<2 C  u(0) ;p̞l<  ; PL :$L4H1# 4S 08_X0 9P0$$4RT SQ  X0  ,p XS  !S0$Qh +S0$:$40 Q$ Qq8*mH (P}}|D,(%~~O}2̇%T}rF}5Ń% %}k}}`)%Zgx5}~4y0C1~G~(U~e~~&P (<Ns{kM7{-D_sր%P)%i~bBhP}3΁HL$ Q,} Q+Q +*0$$0Q0$SV 4S$XnP 44崀S04144 0S @4S 0 \0@4,4S $4R#1ѣ1,4$00 00 00Vv +t {+0S 0+F|p@ P! 0!d|;7N]Q;+ P6+-XQ.041$4+T4S)9 ,"d0|7+C+A+?+< ,\4$P1H4P<$T1x00@ 0++peIc|^P;=0Z +5P;=0OPN  D՛p  TD > 9+-0$ !O--pDMؓcM0p 4, <pP^3`4pGs04WY `⪥  ᦥXaO 4S<44S $$4R0#*p  C `1,p = 4S P,0S Hs$0ߠ $tY0 0 $0Ӡ P0$ x1S  $$4P*`DsZU CUʫDPEU@QXPPTXPXPPXPXPXPXPQQXPXPXPQXPXP,RXPXPXPXT00vbPEUUSXPXPXP@SXPXPpSXPXPXPSSXPXPXPXPTXPXP0T (\!8#80( R!0C RJ ("(8s044s04>00 0 0 0100(0 0,0@# p00 0 X 0D,%&F}5 .%}<s("5̍((D_sր00*0 +0d 00*0 +0X00!0  0L00c 0 0 @100!0 8 03,00\1 )410(40Srt!;BnP!r`*p 4S U)PP!$j0P0!    (@oP<2(0(p00S0 Z400 !p$T"x$` =0TP0 r04lP fP"0-r3m`$`4S804S 1S !10 #4 0SDjDP T3P#X\cRc000  $Ĕ!<#^p3   q0 $ rhpԑ 4P ` 4 $$s(4S$ 04?W  5 $tR $4&S 4%jX0; 4 44 W  0n(0pqpWNX0:S Q4S  0 ᾞ  (0Z00S z(2 $!ਫ਼#X0⫱X0+O-GM MPh ,똔D嘤 9p40PEPEUa!@@5P(Z PP00S0@S p0K 0!; 000 ' 0! 0 000PD1 P00S s  nY <01 ,&d &P 0: 0 @>vP2!.8` [`22`VȌ0 V̌00 ň p+< 00< Pt /n 0@ 2@  0@TgPi 0C Sf0400000,00(00$00 0000000000 000000l 00y 0`RD @@1뤃夓VD 0Zrx8; 00 L0%p8; 00L0 %p$8; 00L0 %p`~8; 00<L0 %pp `D  |0 x;0y; D z+0;0; ; '0cy;0z;(0x;+ @``L0 %P@o;"0#10@00 0pKpQH E p   p0 o%PJK0S ``K0 b%P= 0  006 U%P(0d oD088v <b0@6``D0 A%Ph6h&`l9%tҏ`!2(1kkkk,a0a4aV0 0P````㹏&V<;SV%>@ ;qz蛟{  A 7:S%@ *qVz{  A 7I:`"2RifT' /%{ @l30S 0 '' %@MHIN2 X0弅#pX00 9@+V0@V0 00D /@0`" %00S O `42 $P$Gw42AQJo$`q'okfik@A{@⠋{'8NjG޾$@8HIN'V X({*:#P%U8 i0S4 -&@<0T0x`T00`0p+t#pP T0S &彎I$t;@000!R<  W0 0 &|PC E/d2"SS 0  -C6?8~A$@@@)$)eh%%)$)B$)%5%)!G@ 1PS+ 2R`2 C8#<48#8Sh0!ddh|d&h!L0 0 d20 "  +  `>`$0l0hd $?ph ${3{7@{{{{{ {  M )*3`f 03  hh_h2`0h2d20Wp |B0H #$$@0(0"(00 '2 0BS0 (S8; 2 |0;.pV00#P2!(008C8S! 0 0H 8(#8"(v. 0 f%1币;    0;a. 0W|]B0H #$$@0(00"(0p '0Y 001 J|dP@0<0SW $0 0RZW|(B0H #$$@0(00"(0 O' 0 H0D p .lph0Zp. -)5%.ި %)h%<%)c0CSstuxwxwuu v0vxvvvv w0wTw0 &P Q<8t\tdtltttttttttttttt- #݋p`zlhd0\#!-D@<840,($ 0 &P@ 0 &P7 QTupuxuus-#f-0 `&P 0p#$$0(#"(!R-0 L&P, H-0 B&P 0 9&P Q Q rp0 '&P z0 &P 0 &Ph 0  &PH 0 &P( 0 %P 0 %P 0 %P , `` "#pҩ5IazѪ'LZ׫kyl8NƬڬG&.%)=<B0SL S<0( S W|@0H #$$@0(00"(0p %,S<0KX0C W [B0C<0<00C <0=r, 0D0H<"D0X0 <0K+0C ;!< D0"D0 <0 RKX0CWD0* +X  bPWD0 <0>,<0 ḋ冖W"1,p 0D0H!D0X0 D0"D00 ,W@,#O-M`PEX0@-S@P084 @ ($ t$ a1$p+4QP a`F0pP[N*ȳPQLpKG2!PL m. hۗP@\3 \C d@P h||||||||||p||||`||||||||||L@0S% @HGG 0Е 0p) )Y `dhZ'a`PiP`4b2 R . 7.0 S .  .U+ 0 #.!l.00!0f.XҊϊ̊ɊƊ Êp84 p0S X` p 0S @0 p  - 0g Vpɔ`<%*%7Wϭ&oQ0*O-PAM Mg$@`f눧WP |_Pp700-S% )P z)Pg @H p PZ +`F00S @DDA@D `v 0p ,0Stb@Q6 1 Ql 应<)P -00 &(`@Z-00  D0B5S񟗌긂XLX <ăЃ܃ 00S fPf0 0y긄74P f00k00ht400dx4 `0S `f XH4  T00Q0*P J  B300S P80$030(000,0-#t0Cp ?o2R0S0$0FPAl>P9P0x@Da08(w7T(3@00`FrS= RS iS1 'tS xSAy.4뤢̲ +;$~C0p 0@00@00S D 0/ T+p,00S ,AM.4$A#BR0(0/S 49.((0S w 0@/**(+A,P0,0S (0S xa10t 0l/\3S <TR4 .(0S 0H 0@T/~4>.*,0a,8A-p4pP+#B 0 p4/PTW_3H%*5XpkD,O*ǰ 5%_ 5%%%`M,5%x'+h%DZ0n,9&PO-TM)@@pP4/).p ?,#@DRQ0I  o@@0SRevP cP SP- TP0(3 LP Id0@S(4LXd0D003030800H00 30$30,3%ha*8a*0a*Ha*Pa*Xa*`a*@a*`C2xa*(a*a*f~3]4}ȡG-`XMP|HP y I  #*p 90`FVJlIE' aDP$ b0@SSLLL$LL0LL<LLHLLLTL`Ll0 60$60(60,6006046060860<60@60D60H6$&R <&4  <&,&R 8&R 4&R <&R 0t't7QpqQ P&P@@7=CP =WP0S g P 0000[P&T60 $YPPP061 f(VUupdL&@"0+S L`X.4"`& @ P,țțțțTț|5 000H<00/P 0T& t5 0 000:XP00F0000 C000C2#S0d000 C000C2#d v>C 0C0 0B 0 B "00P00 C0 2#10C0 0 0C0P00C1# 0 0 0C0P00C1#00 0 C000C2#04qp 0P 0PQT+9`꘍JZ2V w`'os`F P$ 0SU030#:U %5PXP H7#1 4%P&T6K/r0sH 3PvTS0 0R3# G@RPEGX!EK/r0\HPی"E0<6S"46S|" 02Q|" 42t01%Ì\վ6S Lо,HP W0`W 0 P0 G᧌,6S m/PP c媾!㐌墾<6S46S;xQL10@6D&Sl1 0 00R\! H& RL! $&DR@! 8&R4! 0&@R$! Q!   @ Tv @I%p@ t0P0 g*D,% pm*faADYG-PHM`pI 'p10PEU& GHP h0@ S SꬢTTTĢTTTT̢ܢHHIIF00pa< P ` 1 !  !aPP ^؀ L`$@@`(` `C "iP *Pɐ0S PxW aP X^0 0000 ]?%D,%0xm*uyt Ct G-0HM`p0^E C S 'p 2B1 `FS 1S 0$  !RS@$ P+PT? PQ[^xP`PAP MP2 Ga0@S̥DHܥHHHHHHH$HH4DHHHHT 00 04044041! 00101@30@3101101101101ДY 000 0NHЍP !PPp  ]0S  R"0 `P5KPV q V Q`FV R $Sa (08 ]V Zm*D,%?% um*h%C-Mp`r:،@PV /&p-6TpF`F5 VE@T XP HỌPGW0F,V &p6PU 5 `V V 50S aP tP0S [V500@V 0S qpG VP`V \\!X L!tP9@PA0@3SpܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨܨĪتܨܨܨ,4@LdܨxzP0S<0S00y0S00S00S00S00S} 000]00Z00W00Sm@0000K00H0 0$ B0SZ<0SU00SPP0$0-:FU 0SA 0S 0S;`V UU5̋P xNjP ‹P& UH U U6PEU2x84888\U( Q P! u\ U4 @U U0000  W  U QaWPJ00000  WP  U U$0S W U p qp5*w@NT + 0"600"$0>$P @:P 5P`*lr*%0 D,%##9L\sG-MbrM@P j$p10S AġP` R ލЍRP fP74YYOP` [X@0JoP1 JP/0: S2  S)J @YP0 JN@~p 0[4S00p7v띍0S Dp :J YPJ Y@PJ(!`r*%CC-GM MXh 0\M+BT=P<8L L=8X@8DX<=`{X`XdXhXpXtXXXXXXXPXHhLhPhThXh\hxxxP0D80l8"=C0 8ՀPP   1P:? | 0 [&LL ` P T<T <@P D P < T(X7$@$0P+TX8 夀;P  0S;+,Kh8S <PU hX 區P@ OoB;p <+|;8(p P [`T`hPdhJP㊎` \+:#ppTJ0 f:  B 01U0܌ |l  dY8\0>0X `Xp0P\ SX8 `0 iT P9Tx < P9 h(p P9 T(X(f bሉPx9 h(d40GDS$Xعdعععȹعععععpععععععععععع@عععlع\عععععععععععԶijع4عععع|Է `,8lعt08WT0X8T8P0%eu#WeD,F%f%iP @,%BhQcH[frz{   {*h G-P`>8Ehg4ΆP03剠p2S l PWU |PH 嬄p 9PB/PE0@' s  pl40pEWQU P4 000`ῄP, L ,rPE0S#44$ 3 PyyyyᲡP 6WvP303 `px pz!l|Pd34X94S HS層P  4Wo P 4SqS埤Pl l  PnR;|,`p1<01 1> 11bG01/΅01$1埣<~y0"02Q$kp`h Pe Q18C8S ᱃֙q`SVl00C?o20S P  \£=S` 0 0000l a18C8S s3S P P=?o20 P Pl E18C8S 0 P u`P?o20S 0P8xZ+..=.*.%%I.]+p.P 9,H,h%v.$J%>40J%}..[+[+( - .%& %C-@`2dPcPT1  LDqH p0,1QA= 1P5 ӫ00DP ?P0 cS 9S0S00C0VS  dS lS0 0T TTM h׫0S Ta+:5XL%%0%5G-PC00`@0p0P 0S002LP00z >25@p 0W* s/RԄrP00"2PP .m밂V 0+0C0S!PP !y ᬄ`FP P0S CP(2   P 0S P 0S10~P  0S1 0$pW pV 0SPP,P`FP\p^P 10S 10=P]|I0S0?PiP|<Pqp 0000'rQP6P fha+d+Cvd7\+dddda+d+d+(m%f e(+O-pB尒専尢P`;T` Sp2 0 qQ pPpGz{uP`P GP( IP) EP k1 0 Za@P ,Ltp0000  0 0`0<0 0S0000 G`P| z00w0 :`Pp kPX0'$AP <,T+ƈh%&%<%D,+/ O-MSyPTD,IP4/᎛40PP 00 0P0X0 P0A@Tl8t`P@@@$ gpx40IY~2[p䓟弃00 \ (0 `04 !1R S` \0 % 0\Z~x, ,AMP 4# ^0S HH Y0S 4 L( H D0S By@P @ೂ"2P0"  -R R -R i^eR^~iR{ kRx eRusPPPEPz IPw -P[ Q@"P8888888888888888888,8X88800JHF|0P^U?0S< ?SPP80`^V40S1 ?S``-0@^T)0S& ?S@@"0000S5`0S2   R-ڰ1\0 1T %\0\_J+2z,%In%D,Z%,ht@,+q%joAIPgtO-@((TMPp` @ @p1 PEUV Pp RgP uP GP0 00`0S@0T  PUP  A p !wRP x0P 0S U_R p U  p T e p V pJR0S l X0wP@P 0P@Q D,%P 0n6@j_GO-08@0050%@,5M@$5` 5bp@ 5b/UӃP P $@T$05$T5$500wP]=O|mPN DP> fP@ CPA \`,pPB rP ]pnR(_$0 P80: S0S00嚆`P p#P 00SpWᒄW  \`P 3 t3t C}]@00PPPLsD~C~0 @H $P ݗPR 4Q ttto @>P0@:UPPP4.@{<00Vnv4t P ,,< 5\00v $2"r 21QY ㆍU^1 Ѝ"^ 0p-40TP 0<0S0<0S0 004 0!00L1QX C0008sH$H( Wp2P0 0P- P(d@P$ @  Q$ tj !OVP 4}04tt 01OPd O,FD,%YFFFG%G/G%ht@LGGbGwGGGt=GGG 8r bPR0S  \0 0/X0 $ ,P0S  $XȠPp>40  Q   S  R#4p_0S0ѫ q kUTP@Pp` tO-0MPp0 0PhL~@P\ XF~@PHH;Dߍ@P/Ҁ ?x1?/0$202@2<211t122H"؞؎klp00m10&`$0 001 0t. 0 h>p0\0J00 JR181SX0 J1!1q匡0 b@P}0, = J0R0 =00-+n181BVPMP 6P^ ?PU 4P000p=` 0N@P񟗭|H`lt0=` 0f@PP񟗚8(8<0x1<*|0$0yu|<` 0q131k0$000AC0` F0<` 0W 0 pgP 0yP 0%$P~ +0 JR0 @P 0 pD90\ 8d&`@0$01@p  =P 100 01Sq@h(P >;,4 @q  7Ꮍ 嚻8:$0P 1@ P m1@ tp  $qp 1$@ 0S  Q0 0  P819:0  0  @0|) t MpPd ɼP ,4L '11X zP`0S9 (Q90( 0(0+'1 @bU`j`噼' o8  PV !epL V 3XhVV`` G0S 8值X?0S @bV$0 RS 1S !10180X7"/0 $<!0 <2s7"/0 <<2s "/  p<Y 10@` P:!1 01 6 `兹p-|  PVV``  0 #$`6`800Q3p $00cS$0L ~<Q8&< 0p !mP$A~0S ջ1 ~0S\׻Z~0SV ~0 SR 1011'zp~0S h%d尻``pw~0S @%0壻@U3P q@ 噻' 塻$rk1S $Pr1 t (0 #^p| m1S 00 #Qp )apW P x30,A>0 (0t10T$t jm1Su 004p1,$p 0^k,0(t10#t Tm1S 4p >04mpl1S 4pl1S |#TTPh `p P 101<D0ٺ0@@00 2`P @ i0 10 ႬpY !1! !" 12{2᩾pD +pdպ`" 0ܷ!R1411lP,% 0$0!$0R0S"RA1<ᰯ1t!笽$0P!  R! 砺$00$0 Q[ 0cc=cIggg%c cJ%&haaD,{aag hI)k:kA_@Bh7hDhg0nIShhDshh8iihhhh̪ki*i@iOi]imiii%q$giiiDiih%iQj#j7jcoccIj\jhjjxjjjjt1Y8 W1 +1pW41!( < V ?= :0嚹>1`@T 0S 0 @`@ 0S    0S g᭺P`p P ( RV  R   1 5@X0 S   0'`Va  Q/0@-0x l P ^0f8O @ 0 0$010t X0@-MdPP@T Ѝ0L0 0 0 @ g~ 0@`~ttjhj0ƒ S&* 0@- "@ R P@ 0\ R^H00"@<0 0 0^$00"@0/pp@-`dAdd1M@0`` H1H!0  00 0  0 Ye QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp +\+**  h\, ` L0 @-M @lY5ЍlUh  Q/X-M  0 p 0 S 0 0 ЍWPLW qbH /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b*/*/*/*/c|*/2y*/v*/s*/9p*/m*/j*/8g*/d*/a*/^*/[*/ X*/U*/R*/0O*/QL*/I*/)F*/{C*/|@*/#=*/:*/)7*/=4*/1*/.*/"+*/(*/%*/"*/*/////^*/*/*/< */ */*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/Z*/ */ **/ *Q/=*/*/*/(*/$  0*/Ȯ */*/ */*/*/*/W}*/Kz*/+/ju*/Or*/ho*/il*/vi*/f*/ c*/`*/]*/Z*/W*/T*/pP/< /!J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*/$*Q/*//7*/>*/4T*/ */6 */*///*/@-@y@*/*/*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogressE̡,?eyK8'NTW6h[XbaZ"e0k0Fqlw - }- OB|(+C2:0:-P:p:x:::::"pNv#Xfd^zz0` (ĿĿGG iz@@( +!Hi%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory s   p(@@#  t' @@- h3   : @ ,@@!+?,@@F hunblock and -DNO_CONV?hDTH8 oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiUsed %*s %*s %%iCapiAvail Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklmNnPt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %sUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-pv] directory ... \T hTzTTTTTT}ETTTETZUU/UEU#OU OU_aU^aUFaU<aU>vU?UUPATH= 5}~tf=,{^d^{^scc^{^m^{^l^^r h8Zp^CYn^{^v ^*b    EOF reading here (<<) document3cccccccccccaccccccccccdd dddrcwc|c\ccWl[.\ۀ \-}-+?=5"@"eeeef fff@\[e[[[[eeabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'8'0Gh'1Oh|'1Uh'8_h$'0mh'0h'0hԒ'0h'0hh;d m  -.Y%Rd B]+ j  .q$SD?ii̇ !r e u\                  p(<N<0n=jhlg[4GBj0Hjx`[pMjIFtPjts@j0Vj0Zj`j3cj3 -]^kjp,6[KZU6sj'rzj jyv0jDwjVj4jhz>  G Dsljt2Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDPeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorerror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${#LINENO${LINENO${#${$(...)"(((...)<>>>>&<&>| && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbtoo many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITUsage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap -- -trap -- ''trap -- trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalshifttrapbgchdirletfalsefcinputrcgetoptsprintffdflagssetvarumaskunaliasulimitwordexpPPID20220122 BUILD:20251019124931Z SMALLNETBSD_SHELLincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s format [arg ...] format "%s" too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failedqq qqm Dsqr r r, |-+ q 5s`tfq:'-r/r .r .r-׶-r.tL.r.r4/<0sP-:9<0r\/sx0,0z0s,.r-W/r/D<0jsnsrsvs{s#zs3s#s3s2s3s3s#tttt t@@tttt[sZs]tettt|tmt#t 2t@9t+t@t/FtcsMtTt sC$sC!sC$ sC(sss2s;sssAsssss@Is@s Qs ssss@st ts sssttttt t@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.[ck@A@q@y@@@@@@@ @@@@@MSŋʋЋ׋ߋ %1@8@=BLR]dj:pv~OČ̌҈$5IYlՉ\Íɍύ֍Eݍ)e,I +/ӌ݌ \',5@)EIM+W[cg mx9AGLSZahqxЊƊϊ֊ߊ%*1:?GMS\Íɍύ֍Eݍ)e,I +/ӌ݌ \',5@)EIM+W[cg mx\Íɍύ֍Eݍ)e,I +/ӌ݌ \',5@)EIM+W[cg mxchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentline %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erareallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] PUsage: %s device %s device command [arg [...]] Available commands: forcerw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'q+L_  & Q m L˸7\pϹ !-#-$&-1-23-4-56-8*9097:P;j<=@AúBC+DREhF}G}H}JLMNȻOػPQRS)T2U:VRWl\vacdּef ghip&q-s-t-u<v-wBxVr̽ٽ0Plپ#:Vnѿ׿08M)Eh{---- ,>Xh)F^|!<W--HE-1a-*/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Extended partition busyThere cannot be 2 extended partitionsSector zero is reserved for the MBROverlaps another partitionPartition exceeds size of diskExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionsecondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionBad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.cannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]#-("-/ӌ݌ \',5@)EIM+W[cg mxreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block Unable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctbadas EOFCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) REPLACE WITH '.'ADD '.' ENTRYREPLACE WITH '..'ADD '..' ENTRYDUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-J9@S^to/ L Z m     |%$%%%%%%%,%D%`%x%<%%%%%% /ӌ݌ \',5@)EIM+W[cg mxq+L_  & Q m L˸7\pϹ !-#-$&-1-23-4-56-8*9097:P;j<=@AúBC+DREhF}G}H}JLMNȻOػPQRS)T2U:VRWl\vacdּef ghip&q-s-t-u<v-wBxVr̽ٽ0Plپ#:Vnѿ׿08M)Eh{---- ,>Xh)F^|!<W--HE-1a-*SFH0eC>+SFU0eCD+MHah!IdontNeedEFIN+S+(s*K>;h1]+|nQn- q+h+t+|nQn- q+++|nQn- q+++|nQn- q+++|nQn- q++=rGy=iG}++;Mt?++mWC 3KOO+,yD<#*=(,,3Dh&',/,\ M}-B,S,-чHEd,-чH y,ZIчH-,IчH(,IчH+,2IчH,S'@ )Ѹ,,*1@ )Ѹ,1x )Ѹ,-backupstore_gptstore_tbla:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qpartition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsFFFsetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifaddrsetifmetricsetifmtusetifnetmasksetifcapsclone_commandusagestatus\4aprintallmaindo_setifpreferencedo_setifcapsLzi!%{yijjj %D#%jj %y$%|$%D $%MH$%mFx$%N %[L,#%N %N#%O#%N %O % O+O6OBONO ZOfOrO@~OOOO O0O@OOOGsO OO O@4ainit_current_mediasetmediamodesetmediaoptsetmediasetmediainstQGQQ.Qu\Qu Qu`QQ@QQQu.Qmedia_statusmedia_constructorQQP%%PQP%%QQ4%%QQQQP%%QQPl%%~Q~%%paddr_match,| dPd<settunnelR| %R&%print_link_addressessetvlansetvlanifS&%TS|&%TT &setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchanYYYYsethidessidsetapbridgesetiffragsetifrtsY '%Y %Y(%YY %V'%VVP.* %<8(%Y'%Y<'%Y@ %Pv'%vVPv.* %;n'%TX'%Y-XXt,YVYV,KTKT%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlenprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskd != NULLdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTUifcap, %s byte%sbyteclonecmd[-m] [-L] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimetimed outSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: multicastqueue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numberexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%s: getifaddrsaddress:%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEAES-CCMPWEP40TKIPWEP104AES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNEL RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm ??? FHPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS CFPARMS TPC CCKMunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAe#BeFe+%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsunionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]Only one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@asynchronousautomountednfs4aclsposix1eaclsextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdupugg S#c#ga cd %bcN3a@gggggggg bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegjo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a relative path.using "%s" instead.ugg S#c#ga cd %bc"@"N3ia@#@ddspecified device does not match mounted devicemount table fullincorrect super block%s on %s: %sreloadugg S#c#ga cd %bcc c"@"N3id#@kaa@cqsoftdepugg S#c#ga cd %bca@usage: mount_kernfs [-o options] /kern mount_point kernfs on %sugg S#c#ga cd %bc"@"N3a@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %sugg S#c#ga cd %bcN3a@Mjuutu u@uuuuuu q@\Gwt}tuttt t@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvConflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cwsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %sN3ugg S#c#ga cd %bca@ddusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o  8p;Rh߃I\}̄Cx %s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir @fBwCFILN™OpSabce.f@hikmno͚rܚsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:#@@@h pp pp 0` @   $1м|^t0 Non-system disk Press any key to reboot %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jdCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u%s: unknown standard format180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()\\\\\\ \\|\usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY3`x3S!KyUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; routing table overflowentry in usenot in table sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapAppleTalkInternet Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_print.,> JT `f uK{ `     !7XXQ_ ow o o o     =A ]h {     1 INt  dd    bitmask_scanda%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacity%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvpfetch_ftpfetch_urlsendrequestrecvrequest&48<@DH***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. APPESTOUSTORlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20241129NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sLogin failed. Account: ACCT %sUnable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Poll timeout waiting before acceptCan't accept data connectionCan't poll waiting before acceptCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unrecognizable host nameunknown ACU typecan't open phone number file call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbertbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20240203malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlV.gza%a%a%S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data&jLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: extra characters after \ at the end of %c commandbranch%lu: %s: filename expectedread commandw command%lu: %s: invalid command code %c%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; export TERM; TERM=; unset noglob; set noglob; setenv TERM standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i$, ,&,$&,09`,J_,[c^, , ,],&{,&z,&,,, ,&@,%-,. ,8Ip,U,b ,s;,|L,, ,,&,&,;,L,& ,,/!,;&!,G&",collectA E! /ӌ݌ \',5@)EIM+W[cg mxNAME="(>e#mount_disks>      !"      !"#$%&'() str_arg_substget_available_cds/ӌ݌ \',5@)EIM+W[cg mx edit_fs_type_ext     x 1L _P o@ edit_and_check_label /ӌ݌ \',5@)EIM+W[cg mxdisklabel_freedisklabel_set_part_infodisklabel_write_to_diskcdt4 A B E ? E ; h8 C 9 < 8 8 (S ? N > P; 3 X: pE HI 0L 3 3 M \9 D9 8 (= t8 disklabel_change_geomFouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default;,;,;,;,pm_from_pepm_whole_diskgpt_freegpt_create_new<$$3x231l1,0&&4-4,9!$ '  (S = <(@H?4`@#!"""!-',',h1h1N+( +>+E +,,, +!B/uBBB-(BB+eB0e"9e EBk+>e#BeFe B,B+gpt_get_part_devicegpt_get_part_alignmentJ9Sto Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC>+SFU0eCD+MHah!IdontNeedEFIN+S+(s*K>;h1]+|nQn- q+h+t+|nQn- q+++|nQn- q+++|nQn- q+++|nQn- q++=rGy=iG}++;Mt?++mWC 3KOO+,yD<#*=(,,3Dh&',/,\ M}-B,S,-чHEd,-чH y,ZIчH-,IчH(,IчH+,2IчH,S'@ )Ѹ,,*1@ )Ѹ,1x )Ѹ,-) DDD0̽,D@ADĽTEE$E 7EEEmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new`^i c|]djXYDP(ePPDXdYXY4YkUV(S |vP|hR0Dq`hRUf[$ZZЋmbr_get_part_devicembr_read_from_diskadjust_ext_partinside_ext_partmbr_add_partwrite_mbrmbr_write_to_diskmbr_free/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 10.1_STABLE This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-10.1_STABLE is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-10.1_STABLE is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-10.1_STABLE is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-10.1_STABLE Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-10.1_STABLE UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable multicast DNS supportEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog10.1_STABLExfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/netbsd-10/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/10.1/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xiwiipw/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:853: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartman/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullgpt %s %s -b %llu %s-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts->geo_sec != 0t != 0Windows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition***************************************************************************************************************************************************************************************************************************************&48<@DHusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipereading inputcontrol_freecontrol_writeonecontrol_recvdatacontrol_handle1dhcpcd_readdumptimeoutdhcpcd_reportssiddhcpcd_readdump1dhcpcd_readdump0dhcpcd_stderr_cbdhcpcd_readdump2dhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_initstate2dhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2021 Roy Marplesmain duid_geteloop_q_timeout_addeloop_event_add_rweloop_event_delete_writeeloop_q_timeout_deleteeloop_exiteloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionMsbw/cdre_mfrg nh2niJfjkslym sn?rosp\qV rss&s/tnuv.swhx5szyEsAKsBXsC-lD_sEisFnsGxsHYoIDJsKsL4MsNsOsPsQ S> TsUsVsWsXsZ`1s4s6sr|~t}tt"t2tDtRtPtYtWt^tftktqtwt}t#qttyptttttttttttuttu uur#ur/udefault_configread_configrt_compare_proto''%%rt_descrt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_addrt_recvrt%%rt_buildrt_delete$$sa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initLvy3h}yyyD;n\yscript_buftoenvtstnymake_envscript_runreasonscript_run0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_os[V{{{{{if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CD@DCget_leaseread_leasedhcp_openbpflog_dhcp%1@dhcp_bindLU]g{e;~ mdhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: write%s: no terminator%s: no arg buffer%s: no args%s: connected to Access Point: %sSTOPPED%s: removing interfaceNOCARRIERPREINITDUID %s%s: waiting for an %s addressexiting due to oneshotforked to background, child pid %d %s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: truncated read %zd (expected %zu)%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version9.4.1--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 9.4.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-9.4.1 startingfreopen stdinsocketpairdup2freopen stdout%s: setsid[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addressno interfaces have a fixed hardware address%s: cannot write duidpicked interface %s to generate a DUIDeloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccallback != NULLnseconds <= NSEC_PER_SECread_cb != NULL || write_cb != NULL%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurloption %d requires an argument%s: embedded config too bigarpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurert1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deletedif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zusrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_RERROR%s: SO_USELOOPBACKifadata != NULL%s: SIOCGIFALIASfwefwiptapvetherxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too bigbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULLreading standard input%s: reading lease: %s%s: %s: truncated lease%s not foundNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: timed out contacting a DHCP server, using last lease%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B/A/0$0HD0d004$00x0 1$1BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%dldtAH4$ x@   A PH4$`x ,p/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysa,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444UO+Gc9c   +: full-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'-o %s: option not supportedROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedzfsv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvswap%#jx%#jo%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!! sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU csp != &blank/usr/src/lib/libcurses/refresh.cmakechunknown 5MS7) bel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9TERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xtermansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: name too long%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Kacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`A #+3;CScs inflate 1.2.13 Copyright 1995-2022 Mark Adler deflate 1.2.13 Copyright 1995-2022 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.2.13need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_nocopyprop_string_create_cstringprop_string_create_formatprop_string_append_cstringctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist