08P>=h'&<  '>=h P''`'2 2>=h'&P@@<@T 08P>=h'&<  '>=h P''`'2 2>=h'&P@@<@TU >=h`'2y?A>=h>=h>=hQA>=h>=h>=hXA>=h>=h>=hYA>=h>=h>=h]A>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hC>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=h>=h>=h>=h/altroot/stand$f >=h>=h>=hRmJ>=h>=h>=h`hpxmI>=h>=h>=hhpxZ[A>=h>=h>=h$>=h>=h>=h^$>>=h>=h>=h$>=h>=h>=h$s>=h>=h>=h$>=h>=h>=h$ >=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=h$`>=h>=h>=h (08@$>=h>=h>=h$>=h>=h>=h$>=h>=h>=h$>=h>=h>=h$>=h>=h>=h$>=h>=h>=h$>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hA>=h>=h>=hgF"J@6N #[wU9RZ'aȍJ#sB%7:+0 !=߻\V\|E;eb}o8hT}JjTvjd4ZnULRP9og{$2 . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr varaltroot stand .profile# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi  . ..chio dd df ed mtrcmdsync catchmod cp ln lsmkdir mv pax pwd rm shsttychgrp . ..MAKEDEV then fstype=tmpfs else # This file system size calculation is exact for mount_mfs(8) # with 512-byte sectors. 40960 bytes (80 blocks) is the # minimum size allowed by mount_mfs. fs_bytes=$((8192 + 2 * 8192 + 4096 + ninode*512 + 8192)) [ "$fs_bytes" -lt 40960 ] && fs_bytes=40960 fs_blocks=$((fs_bytes/512)) if mount_mfs -b 4096 -f 512 -s $fs_blocks -n $ninode -p 0755 \ -o union swap "$dev_mountpoint" then fstype=mfs else die "Failed to create memory file system" fi fi # Our current directory was in the lower file system; change it to # the newly mounted upper file system. cd "$dev_mountpoint" if $do_redirect; then # Redirect stdout and stderr to console ${MKNOD} -m 600 -g 0 -u 0 temp_console c 0 0 exec >temp_console 2>&1 rm temp_console fi echo "Created $fstype $dev_mountpoint" \ "($fs_bytes byte, $ninode inodes)" } # # MAIN: If MAKEDEV_AS_LIBRARY is set, then we are being used as a # function library, so just return. Otherwise, do all the real work. # [ -n "${MAKEDEV_AS_LIBRARY}" ] && return makedev_main makedev ${1+"$@"}  . .. cgdgroup master.passwd netconfig protocolsservicesxrcwheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766: ELFP44 (QQVV)V)D ,,VV)V)Ptd!QtdNetBSD@ ;PaXU|SR ffffUSWVP[Ö$t$$upjPjjjHjr|$0F8 $uLz!BtKj/V;dt@Ƹj4lPV t&uVhjhjh)KV^_`SWVhjhjh)%V 1۸j4lPCPrFh)j &whh)U uh)j jLD$~L$Ht$ QP \SWV\$(t$$~|}|$,D$ $O D$O D$O D$ tO uXD$Phc5T)  u$1^_[VhpVhpV 5P)h6qj@wVhqj?USWV$l$< t$@1D$D$ D$D$N $D$ N D$N  D$t%SdotutD$D$$D$% D$t$@N D$l$t$8hp t$8hpq 5P)hqj>SWV \$ t$~d}g|$$D$ $O D$tO uXD$Phc 5T)  u$1 ^_[VhpVhpA5P)hqj>wVhqj=USWV|$,1AA AAQhc@5T)b  P)D$cc \$|$c  VSUWRPQhq7P D$ tc QPhqP 4$5P)h rO 1^_[]t$(hq0Qhqj<P|$ u5Phc@5T) P)u+4$QhrO 1Yt$hqЄ\Qh&rj<PL$ D$~0u3D$Qhc5T)  u1YPhpPhpk5P)h6rj1<USWVh$1ɍD$THH HHD$$Phc@5T)  $D$D$1$D$ L$D$;Wdotu)DHu;D$9D$<$|$ aD$ $GD$9D$r<$t1A $D$|$ L$ D$tr1A $D$D$N2D$$‹|$ND$ $11D$,"r1@D$$|$D$T$9D$T$ʉL$L$XT$$nL$\ L$`L$do1A|$ t׋$Åtϋ\$ 9klV` V1VP D$D$<\$@|$DD$$D$Hl$Lt$PD$hX)hKD$ @l$0tD$PhhsKj JD$  |$\$4t$,s$L$)L >QPhs3K D$  L$s()@L$L bQPh5sKL$ D$  s D t 4ŤnhXsJL$ D dtPhfsJD$(@9XU \$D$T$T$9tt$N9BD$4Ťn5P)hrdJ 1h^_[]t$|hFr%WS$hrhrj%7U 5P)hrj:7t$|hp5P)hq3$harjhc 5T) u15P)hsj6SWVPD$Hw#t$>oW/t ubo$h|pW t N1AQhc5T) u 1^_[5P)hsjO6USWVP|$t$7hpWV` fu D4P)u ,))u P)uhp pt P)hjQo3 T)u 5P)hpIh/ Eu3$(8oSUt uUhpjA5hpje5$NPVS@o P AV&)PhsVI VjjhsS8F u롈))) ) )); ) )r*jZ))) ) ))^_[á) ) t ))h6uhj/h6uhj/h4uhj/h4uhj/USWVt$|$6 Sj SVWZ u=,)PY)u,)))LuAhmwj1/)Lu1QQP, )y 5)) ) =<)r)uhw롡)u#))Qx()Lu1,)H()Lu hQPO, )yJ1,)H () hP5)Q ) )y 5))),)utS1V )))9)r_ )t= ) )E )t# )) )I )" )ujl) ))) )t ) $)t ,)h`u;5 ) )=() $)5)VP5)W ,)1Vhx)hBjhGj5)5)5))h;<-<)e=,)) ) t@)8)D)<)9ss$) )tQj QjP )5)5)5)P$ xd5)-)1‰1 ) )) )8)<)) ),) )xPhG+)u6)j5)5)5)P  t5)h,) )) ))) )8)) )<)C,)s ))) )@)) )D)u@s)t`)d)H )PQQI )))) )j1))1))h*xj6PhjM*WV)=Ht==u 7.)) )t; )9щ5)s))Rj5) ) )) ) u\54)=0) tJ5 )j5)Y ) )) ))ʉ))Ɖ=0)54) t jY=)u()jPu 48u*()5)Pt^_hXxj)hKxUSWV )|$,t))(p‰D$l$|$,u .) xT$ 4)0) t!()jQP5)R !ƒ~t$VSh) $~ D$ `S18D$ Z 4)0) ʋ-t)p)t>5)5 )QPlh)l)H)L)14)0)T$<$t$ p)-t)l$13L$ P)T)D$11 )t,)u#)5)hwoT$)L$ AD$)ʋ$tЃ|1@|p9@|50)4)* )1 )T$1 uKH)L)I$T$ )))ѣ) )5)- )9P)T)$ t ))PQ5)蝠 )1)) )) t(P)H)5T)5L)QPVRG tjh?j"$^_[]5)hw5)hw5)hwj%5)hj%USWVt$(|$,\$$Uh)jb" C4WVs(P( 8jUj>" 8^_[]SWVY(w#΋A4jjSP xNjF4SP~(^_[hBxjL%V΋A4L$8Qv(Puq#L$@F4 u(Qhm8@v(P 1ɅI@N -1jQQv(P !ƒu8u F ́Ĵ^v$hj$VP蕗9v V VPQi t1$^ÐSWV\$D$L$ڃt1ff0Ju1<ff<|ff||ff||ff||ff|| ff| | ff| |ff|Nu^_[ fffUSWV) )t/jhN^j ) )tjhN^j 1t$PVFȺMb׋ )-։+x)D$H |)iى tL$ 1FD$|$ 5T)5P)5L)5H)5D)5@)5<)58)h^xjdW3,WPWj d)`) t?ƒ ʺtRQPhxjd|$4W3WPWjs \)X) t?ƒ ʺtRQPhxjd|$4WH3WoPWj# t$ l)h) t?ƒ ʺtRQPhxjd|$4W2WPWj t)D$=p)jPt$ t$VÉiL$it$V)QPkRPVSt$Whxjdt$@Vn2$VPVjI e^_[]EVt$;VajfUSWV)5)=)11C)W5)5)P$ Mtg-)u5)h)W5)5)P$ ݅~)t )u=)N{T<)rOH<)d5) )=) )5)jVP5)W !ƒt^_[]hyjv5)hjWV)uD5 ) )=() $)5)jVP5)W !ƒuuJ ) $)ti11()5 )5)5)P$ ~J;5 )$)r,f )H ()Phm5)Q xw^_xof@ ()Phm5)Q tD;5 )$)s5 )5)h) 3 )3 ) t5)hj?fUSWVX $p $l 7h j2 hyWSH H'w$$y)كt=)%-D4 E)2)&)))@))))))}ou)j,UBƿt@Gj,P(ujW )lj(1Et1EF4Ej,Vƅu$p 4=)u#=))).) )=)uȨth.zB Ȩ`-,)D$jP ))Ɖ=)u =M=)ui $XQ0 Phh)! h '(0 Phh)  h N^_[0 Phh)  hn!hN )uá)u tjwGjFUSWVj Ƌ|$11K< @u=D)t?jj5P)V 5P)FH)L)D)5P)UjWU A)߉nH) L)N F5 )q04) )-H)F L)0S Phh)X hn!Mrh6]1HL)H)`0 Phh) hD'70 Phh) h LV 1^_[]Vt$5 )q0F4) )^WVL$ )5T)9})=4)79}>4)H)9~vRO9G9~-H)0)~Z0)΋Nu#H))Ou9~H)RN9H) T)u )uuH)^_É1jDjDVT$0)t=0)10)60)t@9uхt0)uh[hK1^SWV1)L)j?h} ktW5t|8/uWhqWh}hX)O X)tLP=,t$hPP)1ۅu@W5X)h衳j萳PJV$^_[VP)tAPKxGP)X)t!P{+5X)y X)1D)L)H);5X)r0# PVh!h)'hI^Vt$P)t3PX)t!P*5X) X)Vjh)h)x4 "x 0)0)4)1\)@=ujuSVL$D$ T$t$\)\)5\)\)~A2\)BI^[fV1`)d)l)h)PP  x)Fu^SWV5d)95`)t$`)Vjjhx)Iut=|)x)x)jjPP5 thh[Hp)0)@uh)=l)VV4tVPǞG~*hG5)r0h#hG1N1NyhlhG5d)~`)H `)x)1H^_[Ë `)u!T$7d)`)1d)xD$Q`)x)1HSVփuUp)0)@ux)jjPPthhGx) |) l)h)aˍx))Qhp)PU )p)0)@ux)jjPPxthhFVjjhx)0^[Vt$ `)ud)`)1d)x 1H^USWVhԁƊtx<0uFD uhh$EGuȿ|w WjP$ 1T L ш @u)hjV P7 1Fth hDe^_[]Ã?w )QjP 1L$ 1 Gu@w ۃЃ6w1$0~ 1Hø ~ ~ ~۸~1H1@1@H11Hø~눸wu11Hø GEUSWVP0) t uh}XC^_[]eC$t0)8u@0)5,)Nj-,)1;-()M1WtÃ=L)tj jwSVVVSt$ 1Ʌ;L$uWwZ?E;-()|1MV)15)5)5)5)5)豓 5) )u )uu ^j:jq;V5)95)})I)P5) tC5)) )u )urufL$)r5) 1^)0ڹ Phh) hn!A )u‹ )u tj:j9USWV l$ D$fD$p 1P ))19)@u 9u)Sk ) t$$PPh,  $ )| t %)ڃuhN^QUuhQqjD$P 4Ë $)9}=)])9|A‰T$R5)* NjD$)=) )u)2$@PSW` =0)?5ƅt )VPP,+ 0)8uK=)뜣)GhN^50)Rt:jPDžx Q:? ^_[]Í|$00 Phh)5 hn!> )u)utj8j&7WV )5)19}')FىDuw9@u1=)^_USWVD$L$9tV)r=)~=)9 t9|1C)Mu9|1C)=) 9u^_[]fUSWVl$}!uEh]P脭UT1h]PÅt*t$Sǀ}!u?S蝱=0ǵ PUh!h)hł=eS^x(=)uWhsh) 5 )+t$00[ PUh!h)_h܂=^_[]USWV |$$Wơ)$L)D$4)1-)-L)9-)t\$= )t$ gDž~w11)5)Y6ts )PPjJ Å )u)t$ Dž|$$\$9t$utt <$u=)t!9u L) uh)P9¡L)Ƌ )Ӏu1A9|$t $ ) L))t )) )u )ut j4 ^_[]j3USWV1|$=)t WrGHOHt uG `-)9})V)9rFU5)Ɔ -)) )u )0u L)F8W~<1ۍF-)9~N) )9wUQ8 t7-)) )u)uhtk)0 F`0 Phh)  hn!9 ))j2G @utL)0 F)80蕱 Phh)  hY9-1)0=L)=)  )Ɖ^_[]js1USWV|$?!uGhsP}t$WI,VP Åt2l$t$ US NjD$8!u?S莬=0踰 PWh!h) h/{8mSOx-=)uWhsh)  t D$ )@ʼn30G Pt$h!h)H hG8^_[]USWVPl$Uƃ=)t1ۅtf;l$ `1V$th~;-4)u=L)t =)u8 GWPt$ F x4EEs @6;l$ |=)tt$$$^_[]USWV|$\$l$19t[=)3t UPrUPw>Fyj0 Phh)  h`61^_[]USWVP\$50)FEx @u}|~PVq6tj)9~l))9SP\ gƉ)) )u.)_tO50);^_[]Ë5)W50)V| . ,1xщǃ|$uE)| /5)9$~Z)9V5)虁 cÉ5)) )u)t )W5)Uɿ ,$+HPS5)D( |$tM1BDžh4P0 Phh) hn!41 ))5)9} )|$N))9͋|$|MVPb t05)) )u )umua(/ 0B Phh)G hn!4 )t1)uj-j/,SWV11)H )7h)u8)@%f)9u)H )ÍF=)9~Y)9wW5)5 =)) )u )t )0u L)F )C<0 Phrh) h}2%)1t )0)0)^_[0葪 Phh) hn!U2 )u)u tj_+j*USWV\$ D$1tt$hMD$ l$1uHD5X)J X);h)у  P)QP);=T)|hP)hG菴1GD5 | <\t<X)H X);h)hP)j\P)H P)\\5tjj Sh tVG)ȊX)J X);h)Vу J P)QP)\$ !0X)H X);h)hP)PP)H P)D50 X)QX)ɋ\$ ; h)hP)P P)QP)D50 X)QX); h)hP)Pr P)QP)DhP)QL4 X)QX); h)~;ȃ t3 P)QP)D$F9hP)QhP)P똡X)H X)~P)H P) hP)j 1^_[]fWVD$L$L$$$0.| $ |r1)ht$t$ + ot9EtzS)ǃxtostypfD4)먡,)  $)D$|$ta$8-uW)D$|<,)b)S )D)5$L$jjth+j1Fh~VVjhjۘh).ƅux')|$t$8t$0|$t[h)hz$8u h_-jYu$h)h>h--y =)th)hh)= )tPh6hP)艖 xt` )| )x51g )QPP M=)=)h)hKh̃:,j4%))h,%)΃t0h)hˮj515)h)h襮h̃+V菟Q=)th)5)hh)jrjk|Phh)f j\=)junh)5)hh)'f$j0yj؞t$8!$h0h)蛶 uh)hh) jL$ ɸ!)Phht@jp x#$rP)D$ rT)ËL$=)t1@ )Ql"L$=)t1@ )Q#WV1F=)t9|$ ?!t!hSrWtj/W迌th݄)1^_$) )(),)x>$) () ,)() 0);t,uQ0)9;u )빋 $)| $)()t9t,)1Ƀ USWVP)0)DJ@t t@0)@DJ@t uHH 0)~Ã=w$ =)!hd  !=$)" 0)A1Qptntl  Ӊ 0)A˃=$)FP”^ U 0)@߈\$ ̀1ۈL$QuH 0)H1KDB@,Aǡ4) $)  Pj  54)j$1  ˣ0)@̃=)t=)y=$)6DB@jLǡ0)@1Hptntl   ˣ0)@̃=$)DB@8!hP=$)1Hptntl  ˣ0)@̋ ()1PptntlN  ӣ0)@̡ )HQPN"0)@1Hptntl%  ˣ0)@̍H 0) () p1Pptntl   ӣ0)@̡ )PPv 0)A1Qptntl  Љ 0)Aˡ )PPH-,)()=$)=() 9=4) -,)()9 9w h )PP 0)A1Qptntl  Љ 0)Aˡ )PPl@ 0)A1Qptntl  Љ 0)ADB@;h" 1ЍrЃ sO޷j h0)50)6 D)w请8"%@) 0):o t!gc ptrP  A 0)< b=<)Ho1 )PP9 ,)-() =$)=() 9=4),)-()0)@1Hptntl  ˣ0)@̃=$)F1Hptntl  ˣ0)@̃=$)h 1@,) )AQP2 0)<j h0)50)P P)ŵ8"h2 NP) 0)x w =$)4)t()0h3R 0)x A =)u;.5()O1@,) )AQP@ ()jPP>0)x  1q1ۃ=)Ƀ=) ˃h[ 0)x  =)u-5()5,) 5 )g 0)x ? =)uL-5()5,):  )@;4)?7 )-0)x =)u , ()IQ T0)x =)u,,) ()9QPn0)x QVP 0)y F( 0)y 1 0)y P5()5,)g 0)A1Qptnt lu  Љ 0)Aω 0)y  ()4)=P)9|PRQ 1=$)u 4)() ǡ0)@1Hptntl  ˣ0)@̉0)z !)SPhA0)x  1@+))uF%0)x D4uL)=)t1)0)x =)h)hh)~ 0)x }*x1Hptntlu  ˣ0)@У0)x ')G1(),)0)@Hptnt lu  ˣ0)У0)x =))ur|$Wts5()5,)QP';4))0)x ==)uJ)=))u5()Q5;4)))hhh2 D)h[D)1< *5 0)y qtH)@P[H)@P=)hmb+0)x )54)j 6'(Y$i*tZ ;5T)P) ) )b[ )DQ@t/@0)DQ@t@ u uh 1jP0)18!@0)$tH)@PP5H)P)$0)1ɀ: t$1ɍr50)q4$0): $uP@ƅtj5P)b<$h˄ F^0 Phh) hn! 1 )u )u u^j jSWV5)}Z)W5)tX ti=)) )u )} &)NT$1\uZB0tFB9u^_[j0 Phh)  hn! 1 )uË )u tjjUSWVPD$94)1@P0t$"4$91S肻ŋs l)9~Y)9V5h)(W 55l)h) )u )t Yh)sUPY {;$\15l)G9~Z) h)9VQV 5l)h) )u )*t h)f8 t$t$VN5 ))5h)ta )PPj tL)1 )N0 Phh) hn!  )tU)uZtCj0訁 Phh) hn!l  )t ȃ^_[]á)tjD$ )DAuh' ËL$<)u) )1USWVP\$();4)|1p-,)M)9t 9tVUj1 tk94)$1#VDU9ơ()CPSj t,V$9,)~+US) )ySһUǻŋ>EEp $A8GMi ,)91())@أ )=)t W6U)1 )u )u u^_[]jjSWV=)uj貽L$ɸ!)4)Pjhsh Hy|h}tkPP=Yà PG tGWP{|3/tf/Ved.hDhup54)jhsVj=)ujL$ɸ!)jh)GbUSWVPl$5,)'Ƌ=(),)- )9ʼn) u)E1u1$)E@)V}tzP蘹t_ )PPj DžtO))H)u )u[uE6M )@Pi1,$l& )u )ut j1^_[]jUSWV$) )th݄ckjP~0)L$F$ \)9} X)V)X)9|BVPP 5\)X) )u )! 0) u1C1E҃!%=)h)P腚Ɖ$ \)9V)9V5X)0P 5\)X) )" )7 09L$]9)9|WPO =\)X) )]9~[)9V5X)nO /5\)X) )u )yt vX) 0) (E 0)Q0)9\u=Q0)I ( X)G (E,$s 0)L$A 0) H)y `))9~_)9VPN I5\)X) )u ) `)X)| H)A(EAH)`)9r 0)L$A 0)7 )3/ 0)Q0) ( 0)݀ (5d)9}H)R)H)9|KVPM t]5d)H) )u )S5X)Pԋ H)`)D$1!P蚗0Ky Phh)P hn! ) )u!u#^_[]h<qhgj'jVjA tL$Qq p PIH10x Phh) hn!n1^V)t.L$19 p)up)H)t rr^ËL$D$9ty\uIQP1Ʌ1fPD$L$ $QPh'h)XWV 0) td< uh}1 Q0)I t;8t7P1ǡ*t?=8)u6P*95*hR5*j @ *tV8)5)WPy *t.h'h)QP5*.P *3/:0v Phh) hn!^_USWV=0) tD\$9t:\t[u FV.ƅu~ FFF t9uȉ)-*9}=*M)*9|KUPJ tYlj-** )u)uyS50)WS 50)=L)tsj jSWme0u Phh) hn!1 )u*)u(tjhh,[1^_[]jSVL$ 1Ҁ9^tA<]u@[t t9]u12PրҀw"sp tp@]u8u@뻀]t1^[fUSWV|$l$17u0) u *E#t0) uE1^_[]8uP0)HЉʀπwR軒j h0)50)f 1w荒8"uh2 1gu@0)ErUSWV0)H 0)H%u,8Xu'0)$*ht18u=(*9 $*L1}5(*9~[)9V5$*QG #5(*$* )u )\t Y$* 0)Q0) u (\t u^0)8uT0)H 0) $*1< u0=)u't )| t %)ى0)8)$*9|NWPbF t8=(*$* )u )uuuw5 *0$*M1I艐0:r Phh)? hn!1 )u )uu^_[]H0),j'jUSWVPL$ ),)19()}% )ȃ Eh„Kl$ )PUVPt$$KǸ1$ )PP,*)1S̪á )tP芬EPPjM Ņtl9u )l$ u)ue$ )()+,)9}yF )@ )P%Ut$ Pt$$hDž+9 )u1)uAt$jytQSS x1^_[]ËL$$wjrUSWVu V øU=L)tj jvS肮vލD$jPjSuy t1t$ED$$D$1E $A9T$ 40*9Ɖ $T$~c)t$ 9V5,*0C \50*,* )t$ T$u)=L)tjj RS藭T$=,*RSWG 4$D$D$ 0* $9~bt$ )$9V5,*}B 50*,* )t$ u)=L)tjj t$(S=,*t$SW薀 Ept$D$ PSfD$4$D$ 4<t4|$tMt% D$$tjD$PjVu肓 &D$)D$0*9~V) ,*9SQrA 0*,* )u)|$~#D$$ D$ ud$thC$=L)\$tjj SV賫,*SVPf ,*f |$%C=0*,* )T$u)ml9}C ,*1F9u,$y^=0*9},*_)9|W5,*> =0*,* )tT$ )T$M 0E+$*; *50*9},*J),*9|KVP!> t)50*,* )u )u^u`IW0j Phh)  hn! )u )uu؃^_[]jjfWV<* 8*9|ld 8*j Qh4*! tJP|i Phh) hn!@54*mB 14*8*k<*L$t$T$ =4*@Q葤 4*<*RDVu4*5<*@LF5<*4*^_SWV<*<*r9 4*@<u|L19tWWA 9u<* )X)4)\)^_[USWV=X)=\)=<*t ) )$4)D$j荣)<* 4*ÍS4R4nr@44v\1L1 [ 4*\1l1sRt6,lmL)1 4*t)|?wt)LI1 4*t~l)}L1 4*,u44vL1Y 4*l1}w4R4Ӆ HA9~R4*4@Hst$3{|$ t$rs2z{3t$rt$|$ z2 9=)t׫X) )$X)\)4)D$\)1 )u) )u&tj\h^$^_[]jlUSWVL\$d3NPhdtNjt$`hSV fttu=D4߃u ,)r|$L$ D$1xD$P莃ƋO9rPSt$ v tu;_Յuͅu t$h9-|$dD$ Du$$1Fl$?uSt$ hjCL$j QPV $;Fl$|1ƋD$8u&1zPUVy!Uhj"D$ thMjީNjC=m@!sHQPWK xs{QPW* x4$Uh_腼 =muqB dut\$fCShmW HefD$t$Shmh=m8@u֍D$Phm8@W蠣 y?60PhvӍL$fqQhmWr 3UhfD$ukD$Ph&h1諻 T$'h‰T$MhىX)H X)~P)H P) PhkhP)j qt$8t$8t$8t$8t$4hQ t$Ht$Ht$Ht$Ht$8hqt$ht$ hݺjó;Phh)讼 j褳SWV֋|$t ?tVQP萺 JB8X)H X);h)hP)j<}P)H P)聾P)H P)>^_[fUSWVh$$|D$(D$1ɻ|G1ɀ8-t D$1CL$hT:_thfPhu@*hj_thfP>u htjhfhjY QP' u hjV0O8D$ u hjht$,)݉\$D$$D$11D$$hSU c7~+Hr߃8tlH w&$D4$뼃4t6맃dtket/1@D$k=D4umWt$ ~Xh5D4KD$71@D$$+L$ ,) ,)T$uA,)$T$uȋ$D$,jj@RIl$L$ $tL$ $L$,1ۋD$Pf|CEu S' )St$PʼnD$$ r U |l$$T$DtIL$ىL$$U$E L$)QPRq 4${EuED$ushh&Pu]hbhXL$PT$xt09w1ɋ$tD$D$ tȉD$ T$@L$ tT$VhD*t$ t$,QPRt$ 36 yj=D*y h|$$tQt$(jVjhS[y hMjVjh5D*2y h%qMhǽt$(1CUVSwD$PUVSw5D*t$,11L$XAAA @D$HPQS =@*u'l$hD$h\(jUTP ul$umDžy h]1O~fVS5D*l VSt$Vl |$h5D*ml$0fE<u1yu@hWj uy8y18tƉjjU tD$68ZtPy8tEVSt$諜 x )b&y8#ThF|$l$8fE=@*ul$0fE9EjD$LPj脜 |$@f9fGfGD*G$jVU4 tQf|$<tٺtf|$4t?D*L$0u+fD$<=@*ufD$4 Fx8t$>Nf|$Dt1BuNfD$Dh|$u%j t$h7jt$|j貪hy2h{Ph<h)莳j脪PD$L$jQ5D*  XUSWVA1K8uSt<։twhU7ϛ ~WUV辚 ~)u18w1ۃ8#ۉ؁^_[]ÐSWVP|$\$WSmƅu]jjh+ tqƉx jPSRJ ǀ;t$8u1A8Љ4DAtt;L5rShjJS 10hWV|$x$t,WDWLDWDW8Dx uW.Ojtw\wXo=)9}5PBt85)WVh-#|^_USWVT$D$;p~F $1\$I$t$\tt$T\$9tt$t$ $,4* t$$jPf8 D$$t 1þ uދ\$D$Et$9l 1Ɉ\$1эƃt$$l$(.|$4$k,P|$W5 $>$\$HL$, D$h1\$uL$41L$4q$ k,,$t \ t$9>u4(T$\T$LT$h4\0T$TT$LT$,T$$\ t t$t t$t \$(4+\+\ t pt 0N9D$tD$L$D $t$t$ $,W( t$$jP6 D$$$k,l(\$t  t1L$ىl$GL$ 9ϋl$( $1ʋ$ T$ ƒT$$D$%L$8 1 L$t$S,u' t$$jD$TP5 D$$ͺdt\$<=1ۋl$҉ڃ뀉<$\$LtCt1t RP̀ uCt1t RPL$`QRPVD$tP>D$du ppxjt$d>:3t$3|$ uK$@k,PU D$$u-1ҋCl$(uBL$42$̀L$4l$(uD$,%ȊL$4L$,L$,RP$k ,|$T9؉D91HD9D9܋D$D9D$D9D$4$T(D,D9T9uCl|$,t CP|$,tȋ$k,|$D:\:̀耉D:$Cdt; 1ۋ|$$\$ 1Xt|$t$\5L 1 u݋\$t$ЋL$8 L$8l$(L$p T$$9$L$؋L$ ȋ|$G\$ ÉL$$8T$ )ʋ\$~L$H1u$tL$DL$$|$haQt$t$Ph,hkA |$PQt$ (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`t$RhƐjA C$t&8$\T$XT$H|$RQt$t$VhEjA $L$l$8hh~hhUSWV u|$W21+F _^r߉L$ N˃u\tL1uJ\$U t D$9v1Pu hpj@ NN11҉FVe^_[]ÉL$F@ˋ\L19w11D$؃ $L$)$ $؃|5D$ $$L$L$\$ <$jQWP\l1eUSWVt$,>D$(0|$$N|,11k,|ll|9~|܋|$$hBCj,PSkD$HPh |$0hBCj,6S-tND$ $ȃ|\11҉k,L+3L+|+3|+ u$tL+$;D$ $|ʋD$$L$(t$,t811ҋL$(VPWhj> ^_[]SWVL$T$B3Br3r ƋAqYyu 11 t Z11 tWz$A$~CD1y3z1 u7rB !ƒtQI !σt9H 1H1@)^_[USWVH] }8D$tȉL$SPh 1L$1D$0<PQ\$SW~MD$\$0CjSD$PWL$D$L$~"$119ރ,Hu 1N1҉T$(t$,l$(M t<D$ D$$l$ `*`*h*h*x*5|*D$D$TH Qq T$T$ t$t$QSh֒j<8 11KL$0t.SPhZj8 V5*[S*4*t$04tt<t$ D$D$|uluD$ D$D$1ҋt$ 4T$ :ɃT$xR1Rt$(t1RPt$(t$8-lt9<T$ ҍI1ҿL$T$Ѻtu; D$x@ T8L$ L$ 4T8T8L8LT L L8Lt$ Pt$V, 4T1 TD$ltL$L$; ?jt$|*lttt|$<|$9^ D$1h ]jP8處8H H;1D$8<9*8D$D$ tD$tD$T*ڋL$4Iʉ9w9vˋt$ 1t$t$81QSPPD$tD$t$t$8WSPPj5 tD$t19D$D$,D$1G1ɉ\$(L$ 8TJZ  D$uD$9D$,D$+4im۶D$D$uD$2SQVPh͓D$8Ph*Vt$,V'~GD$D$8D$HD$L$PD$LPh*VD$HD$8L$ $\$(\$(u@,,L$ D$tt;<sG9كL$88QT$Q T$ QT$QT$Q(9T$q|$4h P'L p*t*tt94 S.8T*T$4JT$ u 1Ft$ t$ 19ºD$|D$ L$8D$(D$,tD$(t$t$8t$Ph"¹tt<|$ L$11GT$D$8\KS +4i۷m۶t$,D$ut$(RQSVh7D$8Ph*St$,V~D$@s, D$¹tt;<FG;D$ L$?-Vht Qhj81 $K tut ttL$(8L$L$,t Ht$,t t$1D$ uT$ D$T$ хy111Rt$QP;D$DT$@D$(4t$8t$t$t$0|$(WVh HtD$4; L$0d$D$)lj|$T$ |$t$ 9Ƹ|$}9|1۰;t$D$|(9}11C1Qhje1gD$4$DŽ$߬$D$D$D$@$߬$ a111CƋD$|$8D$|$H|$LjD$LPh*VL$HL$8t/*ɉL$,D$(~N$11҉Ӌ׉,Iu4T$t8RPhPb11ҋt$  t<=x*|*$T$p$1߬$$$߬$`*`*h*h*DD$tT$|T$d\$,ۉ|$D1D$@D$1ɅɉL$D$t/k,|$(LkT$,t1΋1 t$ uD$|$(Oƒ tj|thtj\$$4QP31A1ҍt$dV$Vt$4t$4VWPnD$T$@D$D$k,DL ʃ|{T$TR$RQPjt$4s*|$T~WD$(ËL$k,‰T$D$,)ȉD$ 1$ SD$dP$Pt$t$ v6G;|$T|ϋL$A\$,9ًt$ |$DD$T$dD$D$D$@$d$tD$\T$PL$LD$D$lT$X=*$t1J8D$<D$ۋL$؋*k,L$1T$9|L$$)щL$ Ɖ$D$HPWhW $PhD$( yNIL$ L$tL$L$8]:u*t$ tD$PhٕjP ,uhj< uhj( M1N^_[]USWVD$@P1~1L$\$p +n~| ;^ ~| Ju1h.^_[]ÐUSWV0u$1 󫍄$PD$DD$HhttD$t$$ u |t u]D$ 3) CD$pC D$lD$LD$P8D$`D$d1L$|1D$L$QPt$VSD$dPCD$Tu ppxjt$C XtL$Qj4WV,dt<1T$r tFt1t RP3D$ t(Gdt;<r61@h t 1F11Fjt$0t$tw|$$u yQ t$H yQt$Dt RW&NJ1 t1t$|$ 9|1t$$ ]t$FL$|9 |$t$T$$u Bhu:4$BBRt RP4$]0hVP- ȋ|$L$ $]1ҋL$t$9s 4$uAD$$@ht1H袋4$.|dVWjt$Vh̗j T$$BRt RPRPVWjt$$Vht$$ k,P1 D$11ۉ\$ Ék,<01 D$3D3|$ |3 $T3EuD$$PltD$$PPtʋD$T0 4$|$T$9x]|6D$dt$tD$`Ph j D$,|$D$T|$XD$TPh t$TD$L$D$,D$8L$4ȃ|$D$\tt$t$@DD$x D$t1ۉ111҉\$hT$ t$( $|$* * )9|[5*tFNu *5*t5FNHNFy F4VPV*@*1@j@P U1@P F ~4D$F(^$F0^,n#)^8* *t q4*^G FtH 7~ F^_[]É *=hhhhhhh;Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP *H*N^,H ***H@*P * *H*H4I*H89t;tprp*40*t4F *H^h͙hƙh4h;nUSWV}]uuu W@t *1@*1HCSuu WW KN0F,xNF4VPe^_[]vjv p fUSWVP|$g sG4$O,5)w0VPww D$0^_[]USWVPt$ff sF4$N,=)~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j 8p *HtƒQ *@ *^_WVt$ *F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd F hjv v ^_ USWVPT$|$:%4*\$ *$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4*1ہ= *| t Pt**1t 98t@^_[]Ã^_[]`V15 *5*hVh* 5*^ft$ t$ xjmWSWVt$frLN4F,=)~0WPvv 1 t\fv4V1AN4F,=)~0WPvv 11;NuN^_[h 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWR׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h.hh ḧ́USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FhxFxF )yF F$|$0tfhj ljPLtLXt uB\I\$$|$ C$|$4NhHb<1ɺPt`tLtt l$,\$(|$0uej ttPr ttPH A 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=)lj)l$1 UPQSWVhj Ë}Pw S  P G1PWH¹tTt )߀<$u1 t1 L$QWURPVhj Njl$hu P  P E1PUtA|$4t hS Wy 1^_[]u C4CHKL1}Mt|$4t7hޝt$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh?:$  $ V 19tQRh~sO 1@^USWV |$,\$$t$ tCPPt Ttt4RQhܞN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthUNhP)D$(u KHKpStURQPt$DljT$t h~Tu CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh ^ *VRh]G T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhD$L$9tQP$$h݋t$Ht$nL$tI9ȋt$ tPQ$$h9衋1t$Ǽ \^_[]hhhhehhhPD$L$ $QPj) XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttٚ|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$nu0|$ r]@hD$D$D$,$D$ tH,[D$ p D$D$D$,$D$ FH,LD4@hD$D$D$,$D$ H,@o M|$@ t"D$D$D$$D$$ǜuEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$,D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$D*uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW蟍ƋD$0T$UW胍ƋD$0 u$$$UWHljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RPیERPˌ$GW #RP趌ERP覌$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhTD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhD$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RW[Nj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RPۇt$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QPPT$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP蝆|$FV D$t RP耆|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RPk|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RP$ D$TBL$?ttXLT$BtJ J T$$T$ QPsL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP݂ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SVŀD$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hhh h.hh h.hϝh"hPUSWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p  A L$H SjQe ^_[]USWVL$T$ B *ulF1GPUh1%,$X)H X)~P)H P) hP)j !*u q1^_[]Vץ)PPhV&Vjjh¤PP8Ph.rh)p&Duj[USWV׉΋*hPUtCt[PUjhh$*s 5 ** $*t2 *$*WVS5$*^_[]Uhpj5 *hjUSWV$:$D$VuPG 9$j uP* 1ɉ\$QSuU Ƌ8`8"u11F9Ή$<$ 1ɉQSu " ËD$8Չ8"u !t$$Vhyd5$*e tbVh֠"^_[]jh7jh&.uhX$hph$p hhj+$05 *hfj@USWV}E phVFh7VphVZSD$(P5$*Z#D$0= M$L$A1yyy D$Phwd5$* D$tG\$ D$ L$|$j 訑 ljL$ NjL$IuɉNjD$ D$|$uhjf D$v1111O w+Ow?u$L$A1AAA D$Phwd5$*1  \$tmt$ NL$,D$( *D$FD$FD$ FD$$~D$(PPWt$,t$t$t$h KuD$1D$|$Ynhxd 5$*R5 *1111VQRP5 *hvhxd 5$*B *LQhUww ww5 *h,w_G|$9w  jPQ5$*!¡ *tNSVPhWt$ 5$*Q  m9tEQhP)SVPhڡ;كT$;r ZƉ[|$?e^_[]jj{ 5 *hlhh`h=h)  jQh(WV$u>$jvW s'Wh{dЀ5$* t^_jhj 65 *hfj VPPhtd@5$*P $t%t5 *hPY$hu95 *Q7 *$$s QPh  *$$ s QPh *$$s QPhڢ *$$s QPh *$$s VPh-~^5 *h,j WV$u^Vhzd@5$* tH$D$PWVhl"$PwwwwVhz^_%5 *h[j SWVP|$uX|$_hScƅthSOu+1Qhwd5$*\ t ^_[75 *hfjUSWV|$0t$,1@<4,)$1ۉ؉D$hWV-3 qt\$te+$95,)1|$7wWh|d5$* D$ ;D$t-i9l$sUt$k ƉD$l$묅hhPV *L$ tcRQPhV|$ t\ư1P`VvvvvQPh G;|$ ru5 *h$t1^_[]5 *hj5 *hjjP|$u1Phd@5$*m *tQh6XD$ 0QhfjSWVP|$t$^hBStDh]St@hsStt$'T*D4x6*,*D4j/SAFH*(*Shd*h`*h\*h5D4:D4L$<=\*x\*i5D4PR8*A)2)#) D41Bp6*D*1;tٍT$d3D$dD$j/VtC1ۀ>tT$d3D$dD$ tTj/S֥tF1;tٍT$dm3D$dD$,t>\$At$8\$/X\Xh u1\^_[]hTPhLh˫E5,)x6*t4Pu'hhh 5D4h~j/=4*u8=<*D*u~8*uu0*ul,*uc,*6 0*=@*u th3-" 8*,*t uhet=)uhF$)|u D)j=P*|$\G1PPL$lQPjW轆t2t$dƁ t"1PPD$lPVjW葆t5)=P*u4$P5)Ru#$=uP*@* <* D* 8*=t6* ɡ)=P*t&jQPf )uT5)h(7jhh;*QPv )yu8uvh;*hEt);* x6*u0=P*u_L$dQP致5)hRQ5)h1h;*h{:h9*hrdAP 5)h@Gh9*hedA5)O 5)hRhPh9* $$t(hQP5)h oD$$ƒ 9*>s1@![Vs ) ȣ9*9*9*9*? 9* 8*8*9*;*9*;*59*5)=9*=;*?wD9*H9*=L9*L[VL9*?H9*) D9*>r$r$D9* 9*9*t6*u ))]u1hQP )u25t6*hT5)F)jr5)|V} |6*u Vh8 11h6*t1A1A1ۉL$@1h8*8* 8*h8*=(*u#\*D9*`*H9*d*L9* t$\F|$LSSWSjV&t$L,} |9*n 1QQWPjVy5|9*n |9*5)j/Vt@UUUU)ʹ3333!!сisl*1B8*t!tt>8*~8*cԋF8* T9*X9*1J8*‰ \9*`9*h9*1 d9*1AhQhP9* i-P9*=d9* / T9*ًX9*P+==w !r%1H$D$ ʀŸw1D$ $}ȹF8*yt88*t  ud9*1I $L$9 P9*11O|$ytyt F9u1H$L$$L$ 1D$(1uh$D$Nj 9*1҉19ʃ$\$ڍD$0PD$@PD$ P/ x#D$=wD$D$<;D$0 Eu9$r$$D9*5H9*=L9*X9*D$T9*t T$$T$8*=L*uu ); d9*7=0*l(*_h"E|9*81uhLFw|9*L8L$(L8L$$L8L$ L8L$48\$81=)Ɖڋ\$4PVQRePSt$@t$,t$4t$;*1K1Kޅ`1PPPPPP =)8hz1>8*8LFu=0*uRh^%tajhg1WjWWWP+ht҉~8*u >8*=@*u8*u D*1g=@*|9*D$tD$|D$hVs8*1N=t 蹵@ 1"WhVVWP+9tigfff։f58*d9*L$ȃjPz D$ u hjHht^r1HL$ AjhQ18*D$8*tB?t=]WSh 8*L$ DD 3$ D$tD$D$݃ u8* d9*1P9*|.tq<tk؍}PWhD X9*T9*P9*t BD$,T2D$ TL 3$3L$ щtT$ d9*T$D$,F9u|$~O1l$GVWhq T$ L D3$3L$ tT$FЉT$9uT$1۹VWSSSP)T$ ‰ $DD$R> <8*=ue8*$@D$ $#D$u D$ X1$L$19;ta $Ȣ8*=8*u<*uD*u @*=0*t88*~ h628*~lhU2]ho=8*u1I8* 8*t h~oht8*o8*e$jt1 8*F8*t 88*t3$ D$ 8* u=d9*5P9*X9*T9*1|$~t;~t5ӉDžt Ӊǃ3$3|$ ~ 8*|$E9u KD D9*DH9*DL9*DL /9* 9*WQD$lP D8* ^_USWVӉΉȃ н t|$W!,$$j\WU D$EFI 3EPART3M u#E1M1 uu Wjg  ;Et 11=H*t } tu$u SVRt$hjUh ^_[]USWV|պ$u $D$$$L$ T$,D$t[9-d9*~x P9* D$ D$X9*5T9*D$8~" t}t ։t$(t>8*D$D$( D$ 6*1ۉl$8QD$ 1MD$(D$8D$D$P$uat$(T$,$L$P=0*t-t(WPh=  L$ T$8St$,T$4$tD$XRQP舱 XL$ tC=u=D$8L$XRPQS l$0$$L$ *D$ D$Xl$0|$$L$ tW$=,*tduD$P $OD$hl$( >-l*1ۉl$(-D$D$D,*$+D$Phl$(p D$DD$\$1ӅD$4 À[S\$@t$X9* T9*5d9*l*D$t$8*9x @uuhAXPhھ=4*t88*PPh^_[]á)=4*uxPh58*58*5;*5;*5;*hs59*59*5L9*5H9*5D9*h$H5d9*hK5PhY&h"iW;* ;*5)58*58*RQP5;*hc hB$WH9* L9*59*59*RQP5D9*h5l*5h*h& USWVPˁˀ L9* H9* D9*1F8*<8*~t=u88*t 9r u֋ d9*~:P9*”>u~t:t  Iu@* щ $ D*t&=u8*օ4$u 8*G0*tip6*Ȩuhht;pp6*tj,*=u*Ѕ$tNt9*=0*u"Ph~0hoPhIt p6* =p6*uQ$tt1p6*ti*х $t4$P5t9*h=0*u5t9*h1t"1<8*=u *8*^_[]VPD$ L$ $QPh4)H )~)H )0h)®Ɖ t9tD)H )~)H )h)肮ƒ1Y^hjUSWV1=T*˃y CS t 8*58*11 uY1ɉNVt11@5C C tPhzy hK;1He^_[]SWVP$);)u+P*u"QhmdP~ y hF{My11h6*<=x9*u;5p6*|- p*1Puh\V=d9*~e1P9*111 T9*X9*Pt,P9*8C;d9*|h:xShqx$);)u+P*u"QhmdPs y hF{Bx^_[USWVP։蚥1ɉQPUx 1O}t#Ë$8uq8"u r1^_[]USWVP։ϋl$=4*T+P9* 6*tú t~" 76PSRhPT$7St$h_D$7UPS\$ Shp7PUSh|77PUShV7PUSh>7?PUSh#77PUSh˿7PUShܿ7?PUSh'1PPPUt$(SRh@^_[]USWVˉ1u=H*hOT$$8$43|$͉)uh Wh |$Z)uh Wh D$|$F8*:E8*D8* C8*l$M?>F8*J8*KL$ u}tGE)9H9^_[]USWV,։L$D$DD$tD$,l$T|$@D$DD$(D$$t$ D$Du%WVUt$\t$\t$\t$4h L9*H9*D$HL$LVSQP.D$T$D$PVSUPD$|$ D$@VSPWljӸ1=)ƉT$ L$@PVt$QR躘PSW|$LWVUl$lt$,t$,t$(t$@h,h)jdh;*  |hh;*B;*\$ $t < uC{ - )DAu<-j D$$Ph;*K D$$\$ h~!SK|$(@D$PhS  $ϋT$ t։t=t$hpS t't$hS ct$ |$@D$1=)ы5h*jVWR:D$ՋD$D$D$D$D$$t$t$D$$  T$l*u1!׋4$!!ǃ1)ʼn,$\$|$t$ |$@l$ThS!A< u>T$;T$H $D$L| 9T$P}oUt$Tt$Tt$TQRh;*V蝗ƀ;*t$Vh 5h*D$,$t$P։ω,^_[]hjpUSWV΃ twttus^T$(|$$+l*уD$ ;T9*L$ X9*|.|$,T$0 `9*|$9=\9*|=0*u|$4u 1^_[]Ë-d9*~} ʉ$9twP9*|(tk T9*t( T( (t1+l*9\$ \$$}2;T$}#=0*u6|$4ttD(OG1nFt(n9Չػ}n9l$\$QAuƉB8*tt  $tt ^F8* T9*11 X9*t$ -d9*t$|$$|$}P9*] ʀ|(tP T9*t( ;L$T$|L( (9Ή} =0*{|$(t ;P9*KC X9*T9*1$t=t T9* X9*SE=0*|$(5h9*5P9*=O 1l9*h9*d9*`9*\9*X9*T9*ƆB8*t$ |$(PB8*9h9*u85P9*N 1l9*h9*d9*`9*\9*X9*T9*P9*1Ƀ|$(T$3\$1 5d9*n P9*|+D$Nu P9*[\$j5l*T9*)؋ P9*P|$(t$ hhjG P9*VfǀUh9*L$ X9*D$T9*ƋD$$ȉ5\9*`9*d9*11d9*uP9*=0*hku*=0*1|$(9 h9*u85P9*M 1l9*h9*d9*`9*\9*X9*T9*P9*Ju UPQ3 d9*1|$(tD$T9*D$X9*5\9*=`9*^_[]hj迸WVP9*t^ tڋt֋|҉tΡP9*4 d9* QPVq2 d9*ƀ^_USWV T$L$d9*@hPhP9*g  d9*P9*~CX9*T9*$j1ljڅt }ljڃ9|$|$| F9u׉΋$1 ) QRR1 P9*;UjPG fDŽ;UtZF , M ;M;MU;; T9* l*T$)ʉUL$  l*1 EE=L9* H9*ϋEU T$D$1É$19|]E؋$@?! È]D$T$H1Ӊ19|MEߍ;@?! Md9* ^_[]hjEWV1=H*Aut"<t€r<t< upqFfr- 躵@ i¶9uI1ҋ5)<tD~t@ uB 1u€πr<r1@^_USWV )D$Ӌ5)݉t$މ$!!jVWt$!1Kl$ ))uhUPYzQ5|6*PG ;)u[jVW5)苀!1Kt?D$H5|6*#$SUP衁 5)V5) ;)tÉ؃ ^_[]hj9USWV$0$,1@D$l$D$D$ $1hnWV suMj U5D4O áD48=L$90ʌ8"uu)p~qt2rt:w 1@$|t-fD$cD$V1@D$ J-,))1<$L$jhQP4%H h?*hedAP~ =@*aN 9l$| TN @f@*UjDž\$ t|X)H X)~P)H P) hP)j jh?*hP) X)H X)~P)H P) hP)j k<$ D$tt tPhD$f@*?*Waf@*gdWPV} xnu)D$PhwdV~} h:hS6V?1^_[]Phu25D4hj`4 hh0Vk j0KEPhh) jUSWV\T$?*< $S4 D$9d$ՉjRPt$ V|11 Sl$UVI 9 1U\$tL$j@PQ} 1!1D w 8<0l$| (l $l$P…ۉD$t#‰ UQW4hT$l$ @*1ɺ4@*1MtBZ9u!l$ʼn|$ 9zƉl$4u1Mu: A9uI\$tT$urtbL$ IL$(@*t)j9l$ r9\$ 9l$r *9l$KIuf\$tT$Hf @*ŅtMaQ4hCT$ t tuf f111(@*|$ ,@*0@*T$4@*5@*f6@*l$E<$g\$ttXaQ4ho ;B Q4hR <$\$t4h2<$l$!F1D4 Sjjhg\OĄ^_[]USWVt$|$\$PhTS軼 Sjj9heOft1VUWSuE9r^_[]SPL$t9u@WVt$ |$7kLWVSWV$D$\$VPWS$,$,njS7VhkMu$ tu!D$t$jʲ0a PVt$ hj貦USWV\$ l$|$t$1E1@<4,)hWV~ ou%jSh5D4 tEPV ǃuA,))ރu4t$$V4Nut$(t;^_[]hj;:PhGh) jױfWVt$|$ VWt ?/t)Wh Vh WhlQQ^_fWVt$ |$7JWVUSWV|$$t$\$WPVS$8$81EFuMjSt$ WhkkuP>~D$D$ jPu^h&Fu,A*D$9WhhS)3F j/PRJ|4$<Ƌ|$ \$SW~t\ NuZD$@u>=,A*L$D}0^ PWt$hj,A*{<|$\$W4$7 WhhS(4$u hjF j/PeIt|4$4$7 jmUSWV\$ l$|$t$1E(A*`!,A*0A*hWV; h~n3itVn,A*Ѓa~.btCd4A*봃otBs?t jP_VP^_ÐWVt$|$ VWt ?/t)WhdVhV WhlL^_fWVt$ |$7EWVUSWV $$l$WVSU$ $ hU3WhkʳuWVhjG褠D$@tF$j$hhV-5 V$$$h*jUSWV$$$$D$1 hSU $D$D$1G$D$ȃ 1$N|w5D4Ft|$`N|Z5D4Fx|$Cj$h5D4x P' 5D4UFp<$hSU V,)H9$|U4n$W^.l$\$t <$tu;D$ PWtD<$uD$$FpuD$(Ftu #D$FxĈ^_[]hj耞WhKjGsN2Phh) j@WVPt$jWVJ 9u9t x^_Vt$hUjVt$V# t@^hJV^Vt$V t@^h:]V|^WVPt$jWVJ 9t9u x^_VhgjdWVt$|$ VWCt ?/t)WhVh~ WhlH^_fL$”19v f39rËL$D$”19v f39rfUSWVE} tE 1u jPVL$QD$ T$M⿪t׋E4D$T9\$E0D$Ds hq-1VWt$ t$P:1@PPVVu4u0u1OËPhhPi }D@u hh hhSh }D@PE,CEhkV2u\$thkVh, u]u"Er u$1U; D$E Džu"Er\$]8},|3D$t؅D$p~D$p|$D$pt5Ph+%t9\$t h+\$pD$p\$D$D$ 9\$~\$~tSh;+\$9|1} t hbs+hW5lA*hz}4xME0;E4ru0h(+},u,D$D E4t h,D$T 1u D$D5 t$ D$<$$L$$$E@$D$(D$$A$AD$|AD$,A $CD$0D$XFD$D$LD$HAhD$PL$$AlD$hD$\A D$8X$$AP$$p$$$$tD$lD$`$$A`$AtD$xD$tH$$x$$DŽ$|$<S(L$ L$(tL$$|$1F9tSh(D$ D$L$01۾ËT$||$|tL3L$0 3tD D$ WI(\$tt$1F9tWh8((D$ 1tt$ tЉ|$TB7D7R'tt htD$pt\$1t$T$2:|$D$xtIt$)Whw)P |$)Wh)P D$ $L$t$}D@tCW&1@9tWhW&L$G$D$$|$tD$|D$P$\$hT$(T$ T$8tD$X$\$\T$$T$ T$,\$dT$@ÉȺ$L$dD$ L$@uD$ $L$t$L$}D@D$t1ɉD$h|$tD$\$D$8tD$,8$t$D$p1ۋd|$tTt˹)\$E3},|$|tE P|$t$ \$tT$ ltL$U<$u褻L$$|$t$$t$ \$1ҋ} P$$t$D$1P$L$lT$tL$`},D$hD$tD$\0l$1T$$L$t$D$ltD$`0Mt$  L$t1D$uAAQ 1D$1L$LD$tL$H $L$l|$tL$`$tT$LD$@ u M։ ut$@ uƋ$ș)Љ$T$ uD$ D$u D$pD$pL$@H E‰Ɖt$@|$ D$dD$Dt$T t T$@1҉19\$dىrD$@)D$D$@u|$G1ҋL$(D$8|$GWL$$D$,$u 1$\$ u1PVRt$LPttt4D$@$Xt$1F$ӉljѺʃ ʊ$ˆ t1L$\$|$$1T1}$t$D$t$@t$U$%t$@$D$t$w }(t$D$t$M(A$D$t$wr9v{} uS;$~J$u2Whh)诤 ;$uh)jjHh7$$D$tD$|0Wh7 $tt$SWhh)>uDt$ vh7 ~$r-D$ t$$$0hj }D@uh0h#D$ttt$$DŽ$߬$$ڌ$ |$D$ \$$jF T$tT$ uD$(D$tD$$D$LD$tD$Ht$x$t t$t$1‹6t$ uЋL$+D$ut$FF$T$lt$FVF8VUttP Fx HIt$41VRtRRP*t$ tPhAQL$xtL$tD$4@ @},|Bu @@@T$PtT$XJuP P @$uO$ O8W

K K\$t L$Y L$) T$) Qt$S2L VjWK t$ uT$BtfD$T$tf|$0+|$‰T$D$1CD$< D$4H4PQ|$HIht|t<7t1ۃË|$71ҍt$4VRtRSP#tPjh}I D$ uD$4r&1ɋT$P: $D$41ɋT$X:1ɋT$P: IH 1B}D@u{1qqqqQ q0q4q8qWP1HPWW\A*E1@D$491@D$ -HA*"D4=`!WP1HPWW2D$PT$LD4JWP1HPWhPA*Vhh{&u=,)؃rKVhhAjjD$t t @@u|$$hЋ45xA*j/Vum|A*Vhh hS{$DPS"u"5xA*hhhh|A*{xA*|A* PhKu =HA*hjSg |$4tg$y\hh5xA*Xg D$xD=tA*~1hSPeD$ F;5tA*|1QQQP;5D$ u D$y05xA*NB0# PVu hfE 1HD$j5xA*fÅy'5xA*B0# PVu hf $DPS. y'5xA*A0}# PVu hf $L%=ta= uDpA*u DpA*L$t$QRPS5xA*ul5xA*hD5xA*hNDŽ$$lfsD$tjV$$c?$ $L$ Z$ $ u4hPL$ u.$$lfst!$$Phk4hbL$|$u$=Ѐ)|$TttA*1tA*ɉ\$Hu0tA*tL;$$ s5$$ %DŽ$$lfstA*t$$ $$ 1Ҿ9É|$u|$ |$|$ t+|$ u$1Ҿ9s h| h֮L$8J#$L= j|$W$($(D$8T$ t$VN|$(O11VSh$Pt$XixHWD$(+D$L$,L$ ʃ|*5xA*h1D$(+D$L$,L$QPVS=D$DT$XD$PfD$L$L$,D$(D$8L$  L$lD$h1l$h\$8$D$\D$8L$\ |$D$ fD$Bl$B|$`l$D$`L$d QPhSt$Xhx>WFD$(+D$L$,L$ ʃ{1QPWV;th'jd1F\$D1VPSh-wD$XWVPS;%|$$u1Ʌ|$t1ɉAw1@|$Ph[1wD$tt$5dA*5XA*5TA*t$\t$dt$<5`A*5\A*Q5LA*5PA*5)PWt$L@ƃ|$4tVoUSWVӉ $<|$j W\$ SM Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph1L$8ɉ׉u L$8t 1@׉׉|$l$ ;8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3QPWUt$t$h QPWUt$t$h t$t$h{jFbUSWV)1F/WVUhZ WVjhw WVj!hf WVjhU  WVSh@ WVj+h/ WVj;h WVj$hR WVUhwWVjhWVjhhW]vWVj hWVShV3mfD$t1B9| Ā)I Ȁ)1E*IuĀ)P E* Ā)~ t1@E*@9uUSWVD$9Ā)1A9|GȀ)Sw Ɖ<$~ SjVR- Ā)D$~Q1ɡE*t<Ȁ)*tBEB(B$B4!؉B8<:tWBuA;L$u5E* 5E*$Ā)^_[]V$E* E*D$D$ T$ t$ Ā)5E*t$T$L$D$\$ $r$^Vt$FtN H N tNHNfr v Y VP  E*^VD$`sH) E*E* E*HtP4BPQ@@1ҋE*v9tE*E*rh'j^tp4F@E*^USWVD$T$#Ȁ)5E*tC=E*11-E*9| n-E*9t%9P4uH$3L$X(3\$ t Fu1^_[]h~hwhh;蓛USWV\$l$ |$t$SWa tR@UNV9n-~"FCnUv c F V>E* E* ̀)9|[5E*tFNu E*5E*t5FNHNFy F4VPVE*@E*1@j@P~ U1@Po F ~4D$F(^$F0^,n#Ȁ)^8E* E*t q4E*^G FtH 7~ F^_[]É E*=hhhhhhh;Vt$fF4VPNv4VjVL^SWVD$ptH N L$Px 7Xxq q$$2tV H ^_[VL$ D$@ HH`` r)`r(P@uP E*HE*N^,H E*E*E*H@E*P E* E*HE*H4IE*H89t;tprpE*40E*t4F E*H^h͙hƙh4h;^USWV}]uuu W@t E*1@E*1HCSuu WW KN0F,xNF4VPe^_[]vjv `' fUSWVP|$gsG4$O,5Ѐ)w0VPww D$0^_[]USWVPt$ffsF4$N,=Ѐ)~0WPvv D$0jV1^_[]ËD$L$ T$J1WVt$|$ j 8p E*HtƒQ E*@ E*^_WVt$ E*F0tN4H4N4F(tN,H,N,~$tJGtO H O WWzӋGtO H O WWT~ uՋFpd F hjv% v ^_ USWVPT$|$:%4E*\$ E*$19~u)nM,1ًm(1 t%~$u~u Ftʼnv0u˳11V0tN4J4N4$V0tN0J43^4U*1ہ=E*| t PtU*E*1t 98t@^_[]Ã^_[]`V15E*5U*hVhE*q$ 5E*^ft$ t$ DŽj]cSWVt$frLN4F,=Ѐ)~0WPvv 1t\fv4V1AN4F,=Ѐ)~0WPvv 11;NuN^_[h 1HUSWVt$F4PNx>~t * t1u)z,)z@ZDN@PVjV:1^_[]USWVLt$lT$h|$x\$d1 9щsr2tt$`uT(uz\$tt##׋Tp|ttpWRپ׉`l$ u|$L$ T$D$x$|$l$(?|$t+*ʉu t\$t$`uDXtȋ|$$)u$PS$O|$1ۋu} $T$uWVt$lT$ 3D$h3L$l t jS~EL$`tWVt$p(@uBtt D$$ t1S0C,KC4SPC Mu ȋD$L$ ۋt$`tjStt<$1 t1ҋL$p t1OyL^_[]h.hh h轐USWV$D$LtD$D\$@ÉƋT$8pt11Ƌ 1Mt Ew\$4$D$D$HD$1D$1AL$ (11F D$ t19D$|)ЉD$L$uʸ"T$+t$ $zߋD$H0Hx@ T$8߉t$3D$@ $3L$D \$ D$1AL$l$ |$ًt$ uptl$D$HD$  J!D$<$xt$pPEl$J)|$ w.l$ )D$t$3L$@<$3|$D ϋT$8|$d1L$LtT$$^_[]ËD$1QQt$t$t$PpUSWV|$dt\$ ,MtVȃs uFt1t RP3T$3D$M u1^_[]USWV(t$FxlFlF 9mF F$|$0tfhj ljPLtLXt uB\I\$$|$ C$|$4NhHR<1ɺPt`tLtt l$,\$(|$0uej ttPb ttP8 A 芇t u_4u_4_HoL_HoLUS6jjW'hW>q$ 1=Ѐ)ljЀ)l$1 UPQSWVhj Ë}Pw S P G1PWH¹tTt Ѐ)߀<$u1 t1 L$QWURPVhj Njl$hu P P E1PUtA|$4t hS Wi 1^_[]u C4CHKL1}Mt|$4t7hޝot$4VWS9t߉i؉^V΋=a=t4=u @=bt)=bu )hbPh?:$  $ Vx19tQRh~c[ 1@^USWV |$,\$$t$ tCPPt Ttt4RQhN1u9PPtt; QPPtLt,;|; $11 39<$l$,D$ u$$ÅthEZhP)D$(u KHKpStURQPt$DljT$t h~Du CHCpKt``t|$13L$3t3<$t<$+/t/ uVRh  U*VRh] T$u CHCpKt1‹D$1 t$؃ ^_[]USWV$|$@T$D$puD$ 11L$ I,$t$UQPhD$L$9tQP$$ht$Ht$L$tI9ȋt$ tPQ$$h9X1t$ \^_[]hhhhqhhhPD$L$ $QPjԀ) XUSWV,t$@~HILT$T$1҉T$L$ T$T$$ tD$$D$H uIN QIN,V($D$u V D$ V(F,D$D$(@H1htL$@t$ L$L$T$$$D$|ttɦ|$@/7Lt$ t$l$L$ T$D$D$($l$$tD$l$$nu0|$ r]@hD$D$D$,$D$ dT,[D$ p D$D$D$,$D$ 6T,LD4@hD$D$D$,$D$ T,@o M|$@ t"D$D$D$$D$$ǜuEG EMO,G(HILT$T$1҉T$L$ T$T$$tD$$,D$H uUQ UuqQH4$Q:D$ $D$RuO 1O(W, u<$ST$HL$DU*uG(G0W4P1t$t$D$ T$L$<$$,^_[]USWVL$0BD$uxh u4D$0xhu9D$0 uL$mT$UW菙ƋD$0T$UWsƋD$0 u$$$UW8ljՋT$ÍL$QL$4tUWRD$uGW uE-GWu-E?RP˘ERP軘$GW #RP覘ERP薘$GWD$HD$t|t|ht1|)ˋLƉك}T$r{$HIT$1RStSSPtPhTD$H uIM QIM,U($jPuE D$ D$u E(D$ E,D$u(},}rrHIT$1RStSSP/tPhD$H uqqyH4PQ:htLt$1L$͈T$ҋTË $D$0 1 uЀ|$uIL$0)A$yD$H |$t!Aq9|ߋD$ AL$0)A8Y<D$H |$t$1AAljqy 9|ދD$ T$AQ2H |$t!Aq 9|ߋD$ A|$0HIT$1RVtVVPtPh D$H T$0uii Y$t$0H4PQ:D$H4PQ1^_[]USWVE@D$p0D$ L$$tT$M L$}t ]  uT$ Ӊ|$ L$# L$ET$t 4$t$T$\$D$4L$<|$(uwG ‰wOÉʋt$ t RWKNj1 t1ҹ |$9T$Ћ|$9|$D$1 ;L$D$ruL$u T$(BR T$(BRt RP˓t$|$ t19|$t$ sT$u$L$(Au-t$$"D$$ $TTL$(Aut$ $!I t$$It$ $QP@T$#t !‹t$ D$$ $D9M΅tt$,MV\$S|$$WP~ ƅ$ L$tڋ\$uD$t RP荒|$FV D$t RPp|$FVK}t$ tD$,H4PQ1 9|kD$$L$T$u BR t$< BRt$4t RP t1ҋt$ |$9ljD$0L$LT$@PQRVWu|$W[ƅtD$t 1BT$ uЋL$@T$DL$T$(!щ‰L$t1ҋL$0|y\$h;t1OuD$u8$)S$>1 9} L$T$BR $)S8C<|$t$vdVF |$t}NyL$T D$DXtȋ$T$BRt$t RP[|$  t19t$ }s*L$T$BL$$L$ T$$ $DD$t RPҏ$ D$TBL$?ttXLT$BtJ J T$$T$ QPcL$ #D$t$ !L$T$T$t $ًt$ t1\$ЉD$u T$BR T$BRtRP͎ي\$ #L$9sJT$9ʋt$ϋMȅɋMtD$,Pt$VW0ƅ}}ʸ|$t$ Et(Rt$WuD$,M@0@,D$@dpH uh)s$ cL$tT(}MD$,PjRt$VQƅD$,M)s8K< L$$1<҃ DtTpl1҃t$0|1D$TL$u\Xu.\$?}u"t$,ˉ\$t$0B\$SV赌D$Ӎ|$h $twwu6ƉD$8?tPFui$tt $ D$ t1^0F,NF4VP"vjv  t$8F0F,F O$u<u$O TuDu \$ ȉT$\F4VPD$@t$0D$9}|$$ t$ rڊD$L$uAQ L$uu HD$tT(D$T,L$ttX~NL$8Qjtt4\t4\u,t4Lp0h D$8H T4Tu DH4PQ1e^_[]À1ɉ҃LtTpЀ1҉׃hhh h.hh h.hϝh"h\USWV׉ȋ\$I $q0)ӊt L$(t9QjWt$0t$0PtjD$,0oL$(|$u)n$ )n8F<4$NdiA N1t-t$p  A L$H SjQU ^_[]ËD$@(Vt$ V(1y<1I+F$ыT$ptj42QP!51 ^Vt$ V(1y?1I+F$ыT$ptj42QP41 ^Vt$ V(1y?1I+F$ыT$ptj42QP41 ^SWV|$D$PWjSWK jSW? C fd::px$t PSW $u O4OHWLٹ}VSW3 SW :ʃuW1^_[USWV\$|$ t@ f X8ZLJ jDW Ɖ t,U- Ftf^81FFH1|$<΋t$  V*uN V*NVfF fFLtt\$XtD$ 7Dt1V  ЉF <t$@v0A4QPU耍 $K\$ tSD$hD$@p$Fx~"1ɋ@ L;H|PHsu"l$\$ V*{V* V*\$L,D(Pl$tttt$T 1¹pt Ѝ t$@F03FHD$ Pt$0KCLLtPQ4$ Xtt t\$1Ӌ47ֿ uډɨu |$<)W$ |$<)W8O<|$ |$tpD$@p1ۋD$H4;Ptx(U*y U*U*Py`PD$@U* U*C9݋|$t< u6AWhV$& űD$ 1GtPh%^_VG1tL t uDHuԋD$1ɉoo1USWV$$8$@(\$$ىh+C< t< t< uh]SDƍD$$VhPG% L$T$\$PQRSD$0PD$PhED$@P! t$$$ىhrC< t< t< uS=$<rLjShSh辇ShK$hW9$t$<L$D$D$L$ oP@_ tXljo 1tX L@uH~vCtTjhh# V $^_[]V )UjS D$ D$ CD$CD$C D$C$Cl$UhVe  u D$CV~)1$<;obD$D$PSh" =USWV$0xjWh ƅ~F$0h$1jUg ~4$hP C9uЋ$4h]SǍ$ىh$0S赲t| uƄ$ $0phQUMD$$0qhQP+ىD$PUAPUS膥 u׋$0EED$1ɍ$D$ $PhS! D$PD$PD$PD$Ph8 SD$L$ T$ ыD$E L$ T$ D $A9L$D$uPPhqhTI}Shqh Shqh' $02t$t$h.$@t$Phg  |$Wܶ}~14%l G;}|Vl 1^_[]USWVD$(}~;$ ~VE pS肦 $PjVWjSl D$11D$D$D$D$$D$ D$hu Vuc H5$$D$>j 5D4P CrCr C5D4VtD$()ry7D4$P1Crj hVӡ ىVS1PuE$ ~S4V蕡 $PhjSPt$Vi uVh WhjÍD$LPS u $PP@ D$T%=`urދ\$l % r~\r )rW*r rr$P$PP>r<r<)r<XrrM1$PT$ QAA AAAAA hiQhr r 4r ,r 0%r0B$PPh%r0BV  I8tShP\*r6'r)rD$(hCPh)rmr.r^D$>PmHr<r<0|$$$PWS[?$XAQj2$TPQv $PhPhr<r r h kUhjhr V= V*j菁h2U!r+rprTt$$$PVW}>ލ$P|$xhPhrS Pt$|$l$P$0hPh*rt$h!sT~~;$1Fȋy!w QPh G`;$X|΋$\>9r%hbT$`>ߋN8y!wPVh `Ou1B$T$$PىPV1Fލ$Xj2WPt $Ph Phr4tPSh <1$P;$h Shrt$V 0 9;$PVhJ Z|$$VVhd Ahjhr t$ j}= V*S$h Whrt$  ?cG\$jx}h WhrS^ $d|1$XAA$Pj2PQq $PhPhr< h0jhr V VjG$P$P VP,D$$~$0hPh+rW뢉t$$P\$ ZShX$P\$;$PPh VhSh*rt$>  09rh Oh O$\>$Th[ Vrh O$X~:$\1j hXVB BtQ^OC`;$X|j ~-h6O$`>V&O`Ouj $X1~"$1:t@`9uh9u$\Ph~1@\D$,\$H|$PS4$hjV L$,9F Vh+VhrW h ^NF0PhIF0Pv,v(v$hj h N$ThEh|hlh-M$X~n$1WȃwE$L$ 7>!y!*9 EPRh( F`;$X|ۋt$~G$`>G8tu #Py!w QWh `Kut$h VhrPL>8tMPLt$1 h3 V D$0L$4$PND$8FhVh(r W FtsSh.$PtPh/h$Tt*Mbi)QRh j $XNPSh* :$`$d $jj hQPjV~yjh8V V$`t$VhD$XMbi)QR$\Vh $|$|$|$|$|$|Vh $\uMc1whKL$!re $PPVt$h]11҉4hӀB9u tcQPt$h85= V*~S$h1h C1PQhS C uߍ_ j  rt$huVh&r@t$Xm;$Pt4tRPt$ht$USWV`p׉͋$tph S,$tS*bÃr t1C1|L$PVQF Ou vu hu Z$1hoVW貐 owt1$0 j2t Wb F29uut9vQgtcuDŽ$]DŽ$]\uDŽ$]DŽ$]@6wDŽ$]DŽ$] DŽ$]DŽ$],$1$]G1FwGw0GhhW蕑 Ƈ$L$hQh+rUQ9uhjhr U5`p^_[]WV1VFF FFFFF hiVhrQĘ^SWV։ϋ\$1D$$jh S tVjhS tBjhS t.jhS jhS u$D$D$hPhrW?hPhrW)= V*t?|$vtrPVhf |$u$4VhG ^_[$oWV:Uƿ)Ph W Vh W Vh W Vh@ W VhW W Vhz W Vh W Vh W Vh W Vh W Vh Wq Vh< Wb VhS WS Vh WD Vh W5 Vh W& Vh W Vh W Vh W Vh W Vh7 W VhV W Vhr W jVRhQ: t^Vhj螿WVPΉ1WPhPPj PQ u^_Vh Qj6t$ t$ t$ % tt$hljlUSWVӉύD$(jP 1t$`FFF FFD$h V\$DS|$DWwV~ D$(L$,D$L$D$0D$ ^NT$9ʉ|$ 'D$t$ 1dkdSQVP2D$HD$PD$P 5|$D$ fD$ l$ \$Tl$+D$Ty1Phj($PT$D$ +T$(+D$0хyL$XD$\D$\5D$XuT$hL$l+D$$D$ $߬$ݜ$ܼ$D$pt$t$$߬$ݜ$݄$T$xL$|l$xݜ$ܤ$|$D$ fD$l$\$Ll$\$L؉؉ع߉ljعųk؉D$Dډ kĉ\$@|Rh j$P> DŽ$ <\$D9r<^_[]USWV$`T$$<`$8`t$D$0hPh*rQ~ 0͉L$9r\$~HT$ |$ $1hWt$ 軄 u$8`01@$F`9uӃ<$T$ uU~\T$$$0$$<`hWt$ g u$8`D$1@$C`Mu΃<$t $`^_[]t$hj3fUSWV$,h;qtŋ$0h} qkt  Vh)h$ PӺW(yl$`t$Xt$T1ҋ\$މT$̓=V*uZ*MIрs6=V*uA}t']h?S\thSrSJuWH(Ņu{D$TƄ ML$XE|&hP$ Ph-h)CD$+hP$ S'6 ىV1 D$@W'$WĀPh'Wt $'h)jjhO$WtPhWs j)$W>PhWs =V*tVh)jjhNV*$WPhW*s 6WKTh)jjhBNV*3h)jjh!NV*ꍬ$U$PbGVV)1;$v7$5<P{3$P$$1Ehh)jjh|Ml$WK(_D$h)jUPv4L$`\$t$P\$l$LD$(1D$D$D$|$Hʋ9ˋxT$T$s5=V* ut%t$jQ(1Ƀ@N1^_USWVPl$ |$\$h?Syt jh|,Scl t ;/u f. Gf./WxSx9SWͩt͈JB/u/t@ux/u@?1$^7B1Oъt$t9P%PS%utH$P$WSt&($PUWS]&ƃ$u V bN4$1h^_[]VD$ 5) Z*H $s-t$$tHfHxt P2)1^USWV=V*thP)jjhBjj9#tvƃ=V*thP)jjhAZ*1GNIIˋ^s Z* tVfV(Z*ޅuZ*=Z*1WS"ơZ*Krk=V*tV$PhhP)螮 ~uV7dV'%V`v v" a*F$5 a*vu;Z*Z*K^_[]USWVPl$Z*M1t$"Džt.w w!ƅu hd9$$t$ Um!ƅt@t9uVШuN9tJ<$tW0cW&+=V*tW"PhhP)[ W_1l$$ttF9u t G9t$Qt$h%a*hh)<$WbWE&F~X|$<thsV_VCbV&vfFt$ t$ t$ hh)dEuFufFFV!|$WP`WV&N=V*1ۈ(a*$a*|NIL$a*h$a*o,a*ǀ$a*|NAMǀ(a*EFNDt$h%a*hhP)谫1N1@=V*1ۈ(a*$a*|NIL$a*$a*WMoǀ(a*FNDǀ$a*|INOW0o,a*ǀ$a*|NAMǀ(a*EFNDVdPt$h%a*hhP)C<$W`Wb$Pt$$t$$|$$W ƃu V\N1@=V*#~VPt$hh)~1t$h%a*h]a >W\Ut$$t$$|$$WX ƃ*VhVV%]1@KGufGfG1@=V*$ WbPt$h%a*hhP)躩Ut$$t$$|$$WƀH1@=V*ىV_bPWh%a*hD |$u V[v vY a*F$5 a*Ut$$t$$WDUt$$t$$W.PZN1@=V*t-ى,VaPWh%a*hhP)ɨ؃^_[]S1(a*$a*|NIL$a*t!h$a*tlǀ(a*APEǀ$a*|ONTt!h$a*Nlǀ(a*FNDǀ$a*|INOt(h$a*(lǀ$a*|NAMǀ(a*EFNDƀ,a*t(h$a*kǀ$a*|MODǀ(a*ECHGƀ,a*[SWV=V*thP)jjh L:Z*=Z*1VWftmxtg Z*W sJX tCf{u7=V*tSPh$hP)\ S\S [빃;=Z*Z*k5 a*tc~ tWuLfthBW Z=V*tWRPh$hP)ڦ Wy\W9 륋v$^_[SWV=V*thP)jj hZ9 a*tS a*1{ t$C$Su[SFuՅu5 a*th{VKYv$^_[USWV=,V*RV*utDhP)jj"h{8,thP)jjh_850V*t$G!jj#^ơ`V*;Z*dV*Z*,׋-0V*WV]Ɖ׋ dV*`V*9sAWV2ÅuWVhp\ SPhh)Q c렉1‰1 u`WVÅu h%\Cuh*SXCt SZcSSPCcQPWVhh)ɤ:K0V*9tPt$ ZU-0V*`V*;Z*dV*Z*^_[]USWV=V*thP)jjhB6fXV*jY9T jj\ʼnT$Z* Z*PQ\D$5dV*5`V*J\Ɖt$U9\ʼn$St$p\Él$9$\$dV* `V*9ˉs6fXV*j8DTk D$;`V*dV*rM\$ -0V*9sIdV*95`V*s9-0V*tS 0V*E9udV* `V*9\$ dV* `V*9ΉsZWVÅu hYSCPhh)ˢ cWV[ƉסdV* `V*911 uU9t$D$ rIWV<Åu h|YSPKAc9-0V*u*WVZƉ׋D$ $QPZʼn$t$ 6R\$ 5dV*5`V*fZƉ4$t$SZʼn$St$ ^_[]USWVjjtDƃ=V*thP)jjh[4FtVPXfvu݃=V*thP)jj hj3Z*=Z*1ҹ$RL$QtMƋhtDEt9VP|$ WF1ۀ~UiCSPW+W em븋L$$; Z*Z*r^_[]SWV=V*thP)jjhu3Z*=Z*rc11CWS5t:FfN~u %fFfthVYSvuȃ;Z*Z*r^_[USWV|$WtYƋl$|$UW9Åt 9t@tUWhV ~u,|$ t%hVRWhh)謟 1^_[]fUSWV`=V*thP)jjh15Z*5Z*5j薆USWV$ $=V*߉+ft`hjVS =̇*tfʼn$D$CjPl$UE, U^D$fD$|9r9114+=̇*tȉFffF= *t>t=̇*uFFF%)Fu9rV9=V*tJhP)jjh,F V*t(t$hP)jjha,F V*1V9vtRPhhP)跙 V*thP)j $ 9̓>t9߁^_[]áHa*tPjt$t$+uù)WVIAfF=Ta*|CXa*)f`a*5Da*jQh\a*^+u5Ta*F1\a*PVQ =Xa*FTa*^_ù)Qh \/\8u"h ha 5`V* dV*t\V*!=@t^USWV$$$ $jhWVd,\e*tE1M1 tmjWVS$8jWVS$8t$Sh)hVV[$ Pa*U Rh5Pa*DžtGh?P[tShh) 5Pa*DžtGhSrPw[tShh)谖 5Pa*[Nj5Pa*1jPP6M+^^$DOGrhPD$PhAh)B:hPt$V- $(j7V@ Pa*u D5Pa*Nj5Pa*j1PP6L+^^X^_[]SWV׉1jPP1L+FF9tX\$)yWhh)艕 %؉jQP6mL~tF hP6} F^_[USWV|$_ OtGhS7} GO9}vDty)9|n4 ȉG.uFhPY;-Z*Z*rv=V*tUhh)螔 \GP1=V*t:Phwh)o %1=V*th)jjh^&1^_[]USWVD$$PSD$x/@thQD1ƀ81Mbi)\e*H1ًP1 t Pa*P RVvW5Pa*At\G9uGSVPJ t5Pa*Džu*hD$P|tƀ8MbE^_[]USWVt$!M1 tFjhRW褟,\e*t(E1M1 tm`ƋU R^_[]ËD$0d| USWVX=V*thP)jj&h$,V* ߉^_[]USWV|$u h!>WKy*u`Ɖˋ-HV*U$ Džuh!z>-HV*)ًy*9w؉9vlj<y*|$y*WSZ}^_[]USWV։ϋ\$ t;=Z*Z*rVWh#= -t*u*QPVW莓{s LK$\=V*t%[$tC1K 1 uh#S9^_[]SWVt$f~thh!V9~u(~th{!Vg9~ th!VS9FN tkQPDžuh!V)99tt79uNH4~^ SW FtPh!V8.>WIy*y*y*F$5y*^_[ËAP 9ttЋR9uIHËIH h#Qt8Vt$V:Iy*y*^SWV|$t$Åuh!V,8;^ty^C Fs j/W讒GSHy* y*W WHFV86PdI1ɅF fN^_[USWVd=V*thP)jjh "=(V*td|$xhsWƅu0rH0#* Ph$h)( Wh%";t$ f Z*Z*1؉$ tr11GL$QT$Rt8Ƌ\$ ~GFSPj6,vuݡZ*$Z*؋L$T$9Ћ$s 1$ $11A|$1҉T$RL$ Qù l$CKIL$(KtIL$0KtIL$,K ɉtIL$4K$tIL$8t$ jj(WL[uZ*$5Z*L$T$9΋$D 1$T$|u*~L1\$t* tAD$t$ jjSGu*9|͋ Z* $5Z*T$|L$<q$Q AiPV*TV*QA Z*Z*QA@V*A$t$ Vjj(QgF @t3F0' PhR"h)ρ t$xh^"8VeKh^_[]USWV$=V*thP)jjh"e1PPUKj Džy0E0>' Ph%h)C Uh"88D$,PW#y0KE0& Ph"h) Uh"7$jS{ ƅu h#7SVW`i xD$j(PWLi y0D0& Ph{h)膀 Uh7#{7W/j,V*RrD$l$TV*=PV*,$1Չ1 9$h)jjhY#jj5Z*5Z*u*jP t*u h"6PjPh?HĨ^_[]fXV*D$L$ TV*PV*D$L$ Z*Z*=V*u t$(6t$pPh#S6D$ L$$ Z*Z*L$T$ u*<)t*؅~ڋt=V*tPWh6-hP)a =܇* *{*hQV **^_[]t@V* PUh6-k s-*hh *U p%0! Ph-h)&a jXUSWVEV*fXV*|V* xV*D$?SDžu#Sjj0SDPO/F^_[WV|$ th0WWNƃ=(V*uhV0x=V*t.u Ft#P7 *0~Ƌ=*j@WtAt0)_6Dju_t - Cu@**@jh>4QVPh*mǣ*VN @V* 9| $=|JjVhhWlOy($ $=|jVhh5*̋=*VPhhWO|$VWjj5*O1@VWPj5*N=*^_[]WhG4tjK8h3j,hh14j<,h4j0,SWV$$$Vh3hW=*S ^_[USWVӉ΋|$-*RPSUN( S9u ^_[]j\=*uXx3j*SWV t$t$4h3jV<jfƅ~'|$01ۍ)QP5*( ~9߉ ^_[jUSWV t$4|$8\$Wh3jS<-*SPSU\' WV5*L' 1BF ^_[]SWV Ӊύt$sKt$ tVWhf0 |$W2h01HFu*5* PVt(E u踠0 <$xVPh<j' SWUj3Phj (V)Ph(BV< Vjj(hNB55h.rh)}< uh)jj'hwB44h.rh)?< u1Fh)Vj0hBV3|$ujhU 5* u*h<j''SWV |$t$ >hZWut9h^!Wct'\$j SW? $ 9uy6h<U$~hZW t@h^!Wt.\$j SW D$ 9uyvh<j9&D$PhU5* u ^_[2h<j/&SWV |$t$ >hZW}t9h^!Wkt'\$j SWG $ 9uy6h<U$~hZW(t@h^!Wt.\$j SW D$ 9uyvh<jA%D$PhU5* u ^_[:h<j7%USWVh} $(1hWD$ P |$ |$ D$~P1ۈD$$,,jUh  tjUh= tG99ufD$u\$ tR$,4jVh\ EjVh=D 4jVh=, 5\$ D$7f@jh0uht$Vj P5*ED$^ރ9tD$j@h>P ߉tD$P]DaryDpriml$t?tD$P2D andfD D$PDgrowfDnt$VD defDectsDuVjhU>P  V5*5*5*5*hf>5Et2tR}jh>V H}j1h>V #}jIh>Vv t6Wh8 /5Sh!5UփOut$ hBJ^_[]1h=j!USWV}\$j S5* D$t"NuD$Hj@PjSPh4?ji!$j$Vjj5*F=tPhW?24D$D$ D$$fD$t$j VE 0wc 9 1L$81qAQQ a A j QV5*D$t$ *jh?E p  D$ @L$jhtjPjQ5*h?R3hP)D$t$H1D$`D$L'Ƅ$0VhQ`5* $j D$tPS  |$'y9D$(ȋL$;5|"@D$Ph?2hP)j 1D$$<JD$ D$ L$jhtjPjQ5*e^_[]ÄtH<t<u'5*h? 5*h?h) 4 P5*h?h)3h@1h?jE 0hu?`SWV$1FFJ\$WPS} FJjh'WSjV5* D$ t$bjPj!VD$($jPjAWD$8\$jPjSSWV5*5*5*5*h@1^_['USWV|$(Sj ƍD$ 1\$SWV $|$D$FD$ F\$j SD$44` L$9u8ȉDG9uډjh0ut$VjP5* VF ^_[]ËD$,4ha@j/Qh<@|$ u(1AAPh'PPjQ5*q $|$ u(1AAPh'PPjQ5*: $|$ujhQ 5*l uhz@jP|$~,D$ 0PQhQ5*( uXqh@jn|$ u,1AAAPh'PPjQ5* $*|$ u*1AAAPh'PPjQ5*O $|$ u,1AAAPh0uPPjQ5* $|$ u*1AAAPh0uPPjQ5* $}|$ u&1fAPh'PPjQ5* $HV |$(jVjj5*t Nʃ*uPh@-C tRPh@- *D$t VPh@- *|$ y QPh@s-,^USWV t$4}ty|$8hBSt:h]St,hsSthPSt '1̓uhwt1ۉjVjj5*7 f ?F$ȈFfFF PVQ5*Y 0^_[]Ã|$ u(1AA5Ph'PPjQ5*$uV(|$0D$40iб1ɉ $L$L$L$ L$L$fD$u$FFF FF vvVVffFfFD$HHf@ jh'jVj P5*D^SV|$$jVjj5*^*tB@t QPh.AB+ *y VPhYA%+ PhA+*|$ y QPhA*$^[ USWVt$,}ty|$0hBS`t:h]SNt,hsS<thPS*t '1@̓uhwtz1ۉjVjj5*f ?F$?ȈFF PVQ5*(^_[]USWVh耚 ƋD$(1|$|$ |$ D$D$~{ŋD$,ShAUtMShACt?Sh^!1t1jD$PSX L$9=r1D$G9uD$@@ jh0uhVj P5*ȉ$=r%ht$5*hA($<$r],$1D L Tl| D  PW5*hB(C9$uV聩 ^_[]ËD$,4hAjjhAD$Ph?P(VD$P H PpRQh%?( tVh.? (^hBK^VD$P H PpRQh%?' tVh.?'^hB^USWV$Gh4H6V$ VhBf' r[hCS'O yj hC;'O,@tPh%C 'O, tPh5C'GȅtPhWC&GȅtPPhjC& O W hVbVhC&GtPhC&$hVjWƅtVhCf&j |%t)$1@9}$݀f CfJfD$$eD$,G@D$$e%* D$0pu?t$*<$D$ Wt$<$D$OfCk ىШpu:|$t$*4$|$4$D$Xfكှk ] yBD$t$*4$шD$4$D$bf踈k sBD$t$*4$艈D$4$D$kfpk  sBD$t$*4$AD$4$D$sf(k  sBD$t$*4$D$4$D$}fk  sBD$t$*4$豇D$4$D$f蘇k  sBD$t$*4$iD$4$D$fPk  sBD$t$*4$!D$4$D$!k sBD$t$*4$نD$4$D$fk fyBD$t$*4$蒆D$4$D$fyk sBD$t$*4$JD$4$D$f1k }tQL$ D$h$D$D$ |$t$*4$|$D$hD$}4$̅D$0D$D$*$e GHtD$$e G(D$$e $ |$,u=Й*)t|ș*uteXu<$L$$T$ ș*u t GX@r9=*uD$*$ GXHw $r$D|.Gt u'UtVtR|$,ދxT$$\$ ,H L$t$D$,D$\$T$ D$D$*$*ƋG@T$$\$ tnuj1D$D$L$(L$ D$\$$~D$(u;ș* *Y=ܙ*LD$*$e3D$(M I"$a|$D$ D$D$$$p_8Й*ZG4D$hL$$T$ JL$0$ y LưD$81D$D$D$hD$ t$D$0D$D$$$}"4$1 D$8E8 D$h$x 1uG0D$$eD$,-1D$D$D$(D$ t$ht$D$ D$D$$$'}14$D$D$et$h\$(1D$D$\$ t$D$ D$D$$$|D$(D$4$D$*D$(1ɉL$L$D$ t$ht$D$ D$D$$$q|{4$D$D$$bw `1D$D$D$(D$ t$D$ D$D$$$|D$($D$*S1D$D$D$(D$ t$ht$D$ D$D$$${4$D$D$*c[iF D$|$D$ D$D$$D$ D$D$D$*$*V8 D$($>v t31D$D$\$ t$D$ D$D$$$z&A1Ax)$D$*D$fCD$ @D$0t$h1AD$h9k4$ ^G4D$TD$hD$PЉD$8D$4|$,T$<|$PO8D$4@L$DD$@D;tNI΃ ;t$8r\D$DL$@D(;FuK~1Ht0<$ u T$<1Ht |$t$ $菾T$a΀-% plj\$ Cut$BT$ҋ $A|$L1ɉQD$PS, D$ D$ 9K8Bd84\$ L$3 D$D$W|$h0SDha!Sv;hS`7ho#SJ3hnS4'hnSD$t$ |$Xr1ɉQD$PS+ D$D$ 9؋t$48+=8|$1ɉQD$PS- L$ 99։D$L$8z$Kt$1@D$BD$D$,D$D$D$D$D$t$L$ D$,Sh*4)hq 1<==ؙ* ڍt$81 D$ \$phjSh*PVT$Rd$1BD$L4JD4`L$p$QRSRPVo* *u1$P8w dQh*hGq' *1<=4 j=V9=ؙ* j=V蠌T$81 D$ t$ hjVh*PRWctCD$ T$x1BD$L4JZPD4L$p$j`QVRPD$LPn$h*hqD$49t 8Vhqk1JD$ $$QhpD=*D$t$=Й*$D$T$,$uWjjVD$,D$\$(VJGC@D$p9Vhqm0 Pt$h+q|$oQhp=*D$WSt$hnVD$>1ҸD$ |$\$ Cj"$P-h ÍD$pWVPSt$ $Pl\$ E $*jt$tS7 $*jWV# -X0 Ph*hq B* *$Ph*h!D$ $u1@t$2|$ Qh]o(11G|$1\$ tpupth|,QpD$ t$D$t1@L$ ɉtynPQ^Q|$t <8t1j t$ w 4$`St$hnFQt$h o7.|)})L$ L$ ف$K{8P|$W@D$ t@j QS7 D$ ;$|$8tQtUL$4 T$hjRh*QWt$D_ |)T$ gL$4D$ *1ɍAD$4tT8`T$ Q$QRQPWRjc* *T$J8wdPt$hprt$L$ $d$ r $3v $tu¸o#tnPQhjp|$D$u |$u |$TF1@]tynPt$hWn$D$8D$ D$pD$0 ߍD$'D$0L$&L$ 1BQhp莹0? Pt$hp|$L$lj% L$St$hn{D$$a!1ɉQD$PS$ L$ 9t 9St$ho,D$ D$ D$D$0L$0RPQt$,t$$P htBD$t{tPD$ |$*jVPM D$h|$tc81D$8|$*jVP D$p!1FD$&|$*VVP D$'*jVP UD$1=*D$44$vVt$h>o Phn=ԙ*he^_[]4$hEpًt$D$t$$t$S@9s Vt$ho S@D$t$|1ɉQD$PS T$tD$pD$ 9t8u8 St$h pQh'pɶ1ɉQD$PSI" ƋD$ 9t8t}St$hoSt$hnD$t$։D$jL$8`OGL$0d$ rxL$D$nT$!L$8mȃ_ D$(d$ r\1 t$L$M rmL$D$pL$t$XD$0$|$uD$t$D$($|$uD$t$D$p$|$uD$t$hm jj-ߖ Ph*hn h6nh qh\qh*hfSWVPD$t$|$L$ $QP679w‰˅x)ى^_[USWVd։ˉT$ 1BDB$x1DD$L$dj`PD$PQVSc1Ht$L$ltT$d;WuT$h;W(u Q^  ŃtD$ppPU  D$DGXHr Pn oXd^_[]USWV$|)*8*t */*Sh*9tW*މ)ˉESQ|$ W舧 DW*V V fǀ*/SUu*Uh* ,^_[]USWVhT$D$f8b1Ch*觲D$ CL$;rjt$VN ufD$jD$Pjh*V t%u]D$ D$uT$ L$13D$ tGD$C,u1e^_[]Í|$$j@WVP Wt$hf|$$j@WVP Wt$hfj WVPt$=x) mPhW ԙ*t5*Ph;m5x)D$$PV5x) *^_V΅tO躱Hw;s1ș* *te蔱0E Ph*hDmM Atʡș* *t"^0 Ph*h! u =ԙ*t^jUSWV=*ˋ}* * t u tthP)jVu}ti=*|}t j MO؃thD$VuP腤 t$UtuRh.{5)Rh bD$VuP/ tMD$PVhim D$VuP t+t$ t$ Vhpm]D$ s*P? D$L$ r!QPh rD$rIPhQPhuxt$hQ}u hym>j Ue^_[]Pho!USWVP=*u(ˋl$ D$$|$5* * t u^_[]ÅtthP)jt$W*}܅*| t j $^_[]uCuWt$h2z K4$~DN1ۅtPhDXt#=*uPhm99t*C뿃u,hym't+ORhrt51t ttt ttthl 9uЋkT ;$tl  1L$D$Sjh1 {t+1:LtPh m G,;{r܃TD$@TL$9uj VXW 1A ^_[]h*hl+USWV }=ԙ*t D$ tohmW蘜tc 1ɉt$QVW T$$9t8u8,Wuhm =ԙ*j11CL$ t$PSQVuuJtWt =*1=*u?=*u6L$1J1ыT$1 u#MUPj hm1ɅRaMUPjV tK=*u-=*u$1H3$3|$ uMUjj hmMUjjP e^_[]ÉSWVt)q~FDx@uAFX@ut9v)0Dr@tH^_[USWVPω11s6tUVhlSFUhSF t9VT 4$Euuh SƉ$t^_[]hlhljhlhlUSWV\։ύD$ jPj P^ 1u0D$F|fD$Y|Uh~mj D$ P$L$D$ L$/PhDj D$ P[ $fL )/LA .sD$ L<u\$ S5EjPj S踌 E9[|$ t D$ P EVhmd^_[]WVth΋u\~8tU~4~`N4F8 I9rP\S 1F0F4F8FXHr P=S FX^_USWVP\$**hܸ]t8t *ShEkP芘u *t$juĞ*VZ&3#=*Wg9rV$9vPx/uBhEkQu *=*tP]tPPh|X݉}<-,$t<+uuu;Mh9!W肗t,$kWN1,$4=*tt *hT\Ȟ*t8u%h9\Ȟ*t8u Ȟ*Uh\̞*t8u ̞*1=О*tjh}ƅ~;E3[kDžu;VW}jd}WP Mƃ=Ğ*u)}hu h2j=*t!=*u=*ujh)s莫1FVV=@*uh_5L)ߕu}}~:jhSdffQhjfN95@*^uKhܞ*؞*!Ѓt4**|ugeu4 ;jWV|$ WP@jPWP^_t$t$H tjhw8jD$ t u@USWVL$tWt$1|$tu a|{|<׀ǿs [|} @u9u\@u11H^_[]Vt$y5*5**j^0=*t=Ğ*t !jV:fUSWV,\$@9**tU5*q=,*u *,*U =S====,=Xf *G=%~O=~~===fJc21@=_ S=t|=f =tg=u|fp=%tY=Kuhf\KtMnuXfL=` tA=uDf 8f2f,f&f 1f ff ff f=4D$0*D$4*D$8*d$ D$D$fD$ 1D$D$5*o Pj5*| *,^_[]VPhht@j؃ t,1hVt(PU<*)$t$uǹ;!c~U<*t 5@*^heVtPmU@*ؾP˹*~ƅ@*ޡ<*yV> tP'U=l*t1H V!Y ^PL$$D*Aw$r⹜O1(uMfD* ]⹟4⹲( +⹢"⹥⹨⹫⹮"YÉ⹱ufD*D*WV׉t u1=l*u WVY ^_SWVh#U2r!tl*D$QPXV tl*tl*.Ubp*St*Dx*c!5|** &*k\y********~ *l*Q0 *t=4  t *[tlj=*=*t8=*u/¹h*x!W*=*u *1* u * s*t8u** +w!*=|*tt8u** *t8u**!Źģ*t 8t1@ ģ* 1ȣ* ȹ.!VWWhУ*ḥ* 0 u!V5У*5̣*hأ*hԣ*( V5У*5̣*h*hܣ*pV5У*5̣*h*h*Wtlj=*fmb*!m  tơģ*8t,<$1QQPW PW<$W褋@$hι}*^!  tơģ*8t2<$ <*IQjPW PW蒽<$W6@$ `S*entÉ*5 tƹw=x*u t‰h Ɖ5*>u 4*^_[É˹'*8wVt<0 1=l*u V>R ^V=*uh5<*5*P =*uh5<*5*P =*t!=<*|-1Fj F;5<*|hj5*P *^À=*uK=*uh5<*5*TP =*uh5<*5*2P *hj5*P h5<*5*O hj5*O hj5*O t$j5ģ*T hjPO á*8th5<*PO Ã=*u*8th5<*PbO j辷h5<*5*=O hj5*'O V=**t*hj0O 5*t4=|**t*hj0N V+$=|**t*hj0N ^SWVD$#) Éthj5ԣ*eN كthj5ܣ*Ɖ=N thj5*N thj5̣*M *^_[á*thj5У*M *thj5*M *thj5*M *thj5أ*{M *ËD$# )  *9uJVD$ T$5)! щ щ! ‰ 19^ËL$#) ȉ hj5*L SWVhҹKt'8t" *tIVs肆fG _GMCAPG_TERLESSVW耶 WrK[1Cj S7VGVPSP_GVheP^ *= *^_[USWVր9tMτtC1*#U5<*WK *1*U5<*VK ;*|ut$*^_[]ËD$*USWV׋t$$\$l$Et*u( t D$ L$M^_[]fUSWVPt$ P !уtRPtt jhjh}l$$|$\$ tStN9uE}㹜$u $ $уt19uE 9u~3M$ujhOt jhjh5蔴 ^_[]1ۅ IQRPRtfUSWV5*1H;(L$$9t%H1P3T$ u,;Hs D?D${9tG1ЋO3L$ D$D$~9tG#G=*t t̉)x9 }ph j 7 tP 1HGG7FGF8~FNOG Fx ~%,;Gs[D$ *~GO H O A$(L$O‰GGL$G_ x 9GD$ ӋL$t$ Ã!уt 9ÉT$1؋1 t?UjVSmt!ƒ?*D$Љ)\$tODЉ)mt$uST$G  )RQ9 ÅT$y,jhnFT$1OD1C=*u$ȉ)x~OSQP/ 5*_D$04=*|$ uL$Qh!jX1F=*uc5*hL$QP uCD$(3$*L$$3 * uD$3,*L$3 (* tD*t$ =*t$ 5*9>tOOHO*5*wx>GO H O AD$DHOG Hy x,G9r$(aD?jhc1He^_[]Vt$t=Љ)tjhy5Љ)^áȉ)xk=*uE *0#4u.*jh花Ot *tȉ)P: ȉ)*USWV*ˁփ߃|w t$11$9tQ1ڋq1 t! <$u,jh1@$qQ5ȉ)k 9D$}*럃^_[]USWV-*1|$(1Axt$$!уt9} 1@^Z $uL$1T$1 u/$$(),1^_[]Ƀ? *QL$ 9tZ1Ér34$ މtR;T$ uT$9։L$L9}l8*+*9WV*1t[t ] *40!уt RP1Gt *t^_WV1VVftH*9t:ʋz;yzy|ϋ9uOW($ǀ,1F^_S *1JЅt8=*u/u1u04 D[Ë *t$( ,1HV1N=*t9t/ *,wB$(1҉,Ɖ^USWV*tf,tI,^_[]o$(փ|6u/΃?ƃ~9t_1ˋo1 t 1H^_[]É$(늋D$x"  1@1H̉)V*u1I409t1JQQ 9uZ *401($, u1H40VVVl!ƒujh脪^1PPjt$gl!1á*40SV\$t$ 5*b*h8j- *@1I04@II Jut)1PPjVk!ƒt* *P5*a*u^[;SV5* tJ9tPQP PL3 dž @vv Hu5*بuF u躝 5*dž tV2 1*P5*`^[á*t1ÐVh jY hm=1.tDheS=$*hp>hy2=(*h^h=t8t nj3X 1Buh<ƅu&h<ƅuh<ƅt]hVCu6hV1u$h¿VuhǿV t1B!1 )TA ruƀ,*ƀ,*ƀ,*@=u1BSWV։ϋ\$t= *ttMO<^wDAut9t3<*u t)t#GjnPBujnWBtH߀?*uAGrdtku$stuu1@ 1)>^_[Ã= *@D$,*D$,*ËL$=r!= *tP5$*j h,*ĭ',*u ,*-*u,*ESC,*Ãw@,*uQhS\$uL*ESCw ,*ucSzt S5(*x\rTr(r rƀL*1؃@,*u^Ph]ƄM*y=1Jұ(L*@ـ?ɀJ*H L*L*S5$*j hL*nL*[ËL$x1@ÉʁtTʁt?ʁt*ʁt1@SWV|$1wZSst u s&@<(1J8uO!ʁt!|1Aʊu B9u1F^_[SVt$ P$rF? F? ^F? N? ^1N? F? N? ^? BN? F? N? F? ^? É^[WVD$L$ = *=w =w c=w@=w1~9?ʀ1~9?ʀ1~9 ?ʀ1~9?ʀ1~9$? r1^_USWVl$D$|$= *t'~3P&19wKS>~-19s2C,9r9v)CK$GFG0wG^_[á*thl*P*@USWV\$,= *tU|*tfفuG *Q**198h*v-|*1*1E0|***xQ1E|*=x*u x*' *1 )t01Ш%=txSN|*1p1PS3H$̅=**F~ P|*^_[]Ét$*5* \)yl*l*)É\)n1|$ l9} SWhl*N] uԉn ti vl*VW#=l*=l*J l*8ue:**tP$ *>D$Pii-l*E˨-l*E~U* *A ǃ*^_[]*}*U o*l*=l*v!x u2 x E! l*=l*w/*l*< tl*8 t** *t* l**l*8*l*=l*x u l*=l*ix t^ l*=l*Ix u>*l*< u l*8 t l*x**| 1GPفl*Tt$l*; u C9u)D$)D$AD$ l*11҉L$uW~%9sQt$VT$ ZT$ L$ tt 1:D$:D$u1Bt$ 1@ < u^11F9rۋt$**tP! -l*)EjU%* l*)QSP3 l*L$:)u)CS;tP>*U*! S>*L$l* *tC*Qh*/t~ ujh*Y0 jh*0 *l*;*v; l*;*w *tU uf5*Dl*=l*v@:)uh,+t * *w **uWV։hl*d 0r Hl*l*9r1I~G@ l*19r\)31^_USWVl*< w11l* 14֊YAڀЉ r l*11\$A$9.uD$PjQi ^_[]øl*á*t @@@ 1USWV|-ljPW#D$=h]W W |$|VhW jh W| VhW 1rcht t t@D$|.sea1ȋ$1 t5D$|.she1ȋL$ell1 t"|$|"u tD$}PUK )H)VhWF xVUh|^_[]WV|X) 0)8hsPמWh ~u1OPW@x#D$=uhW׊ h WV hWV )*h%WVٝ H)Vtg|^_WV։hP'tP&tO Ody tIHu9G tPh]Vg ?^_SWVl*8\$$jLL$ p*; @*}( $ l*PmD$p*l*8uKl*8tA\$$j|$ $ l*Pl*8ul*9v 95l*w^_[WVl*8L$jƋp* @*9}I9ul*xt,D$l*$p*V艏l*8t1t$j&<$P\D$l*8uՃ^_USWV։ϋl$S_PjW ?)߉ىUVWH ^_[]USWV5l*l*|$7l$ hl*jWq L$)ΉSUV D$ t$l*wɋ p**<9t*l*t$ @*)у|Z~V1\$l$hl*jS L$)ΉjUV |$@*+*t$9}l*wl*)Ɖ5t*5l* @t$D$ p*)5l* p*$H $~V^_[]USWVP׋\$ l$D$ $u#WƉ tCV^t0E+WZƉ t WttE1t^_[]Wuhl*jP WPDutWEt1@SWVp*;*~_|$l*hl*jhl*i l*)ˉVWS $H $~(p*+D$p*;*l*t*l*^_[SWV l*t*$ @*+ *|:1ۉ|$8tdj\$@*+*$9|΀8t2t$|$D$j|$D$$8u$l*)ȣt*5l* ^_[V5l*l*tOl*)Ɗ 0@u\) l*=l*l*"*=l* 1@^À=l*t5t*Al*\) l*b*1@ál*8t GUSWVPQp[$1;t5߉WjUr $)ډju $;u zމ^_[]SWVh:!t8ǀ8t1h_W[1tgh1$W[tUWLh 1t7ǀ8t0WZà jSxhGWhMSPa^_[á* ÃX)Phb腋WV=*t7*qtPtG*t t?u3 8*t#p8=*P' 1* ^_Qg^_S\$jjX ***[SWVt$VY<O9r+jjYX ***O^_[USWV ĭ*<*H@*e1-*-̭*-ȭ*-Э*9-*t[=*%=*]j܎ܭ*ح* u(9tu5*6@a=*t(:tu5*@0=@*u @*=*u%jth`贇 *J賗t hiU艇t>tj)Vm j:h=*eubÃ=*ene*~D.hiiSfYpto**.!CЃ jS dh*̭*ȭ**=*d\$D$D$D$L$QPƋD$t PuM=**+hCjjSpp}Fc $`5*hUL/t}7u D~H - $S *݃  K w$(=Э*u ?=*u) t =Э* *G90*=9*194*%=Э*SЭ* *ῃ45Э*u}5Э*q}*/t"V8UU!$@*=*1;ȭ*ĭ**hLjj\*=*d* ghyj5 @* 9hЧ K1PP1;ȭ*ĭ*̭*̭*ȭ*ĭ* =**=**%hM1PP;0*;* ;4* t u.SMi **%t"hmb4j5$%**=Э*90*d 9*X 94*ulK *ȃ*A!1Ƀ @=*=*71ĭ*þe=*%S D$1< *jD$PD$ Pw| Э*toD$D$t<{|Q<`ʃ=*tRT5 D$HL$@뼃_'-t"+1Ƀ)ȣ*b*V@ *H *S1ɃPh Q5Э*v 1;5ȭ*̭*|̭*ȭ*]VV 1;ȭ*̭* ̭*ȭ*|*訑1PP5*1;ȭ*̭*L5 ̭*ȭ*|*Y~=*u5ܭ*5ح*D>1PP5**L~ ̭*ȭ*1҉gQP?1;ȭ*̭*|̭*ȭ*ΐ<~5̭*5ȭ*>3 *hA1PPþe;0*e;*e;4*e e y&T}Sf9 2zjhx ̭*1d=ȭ*ejh5 =*  **j' e Ve^|\L$Qh=*jhj ̭*ȭ** ̭*ȭ**a1;ȭ*̭*|nȭ*̭*貎 |=*u5ܭ*5ح*;jj ŭ*1;ȭ*̭*|̭*ȭ*u M{{ȭ*1x 5ĭ*1,l{ ̭*?ȭ*Cȭ*1ɉ ̭*|̭*ȭ*1@POuGjhȭ*1ɉ ̭*|̭*ȭ*1@PMPe舦!Ѿe5*RP =]=*t*teV苎Wz;]1;ȭ*̭*|̭*ȭ*謌z=*ȭ*u' ̭*|5ܭ*5ح*9ȭ*1QQPEeM{y***hHe\*2hF1PP þe;0*e;*e;4*e e S[a1;ȭ*̭*|̭*ȭ*Wx=*ȭ*u' ̭*|5ܭ*5ح*/8ȭ*jjP1;ȭ*̭*|̭*ȭ*Sxjj͊;xD$ X)D$ Phb,ȭ*1ɉ ̭*|̭*ȭ*1@P.ejh4 ̭*ȭ*ʃ* ̭*ȭ* *)5ĭ*1;ȭ* ĭ*̭*|̭*ȭ*ω=wȭ*15ĭ*5e5*V/P]V1AD$ D$ Ph~iȭ*̭**Xv=*t5ܭ*5ح*6jj5ȭ*,0hȭ*̭*ۈ Ivjj5ȭ*- BShD$ D$ Phi6ȭ*1ɉ ̭*|̭*ȭ*1@Pe qt't v11A; ȭ*̭*| L$Qh}1ɉ ȭ*̭**Ou5*5ȭ*6Fȭ*1ɉ ̭*|̭*ȭ*1@P.e11A; ȭ*̭*| L$Qh4e5*\.h_P~FM=*tjhv*)hmb1V5$Ɇ7tV5̞*~VPGW,1̭*ȭ*15*QP6jh$*ve* @*ȭ* ̭**9‰}ȭ*5̭*)‰*.* @*ȭ* ̭**D*fVz+XjhDjðD$uj贰P諰USWVP茅躻r 3cD$1Ƀɉlj щ ***=*uH9ljD$u21,UUj( 9-*u;=**D$t̺*: *2t8teue^_[]USWVPӉơĭ*1 r4$0utV4$#ĭ*ĭ*1ESWP áĭ* ĭ*tw1FxOtEu jj^u.SW5ĭ*蝇 áĭ* ĭ*u!~jhst 4$4$^_[]V较,qSơ*"  t]>!t *t P V*=*n*OhPNF<+t< t *t Q V1*$~a%/73ĭ*ĭ*PVߐtD =*V#^j#tw$F5ȭ*jlȭ*^=*u*VPTjhq]5*V5*5Э*fЭ*9N5ȭ*jQPT*hh R^Ë ĭ*t s7*ĭ*shĭ* shĭ* shkĭ*thUĭ* sh=ĭ*~ t sQj5WV`wt ܞ*؞*!ʃtT5*QPD*tP5*=***u -..x/5*=*1jPPk0 ^_SWV*߾!t_*/膶4VJ=*u V8@t h%t umbЧ P1PP^_[fD$= *t@WV|$ Wj$ƅ~WhVL2 ^_USWV |$,l$$t7 U>Ɖ,$D$ D$0D$ ÉL$VjD$P NjD$0tEu@D$;D$ v6H|$ D$9Hu߃tD$0t:%u.$@$9|$ seH $P7tO$9rFD$0tW" t WO WD$Pp|$(|$ t +l$$)D$(,\$؋L$9wȋ,$9L$0t9|$,v x uH|$,t+D$  ^_[]fWV*`)hyjhEm*$)h}yjhem1F1Vh W Vh*h Wh?h7 ^_ËT$*t$xjhE(mUSWVt$$1Ӊj j D$|$ $3D$,$E< u>EP被utP;9~tGCGu뻄u C9w EC뤍E}x X8u;\$r$T$BD$BL$ 11H^_[]ËT$*t$xjhe lËT$ *t$USWVzYqD$9sNՊe8uu9Etkkt ]}u}gtJCKCC<ty {[uCE9r u#CCtjh-Brƹ*VyjhEiHV U] 1O^_[]4$ |t|u۹*S1yjhEh빃xu1WV|$D$t P\uD$tPPPƅt)WVy0PhGhVA ^_USWV\$,$1F90*9*94*1Et$tcÈ\<D< *PotΉƒddrT$0uAruuu-dt($t>P3w߻drΉtD,PAMމ^_[]ÐUSWVt$ \$Z D$P5V֡ʼnP5D$X9vpG$11Ʌu2~>9sWt$V( t't1:)1F9r':)u 1A4$1@1< uD$XЃ^_[]WV|$t$ tW05V19sIȀx@t9r1^_ËL$T$t 19 s(IJAyIt19vAyt9щw@ËD$t5*P1PUSWV]19*˵*tbjPn=*tM迼tWVW[=*]u"jW1SP袟ƍD$L$PQV t$tƉD$V|D$ |$Pt=*jWM *D$*D$*Qjh؞*5*=*St$:|$t$ ue*t=Ğ*t PD$ PV_u&D$,L$0 $* *D$ L$$ ,*(**t P7V 5*a*=Ğ*t?vi=uW5 6u=T*~D$8PhcW 1e^_[]h_V*3hV3hV2VD$t$Vh(c6! \$D$tt$SP V uVt$ S 9W01F$*D$D$D$jt$QV D$xi1C=*u"nt$G ZD$L$Phad߃Y6t$V \$S3^t$Vha6 j&UV=*Vh#FtV5*%H 5*t65*5*PV( 5*Z *1*,*(*$* *e^]USWV$t$8*D$tjP * $|$VWD$ w1t$D$ t U/9Hŀ}mt9Ur D$PD$Pc\$|$1؅t VN/9sGHƀ~vt9s75*V-Pyu|$u5*D$t$! t$;t$t<5*V;*t*4$T5*VP(1F1$t jP$^_[]*1B1j3*1B1jËT$ *jUSWV׉ˋt$~SSŅ Sett O*t1@^_[]1T$ *jWV1|$ VUtPf9uV1@^_á*tjP*1ËD$t jPoSWV\$t jSXSSSt,t1jtt1ju^_[j~V*tjP5*14Vf^V5* u5*h_P^1Vh*]V_t P[`[WVĴt$jPFQ Ox&PR =*u0PhT_ǃ`~n$at6du(At'DOuWotRqjhj VP ȉ)1jQQP!¡ȉ)u(P~Q ȉ)hVWȉ)y0Ph\V ^_jЗUSWVP\$SA+@jPŊ:),$u/CtwK,$:)u 8CudىˈEEACuOhtV*NJt&,$~WVS  uEECCuE$^_[]htUSWV\$$hatUR*D$l$ k1BD$$׉:)tL$:)tʉT$|$t $tD$t $GEEu<$l$ tM1|$S)ƃjV}) )QSPhVW[bE1GjWKNJt*C,tUV[t$CFCu^_[]Sˋ 0*uhkyt 0*PQ1Ʌ[USWVh1À8S(t$(,jUf tVt$hShqR!UPZaV1jPtM x PGN  V 1W} ^_[]USWV|$1tXȃ%t#u@9v8Ct78Ct3<#t1 *<%u *tQP'FCCuFjV褓Ɗtfȃ%t#uJ9v8EtA8Et?<#t1 *<%u *t Q&PSYSs'CEEu^_[]SWV1=*up\$S?'ǃjWShWP_V PVP'u W 1S V ^_[SWV$Vg1ۅSSSV!ƒ|$hWVIK <$~b<1WjS芵 =*u-u WjSh 9<$sP uP9<$r11ۃÉ؁^_[USWV t$ ƃ=*Vht9_tP5yD$\$htǀ8uWz%Vo%ŋ 0*uhkQyt 0*4$Q9% )˃jS) )l$UQPWh SV]U =0*uhkytlj=0*t%GV$Qh!P" GuV$4$hkQ ZV t1U%>tt$p $Vb 4$\$SR  ^_[]USWVh\dtyƀ8trSzteV#W#,jU蚏WhhVhUP\W h]S S h]S ^_[]USWVPνdjjd1ljËFHN~ H V+*ƒtS tN)M9|>,$jUߎWPSUW& U"ڃ,$C^_[]USWVP1=*=* jȣhƋl$11@L|uK@-u)Fh_U4#)މ |jh)hSV1"U&",jUt$VUPZW tCtK~u1OD$jPWF uDD$PעD$ 0_Q1^_[]ÉV] 1;t݉VG 1rDžuËD$ 1OL$9PVj%Q+1txsu@Fj%P^USWV=*D$t P hCƉ| hMQfl$V t$ U ÃjS^Ut$VSPLYYW t V- ^_[]WV|$ƉWPv#O@ V> |^_WV|$ƃ=*t]PV1=*#D$=tuV*jPqVPQh)5V0tVxjP:VPQh)WPP  VLVf |^_V|$PVx D$XT$\1jPPV|^øhVt$V9vHx/uAΉ^fSWV1ۃ=*t^_[!ƒtjT!Ѓt111 1CSWV1=*uJ΢!ƒt>j[T!Ѓt譢11 uj9T^_[Ã=8*t8*]USWV\$,=8*t8*9|$$t$ D$(D$l$<* $t9 *Hx 9}9=*t19-11 t DTWVS1@D$j`S11 u 1UtH TWVS=*t謔ӓ1@D$1@D$=<*u hL$l$01ۅ~1tΉYWV!ЃtB|$ujR!ƒ1PPTu1@PPTtm1OWVRC<$uK=*<*u)!u =*u=@*u8*=D*t J@*9\$'"<*HPj+T1Ozt <$t> =*t<*jK- ^_[]USWVP=8*t8* \$1=4*u!*y=*t <*'D$9||$(9<* ˆT$~_|$ t$1WV=Ɖ!Ѓu|$$t'WVQE|$u赑ƑzI9ut|$tC %=*t=*u 襑jG,^_[]USWVP\$ l$D$$DtW=*uN!ƒtBj}P!ЃtϞ11 u 轢uj%j;P!уtjSURPt$^_[]Åt<*HPj+Rt`=*tBQ1u11GVOVWRPWjO!уt녃=*t^_[]ʐ1Hf^_[]ӐjUSWVP\$ l$D$$jgOƉ!ЃtSUWVt$^_[]Åtj9O uك=*t ^_[]H^_[][1=4*tá*y=*t <*ø'Vt$thV1F95*u#1=()tu1Ɂ()tщ *AF=()tH H*v ^ ^ËD$()t 1()tËD$()tI1()tËD$()tQ1()tЅtË 1()táH*SWV|$5()()tvWt6ui\$j(j蒃W[F1HF FF1FF ()t؋Fq0@@F=()t@H*^_[ËD$t@1ËD$@ËD$L$QP$IH PËD$L$Q$PQI HËD$@ËD$@ËD$L$AËD$@ËD$@ ËD$L$A fUSWV\$(t$$!؃=*t f *t-P*@1҃=*JRQPSV9cSV@*$.vt t*t  U SW SW莘|$9\$$}Zl$|$t$ *ÚWUP ~ sN)݃t$ 9$|p xl*|$l$Wƃ  $ t t;t6$RPV <*tƙƅ~o=*uf=*u]C=*u=*蒙)މӃ19*蠙 tudƉ*1@1@jPUWX=*t)!jjRPUW6Xt j*=*t(<$t" t u*t1Nڃ^_[]Ãt-^_[]骘USWV\$4t$0t$ ޸\$=*t c *t:P* @1T$ )ʋt$|Љjt$t$QPE`|$ \$SW=*tK3.ql t u+] t u*tcZ*H%t u蟗ƉՃ 莗ƉUVK \$|$UVt$,$SVt$p*ǃ t(RPW .;t$ D$|R,~=*uv=*umG=*uUǃ=*JG.ON1t$|$,$jPUWkU%*1@1Nڃ^_[]Ã=*tjjt$t$$UWaUtj*SWV|$t$!t,WVӓuV$ t tu81N5)=)H@ws5)=ĉ)^_[fUSWV耔tjhBv(GrƉRP!Ӌ <*Itt .L$ 9)E>GPuՋL$;L$|L9^B`*  (\*( ED$$ d*ĉߋd* |$߉9}\* `*8(9G)E9uD$)h*-d*l*^_[]ËL$1wQ5T*1SVt$ 1ۃw)V5T*`uV5X*M1ۅÉ^[USWV }*t)15*5*5t1C}*|$t$T$= u[=*uR=x*~0Ӌ* *ڍX*x*T}*5*=*1;= *x*сue *ӍQ**19h*-"h*艑*5*5*$ Ӌ* *ډ@*x*u$**xq1WVál*;*}4 @*9h*~ \*d* *)X= *t*1@tÉ^_[]ÉШu-tU豏x*=*5*Z* *ã*x*5USWV׋l$uF* d* *9~9 h*~=`*D:0ˡp*~M1; *p*\*d*PǏ`* d* 9uW_uh~1ydSu&\*d*PvSP跒5t*)_uփ \*ωփ 1Ƀ_ ΃ uW=*sih*l*+* P)P*|T9}P1J;T*} yɉы,X*)8 * -T))Й)չ jlj4$V{# *#*#5*#*H1G;@*hEt$$ t$ VhC ?M2t0%1t$ Ujt* \*\$QjSw Ƌ h*1E=d**19~c9~_ `*D0uRL$\*)щ d*PjS* ǡ`* d*W^ h*) h*~p*Yֻ_P苊t:*tu%u 1ˉt$  *=*SXS蠊Ë-h*P6Nj) j$5)x# *#*#5*#*<$H1G;@*Lt$t@CȺ t$ Vj u&Cuىt$ UWt t1G1^_[]p*{SWV=*~%։1*Vu C;*|1*)^_[Ã=x*~* *x*1SWV=x*~* *{x*t$ }*t uu15*5* *+ l*~_=*uGjm5T*bt3d* \*`*³19:Gud*h*;@*|a=p*tXt*uD=*t;\* d*tX|$tQ `*1ۈ Dq5d*\  \* d* `* A d*1ۈ ^_[Ë`*D$ \*`*@ËD$L$=|*u=*tt'I1҉ t1Ë`* \*~|*l*USWVL$D$!ʃtcQPy~1H…uSˀtDËt$ l$1t= t8*u/P*H9| 'u:\*8G膀1H^_[]F \*9tMt>(USWVL$D$ʃQP}1H…t$=P*\*D8OD tq*uf~\*A-P*ZuC\* (I=P*9rލPIJ9s=P*t$)\8Oà uRL$ t \*t=P*91H^_[]11USWV$P:ǡh*D$WDË) j5)t# *#*#5*#*\$H1C;@*/t'l$G4$Ⱥ UVj u Gu1ۉ؃^_[]SWV|$ *u W載1҅ƒ։˅t&v!S1҅SW؉1҃P1҅S`d*~q `*DVPruX`* d*DPr# *#*#=*#*‰Vnrt"d*t& `*DVPrt 1J^_[V2r# *#*#5*#*USWV L$Ӌt$(|$$Ѓtt*UjQPVW;t.t)* *!ƒt9} =*5*@=*ut\* d*$~BPjV蒆 [Pt \*9$w̃=*tD$%u 16\* d* $PjU% L$Pfǃ=*tV5h*Sp# *#*ʉ# *#*;@*Et$ |$tPlj D$$1Gd* P*9|t1@=~-\*`* d*Gފ]E AO d*D$h*1 ^_[]Ë|$wW5T*u WZt 1 \*d*ȉ$QjVՄ $ \*)v %u݉d*USWV-P*1GWS7 W\$S' ÅtUtQ\*$UPV =`*UWS W_ 4$T 5\*`*D$P*1t S. t V! ^_[]ø*H ȁp*r1p****** * *******USWVL$0D$,l$$*$**t-9Br }$r1z3|$( H*u$$r*t :=***<$:rBJ jl$(jW*tC:*t9t$ wt$jl$l$t$+ut$ l$} zt$rt$ u <$?*t_ )ϋ,$]}*t*tV+BJ NF=*uW-*MEu$9ˉ|-*],$ϋ=*t sKӋ$JHJ^_[]USWV1=*tDt$(T$$!t3|0**=*t'9PH }=*u11CŋE1ЋM 1 u ]}*EP$H u0\$$)ӉT$ ʋ}E |$+|$$D$9‹T$ QRt1ۿR*<$OWG ;D$$ $1PPWU*!уʼnڃ $;l$$t$t$ s1ۿ*}]Mm 9L$$1PPUQ*uG!уtw$} $뽉 $WUQR9l$$)Ë$A=*u D*1ۉ*Sh!UQWS711؉^_[]á*xCH *d|5* *9|jhv#*USWV|$ l$1Ƀ**tKC9⻸**1 *1 5*v v[r1IʅI~nVv 4$9ʼn1I1PPt$R* ʼn$!Ѓ;l$D$ |l$|$ 11 u KS S$+rt$$r)9L$Ƌ4$'s sq1Iʅut{kSs 4$9}F11IVVt$Rb*uF$!уt>ƒ9l$D$ |<4$VRWUȃ^_[]ÉىUSWVP|$Wh$ÉrƉ$!u1x-9=<*~%GW8$É!Ѓu O;=<*|܄u<$<$US111 )ȃ^_[]USWV t$ >-uF(}ehmbIV@hN^3 D$1ScSqZS@S SL Sh$^ y W h\d?À8t>tkVtmSʼnD$$U $ȃ$jPXt$PSht$U%t$  S`XŅu>tVhskEXU&! U蹧 jc W WQ 1FV>VDYD$$t*Ph8j faD*t$衾jy>^_[]USWVt$t!Ѓt61U!!ѻtՉj!|$.u RPUS 1H19}!ЃL$tWVRPWVt$(1HPPUSQ^_[]USWVP|$ l$WUmtjhu1N\$hsS bhmbShN^La1SWSz=jj ƿ1KD$$#D$($<$t9l$$T$(ʼn|V|otIËFHN~ ;F~à tQuVS)jh1KtL tGot=ËFHN~ ;F~à tQu VSc)V 1Vj ۾1GWw<WV_=D*V6<^_[]Ð1I8*4*uËL$ 1ɅÃ-$t* *'uIÃ.t/^u>1ɉ 8* 4*0*ultPjhh4*!0*RAr AwXى*#*t6*m8*4*0* <*I <* * 0*jh&jh31WV D$pr Hw=ىƉW G*O**** jh3w^_UVpu:V #Ft%D$,*$L$ (*$** *e^]SWVL$bte *= *u1(*#$*u *1҉(*$**,*xpX 9t Ru SWV ^_[ËL$t;*tjh 1HËAQøL$1J90*u 8*4*uÐV=*tjhG0\t$D$tt'uC5*;?ou7=ȉ)x@jh}뽃=ȉ)x%*Qh^jhijhVRP|*P ^*h*=VD$$L$ t tC8.@L$$Vh' Q X)>jhX)PhVi V||P|0tB D$0PhXD$$Vh' Px >tKjh5x9<*C‰**L$Qhw^ã*X)X)x<*C‰*VD$$L$ t tC8.@L$$VhQG \)>jh*\)PhV V||P|0tB D$0PhtXD$$VhP( >tKjhB5x9@*C‰**L$QhX'^ã*\)\)x@*C‰*V|$u%t$jVt0Ph^SWVD$L$t uw@*p=*tjhVPHOPj8蝵?t V轵)=!ЃtV莵5*SWc ^_[ÃD$L$ t tt0PNPȼL)L)QhÃ|$tËD$D*P=*uḧWVD$t t0t$`*l7=tDMtGhuXF)P*`*Qh?Emtwt su!FF)Fh*Fd*F )7 VuM^_D$u5*egÃ|$L&ËD$Ht*hhX)hhhhhhNhhjyMWVD$PtN$T1FPLր1ɀ w1ҍ JЊP@րЀ r; P*~ T*FP{L8,u @|5P)P*+L*T)D$ps D$ stopD$Tab =P)|i1Gt$rVfD,V4T*hPk G;=P)|VD andD theDen t$V5T)hP 0PhD^_à D$t t+uyL$tJQtQytWjhnà)L$)AAD$Ph2B%1)))) )) ËD$Hsjh<Åu О*Ë *1<*t$iPhhH* H*USWV|$,1 P*t&AWjQD$D$1}|$,؍C\$Hl$,zl$D$ t^E<D$D$ PVD$ P Ë|$|$,t$tb< t^<=wtCt G|$,7SohPhhH* H*CD$SÅD$CHl$C D$R1Ʌ3C D$;1ɃD$1҃|$D$ɉ?jUD$4P < t7u@ n=*nzxx tT$sUD$,D*j+*gPhH*S贵 T$jSfD$,|$?+ulGPG*?-u]l$,l$D$ ‰ЋKC|$tWjЃt Wߖ l$,Ex\WۉȀ+u }|$,E+D$H.rD$,jhT*P: P*IP*^_[]Él$|$ u D$Phw D$Ph> ͉P*ōD$(PhMuA0hj*hT*ËI1Phj*hT*SWV9toӉQ@jPlFljtG\$=*t <\u ~t F <$t)\tPSLt GFFuD$QhY 1^_[USWVt$(t2\$4L$0݃㿃u4F@tbD$T*PhT*PhNSWVt$6 C1ۀ-txT$ ,< v t9K1ݍCЊoGЀ r>t-u!D$tQh1H^_[USWVt$$|$7oB€Ѐ vty11PЊDCĀЀ rCكrCgfffKt1)r@ҍHut%D$ tQh1JЃ^_[]á*1A=*tÐWVh蓛t8t *=`)t*h)1FtNFtWWV ~v$u^_SV`)1t+T$ `)9tAt9t Y$$u^[USWVL$0=`)D$,(`)D$D$ D$D$$D$x1P7U@ ~Drb<-t^|$u;t$u1@D$ D$D$6;t$D$~,7O19ƋD$L$D$ $|$t$@t1@`LD$x$@$4|$ t1L$4t?71u**l$D$,(L$0t D$t $1ҋ$^_[]fUSWVh *菘 t-1@*A AAPQjk ^_[]Ët$,|$(l$$1K9@*VWU =*ut1 D*A D*}?@*yL8t B8#uh * tOmjI?jh *ݗ UVV軥e^]USWV\$0蔴 SVv,jU5>VShfUP" ^_[]Um m|$D$ fD$l$|$l$D$]UiM'QmtLE ML$D$l$T$L$5<$$ fD$l$|$,$D$T$ 11҉]fSWVP*t D*Z1H*WPt>1C4$J$H*u=K VeWSCuI^_[V5)L*t41@=*VhL*P 9t D*)L*^S=L*tL*]H\$)=K*r )H )P*[Vt$tFPFu^USWV\$0l$,11Í|$Gjj SU4)0 O9ىʼnrǃ|$0xG-Wt$88 ^_[]USWV\$0l$,11Í|$Gjj SUY4)0 O9ىʼnrǃ|$0xG-Wt$8 ^_[]USWV\$$41ƍ|$Ggfff)0 Ow؅xG-Wt$,V^_[]g,Hw @sÃtPuSWVt$|$T*=*t4=Ğ*t+=*u胰|GDFjF*=*t{=Ğ*trư PGu(G*+Hw @rt PEtDE;@*| D*^_[j '^_[USWV։1%uGGdtPnt{su,$.E1PDCu,$GPE뜍D$P6D$tJ\$PCu1D$Pv6Y D$t\$PXCuD$P Ń$,$^_[]WVt$ |$EDj E.PFuEL*^_WVt$|$ =*t=Ğ*t%D)ƃ=*t(=Ğ*t*C=@* D*+ j g^_USWV\$l$=*u1U 1GWP芍PW71WPPUV词1 rbjj71=*PVW{ ÅtWӆ jhL$t P/L$ 99t V蘆 ^_[]Vt$t PQ/^1|$USWV0]$u} r>1} L$PQjWu L$U |$ >uu Ņ7T$ U L$ډT$ND$Hl$T$:uL|$tA;|$ t7t$u 1l>9_:l:u 9t9|$u+\$׋t$l$uGL$N;|$ r11Et8Mt]$ 4 e^_[]fL$tt"u$ <*<*HI <*IX*ʋTUSWVD$T$ <*5X*|1Gll\G9uTD^_[]SWVD$L$5<*X*|F|\\|N B^_[á<*~Ph5X*1 USWV<*;\* X*t/1~21B1O\t!u 4FBu11K11KՉQ <*jPu4ƣX*<*\*~PhV莼 !t\|^_[]USWVL$X*1H; t$z|#=<*|O1;Ll |C9u^_[]USWV <*~.X*11F1l9޻r G9u1@^_[]USWVL$T$9~1@+5X*A1G1֋l9߻rB9u^_[]USWVD$ <*~-X*1C|l!u4FCu1M 1OX8h^_[]ËT$ <*!Ѕ1@9|IHh2`*=* tѷP2d*hY2h*hu2)h<c2)hQ2 )USWV l$4l*l*E C\$ ȃ9~:5?t.\uEE%tf. D$ D$ ^ uE$ŃO $F$*uE$ŋ $Fw$,!FwW$J!уjSRP2UBtDt LA=*4I!1T#!PQ ~IуRP1 1=l*l*Et1=*5*Uh_Pw`=!0!&!uV*B!ƒt:Hظ u5*ԫ1u mŊEES5*Qу <*IjQRP^/5*c \ #Q4 bm4 腫ƉG!уRPWVvl*=l*H8 l*H=l*wA5*衪P衫\G n!уRPٹ <*IVQRPL] Ȟ*M5*#P芣/Fփr-RPgٹ}SRPT ~ QD$ tMoF׉r4WPٹ}RPVt$SPg~  詩1c5*@SP#:uȃu&\u܅tȃ.u ȃ?uBÉJu^j5)V5*1=*tȉHt)`* @***уQ0q*^á@* * *ȃP5 )>SWVQӿNjl*عl*9r Ѝl*WVS+ ;l*;^_[VQ!уu$x <*H9}FVk!уtt^C^1p*t*x*|***USWVPt$=8*to=*te=ȣ*tl<$=<*|F1U!Ѝ]t#SWVU57<*H9|5<$u*=*^_[]USWV ))D$L$!ȃĉ)D$)D$ 1H)ĉ)))=ȣ*=8*tt=<*$1S!ЍktJU;t$ L$}3!уt 9D$D$}WVS4&1@$<*H9|<$t ^_[]c4^_[]Ã^_[]ͭy*u"5p*tjhxÃ=t*t1=**jWVt$ t8P>x u1H****^_V$)t0Px u$)1H****^V8)t0Pw u8)1H****^USWVD1u- 8)t#T$|$1FY1i1 t u^_[]USWVD$(tL$ T$\$=*uA5)-)!t,;)D$ĉ)}׉ʉ!1@tp9։щ|f-$)1tZ׉։!;] L$M}tM9}| mu.L$(t=*t|$$=*^_[]Ã=*t*t*t Pjv t*hp*á****=*& USWVU utO:tJp*VQ=*t$1W=*=*u @y*u5p*4u U=t*uLj5MwVp*S=*u=*uF 35x* r*uj*u=*t* *utS1>!14==jh3jh1N*tu#؃؃r؃D$ *D$PP!|$u1QQRP!uu=OW!u G;=<*W!Gt|$W1NjWVuSVVEtƃ=*u7)1u5*t$t$ѩ 1=*u j*e^_[] rjhRUSWVP։ϋ\$tWSV y1OGt P+s Gt"V@Pj#GVP"_4$V÷1~.Ɖ1CVjUF P聗 u94$r1ۅ11ۉ* *uʄuʉ*^_[]USWV0։1D$(D$$RQS*t 1H0^_[]É|$t$D$T$ t$H|$Dl$TD$PD$\$T$!t 9D$Ll$T$ $u'D$ PD$0PRSDƉ1Ot$T$%1D$ PD$0PRSlD$T$1@ދT$ЋL$  D$ t|$ T$Ћ|$!L$=*t&)؉1=rWRt$(t$(1 $)D$_>u?8)t6H1P1 t*\$t$H|$Dl$ **ut 1҃1҅…ut=*|$u$Rt$vPj,!Sv4$D$PL$ Qt$8|$Wv\$L|$*u5|*ue =*tZ5*jD$,PD$4Pt$t$5*5|* t(jj hpxL$H 8)y*u5p*CuO =t*tDSjD$,PD$4Pt$t$5t*5p* tuHD$HD$t$H|$Dl$\$4$Go S>o *t$$t$,\$ St$t$t$H|$Dl$뫋L$\ɋD$QD$\t L$HD$k=*|$u"t$$t$,Wt$t$w4$n Wn D$Xt0h1USWV0=***5*y*D$u5p*uC =t*t8\$|$t$} E}xRtU1ۋuE} SSWP誶Nu7;*5|*S1HljD$]* *ȉ$!Ѓtp؋u!94$ƄuW*5*;uT$U |?Ut$ [9ދD$Љȋ$uMP*@U4 C؋u! P* Iƃtȉ։u4$t$ ] \$\$!уt$! 9Ɖʉu߉!T$t$ t9Ή| L$D$`#x*ˉt$ V1VuVPWS|$xM*5*!ЃËL$ D$$9uD$$t$*5* **e^_[]Ã=*1H‹u9΋]  $}B P* IL$L$+t$4$˹|ً4$t$ 4$L$L$L$ $Vt$t>t|*t$ &*t Pbk *h|*D*^k81u+*u5|* =*UWVW-7!t"jjRPWVZjde^_]USWVΉ6tz;~z~}9t"zJh X,$9|ً<$zJJ jt"~^|$9$|L$,$jJ z9J} 2 R+j ^_[]USWV T$ $|$@GT$D;D$4L$8L$ $L$L$L$1A)L$D$ T$D$4)ʼn)jjXËD$<$ST$<L$K9}rL$,9|$H9 uuND$L$C K$)T$<9}'jjT$DË$L$CKrE뛋t$DD$ 9w ;D$tF@ƋD$)5x*jL$LQL$LQPV5t*5p*s t|$@T$Dt$ ^_[]fh4jp *=@*V|$t1hjDhj5h4j&j%1VjVj jjVj^C$hj݁ *=@* hj蹁 *=@*USWV**ty1FVWq&$"a1UOUWMUW>fWP hW!V!5D*tF=@*5<*<*9=@*u9t$H@*D*t =*u^_[]j2fP)=P)tPQP Pf 1***WV=L)hdW7t|hjW tRhqWtGhwWt< t@t<*L$T$B1Ojh@1N^_[]Ë|$ Wt$V  *QA VL$~4*A1t2P)t5**F1I1^VL$~5*A1trP)t5* *F1I1^á*á*á*t pwn1@USWV׉1EUjS@UPFSPUD$F~ |$D$Ft$W@jPFWPF^_[]fjh$ x *VPt$jV5* tx#L$uD$u^jSWV*$D$=0*y VjwVjvh*Mg tW1FVjvVjvhSN*k)=*TP L\)t%5*\)PVTt Oȅu*4 =*$8@h]5*Iƍ|$PhW F<$$h~!P0u$$8 E$H $5x)W蟡$$hPA0u$8  $ $9t $9,t $9 t$ $9t $Q$ *5*PQ*D$V$8tq$ $9t $9,t$ $9t $Q$ *5*PQ*utD$5*hE|V藥|$t*P |$tXPQVlbAV\1VL=*1t*WaPWS. ^_[V1FVt$ )tVh*d =*t&|$t*`f=)t h{/fV$X)J X);h)у  P)QP)jPh*h+ t^h*hhPn L*x;hVh* t9h*_hP)Q|h*hH5)5L*V cUSWV$$$ $FhPW-t܍D$PA t$4$h#hV_7 Dž"t$K hhX*t$  Ɖt$% l$ UHc 9uD$ D$ tȀ uWxkto4$hBehxo$bh]ot$ t$ 9h)jjh3?k!ho4$hRh) 1^_[]ƃX*W*AX*v9 t@X*ˡ)+tt$ 1CS t$a t$ j jVhhWWY<S@rUSWV$,D$D$=*V˛PVW* T*1FVhy5d*_ Vh*5p*K D$ VP5** l$jU5* D$1Ƀ=*ˆ! uϿ1h4*WV h$*l` h WoD$VnD$ T$Nj T*jU5*薿 =*Ӏ"\$\$T*хu$4P(*t tD$HL$ uf=)tGWh \$D$)É;h)JSD$P$8 9thrFT*D$D$ t$D$)Ƌ$0tVPW褽 9t hrSFf=)t!jl+D$ T$RPh h*Vj jh*5l*> t$VanWH ^_[]WVjPh*h% t h*h*HrhE}u ***PhhP׽ x1Ɖ5*hhWh VW b5*h^_USWV1L$\$1Eފ t uFt1\>t t tG1҃Єtt>D><>u^_[]'#1@T*Ph$*] USWV T$(\$$t$ 1|)PURS腖)ˉ<à uVht$|$u u)u%u!1ɃtsQ)Pht DhC^_[]SWV \$ hSh(# uP thC ^_[0xEhSho# 4$ t t$豼 j V h뙿 h Wk5)t$S jW|k|$W\ [9uR1Vt$ 4$4 jJ ShBVKWV|$ 5)j/Vt@jWhhQV\6^_1@P*PjjÊD$X)J X);h)~{у ts P)QP)jPh\*h" th\*h]Pt:j5)P? f=8)u5* hP)Qh\*h8VUSWVt$81GWhy5d*ø 1-P*h SiD$h4*SD$UM Wh*5p*y tLtFPFuf=8)*tjQP> P j9mt$4l$0jggD$T$1D$EHM~EHMU ڃÃ=P*uf=)u0Iڃ% tM 1f=)@ ЈD$P D$ƒ t|f=)Qq f=)uf=)tT$j \$Ct,j Cu\$T$f=)x댉\$ 넻 $f=)tD$ @D$ Ph +ڃf=8)X*5) jW5*耷 X* P* u61=*#$ )9ujw 5$t h>jP ڀ tf=)u j ttFPFuj-eÉUt$jff=)t'+\$|$f=)tJWSP jh*5l*| h*jj+ (^_[]USWVP\$D$jP5* f=8)1=X*5)R jD$P5* W4 9=X*ttػ1FU PhHKtMVh*5*- =X*5) VD$P5*虵 W 9=X*u^_[]WVjPh*ha% t ^_h*h*Hrh<ы *u *Q[h]PtAf=8)*pthPQhWWhz!V \Wh8Lh jdX*USWV$X)J X);h)у  P)QP)t$hVh( 1GWhy5d* WS'dWjdh4*Sj Wh*5p*ȳ (x>jaƉ׉UT ~*9u$hP)Q&Eh4;11f=)tja)RPh jh*5l*4 1h*VW WVDcWj9c^_[]j5*^ W 1SjcSWbVVh"S USWV$X)J X);h)у  P)QP)t$hVh( 1GWhy5d*& WSGbWjj`Ɖ׉US ~*9u$hP)QFEhT911f=)tj_)RPh jh*5l*T 1h*VW WVdaWjYa^_[]1W5*} j5*m S/ WjaWS aVVh3WUSWVPhk81GWj`Wj`9U%tDƅtZWQ 9uh81Vj`Vjt` ^_[]h)WjhYYhZ1SjF`SV7`-)j/Ut@SQU+ h)WVhYYhW` WVPjh5d*諮 f=)t%5Ț)>t=l*VNJPVW| 1FVhN^5l*e |$VW5p*Q ?nu5Ț)h ^_VPjPVh t=*u.5()V yVh]h6P^Vt$j5x*F VtVhh^6EjWV5H)t)>t$=*V貉PVWg jmbj{VhVh Vљ)t$љ)jh5d* )u)$)%)t$)t$)f=)tQ)t$$Q)f=X)t*~Pn)t$))X*)t$)jћ)t$$ћ)f=؛)t*~P^WV,|$8V5* gh*~Wt! $#* $ **1GVW5*~ h*Wjn 8^_WV,t$8W5*fh*~V蓈1Ʌ#G OWj5* 8^_V1Vh{t 5*z jG`Vhzt 5*cz ^S\$1uAjP耬 [ESWV|$\$1FtCWPt1^_[fUSWVl$$1***%Phl)h[t$4U 1I~1L$$D$=X*8O>HЃ sX 4HЉ5*jhl)h[t$4Uk ߃ufH1K$D4*뷃EFD4jhSUy jhS=y hBS视D$QPuVD4h SwhoSazhBSK$_=\*D4*1@D$<$XD$X*=*D4j/SQ*k<$$YxD$ P1PhPjPP5D4c *L$ !P5D4hQbJ *0**=D4WN*Shh*j0 1@1H1HD$1@$D$~1HD$$,))t5|$L$(4hV臄t5**0**) VjpXVjeXVjZXVjOX`*5*h_j VV4$jhP)X NBwPP_ D$tu1=\* 1A111ɣX) ؛)8))=X*t )=*t5* uW6uB=*u5* u3^_[]xVhHhsAhd:hj\ 5*h}!hh|h: hhj' h)jj@htPjh)jhhTPjڴfUSWV,|$@hs jVW^1ۅl*=*hp*F u.j K 1=*ȍPU< *j *x3=l*u?jP *teQݦ *UhSl*WŅ?1GVjU=l*t1O,^_[]ÉVQU_=*uL$ @Vj5* 1Vh t 5*`s VjEU1@l*jhp*E fWVP=*t 5*t$uhd`ƅh{`t8/u)) P Vh)P +0 19uQPt$] \uڃ=*u%h*ht$ u *%h,*hkt$ u ,*=0*j:ht$ 1Ʌuǡ*u'>/5*jV.**5(**0*=*u *%,*Y1ɉ 0**t=*u*t =*lj:ht$ 1Ʌ X*=*u6*t=0*tP5*~1*5(*j:hw!t$ t )j:h!t$w t 8)j:hmt$V t ؙ)j:hnt$5 t ؙ)j:hs2 t$ t )j:ht$ t )j:hWt$ t )j:h!t$ t )j:hA6 t$ t X)j:h/ t$o t X)j:hPt$N t )j:ht$- t )j:ht$  t*j:hrt$ t ؛)=D*u D*)=8*u 8*)4*tPhs,<*tPhH*tPhΨ!@*tPhhL*h$t$ u L*hP*ht$ u P*hT*hfZt$ u T* 5*5**t%j,VHtA1ɉ5* *^_Vh Vh hij ttu$VhKhh5j˭fSWV t$ |$6F 諲 *A*臲 *}*5h*P({*VW8=*1h*SX **%*%*% *f(* 4**f&* *h*jS6 h`*9 hh*, hp* h jpN9*tPh萳x* x |AEjj5*褞 xPj5*茞 hjVu h0j 1hDVW vtHЃ rt+vhP-*ō HЉ*봡,))ǃG<1)DHu0W]x=r$hhc`hj蘟 SGhWh*m ?t GG?u**5*hj V軰) WjLWjLWjLWjLVtuhdhsjhP) hX)t * hB=*t5)u,u5=*5){5)hj) Ph WV'2ƿ)Ph0W VhUW j۩=|*th|*htji jLSWV5ț)t>u+t$@*t P1 V0ƣ@*ț)hBVwts*hoVwtahMVvtShI Vvteh Vvt1)VhW WjI*$11ɺ)0 ߈@*Bu^_[ñ1WV,|$8V5*DTWV WV #NF=*t L$f=؛)t D$#$d$d$ wfD$ f=X)t $Vj5*x 8^_h*jjd SVPf=)tjMt$R 8)0utztD$=*„u)0u1f=))몈D$< t< u>jV5*z f=)t|$ `t P `u 2 X)tu ()tt A8u1f=)t )DAt )DAD$jV5* f=)D$P/h*jj USWVt$D$ $1=*hg- jIHD$1CSj7Hh*SW VhXh*k8 tWD$ h*jj t$jGUjG=*uD$ 1;$ȃ^_[]Ët$$4$)H )~)H )h)wyeȋL$ < U;t$ KD$ V1FVj=G5*h `Vh*7 SWVP8)\$ )t%*)9u Gt+t' u9tpD$jP5* Yـƀ_r*^?t@آ** **h*h豫PW1^_[P)H )~)H )$)%xt1Ƀ=*!YXD$_r*^?<t@ ** ***SWVT$L$D$=*ut1<1*1F9uRQPY yp8thF^C^_[hUSL$ \$1B1t 9tA8u[VL$*tSA 8t6u(^@\VPt*)ƃuf^?݈@*^VD$Ph=))*Ft8)_r*^?<t@ ** **h*h荩_r*^?<t@ ** **F t*vPh*h0*~ v 7^ÐWV1F*VW5t*葒 VW5h*聓 ^_USWVt$jV5h*_  uD$41؍oD<jV5h*6 D$< t r֍,f=)tD*t Pt u)D$y1D$hrP觪D*tD$y)D$nD$jP5t*裑 ^_[]1f=ؙ)ؙ)USWV1GWjBWjB*4 VWBVj{B`*fC*CfC 1l$jjS; ~}D$tvjh*5`* ~]*Bt8StGWuG1GW*U5t*ɐ WUl$5h*赑 1f=ؙ)ؙ)D$hU5*{ jƉ,<=*  A9rWD$Pj4 f=)D*tyf=ؙ)~g|$_r5H)Pt. D*YSQ;Y~ڃ tZG9r QRFl$!y-"l8u!PWjl$UM:VBEh@jf=)tD*t PMqj蓞fSWV̙)t3ܙ)^tPKtF tFFu҉5()h{hWh]W蕧tRVhW t4=*tWhj W蚴tWVp%A)^_[USWV|$h^!WXkj Wj=WX7t@C@uShW ku S6ÉXj?W 7t0tO@t8JS.?!tOYt@t ɡ tWhڣ~5=̙)t,̙)Ft = @t 股 t~vuك=\*~h `\*^_[]SWV΋\*C!w\C\*؋ X)QX); h)hP)j ]\* P)QP) X\*#|>Whأ\*NI$WhL̢\*@\*N Q1f~ @\*X)H X)t;h)lhP)j!衧l\*v WhV `WhLF\*@\*N tEPPg\*VP)H P)!6h\*#|\*h `#^_[SWVL$T$8˃\tF^u[(L$tUIF^ـ0uJۃNπ0u!F߃π0u ߃ЉL$Bt)8u!nL$8t .uՊ^Љ8t1^_[SWV\$It&Ƌ|$@uhSvguW 1@W+ljR1^_[SWV̙)1t8ϻ̙)WP,gt!CtWPgt Cuމ^_[USWV׉A tS^؃H$n tWUftjPu U! W F tQfB t Н th2*N 1?!9~ t~ N 9tF N^_[]hfSWV,1f=)t h{|$ j7D$`*|$hd*' us5) jW5*> jd l$ÈD$V[bt1:ul$B9u|$tjj 7D$t$j 71 ^_[]VP1Vhxt 5*T j:Vhyt 5*T j5*蜑 j:j5*u jhN5*P T<0t<3thW衛hn蔛1FV(:Phf@5*BT jh5* V9j5* jhxt 5*S 5*ц ^jh `5*蚄 h`*jhd*B& fUSWV $ u, h\jh*T 1H*T*h@t *h@$t*$ hUSP ƃw$ *׃BD48jL$QP $9b** *냀 *wD4*` *T *H-D4hU|ſ<hUSVWUi u<7t;upC *KD5tX<=Ehk USƃt=tU^UD$d0@<=uEajD$PU< L$9! t , K*hV|,<0$ $ D4=5D4O*VP^*t=G$tjVP^$ *** *}=*rhk U3RUPh pj蕐h@Vh Wh &UVshXh3j蘄 WhQWh( D4Ph#j= u** t5,))~1҅ S|@hOhAhq hhhh hhKh *u8D$P*# u hC9$S* *y!ǃu h0t!ϋ *1Ph[ <u s*0h{f s*0hLAWh2.t%th|$ D*$ $ 4hW| uW$ 4hfō$UhP tʼn-*=**hPU *uFt3 P5*hDh*Pa9u5*hej*uG=*ty**=*tV*h*Q*u7J$ *z$u+h*Pu,*05*h:u5*h =*uhhh0Yhj$$ t~ T*u$ th(hX*PT8u$ thGX#`*=tD *Au$ thP=@5T*. T*$ DP**5*hD*tpp 0h& *uGP*(tt#`*/@t QPhԒ *tPh<轒*uu+ *0Au*h`N * U *ZSCh*u Vh #*=u#5*d} u5*hg{ 5*} u5*hT*tP} u5P*h]j赊$ thhlUSWVt[ׅtf΋<t#@tVP$Xt%]uWVh jH*^_[]hhhhhhhs.PPPh]h)*t@t h*ЃjΉD$t@0h1h hhhD$t@0hR1h hEhhºD$t@0h1h hyhh茺USWVhw~1!,,Qhh)4t*tu6h)jjhh)jjhh)jjh$tFKrh)j ^_[]USWV)9u1Ht$Vhht@PH V$PPftхu! $hq<tc D$!@0tBVTؽ ;$ݸD$VPhh)躐D$uh)hN^cA^_[]fL$t11f3QBuhhjTh]踸WVD$ tRt$tX|$t3fPh3fPhf1@^_h hj` hhjah]8USWV @$ @SFX~ _cf ߃| RQh%19ս|*Ձ tRQh 1 @^_[]û l$ WWSUP=} 9tmv h%%$ =Ut%tv hfhjUF 1$ PPQ| É11 Զx$" 9/9$ $ =JA|$  D$ |$< |$$u)D$L$T$$RQPT$ L$D$419ع#Phbch Pv tOPSQh26$!u$!$!j?PQt t$hQ+PQh$ "u!$ "$ "hPQ% th$ QRPh]$$j@P$!PD Pt$$"PD$$ Ѷx"l$$ $8v+)t)+8uHJRQP~ t hÍ$  tL$(SUPkD l$ M1h$ US0D |4ōPUSC < ߁WjPC N1\$ PPh t<=NýjPU` 91E rO8thO8ZO8u.N1 T$ PPS 9tǃuz,O8u~\$ShmdvA th!N1 T$ UUP ljl$Shmdv|A 9=tWv h02v h#gh hWh8BhdhWh91hwhWh: hhWh;hhWh<hoUSWV$F~ 1jUWSPw 9u!D$=жxt9wwF̓uv h%R  v hbST$1uD1Gu<jUPSv>w 9tu&v h#h{莼1^_[]hPv hih hTh hdhThhwhThh)USWVՉϋ hΉL$ 9rh1Ƀgw)4QjD$ Pw@ D$VUP@ s DD$st$s 8D$ s <D$tf4$l$4ULt_uh[hQ0 hh) h)h)LJ uh)j D$l$4$sf@8tD4$t$xVL@SMKPSVb \$$Vt$SK1D$0D$,D$(D$$d$sD$4j@HP@ st$st$h}t$ht$hքt$ hńt$th贄L$9t uQh h胄|$4tD$4Phj|$ gvVD$PU> 16D$8uT$Bg)QPR>x thm1@^_[]USWVӉ͋t$V1Htkt$t$VSUs tGUn t$t$VWUs 9uVSWw t'W I W 1H^_[]Wt USWV$$$|G8-t ,)$D$ 1FD$h4WS it 1$)9t9At&9IuJuiu3$tHPhy` AtPqhL 늡D4A뀃Dtou&t$ mt$dD4$W$uQ 1t$hWV=< jSV $FWPP uhM!VhiP: u hj6o Wm T$$)l$D$G_HrY7S? hjD$*Pq; ft$fD$CL$fA37SG hjD$&P1; ft$fD$f\$ $T$0 T$T7hjR: SFZft$fD$fD$PSU; $T$l$GD$x|$ hhjD$$P~: \$ $ sh$zshEjs hhZshJsh:sh*s hs$h s(h+sHhDs,hks0hs4hs8hsXf|$rL$Ifw L$T$ t$"VRQPh}h hjj D$f=Ȟ)1Ȟ)hjD$$PL7 fD$|$<Ğ)fD$ $T$̞)h-}H$L$f|$tP|D$=ufD$L$IL$}1|$D$L$ t)14/Drt#E9uT$ЃDPho|~|$ujtjPP? jt$t$ V VhiW4 u hD$(|$ u,$PD$D$,$|$ 1hSW=5 GG?t$>hSD$$P5 G$0hSW4 jl$UWR wh%zhP)EWh:it$V3 uO j.yhP)jG@Wh:iV]3 u Cw@8)|$P$rkLPD$$PQb4 $<1|$Vh2zt$kL4t4 hwyhy48~1D=PxG9uhqb4 D$4!4"4#4$4%PSWRQt$hey4(hQy444,40k<SWPRQPhy4`hI yhnx4\t h}xt hxhrb4d6|$1A t$t&u/7t$t nu QhvxFL9Mt$ $t$qVc P$t$RVc h 4+Phh)y jpUSWV։1hUS1 jWS'  sUPP$ t'Sh9iP~0 tVPc Ĕ^_[]hM!hjd USWV׉1hVUD1 jSU  }VPP tAUh:iP/ uGPh1FSb Đ^_[]hM!j d VA= u(A11҃r=61|1uD1 F9u"QAt1|1uD1 F9u1Phv^WVhxvf>r1D~Ph5!]vGH9|j]ju^_WVh6vf>r91D>PhDv 9} j:$uG9|hqbu^_WV$fGjRW  WhiV. t Đ^_hjb fUSWV u }6 h j h@VW[ Hw$D*H*ԃBu|1PP5D4 @*\*뭈L*P*T*X*D*너L*`*sjhP)ޏ _L*Su|=,)=X*u,1A AAAQj j_ =H*uRP*uID*u@\*u7`*u.L*u%P #DPhLh)v 1@!P/hP)?ud*e^_[]hQxja SWV|$h*)tGh_S`:t'=T*u]PSut<)h*V)t V ?()%)Sh d*1g^_[USWV|$)1M=th*t]h_S9tT=T*u^jjS] ÅPS4tD$!=1y75)uR1PPSL] Éƅx=h*V)=t9t/V] $S] 7h d*ދ S] 7hH΃|^_[]hj_ USWVP 1t$1G$ӋFHN~ HVg>ƒ =\*u u u1=D*up=H*u< u7 =P*>h hhP)$s \)@t>$@$Ph~hP)rڃ \)@ t_  =P*X)H X);h)hP)j$u  =`*xX)H X);h)hP)j^u:=L*,X)H X);h)hP)jM*uڃP)H P)$P)H P)^X)H X)!;h)hP)jIt P)H P)I P)H P)MX)H X)%;h)hP)j-itڃu!P)H P)-)DPuWX)H X);h)~ƒ tP)H P) hP)RsڃX)H X)";h)hP)j^sڃuvP)H P)^?tЃ@Ӌ X)QX); h)~ ȃ t P)QP)ZhP)PGsAF @t5h*hd*f \)@u^_[]hQxjZ USWV|^)1O=t$l*t~5@*PSX ƅ~B1l*VPWW )u5@*5l*SW ƽy5h*hd*|^_[]Ë5@*uPWwt]5@*r$Vvl*DVh!l*)@*l*p*p* t$h~r5@*hQxjY fUSWV$$6m h j D$$1D$ D$1jh<)hVSy u=D4݃Q~Hwat=uN1@D$뾃K~Lt.P$1렃Huv$1E1@D$11@$yrRu 1@D$ ^XuL ,)T:-u0L$J9uzu L$I ,)L$ u ,))t u u|$ u1ۋD$Ã"|$uo<$tD$D$`tD$,u}W u5Wh1yD$PWƫu&WhK[hjW ƃD$ D$ D$1jSU  u h\P$l$ue084$$c$CHHf wz$ulWÅu븋ks  PUl$ hf4 ~|$ u1jSWo #ks  PUhf 1@$kD$tCPpV` PUT$t*|$l$^sh1@$Cl$:hk!jqV LPPheh)kjbUSWV$$6 1h UE -t*-x*-|*-*1ChLVWǀ e'H wu$*-x*-|*Ńo'fil*뙃prv*oax**t*%|*-x*-*7x*-|*-** t*******u ,))ǃ=*t*u-tX1Ƀ=*=|*tL$H=*=|*=x*=x*tʉT$4d *j3e *P%e t$lVUhd)Y" 9rUh\hd)`,d) \)QT$/u>t$|9A\)A \)e)vy/thYhj7S t$ `)Dh1u j=x*u$Phd) $Phd)wu@+8uT\=*u=t*t@|* *t3D$ P6豦1#$=@txUhd)D$ P6u6hjR #D$=@ut* *1ۉ  t1ۀ|$/uhd)h.t9U*r|/u (IHr IH9/touɉt$P]*USWVT$juQ PE D$1t$CHfw?$ss ! PVt$ hf膙 Psht>|$(5`)C,d))=|5TShd)h8 t$V 1Ga{DuO|$u C(D$?Cj/D$ PAst L$)@L$D$hSrQ*T$CS(L$)ʀ</t ~/t/FD$щT$d))rPhd)h9t$PVL L$\)\)=e)vx/u H\)=x*tD$Phd)dD$Phd)ӣT$KP3Qt$31 u@T$(3Qt$$3q u.shd)hZϗ CP@!=@uYBqt$1ҁ@T$ D$ ȹ!ʉD$ @u4shd)hb 1Gt$#KPqt$1BD$ $$=t*L$ QP T$ t* *sHtbffM *Q*T$ *t$/D$ !=@8fushtjSt$ V 1G)=t*tRL$ QP[ IRSt1Gt$EuEt{DtD$ 1ɈQSt RSt$1G=*t$tjQ\*H *<*tICPphd)O 4sh{D$ Phd)_1u=*thd)sh{_ VÅc1G1%8uVTe^_[]7hhk!jL h7h/h6!%hd)hQhJh?h覉fWVt$$D$(H0JH(x,z H4x8J z@/uD$PV赒X$hSW6  W+I t?$ VPhMhWOD$PW[t VQD$PW躒Å+WV/PV`t@\$L$/PWr`t@L$ Q\$SWu)D$ )=|\$=+u=+hP)Whh)USWV΋\$=+} t1PSR\ ~jP 1ɉ=+tW| L݉t$=+D$W| ÉL$ CHHf$ ks PPUhfy +{Dt{T.u =+tw=,+uL=T+u%sh#D1TSh`yL|$|shCT+VW ʼnى=+ut jSWb Wy Å 0W?  0 8u ^_[]jhk!j0 WVD$ qH1ftYT$zHftIf t$f tf9t=+uyDt,RQL+1f Duf u RQ^_fu1@fu1HUSWVL$p~+D$ +u =@+D$D$\T$8D$,D$D$L1D$<D$0D$(D$ D$dD$@1D$D1D$H1D$D$D$D$ FHf tfuPߍ^Tv t$l$ՉPShfAwl$ t$ 1@F F+|$pt~T.u-=+t"fu=+uFF ~,D$9wǀ|$T$Pl$\$|$`FPPdD$$x`\$9l$ЉT$X|$|߉|$lT$D$$P h\$H9Ӌ|$rډT$H|$$GD$9ȋD$l$wL$W\X9D$ ЉT$|$4|T$ L$4T$ |$T\$h|$$G@ %=`G 9|$\$L$  ȋL$D9ȉD$D1@D$@D$ L$(l$0oD$D$4D$ T$T$lT$T$\$hl$4\$(\$T\$ \$\$<\$\$0\$X\$,\$\$l$|$D$ L$(l$0\$|$<l$XL$TÃ=+\$|$t-=(+t1D$$pho!j $UH>l$ &D$,D$HjD$(p贁 D$ t=(+t D$$pho!j $U=jD$(p Ņtt$ T$,D$(9щL$l$,UʼnD$L9L$L=0+t3h_D$(plY D$\PT$P9щL$P1|$(P5hà t$ P6 Ct$,P6=0+t +Cl$\UPy6UL^|$`\$L$D$ l$4T$D$dl$D$ D$lD$\$\$hՋD$TD$(D$D$ D$D$ [Vsh~8 O=$+tD$+U`‹ud΋[QPVRRPSt$c8t$Vu0 _u$<p,V$Dh.8=+u3v4h8 sv$h8 =0+tsv h 7 E@ %=`u6E %  1QRv X)J X);h)~у t P)QP)GuhP)Qf9=D+tXD>X)J X);h)~!у t P)QP)Gu7hP)Q9L$D$ ρÃX+T$9\+}`;L$}XD>X)J X);h)~!у t P)QP)GuhP)Qo8X)H X);h)hP)j D8P)H P) 1D>X)J X);h)~!у t P)QP)GuhP)Q7X)H X);h)hP)j 7P)H P) e^_[]SWV΃=4+t voh`1TVL^_[SWV΃=4+t vh1TV^_[Ã=4+tATPqhM1 ÃTQh1Í` f w5$<X)H X);h)hP)j@I/X)H X);h)hP)j*X)H X);h)hP)j=kX)H X);h)hP)j%DX)H X)w;h)ohP)j|!X)H X)g;h)_hP)j/51@áP)H P)@P)H P)=֡P)H P)%áP)H P)|밡P)H P)/1áP)H P)*USWVl$(}=+tE(G=@+t= +t0DG+1 8+Í9h)} ^_[]E;x)~*P5`+K|M x)`+`+GMt%$Q  Qt $ B$Iu$ h)șƉșD$$t$ƃt$ D$|$1ۋ|$= +t0 `+ U(t|$ ;<$}Z;D$}El$)šX)H X);h)hP)j 3P)H P) MuC;\$rX)H X)~P)H P) hP)j ]3D$@D$;D$ ^_[]jDUSWVt$F=+tN(@=@+t= +t0 @ +1 8+< h)9} ^_[]n<Gșljș|$$.1E  E;|$|6X)H X)~P)H P) hP)j R21V(= +t04<;$}D$)áX)H X);h)hP)j 1P)H P) KuGm=X)H X)~P)H P) hP)j 1^_[]USWV|$=+t_(C1ۃ=@+t= +t0C=+71F  FX)H X);h)hP)j, 1P)H P), +N,X)PX); h)} 0;h)(hP)j 0;~&P)H P) "P)H P) hP)j 01W(= +t04jŋvX)H X)~P)H P) hP)j 0^_[]fSWV|$+Wt pSP6t81PWV Vh*Vr^_[hUWhjY USWV$U4(F$$1 |$1 9$)덄$PSUD$PtXǃt-tat$F?tL$T$d$.?T$O$E1 $ ; )r9vL$?T$$$^_[]SWV ΉRQS 1t4u t|uHthP)PjSyt Vlj ^_[fUSWV$$3 1h W!W$' %$ D$D$ hdSV@ mu05D4y tChPE $We뼃pu D$ 뭃u ,),uk5D4h1j] hft(d+ht14vt%ih+l+l+h+p+맃,))Ń#D$=@u.$VtP[ 9r*thj |WPj ty/t AƄ/@L$M$D$S|/uH9tx/@tj/S4ޅt@VL$rSh@Z1A $'@PVt$  ٍ$Ct1@$Mg4$跥PPhh)&j|x+USWV։π=h+ujVq)t~VWc t9g8uR\$@SVet{SWe9Wh1ۀ=p+VWh{# VWh蔼 w=l+u=jW(uWhH#D$H=@V# =t+/jV(D$@PV{djWh(uD$1Pt$L D$2x tCD$1Pt$\Le 1Pt$`f VPSt$D$BPhh)$#D$H=u}1PPW t$HhV \$D$|++Vn3CVh1C؍e^_[]ÉVhih)+$ )H )~)H )h)ÃtH tC )I )~)P)h) ) tuÃ߉1ۃYM@VhG'$|+S+t$|$SPt$ Å11S5+t$ 9x߉=x+t{\$(t$,l$( $$L$$D$ l$ |$T$ fT$l$\$l$T$x+RQPVSt$(t$(h}h)"$5|+5+t$  Å6|$W\$S t$uVhxS D$hL$l$JD$pBD$tB D$xBD$|BRW] tVh諸t$\t$\Wz 8tVhz#D$HD$Ht$\$ \$D$t$PhBVy0tVh't$ S 1V5|+t$ t$ЋD$HPW tVhʷ$W t8-t$Vh%藷 W tV|$W/t WhH1ۀ=p+DVt$SWVP׉! jWP謪 t$t-h@h_Sh@hS1@^_[%tPh@h~tS jWP9 t$thh%tPh1돸H=p+uN@jWVh9!PhkkS׃ ShIj诹jVh9!hhkkW袃 WUSWV8|)t P |)1+++++$,ħ)it$L$hjV |)Vh 0jG|)hhV |)+hjVP |)VhK 0jͳ+)1|)+)1t~+ttja|)+)1@5|)+)1@DVh0 0jE|)t+tj|) x,tQ|)h+PxC+%= ts=`=@5+h} j許 I5+hk 0j膲5|) |)+1HPhm8@5|) 1ɅA +-+5++ˋ ħ)u,,)v$ =,=,>1jSS5|)7!ƒuX8f+-+5+ a1H ħ)ħ)= +Gt =}r t~=,,q˃u#=,tPWUVp ~jWUVV tw߿(=,u ,~~=))18^_[]111RSWV։ωSC 3x)D$t,t\$W3 4$U t$I ctjt$ h1@jt$m 1PW\ 4$ t$ jSVV x^_[h hhj@ VP=|)x=P, h,t}=+ut=x,tD ,HQP~'Q &$,1++$Pj 5,h 5 ,| 5 ,ް=+uKh+5|)һu4#+=u"+ +u5+!(+=ħ)w=D,t)~ jP 5|) )~jQP P, h,t4=+u+5 ,h@vx,5 ,|)=+u +tP1++,t) P, h,t'=x,tG ,HQP~Q $,Pj Hx,,tZ5,h uC5 , ,, u ,,jhQP3RPh V1V5 ,5$,^USWV=ħ)P)t)D$W6O+0+ 4+ u1@1ɉ$L$=,ħ)\$5,5,hhS<$t$W5,5,Q$hRPWhhVW$VShhW;}WXPW}tf=@,t]t$5$,5$,hhV$Vh@,hhWWPWj ħ)u_5$,<$t$WjVo$hRPWhhSu$S]VhhPV,D$=)O$,D$ D$5,5,VSP$5 ,5,VSP , , ,,4$t$VPQ$hRPVhhS$S]$QL$Qt$Wt$$hhPt$t$VPVjD "$PW5,hft$e^_[]V~=+u(=)~h~V5|) 裘)~^V +1=+uE1jVV5|)xRP5|)  y!h 0jd 1N^Ã=+uhjI&1=+u5,5,hBj!1HUSWV1|$\$l$WSU ~)t^_[]USWV1|$\$l$WSU ~)t^_[]WV5)=+t$t$5|) ƃu*~3+;5,tc5,tU+L~ +?5)x5)hj, 15)h0j^_USWVP5)|$l$1ۡ|)$WUt$ ƅ~)tދD$9u ++!𣘣)+Hs-%8 uc1hVh5):~\%tS1jPP5|)x})RP5|) yPb8tD8t:8t0Ty:8t 8u )1t8Eu )xt  +1+= +uhj腥`tx>,Ht)t hz5)hjL 1%hDj5)h!0j^_[]USWV1N=$+=) ħ)uhj٤+<u+-+sg+ +1jWW5|)xXͽuWURP)jWU5|)yQu t#+@+=):hFf@Phm5|)b x)h j1^_[]USWV \$$|$ l$(1uu5)+1jVV5|)x\D$ljT$Ӄ=+D$++9L$ujRP5|)x+D$T$EU,=+u#h?0j )1N ^_[]USWV~=)$(~$$~+t)hoj蔢I1u)1ɍ|$h~W5|) 0|$fGWhm5|) fD$D$Whm5|)k \$h~S5|) $h~S5|) GfD$D$Whm5|) )t1<$uzfD$D$Whm5|) f $ ,11F$$~jQUR8kы$ʉD$ ʋ$$~) hb1F|?1jPP5|)Zxg)y11=)|!h11Fs1oSh.RjRP5|) 1yK/h.#h"h hV h0jB 1N5)~^_[]fD$D$ D$Shm5|)f yt$hAt$h0j٠SWV Vh,j y_hf0j袠 jVj y3h0jv 1N=$+ +=,+=,u5,h趟=+h)WKh)W5o +aXt )t:QWPA S8 ħ)dtN^P5,hhhhݞ|$h Wf|$.D$tL|$uErYtSu6yu#5+5+hOsWh0T5,hAh4h'h<=,thj{5)h5,hҝhŝ|$h Wf|$.|$t+D$5..L$f tWT= r@h@ hhY5,hFh9sWy\Why$+)5,h"x, ^_[hmМ(+t P辆W蹅(+t +1$+)h_j|5ȧ)mtt$11Hfhh8+S th8+8,1Dh)0j臜 1Ht$ƽ hF0jX 1HVt$V uVhZ0j*^\SWV|$$WEƃu[1~tHNtt 9 tu/~PWcEt#D$=@t V1N|^_[USWV1F,PH{,P kjŜƉ+$,Hw> ,SPh<,Q@ $,$ $,L$QPh<,\h<,Cjuh<,[jh<,^uH=@,/u+-Bu"@,PPhA,@,P9j hP)WVh<,M<\)@ub$,$, $, $,QP.t ,P(jh,j` xsZ1e^_[]ho0jՙ USWV D)x&H)kL)9|׋yM1II1$,1PQÅy19}WDu=ħ)hj.hh$,OÅy1ۉ9|D)x(H)kLSh$,ȣ)y݅u=ħ)tehj迗$,1E$sVh$,$,PXh )؍$,1Ehji1IkFL),Sh$,#1ɉ^_[]USWV D$,xGD$$,$1F1$,SQ291C,h$,h<,P$ ,Qu*D$PUh$,Q8 $,tu=ħ)hj耖t$h$,h$,5g $W1CttUtB:x9u=ħ)tFhWj,Wh$,Q19uhj1H ^_[]h4th<,Q<t $,1h}USWV1C,PH,P yjؗƉ׃=|,t/5ȧ)M th0j4 e=8,t Rrx7t$t4,P(jh,jT lzbV1ۉ؍e^_[]Ít$\$D$$,Hw5 ,VPh<,Q@ $,D$ $,L$ h<,kWeh<,duy=<,tSh@,d?t^L, X,tSh@,E?h<,Ujh<,Xt@h<,Em$,$, $, $,QP=@,/u+?<u"@,PPhA,@,PKd p, t,tSh@,> P,tp ,|NPWt$h<,)6Q=L,X,D$L;$,D$P$,Ph@,8x,X$,t@t=,u Pl=ا)t1$,Hr@tZ tUh<,l'9D$X;$,D$\$,?uD$Ph<,$Ã|$=,ut$h<,Å,VSh<,P@ =,uSh<,/!؃=P,\$C=x,6D$ ,HQPQ p,=t,D$L;$,D$P$,$,$, $, $,QPDy h<,j=P,\$^=x,Q ,HQPQ D$L;$,D$P$,D$X;$,D$\$,OPj \x,D$u$,D$ $,L$ QPpX$,x5ȧ)5 ,%$,$, $, $,QPh<,ji\$=D$L;$,D$P$,Pj x,USWVj/h@,1Uh@, E t>58,h8+U# /tOGh8+WUh@,hjjO1N,K|/t1Nuh@,hjj^_[]SWV=,01F ,t9t71hjێmQHb,P R=L,t i<,x t `m#P, h,t#5,h5 , x,ujh<,^t($,$, $, $,QPu1=L,th<,hxuth<,ly,P(ljgSW, xaP, h,t&=x,t5 ,h@2x,1G*ƃuejh,j ^_[USWV $,xu d?*1F,P,,@0D$ jiD$T$=8,jSh<,9]jh<,Q$=L,th<,~gh<,+th<,2d$, w's1PP5L, $jh<,Pƀ=@,/u+4u"@,PBPhA,@,P\ =,t4$h<,Z' P,t: ,|Pt$t$h<,s.Ph@,0x,$,h<,T$t8=P,=x, ,HQP~dQ c,L$Qt$<,SPD ƉPS?&=P,tc=x,tZ ,HQP~3Q 2Pj jx,Ph<,%dPj Cx,D$L$ʃ|QP  $,$,ʃ|QPxnh<,*1C@TPh<,Z%覹5L,hf0jh<,8ch<,)t ,P4 jh,j =H,tn)11Fe^_[]þ<,PV$Vb뙉Ph<,$뇃=L,t cxIx,PHx11@USWV $$h 5,S) = u$ /,4ŏ4/t EƄ4/FED$P5,83#D$=@`1Gxv%xmlxd=8,t exRh<,!(ttjh,j Gm'15,hj 1GĐ ^_[]蕷5,h0j҈5,h#뻸 )D$ )D$$h<, XL, X,tV1=@,/@,t$PU裬 ;D$vh@,hEjN _D$PSY2E<,WT&W^jh<,Kt'h<,K`h<,&'VSh<,NR xơp, t,tD$Ph@,1I=P,t5 ,h@,+x,$,=@,tEh<,C=L,X,D$D;$,D$H$,h<,{$,Ht 1PP5L,4 $jh<,#Pt$h<, Wh<,D$P;$,D$T$,7wD$ Ph<,;p,tk=t,tbD$D;$,D$H$,Nh<,h<,^^D$D;$,D$H$,D$P;$,D$T$,X5L,hf0j蕅P<,WWWh<,!Ph<,=P,e=x,X ,HQP~ Q Pj x, D$D;$,D$H$,Uf,(,,u ,@,=~| h~Ph!thPhRj蜃1Hã,)5+y x1 ,, ,,ʉ, ,,(,=ħ)u=,t4=~| h~PhthPhj1H5+ y x,,,,1,,,(,~),USWV=$,thj艂1I^_[]Ã=,,)u,1IxՋ=,+=,|$\$5)UVSW)9|11UV$)݃,|J, ),~H5,P,,;,r֋ , ),,1)ȉQPx[,Ɖ5, )ȣ,)=,, ,1 ,,ħ)1hjWV1N=)=ħ)uhBjy1,,5)5,Z1)~9} G{u'Phwj~ xI1=,=,5)5,~ , ,,, ,1^_ËD$L$,)ʉ,QPR USWVu ]1D$ D$ D$, ,)ȉ9؉| ,)։ ,QPVS)ЍT$RPQ 1ID$L$ ), ,|~ ,,)ЅqxUtX ,,D$9ؿ|‰,)ظ|D$L$ 1H1@D$D$e^_[]V1= ,5)5,~# , ,, ,,V1xC=,t/x&5,5,5)5,~ ,1 $,1H^V,;,v*5,)QjPc 5,5)^USWVt$,, (,ƒ|]; , ,}O1hW}= ,=,$-,) ( ,9)1 -,1ۡ)1PUK;)tS1 ,,S, ),9)QP륉, ,Nj-,S5,U~ +,))US, ,, )VQSB ,,Htt$,1O1^_[]É-,USWVP\$1~cl$,$5,<$)"5)3x3ǡ,$5,9|WUV訟 5,)11H^_[]USWVPD$~Z\$ , $5,ŋ<$)Dž~9,$5,9|WVS6 5,)D$^_[]ËD$)USWV\$ l$؃|~,D$=,t$)#5)4x\ơ,D$=,19|VQWD$ G =,)Éظ|$1H$$^_[]USWV$  $x$|$D$|=d,t7P$Ty#$ hk 0j.{$|r ,1N,)ȅ5)  ,9غ|PQ$ ~|)à , ,ظ| uXP$蒇$3D$8$3L$4 $ hjUy hx$ hj5y L֨$ h0j z'豨$ hk 0jy111o^_[]USWV$$x$|$$D$x-D$PQ芆t".4$h0jny L$|L$1$p0L$1, ,)ȅ\$^ ,9|4$ST$ RT$RPQ$P~R|$ =, ,tP;CJ ,)ŋ|$ 1ۉظ\1$(x$x5D$t-$|$x$|Pt$$2 t$1 A01ۃ=,t% u!$9$t4$h#jv ؁Đ^_[]USWV$0D$ $$$D$x$D$ |$D$$D$=d,$4t1PWpy#hk 0jQw1HD$sD$$P$<24$tӥVh0jw $l$ l$\$ 5)5,W lj\$11ËD$ 9D$D$D$,}$4$t$ L$ QL$,QWP$PWP$@ ى9u15)5,$<r ljޅz11 ͉$03x$3|$ uRD$$P$8$3D$\$3L$X $0<$\$t*Wh<$Whrjt1KD$ 9D$D$D$}2D$t*|$x$|PW$@e y1K؁^_[]$0h0j8u1K<$ף<$W$4hM0j uUSWV|$7t6|>/u/1N=0,MWhjs 0,.|$tjh W VM$=4,4,_ShqVP$ƅE<$8$S x<ShqP$E$yw諢0=|,t5 ,u$h{Vjs154,$E]$YQhZ0js1N^_[ÉoUSWV|$?/tGj/PnƳUWcu/Fj/VnƅuhW=,t$$W jWy3UWu%D$ PW)jUPWV/Fj/Vm1ۅA4t*PWt1K#D$1=@ۉ؃|^_[]/WVD$t$ $Pk yu~ȠWh0j r$tDPvy蚠$h0jq$T[1$4,^_USWVD$Et$$^߅tP y.Wh0jpq=,t<$8$W 1 ,tt)$($u7=@,uj <,P @,<,!UW̧) Ч)t%1PPL$H$X$T$W$tJSWC y!GSWh0jpW$Y1$4,^_[]WV1uA|$ t$t$W t(5 ,rҞWh00jp1N^_Vt$#D$ PVs t%5 ,q艞VhN0jo^UWVuE MU}|$$1҉T$L$D$ T$9U=̧)t =Ч)D$PVt Vh0jKo_=̧)u&D$DL$HL$$Mbl$L‰T$=Ч)u'D$PL$TL$D$ Mbl$X‰T$WV t6聝8Nu} u&WV ubVh0jne^_]SWV|$$#($1Ɂu*x$|$Ӄ|$9$ɉ PVTt%#D$=@uVhjm 1HjW |^_[USWV׉L$]D$PSt6St$ th^0wwS tՃ} tL1@_1=<,uTG3D$ 3L$ uKG3D$O 3L$ u9t$hjUl 1St$h7Vj6m1He^_[]ø#D$=@u%h?S<tS 0Sl} D肛Sh&0jl댋D$$u1@Ë $jPUWV}wPV1@xN=<,t1A$$3L$ $3$ u*0$3L$,$3T$ uVhj%k 뻍e^_]USWV$n$1Ƀ #($ $ $L$ L$D$$1ɉl$HfL$ $$ 5,h+!šuu=`,tlD$PUuZD$ !=uHhWUR ƄD$PWSuD$ !ȉ=t4$U|$tK$ $ `D$@$D$PU Ut$ 4$U YL$ t uu$UFD$y)Q8=|,us<$8$U xZL$ A$t$Uh50j3j1H=,t2<$8$U Uh{Wji1ɡ,tt1Ƀ$ !($t($t$$5,h 还jUxN1=,=̧)=Ч)UhUh^j7h 1OD$PU<x=1$ ?#D$ PU1@=,u;L$ ($/胗t$h0jh$ PU1@Pt$6UĶ)1 Ч)t31$PjL$H$X$T$t$Ĕ^_[]USWV|$PWS1x1K=<,t މ|^_[]ø#D$=@u5h?W'1EtXWw yĉ$t WGy5 ,iXWU0jgwrUSWV \$(|$$ T$0t$$D$,u D$49|)L$,:t,<.~F9w8u@9u9t]D$ tu5,, ,,L$T$tI AQP!KDUVP 9t_L$ xZjPUQ,ҋT$0y@oEP?Džt<$\$MQVP跊 D$8+$T$0)+|$$>h{jJe*t$8h۔t$8hk0jf1O ^_[]SWV1|$tQ\$1OjWWSlxjh8,S y%\$lSV0je^_[Vt$ xFPչ =H,t.D$jjL$H$X$T$^USWV|($($(xd$(9r(D$|VP$(2 ~H111Ã1T |A9uV$P$( ǀ$1111틴$(3x$3|$ uUP$(qxLX$3D$8T$3L$4 uF1VVV$(xE$($\hhk .hj%c #ƒ$(h0jc1N|(^_[]V=`,tD,=\,tD,=l,t@D,=H,uh <L,t01x&=H,tDyhQjhb1N^WVd,tPxs 1d,`,1NH,t X,tqAX,uj1)H )~)H )h)1tN;P)u1tB L,9G= |+X,xxL, PW1t-L,8j5D,hL,Lk d,&1^_SWV|$tR?tMj X;tSƋ\$W苐H~ </u>ۉ^F=H,t%T,p!hj`1Hh5H,5T,1^_[áX,t@=D,t\,=d,u0=4,t'D$$u`,tjP5d,~ WV=H,tB5H,t;11G~u)uhjA`6hh) vu^_USWV =\,u%\,1Nd,ud,}$ $ $L$Pr `,t#HHf w=$@ phE #"phje_1ɉ Ƈ K KK pP|$׋($!с LJ$h t$p 蕎 `,qhY 0 ph p j_e=H,t\@PL$QL$ Qpp p09Bx8`,jjt$t$t$t$ph) p j[_ d,1N1 $h LJ$Ƅ  LJ$LJ$=H,twL$H$X$T$0$,$$$ $p|@$:LJ$.LJ$x$|$$$ LJ$G `, VqP袂  `,VqP聂 5,h ^1uX,@e^_[]fUSWVT\$tl$h=P,P($ T$L$X$1V8$u V<$   t4$tVjQjRD$Phs S $u2@$%  RPh Uh^|$x$h SEPD$PhS}$Hs Uh u# Uh}SG S^X^_[]Sj ^USWV@L$E\$CD$PS~{3j]9 | L$QPj@t$VF ue^_[]SWVT|$dT$t$X$hS($@ WVSh t[d^_[SWVt$F=u1H|$Pht6t)G\$QjPS[ VSvGu܃^_[Ã^_[vUSWVD$L$t$,1~y9w0uA9uuF19s`1ڀо rڀ¿rڀŸw.A9u 19s1ڀ0u AÃ9u^_[]USWVD$H=s1HT$L$ D$1I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]USWV|$t$,>~'V9wЊ0uF9u1|$us911ـЀ w<ـwǃ ـǃ F9uj9sf11ـ0uUF؃9u?1H@u5?1҃|#1F1Ou F9r^_[]USWVt$T$D$L$ I|$$u29rjӃ rW0Is29r8Ӏ0IǸ9Љډr110I9s1 ^_[]VT,~1F1uT,h j9W^ÐSWVL$D$t$|$D4h,tl,tt\^_[_ }\1KZh,teSPSti:tdx:,)9}j D4@,)sPVW# hVh,:-u/l,Èl,nh,l,`S6h ,)=S6h!h)?^_[f1Ã=t,u1á,0h"jV t,t"H t,p0h"h)U5,h+!u_sUSWVd|$|j/7 ,t@l$x,h+!Pv,+!1C,,D$ D$1D$$jhĤ)h$WUHЃJw$ ;t$$@$ D4+묡ħ)t ħ)D,Ч)rħ)t cħ)P=ħ)$\$<,! D4k, ,+]"+k)l,5D4Rħ)t ħ)Ч)\$h,t+)e,T,L+)=\,.8, Pt$8* NL$ D4 x,$LF+)+)+)+)p,D4x,+j`,q5D4[Z ħ)@K ħ)8D48-u x+D$ =,u ,,̧)Ч)+z!P,̧)|,5D4WO 4,,s,dا)U,,?+1@D$ )ħ) L$ ƒ ʺ)tP) ,) ,ƒu 9u , l$D$kL),x, ,nk1$jhT)h"WU# /~HЃJS$4 P)ƍHw$ ,뫅!D4+ا),|+jmL,@X@,ˀC0,1+z!"8, D4@Ƀl~mtKotRpd,SatDeJ1A , , ̧) Ч) ԧ)"Ч), ̧)@{peD4+SHP,3 D4 ,,(,1ɉ5D4"]T,X,D4L$hi. jLjh)Qݱ,bl 5D4VhBK~VzB)4h, l,@5D4 i@`,,+4,+k\,5D49i D4E ,N`,4t, $! D4 }D,p,5D4 =<,@H, )%=ħ) ,P) 0akG1A11|$<$t,D$tGNutNj]]hG%S{1t[hl%S{uEx,p,j5x,S^ 1AL$y#$]1x,<$D$h_SJ{l$\$th]SDžu )1 ðt5hl%Szu3p,SB5I 1urL$tP؅uAJjho%S2m uPp,D$t t P4CP3ىQ4؉D$1ES#jt$ S 1AL$"1ED$\$t t P{4h_Szt W=,<$l$S|$;x,,ħ)1ɺ G1Fmفt#u41A 0ħ)<1A 0ħ)!5ħ)1ɺ.1!# $ 4u ,)=rnFr0s9-,)D,PM,)9}j4NxP,)@,)),)9 1VV4b x,)@,)9| Qh7#j?H 1FPh#V(H V蚪5D4h!#h<$jHjt5D4h~#hh#5D4hM#jG )Vhc#d5)WV! 5)WV Vh!c5D4h!#0h#jjG!j֩mh%jCGt$h$jjP$t,(XN8@tUjP$yFD$8UhG%Wv1D$h.D$1$h_Uvth]UpDžu J)tkðtAhl%Svtjho%Sh tj1ujSðuh_Uvt W{=,Uhs%l$}$l$hl%Wu]tjWB\$rt D$W)|$ td^_[]á+t8uh:U+t8u+UhJ%j E USWV|$UWUVhNJ00ht$跩tAtZ/UVOUWh488ht$vu9tt$h"0jxE1H1^_[]át,t H t,h)h(`j輦WV)1FWVhh%BWVhh7&AWVhh'AWVhh(AV\USWVPˉjPQji փ19͹ $91lbt1ku& 7mt'wu,ʼn+ 19ʼnп|IA $t:xt 1*u-A4щ19ډʼn˿|߉^_[]USWVP9QQ,$1>tj,V>Åtj=V>tmj tdAE0H@t,=t,t ,s,uh($j6B1O^_[]h<$he$h<$j B4$,ɋD$L$01rWV5,h|$h)I t(ο$Phnh)! !uء)H )~)H ) h)j )^_SWVPωPQ$3 t4Ƌ$| tC$SQt'ǍCPVWd DG , ,1^_[USWV$t%t_݊M\tS8uEEhV)j@EjUEƃjSVT t3l$hUVP WUh)j\@S*$EE<\t:uCCU) $AStRC1fGt,PtStgtstp1B ы$J@u $A=,tZ ,HVV 4$*Who)ji? 1H^_[]V V)h) , ,1V 4$)Wh)USWV\$tK;tFjtLNjl$1pS3nG woD$G95,t%,x!h *j>1Nh!*=,=,^_[]WV5,t;11GFu)uhN*j^>6hh)ũ vu^_USWV,1 l$$=D,Kt(=4,t!9t)@tB9uKKt8<,CSB(Dž$h*j=z$uEP't?NjCt /C;WlC |/uHC C$#hx*j2=Ct/C1N^_[]USWV|$LJ$,tOwCu kPUC |/uPV3p_ t2[u1=0,O=D,=0, 2$=0,tW<xLJ$1@11H^_[]USWVP׋D$1Eq؃>?[|$1Ҁy!uΈ$1ɉ#s]t^>-u St]u8tʉω8|8뼃*u|$uE|$u ?u mt:ueG?; $uVt+=4,tGtlD$@1G8D$@1D$\1GEt$ h,j5 t$ L$"t$ 9Ӌt$ sLtBAC9uƄ$ 8t41GE$PVh7,j59tNjE|$tDD$@t:$t$PVhp,h)QVhZ,h)< $t+Et$h PVY 1e^_[]1G$ SWV\$|$t$NSW;x-$1u  SW1H^_[USWVˋD$*̀9/tKHt$)߁ |QVh,j31H(:9r UMHL$I9rHI;1^_[]ÐUSWVHu} 7//  ,)WVVjuD$L$ L$$Vj VjuD$L$ L$$Vj跛 VjuD$L$ L$$Vj莛 VjsuD$L$ L$$Vje h,B,1,,,P ,t$,NFF FFm@ |$WVj~8 y|$ujWjf8 WVjR8 y|$ujWj:8 WVj&8 y|$ujWj8 WVj7 y|$ujWj7 TWVj7 y|$ujWj7 (D$,WVj 7  WVj7 0=ħ)t3i=)‹1@?9 tR=,t3<$/>3i=)‹1@9 tR ,1QӃ tj t)X$)y9T$}d$9`$y;T$Y X$;`$d$|frt`$;9d$y|LtUQ;`$Q d$|3?tT$;9X$y|t"Q;T$Q X$}I1@^_[]USWVP|$1N=,ujh=,#t\u#uGWtjxGj jW 9/>3i=)Ë ,,t 98t#@u $jqt!8h $1(Wh-j9- h-hU-j!-^_[]USWVP|$1N=,ujh=,#t\u#uGWtjxGj jW />3i=)Ë ,,t 98t#@u $jtt!8h $1(Wh-j<, h&.h-j$,^_[]USWVt$totij/V( 1tEt\N1B1߀Ѐ r&,uu A1.MCAuɉhJ.j+1H^_[]1jÅtU}tOCMtHE1ɺbCtMt$mtc ЉCMEuCjs-S CS>tKt^?tYڃCKt6C;C C})VWh/j*Sh.C=,t$,X Vhb.jW* 4Vh.,,1Wh.j** Sh+/}VQh.j*USWVPϊۉ$ts)11JDhu.e[YAuۉ4$ALÅt>VY,FN4A1RL113WX1J 4$$p G W JT>T<OAkdT*KOW JD(C KOACOAC OACOACSPV!1҃ډЃ^_[]fV1=,u*jh a ,uhb/j1(1N^USWV ,1Nt$$4$D$,$qvщ⋶0$ i )$t9,$C 1K1 uCT$3$$K3 $ tqC݉ÅujËl$EP $$$KCs{ D$C $C1^_[]Ët$ h 3PEL  1$$CHC1FwCE3WSNSCh/j&1NwUSWV,t"t$4$r$ ws^_[]Ë,$qvщ i )‹3i=)ƋDt1ًP1 tD@|$t6jtx@ LHDh2jY 1^_[]USWV̨,CD$l$, $$$#D$0$1ȉD$ D$4D$,$!É\$ 1Ӌ0$݉t$ t!‰$/>3i=)‹D$4t1ȋV1 ttv \$ D$<jj |$u^<$tXjJ1ɉHT$, $$$P HN HF F t$1 H;@u ̨,-Ԩ,Ш,Ш,-Ԩ,Ӊl$T$tQغ/>3i=)‹t01ڋh1 t@Ш,=Ԩ,l$T$s}ډD$0! umщjt[Ԩ,=Ш, tIjut; $1ɉHxX V PF D$,$$ $0$L$ ,$&D$,Phl1j  h1j1^_[]ËH@ T$,$$ $D$ ,$ǂ0$V1=ب,u*jh=ب,uh1j1N^WVب,t813i=)Ët%H 1P1 uH3L$P3T$ tf@$׉<$j(t^t$TtAD$GD$ Gw oD$,GD$0GD$4GD$8G $G$<Wh2jj ^_[]USWV ب,1Kt$/>3i=)‹/uPV Džj$tWWtN$$QVQ4y8~V Q(y,~VIlNF ܨ,F5ܨ,3Wh^2!Wh^2j V{VhG2j ^_WV5ܨ,t~1Fܨ,=,u~ t v6蚫̧) Ч)tWWvvvv 6踫=ԧ)t v6ά6V5ܨ,u^_jhÀ=,u1WVL$T$t$ ,11H<>u5Guu%P=,t,11@^_V|$ |et$>t\jh)!PO< t )=)t#h2j|j )1H^USWV֋|$1PPQ跾  .Eˁu񍎜9sAu19t1NuSPh6j^_[]SWVh1Njh2SHu3h$WHu!ħ)u9,Džu91FWSh2Voh$h2h3V WShK3jL1N^_[USWV\$hSb1N|$1h$UWx; O$LJ4$<rD Sh,h,   Ph,h,  CdUUP %($ClUUP 8$CtUUP <$C|Uj P# |$x$!Ѓjj P褼 T$X$H$L$`$d$1ɉ$$$$эrr 1t22uJLJ$)$1ҀK¹ )щ$:LJ$LJ4$)$O|/t_5tZLJ$)$x$|$ށ$LJ$$$1|/uD^_[]LJ$)$@LJ4$SWV|$t%\$RPQ; 7W1D$ereRPQ: ^_[USWV $ $Hw.$  e| Rh3{=,x1ۃd|Rh4Q1l$ hVU8 $ jdPU$,H: $$$Hrjtr$@ L$ D /f@ 0 whq3h3h3h3$F1 $F2 jdPV9 fF0 $j j0P7 , ,t,T$L$@$($1l$oL$tfA 9r'$ 0I9߻Ér119rD$ )Qj0U+7 $ 8$1l$wL$|fA 9r'$ 0I9߻Ér119rD$ )Qj0U6 $ J<$1l$$fA 9r'$ 0I9߻Ér119rD$ )Qj0UL6 $ $H=$1ҍ$A \$9$ 0I9߿׋$ Ér11$B x$|$$A $9r+$ 0I׉9ݻÉ։r119rD$ )Qj0R^5 t$ h74$%$ $LJ$m9rD$ )yQj0U4 1L @=u1@eu1$$A9r'$ 0I9߻Ér119rD$ )mQj0Uo4 $ t%hT4j 1F ^_[]hD$P{1Nxjh\xNj$  11WV|$|#t$ >tjh)!W 3 t1H^_jhy4W2 u(=,u,u,h4jjUSWVl$hUh1N\$1h$WS93 K$ǃ4$Yt"Yh PQ4 Ǎ A/G<rH )Uh,h,o   Ph,h,G  EdWWP袴 %($E|Wj Pݵ |$x$!Ѓjj P^ T$X$H$L$`$d$)ƅH<$VP$ yEtQQP  ƅ(8$VP yElQQP˳ 1D$@$$$$$ȃJ-σwY$ <2ǃ$)$Qgtxu4-u~t6h]VmDžu'00kPVhL6jH)1FUW t5Ë$rt$Vh_6j$_Ft1N1)t W5^_[]fVjh$T xKhsP2,t)h]V2 ,1u;5,]5VdU =8,th$h7j 1H1^WVPD$$|$t $,t$h, P,t"=x,th)j jx,)5,hWk 4$VWo Wj / ^_P,t$L$T$ $RQPn 5,>XSWV|$1N|5 ,t,\$OPWS4 t;j Sa1t^_[SWVPD$ $|$t $,|$t$h, P,t"=x,thP)j ix,)5,hSj 4$WSn ~VPhhh)i h)j  ^_[fUSWV} u7 h j \$1hWV LtPt߃95,)D$hM ƀ8/h77V趆ushz,V褆ua$PV/tKD$Ph?t4$3D$ $3L$ u$3D$$3L$ t1PPs ƅu j02V hP)\)@uj{_hQxjS Ph;7h)Zh jP_USWV$$6Q h j 1Ɉ , ,1Cht7VU~ e~%q~3كrtރvt_x,ŃV.PtrكRtwftAi, ,뒃Wt6duq,z$,l, ,W(,I,;u,)9|=,u 1Ĉ^_[] D$hy j$D$,$S* I9v9/u؃@]9v8/@tj/Slt t@À;.uCt<.u{t0\$u h8C\$0,EHu]j$8u 0,PG]j,,a$8tӋD$t$ VW貥 (,tRtD$WrP =,u *8ts)8?ti)8t_WhuHtj PWhf +D$@uD,u;Wh7˘0,;;=$,uW ڀ=,utV/tD$%=@t/==,u uWsWb , ,х ˉ4=(,u Ő=,t@jPt$ u h~77P9 u(8V NjGHHf wO$L7=,WOwP"{jWV GG \=,uWOwP:GHftIfgft9G =,u Pr PW}G  Gw|a ,'8=,uG ?tow PUhf\ c=,uO1zuSwqt),t &8t1&8?t'&8ut/whW0,VW Dž6=$,u =4,t4,w wL hk!jsM ww PVhfj'M 2Ph$8h)b jX4,USWV΀= ,uLVh7h)a h)2)H ))H )01C=,,l$$#E=jRd%8D$PuV =,uvVh7臔1Zh)+Ɖt9 t4)H )~)H )h)+ƒ1ۃYÉ؃^_[]ÍD$x tC1Puݠ 1Pu= VPWSD$Ph7h)r`USWVAӉ΅:#K1jhV I $ǍD$PW.D$3CL$3 D$(3CL$$3K #D$ =rD$WH 1PPPW D$$h PQq KXS\Ѓ 9ЃT$L$|1ҹ L$T$ Q$PWF D$L$D$)T$T$ 9D$t;$SV觞0,Vh)#0,VhWH 1@e^_[] F WG u1PPPW uh h$Pf KXS\Ѓ|X 9ЃT$L$|1ҹ L$T$ Q$PWE D$L$D$)T$T$ 9D$t1fE W@G 1PPPW h j$P KXS\Ѓ|^ 9ЃT$ T$L$| D$ L$Q$PWE D$L$D$)T$ T$9D$tD WF j1PPPW9 Th j$P  CXK\D$L$ ȃ L$9T$ ЃT$L$|D$D$ t$$!PW[E ;D$t$$P$!PN L$)L$L$L$ |$D$ hC WE |1PPPWK fCXK\D$L$ȃ|onr \$9ËD$| S$PWC 9D$)؋L$D$ظL$|C WnE 1USWV\$l$UEtMƊAuA)k') ,j=UlGG SYG8,<8, ,t^_[]Ã=,t^_[]USWV\$tKƊAuA)k')Ƌ,8,1Gt?uSKtmt&uS2u48,jVJ1^_[]ËD$t @ъ@uA)k')8,WVt$ >tVG t|$u G? ,wwW ,u=,t^_WVt$  ,1<8,t8,VPs8uG'u ,t^_Ã=,t^_FUSWV|$tWBuA)k')8,1t(l$sWtu tC uމ^_[]jt$ }t@1ËD$L$ pqrSWV ,ƍ1P 1 8,tQ:t @ C'u9 ,u=,t5h jVW~R1ۋph L"p8,)HQPP)Q C9uW^_[hK'WV11 8,t)8,Q:ujPuFȋ G'uƉ^_USWV|$u \$k1Ej=P2tAQUmjUtGUh L!w6+)HQPP)Q UhL5)q  1F+b1^_[]VhrPtauj4$,t$1P ơ$,H $,@u1^fWVP5,)DBuFGut t- ة,]$L8NF밉jWV ,, Gjة,,1D>GGuGP,WVP  ,8^|~u$PPhnL~=v VF&"#x~+umF's)l~-uSF(YD&KFF=teuZ %VF=u Fȉ5,^_ÊVF|uܹո ѹ Ǹ É)B$:@BGuVPQh)LNfUSWV|$,t$(SD=ة,jLVt:xIuxNt@jLPj V1tE@j Pt)=ة,5ܩ,5,"1,=,uƉS^_[]ùLV=,)u ^5ܩ,QhQMnWV |$ |$wh) l) ,>t'F ,Q,N@>vuڋ7 ,Q,t @뭅ԯ+h)@P5,VrƉRPhJ 1 ^_USWV8׉ˋ ,,D$ L$L$ƃut/F r'T$T$WVyӉڍe^_[]Ӆut&L$T$SWt$ Ӎt$SPh+jVGNjVt$  USWV Ջ\$$St$$tƉ׃=,%up1҉  ډD$$=,&uU1ۉ D$, ,ME \$$L$SPy t D$$ ^_[]ùLSWV֍Qȋ\$L$|$$8  u !ڃ SQWVR99 991|111 Y!!i t_1Y uUI%3 -)'11!111 1SQWVdƉ׉^_[߹M MMwSWVP=,,,Q!Ɖ=,=)ttxt>u!1ۉSPVw  Ɖ{9u$8t*j8u+$t@G t$@u^_[ù-MI USWVPՋ\$St$gƉ׃=,uKh$, ,MEO1ۉ  Ӌ $SP 1 1^_[]USWV֋\$ St$ ljա,HwSjP ljա,uND$, ,N1 D$ ˋL$SP| "D$1^_[]USWV։͋|$4\$0!TH, ,N"ىWP1Eكra$"ى=,#É,݅~h, ,2É׃'1H, ,NLىWP1 1, ,NىWPÉ,L, ,NىWPe$É׍Eكw,|$4t;~l-,b1A1Ǎt$WSh+jVHjV5,0't1I1@1l$QPh+jU]HjU6 ؉^_[]ùLTLJL@USWV֋] $t$ơ, ,L$ D$T$uPV֋=,Ww,e8e}uPW ֋=,ȃ}tً$VPt$ ֍Gwe;E Qȉe^_[]fUSWV)$1hqM=etuj$,0\$h,VSgS U @Pvá,)QPS2 ,)١$,pQ@V PS> $>jhƅu)htM >-u~u5,u5,$>?t<.u 1.D8t/ua$Ph?聃tGPVpt6$3D$$3 $ u$$3L$3D$ 1e^]Sh薸t/h胸u$,8Ltj$,8j75,uj=,5) )f`5,)HQPP )Q 5) )@u1[hM]<0PhMChM9SWVWMWP蓏 u2\$V8"u6WWPa tVʜ,V话^_[Åu0WPh&Nj,tjPhMY hMfUSWVD$ )fa1Ƀ|$‰tpыLh S$thfSu 1t$.4NJ]taM\uNEU\rw$ 9\0u!11ЃwxAunjt$>)HQPP)Q t$.PN    ȉš)HQPP)Q<$t*)HQPPK)Q 5))Hu 1^_[]ÁfHh:Njf,uL$ ,jP$ V= ,t ,K15,0ppp VPj' 95,t =)ujVV^jpPT$=\,u \,D$ $1APV, ,t1It$a<VPL$T$ D$$PD$\,jWVP|$t$D$$M4$ WWV׉Ρt)t h)9ty u hh)3= ,P,uPhh|)@ =$,t5$,hh|) t*t$ Wh|)& x4hw&h|)xV=Phh|) )HQPP)Q h|)_^_SWV|$t$\$!SWVPt$ T$D$$1IPVvVt$T$ 1It$VXVPt$ D$$4$w^WVt$ |$WY^_PT$D$ $1IP>XËT$1It$)Vfl9T$ L$9upu'0fuQhn!j h,,@^1(,0,4,8,WV|$ |t|$wh) l) ,>t'F ,Q,™N@>vuڋ7 ,Q,t 薙 @@,15v+h)@P蓖ơ<,PV @,^_USWV\$0t$,|$WH5,jVh jN=X)thƉ؃$1t7=Ҩ)u.D$0t d $uQVi=(,u"W;j=X)u11EgWߖu @,D$0u^_[]jUSWVL$,|$(Ҩ)06̓VP$L:Uw1ۀ=Ҩ)_=(,Mjw1ۀ=Ҩ)1=(,$=@,jwH1ۀ=Ҩ)=(,=@,uQ=,tjw1ۀ=Ҩ)=(,=@,t  u8V试1tu @,1l=,tRUWJj\$0SWH a=,t&WD$,E=,tt$,WK_=,tt$,WE\$,SW=,tUW=,tUWdPhOhh)5k=,tiwww|- @,@jw1=@,@, jwa=@,t @,1V,VL$,=,t =)t @,tu u^_[]PjUSWV<|$P5,D$$w=J)tttn,5,PM$PahOTGtj P5) KȅuhO$5)l$UE tc5,5,<$t&4$hO5)x|$@,\$T ,-,j wD$ ,u=,tSw ,5, ,u=,ti<$t&4$#hO5)<^_[]j5,L USWV\$;s=J){,5,PPhOstj V5)$ vhOpu hO^)HQPPV)Q 5)l$ ,ttu ozt=1ۃjUzSl$SPO| tuH@,Ju ,u=,tjs%UsV~@, ,u=,ttJ=J)tA{t;,5,PP-hO 5)^_[]SWV|$4,jw)1=Ҩ)t 4,5@,^_[Ë\$1(,u/? @,ut΅tSw5@,(,t"u8,,H ,,K(,jw=Ҩ)tru+,,H ,,(,1 1@65@,+USWV1=Ҩ)t5@,|$0D$P衎m[thUS, =(,tiD$4,,$\$4>G,=J) ,PQUPlh!_w T)HQPPL)Q=u )HQPP)Q 5)juw K Sw5@,=Ҩ)uZ(,t"u*,,H ,,9(,m"u,,H ,, (, 4,5@,D$P6 ^_[]USWV|$0t$V@O ,jPw* _1=(,1{t'G,$pWUuuޡ(,[tZtT1=(,uI=Ҩ)u@l$41; u{C,Us t=(,u =Ҩ)tʋ-@,-@,V> ^_[]USWV\$K1t@  ,PSuƋk1OuD$}t1{PuVNw uR ,u=,t~ jW|$x4$ jt$jux W <$t$ mE1{u Vy@, ,u=,ta^_[]Åx W3 0LPhOUSWV$$D$1t$ ,D$$ ,D$D$,D$Ht$05H,$PZ5L,E,L$TIEtH1F\$Tljtw|uG,hSW%( 1ɉȋOυuNjL$Xu ! L$4IEt6t$4NjG,wtjVW' GDžuԋL$81D$ D$Tt D$ ȅuD$ P脈$D$TtH$r4$ ȅu$1ɉL$@=)t=8,u|$ ~ $@D$@D$ )$=J),5,PP4l$41dz=u))HQPP)Q9}j=WƉt>u)HQPP)QFPU 1Ո`1t$TtOË$t))HQPP_)Qv É΅u$u t(PV5) مt ȋN΅uء)HQPP)Q 5)g|$ +t$4~jh:W u|$$ƅuf|$> L$0|$ $NtW11B͉|$<ËE8-uwH-uxtd$pu@؉Iu151ۉމ)tf)D$ $t  D$$|$ uT$|$<‹$t$t$$t$4V0fD$+ fD$D$> f=,t*fsD$= t= u ft/$}u$D$@f%u D$ ,jUoD$,ED$D$tD$L$\ N=)u f|$t$Ut$4q t@@,|$D$D$\t$` D$,F L$ ,=,tyD$t;=H,u ,=,tNt$\) jt$d L$D$HsI|$D taD$t$,3s@, ,=,<u D$1@ $At:ʉ9-)ЊQ-t uy8‰uD$}t } k,D$(,H,( |NjD$ ,xD$(,=H,H,01PPWM s1ɅȉD$LPV0,\$lf4,D$ H0,$8,1<, , ,L$(,D$D$dP ,u=,tP$VG  ,D$ 5,|$tD$1f|$tH ,$,h t$8C8,H 8,=t$L$QP 8, ,t$]D$(,D$D ,D$H$,h0,,0,t$lD$ ,|$Lt ,u=,t?=(,u 1(,,,D$5o$W ,D$ =,h!t$8-5H,t$ Ut$8omJWt$ Ut$8nD$ffD$0fD$8D$D$u#))))@L$D$P,D$lhRD$h,D$ D$P$W t+,D$|$D$\,=,D$$ ,9t;D$= t=+ u),D$(1,D$PL$$PQt$u |$ uD$0ufD$D$4T,1f|$ˆQP@$P,$$,H,1@<4,)D$<,)f`4$t$T$$L$t@,D$ ,)h))|)#|$PtD$(,T,D$tD$lP,D$D$tFD$t D$f|$t$h{P ,=,t|$D twD$u)F ))N)|$@tht$Dh!= $Pr~^_[]h P5@,kt$t1=H,ȍPu =H,u"D$4thB p,ȅul5H,t$ t$,Pt$=,uS˒'h,P}h0,貒0,t$l|$LtNt$d8D$(,D$D ,D$H$,D$ ,jP˪ 0 ,u=,tVPhP,uH,j读@,t\,1虻WVt$tr|$w$:j Wv  $@Fvu;Ftj WP $jpV! ыF @v ?빃^_V t$t8>u3Ft,pɣtF ,QjRp@ ^SWVQ! t1OS jjP t6" >F1"jjP tv ^^_[USWV|$41GGG =Ҩ)l$0\$SG{ ,AjUejUPf uA ,=,t{4$W 1CSt$5SUW\$t$- $w ,u=,t(Sz^_[]h P}VPD,u1PPVPjh )蒒tF$PxD,t.1QQVPjh )]tD,@=PATH5D,ŝD,()()^áL,SVj*$,8u1^[1ۈ)¨)q5T,thB v 65$,J ,SSQPV8,á(,ËD$ (,,,PËD$@,, (,1(,,,Vt$ |$|v_PhKP1@ 4,9~1Ҁ8cB(, ,,1^WV15@,V$,90t\Wx$,0PjPtG5P,50,8,@0,ju50,IWx@,^_USWV$,$j/Wt@D$PW[D$ %=`t|=@t}Ā^_[]ÉjWS tFƍl$UV[uD$ %=`uVwjWS_ ƅuWhsPWh]PWh7|L$0,x 0,V|$|D$ p荅@,0,58,uu~9} ~ (,,,^11@1USWV4h =|$$W T$ _$OT$PŋOt$@ËO |$0WPVSD$PUD$$Pt$hP5)(14^_[]UWV׉΋ X,uj'ok< X,11D$ T$l$ eD$ $,$<$\$ D$PD$i?6u0uFjhgW] %Wr|80uHx.t x0@te^_]fUSWVP|$7j/V%\$ jVSB Ƌl$$$9=`,u0t$(t$ WV,8t"8t $Vuj7S Mut$(t$ WVL$ $Aƒrt ~u\,7jQMPVhfjSWVt$|$t$VW {t o^_[Ã|$u0jWBC6Qs,,P,V聆jUSWVPD$tnt$ t%1;t <:t9tGt$,89-l)}t,; h)t,WSQL$ L$ |9/u 1xAA/D$PL$Q`,E9u,;E-`,L$Et <:tEL$<:t1ED$(Q $+ h)AQpr^_[]USWV$1C1D$ 1D$D$D$\$hPSHw5$:\$މD$Љ\$ 1Ɖ‰\$뼉\$붅ut j D$ D$ D$u1El$ l$l$ $,9A$,93t$$1CjWtV@wM$<;|$t&|$ t4t=L)x'@ |$u$,H $,8u,PVD$ PW9D$ft $|$t $|$tftjWt jP:.뇉4|$ÿd,/tPEȃw?$L;|$u/|$ u&u |$tf<u t$Um묃,r5)&)$@thPW1@$$$$^_[]SWVt$ ,d,t5Hftfu95L)| Pg9p}Ëu̓,r ,t^_[Ã=,t^_[USWV$G$$\;o,EjWS PoM䃼$$twhPVhQGPhZ ,wHPQ] ,u=,th QsD$PfhQY/thPFhP9GPh t*)HQPPz)Q*)HQPPP)Q ^_[]ÃPWhQSWV|$tWȊ Bu%iC)ʾ!)!d,3tFWPtc6|$tT ,WPlƉf@@ WP ,u=,t 1,^_[ ,,Q舑 ,u =,@USWV$$$j/$turfEE^,9tth5QVy/t $j$q1Ʌt@@t`tm$umtisD$ P$PxfE$K88$ u=L)x $u  \u =L)y& u $MƋ$1MtfyuL)YL$$j$P 1OD$VkG`,tAPh6Qzt$t-'5`,h>Qyt>/u19}-9j$$PM ƅvvD$ PVNOx3D$(!D$ =u8=`,$Nu$8t8t D$}o$E$\$|$$t$t'5)jSfP$h!V fEo$T$pƋ$$ ,|$ÍD$ uj$HfxT$ ufBuω7 ,u=,t ׅt"G GfEG EG fEGE fEEĜ^_[] ,T$ Éuj$fxE$ufBj ,tbiV2C+h)PhVgj$t3fxu*SVk$=,V$hCQ#SWVP|H1t8|$HL$8u%tWPYL$ t us^_[SWVPI1t3|$IL$8uWPL$ t us^_[VIt%IjPf@NHu^Vd, L)trft fuxB =,r^USWVP\$=,1N$'18t'u<:u M $߉,$:u ,$߄ut.<%uyCPh6Qut1<:CG럡L)y x5L)1Ʌx $y $Q5L)^_[]SWV ,d,>t+fuwW߉?u׃,r ,t^_[Ã=,t^_[WV|$D$  ,jP+@ft*fu v fFGF GF GF ,t^_Ã=,t^_ WV t$D$L$  ,fO )fOP~GWVU ,t ^_Ã=,t ^_jt$itfxupO%1USWV t$811G$1D$hXQ!ot"Vu$܃pt vu҉Ή|$ȋ6ct l$‹$ШP$,:KB$,*#$1\$ D$4$߅u U:=?t,]??8uUPujULƃ<$t0vh4$$,H $,(t|hQj v*tuhQvh$$,84$t)HQPP)Q l4$t%UhPhQ+hQ,|$t'}4$PjD$PU51T$(jU4$PfT$HL$ʃwW$l;D$j/UjUV ~G0Ph0n:uhhQR4Yuh RBu hR7t.Uh+, t$|$tJtHh4Rt$$,H $,(ouhn{P돡,D$ FjUD$PK PdbN<$u |$tQPhQSht$ct$1 ^_[]hnQ%Qct RVhQ Vh\Qf1PPt$  5h)@P`USWV|$D$\$=ڨ)t,H , h) , l) ,1ɉ , ,H ,Sp,tH ,~,,*cH ,,+h)P:`,,u%Vj`p ,,s,UVW,-,5,x=tE,0va5,΅u!}b,,2V',,t O,G^_[]S1HL$ʊ߀ vB@u;Ѐ ߀xsBuB u ZBtB@)[USWVT$,|$(D$ t,,t D$) 0,D$,+h)D$?~uЃtRWT$4$ D$1@D$ wy< ,H ,f,e$!PVtVT$0/>u!y@u=D$ D$,$,H ,R,Q=,un,+ h);L$~[xuUH,Q,H ,,,H ,,$ |$D$5ЉD$$ ,H ,,S_T$,H ,>~=u|$ D$ RV"T$4| u,,H ,~#,%^T$,H , X^T$,H ,$9Ut$ T$4,+h)jPHPT$8 U^T$,H ,>,H ,~, &^T$,H ,8 ,]T$,H ,,]T$,H ,$^]T$,H ,D$$ 4|$tu^_[]USWVt$,\$(=,t,,t$D$ )&jlZXNF0,D$ ,1oO9R$D$(4ʼn|$L$xr8*u [t?uߋ=, , ,u(Q9PW ,NQP5 ,| , ,u=,tX,9t31Ʌt AuQPk!u=,7vA ,6^_Vt$t",0v5,΅u^V5,t1 ,6P{5, ,uۃ=,t薼1,,^USWVt$(PW,+h)PVh)Gtp}t  KvA! t?/tO:u= )tAL$,u8 ,Q,`YO@렃tPW^_[]Ã=,u 2Y,h)8t!PPhtx PWWu$hljP/WGD$,tÊE$< t< s4< w*,H ,~,XH ,,H ,~,`XH ,Gy PChUSWV,L$DD$@L$L$ X8L$@1GL$j=SzFD$(|$$ \$ D$u.|$PS1ۋl$L$̵,L$+l$ 11G,+h)D$D$!D$ %t$QPt$6L$SL$t'1D$t;u;@L$u,,+h)=)T$t&D$ 1<*t<@t1 ws 1D$k ;vD$1|@uB\$,H ,~\$  ,Q,@V,\$ P,C\$ M1L$\$|$ U|$JD$CŠE$< u2,H ,~, T$UT$H ,,H ,~, T$UT$H ,Cu>M u",h))£,,l$l$1\$ul$@ %D$ 8@u =0,t1E L$@11|$@t$|$Wt$ \$SVlWD$(D$aC< w2,H ,~, T$sTT$H ,,H ,~, T$ATT$H ,Cu1L$D$L$I q$;|$t,H ,~P,N1G>L$u0L$ QV1>t5,R,uhSH ,=,+=h)t$ t$(l$Ut$WVu,=h),)=,U1G,+h)SPt$ |$t[1@Ftuրut܋ , ,̀tuŠQ1ۀ؉Hu,^_[]ËL$ QPhR蟵USWV5,+h)D$ ,,D$ ,D$$,D$(,D$,,D$,-p)p)|$0W:P+h)P2tc*<) t`,H ,~,)AH ,,,)@,5,1,^_[ÃЃ w§j PV!{ 觧8ű$<=tuw~;50,8,b0,D$58,ØD$D$‰؃AD$$Z|$ T$L$T$|$,E$< u*,H ,~,?H ,,H ,~$H $ ,Q, ?, $Q$ P,$eØt2H ,,H ,~,[>H ,L$$S5>H ,۸,,$Ø/'E$< u*,H ,~,=H ,,H ,~$H $ ,Q, =, $Q$ P,$eØt2kt!Zu忀ރlt puԉпɁu$,tg8tbPhsY m=)u = )u@$,tA5)jPvW:$,H $,@ujY W5) 1^_USWVPϋD$dumT$ ƒ$ʀucu^L$$0$$@QTuPh3W近\\D$XV\$;\$t $݃t(t# $ttt t t $ G뵅T$9É\$th CjD$P蠑 ] h,)i5rOC-`)+9tti-;)t RPhVjl$ UE\$D$P $t+,D$0h VjSS\$ڊŋCt:tBuM ,%PhVjQĐD,ingD,Runn}=tQll$ ,j SP/ D$xxl$ ?S=l$ ō,@)QPhVo/ hI jQ2 ݍ,PWD$P]݃FD$ ݋\$GHO W茋H EuݍCWP$u/1M|t؁PhW N1MM|FGHO W"H GHOl$  WH|1GHO WڊH ~T$KWID$u$$@u P|P^_[]USWVP1WWj ƅ~WWj =¨)$tCt>5\) B9t%5\)BPV蒷 $=l,~y\$t$1=h,tEt*t t.<$u u/S0=d,u WE;-l,| $^_[]0ihjPhSUSWVD$4\$,tl$0|$WUS ƃu蛇8=,t ,l,h,D$\$  ɉ$D$D$1BT$E}9u\t%tTuJ|$u& |$uEƃ1O|$}D$4t\$tЃtЁt D$i9S|$l$0u=1B9t$t1oh,D$ l,$iD$ 9T$tcu tQ=,t 1=)uL$,uP9tPtu )P ,u=,t<^_[]Vt$ ,9tPG@džƆ1z ,t^Ã=,t^ۀWVL$D$ u r..t"~X1>tJu1iDu.t u =uɀ 1ă^_USWV,1۰D$hnT4t$ntpueL,D$˅t(1PPS辌 DjS耙<=d,u)D$$,(l,-$,~6@ h,D$u}t!AH Et~1jPƅt<u ED$u 'u G 4$Eu$,t .t111D$u$l,L$L$ D$ \$l$ h,@1퀹tttVu $́H΅2u61$QPj m,$t/u # $͊u+uu U$l,M$jU9 L$ tb|$tMuID$1rȋi4hjD$$PR,$D$D$ L$ D$u U#D$\$l$t/~Ot($l,\$l$D$ tUD$ tMjPS; ?jVDžtjuS =)u V 4Ń퀉,^_[]hrT}ShT }ShT}USWVP1$1C11hT/1it"gu$ڃjt puЉ̉( $,t yjPƅt,1th,)i5rO@PhTH$t#tH~1i0 tPh3跅11G^_[]Ã~1i4h)HQP~G ;| Z %PG ;| )Z;|lhTw{hTm{D$=d,tjPot 1+1PhU8{V1=d,t. l,~$Ah,1F:uI}^USWV=d,u65l,~%=h,Ft W-Nd,l$l,~"5h,HI} ,tfiPƋ-h,=l,iPUVDr ~ ;uKuU8l$hƋ=l,5h,i 1҉AJw)׉=l, ,u=,tCy ,fdž=)1\,1B|iP  ,u=,tx^_[]SWV\$|$Cƅtt.VSt$W\$<$D$ #^_[|0v^Ph>UxUSWV|$ ,tWWPy*15,,,VV*y5\,l$t$t%t =¨)ttttk0hWj,zWj!zt uuUiul1V股 Vh1$蔠 tOh1$hRw5Vjߴ uV5\)謪 tTWj/vWj$vt*=)t!Wj vWjvWjuud,^_[]K{0\hPhSMwUSWVt$ l$|$1ۃ=,t/t*=¨)t!ttSV u5X)tEL$ji4DDt QP ^_[]WVD$t$ N t,=)u=¨)2t=x,P=x,~t,>f@..@.^_WVt$ (  ,NJujVj& 瀾tW5\) <u%+h,i5rO9`)t jVpt=tu  ρπtt=ttu jOu V ,u=,tt^_y0ZhDPhSuSVD$L$ =¨)t1ۅ SPj> ^[Ët$1҅tހu1=p,u2d,u) l,~h,:tzt IuhOUyp,1@SWVt$$=x,,1@J k-$<hUvhUjv!~ tChCW|~t!we?thtU?ۃ~WhO{h}v#hF YvhgUvhlU>vhxU)vh|Uv~ thUv hUURvv2h!v h#jvhUv*hU`hUbFpTh#G~(wh$w > UtUPh8vhUvU'1_1UUU1UN9tQhjSy{SW{uF x PhjVC{Vv h_=1hqU+hqUv hU^_[USWV fD$ t, x,l$ 1D$U$u1!" $x<]1x&~'t!=\t_"t $Q\$ \|$ B]ڃ U tU,$$׃߻p!!$}D$UU} uV$F )4$<$zT$tvӃux<<t ur>u<<_pE~FЃ rU ,$tU\$҉Ӄ9uG8,$"2D$1&<<:<$҉$D$t#@ʼnʉ]|t GhJuJщɋ$t t"@I x,t, ^_[]WVt$ t@|$tV`~t"hChCV8vu^_ÐUSWV$t , =,D$P T,t D,X, $=,z1jh=S `P>;Hx@u8/UD$PVx D$pL$t 1D$tD$p1ɋ팯,9툯,`,tH1 8t:tGt89=l)V 9=l)~`,5h)WPV`e >?8V<=, Vp: fiDle cDhangD ged߉Vrr)HQPPjr)Q D$pL$t 팯,툯,E;-,1-,D$PĔ^_[]'>fUSWV<1UjED$hhh UPj  9u 裮 9Èد,j UP  ܯ,jT,h U%QhFV$P ),$h,{4 t$T|$P,,),,ɒhD$PVWLVWz=د, Àuv=)n$hVV,ttQu \, @,<$B=)5=,(ȃu6(,,(,$,u轒=,u7)HQPPp)Q h|)pD$P ,=,ti$$=د,u>h{=t1PhcVQPP[V$=)u ) د,t N=د,uEt$(VhmVj{t8t$PFQPV$,=")t =(,tj<guD$P(,u/jM=)tFhN^qnh|)o*1ɀ=")ˆQPl=")u=(,tP),5@,&l$$#uSWVD$8t^ ,jP% ƅx jVc ,u=,tgx"1=)t=J)tJ)1G ^_[11=:)t :)1j袋V3V萋=)ttJ)u:)^_[%USWV|$(V11C=,t j1=)u4t0j5)jh|)mҨ)P=X)t.te=Ҩ)u\1Ƀ=p, p,jPk1;tW1R=Ҩ)uINu=)t7=)t.hqV]lEVr{$u蚈V ^_[]Vt$ ,jVT x1jP ,u=,t(fj^VhR}ft1Ã|$|D$pPiit$thV5ft$t$thVfWV|$ Wi@PNtWPԛ^_hVeSWV|$l)9~b9 ,؃Ptr d) h)l)d) ,u=,t dl) ,5h)>h))l) ,u=,td^_[hV#eD$t h)) l)h)j hVjM u6D$ d) h)H l)H ,H ,H ,ËD$ ,H ,P ,u =,dVt$ ,d);t d)P'#Fh)Fl)F , ,t^Ã=,t^cUSWVl)<k ,-h)5d) ,t|F9uud)PVc d)d)+ l) ,h)=l) ,tG90uC d) h)H+HH x@WSUPi[ 5h)=l) ,t^_[]Ã=,t^_[]bhV=cD$ ,h))l) ,u =,bV5l)p)x'|V5h)Pk N5,5h)l),5h)^V5l)+5,sl)),5h)^ËD$ h)) l) l)h)+D$ȣ,USWV(L$@D$D$@t-΍i11PewDGÉ,$Eu1ۋD$1 {)t$y)t(8Q)uƆR)u z)@uă^_[V(D$ T$P)9tu|YRPhYOt#Q)t(8Q)uƆR)u숁R)^WVt$ ~t)~tPcuvO^_WVD$ uD$p1F0,) ,0,=8,~-4,Ft7 4,1N8,1ɋu<, ,u=,toN1^_hYNhYN|$u1PjPPd ,jQ$,8t P ,u=,tN1ËD$Ѓ w#j jP% u<,5,ËL$~ND$tH  8,=5,u <,@,5,h@,h<,QpphZMUSWVT$4t$0|$,*td}t]L$$8D$u'1y:tQQ؊D8uEz:uy}9ՉtNt+9-u&yt i}-x-yl)@11GD$?11Gjh h+ZX J|$:uUD$8@?jPh+ZX ^jUh+ZX 1|$D$0)@<Ph2Zh|)U jh+Ze1?\$D$01@11T$4*l$Phj UUhUh]Z$X D$EEjUt$0X u0^_[]À|$:uD$8@:PhFZK1L$0L$4KTj%KSWVT$ H,tstm8u'1z:trrD8uAÀ~:u"9u $,Q$, tf L,1ɉ H,D5$,>1t6?-u1t+O^$,-uta5$,1^_[PhdZJPhwZJVD$ X)1qqA1Ʌ X,/POX)p ]t u 1%X)X)@j* X) u^qqh2[HJPD$X,/$OXUSWVA'ơX)@tu%'tƃ X) x,$@D$t.$xv18uWPNtG?uD$tKjD$p/t6NjpVMWPV賲 E$htX)@^_[]USWVX)@|$u X)A1p811+ǃu<Hs C)uj X@Åt"j tMHXE pXƉōGs1Gt,u|$uqX)@@|$Fu6|$uDX)@ X)Ap8 u7|$uX)@^_[]jjX X)ASWVƻt u j pxʡX)@^_[USWVX)kE1͋ X)x t*X,-,PLX)@ C1Ƀ8Qs s j1@X)HOH O oKy K9t?U1CSp軲 躬ShDP= X)HO@ G X)!^_[]WV@t$P X)A uyWJ wWhg\4?h\j"Q Wh\j"POWIuL$Lx4?h\Vh\jPOWUSWVX)@1u 1= )tMtݡX)@xuUj @jÉGpjaC+tX)@tj\(pƉ^_[]hd[X)t$p0h\EUSWVX)@$ uX)@$EŃCߡX)@$=$ X)APUj áX)1Ƀx )ȉjCjCUjjj 81VCs9jjN$:jj{Cj`Ce߃uKjljF j0G5jGtX)xJjG B u0X)x,u%@Gt@/@Guhw[jÀ= )tjjj X)H0+H8O U X)p0j@ X)QPI H pGu5X)~ h#vzFm|$FX)xujD$ X)Hu X)H L$ qx0j@X)HKH K {@;u.X)x }X)x|$ T@0GjG X)@t(HS u X)@X)x\$\$j X)HK @0CkuX)x ux,uh#pDj@\)1ɉH H X)Q0PCAHrAAtejC9t jW\G @:X)@ uX)@$EŃ!ߡX)@E<$t!t;tj XÉ{؃^_[]/ uS\$|$X)X0jbx@ X)QPI H X t\$|$D$C X)APsVL X)jj 5jj,jj#jj jjh#jjjjWVX)x$G HsX)jpW$ uqX)p(x,u~ X)At8 u @A8 @tHA~րxru\tuՀh[X)p0+p8j@ X)QPI H pG .PRxX)@F X)t1^_jjVt$&9u^jVVL$1GtA1B1t AGu^uVt$j@ X)QPI H p^USWV |$$tD$ D$$D$l$E1$X)xc X)x0$t $jƃF X)QVI N ~ut. X)IGtAt=t AGu1cX)H u' $uH0 $p$D$0FD$N/unL$yT$$9ugucP) X)A4FA~րxruwtuՀh[BL$T$$@ 1}D$8jXX) $+H8N~L$NL$$N @0FEPuj/vu uGP) X)+A8FFX)@4 ^_[]jjjjh[L$1GtAt=t AGu1@VL$1@A~րxrutuՀ1^SWV|$\$t$uFSt#S;F ;,}X;ܯ,~Pܯ,I;-u{tBuGX)x0+x8j@ X)QPI H xF^_[F h[lUSWV|$P)D$`=u ?vl$$5h)l),G$|$ t u # t19uD $ tC9u?,$ uP)X)HH }՞Mt9t u>u:<$ t=uء$)jWPס |$l$$uS\uN,H ,c\FW u%,H ,< FP)#á,H ,ƈF t=vP)=t h? uP)X)HH ,H ,=h))FV\X)xP)+D$^_[]USWV$$1҉T$(T$,D$05P)X)r0=Dt1$|$(fwt$$1.fGo D$j8fO=h) l) ,=FT$ u T$ ǃ=, T$ NjrD* $>=Cu f|* ,P)GX)m=C f|* uD*f?T!pЃ0,0}, L*=Efu ,GrNJЃ|$kT$ @1fD T2fTT3fTT3fTDEfD(Émǃ( ,T$ BD ,GrNJЃ|$T$ @1ɃfD T2fTDFDfDGfD* 葚 u= ,\G諝*Hfhfh ,f|*D*D$$$D$щsT$ f|*  ,GBfL Cf|*tD*t ,Gf|*u D* ,G ,Ã{t G ,uE+5h) ,E{u!#n#}D$D$D$1Aftf|*u f|*Wf\$ D+PD$؍^X|'$r@L$ L)T$1fD t$ t.ftfLfTDDfD ,G1AL$)j pËT$ BfL  ,G)P)X)@8xt X, X,$@7ET$ Jf| \`"$}f|  ,GCt蝚D$$$D$t$ Pž1۹$X>T$ D*wD$NJD$؃|+4+$@L$ L$1fD t+ftfTT$fTDDfD [$!sNsD3=C ,t$sNsT$ ,G2f2$FHFðD$D$D$1''T$ uB|C ,GE$Ę{   P)2t$FHF ,GGljȹ T$D$D$nEf| t , ,G\E u ,GJf| t ,Z , ,GD"{Ń'xr 谗it$,sNs ,G1@D$U2 )`2 ƃ<$ ?\u\ g  w h1袓HЃ w&Hw ÃHÃéNu  )Dy|$  j}D$D$\$ t ,ErNJЃ|$T$ @1EfD T2fTT7fTT7fTDEfD-ŕ ur%=m =, ǁT$ $ ,G?ˀtw ,G ,@݉= t]\t 'u jؑ t =unP)X)1Ƀxɉ X,$1 ,GT$ L,H L,~P,H P, 諑ËBDeE$< u ,GT$ , , G?ɀtw ,G ,x?ˀ# ,@D$D$ L$ }Gt.,H ,lLjG/ GuYKЃ w4,H ,6LjG ÃЃ D$u ,] á,H ,=|$tO#tp%tk1:u  É\$D$$? ?)AT$ O}L$ 謒1ۋT$ L$ )1#, 9u1ۋT$ Bf|uf|tˀAs@G ˡh)0qL$ rNJЃ|$T$ @11f\ T2fTT5\5\t5ftBfT1fT|$ ,CfQ fQ wS ,G ?ʀ ,G  ,G?ʀtw ,G ,H ?ʀtw ,@ ,A?ʀtw ,A ,x?ˀ^T$ }D$D$eD$ ,,D$D$$,K& ,G?ʀtw ,G ,H?ʀtw ,@ ,A ?ʀtw ,A ,H?ʀtw ,@ ,y?ˀt!T$ j ,AVT$ M??CT$ rD=Fr=Ctf|f|2^,H , T$ 5h)Bf|uJ؃t 4$t$bǀ>ts4$jjYl$ )GX)L$H,L$$H <$X)pM tΉ$NuX)xİ^_[]1Mo;-,};-ܯ,~-ܯ,>u6y1E[&|T$ >y1&&tp>T$ to1 t=u]럃F~t\u^ P)@P) X)A0ytX, KX,$'*;|u0d|X)@=t*訊4$D$D$CuۡX)@1v uP)X)HH @1@Q&X)@-X)@X)@&tQ;ubX)@ щX)@趉X)@X)@ 腉X)@u-\u?# u6P)X)@81Ƀxɉ X,PR% jjh ͅVȋ X)y8~0 ,Q,觼@ X)Q8rq8^USWVXӉΡX)@D$ $,D$:+h)l$$U  ,$~"Slj$S5h)P 1D$|$p-, ,u=,twP)D$-h)l),X)x t*X,P$X)@ 菄ǃ[~!\u9~ǃ[C tJ$Q u"P)X)HH s`un=ub\tX`tSP) X)QQ NDt""u$,H ,~E\E ޺\@ŋ ,A,迺@,H ,蜺Eh)@|$p~P諷t$jPg D$lŋȅut$ j耷EX)xtH@1D$P)D$jǡP)D$t5 X)At$ D$AEx%X)@t$ Ex l)9ًl${ l)9~=h),t1SUW} ), ,U2$ ,t\$=,\$t X)T$ Q,Nf|u%Du ,Q,@Vt$+t$ ,Q,Ӹ@~.F,B,ȅ诸AJ։ȃՃX^_[]áX)L$H0h]qWX<$t 4$3/X)@D$,jP jjjjVtQN^V X) ytA5X,t7t u(,,5P)P5X,\^USWVt$,|$0l$U辵5l)ô1BW;h)u(VG,9w&,WVSW U蝵^_[]Áw: t9v$P5,tã,$,랾\뤾]USWVT$L$ -,謆ƊJ) ,D$1|$0X)D$|$lWA tJD$X)J)Ve-,D$ ,, jU \$t$l$=,1F5 ,D$0X)$V\$S VhDP X)A |$t|$t=)u ]@݅u:T$1rIJ$JB J)VVRQ -h)=X)D$J)t$cD$,D$ ,؅tȁĠ^_[]jL$1jTfL$1tT$9Qt uÉV ,1t!T$qt 9Vt 6 u^USWVt$~tB\$?Eu ,tMx PQ' P.A UquF^_[]SWVt$|$9t V@ VWCW 9uW@ ^_[HW@ SPVh=^DSWVt$|$\$j ްKCxp^_[USWV D$$l$ 14$t$fD$À\$t j薰@,5,];,};ܯ,~ܯ,Eu9] u,tX9X,t-xt 9_t?SG9t S?  ,1tF9Yt? 󡠲,tHt 9Y jjS$? /vP.D$$Ft 9X ,,  >, ܯ,9|AQjS> tDžyjut1O tft 5,jSy> Džy/;8t18jjSN> DžjjW7> j ɮNFXx ,u=,tu,t$$D$PU m\$t ))|$t )) ^_[]j 5PShL^i0`0PShO^f ,1tT$9Qt uÉVt$5,j VH= u ,|Qj V*= u8FPj V= u$j j V= ujj V< t^hV^WV|$ t;G;,|.GP`ƋG9tVPWw< w^_WV d) A d)1F |*1FPWWk< y w P< gfff  ,^_USWV$$$~ , 8n$?n  ,t9i  V ,tQt 9j ] T<(J8x=ʨ)tNnjU: ƍD$PVZ#D$ =nhh_F݃UD$Pn: oƅtNjjV: !UjV: /nhh nhh U: ƅZ|'u" )9uu4jjWh: %9t!1PWVD V:  ,uO=,tF?1PWU y v 0PWVPWR:  ,t Ā^_[]Ã=,tĀ^_[]@hh j 6PWUh]iV9 SPWh]e1F5\,6V0Pt$hL688V9 8\,j0PUh(^|$ tD$|h@Pt$ < O USWVPO xR|$_SC=VSt$ B 1jSSY t!t$8 $^_[]h P`4$8 1EUjUjUUUjSj Vwt$  SV5, ,jV,V ,t^Ã=,t^U1=,SWV5,t4|$t^tCx P8 jV6u^_[WV, |;,| ,t$ Pj V\7 y2 8t 8u, jjV(7 9t Vw7 ^_Vj 衧tL$ T$5,0,PH^á,tT$,9Pt u7 P_ 7 USWV$|$<\$81D$ $D$1F5<45,)h~^WS c !1 h^4 Vh^) 0PWh_ 0PWh_ USWVƋ\$|$tWhr5) tЧ k D@ut&PWh5)E!u,u 17t3Ph5) u1}thk 5)E uttVhS_5)d hN^5)Q^_[]SWV|$1\$t$tFHN V3H?>tbhj_W h_W uo1<,tE ,4,,t jV[ ,u=,t[F@u,&>hW th|W t D$1p@|MD$K}h9!W t8D$D$h_, j5)a1CKD$D$u}h_N 0vU11 t=t8<,u.u h_ VaPh>  GF@uhN^y F@uu=,t1uuޭ1]y1D$S跭t SO)hXSPS7 Å@|$t<,tW4,hAh_<,t4,Y h_}S0Ph ]41tuh`5) CD$ut]1F ,t P1<,t4,D$D$,tjS>؃ ,u=,t :؋]mt hN^11<,t:,8u.u h_WV Ph   GF@uhN^%F@ut hN^1<,t?,8t3h_4,VPhc F@u1^_[]ËE8-uxu1Q1FSWVD$,\$(=,t61B=,tbu^1Ƀ~7t@tuH1=¨)4 ,t1Ҁ9ƒ (u1=)B1ɉσu1B,1t)9t`tbփub1^։PjS $u=¨)d1@ָ PSt^u,u jSl 1D$ D$D$$K?r  1@ jPj' ^_[À=)u=(,u =")=)1@V ,,>t8t6R,r, ,t^Ã=,t^SWVt$u ,1ۃÿ,t6,8t+ ,SP ,u=,t,=,ru^_[,^_[V1=,u#,1A:t2>u ,r^WV|$ 0,u"t$= ,tg=,u^,WuS =,tӃ<,t>,8t2t-,,=)tu= ,u0^_WV|$t$ ,uWVj,<rjV`uƆ,^_á,=,t1Åt8uUSWV,1G,<,u@@uu,=,u΋4,tã,S-@,V0jPVt<$tS-@,m ,^_[]ù@rA<,tøWVt$ 95,t)1Wj;Wj0Wj%5,^_ËD$, ,USWV`D$=,u ,)=,t,t D$D$@, ,@,=,tt$(V u 5,gt$(V u45,=,u%=,t?t1,PW ,VY u5,Bji|$wfs 5 ,o1ۍD$X XXPj48 SW\$\$ \$\$O?r ,1@ DD$jPj" .VP# uf5)t$WVt$|$ ?t*FHN V>Qu95)u V^_5)t$WVt$ Nfu,FNtF t0fu^~ , ?NQPF N)N ,vݓF FF ,u=,t V N^_Vt$F t-)t'VfxQPR yNFN F^5)t$USWVP|$t$j'Vt~th`V<k>t!h@V$ 1<t8t#GHO WH'1E$$'t$GHO WdHt GHO W<H'GHO WH\GHO WH'1<$t4>t/t$ËGHO WH'F^+t GHO WH'9=)uUWMGHO W]H"WVGHO W3H"^_[]WVh@Qh j'Vt)19<>^_hh)oh|)bUSWVD$~@|$l$1SWU t 8tF r)~1H^_[]ËD$)D$ ,t)tP袵1t)l) ,u =,NPD$L$ T$$RQP XVPt$t$V tt$ P4$0^h`aPD$L$ $QP5) XSWVt$,|$(D$0L$4 $\$;sCQPSr CHK SgD$D$tD>^_[fL$1Au+,+ ,Pqq h'bjh,2,SWVP(, AC PVw u,$$w0CGσCGCuh,VhHa8 u*$ ܵ,ܵ,,,^_[USWV1ۋD$t$l$1Tt =t JCtA)k')<,t>7t9^ uSUvn& t61^_[]ËD$t8SV Q Ƌ,`u,$,SatLa$t ,㟉,t$D$$dY ^[WV85,$|$Wx t $D$LL$HT$D=,PQR 5,$8^_USWVL$T$tHtA|$9t91GÍrjt/9t+1GtnFt9u1u ؅t)։1^_[]USWVP\$Vj=Sx 6tt|$ l$t UV袌Ƌ $A$~ C@ $Q$f=t @UP(WV ^_[]SVhZaUSWVD$ èu|$=z)uÍD$PQWc Ƌ@ ,Nt#݁ uF @PуF`u vȰF~tuF1Ƀɜ! st É^~P,t<,uT,t j ,uk=,tb [r2jXxL$H @ $  $#`uW`u Wfy^_[]vv hra D$@!|$$~L$( t 9-uD$@-=0,u0@=(,tc@=P,tf@=)ti@=)tl@=د,tp@=")ts@jPha=,WVt$|$  ,tw;VP? ,t^_Ã=,t^_WVt$ t|$Wv 6u^_USWVP\$ ,j蜉ƀ;-u {l$jPS tjNj@F GFGFG0 t uuO tGT$< =uFRQSP}j=SԿS)UPu< ؉G@5T)轈5T)ht)P ~ F1gjt$ȵ,uQG L$<=u5$,H ,2UjSs $81F FF ,ȵ,~,5, ,u=,t^_[]WV1VVt$? t/NjHu%Gtt WЃu GO 4F^_SWVD$ T,t8Q12<08uF=u =ut j=RNF^_[1VVP tNj@u L$tՋOt%t Wуu뻋GO 4FS1L$ T$<8u @=u1@ =1[USWV,1tr:1҃Љu,r׍P(ƻ,Nj+t7Mȃu%EttUЃuEmŃ,r^_[]SWV,>tLGu% uw>Gu#W.@twGGg;u,r^_[SWV|$tfhaWTW9uWhV't*tUj'Wyt8)WPha} halGh_ZWhLcJ^_[USWV\$ |$wGt"GtWЃtw1ۋl$D$tPhtUh>=uD)HQP~ j( P} )j)n~=uGuth3 ~EU)HQPP%)Q ^_[]USWVP,u, h1,T$ t$\$,1<$?tIOt !T$ ttуt݋ ,9|QPT$(,%,)uF Gt/1Ix t#t0u51>j1ɀ>g1AbPI1>?f u%PVCb1u%#L$1PVa1t1Ʌȃ|^_1@Ow$A1Bù#L$1>#L$1@(#L$1 #L$1`#L$1#L$11;D$XD$\*D$ D$ D$  t$c> t$$ 19{USWVӉϋu,fx@$B$PW#`1ۅD$PV `r$$\$t$<|$@11$;T$D9|$ t-1H'(t(!ى61Ʌщ>)~1;$PWT_1ۅD$PV<_$L$$t$<|$@11$;D$D9t$ aZ$PW^1ۅBD$PV^,$3D$ $3L$ $$3L$3D$1 dVW 1ۅTVW1ۅfVWVW1ۅ`ljӉU111 >ljӉ3111 gljӉ9.ljӉ91ljӉ9ljӉ91e^_[]*Q9-u1tQyt8ytBÄthbQhCt1h jjhPCQh jjh`Bh jj hCRËD$L$  )VL$D$ 2)u AJ)^USWVPj PVRM lj8t"ځ8"u 11E9s:$9t( )@DQ@uuN9t ڃ^_[]VhbqVhbfUSWV׉9 t 9Fup  ^^ 9uM1PP ~ōPvPU| ~ LH;NuS螛#~^_[]ÐUSWVt$(h jD$,^H $x?-Ok-u)sstdluu~xwGW苩 Åu")DHt'1Ʌ S躪 كhb=h)DH\ƃ~ƀtV= tV菪 VhbjIރ $h!S1Ʌt:S艨 u+$891V5) V|-$K$8ʉT$h9!WQ1Ʌ9ufمu$1D$\$ $,}%urU?_Džl$UWh u.c| $4Ph 1@D$l$t jW j D$PU ljӋD$9t-ف8ur1u 8tQJx UPh:c+ 1@D$\$ $4hc 1@D$F \$ t$PhjP,PPPPhsc5)jWVPΉj WQ 9u=у|=}^_Vh$cjQhQc\j5)jXWV@V X,,,(,&55>t&j=W7t j"W >u Phj@VjVhPd? Vh)h' VWh]Z 4 t VQhdY j,hbdhUd VWhUL^_=,t 1L,T,DX)P,1d,l,P,9,t=,u)h))|))tPI)Vjn15@, cDX)5\,95t)t|)@8@ujq ,j,uƀ,@u ,u=,tx^=fSWV|$ tK\$CSW>CP\pAQW1^_[SWV|$t$J$ JVw vVw d_ t"Vst Vw?wN@F1Vw q#w qN@FVwL?O^_[ËtVw#?tރUSWV|$t6l$uJE$|JUw b1GFUw GFUw F WE1Ɋ AuMUweFG F GfGFUw EF Uw6 UwFGAGFW E1Ɋ AuMG F UwFUwF^_[]ËD$tWVt$ t|$Wv6u^_SWVPt$t(\$Sv}A6?u$^_[SVL$t$ A1ҊBu‰Q^[ËD$tËD$tmÃ|$aUSWV4t$L|$H,)f`|j%v< O1@D 0D$(,1O\$,t$$>p%>%bD$hdV ,<*u E5 hqU ʼnE<.u}*u EhqU ʼnEtt$}EWl$ D$~^F$$K׈|$ D$ ӋL$ D$KSt$WPhԶ,1D~ ƻr3bAt)BA,0T$(, ,D$,t$؉D$ 't"u:Xt%xtPh}e 1O,fD$D$Go,L$ Q0 \$ ,H ,T$ Q D$ 1Ot(t5\$ T$t$D$$t$\$T$ \$t$D$$ \$D$$XӈD$ D$ ׋L$W D$t"Wt$SPhԶ,7Wt$Sd,0T$, , , , ,Wt$PhԶ,&St$WnWt$hԶ, 1O|$,ж,t P膎VQP}ж,Fl$ wZ$Ka=&t1"u@"*\\t#'u0'btnv fre\qFu`)yDku%\ҋl$ y AMπuf^?l$ 뱀^@-Wl$ EsL$T$ZtPRiSt$PhԶ,tPt$ +,,t P,Ķ,t P1-Ķ,-ȶ,|$H\t X]%P0tMMu+^tx-uE-ȶ,뼸^tbcT$j-ȶ,E-ȶ,댋 )1:DYt 7GuE-ȶ,|$UE-ȶ,@1L$ ,L$tPRQt$PQt$ St$hԶ, |$ ,EP9{Ķ,UjxPt /D$ sĶ,|$t#T$L$t'PRt$Qh,l| 5T$L$tPRPt$ Qh,F| PQh,5| r,̶,l$ ~\tnF<]I<0uQ)11\DXt7 BuՉql$ |$1<^tW\uXT$jdơ)HQP~bL$z8 1O,;D$(tf8t$$Wơ)HQPP )Q9RPD$ )z91O.5)d)H#,Ct$hd-h VW t$5P,he5)@ 1@4^_[]á,))hdڃ%u|$Nu1Btt$hd녁fHh:Nj USWV ։͋T$ y كDN/~{CЃ$1<0}11ɍكЃvLʀ@0t^C vC w>$K ?$K."'#Eu uShe, 4$)D$11ۉ|$L$DAt_ŀſrrB|$u4$Mu hdn,\),ҋ4$u|$ uWhd>, ^_[]SWVP,0t?,1ɉQSV4 NjrVhJe1^_[SVˡ̶,H ̶, u:)Prp~r0 P)Q 밅u̶,))HQPPe)Q^[USWVP,81t<,<'t<"u._ttWh}e,(1$s1ɉQUWU É֋Um؉^_[]SWVӉQǃArVh2e,GPVhԶ,"k ƇѶ,jҶ,ƇӶ,^_[V΀:t 9t-Vh}e+8"u3j"zPVhf( Rhbe,^USWV\$$8l$}h j jheUJ ƅu!h j jhfU- ƅH h]8 x ƍC8j,PV V yTj P  C8 C< C@ CD D3\Fu C\ C`C,^_[WVt$ ~8v4豇 PW7 F,^_ËD$x(H8tH8H< H8`<@,WVt$ ~8v4X PW F,^_Vt$~(t0#F@ KF@F8+$@#FD FDF<F8P #F@ F@F,^Vt$v4Ԇ fFdF0^ËD$Hd@fPQh ËD$8Pk Ph@ P1QhtPf xXhlj hnt jExhlj hot j%xhljq WV|$D$ 0G@gPhDhluTG8hPh`iPu8GDiPh4j4uGu.-D$PW,WhKj:W|~u&j.WM t"h0,W0 u @>t(<#th0,W}0 u:]0,=,,t D$,0,D$04,jSV{ u h\Pғ 1u$8W 1HH@If $oujPVi |$uXVw u륋xp {PWhf cxp D$XPWhf D$ 1G<$54,50,pӃ t|$uwh߂ 1Gg|$ t we\ <$Mhk!j. hoj (,=,,JtpPQPhEph) j Vt)<#tVRt@ J4,^SWVP׉蟯>#uFj PV ~8u$8u؃^_[Vhjk WVh1pj- USWVUf(,8,zU ,ƒ ,<,V ,€ш ,@,T$,D,H,ht h!{t8ƿtuCPVtG uVh2jS  $$1ɉh`zSU. P6$pL,kj j5D4x ƃu 8"58,h,v D4f@,Wj j5D4 ƃ _%\,j j5D4 ƃul8"G5<,d,l,T,1A5D4K 5D4hmVgtchzVUK`,P,BX,P,/@,#芬8"tD5D,  9uD,rCjhz5D4hz#Vh~z5D4hz 5D4hzj u hz H,t 1ҁ‰p, ,փ95@,u<9<,u2(,98,u#$,9 Щ)t Щ)P,\,=d,u\1ɅQ h.{ ,)=X,t)ͅt=`,ut 1jhht,P4f$yht,hj =\,u1D$(Pt$u#D$0=u P,\,1N1$q $$h} 蠊kt$h&QhMhV VthsP跬$Ph| L,, $=,=h,pt,B=h]t t1@$$Phmdt$ hh@{h|tW Wh $=,u , =,u , 4$ht, TX, $$1 uWhPht,茜 1,,,,tjVh,u ht,\ $RhS t,ht,VW0 5T,VWF5 Wsl$t$D$ 1ɉHHD$UD$ Pju @Džy#貧8#Bj" @x߉DžVFm x9ujUj! 1|$nh]$P <hjht, ^ W蚬t $h3 hP),z)H )~)H )8h)Zljt9 t4)H )~)H )h)ƒ߃NyjUj h]x 1t,P)ht,VW4. 5T,VWj3 ht,dtd($Phx $P1@P jUj{ Pm u PO hLtǍ$PWhVpQ D$uhZ$P.+jPhhQQ ƃu WV WVθ}rPV蔥t uVh}j G @,<,G8,GD,O1,t^_^_WV΃=, ,t>H,t49t0zz9tm9tmQPh9 5H,,,^_SWV$_hwdwVShh) juj VPjj"P= thV}  1Q1q$ =uh( jj"t$ Y1$4O F"u4$f^1@^WVκ u1H3 r1P^_V΀=P,u6=@,t t41t)Pht,0ht,hedAV xk^Ã=@,u Jt=\,t7`,t.ht,hedAVp tht,hrdAVY t=,ujR hj hjJ USWVPύAPjhNhP) Gw4vhPhyhP) P)w(hV w,hV w0hV w8hV w4hV W4O<W8I9tQhIhhP)o  OHtQPhhP)J  OJtQPhhP)(  OLtQPhńhP)  ONtQPhτhP)  OPtQPhلhP)  OTtQPhhP) <$f$1۽aP)PjjhInwVhP)PH wVhP)P1 GtmÈJ9|6{u;[tVPWhq|F D$(ffL$(D$ 1ۉa)D$u!)tPt$h| L$4 <)ǘ΋I<9vt$h| $N<.”T$9vt$h} $D$((toSȉT$9sTbl$ }t5Uu9s't$9sSt$h9}7 D$(ȍSà9ˉrD$ C؉9ȋL$(USWV( ,,t$(L$QhV  D$ 1hXVWPtG<$hV>E 4(1>tYj:WhD$AL$\$hSD ,1tD$hυ!WvtkhWdhWN\D$Ph҅W# D$q;D,ef,ujh2r!l$!U l$v1tUP|QF wr܉1hD$ Pj <$Wh\? D$ D$t$ <$}trÉD$hU6|t:hU$|t/hU|t$UWh F\$L$ L$L$݅ut$ D$ ۋ<$r1}f]1jD$ Pj tWhS D$ D$л,FʼnD$uf5x,l$u D$l$l$hWLhJ W6hW hW h-W h>WޙhWșThNW貙h\W蜙hiW膙Uh3WpkhmWZhwWDhW.hW<w ~W|$Wh T1<$̻,jD$<$rt$Whri D$fx,@<$WhL D,f,jUh|,jUh, e <$t$ht$0V7 J21jD$ Pj< D$,뜉1jD$ Pj D$,q1jD$ Pj uuD$,J1jD$ Pj uND$,#1jD$ Pj u'D$,1jD$ Pj^ tt$W|$Wh  D$,1hD$ Pj uD$f,1hD$ Pj uD$f,a1hD$ Pj ^D$f,11hD$ Pj .D$f»,1jD$ Pjc D$Ļ,1jD$ Pj8 D$Ȼ,; D,sr"jW|$WhކW|$Wh΍L$$ t$,|$,L$$ L$ ,t$,rhV= l$}}q1ۋ>t.W茔Lt t uPUW Á|rr D$)MDHu D$"91hD$ Pj t4$h\ D$ \$"r)Ut$hj hF] D$1ۋD$,ND$,W贓4(t$|t%hV<  L$1Ҁ<tʉT$D$< w'<$$qL$ L$,<$tL$$L$ L$,|$,cL$$t D$|$,L$,16FL$<$C fF|$,L$! L$,|$,t8L$$ D$|$,tL$,11A<$D$ ht,1D$ ȁ(^_[]4$h D$ WVPθWEVt,,f,ht, f,=P,u=\,u#$}ht,hgdV 1ht,hfdV yۑ8t ё8uv$=\,u(PhmdVn xX5ԩ)h  1=\,u$ht,hgdV2 y f1G^_ùUh@{1r뙃=Щ)tt$ t$ t$ փ 1HVD$ t$=t,thPht, ^D$L$01WVːt,uVh-t"uVhVh%c VhwVh9 ^h,hmd5ԩ)& USWV8 $RPh h ,Q+  , l,v|Pt$hցA lj D$T$1D$ XƉ 11 ‹l$, , ,9 ,hWD$P蕃 $;D$ =,t =}t=}uЉD$$=p,tȋ p,=WEVuT$tf9D,rD$Pftt=l,%4$t$UhA  D$t=VEW=p,$t=VEW4$t$UVh =l,|4$t$UVhp =,$D$PSt$Ut$Vh =h,u $ht,SP)V 5T,SVI SGSt$VhVW ,D$ L$D$11t4$h,` 8^_[]USWV T$ $11F1Ń=l,|Uh  QPWD$Pt$+ 9$ =U\$11&t+u(Pt$T$~S9 tuǃ@ut3L$tω99=l,tUPhs Ɖ ^_[]Ã=l,tUh/_ =l,tUhP ċL$T$tPht,11@Phdlt"j QPr u8"t1H<,1Yh˂j Phlt"j QP) u輋8"t1H8,1Yhj譲 SWV։ϋ\$+X,tItEuX,1tGtB ,, ,9w1 , 1ttht,QA1@^_[Vhj L$1=@,T$ PG1ɅɉWV ,~( WRPh ,Qr  ,9u ^_hăuQVhj蘱 PQVhjY USWVPӉ΋l$|$uj WV EuG"9"t:M";L$ w,O>t" t9t)DJ@t1^_[]WV1t>΀9t7hV/~<t#ƍFhP2 1|t<G^_USWV׉΋ t*9t%D$l$/jPU t)WhuWh 1۹,؃^_[]ËL$9/up,D$\$A/jPU u$D$ ,D$L$A1jD$PU zD$D$ \$$L${\$rUSWV׉΋ t59t0l$11jPU. t.Wh\ ,!Wh ,1 D$$؃^_[]fL$”19v f39rËL$D$”19v f39rfUSWVX uh  4 D$$ThSut]~ wWaPWSz '> uۀ$U-$T14xD$XP#htpC"uD$TPh $T$끹oxj" $eFMu SQЃ {Sh', h$X u>D$|$TD$1ۉ\$,D$(l$(N(V8T$8\$|$TWQ  $jt$D$LP t5T,t$VhP) =,,Ef1t$1I~ t8t.9Nt)N5T,W]ShP) $TNGЃ9re^_[]VPt$ D$L$ $QPt h)hV t&1t! tj V 1@t1H^V~ wvPhfü  u(`Phm褼 ^VPhrdA$d t"$D$hU /$PQhR~$ $u ~ˍ|$@WV 9t"b&J~PH k$|w1OJH w@$w 8B(D$ D$$l$ CtGtngtbcB8D$D$l$c8ɋB(D$(D$,l$(B8ɋB(D$8D$<l$88ɋB(D$0D$4l$0|$D$ fD$l$|$l$|$\$=0,uHr8jVSWvD$щƉD$ D$T$ )1 ‹D$Ѓщˉljڍe^_[]Phy h ~USWV|$t$t$hwV豳 Gw4tyh,Ph~V苳 GPShVs GPShV` Vjjhw!EGXtVjj hEGXtVjjhEGXtVjjhsEVj ( w(hV w,hVֲ w0hVŲ w8hV贲 w4h V裲 wu 1<1A71Au01<  $jj@PD$Pp@ D$ Phި C9u<$u4X)H X)~P)H P) hP)j ˭ 1^_[]hDj貕 fUSWV $ $ D$-@14,8,4,<,@,<,$D,H,D,t$ hXUS c~!P$X L,˃PtdT]=D4?1AJ5D42 P,뒹 .D4D,h n L,b L,D$T,T$:@=4,lD4D$ Tnt uBxou D$ 1Ɉ X,hk VC t4,h `ءD4$j:W9C-<,tWu[mtm<,S c$ \WL,tL,t P,,)9$ 1ɉL$tVh$P tj/U踵 u Uhhh$ U蔤 Vۇ DžuV, Dž7h$P  ƋohMW=lt(hPW+lthiWlpV 1QQ$ 4PU7L$9C9$ $ 9tUm lj?,$u1QhD$PQV'h\,hzd@P] tq$ PhedAW] WY |$ WljD8$9",HuW  ,,$h7 h'7 5P,P Ġ ^_[]hj $Phj. Vhlj h-{hyʍD$ Ph D$ Ph)j D$ PhG롍D$ Phm땍L$ Q4hUSWV։ϋl$jxVUCCCOK G^_[]]$hԑPh˓h)( j USWVP׉΋tAShWh4$4(VS{Wh(.Vt$ P胡  WHÉ^_[]USWV|$1_hMSGit$hPS5ithiS#iu\4,toU3it[u=X,t .=X,t%D,toU3ht [u^_[]USWV$D$|$<, tW3ht CÅusht$ ehuD$kD$ T,t L$ mt L$ ^$D$ D$hc$$ t$hhV $0|$D$4$L$hk QW 1G@΍K9|,SPzŊt><-u(GD$tj=V3t>FD$ GDthk D$P u|$1F1B,$֋$$$,$DL,tP tP$h4 xF1Ë$4h C9uj '  t2ƅ|$t t$ 4$ tA710hn8 |$t t$ 4$ ^_[]ÍD$jPV+ x!L$ȃtuuhW7 묁tlP&GPUhfs 끉 L,utD$P$ uW$P$eud8u*uVhLN!6 j:SVh6 j:D$L$ ,,0,á,,á4,VPD$ L$ $)QPV讣 Vj j艖 USWVt$c80,ut5,,hi 0,l$\$=8,t!u5,,h< 8,USx yWDPhh 0,ttj  0,tu^_[]Ë5,,PVhœ j訕 PD$L$ $QPj XPD$L$ $QPj XPD$L$ $QPh XPD$L$ $QPj j8 USWVu4,$Ph*$|hWVl t Ƅ|D$PV1ۋD$ !=`= بtLV} 0h$Pq Džu6h<,h1 Vh$P" DžD$PWGVh)Wh8ue^_[]Ë$3D$($3L$$ u4,Vhh<,* t9Ǎ$PWx#$= uVh{VhHpWhbeUEM JR(W tHPQh t$t$hhh<,Ƙ <,]á,tjЃj #6WV`01Gj0h'Wz =,jj4_0^_SWV_01GWX8 WSi4jS^4_0^_[USWV1,,,,,,1@D$ $1Qu 4t DžW$ t7h$P Ɖl$Pŋ$ tUt$h۔ߘ $ uu&낋D$ t^pfjt$wUw$ Ë$ U؋ $9|ȉ$z\$GD$GD$1Qh$PQU9t,ƍD$Phzd@VP t$V覃 S] )‰D$H9rHDQtD$=,t*wt$SVP u D$<tQ?1GjySGL$G 1ɉO GO,G8=,,\$w tUv]tt6jUFt$zF t$kFD$FGF0wVhh)踘 rUh _$ }L$ AL$ 15,tyvhh ~ twhQ ?j c 6Í$Ph. ؁^_[]hДhV ܋,Ћ$ t9‹-,҉T$։鋔$ t$ t $9|ȉ$mNu\$,t 9Ct,Ph $PF! u$ȃt1{ $ t#Qw wwh! $ȃt*t&t!Pw wwh'h)ؖ  OtHOKt,G8=, t$wwWC,H ,{ t t , ,I ,;D$\$9,MŅt̓} t}u鋔$ tV$  $9|ȉ$8ً$ 1t $  $9|ȉ$1\$$P \$tq,c8 thsPhKh)Q 5,.>N^tPv vvhh) 6u $SWV։ϋY Wss ss҃ ,t~j 1 Wss ssԅuA ,^_[ÐWV1t$|$ ɉ @4uȉXȉX\ȉ\ȉI)  PQ4040<8<8D@D@LHuLHTPUTPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,4040<8<8D@{D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7Vw wV FwwVFwwVF^_USWV\$l$EffEffCEffCEffCu utS CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuSCuuSCu$u S$C EDȉCDu,u(eS,C(E@ȉC@u4u0IS4C0EHȉCHudh$VŋFN ,tbSQP ,x ,~,=,tffOfGG@ Չn,~$N()ǃ~$N(=,9<$D$hP-,>N,ș)N,)n$F(teh$V$FN ,tbSQP ,HT$<L=,tAf=,t4f.<$ ^_[]8,,F,)F$N($fOt@ 8,븋D$L$t$ QPQPUSWV$$$ $$$(hSV\1j G D$SVWUhP@؃r_,95,rPSV Pt7=,tf% =@t"WQhڙd WhљT^_[]USWVP|$\$s s@=,tf9uR,t=`,t=,tj:D$1PPPs sQs s6O,3C ,3K u ة)&=,tf% =@t"Qh胣s s/)SUh茀 `,u =,t:yj  h `,th =`,uh"u=,,t7t;f58,D$,jhS-^_[]Åtff^^_[]USWVP$h$d|$1SV(=,tf=,tGf @t"Ph)/SVz.=`,t)1=,L L ho h3{$p$l tRQf@ ,, 1VW ة)L$@D$DD$ t$|$ ,pt95,tʋ ,5,T$Htt tɉL$LL$QPh==`,uhU515ܩ)PPPj,,  5ة)RPjjt:L,=`,h D$L$ ,,5,=, tYjj=,H,tt,fI=,tftfI=,tfIfHVW51,,9`,t-j "|  ,, djjQP ,, AQP=,tf%=@5,5,8,$t$R=,, t# Fjj WS9ݹÉrFND$P9|$P$d닔$hjj RS )ˀ0^N9wh訞hJtf5,,15ܩ)WWWj,, CRP5ة)jj_h\h18,1P^_[]Ë$d#, ,$tҍt$PtV$lSUQP4$SU fH1G@u5,5,hSrSUu.$l#$pthSr5,5,SUq5,5,H=,,fA=,fh\8,hҚhN^| jj5,5,D$DD$W t$\$ VS@@PD$PQVSf@5,5,tfA=,tfA$l$p!fHG5,5,mf@5,5,SU5SUh t$p$ph#y =`,j ,x USWV @ D$0Pt$0t$0+ 1Ѓ{T$Չޡ(,@4 1WjPQWWRS 9=,f) ,ff)=,twf) ,ff )=,tjf))f")=|,t)ȃ=,t]D$ Yf) ,f)f) ,f )f))f")=|,t)7D$ G UV=,l$$tApQt=,tRPA(=,t1ҋ (,I4- ,teQRP ,xtt$V/11jWp^ =,=,tf=,f)(,;x4})}jh)W =,E (,A49rE =,t<$fGj \$l$u6_=,tf1UVufXUVW! t$$\$$SP8tt$$S>8UVW! UVo#L$$HXH XQSߊUVUV8u8|$$$X=,tfUVfXW|$$Wf@t$$W=,H,tt,fA=,tftfA=,tfAfH ^_[]UUSWV$$1Q ,,9;$$߃9։$PU$T$L1 B(Bn $BjZr1B$J$=,pt$ =,t ɋ=,,L$xtt tɋ=,5,1L$|1ɅDT t$t RP5,UVRP虂  tE{[|$t}SWljUVSW\ )SWlj_{[ |$t]SWljUVSW )SWqlj?UVSW )Ӌ$xX#UVSWȁ )Ӌ$xX D$4PS $$W$VWVhPWV ,1ۉ‰ΉL$t1҉Ɖt$,T$$ˋ|D$\ =,t SW (,L$IP1 t1ҹ É$9T$ {|$tT$$LpTt1@[L$$L( A 9D$p8/  D$HL$D$ =,<$\$T$|$(t$,DpLtL|Dx=,RSTtDp(,D$0X0vv{RPmVFvvY RSHVFt|tx|$8.D$T$Rl$$D(D,=,tFB\pTt(,B0FN FNDxD$L|׉L$L$؉D(MU =,t]RQ (,I0VPU EMhɡ(,@0 ȃ=,t3ȃ=,EhD,t($(,@0MU EhEhD,=,L$ tL$D$D$=(,,$\$ 1QOP\$  t19}#8@#pLp0l$$ ,ɋD$taVt$P9 ,x4ƍ$5,pS) (,@0fPt$t$ ,x5,Sp]) ,=,tf؋,f)(,B09}+^jh)S( ,(,B0N9rF =,tL$L$ L$ 1YJP|$ uL$ 19}#8@#rL ,taPt$t$$ ,x=,t$,|$(DxL|DpLt1҉TxT|FN=(,<$09,QP )RPVF^vv )RPL$(D,D(D,EM =,\$QP (,I0)RP|U EEhhȋ5(,N0 )ȃ=,t^ȋ5(,T)FN^FV )S\$L$4$*5(,V0)EM Ehh )ЋL$Ev8QS 8,1Ą^_[]Éjh)p $Phmk=`,th hۻF & (,@0 1RRPQ$$t$Xt$XE D$4Pt$ IUSWVLl$`\$dSU& t$1 F(Fn ^nFD$hF$D$pFD$lF,pt =,tɡ,=,L$Dtt uȉAHQRT^_[]WV|$ w8FNAQwt~1F=,tf)9F=,\$tAf)=,t4f=,t'fL$=,fVT$Rt)f~T$JR>>fD>=|,tq1@1$CD$ƈCCEUL$ q/G9<$u1A=h,=,\$ ~t F1@1~tF1@~tF1@L$ tfɋT$˃~#$ރ))у1B>tFI1At;D$0@ 1F8t3=X,t Vt$t$Ut$h8g 1Ƀȃ^_[]1A=h,t1=,<$\$ HfUSWV $8$4}tE1ɉM4M019 ,‹DT 9 ,tRP9M$U(E$f M$E$U( u ^_[]%=uLI(,(9‰|ǃ=D,t<|u=,tFNFh1 t,tD$hVP  |$ D$0D$D$,D$ D$$T$(T$$tT$D$ =,t RP; (,I0VQRP։D$D$ ЉT$t (,=,Q8k=,L$$tL$D$ =,t QP轻 (,#8t@DQL!!IT u‹$8U t#DT tE=,t!RPVD t(=,t1҉EU}@U=}@|$8,EM QPQPh$3WWh聇hޛ#uQ{u u (,y0ƃ=,,t:tMPW腺?UUlCD$T$NQt PWK~V ~V hb ,$,@ 뛋5(,F8E -,T$$tT$D$ =,t RPչv0 I)؉$ʉT$t*DT tZ=,t RP艹$8D t6=,tȋ$81҉AQSt$t$tv<$8}@ud<$D$|W8,E$8I QPQPh$3UUh薅hޛ8$<t7(,Ht)$|$-,Cq qƃ=,t0FV=,|$$tJRPa)RPS4FV =,|$$t&RP1)RP#)FV )FV h> ,$,@ USWV|$ \$t,9,a, , ‹-(,t9ˉrux9ˉ\$؉jL$QWPց<$Tu,U]Ӊ$!!׋$E‰$L$\$)1uxM`1 t1,$ס$,t`v0WUH $,(,pxjV|$(WS0o )Љ ,,=,jVPSo  $,A^_[]WSh$,@ USWV$׉νR y@tnVՃ2v vv $<D$$8D$(,p0vv[ $G (,y0Ytt$D$ l$|)T$ƉL$͉Nu|$$8$<UWQP辿19rÃ=,$t$ \$ti=,t,ۉ~A1_t4 T\$F9uۉ~1O ɋW @9uG W5,茲t$ D$x; (,;Xt|$#=,t JًL B tmt$v vhhW\ WVt=,t$$B1ɉL 8,t$ $$Bt$ B C(,;Xt`R5,贱T$\$1ۃ=,t%JًT tN=,t#RP跳Bt/=,t1ҋL$AQt~t$t$BrD$x@$ulD$ D$tb8,L$AI QPQPh$7WYWhhޛxT$u:QT$$uD$)D$l$C9\$ b$^_[]Ë\$D$p pƃ=,t+FV=,tGRP螲+D$RP莲1FV =,t*RPs+D$RPc+D$ډFV +D$ډFV hz ,$,@ 1@$5USWV\$41F~3|$0l$,|!, ,9|)S9у} ȃ^_[]Éދ(,K89}=X,tOI.A!1‰9)=X,l$,|$0t!t$4PWUhZ[ (,PVWUNj\t$L$ T<$tK!Kl$,ދ{|$L$ʋ\$4L$0σ9ʼn|$<$l$|$ TtN!NN19l$l$,=X,!$l$|$ T|$0tN# $ND$T$RPWUh>Z  (,<$\Ttq!qIVPt$ Sh,Y $@l$19=X,tk|$ $l$|$ T|$0tϋN!|$0ND$T$RPWUhL}Y (,t$She`Y 1Al$,|$0USWVD$,\$( ,,փσ5,=,11 J ,9,6 ,,,9,@D$ ,=(,\$jD$ PL$QT$Rց<$Tu.WoՉ$!!ډӋ$މӋGL$D$)1wxO`1 t1ՊOd t1ۋD$ =,,t ,8,T$t$,‹D$ȉ, ,(,WUS5(,5,谬=,l$$-,+l$(=,|$`5(,1VV=,tf%=tjvdv`DVdF`vlvh0VlFht4TCut4TCuG9a=D,t< (,(1(,SS=,tf%=u1=x,u(x$CS =,t RP]9Ƹs& ɉ @u ɉ @uG9wt$t$t$5(,5,衬(,1Ƀ=, ,^_[]PShawUSWVl$|$(,jVUW;d  1ƒ ,,,,=,-,=,- ,,9(,8#{H1ۃ=,(= ,-$,1,,ډ,t@, -,=,Wh(,t^_[]UWh͜TvhJv(,t P(,USWV l$ =,1ɅDT =,t RPa (,Y0މD$ʃQSRV wÉD$4t,P1ơD,$P,QPt$0t$0xb $ 41ɋT$$1 T$(NNFNN ND$(FD$$F D$F$^( r t&1t LpTt L(L,T0@9u܃|$ r51tEE LXFF u͋ X,; T,u3P5H,=H,t-H,T,d X,H,QX,4 ^_[]h\tSWV|$t$D,P,QPWV4a tH 1P1 t^_[WVh8 tVD,tR X,~%H,466;5H,sD,P5H,1H,D,^SWV\$t$s sǃuG=,tfL$% =@t"RQht s s=`,tfhў ,,{@t1H1PPQQsHsDs sq SW=,t6hhp,Wa  -hO荠u7=`,{놹 ,s s$,H 8,^_[WV|$t$ WVhUP C,95,0WVh^P =d,t7=,pt=,tP莿t 0h'=,pt=,tPh!P =,tfPhfO =`,tqPhO 1Ƀ=,DT =,t RP¥RPhoO =,tF(F=,tjP|tPhznO ^_SWVD$H8=,t3P PP0p4u'11C9}QBRQp=,RMT$=,HRP;9L$0ơ(,@0 T$D$=,D$0T$T$4=,t$$t RPٔMt$t$$=,tȋMD((,@0T$,‹t$(΃=,,t+tMVRtuVFt$t$ [7KVREMQ AD$:MQqD$T$AQ!EL$DT=,t1ҋ (,q0RP| ƋL$ jWSQ?Ӄ=,D$ t7~SPt$t$$NjT=,t RP藓|$)~SPt$t$$=,tȋ|$1҉\$$ t/f (,q0RPُ xËD$L$ L$0|á(,@0 T$ʋL$ȃ=,L$0T$D$t!D$4=,t)PQҒD$ T$8=,t@ɉL$ D$ =`,t hZX=,t hxXhX/=`,u hWX=`,u hݠW3=`,u hW6=`,u h#W<=\,t=`,u hBWT (,|$Y8֋T$  SP5,5,5,5,h]Wd,$kdы(,@DWSQPD$T$iщډWSURMjj RP7 RPt$t$t$t$t$VD$Ph3 $=X, (,+, ,, ,, , tQPhA3 =X,-(,KC)s, ,-,Ջs4HS8\$ ډD$$+,$T$, $ $ډ Љ ,,tRQhɡ2 =8,t8hޡs2 58,tvvhV2 6j h1 =@,t8h 22 5@,tvvh92 6j '1 15@,58,5<,95,tmj  (,405,h QV 54,Vƍ=,t,PPҞ5,z,=,t 8,j (,y,t+h,1TtR4h, (,F;q,rh,Ph,=,t =,th@S ,1=,=`,u hpS=,t hSGRtgD$Ph螜 u1D$t)L$ jQPhhk0 t-=`,u hS  ^_[]1USWV0,D$45(,~,1с\T|$0u^ډͅu-11?V^!^ڃt؃Ӊv119؉}Kl$Ɖ݉)1B ,l$9؉|5(,|$0G;~,$LHN4H~KT$މ)1@ ,9׋T$9|5(,1҉t$L1F; ,,,,9S,SދD$4HxL$HD$81ۋjV (,ׁ\Tډ\$tQ!QЃQ SPh,A(,5,|$D$Xt1NPSWUʼnFظ|߃\$ <$w4F,<$t LX FuWBsT$ ,,$@=,tfL$fAf|$l$$j {hX @,@,T$ =X,t| $=,t RPyRPh2l=X,gq$ʋT=,t RPgyWURPVhE# ($DX=,tPh # 8,hKEhbrT$ '|$@@u' T$t$SUt$A ,t$D$, F=,=x,$@=,tffu$@=,tfft}SU{$@=,t?f=,t/ȃ=, $ApfAAt$f=,t $ApfAA $AtfA1ɉ , , |, x,l$T\$X,pt4$9 ,t ʡ, ,$tt4$tʡ, ,1ɉ$dtX$t $D$LPt$衹=,=,t=P,u,$$@\=,tȅSUheC h(p~SUؾ19 ,t1ɉH\H`HdHhHl$f!B=,,$(E\=,tȅƄ$E\=,tȋ (,I0H111҉,$L$ D$t ߋ (,Y8Om\=,t͋ (,#8߉@DYL!!ÊIT u,$\$lD`Td t<=,t RPuD$dT$hD$LPT$T1BD$1BD$D$) ߋ,$9(,H4 D$|$׉D$|$=,t݋AQ=,t-RPt!Eh=,tȋt$|$1҉11 ˉl$$WVRPSUhuA=`,thِ hm|$t;SU蕼ƃ=,D$|t1$=,t RPOtFV8,=,tȉFhܽ$|$jj$$$$SU z $A`Id=,tEQPs $plphs1$D=,tWUPVhͤ  $AhQl D\$C5(,;^,T$$L$ t,p,׃ƃ=p,5t, (,9˃r\$$1ӋT$ 1 tȋ\$1ۉ)͉9ֿrˉ-h,t$| ؋T$(tu3D$1 Kl$@؃,Ut$H.ƋD$9\$(s+l$ Uh>j SWUt$@hhm=jWsUSWV |$ ow@u Xw VUp D$t|VUh2w w|, x,ʃǃx,=|,|$ |:w wh= =`,hmjG $D$|$tjVU¾ ,<)1CVUhD$,p p*, ,ʃǃ,=, j Êhp <,tH<, 8,9tDy1Y1 t 9u,,,$|$ ,<,8,Q1I1 ы|$ t<,$G0W4L$Aڃ]D$ p ph J< =`,t)h讋 1C+8,h';hh1Ct ؃ ^_[]8,jpj fUSWVP$T$1B@BM 8,,(,x,11=,t>Q:(,x,$kd1PWSQhh)z ,(,1ۃVU聶tzljl$ t$,pt=,tʡ, ,1ɉT$HtttȉD$LVUz8tD$PWbu(C(,;R $A $;H,P^_[]USWV|$G _w$D$jVSj t$,ŅtTM1ًU1 u3VShw w,HPUMpX, <,9tmu1 <,ͅt&;Et!L$A]$1@$$^_[]ÐUSWVXjjyH $(hF9heh+ejj聴=,,f@=,fh:8haeU1hPVPVҜ1Bhl8h#et21VWhVWVW莜1 tahQ+78,hdu<tf@=,tf @f=|,tjjxfh j5X,5H,膐T$1B@B -H,X,  $,$Wt>E6+5H,=X,kdPWVQhh)i ,uF$hۦvv 躑 ,A1ڍF$h+cvv 6ǃ=,F$ ,&jPi1 ,I F NQPQPhSt=,F$ ,t%QjPShnh>6#8,QjPShnh36=`,th藅 =`,1F$, I1)щN$uh"b-vv *ǃ=,F$ ,$Wt jPh1҉GW1҉GW }hjD$\P =,,D$tt7fD$T@jv$h-fD$T@jv$ihfD$T@F$1҉D$dT$hN(ȃ r ~'1ɋT,\0A9uN($W1 11ɋΌΐ($Auލ$W[fD$T@F$1҉D$\T$`V(у r ~1ҋ\,\|B9uV($W r1ɋΌAuN VT$L$NVT$L$t1$|$t)ɉL$L=,$tD$\=,tL$Lu$D$PD$PD$XPy,;,$/8,$W=,v,5H,;4$]|$T{$AhjWb -,=,tt0fD$T@js$jf&tPfD$T@js$PfFfD$T@C$1҉D$dT$h{(tJ1L,T0@;C(r*fD$T@C$1҉D$\T$`{(t1L,L|@;C(rC KL$D$CKL$D$$tD$Xt-ȉD$L=,$|$TtD$\=,tD$L$|$TtD$\D$PD$PW٧;4$=H,;<$CK {$sk l$1͉1 #t$QPqƋC C CKt_h/ss QPTh+$^t~s sqf@fNCKK CQPhSrss oOCK =X,thss QPCKhSrQPss fN 8,;<$=H,X,4~^1ۋ/uu p]]8u9rۋ=H,/CK tS  StQP HKX9rjj轄`^_[]8,j"ejk Ph/L$D$@, +A,USWV $0 n8$=,ui=x,t`E=,tȅtNE=,t$;,,s&E=,tjPo@E$F0N4 utEh?PK)$0 F=,tȍL$A=|,AAhh?Q |, ,tD$D$L$L$D$hyv v薉 E=,tfM9v%}EPh.h0[4/E=,f)=,f=,fEtf=,t΋$0 AI 1 hIQP辈 h+Z$0 F=,tȉE$PlZEL$fAWQU"r $)fEPUVr =,tfD$fXWPUq $0 G0W4w wmfH$X8,$0 =|,t>}t8hbv v贇 h+Yu EB8,F0N411G9 v vGD$@=,tȍL$A=|,AAhhSrQg , |, tL$L$T$T$L$كSN0 N4t T$ uMtf 9E=,t2f)=,t%ffD$=,ff, )fD$1fM$0 A0Q4MT$ tjQkfHD$=,tfPjU D$fEutEhSrP1l$L$Aq $0 JR ωtljhRQUW݅l$EMك9v%}EPh*&hmWD$$0 T$ 3F0V4=X,h z ڃD$=,t΋D$p@ =|,X}$0 ~h˧v vڄ Eh+VJ8,B$0 1GPVtXD$T$ F0V4=X,h)"=X,kdPWVQhh) ,}ww cO W $T$ WGO ƀÄ:1=`,t4=,t+=,t"uGO 1F9ƺw1 tbQPc8uS=,xJ1v6KNj@ $GD$wOG tQPb8u E;-,|E;-,=4$h9b"h3ORv6话11|$D$HNL$D$D$D$$D$D$ D$TD$D,pt =,t ɡ,-,L$Ltt tȉ݉D$PD$PRmu h`!D$TPv6t$t$~tyD$ c v6ΜL$QPt4t$t$af@jw wt$t$~t ,,1JQPBafpH,9)T^_[]fUSWVT1ۍT$1BW (,x,@=,t;(,p,kd1PVSQhh) ,(, h,<\$11ۃVU衛VUi`$t$l$ ,pt<=,tϋ ,,1҉|$Ltt<8tϋ ,,1҉|$PdtX 8Džtɋ$L$HQ$@xtCVUztV=X,VUh^1=,L L tOjhs@,tuQ1y1 t6 u_VUUdtl=X,tHVUhک( 7jh$PxyQ @,P|jhD$P Ch,L$;JWD$ P,,tDŽ$@t$`$L$$8t$ٍ؉$<PNdD$1Ћ11ډ1fG$~)N`D$1B⋌$P$F8T$‹|$$D$T$;T$(|$$L$`$$T$L$L$$P1A11C1tBtD$$9ЋT$1҉Шu 1A1CG;$Trҋt$t$9ЋL$$L$5,,(,hHhm ud(,ǀh P5,28 54,5,,=,t,PP >5,,(,@ =`,uh+Uu_h 5(,5, 3 54,5,'=,t,PP85,,,=,(,(t xu<PhY'=,<tx (,(=`,thkl= =`,uh+qu_h 5(,5,(2 54,5,&=,t,PP85,,,(,<8RH҉11 QPhA (,HHщ8<=`,thk< =`,uh+u_h 5(,5,H1 54,5,&=,t,PP 75,',,(,D@RL҉111C QPh^ (,HLщ@D=`,thk; =`,uh+h 5(,5,a0 54,5,-%=,t,PP965,@,,*HHPLщ8<҉@D1ۉ|, ,T,(,1Ƀ,=`,ẖ4L$ (,L9| 9Phǰ(,=`,thkC: =`,uhmHh 5(,5,. 54,5,#=,t,PP45,,,@hL$Ax,(,ǀ,04ǀ(<HHPLщ8<҉@Dh P5,0. 54,5,"=,t,PP45,,, ,T,G?(,L-=`,th=h1:t,(,ǀLǀPǀT\ǀX`K< $~H`Kك 1ɋ@RVʍ #HLh P5,, 54,5,!=,t,PP25,,,=,t}=H,uth 5(,5,e, 54,5,1!=,t,PP=2(,ph5,5,, h,5,=(,VhnLVjPv~ G011D$)9|ËLG8 $HLOd t1SRPV5,5t0|$u)h~hr1AL$=,tLSVV66 (,A8$HLId t1SRPV5,T=,t SVV5 =(,G0ŋ $A9, ,ʃƃVhm,VjP| jw,=h,y9 ,,L,9؃sL,ÉP,X,C T,UP)=ƣH,US=D, VhRl0,E(, $,=<, l,1Ƹ1ҽhWV5,5,|5,=, ,5,=LBALtl=D,Hh[h+11IPPQQPV7,f@5,.6 ,fA,FȃtvFjPhʳ =`,thh3 =`,uhmt1F,f@5,5 ,fA,Ff=rmh=`,tht2 =`,uht0fF,f@5,/5 ,fA,Fffuzh& =`,thkn2 =`,uh+st=11IPPQQPV6,f@5,4 ,fA,1Ff9D> <:P^_[]USWVTt$xl$tL$p|$lȃ u D$|uWhmUQ=,,uR<sJ,,1\$|11 ʍT$ ٰBPVQ D>/|)Ot$L$6,,2,,$!D$h8J,,$ D$tB?JL$h)PRQDSWVD$t$ ,95,r==h, (,jSPVH )޹0)94v t^_[PVh]GWV|$ wu$Ж1XD$@uPw w Ph.=`,th0 h9t ^_PhA躽,USWV$\TM@$ 5uh`@ h`VP =X,t h< =,1ۃL뀃=,t\,L$UPQvU DPP~$\, ,L$L$UPQDU |$u $PPD1LDffLD@9u=,t8PP\,L$UQPT t"PP\L$UQPT  F0\F N$048<F(@DHLdždž  Lu*džPdždž^_[]h,USWV\$t$=f,!ߋ,t9Xt6@u|$t&j t1ɉH HHXh1^_[]hĺVD$ L$5f,#p9tыR9u @^USWVt$|$VW/(,!t7^Fu+11 33 1u{ \,tqt$0|$,\$(l$$T$0,t9PtjRQ 0,(Xxp L$ 4,t9HtjQ5`, 4,(Xxp ^_[]WV (,1!t@^Fu4T$t$ 11 u1@331 ^_ÐUSWVPD$h8\$h$1Aȋ$sY9UD< Ή!9u0T$ ,|$(t l$$l$$T$ ,T$j8V9|A9|^_[]ËD$H`w^D$ T$$4  <Qhhv船D$P`wZL$ D$$1B(ɀ!1RhhvSD$H`wPD$T$ $1C%   [Qhhv襸SD$H`wND$T$ $1C%  [Qhhv:USWVD$($l$, ]lxEhˋEhȉD$D$0ƀ1B |$4 ыt$,l$( D$0@$$‹Fp|$ \$x9r 9rVpʋ$ـ1@9}I<$t$4!t'L$A<$u 1A1@G9}!uD$0H$‰L$)y1J+<$1F$9~K$L$0HL$, $!t'\$K $t +KI9~!uT$,T$$)ˍ;L$9} ;Al$4t$ ؉ˋ x ~),\$(~L)Aɉ ~!)ȉ\$(~ y \$(~ )ɉ$~@LyɅuH^_[]ÐUSWV$8tWq ƅuWhgj $$<$4D$Phd@Up tg1OVhedAUQK F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uht$=1 ShUX CPhU C PhU CPhU CPh#U $@D$t P1-Uhzd@$<WXJ t1 VhedAW=J hjU4K D$ P$4P D$, 9L$L$9u0$S11: W8tx$0h~) b$11҉ $ƅ*ŰPmj PU!L ^_[]$0hj~} USWV01ۍD$,ShPSu91NtAljSPSWuW{uMU D$t$$$Q1e^_[]fUSWV]D$D$ PS; $1NHD$ D$(%=@= j/S xr)ك$0PSQhȺhR͍ D$jPNf ǻ\$$0PSU: Ou\$ |E tÉ\$D$D$ D$|$$D$ PS 1@$D$hh SPy ƅ%D$ PV2D$3D$ 3|$$  D$uH$0PSH $8$P$TRPV X VyD$4@D$1$Vh޺jSf VjSx ƅxc1GD$ PhFVnF  S8u;V3yWh޺jS jjS5x Gy tSD$t P<<$t t$ 1Ox Vxe^_[]D$(%= tn=@u$0ShкhPz S Ɖ\$1@$D$:\$ D$ PS B$D$jSKw}tSf tN$PhF|@VE x4D$t P1 U$$JhF VD$USWVP1hUU= ƉRP*9-,t1@fC}+PUUS'G (,;A0u $ytWVD^_[]Ë\$-d,5,SUqRPX$@ `(,ؔؐh P5,k 54,5,7=,t,PPC5,J,[USWVt$(~Ohol,tUQ Չ 1=,L$$t| tWV Ɖt$$H$á(,@05,QPWVsUC cMhml=,tUQ4 Ջt$( }(,@0ˉ9Éʉ\$4$rQPUt$脘 LPDTGlOh|$ wL$,=,tȋ|$(,1ɉSh (=`,th hUt$" (,QP%$T$1RQQD$PaAá(,;X0t$~~1Ƀ=,T$DT =,|$t RP L$ pL$QSRP ǍP8,$|$1D$D$t1)ÉعF@jPD`r9w<$r$l$T1C @<$9uG<$;|$}(,X0l$ot$|$oh\$ىhY PU -l$($|$ t$ t31T$phY WP $@$9|$|$|$(1L$t1ɡ(,@0)ȃ`T$1ۡ8,ـ#h=蒦=`,thk h+ ع`֋,$L$t1ɉȉD$ օt$ tH (,i0T$,RQUt$> (,;A0l$,} $L$l$l$,(,@0D$Mt$ |1TT1PD$T$ ʃ=,t RP L$(ωQM D$H 9tet$C9\$t$$hUD 8,4$F4$;t$SD$`18,0^_[]ËL$ ʋ (,f9u ShԤD$`,t$$h蜤jz (,PhsUSWVT$L$D$0(D$ X=,tSU ʼnӉ OD$$(,@09ʼn} t$t$5D$PSUt$< (,;A0 t$~QPSU ~t$4SUWt$T$LtL$A L$ Q5,t9RPt$ƉT$ t$1ӋT$1 t<$G RQ D11 u5\$$9t ;D$t`GPD$ GPWTt RPr $<$G L$;L$t9ta щʼn$;D$t`1h^_[]USWV d,$(,x0UWt$0t$0U Ɖt$ыt$$)‹\$(19r11 $p|$ )Qj`PR  8,T$4$1B srl$,$ ȈU1wX=,t f,!9GX=,tȋL$,1Phʡ 8,L$ $  h 詡=`,thk h+t$D$OPWTP1GTGP^_[]8,1USWV|$,td,1@$(,sll$\,t`, L$ =ƍD$1PQQV{9 (,;A0-T$zu D$`1]l$z$Ń1EGpD$hV] D$ Pt$ u&xMt(T$hV] D$ PW t݃^_[]À|$t<$1@$1D$ tms ss3sWhp=`,th}e hqt3s ss3st$Vn[E;,$u8,:]tJPh`ju USWV0\$T|$HOX=,t1D$,D$(D$$D$ D$D$PL$Qs tPs+t$OG,҉L$D$td$PQ( É׋n11 D$Hpq1Ƌy 1 t $B8HB8tQPQQC;\$4${D$@D$ \$C;\$ } 4$N/D$P<$D$@Pt$\$D$D1؋L$@1 u$3D$<3L$8 OE81H"h Phn8p O4$VIVh.hh h$I hhh hhؾh|WVt$ F,t@=,th% F,P1~,>d9~8uv0^_hDh[h h$辙 D$x,u@Pt PSKhnh\h h$膙 WV΋I01t*N8~2IN8tPQP PN0G;~4vɃ~8u^_h.hh h$$ hDhh USWVEH1BT$x,1h1MA04$4tOF~|$ D$ڍD$P|$Weu$v vu WS}u 6Mu1NjM4$F;q4vSe^_[]hohh$ h$G USWVP΋I1H$ЅD$T$R^~9؉|׉^ );\$sH tʼnnF PUvS|$W T$uu߉<$)ڋ~Nn\$ tЉFV RPvSt$u,݃FNV ‹v$9Չ|ʼnϋD$x(1^_[]hhh3 h$7 USWVPl$M1F},tXL$$Fu^1t?|$ \$U0m4!݋$<$t,$U1ڋE 1 tmu)u11@^_[]hohh> hhh? h$螖 USWVEH1Bx,MB1ts}u] $L$E@0I4!t:H1P 1 tH@D$ L$MڍD$Pt$u$ӃL$)u1e^_[]hohƾhO hhƾhQ h$ĕ USWV ȊI1Nօuyt$ ^px9t$|݉L$,$H @$+\$t$9r1ۋ,$4$t$t$4$)T$9ʉ|D$ h ^_[]hhhf h$ fUSWV\$$|$ l$t$=,t5,SWUh>j USWV5,71^_[]USWV\$$|$ l$t$=,t5,SWUhoLj USWV5,C1^_[]V=\,th2j5@,Gtah赌hWtS@,xL~61 <, s"@Pt4hi <,@,F;pL|^5@,vj{b @,t'x,tP@,P@,á@,t x,tt$t$t$t$P1WVt$|$ VWJ=,dtX=,ts,(,`uau33 u1@1^_WV X,t1 <, (,1!`u/aʀs2hlpx1Ph!PhWh蓷Jh<(, ǀdƀah P5, 54,5,=,t,PP5,,(,!1111QWRPjh@,hhsh赶lh< (, ǀdh P5,H 54,5,=,t,PP 5,', (,dPs+aʀu PhWPh)h˵h!(,ǀdƀah P5,a 54,5,-=,t,PP95,@,^_j^ USWV1L$ AL$HAL$@AL$<L$ L$A AA}u ]hRWV\} k~lt$tu4D$PS\,buD$HPS3# D$ PS$t9PD$DPD$DPD$,PS(uh<)jƉe^_[]95,)ujhD$PX u1PPD$Pjb95,)t$Dt$Djt$0t$0Sp(!уtdT$0D$4D$ D$XD$$D$TD$HD$,D$LD$(|$j}$RQ RPt$8t$@t$8t$@WA1u2hR1PPt$8t$@t$8t$@}W1%L$\$K L$KT$L$KHK$S PH S(K,L$8ɉt8j$SQt ]S5rt$SL$T$PL$HL$H WP$H OW H(P,L$8t8j$PQ St$\D$PhhVV\D$@w ww7VPh.S 1h+h WfUSWV1L$(AL$$t$@L$ D$ }] hWSBy aLuKVbtit'cD$ Pu D$(Pu  D$$PuY udt AuZD$ 9,)u~]#@1غ$Phzd@e tN|$$tOhT)j1t$ jt$@^1Oe^_[]hT)j11J$THPT$,L$(HL$x1VVVVV]P-T$4 @T$ƋD$(D$8D$,D$4D$$D$ 9u 1^_[]USWV$$$jUWS1HtEFI 3PART3N tVB1Č^_[]ËV FFt5$1I1,13 C9uы$$$193nTnP1$lj1ۃNHVLWT$RL$QP(|$t!1K1 13@9uӋ$;^X$$|/$ QtUU$Ph<S1B$11 )RVPjRUS$ 1 )jWQjt$vLvH$ 1ɅD c [VP1ۉ$nTjhUF \$],U(E M$)˃$$|BUhhD$PLSt$u$u D$PhY$E M$jUjSt$QP$ \$CXVPC$9.1@rZUWhSE$$+tWt$t$hPItt$t$h$"Q#1HPD$tu-PhP D$ L$ $QP.kj O XUSWV \$$|$ hjAƋD$(D$,(D$0,D$4$D$80D$<4t1jhVPWZ8QP ($#@=$؃u E:j ]1uSWhQ ChWV@  hhV6t P;VZ1 ^_[]ËMz /1SQWD$P9|RPh V늉|$$tRPUQWh(V؋T$RPV" ID$11WWPW$1@PjPV ؃$jS T$jQUWL$NR  ts^Uhd@ tYMɉhrRhd@ t4O tGʋMD$8h $h4h*jV tH hV{ 1Ʌ$A I$ 9؉$jQPVSWVPt$|$\$$M0PS ^_[PL$T$ D$$jPXUSWV Ӊ΋l$ jURQQtn=Uuq1tu@ yyu݅tj ud1PPhV[hVtUShV-W0\tUShV |UShV1@PWPjPUSV D$@\$4$1= uD$ Pt$h t$  $|(1RVRUPQh't$O $\$S]jPjt$ t$jjW X CPARTEFI CC \@CKl$0k$s l$@$ЉK(C,)l$0ՉD$ C0C4C8PWBl$QSLCH$<$D$D$49wЉCP\$CTD$(t3I 11KQP@BE逋D$;hPD$(r؋\$0|$8SVjPljp jt$ t$t$t$$W@ t $p q J H @AQ@A$Q @QHALhSh-hMUSWVP\$|$tus$  $$jtQ1@PVSjPt$8t$8WJ E1u>4$hW V%ShSW4$hnW 1H^_[]UWV} uOʃD4|RQPhoVJPRx: x& $T$W1ٹ|$5D4h 5D4h V5 1He^_]WVD$t$L$ hLtXat_bVQCiitZstdturjhV,5 1OujV5D4<uW?,VQ>~IhQ1$VQ7 t1PhQi 1O^_SWVP|$1N?u;j S5D4o 8u1u5D4h t$ ^_[WV|$1N?t5D4* 1t^_h9t$USWV 1O1;B։ˍD$ j P5D4q уT$L$ L$R~ st btSu$L$yt;bt t0Bu L$yt4D$P5D4.8 x(D$T$$L$T$V1e^_[]USWVt$1191A;BB|z$u z,1O9$S`SljF$qofC$t9WCKʃ| 33O :CK ʃ|3G3O M$I qTp {,t-F8jmL$ Qj$P.D$Ps,jht$2 $ tjVt$1 $ jQV$Ѓ $V  I iTh j$U$  Vd tZs0whV;z1t^_[]1;BB  FjhP!1 1Ʌ1OUSWV|$Wf1Ntml$ \$jUPӃ W tB jUp Ӄ  W tD$p0hWm 1^_[]ËD$L$stitau1t$QVT$> t$ Q1PhQ 1HUSWVt$|$ t)l$\$$jWUS?  tWUSh1h V*l$(\$$jWUS?  tWUShVV1H^_[]Ã|jWUS 11USWV\$1s3hk 5D42t^1W(tuWht$ 1N0, Chk j2Džu^_[]WV|$ 4(Wh: u^_USWV\$l$t$Uh VW ,!؋0#L$ t*> tUPVb U(VR u^_[]USWV \$ |$$tl$4|$0L$,D$( uhS 1N ^_[]S1Nt@PL$$9sPQhSɍQD$@ XT$ډL$Y jhS- ׋C0!K4!T$, ыT$( ЉC0K4t$t$ D$(Po K H $YTL$ Q #|0#l4 l$, |$(|0l4|$ QPW" t$$hW 1t$$ht$( WV|$jhW, 1Nu.W5D4~4t5D4ht$ 1^_USWVl$$\$ |$t$jj h USjVyD$USWhKP8 |$tVhh;8 j Q7 ^_[]ÐWV,);$$,(h\^ $hg7 j$,(: RPhx h jV p FQPhx7 v,v(h v4v0h F8PhhW1Wh+7 vPh7 1$h)jĈhF 1HĀ^_fUSWV  tSUWV= )׋ $T$$Zj 9މrz t yD$BD$j(j藩)L$T$PXh L$$AH $HtAhvt$$1N ^_[]Åt.yt?h9}ۅyhhhet$$룋Br t$qD$Ƌy |$ tj $SUWV82 )׉T$1Љ\$1 uc։[)1yqy Kh0A)ډI 9Љ}Lh?rz ABAtP9։}mWVSRht$4)ً$BJ l$$+]\$] l$*l$$Z u $AEAthnu} l$$u)Љى} $KS)‹C ȉC ЉSZًCECD$ $t|$$L$|$t$,t$4RQn L$ ‹T$4L$tJt$,t$4RQWu!уvL$11 u21D$EZh_P%1D$Bh_ D$_$ӃD$DL$H(X,EPt$@E X,L$H(ux4$t$w7t$HhuU1fUSWVPM(,|$8O] D$1huS1 sujsWVVuutqD$9,)1t$ƻSUV 9)uVL$D$4$T$d$ 0$D$D$D$ ‰Ƌ|$(@fL$$? 7fWfOGg D$ G D$fG1ChW?0hh5W(SPhKWJV1H^_[]USWV4t$Pl$L\$H1 B0dhVU ttLPWS莾 u:t69-,)u.jhT WSu(<$t*jh WShȫ)jb4^_[]1Vt$|$uh,j,F,F,F,F^Vt$|$uh,j,FD,F@,F<,F8^fUSWV$ $$_hWV ou-D495,)1O$ QhD$PI $ƋFHt$ $茤^ hSh5!PD$Q|þ1${CWhPI PhVL CPhVL CPhVL xCPhVrL ]CPhυ!VWL BCPh#Vu$L$4fL$fB$PhaSq: $PhnSP: t$(\Åt$(膃$fǀU1PPPE$ !ƒ[u$t$ ;$4t$8fD$t$΂fËt$01 |$lD$Phυ!SPA D$lPt$[D$PhSA D$|Pt$'$Ph=`!Su9 `$Ph)!SW9 B$Ph9,S99 $D$PhS@ tj$$Pt$ ח D$DPhS7 D$D9M$ $ȃhL$pQP趨 t$jÅt$蔁U$61QQP5 !ƒ~t$ M$$VP 9U]$|$$D$jRPצ !ƒ=M$$VPP 9E$1SP|$W~ GPARTEFI G\G 1ɉOGD$,G$D$G D$ G(O,1ɋD$\$uohD$\$tYM L$ M$P9rQPt$2|$hҋ\$t'E(D$M,R9rQPt$ ו E0t!t+M4S9rQSP豕 0t,h MHtU4uL9rRQP胕 t$|$t%u@uhV tIM 81tSul|$tDEM9rQWP2 u@u`VÓ u@yu@u`V譓 teEptUt$8ЃtEu8uXV胓 t, ^_[]hUh,AhUh5hUhn)u\u\hudSh}j^wlhjfUSWVt$O1tvt$˃t[S mtCPݍVt$tPUW uWdS m1SlW^_[]USWVu]PhuS# t$f1j?1Nt}ǍD$ PhvS* td\$ t\hjD$P jS\$SF ShiW t$E L$Uf jQhuP:*je^_[]PPhvt$v* u1$YVPt$ t$t$V tPhvV<* u1$^USWVt$t$ht Nj\$ P%9vy ? l 1N*Ƌl$W%VPUZ )SjU ^_[]USWVt$t$t?Nj\$ P謝9s9Ƌl$WɝVPU )SjU螑 ԝ  ǝ ?1N^_[]UPhF1u t$荝 1H]USWV@uPhV ] h@VtP |$ P\$$ShiV\@ |$ jSSPh@u  Vaۋ] tY$L$x D$ 1҉ʉ4$T$H!D$ D$ jPt!Ph@S襃 VJa1He^_[]hh=hh WV|$$h@Wt;Pۛu1VjPV/ VhiWQ? t^_hJh:jVh hljV,h)V V ,hkV V ^V$ 1ɉ JJJ JJRhiP> D$t$j7QPhhVAG>tVh V՚ FߋD$t$j7QPhhVF>tVh V萚 F߁^UVuPhV t3$L$ AQhiV= u hm 1e^]hhhhl  UVuPh:Vq t3$L$ AQhiVe= u h>l 1e^]hh5hhl  UWV}W#ƉPhxW tZt4$P<tW@PVtGPhu 菀 t>VNT1e^_]hhIhhl } hhIhX hIhrj9ht$}tPht$ Hhhhhl  WVPt$|$D$PVW t2D$t u Wh& jP D$L$AËD$L$AËD$L$AËD$L$AËD$ ,),)1ËD$ 4)4)1ËD$ <)<)1ËD$ D)D)1ËD$H@L) L)1SV\$ ShP)[ uCЃ r"CrCr 01H^[hP)蝎 H?r ݎ ؈P)1ыL$t L,1ÍAЃ r)Aw AwÉ臎 1HUSWV1t$ D$hVP H)xT,t8u^L,ǁP,T,X,\,`,d,h,l,p,t,x,|,,@wh)R&uh0h)9&uhh) &u hj茴$5()tvh<)%61,,,\)t)$hP)$U ƃV B~>CN,F v/FwD$t,Au"h  $D,xu>Wu4D$P1VhVVj V5D4k ,9t$:*ƀL,l `C Lvms)\)u),,r,,D$P1VhVVj V5D4Dj ,9t$taY,>,O,CatTl5)+wtz\)9t))$ÿx)؉$\),) ,$u =,uB=b,=,=,u|t =,u =[,uftu^,uS$ttH)ŋ$L$ T$ RQL$QWPU%u`ju&hh ,5D4h jt$PD$P & u h/ D$t,DtVPyDžuhh< JW WtS)uhh,WuhhH)t H9t@hhX $@ uh hh*hl a VWЃ Wjܻ USWVC iuhh jƸP)jmPxU   tjLP)PUU tUSWhh)g @)t VSm#u WWWWWQWhh)! $VMj V H)1tT$q9t Iu^WVΉhjW{ D$PhV  tZhJ VltQP蝇L$PyRPQ{ WhiV* u h%Z Ĕ^_hhhhl  WV h% Q'lt;P u1W j PW<{ Whui V^* t ^_h hhihl & h+jh 3 1ÃD$ 1ɉJJJ JJ BRhiP) t1h j衭$1ɉJJRhiP) u 1Đh jbQhP)R USWV΅t Rh.f'f0($D$P ; !\$D$1t$$tsVH sD$tVP+ VhvWd trC=,D$uCt\=,uCuM=,uCt>=,uLhj$Vx VhiWn( t!$uۋt$$4u=,t ~ j hP)s}q Wt& H)ɋ,$t(D$Q9t"IuD$1,$D$L$P$D$t$ D$PUW{ D$jPhm h$V?VUh  jl$U$V+ Vhit$v t$,$t!Ph 輽 Vh \V ,$jt$Vj+ Vh~it$Xv t$tPh j j 耼 ꍄ$P$$ j:QPh, h$P-/$t'$Uh  U赂 E}uj:$$h, h$P.$t'$Uh 蓼 UZ E}u-8)4$tVWUmuj|$W$V* $$ DŽ$@Vhit$Vt u$ h  1@Pl$U%jWl$0U) 1@D$81D$ƉPV5,( ǣ,V01u ,$hlZ1H^_hhhh+) WVPt$T$h[VYtbPtVbtPW8. tIƉPV5, ǣ,Vl/1u! ,$hlnt 1H^_USWVt$T$1h$VYthƋ-,PsVsPW- t6ƉPWt>V. ݉-,11H^_[]hh!h2h+ h:fSWV|$ ts 1H>t$|$\$j+|PstЋD$F ^F1^_[WV$tq$Wt$RQVjPtH4$VWqtE$$PwCt/$F ~G F1r  r 1HĄ^_ËD$@ txt1@ItPуu1HUSWVPD$(t?\$s$QPGh Ɖ׃с11E9r 5r 8"t$8t#r 1H^_[];sC| C 9s} q "WV*?t/t$ L$Ps(,tD$$F ^C F1q USWVuD$ tV} ]CtP7DVtEC tP7.Vu/D$ PhF17v u$D$1$.q 1Oe^_[]D$T$ |$T1 1O~oJt 뺅tuT$V* t|$,$hk W D$!tD$1{tj/t$ tAL$L$4yyyyy D$AAD$ PQt$ t$ tsË|$D$4t'u#D$XPt$W D$4D$4D$ PD$8Pt$ t$  ÅuD$ xo 1ۍT$T1 B1G11Ҋ<:txĀğw.J2L\C:ĀĿw < ttFxro 1X \$TfD$t7|$0j WPGB t9t1ۉD$=rn "11HD$$Py)|$1OL$L$D$L$T$PQRhV1D$%=L$L$<fD$Tf\$fD$X0u4JL\ D$TD$1HD$\$Z\$T3F$P&NjD$fVSPa sD$ t P 4$WkWK(<4$uM S]s {te|$t^t$Vt$t_@PWZkW'tNVsE0S ߉Vu1ۉt3EF ^C F1Vt$hhhhX hhrj蝓WVt$tV-l rpl 1H^_V>t3t$L$|$ Pwt΋D$F ~G F1l USWVt$,1D$D$D$ D$D$^ |$41$Ct$|$<u-EL$01PP1GwD$8G $~u t'u'j <$t@1@>j .1-t P/1GG GGj 1H^_[]SWVt$F$tPv V, t@F$~1t71KGtxu@It Pуt ?u1Nމ^_[USWVPt$(tfD$X$tN|$nCtP7Nt+{0t>-uUsbj t>VsRj t)ui  i 1H^_[]Ís s(CtP7[NuCtP7ENt1@뿋C$1$4v66!66 Pq v6 8tMtk $t$ 4$UQV,h?WVW^_USWV, $@ 1 8,t1ۈ$+$*|$hjWT WhKiVb l$(EPƀ}u jUt$GL$$*SjQhRPUZ u jW9$L$ $+SjQhUPW" 1f|$0t,L$f|$ 0t,D$ t8L$ T$QUR$6QPh! , ^_[]h)jj7h`. jhIit$  t1hjWVt$ ̳)9tEtt$t^hD$L$8jPQjVt_1$D @u D$D$1D@uPhi8W^ 1uh<jzS 1Hx^_[]hhjyWV0t$<|$jWhYV萴t8W"t7HfJBRhiV t!10^_h0hWh;jGyhqjkySWV,hl)VS,h@)W@VgW^,hHNV3,hRW,hRSVPW-SX^_[USWV1퍴$1 Vh8i($  t$r 1ۉ,$l$l$l$ l$fD$|$41󫍼$j!UWE Whi$ U $!hB $HQPۍ\$4|$fGWhiU t$If|$*uS=,t P肊 fD$(WhiU t$\f|$*uf=,t PC |$fG WhiU t2D$*=) Phq =,t hy fD$(IWhiU> t2D$*=) Ph辉 =,t h覉 1Shi8U |$Dhk 1tPDL@uShi8U t$HuM1|TuD@uD$L|C)L$P9Dzty:t|$jQhz uVh؈ 11t j, DLxPtT h袈 v<u h*脈 j 蚇 $PhiU tDhR $t$h4  h% j ; PhiUk D$tPhiUO t|D$ D$tTD$HT$lfJRPh資 $=tPh薇 j 謆 $=tPhm ^_[]PhjRth)jhh ÃD$1ɉJJ JJ fBRhiPm t1hqj"t8D$<1ɉJBJJJ J$J(J,J0J4Rhi8P t18h<jsUSWV,$@$PhiV tr$A jjj" xgljj2 xi$-hSWp xB$/uE$0uf$Ciu.h 1H h h W}q1L$AAAAA fA$-yfAQhiV i t$0(G 1ۉt$/G($G!L$[ Pt$ )9ˉփ'hKh3fhGh. hh{h|QL$4Qh (D$f($-D$](E!L$:!PS E P$EM r)uv= tC= %s fyBMt11OD9|B9u1ML$}mL$ Q ,t  ,E ,tIAtcAtCAtPA tSA@tBAyAAT$h ,UWt$PVt$D$VPRRhP菃 ,l$ }"E!Ê<)\<$h=,`Cs|$[VPWl$Ph{h #<*<0<2=,<$<tsQhς _1L; yQRPhk蚂 Gk 9u<]K%C=PhhT =,S<$CPh2 KPh K s k t?L$D$FPWh NЧ ܋L$D$(Mu} L$D$D$FPtPtPu8  +~ QPhS NЧ D$ŋL$D$(ȉ</=,%<C<$=,CPh=,CKSRQPhh詀 C~@sFNuQPhq IRQPhY Muj>i l$ L=,?CPh! (shh =,<$CPh KPh Ck tAt$D$x\PVh OЧ ܋D$t$)E}twt$D$pttu8  +~ QPh NЧ D$<t$)ƃl$ rPh~ j>} <$€$rQ=PuJC<u;hhz~ =,yCKQPhBV~ ]=,Pȹ6<"<1  #hh} =,<$CPhgo} 1D3 tT3 ׃l3 URWPQLhu-} uj>;| l$ <7,CPCHÃ)gj { EŋL$)ȃ'=wBtP iff1=33H?% xi =%r`01,^_[]hhjiWVD$(1www ww7fWfGfGwWhiQ6 uhs 1N^_USWV ׋D$$P<$9w$T$t$ L$t1ۊ^w3C9u,$UVQ7 ;l$D$tD...P#A ^_[]WhhQ6 1<$tɍGrD$X1.PhDS` E;,$sGwUSWV։ϋ\$Qhz W@ )Ǎ 9~)jy ^_[]ø w ø~ øSw$ø~ VPt$ D$PhV跿 tD$P^hhhhL0 VPt$ D$Ph]Vj tD$P^hhhhL WVt$(|$WhiV tND$PhV tCD$D$WhiV 1uh 1H^_hjHfhhhhLO fUSWV4jh,,' v! wy he h Qy hG jh } t\ L$0jQP iD$0tPh% jh @} $L$Hj jhbj  hWV ft&stt%Ph&ȵ)e8,95,)t h1 VPhh  VPUSWQRPhh$1EVQPUhiVSh4i 1H|$G GGVSPPUPP P P PUPPW!8VWj` |$www wwVWj VWj  VCbS:bW,b T$0B (L$VVPQWR 1I9u e< 8tމ5<,5ȵ)31̵)=et/=mjt.=mt-="xt,=st+1=-qd)fsfrft fmfTet/mjt+mt'"xt#st-qd(sr tmT=D,tyhUD$8PO/ Sh#j D$`Ps fDŽ$vU$P,$ f$~f$|D$0P_u h#W5̵)։1@4^_[]h'% j  : 1AjQahjajjvh$vu8$jVy t$jhbjh %Vhskh+j { j t USWV`@,z~11t$HFFF FF1G>l$ UVj \$SVWp X ƅȵ)1MjSj tFNj$ 9uF$=h$jV^9 8ȵ)9tt1VD$$Pj VD$ Pj ȵ)>hG$B jjjH 1VUjv VSjj e`^_[]hv$)=ȵ)u$=|$\$ u(8,1VSj VWj mj뢉tуt̃ u1Ht$8F FFV\Ph$1VSj VWB1#WVEw t D$8x xx8WPV[ rk{jh#hMǔ +SW]Wh#$j` V PD$L$ $QPj XSWVD$,D$D$4$@t@t$1O\$~ ~~>1ɃL$jSP $H $u˃^_[áP,H P,t$Vt$VPhv#j V D$ttuys -q1ȵ)L,VPD$$Ht5t$ I?r6 $ !P$Ѕuσ^USWVl`(t$T$1BqZBinitL$ UQD$PQjV tw\$`$CD$l$T$11BsB4B$jCroot`PD$PVVjD$P u\%=%Pl^_[]USWVl119=m&D$`VVPhA,h5#l+ t@t$A,u"hA,4 N9uf=A,/h\#Tqh?#C5 8uXD$PVhbj t9T$11B$B$D$ j`PUUjV )u1AM=mu>@,8, ^jjVWS2VWS& ml^_[]USWV( ƅ@1MjSj: tKNj$19uG $tCȃu9hh+h jVX 3 8ux9u $ȃu;u@Ohh+hc jjj j @tuDhh+hmuhh+hh e(^_[]Ão=ȵ)-q_1Ht$F FFVVt$1ۉ^^ ^^1@Fl$SUj" SU1@P %$skD$=8,u D$\$ SVj4V thA,[u++PV~WhVhF jA hA,h)[j( UWV5D,1 "Ph,,Pj2D$ Ph"Ь thD$d D$ht^D$4L$8T$Dt$@9Ɖ|щL$$|L$HL$PUhf| 1ۃ$u=`,t$, PU#t$, Uh,J=\,uj $t7t$21FVs2Vt$Hu h+T $($(\$(SPhMhWE t$W1 8tUWh uc 8uD$(PUPh , jC USWV ˁD$Pj VL$ Qh*,E #+t$1(Gt6t =`,t#tFwPhE G!Ņt G \*rt4tU tcFUQPh=,TE 1tKtFPhR,*E Xt 0h hD =`,tFstspPh`,D =`,tPhD sds`sTsPhr,D slshs\sXh,qD =`,|Ut$ 1|$$hVPPh6Pt$5u(|$ t!j V tVWh,D hF V N^tgPhC ^_[]fWVt$t-t|$ PWZ tu4,4 14,^_WVD$ 18nuxou 4,Pd t_1,tu@APótCƉ8j,W 1Gt@Gj,P 'h3 h W1^_fWVt$ |$7WVUSWVx|$x$xl$WVSU$$ejtU3WhkBuWVhj/D$@t.D$t$xQPh`0hVVx j; USWVPl$$|$ \$11U1@<4,)|$h0SWY i~jt$ot%r $Ӄet5gu6 $À $VUh.5D4էtfP舧뙀 $듃u\,))ǃuPt|$(W4ct$,VVErEL$ 9$Ap^_[]hjL." PhGh)B j9 WVt$|$ VW׌t ?/t)Wh v Vhv Whle ^_fWVt$ |$7WVSWV$D$\$VPWS$,$,njS7Vhk@u$` tu!D$t$j 9 . 0PVt$ hj,USWV\$ l$|$t$1E1@<4,)hWVW ou%jSh05D4tEP薥ǃuA,))ރu4t$$V4Nut$(t;^_[]hj{,Q PhGh)!A j8 fWVt$|$ VWt ?/t)WhLt Vh>t Whl ^_fWVt$ |$7WVUSWV $$l$WVSU$ $ hU3Whk>uWVhj+D$@tY$$QPhH4hVV$$$$$h4= j6 USWVMu1} ]hD$ PV D$ FxD$D$D$D$D$h4WSU L~)Hw;$25D4Ft1@D$Ã9tGN|므N|멃MUN| 둀N|5D4L$1@D$kjuh35D4$PӢ=N|45D4 1@D$5D4Fp1@D$5D4L$ 1@D$,)H9|$\$t L$T$ ttL$ T$|$u 1AL$\MQ4u\$ SE|$\$t t|$uHD$(Pt$ | tuD$@FpuD$DFt|$u#D$0L$ L$|$u|$ W_ Wv @$N|dže^_[]hjs(t$hKC Ph4h)= j 4 WVPt$jWV 9u9t x^_Vt$hUj'Vt$Vt@^hJV^Vt$Vt@^h:]V|^WVPt$jWV 9t9u x^_VhgjX'WVt$|$ VW7t ?/t)Who Vhro Whl ^_fWVt$ |$7 WV1^_USWVp|$o$o\$WVUS$$jHSuWh |9uI 8KD$  =,%D$ Vt$S jHSt$D$@D$ $p QPh8hVD$tS\$O$oj j ShWt$ PI tPX Ph:/n t$ SWh:8 t$Dt$Dt$Dt$Dt$Dt$Dt$Dt$Dt$DVt$Dt$@t$@h:8 81p^_[]WVhj%jW1 SWV\$D$@u+t$P t;SP t7V/1 8,C8,C^_[h3j2%j0 USWVPL$$T$ l$\$1$1X)֍zh9USO @~7M$d5OӃ23=,,먀'룋 D4DF@N@늋 D4IF(NnOe D4R)KF ?)0O' D4aF8N ,O D4g\P6 D$ p4t$ N @OPt$(hD65D4蘜Ƌ$t ,t'tOt@tO t=,, s=,,g@tOy )sg st1A T$ J shV^,$fyh9VCL$ A$I$sh9V!L$ A I$sh9VL$ A$I$sh9VݙL$ AWSB H$$=P5D4#3$L$T$,Jjuh`=5D4iP뇉=D4jh>W t5jh>W tZPW"$T$D$0PWD$0t 8D$ D$(JD$0PW{D$0t 8D$ vD$$c5$T$$MA QD$5D4D$o5D4D$1@D$Q5D4tD$ 1@D$35,))h4uE }WtD$0PWi |$L$T$t$ ut$HEpD$tT$LEP|$uL$8EHe^_[]]5D4h>h 5D4h>j'Wh?PWh?Wh/@ PWh@jWh>˨ Phb@h)) j SWV$t$$$$\$VPWS$H$HTj S7Vhk'D$@t$h ?8' t$t$h?#' t$ t$ h&?' t$>t0hG?& jt$h7?& t$葐t0he?& jt$ hU?& t$ hs?& 1$^_[Vh>jWVt$ |$7xWV1^_U0E\$D$,1ɍT$ QQPRh?HuUD$ L$$L$D$l$\$ D$L$ |$D$ fD$l$|$l$D$T$]h?jWVPt$jWV> 9u9t x^_Vt$hUjVt$V迎t@^hJV^Vt$V軓t@^h:]V|^WVPt$jWV赾 9t9u x^_VhgjWVt$|$ VWpt ?/t)Wh(Z VhZ Whlm ^_fWV1t$|$ ɉ @4uz ȉXȉX\ȉ\ȉAz !z z  PQ40y 40<8y <8D@y D@LHmy LHTPMy TPXȉX1\ɉ\@uꋇȉȉ ȉ $ȉ$(ȉ(,ȉ,40x 40<8x <8D@sx D@HȉHLȉLPȉPTȉTXȉX\ȉ\^_WVt$|$ w7w Vw ww V Fwww VFwww VF^_USWV\$l$EffEffCEffCEffCu ulw S CEȉCEȉCEȉCEȉCE ȉC E$ȉC${(u( E`C`EXM\K\CXEdȉCdEhȉChElȉClEpȉCpEtȉCt^_[]USWV\$l$EffEffCEȉCEȉCE ȉC uuv SCuuv SCu$u yv S$C EDȉCDu,u(]v S,C(E@ȉC@u4u0Av S4C0EHȉCHu LABLGˉ_ ffGGVt$P聮 uu3q 12wȉfOe^_[]ËL$”19v f39rËL$D$”19v f39rfUSWVT$l$hD$0,m hCP9 uCt hCP uO,=,D$CtD$C1MD$,D$(D$$1D$D$<$\$t$SW1 P4E1A$@=D4hmW@ hzW* <$t=D4WՇ@,D41JPPhPPVx,Yjj5D4豲 D$,9D41aJPPhPj, =,=D4jh,h)W~P~ D41JPPhPj,D41JPPhPhot,rD4,a1@D$(SD41ePPhPj%p,(D41KPPjcPP)=D4h:]Wg hJWQ  ,,=,,=,=D4yW蜀@D41}KPPhPj?,BD41vDPPhPj)1Gh)Wj>h D9 =,<$=D4hLDWU u,G=D41PPjPP)1@D$$D41PPjPPj,mD41IPPhPh<,P9D41DPPhPj, =D4=,j:W茨 Aj/Wy .?y,D4빌Fl$0UU݋\$UW|$Pv ,,s)DH,W D$hW h^~!W |,W ,N1KPPhPj ),, )DHW} D$<$|,hE,)=)_=,tVh]Ez5D4hDj5D4hPDZh1EPhjFWhD9WhL.D$ =,u1=,@,$1󫍄$,B,Al$$+D$ -,t1$ 1D$$$MljL$$ PWq ?t$hE,l$Ul$RQPC  $׉ȉ ,=,1| hxF$t/$$T$9‰sQt$t$WPhFtFtA ,WPU@ u5,5,t$hF|$(F=$PU<|uRt$hF薨  A#$=`h,hE1=, $Vh耹u VhGal$VjD$PM ,-,-,݃=,~VUWt$h)G+ |>9|Pt$t$  )̓ }4$ԏ\$l$ p,t,ɋ|$  p,=, ,5,σ|,@σ|1ҿ9  ,9|щ p,|$ D=,Ejjh, .h,hFp,=,tt,,t&hQhGB ,t,t=|hPhGB =,u1=t,1@,=,u p,,=),=|,t#jh8HhHhHiB |,=,u=)t,裴,t$t$ t$4Ut$$Vt$t 9t Vmt U_=,9$Pt~Ek tƃhCyj S 讌 PhUHjd$8P ! jjjh9,$,,ApQt,@jxQP$PhC g 0 VhUHjd$8PL $T $|$8j@ U$Pw$,PS u/jZ$P$\Ph u$4mfsjWVW 9uD$8%PϲP$Ph\HhrG|$D$D$4jP$u/h,h"F$Ph,jXhWj /dev3, ,/ D$ ,tD$ ,<$~~l$4 $jWh[ u ƃrl$Wl$$U MGWU :l$ ʼn\$4Ë$H$|$,\$L$ u D,$T$dž,<tx(=,dž dž,dž(Ɔ ))u(jhRM  =,-5,u"jhyM =,,5, t,N0p,F4Qt$QhM =,w,5,F4Ht$PhM| =,S,5,F4 ,9}"QPhNM =,+,5,F0=)hPh/N =,+5,F0=|)hPhZN =,+5,F0N49}QPhN =,+x,,;t,|QUUUU)ʹ3333!!сis{09\~\{0\\5,sXș9}%CX=,~QhN  ,sX||$C0{4ىKHىKLH8<O@DCP|1ɉƉAwKPCT1Ƀ|1ɉAwKTS8C`|a$1ɉ׉AwK` |;QP$hN" =,**,{4$=,11F9tA uPh,Qj$Kd=,5, u։<8=)[ WVhOx =,),<$C4$8=,`$$ǃ\TǃǃK0$Ct$Cx1ɸ $ǃ\T1ɉǃ {0$St${xKC$s$K@CD<C|1@XLP@$$уRVQP Njs8ƒPVRW )lj{$ 0Iș)K $$K$ @ 0$4$$ً$Nu݋$04$@$$9Ƌ$}PWVhMO1 =,',tm ,yxH1҉$q1ҋ8$$)$<$$1C$I8$ ,=,_x$ʊOT t11A9rȉً<8q$$)$މ$։$I8$1QPV$W 1C1 t׉Ë$$QPV$$VM] 9s($$$V É׃$؋$щ$ʉ t$DŽ$1ҋ$$ዌ$4?$$$ˉ$$ $$$$$ $1$~$$$$$$~X$I`$$ t$ك$ 1ɋ$$0$$)$$$)؃OȃjWRP8[ ƒ$$$$$$׋$$$RPVQZ $9wȃr$9‹$֋$r‰$$$$$B1WRQPO Ë$Ë$ʃQPRS )ÍC4$$W$$P$QY @$H$$$ރ$$$~!$I`OσNj$I $9ϋ$$)$$$PSRQ j$P$$X @$$$$߉كʋ$ $$$~:J`Jу$0ʋ$9‹$~v1ɉƋ$9~c$PQhxO =, ,B$Bx$<$8$J`$$$؉1$$S$$׋$)DŽ$A9~#)$׉8<$$Y,$$$$S<$$~&ڋ$Jу $$I$Q$@$OL°!ʉ=)$_|HL!ʉG41SSjhjPSQ7 ,N ,I4QSP] ,H , , ,P44Q5,щ ,`@#HL 9| Hh )H< ,HX ,H\ |,PTXH fǀ$D %=,O4H$$GW)‹w,$ً8$)Љ‹<$ΊO` $$uމO8$H)։q#$$!#$$1) $1ɉ$$)Ӌ$ʉ@D$$40=)5O _(HLJ$,$$$t!LJ^F=,$$߬$$ڌ$ݔ$ɊOd t1G0 T$D$\$t$ED$\$$O- ,$ۄ$q,Q4$ڌ$݄$əy8L$D$t$\$$O =,O0 9| IУ,,=,u\Tu))У,1VVjhjPV3 ,u,9,,5,jP =,G, ,1ظ|(RQh P =,, ,5,5,~ ș)dہ|4\CGuȹC=,tL1$PP$$5,V1=,VhZN ,1u;1$VhjVu  =,5,h`VW =,tWV5,x\,hhPb 1@$=,heQa =,|o5,N,I\Tt~!NȃN׊Nd1 t1WPhRR $^)9u1H$Whht@P荧 PPftu!ѡ,t $ Q$=,u$|&,H,$$DŽ$%$ ,I,$1$ DŽ$1hP)a ,$ω$׉$$$ϋ$89Ë<|Ë\=TuA$$׋$'y׋$!yQ$$)yt $Q4Hљ$T$$t΋$BЃB9$} $ hQ_ =,Y ,j5,聦 5,FU $F +$^,$~J`^p=)uE$$FtJx9rȉFx$ofF$xB,H9ufVڋ$FfFNTNXHF\N`PЃȃ$~S=,uFh$ NlK`ڍOȃ$ډFd;v&hQW] =,,5,F $11ہ~U uv`щSA,$~!ـ1@ ,Il ,5,F=)Jd1҉$~U uNTNT~U $u-NX$P$$$ A P$1$$Jd1ҋ$Ћ$$1$$1$$1ҋ$$$fAz8C;$k$?1ɋ$~U uv\5,N uҋ,B8H!tk)D4,B8)Nj5,$9sE)ȉـ1B~U uv`5,F$CHu͋,B8$؋N9ȉ$J`~U uv`щS,$~!ـ1@ ,Il ,5,F=)Jd$1҉$~U uNTNT~U $uNXPǍ A P1$Jd$1ҋ$Ћ$$1$$1$1ҋ$$$fAB8$C$ȋN9|$)vAD45,;Vs2р1@~U uv`5,F$Bɋ,$~p$Fh$NlA$11G1ۉtB%t$$9Љ‹$1҉Шu$A$1GC;^prҋ$t$9Ћ$,H ,V$P V PV~x; ,up=,t,s4PP ,,@,Kd15,s4,, ,q4jP ,5,{0 9 ,PVQ: =,t,5,P5,g ,y0,$ryxtG$\P %TuCl$AP$ ,Ou$ց\TtQ!QЃyId t15,5,3 5,\TG~8^xN`1?9',+$~0lj$Ɖ$)ى$=,$= %Gl,,9wߋ$9w$,$$׋$\TtB!BƃB$ϊJd t1B0$1q8$SP $$Ë$9=,} $H$$$~A=,2$=|j.u 扄$ tC ,ׁ\TtQ!QЃYId t1RP$Vh#P $$;$$|W=,9,H,t =, $$ DŽ$j w DŽ$C,;X,/$~ j I =, $hjP ) ,+ɋMt@U@f$$hM$lCɋuM@EfDŽ$A| $h $l)fDŽ$ )t)$_ lj$DŽ$,H4$ $ H5,D@VL!! $`Nd8 sfAf$$$$$$i$$$<$$$ $8$,$($@$4$0$DfDŽ$$)@ lj$DŽ$ ,H4$ $l$h  5,D@~L!! $߉$Nd t1$Sv4$j2,@0p9w Au1H$$DŽ$1$$t ǡ,,@05,V$SQP$h$l ,ɉ$$$t RP3 $CPKT$l$hߍ$󥃼$$tA$ȃ=,CX$tFDŽ$PQD3 18$${X1$1$1ACSK8s<#$ptKTCP$t$$$$$2 $pthj$PN ,\T$$i$$ $$$$DŽ$H0$$_$ ,@$D$@L!! $` $h+$l$  ,Id$*$$i$$$<$ $$$8$($,$@$0$4$DDŽ$H0$$ P$l$h ,@$D$ @L!! $$g $ $$h$l,Hd t1$S6j$$V ,$ȔȐG$11F$t =,$$=,40=)0w4w+_1,$`SWPr $PjS =,t$W\=,t,ǀ\8 ,=,x\hhP誒 ,QP" WV=,t, ,q4PP׸ 5,HLNd t15,v4t5,95,vG=,t,p4VVx 5,,@,=,Od1Vw45,5, ,@4P5, e^_[]ÿWjV茑 1=,VW\hQr BhJQI j&X j%Q j(J ,j 9 j2 j'+ j$ h,PLhDPBj j j j j j j j j j j USWV=,ua΋\$=,t,,St$P= 4׋ ,UPSt$$5,L9u^_[]{ 0,~PWVhQD j$* USWV"=,΅ ,u,H4H , , =,;,,,;}FWh lC1I!;HtG#P;Pt;H uV9R_1ڍ_5,P=,Wh De^_[]USWV΋L$l$=,t=,teUjQÎ p׋ ,SPUt$$5,9t?Ț 0y|PWVhP j"w ,,UPQ; ^_[]SI`wD$$(C1C:Qh\Ph)& .  [SWV1ۃ=,։ SjQ輍 =)@fF F)f ^_[USWV Ӊϋ5,F Nd t15,G=,t,5,PP跳 ,yU +y/\$|$y1U =,1=U L$D$uq`|$ G`Ӊ $u щw*l$$8Cр4l$skPhzPh)c =,,D$$F  l$uX<tR$|$ G8ʋL$;iЃ}AhNR hQh(R,D 11҉ ^_[]ÉՁ|$U u L$I` L$w$HCʉـ1@BPhPh)i 8ʍ 6ʍ   1$5,$~3%)1@ ,Il 5,,K=,Od$sC=)CNdЋT$ t1҉t$VQPR {U uKTKTt$$ {U uKXًPō A P1l$L$NdЋT$ t1ҋL$QVPR L$|$ щT$ՉD$ȋL$D$VW|$RP ыt$ʋL$Vt$QRP $L$f AD$9F0u Ջ|$ՋN4|$ v8H)ƋL$ q O8) K$O8)D45,;F8|$}X1Bσ) ,yU uI`1@5,;F8|$|=,t,VPP 5,F Nd t15,USWV$΋=,G Od t15,=,t,5,PP胮 ,xU t)hNR2@ =,(,xU ‹l$(H $t@\$=,t,5,PP =,G Od t15,w,,HC, $9r%UQhP =,V, $\D$jT$RPQE- D$ ׁ|$Tu0SkՉD$D$ !!ʉыl$ϋCL$L$ L$$)1sxK`1 t1{0ŋD$ЉŠKd t1T$5,W,\Tud,jpxt$0t$ $<=,WV1L(ɉL(@ u1LXɉLX@ul$,jpxt$0t$ $,;=,trUV胪1tttpX! TtDpC u12! Cu) % $D l$hVU % $D9Pl$,T$5,p0^_[]j j WV։σ=)ȃ@PQR襄 =,t'ȉGffF=)u GffF^_fUSWV$8tW豷ƅuWhgj $$<$4D$Phd@U  tg1OVhedAU葂 F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uht$Tt1 ShU CPhU6 C PhU$ CPhU CPh#U $@D$t PS1-Uhzd@$<W蘁 t1 VhedAW} hjUt D$ P$4 D$, 9L$PL$9u0$S11:K 8tx$0h~` b$11҉ $ƅ*ŰP9j PUa ^_[]$0hj辴USWV01ۍD$,ShPSuyI1NtAljSPSWuWuMU D$t$$$Q1e^_[]fWVt$|$ VWt ?/t)Wh8 Vh* Whl}_ ^_fUSWV|$$\$(SWt$(t$(Q)jj`SW' ~XNjL$t$AhQl11 mTTDPD$T$ |$,t RP[ E`9uƋL$AhQl^_[]USWVl$(t$|$$\$ 1Gt$jV 1ɺ^FtF^D$~^tf :1: f^1K^^ ^^V(N,^0^4^8^$VjL7$u VhG ,,,%(,ʼn߃=,~VWUt$h)Gs |>9|Pt$t$ץ )σ}4$= ,-,uU- ,uY5,,=(,,@19lj| 19ǃ| ,u ,͋5,,=(,,ˉjURP =$,l$  ,uA@19lj$ $t$u h0,h\FjPVW v|$wext23$2fs3$ Whh0,hRVh0,h1F} 19ǃ} hrG $,t$VUt$  U.t 9t VjR USWVӉ $q |$j W\$ S Ƌtox+1۽ R~j'StJbtcgtU0F~"GtIKtKMtDkt?mt8st tBt,4$Ph1L$8ɉ׉u L$8t 1@׉׉|$l$  8"t83T$ 3t$ u,L$,D$(9ʼn|+L$4D$09|.^_[]t$t$h3QPWUt$t$h QPWUt$t$h t$t$h{jWV9 )Ph6VV軺 1GVWjhM VhSik W萱 USWVu} D$8jPog =0-54-5 ,%UUUU)3333!!щ%i|,Bv,9ttx9) )T$u hj|$΍QP-T-5< - @ -VT$ H -L -ډD -P…Ƅ) P -1f1ҁ‰t$$r=,,(,\$9D$\ -T$L-1t$$ËT$ u׍؉)9H1D$ 1$, w D$L$ |$)9wЉD$,1D$L$0D$ 1D$K|$tNrI|>9t19t+9t'R<4)Ή9|݉9|׉9|ы|$ T$|$GƉD$L$  t$D$)D$9s%|$D$ 1t$$D$D$,1L$ \$t$D$01ۃ|$Ë|$ I1D$ )щȋ|$ǣ$,5<-8-$)t$ƺQ=T -D$X -D$ ` -@-D$ X-\-1 `-5d-D$8h-l-p-St-x-|-N5----[- f-kf--  )f-\$P$SW輝93fWh-F5,|$t"VOz MjVh-p 1-8----D$- <-+ L- 1҃r1I15X-~σRVPWr 5< -H19w+5X -|$OL$)9r΅u -f5-5 ,5X -V$d -MVjPXm GD$AD$ 11L$\$X-L-tn-tHrC|d9t+9t'9t# I4)މ9~߉9~ى9~& X -@-t - X -@ d -1Hd -L2 d -D1\$;|$tX-)ád -f\0 d -D1 `-u\$fT1 d -T1fD1L$ G;|$tD$ -|$11t$D-H-=,~i , i{5,Q5,,5(,PRuh)Xʱ X- ,5`-PQWhfX裱 X -@< -h -1QQjhjPQ* l -= 5h -jP:k =,uo,, (,1 V5, 1N1Ƀ [Fu  |$1@D$$=,|>h[# =,|(L$ X- L-1PQhPP8 D$$^)=u1HL$HQhht@P@i tPD$J ,tD$ PT$ =,uD$ D$ D$D$ D$1D$11T$hP)ZI =-t$tX-tOrJ9t.9t*9t&@ <)׉9~߉9~ى9~f5-X-1L- 5l -D$ hh8-Pi 5< -T -P5d -Vt$fi =X-=L- P -15,ǡh -)؉1t$ P =< -Wjhp -h T -H9|$u_<-5X- L-)ʍZ9s1Gрp -B9r)p -VhP\h t$ 1Ƀr!11ƃp -Cω 9rωp 9ǿs"ˀp -CI 9rޡd -L$  P -1Ҹp -Pt$ 5`-Vjp -Pg p - < -L$)QhPg u1p -@ ud -L$ D P -1Ҿp -Vt$# 5< -jV+g =` -tb1=\ -t 1 ) -F;5\ -rd -L$ D P -1hp -5< - G;=` -r=,t$|\tX=-te-t\rW|<9t?9t;9t7@ <)׉9~߉9~ى9~Ӌ|$T$F9[|$~A=,|$T$T$|ʉj.M t$몸 |$|$tC X- L-jQt$,Ph#P T$;D$ _=,* T -t=,u&D$D$D$j 豪 1hQr{ ~ j 苪 =,d=-1-$hjV e fF쀁 fFD$8FFF虯fF5< - ׉؉t$ ֍$fBt -$,F܉VDF81 L$ F4D$4z P -1CL$=< -WD$(\WD$S5X -tPjt$0d - 9`L$97|$0NL-L$,ʋL$(T$T -1GL$T$ D$ -D$X-D$$1ɉ\$D$tHrC|c9t+9t'9t#4v)ډ9~߉9~ى9~%;L$YD$$D$T$AD$ D$G;|$ u\$1;L$t$0sD$)RjPb L$D$1t$V P -1CL$\$- X -=< -t$,9sD$()QjPhb t$x)L$D$41ҋt$(VW'VS)$Yj=-t-t G)O)@)@1=< -à r t$hhjVa fFA fF< -ÉFD$8FFFE P -fFfFV < -AFmlj\$r*D$p1ۋ < -1zC9uߊ P -1hp -5< -5< -f5T)|$D$1ۉt$ V)x1ɉt$)rq -RQP` WhP)p -V` P)p -D$ ft - P -1Vt$ \9\$t5< -T)D$ CiL$T 1VhVD$pP1` 95-t-t/)7)?)fD$TA fD$V()ƉD$XD$8D$\D$`D$d聪fD$lfD$n P -1@D$pAD$| P -1hp -5< -iL$Tj f-1ۃ=L- 5l -<hh8-W_ 5< -T -P5d -Vm_ 5L- P -15,ơh -)؉1WP5h -5l -* e^_[]hYhZ YhYPФ h,PPhYhLZVh^VRhVPRhVhVhVhVhWRVh2WWhmWVPh[h[vjVWt$hWghW`hXYhJQRhWKRQhXBX12Y'hYhY"hYhYhYhZ hYhYYj͐USWV` -=-tr-tKrFB|f9t+9t'9t#4v<,)݉9~߉9~ى9~(X -Ѓ-t - X -Ѓ^_[]SWV=,u0׉΋ ,\$QPSt$ 54-9u^_[WVh[hg[jUSWV=,΁ p .u=L-1 < - p .,11;(,-,,ǡ ,L-9v@1ShtU8!;HtH#P;Pt!hZj膌USWVӉL$-< -Ut$(D$ ǃ $ 15`- d -f|A P -1WUFG Gd -@ P -1W5< -d -fL H-$|$-`-T -9É/d -D$1PUVS щʉ$)ÉЋ\ -URPS ŋD$l8ӸÊ P - t1D$P5< -X= )\ -QPVt$ 觬Nj|$ ǃ=-t-Pt$VWX %=t((Z Gdڋt$V5< -ZV^_[]hZhZ-VShZhC[Pjj hZhZjj hZh%[jBfUSWV$8tW赊ƅuWhgj$$<$4D$Phd@U tg1OVhedAUU F<CF(CF,C F0CF4CN8KCF@C FBC$FDC(uht$XG1 ShU CPhU: C PhU( CPhU CPh#U $@D$t P&1-Uhzd@$<WT t1 VhedAWT hjUxU D$ P$4 D$, 9L$#L$9u0$S11:Oa 8tx$0h~3 b$11҉ $ƅ*ŰP j PUeV ^_[]$0hj‡USWV01ۍD$,ShPSu}1NtAljSPSWuWuMU D$t$$$Q1e^_[]fUSWV1@D$D$PjjO x .xjjj8 | .y h]jjPhu h]V2 ~PXuh]‹} ]7+1HD$D$ 1D$؉h]WSN H41B$[؍|$W5D4衜  .8\]} r؍|$W5D4S  .} 8!M ؍|$jW5D4"2 9D$=} ؍|$jW5D4 D$} 8e؉|$L؀ . D41^PPh .؀ .؍|$jW5D4i1 9  .7؀ .k؍|$jW5D4'1 9=D$؀ .؀ .؀ .ء .@ .؀ .؀ .؀ .D41G%PPh .4 ء .@ .D4 .|؀ .@q؍|$jW5D4-0 9 .} ؀ .-؀ ."ء,)HD$ ؀ . ؀ .hl^  . .uzd]t .tÓT .v 觓= .~ 葓 .|$D$ fD$"l$"|$0l$L$0T$4D/ @/T$,L$(l$( ]|$D$ fD$ l$ \$$l$D$$H/ hm_ 5D4h^t\$D$1^$5D4h^Lh^C5D4h^45D4h]'5D4h^5D4hN^ 5D4h^j臁h_ .Щu h_  .t . .D$ Ku9,)t-h"_hQ_9} hh .h .P .% .=u  .L$ u( . . . . . . . .f . .8tω= .u ~ 1ۃ| ‰T$  .T$  .5 .V .u Vh_WD$ @ux=9}b< .C9uU .zhP)H, 5 .hDhG9}%</i-@=B'< .C9u</W  / .t.D$jPjh5x .ݡu h_+  .t.D$jPjh5x .覡u h_*  .t.D$jPjh5| .ou h_*  .t.D$jPjh5| .8u h_v*  . t+f / / . /$ / /$ /t'ƀ /'( /ƀ /$ /(( .) ( /4 .)Ph /QlK D$jPjj5x .胠y h`K( / $ /@L$H .@fP\$1ҀڈP@  .P  .P ; jh .j j5x .h`)1Drp\Au_!V\$h|$lt$pT$tL$xQRVWSL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQL$xQh~hP}Hơ . .9}1Ҋ\<< .B9|1@9u .hh誏 ~"1 .< .PhD艏 G9uj 蚎 s*D$<jPj j5x .賞y h`{t'D$jPj j5x .舞y h=`P .t'jh .j j5x .Xy h^` 5 . 5 .Ph .h`Î jhX)hh5x .y"X) X)=h`jhX)hh5x .违h Mj) 15, /50 /54 /58 /5@ /5D /5H /< /HMD$<8@ppp pVPj`* Wj( <95 .~hP /j詬CF;5 .|/USWV։ϋ\$l$1EE EEfEURt tM .u6jjU7 u##Vx t)xu:H Mt0t$VSH ^_[]5H4}PVhhWhhjz Phhh)ߎ jՅ =| /u-= /t$hft$' l /9 .~ .j1jh< /jcv th*hjyUSWVX5 .l /ff: .d /3T / ` /3 P / 4 . /f8 .f6 .1< .Ѓuȉf 6 .1t$<jVjP5| .64jh .jjh4 .5| .uy .t hgF$ D$<jVjj5| .ٚh` /jB4 . /f8 . . r&sKX /D .T /@ .P /< .+ P /ɸMb-X /ʉ < .@ . .yf6 .|$qD114 .C9ut  .‰f6 .( /T$1A xVWh .hh茿  h h" h)# l /1B  /| /@l /P / /T / /X / /t / p / uCءX / /T // P / /t / p /x / ؉+P /T /D$HT$Ll$Hx /+X /D$8D$85]v?|$ D$ fD$l$\$4l$ D$4Ӊ p /t /l]wh . @/D/ p /t /H/x /ʚ; p /t /6eĉx /11ۋD/@/D$T$ ؋H/T /D$P /D$X /D$5x /L$\$ \$$<21ɚ;|$ ց6eĉt$\$$ t2؉+D$D$@D$D$Dl$@D$+D$D$0D$05]l]t$v p /t /5x /=H/|$(t$(|$D$ fD$ l$ \$,l$|$,=x /ʚ;|YΉٺ5w9|5w؍ɚ; Kփiʚ;))ׁ6eă5p / t /=x / .t 1A .y7 . .9}(</i-@=B'< .@9u</e^_[]hgh`jsUSWVh` /jI .]\$Du{'-` /h /D$hD$h5]\$Dݜ$݄$hP /jڤu{(-P /X /D$dD$d5]݄$\$Dl /; .D$Dt / p / t]+ P /T /$$߬$x /+X /D$\D$\5]t]s=| /uZ .tQt / p / t5+ P /T /L$xD$|l$xx /+X /D$XD$X5]wD$DD$D / . ]w١T / P / t>+ / /$$߬$X /+ /D$`D$`5]D$Dw\$8x .$fDŽ$jh, /jm D$8 ]|$&D$& fD$Bl$B\$Tl$&t$Tj$P\n SD$lD$lPD$,Pj5 .5 .5x .m<hP /j6 .D$8<BC97)؉D$D$8 T$\\$A9 /I؉L$A l /Iff9u| /X / /T / /P / / /  /uX / /T / /P / / / . 1D$1XH 8 CH 8l1A h` h)A .<1A t$,PVh aƁ ΍T$(jt$>Phf萁 D$  .t$؉T$΍T$(jt$F$]hc΍T$(jt$Jh8e ΍T$(jt$bF$ ]hFe΍T$(jt$$Fft$NfQPhe^ ΍T$(jt$؉t$he΍T$(jt$^؉t$h fv΍T$(jt$z0FT_h$fG΍T$(jt$9FPhtf΍T$(jt$ ؉t$hf΍T$(jt$؉t$hf΍T$(jt$d؉t$hf΍T$(jt$9؉t$h J T΍T$(jt$X؉t$hf)΍T$(jt$-؉t$hf~ h:fk~ PhXfW~ L$lL$AQ D$iPhe ~ hWe heehe~ Nh$/he} t$T$D$ D$8p\$<+u1]<K<^FN8wȍN{<9\$ظ+bL$dT$C; /u#Ph /QD$XIq L$$ D$L /PQh /E7 T$Ҹ+bu1G,bT$P| L$r |$ rIX)H X)~P)H P) hP)j ΁ (  }T$A{^N2D$ˀ) h1b1| uPt$,LL$IfɋT$8RD$4\$T$T$$T$ $L$*1BPh6b{ hb{ 9 |$ sSX)H X)~P)H P) hP)j 艀   }KF߉Ήs(T$hb{ L$T$؅t%X)H X)~P)H P) 1I hP)j  hP) ء /; .*؅tء .!^L$AQ T$Q= / / t+)|$L$p|$tl$p /)ЉD$PD$P5] / / / /`)v`) /v /\$CfK% /f!t/ /T$ .KfKf /D$ ( /@1ۺ9T$t$,lL$IfɋT$8RD$4\$T$T$$T$ $L$J( /@)t2(uK / .t1 /h/a /  . PVhax PhehchchcAfPhch!dh5dhMdhfdhdhdhdhdhdwhdmhec /hZaw 1BD$D$pfh)@)f~\ .tSωL$!ȹT$V!RPt$ ha\w T$ D$, .t1RT$D$fxf5h) .ruTt$,9L$IfɋT$8RD$4\$T$T$$T$ $L$D$41B .C9D$= . ؉T$5 .|$7< .)RQPj GD$9L$~D$8:< .uG9u߅uQt$,gL$IfɋT$8RD$4\$T$T$$T$ $L$E5 .)< .t$>RQPhau  .; .}0u hu Ph۬u Cы\$1B\$D$\$D$T$jh`jb1Ah7WV^; 8 /~b / / X)QX); h)hP)j./z  / P)QP).H /by`) / / X)QX); h)hP)jy  / P)QP)H /|tN= /t4X)H X)~P)H P) hP)j ay  / /hP)s h)f P / /T / /X / /: 8^_jj 1A1= /Pl USWV׉E\$1AM .]E uWVhKbps t hib_s ShobQs  .t5@D$ ]\$D$$wbs  .fyuh)j e^_[]UVh1AtD$ .$br l /D$$br /D$$br /tD$$b~r l /t9+ /} $b!L$LD$L D$Ht$H\$$cL> QPhgl .tkD>L> QPh4gF|>uGD> .ufPhjg(n "L> ffPQhUgn ^_[WV .u8jjV t'86PWh{ghh$/]l "6Phhh$/9l ^_USWV$։Y$I L$ O L$O L$oGD$GD$GD$GD$GD$ hi$t$t$ t$SPhgm  UPhgl t$t$t$ hgl t$Phgl t$ Phl r0G9s'GPhDl | KG9r߃$^_[]fUSWVl ƀ8-uFh_V2 u L/h^V2 1u P/T$,11CD$D$hjRt$0 Hw؉$i\$̃duE뻁뱀=L/t\랉\$떁댁낃u1 ,)1;L$(uj1L$ 1ɉT$Љ $P0 L$Au $APD$t2ڋL$ PWaW0 f uމ$D蔉 uY|$ujBDžuqhP8t8=L/uIj Vh_r WhjT1FV&PhV?WSUhWh^=P/Mj Vh^ Wh&jV \$ VWS jjVWS\$uS1GWWv Wjk Wj` WjU WVF Wj ; VWTu hZjjVjjdTug/ gj8juvRjj j#Tt)qtOQj jSu. }j8t1Aj jh^ ukWhKjjhj t$UUjQ: . 0WWSjt V9PShWQUSWh8jj[AVe!=L/u 2 VPhjh)j j` fD$tPhqA  hmPh%qh)i j` USWVPu } hmWV cR~5StET |/͍Hw4$kl/벃Lh/t/둃ftTdL `/tp/e/Vx/G/8d/) ,) /=/tjjh1$xQ /ND$ jjj" /jL$$Qh@hPuu hQq /i )ލ<S H $,k=d/t1Aj D$<1CPS{D$D$ PSdD$D$$PSMD$D$(PS6D$ D$,PSD$D$0PSD$D$4PSD$8|$ |$z |$o |$ d |$Y |$N F /D$8gtj5/QrD$ D$ D$D$ _;-/Sxt.H$1ۃ=p/uWhvhvhC踙 >h!S* g =p/uhvhgvhC{ 1C/FLCSS H3 VT$W$Tk \$@1ɍP$$l/1A1AڍD$ PD$@PJD$ F\$ڍD$ PD$@P F\$ڍD$ PjF 12/#/L$L$# 1AD$ PD$@PD$ D$<+/R D$ Pj$/)/)/) //׋t$#D$ Pj/d$zT$ ED$ L$TL$@JL$C/")-L$#d$d$d$L$׋t$/:/@./"// /\$ /// t /t /1SSPF L$Y\=d/j$)/jD$D$ D$ D$ /L$9a|$u q/ /ta|$  ‰4 D$=/T$tD$1@D$ % 1ۉD$0% hxSh/ atgcuL$ / / //@////0// / (/tJt$(~A|t1/t|$ ObT//tPt$ tH@WVh/ /=/t=x/uw/tMD$tH@Vt$ W =/t=x/uL$w/tDD$(tIAVPW] =/t=x/uL$(w{/tDD$,tIAVPW =/t=x/uL$,w./tDD$4tIAVPW =/t=x/uL$4w/ tDD$0tIAVPWv =/t=x/uL$0w/)f=/=/tP=x/uG=/t4X)H X)~P)H P) hP)j a /1=`/IWh/5/F u+" 87t" t)7|$t+u-Cv/9|$Phdt!6v|$Pv PPhFtk 3" 83u=/t"" 1ۃ8=/1ۀ?D$PSVhxH hP)N ^[ÐUSWVLL$`t$4F"1FN FF|$ PPWPjV +D$  P1PPWSjV޽ |$dt$ \$h)y虺D$$t$'tD$t$`T$h\$Cх`t Ky9PL$dt %<sxCy9 )tE )P{y$L$t hxhqQQhM PPhqxG C 1stJB1҉TA uԋ|$t$`T$h$tt$dPst$$WfD$tt$dPjjt$$BC#D$lP_PPhyF X)H X)~P)H P) hP)j K T$h9t$ h)y˸L^_[]hs jhYxj3D$t'T$tt hxhqQQhM PPhqx F ËD$t%ux%tuxPhxxxPhE USWV|$<\$8D$4t$0~u/jU*fu.\$@St$8U (u)t%\$@SPV "\$@SUY|$<\$@SVExu"PWWh}E Ph E PWh D ^_[]USWV|$4t$0=/uM/hh/ t /'j.h/f t@hPh/> t"^tCt0Wv`rhhYh/ ^_[]1w)ȉPjQ SVU@ fEu jUdWUu&Vh/Shxhh/hB /^_[]ST$D$ L$YttuRPQ9RPQM ,[TQh/Shxhh/A /[SWV$L$4D$1Got$"tZ@:t9rD$Phx C ,^_[SWV|$t^D$uFD$jjP贜 t1Nj0j.V t@h/P\ u7ut$ӘYhVh/7 /^_[VD$L$ 1Ҁ0QRRhh/VPRthhI h/ /^Au yuyt$Qtu ȃPQAPh!yhh/v@ /SWVD$/Q4yR/4yR/ƄR/.r|I /^_[USWV(E u\$9wJ1rο$111$E Dtt#Gl<~!w:$o$EC1C1AFL$ tWWVWhyu;D$ D$ P'WWVD$Phytt$tĨ ^_[]hCt$ +tԉ1|$l$Vh$PVSDHt$t$Wh|dD$P \$tN1D$;D$ 2i9t$sVt$蓯t!ʼnD$t$Wh|dt$ ul$$WhedAPs f$a$>ukSt$hh h$W1 Ƅ$t/5{ {t/ $QPW3 $Kà9Éu|$$P1hCjT*Å~A1ۉhqPE ujVhhh$W!1 Ƅ$|$t/\{ {tV $QPW72 C;\$ mU|$l$|$$PUSWV ~ uj* D$$D$,$3hW誙 t-Ƅ$sh mV= u#tWh+ qh{V [k h mUP t<$t k h{UP t P-K5/h{UuP tMá/th0P Gt$ j,S tP S輰 E,ED$PWq t$ D$!=`É Sq Ƌ,$>tBt`VWh{hh$S. S*tRWh|oe h{`e Wh bWh|hh$P{. 1-/t |$7jj h PQjWa ݉) \$Cjj h QPjS,D$t$LD$Ll$Pt$P $\$|$L$OL$D$ D$DD$\$D$c$I_( $Dt$SVPQ lj SVPQ t$PWh~( $S 1Fl^_[]Éω |$t$+jj h QPjV9 |$7jj h PQjW) \$Cjj h PQjS}SWVh~,D$L$PQKD$D$t$UVQP D$ UVPQa D$ ) UVPSC L$QPQt$Qt$,h&  L$L$ t$WVPQ D$  WVPQ D$$) WVQP l$XD$X\$Tt$T $L$D$Pu|1BD$P{ŅubSVD$ %=@t)=`u1BD$P<Ņu!D$Pt$hh$S" \$ =/uD$_D$ P$P$< 8\$t$Ph豼 /PU=uUh芼 1@$~#QhY 1@$\$$$Ĕ ^_[]$Phj胤 Phh)S% jI USWV L$/$T$t-/*jh/Z/š/$T$1i E$48t!u6$t$Pj T$ uF$t$PN T$ tEM<ǃ h&F6 1 ^_[]ËD$ t 0/$4$݋D$ t 0/$$ؾ/Phh/" uh/hjJfVD$t.})zh"/h5D/# /T轴CкPQh5D/# tUu5D/hZ/^ËD$ H^WVθкPV t)uVh5D/;# /SGt8tPwhx whfuj wh"/ GD/H/^_WVD$ t;5H/D$=?/ $D/u ?/;pt8@uVhւj @u=/th/PhÀ Ph賀u5H/=?/^_Ã|$t /Ã|$t к/Ã|$t rϲ/Ã|$uh/h5D/! 螲/Ã|$uhp/h35D/! m/Ã|$uhL/hV5D/U! </SWV$$DŽ$HH$p)Ƌ$ ƒtS!=/tatσ=/ =/ PSj $;rtr1Auu($$h|PQJ te$P$$hPQ t8$(1;BQPVWEVְ/^_[USWVx֋$$t{tp11@=)D_t1z\t r9΅t<΄t45)AҀ|Vy5)TVP5)@u΋$ $t`1Hh/trʄt<$1ۊ/t8tCu 9s/B+$=FFu4$D$|$ 1 "/$t \u"8QurAi1|8 y:Qu8uQ@AuSHUωT$D@‰ЊtP8u񉄬l8t@ytω븉D$D <$ "/<$؉D$"/$to\[$uvz$\$-)BDEJ<0HB,t ]tVрy$t[)BDC$G)=~"B $tG)=BJB5A)<+~<\uTA<$uWYDZtTA<0teHtҋT\$,;;lt\$B\$GE~A<,tu<]tqAG+$=vD$_BG@=~B<0uPD$ AG@=~IQA<\t<]uytʉԃHL\$;lŊAGC~a؍;tBG@=~FT,;;lk\$B\$GE~$5D/hB<$?uhVW x^_[]USWV0$Du%$H$DhPQ y1E-/hjUh/ t$H4$=DD/I1VV$PH Í|$0;=D/=/$H5/5/5/s =/t9ƒ=?/RPSQUy=/uE=D/t<?/?/$Hct/?/ /VV$PO Å 4$j/x/0^_[]Ã$D|Ã=D/t=?/;1 T$󫋄$HRjh4\|$D$=D/ʉǃ=/$H[L$05/5/j =/t9Ã=?/VPRQw=/u9=D/t05?/?/$H1t/5?/G=D/-=/$H$HL$05/5/j ƃ=/t$H9=?/PVRQv=/u_=D/tV=?/?/$H1t/=?/$$H4hJ D$PE;$Dnj=D/t#D/@=u1HjhN^P jh/aWV=/t@=D/t75?/=/?//15?/=/u /^_USWV1@=?/S=/FϻͅtUSh5D// 5D/葭 t$PhVh)xd)L$DH?u(t5?/RPhQ ?/#5D/jj6h]1 ?/1/^_hh?/t$t$ /hh?/t$t$/WVD$ tZ}UuZt$~h*~WܯtOhWʯtBWy7vh܅5D/ 1H_1=$D/1@1$D/ D/1Ҿt*~ щ D/PVh5D/ 1=$D//^_ËD$uD$L$hPQ[ tvD$phLgu<=/u0=?/t5D/h!D$phKtgu+///֙/VD$ L$/t u]H TD/HQtsPt8 =/D/t5h/hdPo /(^KVhS Pjj$h}諚 V>^ËD$tIDuD$L$hPQ t$D$phUfu/Ș/SWVD$-uD$L$hPQ  1G=/hjlWh/贏t D$1VVt$ ǀ?tx=/tyD$thWheu /=/uB=D/t9=?/?/D$bt/=?/ /VVt$Q DžaSj致/|/^_[ËD$uD$L$hPQL tmD$_D$L$hPQ( tI|$BD$ph{du8D$phĆbdu/ÃtЖ/USWVt$ |$.E1ۈ$5D/jj,h̆ % u v1.L/^_[]/USWV D$ #D$$L$ hPQ L$ ȃ#D$$L$ h|PQ D$ L$$|<$Dh_t$e t3$8|t+4$$H$ 3D$$h%0 D$1E-/hj7Uh/t D$$\t$=/1D$ H9=D/str9t$tPT$$VVP4t$Q/u?=D/t6?/?/D$$" /tA /?/E_t$jV/$9t4$^9/ ^_[]SWV$tKjj_ tK~S9uWjد1uh<蜘 Ò1H/^_[þVuFujj苯h\d +tj/V0t@hQW& =$D/t85D/VD/HQP~ Q Pj e |j5/hhWVIe jWV;e Vh)譗 /j SWVPD$D$t&D$t$hcPV製 r莑/^_[ËD$phl^u|$ht tD$x|$Wh^W PjW uP|$ht D$x |$WhI^W PjW輷 1ۃuM|$ Àu*D$p Vh^Vx PjV| D/5D/h5D$/7=/t =/u=/t#h/h·5D/ /5D/jj%h_ ËD$/ŏ=/uD=/t#h/h5D/ /5D/jj$h} ËD$uD$L$hPQH teD$ph3\u<=/u0=?/t5D/h߮D$ph2a\u/Ԏ/ËD$uD$L$hPQ螺 teD$phe[u<=/u0=?/t5D/h:5D$phd[u/*/ËD$t8uD$L$hlPQ tD$L$QPh  ڍ/USWVh$V耶 $|F$$h1Gh4Vu 9}hhCVzu G9$uVhZu jLT/^_[]ËD$t8uD$L$hPQ tD$L$QPh /ËD$thuD$L$h:PQ輸 tHD$:D$L$hPQ蘸 t$|$D$pphY Ãte/VD$t$5?/?/u hY%(/D$ phY5?/^VD$Hr/>5?/?/uhˈ8YD$ phՈ"Y5?/^VD$t$5?/?/u hX%p/D$ phX5?/^Ã|$u|$t5/Ã=D/t 1PP)j=D/t 1PP j |$u|$t܊/Ã=D/th3X7V1VVcV VPD$ D$t}uD$p*{/jWj5D/h%ը/ ^_[]hhL/a t)ƸL/L/P觻 )@PUL/P] j 3Ve D$$pL$ IPQS 1=D/ȣ/jSWjNfhNh/t$t$/h[hHD/t$t$/WVt$ t3}.u:/5D/hu//W͇/F|$/@//jwh/m u /jwh/M ^_VD$u,/5D/h+//D$ L$hPQ |$1@//j 5/̆ ƃ=DD/t~ vt5/j V视 h5/h"/z ~ vthVh"/^ z|/^VD$t.uf1=?/?/?/*~tD$ ph*~V͚t.hV軚t!W諘u1C$1|,vGxǃuv 1$o1FVj襠D$Vj薠tR|=?/$?/|$$t =?/t/D/ ?/t*~5?/QRhPU tR|=?/$?/|$$t =?/t/D/ ?/t*~5?/QRh@P t$j؟Vj͟1jt$ t$ M /Ã|$thh|Pu5=/u)=?/t5D/hUhOu///@/VPD$ tK}F=/tQumt$j Pv x $9tBvh5D/ 5ہ/X5D/jj/h̓7 //// / СD/tRQhP PhϊV ^V|$t%5?/?/hN5?/@/^WVD$ =D/u5D/hD$L$ hNPQ tq|$ j=?/t5D/hY訠D//L$j qPw D/t./F /T/u#ts /T/T/T/)H )~)H )h) < u# D/;4 /~F9u )I )~)P)h)蠹  ) tu:Q)~)H )h)a )у u5D/hA1H/^_NA D/4$/15D/hWVD$ tkfuD$L$ hPQ tFD$jp謸lj!ЃtD$VWph5D/ 1~1H/^_USWVE{uE MhPQ t]E jpPT$$!ЃtI5D/E xSb PIPWhV9 1;C ~1H1/e^_[]ËD$tu}/hMKËD$ph8KVt$ hsjVt$tvvh5D/ ^USWVD$uD$L$h|PQX D$pvh ktǀ8uEkW V ,U`UWP趥 UhCSd UVSd SC/SjVj|/^_[]USWVPD$uD$L$hPQ_ h 苐tǀ8uEkW ÃP茲|@CSWPݤ =//$-/?/1?////L$PjhʃqVhh=/-/$/?/Vi{/^_[]SWV|$uvt$>h0Wt+h7Wt h>Wu: 1Cv荼tu&6hF5D/ z1H/^_[t8D/ub/D$@9G=?/t<5D/hL/'D/HQP~ Q Pj n j 6\$Sݝ D/D/05/V =/t'~t!D/HQP;H~EQh@D$PhL/z /$(@D/$,@Pj 븃<$JE1A;$(@t4fUSWV1$D$jh\D/kt%=D/t 1PP1<$~KD$@$AhҠjhj <$t(=D/t$t 1PP$^_[]Ë|$ \$1D$9}ƋD$j:4s tX!/=D/u D/D$ Y$-?/t+h_U t}|tU_a?/<$~D$@$D$<$d-SWV։jh4Q jh<W tlh@WgtjhDW uYt F t8t4hΏt8tjhDWW t ^_[(11VPP ^_[)WShKjqUSWV$\$@t$<|$j hLW |$D$ 1D$D$SyƉ$P D0!W |$j/Vt@P腦D$-t$|j:Vt\ÉGWZD$C/GPj5D$<L$AQj茾8/1ۃcVh#  1CV^D$t P^؃$^_[]USWVωT$L1$\1J$$$$$D$D$@$D$$$D$P$D$`1C\$TD$lD$hD$dT$pfD$t$h$d$`$lf$pM $M$t$$$|$xD$HShd!/f$t$jO$t$j 2$t$j$t$j|$t$j$D$duV1KP_* F|$Dt$d$`t$h$dt$l$hD$d|$p$lL$tf$pOG8>hiP(t$Dhs$t$$t|$@t$t$@ЃD$;?/t|$tt$[D$L$d).$`.$Y.$tM.|$Htt$H[D$H|$Ptt$P[D$P$t$`[DŽ$$t$<[DŽ$D$Te^_[]ËD$lt8uu L$DUuD=?/t;P=D$HL$H+?/tD$Ej/t$Lnt@Pt$Dht$HD$t$?/L$D|$D$81////$$9?/t1$Pt$I u$\$` //|$py/h]t$LƸD$|$t$u$QP:} u5$8$<$$$\$` /// /t+t$j5/5/PQ Y=?/tPt$Hh!5D/) // tQPh,5D/ 5D/hN^1O$= 1F&1t$lhV7 $`#=(D/t"D$$UtBQP|$hoGu tPh|Wج hqhfhW辬D$$0$|$Pt1$tttD=?/$tPh5D/P FWhו$8WM $$0t-=?/tPh5D/ FShѕW t=?/t5D/hg言hYt$ ۫t$t1V`}\$D$Lt$P5)Ɖ$$ىD$ډ׋$$|$\!/‹$4$8$ ?/ˉƉ$D$@1S$Plo $+$$$$+$ى|g@By)Q@ j$Po $+$$$$+$ΉЃ||$`t$@$Dt$M$|$`tCt$5\!/5`!/臢 hY5`!/ M|$`=$@$Dt$h#W |h_t$諅 D$8|jj n$D$@hsP^D$@|$@DŽ$}H/ / m!ڃt9}M#$H5//$$!;$$=?/t5D/jj h~R D$T}D$@P)=/=?/?/ ?/ƒ?/9}%D/HQP ;HQ#D/HQP<Q 8tB$ڋ$!t /5/1ϋ$H1 D$hrP hst$~ D$@|$@tDŽ$t$D$@Ph)h2VhTO "`!/)PShgkU hy%Pt$HhjBlhhbhL$D$ D$8t$4D$ D$0D$D$,T$1@މPj n t$ӛthT jct$@fU $=$#$1V$Wj $$$$$$t$@Ѓt$@Wt$ƹu.5D/$Pkt PRPhVC ?/=?/| jjk/x& / ?//?/; /u1?/?/D1\$  / /PL$T$ T$8t$4\$0r\$ ?/1tt$hY5D/p L$D|$D$dP$$| \$L$ L$8t$4L$ L$0L$L$,T$|$$|$$Wh~`D$L$ L$8t$4\$0ËD$D$,T$1@t$~Pj# 7tt$hl5D/觻 T$d|$pD$TD$L$ L$8t$4\$0ËD$D$,T$1@hD$L$ L$8t$4\$0hD$L$ L$8t$4\$0ËD$D$,T$1@t$1|$D$ D$|\$xT$ t$\$|$D$ D$|$D$xT$ t$\$|$ ׋$$T$|$D$x$h $$D$8$D$4$D$0t$,$$1@މjhD$L$ L$8\$4$$ًT$ t$\$|$|ljL$xL$D$$"$$ω$$$h"hhhVK USWVD1D$ D$D$D$fD$D$0D$8D$4jhDQ t}D$VƉD$j@PI t%L$L$4D/@PPƉD$j:VI @P*D$ t$D$0|$jPW4 D$4t 8D$t{8tvD$ t8tj;PthP]hW]hW]VWh/m Vh#]1C)1C>l$,|$ $tc?tTj/WUL$9uut$@jhVDq @L$ǃuC=?/taD$t$uI$t>thOV+/ 1Ʌ $t}thOU / 1ɉL$<=D/=D/t 1PPӼ=D/5 |$DhPWsp |$L$D$L$D$ tD$ D$$=?/?/L$QPq=?/D/t=ut$8t$8t$ s t D$,t>D$Pj3D$T$~ tQPhVS "D$Pj詓<$l$,|$u'j/VF tG1|$t>tFhh+w!l$LU:o l$t$1l$ -/D$Pj«9-/*x1l$,1Kd}Z<$t3$DSVWn ShW- SUW- <$hhB!t$LVn t$l$D$ D$<4uT5?/?/=?/:thP|$LW?n |$D$Pj5?/?/uj/Ut@ʼnD$ D$$=?/tAD$Pj?>uP=/uDh)jhhgF )1D$PjV8/1ۃcÍL$%L$0d؁D^_[]1EhPhh}j脞USWV օ\$ |$$jh4Q l$t=jhDUܢ t;jh<UȢ t9T$(.C fCPC fC C 1}Gt$j/UvC $t9lj)CSyS\$$UP>l { uG<$WxC Uxj@V C |$$tZ{ u D/w@P}xƋ_j:SB t@P\xG_Ot[uUnj]UB $tYÊ@t<:uL)SUV Vɉ,$}:1j:VWB tEt$t$Vhh1ۋ\$ t3tHj PU }t $9ut=s fCt$t$UhpCC tWt_uk?/KUVhXG t$t$Vh/\$ n1HJ3?/(u UvC{u{ tPvC1 ^_[]h1jgWV։2vvvGvvGF G FfG^_USWVȀ%t u7Qt*5)|Vsytt~t$rA@븉 t1\$D$tD$\$é\$\$^_[]Vdj]=D/t tDS9tPtj%S> tSh7Vȉ S,Sh.V讉 G tu)GfPu G=tPhVy hYVk^_[USWVP։ϋ\$l$ ,D/<tPZPUVWRjZ x.1tETw4s,I  $8 u@$Ph 1@^_[]USWVPӉRp lj4$6Mw sEWSU4 1uCL=ʀw һru$wsME$(^_[]fUSWVL$d$`1@D$1ɉ #/ #/ #/ #/ #/ #/ #/ #/ #/ #/ #/ #/ #/ #/T$(JJJJ5@/rBJ PRSWt u o 0FQ$@t0hP.PDPSWh/hWh"/d /"/<$l$\$HWj j UhSww蓹t h~ VS{d j VUod =?/t*$xt!<tPUSP5D/| w jw( x6ư=?/uPwwV迂yWVUShb@ #$d$dhm] /4$xwwh#/b G#/4$$#/D$HSh#/V D$H#/=#/uD$jUjjVܶh]V.p T/hsVp X/=T/=?/t5/h 5D/ j}^\$WSjUVTWShUVC/c$d$dh™q? 1hT/t P@r X/t P.r /V+1L^_[]VD$xuGxuAHyu8y u2yu)Qq@ffqQ1҉Q Q@^USWV(1#/D$$/hx9jUD$$h9jUD$ D$D$ $/D$1D$/11T$(\$$T$Ɖ ,D/<tP&UT/HQP~ Q Pr ÁT/HQP~ Q Pq r,qT/HQP~*Q'T/HQP~QPq PhPrq Phhh5X/脦 5X/=  o T$ ?/uv5uqrl=0D/uc=/t&t uu5/h5D/ D/HQP;H˃  QT$w)DXt/CУ//uss&5 иdtЃru)DXu 1@Au<1Ƀ t$|$ )t(/sW|$ T$ dڃ( ʹtu-u|$t /D$L$؅t$'T$9EPS B(=?/\$$t$uE5u@=0D/u7D/HQP~ Q Pj 諧 5D/; ~ uFuhD$,PhT/] /ۋt$tu ?/tD$(Pу/|$t9ttCD$K1t @D/jQ4$jQt$jQ=/tu jh=#/D$t=x9t@wu jT$=$/D$ t=9t@wu jT$5$/=#/jP$<t T/@ u|1ۉ@D/SHh9?/t71@t14@h>5D/٢ 5D/;: /4$jPt$jP'4$jzPt$jlP/1(^_[]Vf 0?/jP=D/t#D/@=u1HjhN^PÉ #/=#/u |jj KMD$~h]W<D$|$n?/D$ }D$)?/u Njh (/:'t$jLD$=@D/?/xP}?/|$tt$Ph D$j/?/=?/jLh]Vž D$|$t~D$ D$fxtD$xD$(PW@ ux.#D$0=u$$ //u hi5D/ӝ Wh)Vhz{4 /D$tt$jKD$tt$j kK?/xP1?/|$ t|$t D$ t$Ѓ|$t t$f D$$?/1//?/?/e^_[]Ë=/ /s t^L$ hVa thVa su3H/HD$fxL$ D$@щυtSVh Vh/WD$|$Y8D/;(/v+ (/tQ/8D/(/Pmc(/jAD$ujj ID$=/tD?/=?/t /!ȉ'D$ !jWPt$1H/HspL$1HfytL$IT$fztD$PV5?/5(/5(/IE aPh%1 NED$HQPD$~ Q Pe à tWti?/ ?/;L$D$|TD/HQP;H~0Q#5D/1 ?/L$D$L$Pj#詝 ͋D$@ @D$HQP;H~bQ ?/?/D$HQP;H~(˃ tًz8?/?/PS# Pj  1HjWQPP Ѕx,5/5/h ʃu hB0 tc?/ ?/;L$D$}%D/HQP ;HQ#D/HQP~ Q Pj V D$@ @tu h%/ D$@ @t$] 8 t hۚ/ 1H?/?/j>|$ tD$ t$ЃD$t$Lb 1t$V?/=?/ Pj#詛 %h˚hh+hSWV |$$D$hW\ t D$=/tD$D/ƅu=/=/ 4F95H/t jVthj$=D/95H/t jVth$/h$t$ jh#/jh (/hfjE#/hW[  DD/|t1@v5D/h֞GM5D/h Gj#/!hbkjD$ // tQPh \$$SWh j2j%#D$ // tQPh Vt$hj #/1WW"W4$jCj"=#/SVh,5D/覕 4$jCjo" ^_[Åu1t PU"=@D/t j  |$1=DD/P"=@D/t j  |$1=DD/P!=@D/tV T/1j $,y hB+ =;/t /jYVV=DD/t ju!jk!=;/t /4$jQBVt$h t)Vt$h u=@D/ j =@D/{jklWVd?/1VA5/5#//rt suYlcdWPVlM WhV D/Iu1IPVQ{ jh (/Phrjq~USWVD$=?/p`(/#/a(/jjP ?/ D/tL$jQjhPca(/<<=?/w=?/j=?/=$D/u ?/hƉ=?/~&t =D/u!hT/h5D/l =D/tC/=$ 5D/hCh( 1A =?/=?/=?/=$D/u ?/h>Ɖ=?/~&t =D/u%hT/h5D/覑 =D/y/=tT$ wJ5D/h@B?tg?/h=D/ 3t2?/h~=D/PASV3Q LPSV3Q QEPSV3I1  $/=t$ <$$T$$$VRQPWhZh$/e$:$:$:$`(/#/D$ffb(/k=?/5?/y?/?/=LD/1`(/#/u fb(/?/t PVya(/jjP ?/=LD/u(QT$ RQhPœ?/ `(/Qh`(/P.  D/tjD$ Pjh5?/qD$1`(/d(/h(/l(/p(/t(/x(/D$Ph`(/5?/ OD$`(/j5?/jy hI% =LD/" a(/$t#/=?/=?/=?/=?/1)L$ ׾`(/󥀼$u DŽ$$j j $Qh$QPR茜=?/=$D/u ?/$P$Pt$h Ɖ=?/~&t =D/u.hT/h5D/X =D/+?/ a(/tPVd(/ e(/f(/5g(/=b(/c(/SWVRQPhHh(/$i(/$j(/D$|k(/D$xl(/D$tm(/D$pn(/D$lo(/D$hp(/D$dq(/D$`r(/D$\-s(/t(/=u(/5v(/w(/ b(/c(/PQjRVWSUt$|$$$$$$$$$$jjh1/X=D/[=LD/NLD/1ۉh?" 1A#hhu LD/1ɀ=a(/D$jD$ Pjj5?/苘1Ƀ5D/h;1E=a(//=$ w5D/h]hsx! 5?/jt?/1AJLD/;/=t+$ w!5D/hڜW5D/Q!;뗠a(/<<AL$$T$(t$\$l$D$VWSRQL$4QUPD$,Ph%h$/蝮, |$ |$|$1-`(/-x(/-t(/-p(/-l(/-h(/-d(/f`(/D$L$  ȋL$$ D$( ȣd(/D$ $ fD$ L$$T$(t$\$VWRQPSh.h$/ͭ 1-`(/-x(/-t(/-p(/-l(/-h(/-d(/f`(/D$L$  ȋL$$ D$( ȣd(/D$ $ fd(/f b(/;#/`(/jPh`(/5?/`1ɀ=a(/uD$j*1Ƀȁ^_[]Íl$L\$P|$Tt$XD$T$PQRVWSUD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$dPD$`PD$\Phh$/e\|$ |$|$1`(/x(/t(/p(/l(/h(/d(/f`(/Lh(/@uD$ $ ff b(/jh#/hh(/Qy 5D/h5D/h05D/h5D/h@5D/h=?/USWVX=?/?/tuPqM jjPo ƃPj5?/o t$?/D$fD$D$jPD3 ,D/<D$T$ |$ Mbt$1PW3 T$L$+T$ +L$(x@Biy1PjV>a uI 8tI 8#thuuh#/t$4\$8VS5?/Xo ǃu+I 8t I 8#uoVS5?/-o t׉5?/n=?/t$jWn ut:|$9uD$0jPjjWjV5?/Eh 5?/n?/1e^_[]USWVPT$$L$u]1 ʉ4$|$|$} tΉډT$9||$t$ |$HtjD$ // )$fz$R|$0|$/ /1PPPt$ ]K/=/|{11FljË$D$$@D$(PD$$PL$,$|$(~ Q PE  t u\$,ى;=//|1jPPt$ \$0D$HQPD$~ Q P!E  " t ]Pj h} ti?/ ?/;L$D$|TD/HQP;H~0Q#5D/K ?/L$D$L$Pj#| ̓?/?/D$HQPD$~ Q9 PND ǃ u|$<tN$@ @$HQP ;HQ t3 D$ $Prp;P~&у tr0 ?/?/gPQ| ۋ] ?/ ?/;L$D$}%D/HQP ;HzQ#D/HQPQ 1JjQPR\/ x~L$1HfytL$I$fzt$PW5?/5X(/5\(/V(< 8 t h 1H?/?/vu h E @Ph)4Pj z D$@ @t$; 8 t hJ 1H?/?/$@ @tu h#$ j|$ tD$ 4$Ѓ$t$@ 1t$V9t$t*t$h25D/w 5D/hf'?/ ?/|$| j%=?/D$ =jSwBT$DD$@!уk։1\$HPSu# s{ 1CSu r75D/} D$@PO- P6DPWhV&v Pj#Vy h"hh3hUUSWV\$j/S蕃t"9tjPx /t?jPx Džxx;/hSh;/H/ ƀ;/.ue;/G1dMt[G09tÉ؉jh;/jx x.0uO.u1GOtSh 1^_[]5D/hz%SWVd|$t1F5?/j"jdhàS. D/Iu1IPSQP\ W9Vh (/)SWVX/ f$D$@=u1H$jjSP t hß hhܟ5X/,t 5X/  T/j Dž,y hß =;/t /j9t+t&1ONthSPO\ ju=/(u jju'hЦ=;/t /j8^_[Vs7 0?/j #/R7 0^USWVP#/hhj |$ DD/te$|(/2/1@K$2/|(/1DD/D/ED/ /CthQPU, E/ <#/#/<#/#/T/<<T/X/@@X/D/DDD/H/HHH/@D/LL@D//PP//TT//XX//\\/`;/VQP+ VW/P + q;/VQP* VW/P* //;"/VQP* VW"/P* "/VPS* VU"/Ps* 4$Vj=#/t#/jփ^_[]?/j&=D/t#D/@=u1HjhN^PW ;/1/#/jh#/WV׉΅tF=u1H$fD$1@1L$tWu1JfD@iQPR1K ~%tD$t1ɅLɃ ȃ^_V|$u&|$ t5D/hA /Q T/11j1xt5V9 T/1Vh_ /jR4^5D/hfUSWV(I 1h S@$@0?/?/m?/?/h t ?/1@?/?/?/?/?/?/?/?/?/?/?/?/?/?/5?/?/5?/?/5?/?/?/?/?/?/@/@/h P tVPh@/' 9 ID/h}  kt D/h  hiPtFh=VtJhwVt5D/hD/0K=H/thH/h5D/:a 5D/ jh@hL/h)'tEt W=/kD/0t&ƅu'B5D/P/~ t>=D/t/j 6W> D/8D/05/V =/t'~t!D/HQP;H~Q~ 2~ PjXc hҠj hj ^_Ã=D/tD/HQP~Q fPj c eV5D/u<)t!)h`P,tFuhjJ5D/ŢtPhhD/3 D/^SWV|$1t*)t!)WPt Cuމ^_[V5H/u<)t!)hPtFuh jI5H/ tPhhH/P3 H/^V/L///1/ D/A/5P5D/O:t/^USWV1|$-$)t}D$$)111ɉ $t$|$:]uEً|$tOOGu:Mtt $t$+|$1F9ɋt$΋ $׋hu~1Iȃ^_[]USWV\$0l$,hD$P>" t uu ^_[]c;9ơD/=DD/m%tQhbP>] $)t74) DD/ttPl#PV8 DD/uV-jVZ D$E3Vxtǃu&Vt$h Vt$h5D/\ E|$tw7j h5D/w\ "j 7t$V$ t$D$PjW Mr^_[]USWVP //$t!uL/t.u=/A/9!) )/ /A t tu //tu$/1B/ /$11CƊ!tH tC t>FA\t"uAt""tFAQt FAAtF5/ /;$/ /1tu ///^_[]WVt$ t8)t)VPDtuVhjEG^_hϣf= )u F )D/@=u1HPM1; )USWV}uCjhh/" h/x/l/|/p/// / d/`/|$(jW /?/ / ?/w+x/5|/G1;/)ʉT$t$d/9`/s?D$0/D$(L$, |/x/`/=d/D$,D/D$",D/ʃ|;D$L$y =?/`E\$ |$tY1${ {{;{{WSWjV ;{{{ {{|$$PS\$j. U$1ۉ___ __$PWj 1@G ____SW|$ S\$U =?/fDŽ$ /t$PhhQT 1F/ /ƒ\$x|$|l$xݜ$݄$ L$pD$tl$p|$D$ fD$&l$&\$Dl$|$Dy1d|d4)WhQPT /9|ӡ/tPL$  L$ )΅~DQ4))h Sh`Rh"QPS Ƌ\$ |$1ҁ؉r61҉؋L$ωÉ zrr޺t<4Ǵ)4HQPh,SWS L$(+ h/T$,l/\$0+p/x@BD$ډL$hT$ll$h|$@?/ ?/1G؃D$@5vqL$`\$dl$`ݜ$ܼ$1۞s|$L$ fL$$l$$|$Xl$3\$\L$X؃r+1@ډω >xr r11ݜ$D$8dt$4) 4HRSt$Dh9QPQ  //ȃ?/?/D$u݄$|9s0;T$ D$r$|$\$|?؍<)h[؍<)hNQPQ N+/ /T$PL$Tl$P\$HD$D$Ll$H|$D$ fD$"l$"\$jh\D/VD$ B J1rrJVRVO$^Ã0D$4L$8T$ 1ɉJJJ JJQRPl x$1H0V 0j 0^USWVh=?/u=?/u }t$XjV+h/~=l/N+ p/y@BD$HT$Ll$HL$$D$$5?/ ?/Ѓ|HΉv;L$@T$Dl$@|$D$ fD$l$|$8l$t$8\$<11\$Pȃ и tc|$d5/PRQhvhWUM |$ L$ fL$l$D$P\$ l$ |$ Q$|\E.‰i€QD$ dD$)ȍQ rc+|$QRhPt$L $ų i)s<$*<$Hrr޸t1@D$))kd΍ /HQP~ Q P ʍHr̃t"1/HQP~ Q PA \t"u5/HQP~ QP /Gdu/1G /HQP~ Q P [~#\uE/HQP~%Q'H wr? t:,u3Pj t%/Gdzh x1N/=/iY|h/P tu :v2USWVՉh/QtDj.V 1ۅt6UPu&)Wh/V4 u1ۀ/1C^_[]SWVD$=D/t5/h&5D/D nD$t$h hPV` uA ?/?/t?/t$~Vt. D/9PQ/^_[Pvt=?/t"=?/t5 D/hn5D/C 1G=D/ Shкh"/p =D/=H/Shhp/Q =/Shh/8 =/ShxhL/ =l/Sh`!h/ /=?/1PPv hQj.WVPhL/ ơD/?snt$hPB ƆL/ L/?)PRQh)5 x?t$|$ /1; D/ ^_PhrD^ht$hT5D/SB =USWVd$D$|D$1t$ t$4$tPmlj$tS[ƉD$\$x=D/tDt Wh.$t VhŏPD$D$ L$PQRSm:4$uu|$l$ XD/D/tQSh9PcA ShHPRA D$WjPUh)tU5XD/sƉ$t=?/t`V S <WFWt$P Wh+Vʹ WSV迹 $t P軿4$VhluD$uqhtBt66h]t$hT5D/W@ /kt$VD$V PjV D$PhvƋ|$W PjW u{D$ u?htt$VD$ V PjV D$ 8PhƋ|$ Wc PjWg 1ۃD$  ˀuPh贝u_4$ /1F=DD/uRD/,=D//Shbj Ouhe=r1$tP׽$|$t.W PjW D$tP袽D$|$ t&W] PjWa D$ t Pld^_[]h@hhL/ D/05/EWhh/ӊu///V5?/=$D/u ?/h1t>hhX/, r1ɀW/.)hX/Ph5D/= jhhX/,- tfjh (hX/- tN=DD//t/j hƨhT/;/ uh5D/hѨS=DD//t/D/j hh"/ th"/h5D/< 1H//////?/hݚ1Ƀu 1A/u ǀ/u /?/5?/^Vt$t)DH@tNFuhVtQjh3V+ tDhVzt9h T!Vht.hɭVVu'/// //^áX/t P/ 1X/D///=D/u D/?/?/?/ /t P< /=DD/tD/?/j=D/t#D/@=u1HjhN^Pq" jh\D/RWV 0jk=D/tpX/t1@=u1HjPG%5X/) X/?/x#jP%5?/ $?/D/|$ j =D/tDX/t1@=u1HjP$5X/ X/D/1/P8u 0^_Whj$D$tP護 t hhj$hj$USWVt$ \$l$|$WSUl tU4 | u;HDO 1 t5 t'fO gK9uX )I )~)P)h)  ) tuÅtGg t^_[]Vt$V2t^Vhj#hh/3t/USWV=/?/t`=D/tW$tw/Phh/k j h/ /tJ/1P //tNjwt//t$h5D/V9 |0/thhV_ hhVL VcF 5$$P  ?/L$?//$-?/1/?/$ t1=DD/PGt*s1SSQPVhru8/d$$r tT/$ t1=DD/PND$?/$/-?/h]V6 /V9E /t2ѩ75/ /Vh hѩIi1^_[]USWV,=?/t8l$@11 SjhUtUhh",^_[]<$tދD$0S,^_[]WVP5?/=$D/u ?/|$=/tft$h艓uqj hT/ @j WPd  =)LO@1 5D/jj(h ru=/u=/u /1HtJ=$D/uA5D/hT/4D/HQP~ Q Pj {7 1H‰5?/^_USWV45?/=$D/u ?/\$L=/=/!t$HhKH+j hX/ t|$j.hX/ thX/| X/4$uYX/519 Z/1f u>hX/hW5D/\3 fY/20hY/h5D/;3 Y/t$1 U VhU5 D$(V!у $ ?/5D/jj(h"# u=/u=/u /tj=$D/ua5D/hT/:D/HQP~ Q 0Pj 5 # $D/tUh5D/#2 4$|$5?/=/1Hƒ4^_[]t$h˪j2h/kt/hjUSWV\$l$jWhm%W UhS3 Džu&Uh-S3 DžuUhGS3 Vj^_[]SWV/5?/=$D/u ?/=/hM艏/u_j hT/ tL8tGx"uAHt.1Ҁ"ux"u"@/ZHt@r1Ӎ/5?/=/^_[SWV$h$VB V9&h?P 1Fta\$SWTzt?|$/uH$V PVS\ 1u%D<3;|$wt$A9t;GAu3^_[]V$D$,1ɍT$J JJJJBBQRh!P"Fƅu 4$E1$^USWVHuI\$ $Cj j ShWuu 6t ~ hVW j VS PD/]t/M I9Nt vuvvS- jjS; ƃPjS! \$fD$=,D/~%|$@jW,D/O$Cuu S VjP 1D$ PWh,k D$ PWhhqJ 81\$@jPPhSvv4thh~ S  8Sh^葼-D$ PWh 8$\$=,D/~N1PD$PT$@L$H+T$+L$x@BѺMbiy1fD$ PjS  u,^ 8tT 8#tj}ud> 8AuZku<FD$ t:D$L$ PQhhuc2t\$ ۋEu Y D$ PWhm_ 1He^_[]L t$a+'WV|$hW t.h!W t!t$?tt$ hӬ1F1^_IthjSVt$ Vt$ It^VhGj-USWVHE ML$8t$QPVz DUt$F|$$Wh $1B1P 54/D hfhh)0 j& V)hfhV ( Ph`V j UWVD$PjX x2=0/t0#D$1=uT$l1hjKh<|$VWj& tt)u1)tu4h6e^_]ÍD$t$1B1hPjVhPD$L$ $QP.=4/u 4/XUSWV׉ˀ= |$_ $ȲCىt KDP@uD$ )|$1 ,,C t ^DH@ujGt-Ê )DA@CCu 1OD$" 8)L$C CDP@uʃ;K}/ K>C<\W O Cj$jfGٍ$'jY| 1$'t$'1T$JAjD$ $$ _E 0ED$$hD$1$L$$ L$<\tu8<  uO$$ GHЃ s9$ H$ \ЋUɅt 9J 9Ms-M(\t&t uJO1F+$ H$ \$ Q$ 1O$$ Gτ6"$$ $ 1$$ u뮋$ L$)ȋ$‹|$щ$)=w|$Wt$SD$H0$$ D$ PhW&  hG1$C<\  Cٍ$ j  H$$ j  Êt)DH@tKCu$ D$VVD$PV蛥z Ǎ$$ D$ VVD$PVuT 94$ = )1@=uD$L$  D$HL$L$ AL$ @uw$$ |$ |$H0L$ QhP H011 |$ 1 $RKt1BuڋD$8L$ Qj P Ǎ$Pj t$ ^ŃuuD$ L$ }D$HPQ4xWt$ P$ $(4$hUt$P L$l$ ȉD$<9 ɽ|$X)CDP@t Cu<Ƀ;}K|$+|$$  $+L$@Pt$E o$$ E1EE EEt't )DQ@tVFu$$  Qσ s[ j $( PS3. 8"u$$ K1@C$$ jh$H~?It1gEŃitpEE먅t t ;$'OtQ$': O1A )CDP@t Cu;|kw)Cىt KDP@u퉜$$ 1 t t  @Ƅ Í$ VS} E =X 0 hh V EKCDH@uٺyG=X 0 GKoCDH@uٺKfCDH@uٺ' GQC t _DH@uJ ƋD$pW< @1҉ϊ@usFCDH@u\.tDH@*Bhxjh$(Pv 1 $ 11E\tuQtA u>AGۅ)=wSVƍ$ jhU uG1,H0t!9}uEpV *mj H0xt$p@ H0>GWVZt$F1EjhhD/2 Å1|$څ,5 05 0h|$t5 05 0h@/ @/115 05 0h(5 05 0hٺQ5 05 0h"5 05 0hi5 05 0hPjju5 05 0hC5 05 0h5 05 0hƻ5 05 0hn5 05 0hX5 05 0h.B5 05 0hB,$P5 05 0hXSh95 05 0h$ PUSWV9׉ΉT$Fq~{tQttrt?at5b^t9 ɉ4$t9C1҉͊@u0_NSFJ1s9[upx[th[dx\t\uX@D$L$t+D$1G]t[u2ʄtډ&t[u1$H $\D$8Xu$z<$ @W[8Xu뼃|$ L$tL$$Qt$\$ SG uC90s0؃^_[]Ë5 0= 0SP PWVhjlUSWVP׉΋$1m~ w]$ 1at*dt+fuC j   j j t C$1E^_[]USWVPӉ΋|$)MQ1?t@$M7Et*j @x ))>u)jH1҉P5) )5ojnH@)8 )>u j5@/hP)A u d 0P}hQxjo PPh8h)[jQUSWV\$|$t$ h 01EtB5l 0WV#  0 05l 0謹 1 0 0Ht8h]p.l 0 0I 0Kphjht 07rf 0" 0 ... 0t 0 0@p 0 h 0 = 0up 08#uxnu ` 0  p 0W1 t,E-p 0@J}h 0 0R)ʉ1ɉ 09‹\$k 01m1 0Q 0u>#u~nu ` 0tl 01B C1ɾ8f  0@p 01ɋ\$u 0\$t1A ^_[]É Qhj-USWV| 0uN 019u:=P 0u 0)) 0 0P) 0Qx 01NHQPP5  0=)P = 0tC 0S$ S5 0th 05 0o 0=0tM 0t=P)tP} V 05 0h00 0= 0t 0 0 0@ 0 0=P 0QP+ rf|$P 08t0W5 0 0VΥ W5P 0Vd =<W5 0$V蜥 W5 0$U腥 V|j UPWVh,Wh0?9h0z  0޻t=P)t P hsh0 0rH9tt$t$P 0H9tȋL$!QP 00=T 0u 0 0 0P) 0Qxh]P 05 0hMd 0 0$@1Q5 0Pn5 0h 0h 0 ƅttb 0|0 uNt$@ $@ $QV5 0P 01@|^_[]5 0hj5 0hhh5 0hjhh:=0uh"h0U jKh벡 0@ u:HQP~ QP t5 0Pvm1=P 0t T 0t SWV 0X1t^h]30t&Nj@HOWt uWF [뾋HWPlW$ 1F^_[Vt$VVt^Vh½jVt$ D$tVPauVhνj_V^WV|$t$ WV`t^_WVh۽j+SWVP\$|$0t PfD$jPSWoPL0VPSWS0^_[USWV 0jh091FD$0@/0JBtOz T$R uW|$+;A 00 0ыR L$y th|$ 0)щ;HT$7D$t{T$A 00+ 0. 0;H@ 00|$to 0u1ۉ 01;A 01;AT$t1~T$  0=01ۉ__ WjWSQP|$t4JT$B8 0;H`0T$ 0501~>~ VjVWQP苰1FT$1 0=01ۉ__ WjWSQP<T$t tCsBtt$u 0;Hr0xt$t 01BtȉÅQJA7$=050$=0FPj W~ @) 0QPW)I @/Ҿ5=0 0R҉Y = 5 0hs5 0t u 1PjhN^0S1P5050)1PjhN^0S1P5050S%1PjhN^0S1PS =0 T$0=0GPj S]} ƅ 0D$4)أ00 5009a0j5050h0j5050h0 4 5 0r T$00D$<= 0P)=)11 |$@L$ɿ1D$@PL$ QSD$,P̂tǃrT$ 1 |$@1GT$ uGF;5)r5 0jjhGs 5 0j${5 0j k1-R譄L$ tKQ觅D$ ;)r5 0jjhGes 15 0WjSQs t$ tsQMtejPhf{ tQF;)r5 0jjhGr 1)-Ph)5 0f Z;)r5 0jjhGr 1t$ D$13Ph55 0 F9ut$ t$L$)4)F9r5 0jjhGBr 5 0j$5 0j  0@ @9  ֡` 0 0u55 050j50q =0t5 0j n jh0Y 05 =0( 5 050j50rq =0t5 0j 볋50090+0T$JQ 0T$ut Q;P 0T$I 0D=0yBu%hh r2 F 5050P ;0 jhN^r  _ T$=0ujjh h0 0D$00D$,0D$(000000L$(t$, 050L$0 0000=0_ 0QZ= )90 @ 0 09r 0֍0@PQ050 F@+6vFt PuF6^_ËFp vhjZUSWV ՉL$00щT$Љ$ )0E]1&t+\DY/2\2!Ãt\2|2 !߃t)ËL$ B $09r7 $0P5 0 000$00D$SPt$V6 it}ŋ4$L$]\4$L$t&uE\$09r+$0P5 0ƣ 0050F1C4$00\$D$ $09ȋ$r+ $0Q5 0; 000 ^_[]USWV`}$111D$h;u WF uu5D4>ut0GtgD4;uD4$8u ,)ȉL$91t*V<<t@T$?D$D$t Vlj|$\$ |$t?1hk St+8ttDGhBjV1E L$3^th?\u3hjFtD$PWuhiۃ|$ tt$踹uhs뼅tt$uh]렋Cu/h\d s +tjhzVVVeSP}2QVh} uM Phh)E j;UVQ~5t@t $e^]Vhj WVP։ 1ɉQPW? V?t$8t 1H^_ 8"u #Ft1fffffffUSWV $} 7]6 1$A AAQj[t j蘸i ]17;D$D$D$ D$h"WS  H3$t 5D4rQPAH0묃|$5D49D$덅t5D4!QPEL$PQ<J=h5D4PP@ )|$55D48D$ @0D0 )|$ 5D48D$ o bP{ D4$d`$?IPt$9D$ !D$  D$ t‹D$L$tD$,)tt )Í<@0ɉT$ tpulhd=@0tZtw7jG1KiƋD$@ @0ߨu $jt$WS C&7Nt$|"O$$F Vm:ÅD$PF1Kt$P:rVW98ƃP@F=@0xt$PAXFt,t t@0h{VM7VG:V=jv F|$7LwL6cLvVLGF G FGu FL$AV6D$PzEyP9t$S7ǃP?|$G=@0P@hX^jjWS 6L$h[L$hCt$whV- >D$wFLt$|"O $$F V8Åm$ 1KSv h)*PF@$Vt$ .h 7h L$hv!u t$Fuj<Fv P"=h7hVhh j$ P?~ hҀP诙lj\$w jhV>} uE2 1ɉ_QD$PS] D$D$9t 8t#Vh)\$S<Džu6L$1Fʋ\$r 򉔄Sy1{|$uj;G\W5w w;=@0w<Å|$W?3t$hsB=@0tvq<Åt$V6t t$ Vt$hhS2t$hshmt$hy|$GD$WFjw d Gj:vwJCSt$4W\5tt$ WEAhOV1K؍e^_[]h:<Kh hhjh?hhj裮hhWVB ƿ)PhWm VhW^ VhWO VhkW@ VhW1 VhW" VhW Vh+W VhIW VhmW jܹSWVP։ j PW^Z w چ 8u9<$t1ņ 1H^_[USWV)$)uy$)$hjhPj36Dtrƍ$PhF8Vy tF$ $t63h_V趫x$)unh=NV菫$%shV' t)Ńu@$hUVV{ V荹P!Vh1NĨ)^_[]sd>1Nt$)P0P1t Wk/Wh2t5D$ )t7Gt01A0wr@0uh?L$D$ $K$;|$l$Gt PmFKWD$ Pw G/ $$WUh GH$1PPh $Vt$QtPVD$Pj! |$D@h St$ =$ =T"=T=8  =Tu&=T= 8=TuoE1ۃ}Et)t8W2EPM /WEjWEjP> WPD1ۅVDuD}|$m0< 1PPh $Pt$覬$1=U1PPh $Pt$j1Kl$4j\PUbv D$EFI 1ȋL$PART1 uD|$u:|$ \u3D$$1T13 H@\u|$r1Ch hh ZT1K 4$V3D$ tL1Fl$xXuH tPQP PK<!މuӃ|$|$t|$l$h(cD$ $) $n1AL$$$R10h'zS h#D$ t @@W*4$A1h}|$ $ hW*4$@hyUSWV$ $hjSs u ut1O$hjhSju=ƃu! 8SuhbR =D0u7=H0tSuh菹 1=D0uV"^_[]USWV9rth]W藻t}Ɖ|$|$D$ jhWPVM$1t{8t.QP=jjPt$ T$4u=4$S=jhWD$PV#u1*WhXQ1Mt$t$h ^_[]USWV$ $؃1Our$$phU"  t#ƃu,hVWs WUhM$@VhPV lj^_[]hGh=hh$PhF$Qup 1uh 4?P1H$SWV։σ=H0rhVWhWd1KtYtU=D0u hWVr 1.hjhVjW:uVWhT ^_[USWV։ $=H0rt$,Vt$h}ӶD$,D$ 1D$F L$,˅t[P=NjF(D$L0t;F$;u/n(sq>9usI=PW} [ \$H$j $jv=pjSA $jSNWv<h]P.USP@WgYt $SŃ~ jj$ËF$v ;CkL0C tK HL0CL0C~ F$~,t$ %$D$U=D$U=ŃW<D$W|$<Pt$Ut$t$Wu`t$,W<W5tjD$0t CD$t PU=ŋv0Ik&PhhW^5PhD$t P;1^_[]hPhjNhjUSWV,1ND$@ ϋl$D1t$t$t$ D$u:D$u:D$u;D$$E D$ ED$(95H0t}up:$|$} ]uX:PSW|$t$ hCa=H0r9hځK=H0r#uhP)>=H0r j ?=D0u,D$PhF$Wk uy 0h 4K,^_[]USWV ) t$PQhhWEŋFD$ FD$F D$UNx $v`:v[:1ۍL$vjSShQPWt$ Ut$,t$4t$F(d0t h019tF F$t G=u1HPD 1Ʌ1ɉN g ^_[WVt$ fd0t3 h09tct,p0=l0z09P^_USWV|$,1QrI$x @0uԅ\$jS;rD$PUSl D$uv4$ G G$G(jhVG,4$0uhE hh1N^_[]h[DPhc׺WV|$ 1tgQrIwR$x t2@0u׃?tw, jhG,0uvRe1N^_úSWV\$j411INNN NFFFF F$N(F,F0S PhOK uWh7K uWhK uWhK uWhJ uWhJ uWhJ uS >uWhI^_[Vt$t$ PVF^Vt$j41ɉ1JPPP PHHH H$P(H,H0p^Vt$j4{1ɉ1JPP PHHHH H$P(H,H0p^Vt$j4?1ɉ1JPP PHHHH H$P(H,H0p^Vt$j41ɉ1JPPPHHHH H$P(H,H0p ^Vt$j41ɉ1JPPP HHHH H$P(H,H0p^Vt$j41ɉ1JPPP PHHH H$P(H,H0p^Vt$j4O1ɉ1JPPP PHHH H$P(H,H0p^USWV\$l$|$j411INNN NFFFF F$N(F,F0WPhrH t~$uWh F$F(n ^,^_[]WVt$ ƅttFtmxu@NH0xtJj4O1IHHH H1҉PPPP P$H(P,FNyxQH0FF^_SWV$h]WRƅtVIVxL F?/t1Wh#hMhSTh]SƉ߅uWh,@1^_[USWV\$Xt$|$1EVjjhL Hw$Vjj h`VUjhHVjj hTz shj Vjj h_VUjh< shxlPhVUj hl  shxshTXs hssh9!_1shpW3 SVUjh [01^_[]USWV|$(D$,ՉPD$PD$ PD $|$$~D$$XVj ӵKWhV莀 WeD <$~i|$$ /,EЃD$1ۉ3|/VjjhF ~|$Vj gOD$ VPMCG;$uVjjhbt t$^_[]SWVP\$t>D$t5։ωPhQ t"4$SH4$^_[jjjUSWV\$C t[{$wU։Pa PUVh8W\C$4UVhJW?1s,h<V( ^_[]SWVt$\$3]PhpWV~sPhWV~11s h1shT!CHs*4hh]V~Vjs Phӱ1O^_[USWV΋l$\$~GVj zOUSh]V4~^_[]Vt$ P)t>thsV~~tPt$ ^Vh1HUSWV D$$t$ N1Št< t< u t tEAuP$V|$D$hW诪tE1Ph& thW脪ÅuS $F1 1$t$D$$( ^_[]SWVt$~|$14C9u^_[SVD$tL$T$ 1102F9u^[j1ɉHSWV|$\$jƉXCSvWP4 N^_[SWVD$8XjKƉXCS<vWPm4 N^_[ËD$t0WVt$|$ 77^_SWV|$\$jƋCOV@Ps3P3 Cw7P3 N^_[SWV|$\$SWWQSH^_[SWV\$S-? jAljpFV2wSPc3 O^_[ËD$WV|$ jWhP  F>t^_jjfD$t$jp0/ SWV|$\$jƉSFQWP2 ^_[SWVD$8XjdƉ8WQFQSP{2 ^_[ËD$tp.&WVt$|$ 77^_ËD$@ËD$SWVT$t$1; u'1@rvR1>::uG9u1^_[USWVP\$|$j$ 9wȋ4$PjFL$ T$9rуr\|$O\$S2 9rȃr61@ $It$V|$o\2@9rу9r͋$^_[]SWV|$\$SW0WS^_[USWV|$_SSP7m t ˍ 9v:PSh heի7hƫVi1AjJljS7GQUPa0 V$^_[]WV|$ W<W^_USWVPD$18G$PÍ,?UT$ ɉ KWrQ/ UWt$Sit?j{ƉhEUlvWP/ NSWW WKSB^_[]WV|$ W.W^_SWV|$\$jƉSFWjQPMut V1^_[WVh]t$wtt$PV6@ 1^_ËD$|$>tPQWV|$ t$\Wjp0 V<^_fUSWVPL$9A1@T$0D$D$1VVPRSQa tD$0D$|$D$t$ t$D$HVVPD$PSD$,P tND$0Pj T$t$ T$t6|$0L$49׉‰ˁ uΉ|$D$u:D$(} W*jD$4P9 W\$(S+ jhVt$ Ƹ9wh)jj"hA D$Pj譑$jj1PPut$2: G9uIs1^_[jt$t$t$jt$t$t$jt$t$t$jt$ejt$Vjt$Gjt$ t$ 4 jt$ t$ ! jt$ t$  ËD$H##wøUSWV|$(l$$\$ t$D$040 D$VS$UWt$,jt$4$^_[]fffffD$hPt$ ]$ ht$ t$ $ WV1L$T$ 4|141|@=u^_VD$d$t$ ¹t0u,L$I+3CHD$Lك3CTD$kA3CPD$H[3C\D$8y!~$3CXD$xыD$DBD$dR$q A D$TAD$hA,D$A(D$@AD$4AD$lA4D$A0D$XAD$tAD$pA؃ ^_[]USWVP$׀1 v^_[]111w4rي\9G߀Ѐ rڀ0uu$0USWVT$L$ D$|$$1$7FҽZ)!¸!!Սкz)҉!Ǹ!! ꍾ׸9)Ѝn!!!?G׃>?EՃ? ʼnЁF!! 9tJAދ$$%D$T$;sM $ $BT$L$ AL$ 1 $w1J҅u D$L$^_[]1USWV$jt$Ht$@t$<l$8fE$NW )E@PWU E$v=|$D$@p8hW Wb )|ǃ@PD$ PS \$m=l$@u,h|$W W  )'ǃ@PD$ PSP  ,t=u(h|$WG W )ǃ@PD$ PS ,p=u0h|$W Wo )ǃ@PD$ PS rof$${Nuu_1Ƀt)΃t $|t6\$@r-f$GNs3 t 1$^_[]USWVՉ΋\$(< R)ȃtu9sutl\$<$L$$11L$  L$ ωÍK?FwL$ ACL$uƒ<$t(ًD$?hF1O^_[]ËL$R)уtuWVt$ 1A r̉Acw^_USWV!؍qA!1؍QG!!!!!߉5?@Ѓ+ ?Aу/ ^_[]ÐUSWV ]Lu C t41Ƀ>F<rF1҉$1ɋ]F$1ҍ$RPy|$1PWi1ɉOډFGO $OG]C OGCO$1ɉG C O,G(б1ɍu F$1ҋC9|ljL$Kvt$$D$ $1$֍A ƋD$ Ɖt$|$ D$ |$1u7HD$D$4$tLu=D$HT$L$T$1P$ WY$1PWD D$ L$@1s} ?ŋGƄu֋ $O 11Rt$WS%s  T$ 4{u T$ T$ у?tjjV$B;SsD$KD$ |$e^_[]ÊF1҄҉$Z4PT$B0R4$ȍ$D$1PW-$$1PWL$USWV΍$RWVW$WV$t$V1Ax$l0l$ t,t$ $D Ƌ<$\<!!͋L$ ډT$$tp1֋$\l1\$$DL‰T$$TPډщ!t$(1@!\$΋T$ 1D$ 1؉‰D$ L$ l$ɸ!1@!L$ L$hT$T$D|$1׋D$(1ȉT$Hlj߉|$։۸!ÉL$(1@!\$\$xT$T1ՋD$ 1؉L$XD$ $D $| 4Ƌ $T 8T$ $\ Ӊ!1A!ډT$$tx1֋$\t1ˉ\$$DT‰T$$TXډT$!t$1@!\$T$D$ 1Љ։1ډЉT$ ȉD$l$ɸ!1@!L$L$pT$T$t|$1׋D$1ȉT$Llj߉|$։۸!ÉL$1@!\$\$|$1ՋD$ 1؉L$0D$ $D $t <Nj $T @T$$ $\ Ӊ!1A!͉t$ډT$$1֋$\|1ˉ\$$D\‰T$$T`ډT$<!t$lj1@!|$\$Xr]h,8 1s e11A)e1C6$2f e1 fHe1yy1e1u<ǁw 9HtSu w 9He1e1te1;e1re1 Pe1He1Pe1e1Pe1e1He1`22fǀ2 u22e1e1HljD$e1 2L$ L$ )L$LAT$|$fLzT$ BDB|$T$DWD$ W;2R@2G e1A=;2r @2Ae12e1 2fe1 2fAPy 2fAQfQQe1H2fJfBfJ]e1H2fJHfJfBP 2fAre1H2fJHfJHfJfBFe1fe16e1 0D$D$D$P=afe1=e1)=e1e1)裠e1uPuKWe1GH e1 e1He1yvy1e11A  w1`މs# Ӂw9Hu  ;=e1r=e1e1 We1OPe1e1P{e1 e1e19ve19we1e1D$ ^_[]D$ e- Ph, jUSWVPe1t#'۸'9r '-e15e1$PV=tN)e1e14$5e1t e1e1e1e11ɉȃ^_[]5252Qh- j V)t05)1f9Nt8f9Nt2f9Nt,f9Nt&f9t!@ 9uPPh!- j^ÐVt$Vy PV ^Vt$V_ PV ^USWV=22=2u2=2u 2)=2u 2P) 2t 2u'h@52 22p52@22 22=222|$Pw 2=2`  ։6 9t*st <  f;6 u6 GsAv =2 2 ` T$2)У22|$ -2 [2D$22 2<,L$t52w522F(2t 219tF F$t G=u1HPQ 1Ʌ1ɉN ^_[WVt$ \2t3 29t\t,2=2z2P1222222221mUSWV0$Dh2t @ th2h W@WT ,h 2F @ uPh23 @ u=h2 @ u*h2 @ uh 2 @ D$0Ph%WAWֿ h 2 @ t D$0 2h2 @ t D$42h2 @ t D$82h2t @ t D$<2h 2X @ 5 2eD$@@Pv\$P1 tL3sssPh. j0W WVE;l$@|‰5 2$D]h 2 h2 h2 h2 h 2 h 蜅 2Fh$2Y @ u=h(2F @ u*h,23 @ uh02 @ D$0Ph'W@W h$2@ t D$0$2h(2@ t D$4(2h,2@ t D$8,2h02@ t D$<02h2~@ u*h2k@ uh2X@ D$D$0$h221@ tD$D$01Fh2 @ t D0Ft$h2@ tFD$D0Ph*WW轼 x'D$t1ɋT0w  t42A9u`h2@ t h2h2l@ t h2h2L@ t h2d0^_[]h.  hj. h. jjUSWV$(h2@ t=2L$Qh!WWϻ ch2hymPh2@ t=2L$Qh#WW h2qhymPh 2V@ uPh2C@ u=h20@ u*h2@ uh 2 @ ~t$Vh%WAW ^h 2@ t 2D$h2@ t 2D$h2@ t 2D$h2@ t 2D$ h 2h@  2;t$41҉t$T$ jUS F<$?,u|GjUWԚ L$A4$>,u^FjUV趚 L$A$8,u@@jUP蘚 L$$C<:tuT$ B tg D$ ɋ$(t$t5 2h. j1D$$Vh$WWi h 2[@ th 2HhymPvh2-@ th2hymPHh2@ th2hymPh2@ th2hymPh 2@ th 2hymPh$2u@ u=h(2b@ u*h,2O@ uh02<@ Zt$Vh'W@W h$2 @ t $2D$h(2@ t (2D$h,2@ t ,2D$h02@ t 02D$ Vh(WW葷 h$2@ th$2phymPh(2U@ th(2BhymPph,2'@ th,2hymPBh02@ th02hymPh2@ u*h2@ uh2@  D$D$$h21@ tD$2D$D$1Fh2N@ tD2DFt$h2%@ tD2NL$DPh+WW y`h2@ t h2h2@ t h2h2@ t h2^_[]h. !h/ h. h)/  hz. h. jfD$L$ 4282SWV|$82~542W6 tKuWhsPj/^_[Ë 82~T$429PtIuh=/ jt$H USWV $ $ tP6h F====% 1Vˉ!us9< t!uQh, jh<2<2@ PWh) k sH$ Fh9 uF9 tluPh, jh<2X<2QFVptLhI  uThBEH $ F0ho!  PhRj fV j SĔ ^_[]ËF94 u>F9| uF@9t uPh, jh<2V<2v>c1nD=u4D=u(D=uD=uD=j lWh2 >D=tPUPhDP9PhLDf9uf;Luf;LtdPPhDf9Du Lf;Lt5PPPDPPP~G ;>0F0hF011C؅tCt WQh ) 1G uF0h 8  x PhF#011G!tB9 t!uPh, jh<26<2 Phr!{C u3Phg/ j`USWV t$(|$$l$ Eg8H$$ D$Pho!W D$&=Ch(iW2)92s2q==A1W ? [Hu$Wh/ D$?h1耼 j D$ PSݏ \$V 8"uKCC< tuPhW v$Msj.W荈 FMj,Wg tF1W@ % t u< $M uWUuMh3ji $M)WZ-1D$ @(1Wx ~ tu$Wh/ 5t MtOj.Vi tG1V ' t u $M u ^_[]Å1ɋ521<u\|uO|uB|u5|u()|f|<DD<52)B 9rT$2)P525) L1$Wh/  $Vh/ jWh2 Vh2 Wh Ph/ USWV$D$D$3 |$81E1D$$D$ 1h 3 t$@W  fuD4j~m0kt?ml$ ÃT$t@at&d,$맃ntwl$듉돰D$D$z$D$ u1A\$$t$ ȃ4͋,))߅ D$ <|$ t,u3 L$tD$D$)-)g|$ t,3 L$tD$D$8)-)4<$.3 L$tD$D$)-)UW,jVm$yjV[$dD$ty\$G uIu4$T$ |G u%=u#SW77(rVPVh3 [&Mu;|$ t$|$t$<\$j=S萃 519v+u G11@D$ D$4/Ë@ u#  C 4$T$ c Gt$ WS s 4$T$c \$C9\$8GfD$<4H H C9\$8u4$T$ ~-G s VWMu 4$T$ 4$j1$^_[]11D$D$t$h3 9D$h: _/h\7 VEPt he7 Cj YES kd(PQh{7  EQMRQPh7  ETPh7 ETyh: (_ET@th: _ET th: _ET$4L ^ETtha: ^ETthO: ^ETt h8: ^h: ^ExPh7 ;EzPh7 )E|Ph7 E~Ph7 Ph7 Ph8 Ph8 Ph"8 }Xh]E`MbQPh28  E\M^QPhL8 l EdPhc8 Z}htZElPh{8 BEnPh8 0EpPh8 EtPh8  ErPh8 h+: =]1iOwG$oșOЙPVt$h8 wwwwwwwh8 q   tЧ  t_ tЧ t_QVUPh8 "C,l$;6t>iqyYЙI ЙPVWh8 EUPh9  ^_[]USWVTt$hVt1H|$lVF @@O$ @GGF fGD 2f37R2Wf t uGGj PĤ GDf9 u 2f37R2Wf t uGGj Py O4t$hF Ph5o jL$ QHG$FGLFGHFGFFGGFGPFGQFGRFd $T$1PhVS> D$ t$t$RP> ËD$<@ źQL$)֋|$DwG oOT$D$‰WL$<QWT$W G^_[]WV$D$0L$4T$8t$<GGG G&GXG(GG VjWRQP<^_fUSWV} u1D$P2T2X2\2`2d2h2t2D$p2D$1D$0D$h? WV H0$> |$W5D4@4} 8r D$j P5D4v ) D4B99T$:,=Z(D$j P5D4u ) D49T$:@=cED$j P5D4qu D4D$0؀:؋L$9¡ 18D$8j P5D4  D$螡 98} TءD48B؋D$8Z,#x4 x4D4X*|$W5D44} 8yeD4D$#x4 7 y4#x4 D$#x4 x4D$j P5D4t D4K9BT$:54I1L$xA AAL$hAAA :h4QP5D4m=4wwh4 G4W}  y4@T x41WhP)=)=)} T,4D4D$ y4 Ck z4_ x4D4t )xDQGu\$$$$R$R$R$R$R$R$R$R$R$R$R$R$R$R$RQh~hP&HH=w$)11Ҋ2B9u9~x4u7hhR~12PhD7C9uj H\$$} # z4  z4 x4@ x4%z4D$P5D4MD48L$9v\$$}D$$\]9|$D$ fD$ l$ |$Pl$D$PL$T ))L$LD$Hl$H ]|$ T$ fT$l$\$4l$ T$4T,4 uh@ 4 T,4 x4@Ƀ`F~2GtZLtOStf~(gtAlt6sf7At.Ctfatcxff f f@f |4@xEhPL j/QhmA Rh6A h@ Qh6@ Qhv@ P ,))΃\$$x4j.Sh u S腛 )1?$QSPh Ƅ<t- )CҀ|Qy )LQH )@u܍$1R7D$#jPW8 VSW8 D$8WPY@|$XWhyL j0 D$8D$dh$VWj|5VTɚ 1AhA TQh@ Z5D4hA H5D4h^6PVPhRA "s 1AhV@ QC5D4h@ 5D4h@ hhA 1FV{Ph@ V1uS áx4t=) hA  1t$hFFFFFFF :h4VPSu&=4GtÉ4GuhA -PMPhwPh4q w wwS 4y hM!jHy4@t54h4P L$y4tG$jVj'j)54jVj(j)54rPLdP>x4ШhB )$PVjQud$xty4th9B u$ppj0j)54fuc$hB PPVhB  u2=)4r-0*hyB }h`B s4)0 WBD$u hB Bu r2@9u414444DŽ$x4@t$jPjh54JD$8@=4u2D$8jPj j)54 uhB hB |$u.D$8jPj+j)54u>hC P1|$L$8jQj*j)54u hC x4rN1ɉ$$$$$$$$ uJDŽ$H1H$$$$$$$$ DŽ$$j Pjj:54y h:C Qy4t+DŽ$j$Pj&j)54uK1ۃ|$$)D$,tD$t3S?4uhnC hSC ƣ`2d2|$$tF1FFFFF  F)F.N,`2d29rF t$ƃ|$t.t$mAL$Aut$hC +)D$,|$,tF)F/)F y4@;DŽ$jjjrN y hC 444444444f4'u44|$tjt$ j.j)V=)ujh4V yPhD UPh)Pj)VuY=)tjh)j j)VthC $Ph4V; yh D hC hC V蠸D$ ) | h,D $jPhh54t$8jVj$j)54y hD !ejVj%j)54y hD dx4H H r8r )0 s~|9~ h,D 0t$jVhh54!y hWD jVhh54hmD d8)PQhD f x4Ѓ1۹P(4PSSQVRh4P(4t~ QhD x4ЃPSSPVPh4t~ V-=t$0tWNuzVj}e Vjre 144L$?V1Fh)VhhL ^ VfUSWVX 4 4t91ɉ |2 x21GH 4 P44f x4 r+rm ]1sqy2|2Yy2|242424242 y2|2 t1x2 442 2f2)Ufx2 4ff |2f~2=4u"t$@jVwȣ2Fȣ2)P24T21L$@A Ax2Y X2\2PhP254赲 ƅx9t&y h&L :aVS54h.L ux4uWh)W 4044,44(444 u2ء444444 P؉+454D$8t$]hI <hJ ohbNfG fw ? P<y4F hI Ffff=fhG fPhF FffQPhF 谷 sFPhG 蘷L$$T$ /Ftc|$ umhvM h-H cFz$? hAH t$Ɖt$ t$QRPhF $h:fb)PhH `4? h)y4F<<G hqG 貶y4tFG sG P茶K1D$T$|$ )F|$u,O\$D$ ׉fҍ;T$WfɉL$fʉ|$L$L$L$L$L$tm|$\$1\$ 2ɉ׉P  ;t$r\$,L$1P L$ʋt$ L$;T$ t$D$1뺋D$4D$ O9D$L$( )D$0LA 5s0PQF9uEPhH δhSH  hgH h|H 豴|$ FPhH 蚴6PhG 芴|$ "hM hM  hchc&L$$ 'j.$Pt$ jF$Q4? hI ThI t$ UL$ $@Pt$O&|$ O9v $@8?u$@$@t"Pey $@D$@|$ Ph hk t$ 9|$ohJ hI DD$$$T$ $@WjWhh!PFt hG X)H X)~P)H P) hP)j )L$|$$t1 q΃j.PL$Qj uj.h~ $Pm $Ph+|$u"tVhG  hG X)H X)~P)H P) hP)j t$GNjL$+{h`M #ih8藱y4t$NhyNtuG !PU1L$1΄u j,TD$H3G xBG  G sVQD$9D$t$uKj,hIG D$4L$:D$tHj,D$4WPhZG 谰 $D$4D$ uj,路hRG 芰X)H X);h)hP)j)葵nP)H P))hI h88x4؋ X)QX)~ P)QP) hP)j !x4z|$h ot$dc~)/F1#ty1hK n2td3h7K 良^ F N t$~WRQPhK ^\$SAƅx*VhK ='h'K .N hK D$@PhL ~`1St$ t:j.$WPjuj.h~ Wnj WShL 诮 Sh L 蟮C9u\$,t$ |$d|$h19wƉ΅hP)G (M44T$p1Ʌu9QV&jVH [.VPj 54hE 5 4h&E ԭ544h@E 84tPhWE 読 4tI 449~hb芭0D$D$L$d$  \$$cX X)H X)~P)H P) hP)j T444tz84$$@4|-H4) 4$\$\$\$ \$$iE 衬$hP)E hP)E USWV $$919gՉ $t$ $;8t$hh?$,"' =&GШu+$ ؃?9?)9K9si )LA 5s0PQhV`=hV$,& =GC~ 9r9$$ul&hh?$,V?& =wDG$8:$ t-؍L$VSthV$,% 1 ^_[]USWVP։1|$4$u9|.HPhG Ī%wS$? W )1@1sC9uÅu.Pho!pt$߉E1 `^_[]USWV4)ȃ'hJ :։ϋ ˉ hM Bˉ $Wf_oUSRQt$PhJ 賩Gl$j.UPjN uj.h~ U:e UhJ |Gj.UPj uj.h~ Ue _U()|c؉<+<'uehJ 0<9#<,uth,J '<+ugh2J  <8ut}YA8uEuuЀ@t$:u tȀ:u9u1y@tA^_[]PL$jt$jt$YUSWV4Ջ$T Sˋ$L$HL$҉\$$l$0u"5X,4t$PV;hD$$HL$L$ 1x1PPPW>^ jh@P  1@D$|$1T$4։1ۋ|$<$L$D$@D$ϋL$9r,hRt$s ƅ 44F< uTtO1L$|$t|$ $1ۄt $<#t$Pl$UdT$<t^tD$<9L$ < t-< t)<:t <\u1CL$t1ۉ|$ D$1ۈG;|$ D$ D$ $)D$ PL$Qt+<$D$ lj$T$4D$L$L$tt$o_D$t@E1O$D$΋L$AL$$D$$ߋD$$4$c$1H|$\,4D$PVPPL$@D$D$ 1 G|$<$D$=)$TD$j=hw!|$WT FD$t$,t C<:uCL$ T$4VUt$t$(|$ L$4t5au4C:Kj=hw!S 1@D$uY)ډT$tD$)ډT$D$tF:u)ʀ|:t:BL$ы|$ +D$9L$}|$IT$($)ρWD$Pz$))Չ|$)L$ É$T$(*)QSP SVU |$|$t$ v"+Hj=hw!P Ņt$,]ng 04$@"\g 0D$$N ߈FHGNm&Þw$$N :܃Nt)Rt(TtɃntrttu 붱벱 뮱 몱 릋$)ލFdPSt^Ɖ$<$)u#1N4a "FPWtL$ W^_[]SUSWVj=t$t$ jd tvƉŻDdt3<:t/DdCu)PU t2߃dރdDd)t8ePUu$U1H )` dT$ ^_[]USWVj#t$t$N t 80u H xu 1HO@l$1ڀп rڀŸrڀ¿w9}@‰u1^_[]f=p,4u t11jNtt,41,4p,4t P1@h]hDf [p,41USWV1=,4MT$ l$(L$DžD$5p,4hh,4#  |$t$Cj h,4=+ D$,4hCVt,4tUP^ uTWVnx,4WV_t7j L$QP x#L$9u|,4;D$ D$uL$us p,48 p,4APQ~ PQd p,4 tuQhh,4!  |$u,41^_[],404041Ҋ+~,u"1t$L$t' t" t΅tAL$=34u34 t1@Vt$L$ r5t$.t#L$P Q PQ@A1^VtJ1A1t$ƃ=,4u#,4p,4tPbp,4t t,41^,4p,4tPap,4VtJT$1Aj<ƃ=,4u#,4p,4tPap,4t t,41^t ,4t D$,41@1USWV D$,L$(l$$~ )$1H$`t ,41A\$9|ωL$ tgp9tX tt$ P[ t uȃ|$~1@T$(;4t9u1H\$L$9} D$(4$A$,4p,4tP`p,4D$,L$$ ^_[]f11f11Ã=34u /t(3411hh34PjNt3417434t P1@h]hOf 裖341USWVT$1=74+\$0L$ D$D$|$(D$534t$8Si l$,D$ D$D$t$j S& \$1 hCVE|$tt$(P&Z u~CWVEWVt^j L$QP xJL$9uAE;D$ D$<u/hCVUtj L$QP x L$9t[ 348 34APQ~ PQ_ 34 tuQt$8S6 E hLVEthLVwhLVahCVEHhCVnE /hCVUE$j:t$ $ 1@|$ u741^_[]WV=34u et3t$|$ 11t$t$Wj1tЉ^_1@PPhh34h34t$t1$YSWVPtk|$1A1t$ t$ Wt$ 1ۅ=74u+7434tPL$\L$34D$$tˉ01C؃^_[7434tPr\34PPhh34h34t$t1$YSWVP tk|$T$1At$ t$ Wj?1ۅ=74u+7434tPL$[L$34D$$tˉ01C؃^_[t 74t D$741@1fUSWV\$l$t$VU PVWNy UU PUW:y SqU PSW&y t$ VYU PVWy ^_[]WV t$uu1=74u1F Džu=74t =74t?J 1ހ=74upxj Php ^_[Ë5)r QQhf Pփ  USWV|$,t$(u=74utI11Gt9NË L849sI<849 8Ս1ʅM48499-G  ȉ  ȉ BrAS Չ  Չ  Br@9Չхu95T84 95\84ŋ <84!9r؅ 849s9sR84 8!9t*@9w<9r80848! )!9u=84u\9sX7)SjZPbetu  ʼn9rPVUj< U=84u)vPjS; 8!!šP841҅ $t9pwt u¹P84T$@84Pt$jUVmt4ŋT$$BjP84:=84u%9s!/ $)QjZP(P84T$]=84u)vPjS); u=74tЉGtx u1ɉH J G j9t&ӉЉFt-PBFu#$(BthPBFu^$c~Z;t3Vr@ G GOtyOHt _;;t$8GS~Z;t3rk@ G /t}GCt G;8t${_֋R$0$0F ^_[]USWVP $1N=<841!׉) 84D$)_t$ +t= 84u jPRS ;-H84v|u+HL)ˉ\ \ +;D84s|$u\ \ D$+\D ;Gv$XىJD Gى;osouA = 84t884^_[]#$H t 884$x ^_[]USWV@׉9 T8495\84j ;\84u >9uP;\84?jWVfR #1ۋd84t d849p84B@;t84v@p84B@p843B884B`84N8849rWV迠u=% j@S0fP -)xhN^Shnh PՃ= 849=884uZd84t d847p84B@;t84v@(u(p84B@p84t=884rz`84@^_[]9X84u)X84\84USWVP $)t-1N1ۉ9wˉv X+u11B1ɉJ B ax Hx9tt { u1ɉK 9t>wt~ u1ɉN H G h9t&ÉƉJt-AHJu#$( HthAHJu^$czX;tBPA G W OtyOJt _;;t$:WSzX;tPkF G /t}OKt W;:t${_‹@$$B ^_[]ø)ø)ËL$tD$t191ËL$tD$t191ÊD$L$1@ÊD$L$1@ËD$ËD$ËD$ËD$ËL$tT$1<t@9u1ËL$tT$1<t@9u11WVD$t$T$t$ 1t<><t @9v1^_SWVD$t)T$t$1t<t @9v1^_[SVT$L$ D$01t@9v^[SVT$L$ D$01t@9v^[á )KwD$t$P|WVL$T$ ‹q~y ;q~ t 1~9 QPR`^_D$ )DAD$ )DAD$ )DA%D$ )DAD$ )DAD$ )DAD$ )DAD$ )DA%D$ )DA D$ )DA@D$ )DA%D$ )DA%D$ )DA@WV1F|$ 4P W tF u1^_ËD$t w$P 1ËL$1t9t1ҍB|uËL$1t# t|$t)LH1H rËD$t )DA$H1ËL$tT$At9ut1VD$t$tPt$VM ^D$ )DAD$ )DAWVD$  tƀ>tw& 0PWVh]!h)Z^_Ð1|$w L$t9tø)f|$3 t fSV1t$T$ ߀ǿs πǿs t 8u@u118tʍH^[fL$h 9 t!v)fL$h 9 H^!v)føÃD$L$L$ L$D$Vt$ t$Vh)] h#Vwt" 0kPhhh)pY )Vj 萎V^ÃD$L$ L$ L$D$~à D$L$L$D$b ÃD$L$ L$ L$D$Bà D$L$L$D$& øÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$$L$(L$ L$D$à D$ L$$L$D$ ÃD$ L$$L$ L$D$à D$L$ L$D$j f11fD$uD$fVPD$ Hu)L$rQRP t 0  1$^ÐWV|$ W4T_ @ tFu1 ^_D$ftL$Q^ 1USWV$п$$ u V  X)jL ŁTUUrP$@@D$0jPmD$,D$4t]l$1T$@$Br܉ZjjjTj󫋄$JP%u#l;4$d(ŋ111ҍ|$_uO|4$n nFn n$n(n,F0n4n8n!ǁPt HuB 9wJكuӳ1tT$ $JHEJ@MU EeB tt D$$x84L$L$ tUx|$$1Ĥ^_[]USWVt$~X>3܃ V$]  j F H @(N]_?[\;^r~uFFx84x84C><% ^q{t|~F~F ;^r~uFx84FF h@]X@ w|(hS;Fs8)t)h~ wFDPpSe;Ns A9)t~uFx84F^9րրw t$rI{i9s <$=)]D_\,<$t~uF Fx84x84Au~uF x84F>:* +F)@HWPF)P)?#{Ë;NsD9,u=A)IDJt"9~~uF x84NPSN9/8}@F @y(N pjF H @$1P1C)F؉HWPF)PPY^XWSrF)`P}F)@xWPLF)P ~uFN)# ʉj~uFN#TTjN9sTրրw& s~uF x84F"{u@9s )DAu~t}1^_[]ËnD$D$F@^ ]njFxup )DAu f'tf`uW~F=@9t8}@u~uF ~uF x84FЉ0L<$USWVt$Nh.8\u/;nr~uFFx84x84E}Ł' $~`$] |tb]Љ8SdBtX@S>**.[9D~uFx84FF @Ds{~F F X@kh@ wL(hU4V9s"H9s 8\u9)t\j)F wFDPpUV9sH9s8\u9)u ~uFx84FD$ xt~uF x84.n~EFx )DQuf't f`FjF @u(jV9H*uc1C<$)F؉HWP F)PP^XWS F)`P9\9{ ËV9sE9,u>A9s2) DJt" 9~~uF x84N$PS FJ9s&9s":\u9}u$t1^_[]9s9sy\u9}tHA~uJF AM ^D$D$F@^ ]$.^t~uF x84FVt$;Fs#8^u@j>F H @$^VD$ xt"t$N jF H @(^WVyu2։ϋIG9rAItG t$ OPW4^_USWV Ӎt$F 13D$4 FΉ\$FD$D$D$t L$QVЃN9s_~tVutt0P9s8\u :|u?tP9s9u;D$4u"8|t9tD$PVV|D$D$똋t L$QVЃ~ u F;D$u~uFx84F~t[FuD$^19|$t9s6j9s/:\u(}|t9s:|u @1|$|$tD$'F|$)@xWP] D$D$ D$\$~)ljW FHL$~uL$ )ȋV<! lj~F jpf]@T$P F$\$T$  D$^90NL$]H9s-u9]-t{[9 =:uv9r$8ux84^x84]t -$8ux84Fx84$8u x84F ËN98-P9:]:-f-9؋$r;ux84F<]t<-u;ux84F= T$P V9H98=9] f9u$ÉT$P^99]= )0f9Ë $~9u x84Nff9ۉT$SRC1= )9f9~w;d;TH9s)DJ)Ãr~$u[FPSPD$$P DD$P4T_ G Cu$:ux84D$x84:\$1ɈL$D$L$D$PD$ PU$~8u x84F1ۉD$1D$\$D$D$PD$ P<\$1D$L$D$D$PD$ PÉT$PC=u,X_ 11GPՃtGT$P1Ƀ= )G9ɋ|$G@jP7` t@OQW fHV9sjH9ы$8:9]9~$F Hl$ 9=)ADWuI$:Hf9݋\$C@jPs_ tCKf,f|AK$8 T$j-K^9H8] $8L$T$ D8$tF @tL1= )耉11G1ۉD$L$119 $tOL$G9fl$|$L$=щF X@ $D$ t(^|$wO7E1$؃9u F H$8ux84F,^_[]ËD$ |,uD$xuD$xu D$ |<tF +h 0Ur0붋D$ D(D$SWV$΋A @u1 )LAtx )u)f9DAuP(^_[Ë>^D$f@]D$F~>^$SWVyua΋|$Yt$F1ɋT(9rBT(TP9rBTPA u VRPQ F^_[USWV1y19sC11-)D]t#=k)CB9u1Bt=|yuA x84Q^_[]USWVyt^_[]É׉΋D$ 1=‰$|у $\$D$1ڃ|ȃ‹n$ЃuUK~t돃$(^ )@xWPF)PA~uFN)! ʉj~uFNT!ڃTjGEUS1CU?Kl$E1=‰$|у $~)ExWUWt$jpF)PR~uFN)# ʉj&~uFN#TTj)~ )EHWUF)PP Fx84FUSWV\$1= )9~1@(ϋF,@jPv(Y t|F(N,QV,fH~<t})Dh )1҃9~1B ))Dh1҃9~)1BuG x84G^_[]WV΋Q9sCH9sZ8[uU9.uP.`~9s>Q9s79.u2:]u-#~uFFx84x84y84^_Ã~uFx84NUSWV΋ F $9s" $A9s1y9u9]t)AK9r~uFx84F1^_[]É؉D$ i \_ t$t$U6 u Ut/uՃt~uFG롋$USWVl$q)t3ӉϋQ,t!GO RPQ o^_[]SWV1G9Qs7ӉjRqW tF^~uF x84F1^_[USWVP1N׉$1+t{`tswsK$t^ @LtZ+t`tu/$9Љ$1˃u $9Ɖ^_[]USWVt$8e x ?E G  $$$T$$ƃt$l= )|$ r3GtD$WT$ou]t$S|$Qo ]GtD$wt$wt$wS}|$ht$؋ID$) D$,$G,1ҽt$L$t$D$G4D$$G8΋OM1PVh{t$Vt$pL$xtEpt$t$4L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$  ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$pt OuË|$$ωL$ =~uf~|$\$\tf )>|$u l$`\$\z )D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" )T$l$`DQuf|$_tfv3fy}$ljt$t$VPVUo Ɓ|$tK|$tA )D$¿!DQf_֋D$ !DAf|$$_8tV|$u)L$ DHuf|$$_u3|$u)T$DHf_u =wu$t$D$PhwPU D$<(D$@t|$0 L$4$hUt$HD$DHW_N$;GOXL$LY;GU_$_ŋt$DF81ۋ$;D$09$;Gu G1;G ;G~x t,sO$9u G19U8 LD$@un=$;D$0.@$V1ۋ$;D$0L$I L$|$D$<1ϋ|$L$9D18$ED$89t$DN_u_uuP uC͉$t$ t$ D$@PVt$@L%;D$8Z,Nk )$c T$L$GL$Tt !1ۃ)uL$ dAL$ L$0)ы4$9G T$RPV  t$T$\$@E9uo$L$8uG $T$LBT$AG$l$;t-)ȉt$ Ut$@Pt$@9Ml$D$89I $L$8u9uD$$9'$;\$0t1ۉ؃^_[]ÁGT$$ˉ+O l Lt$ t$ t$@Vt$@كÅuGlT$떁GTT$$ˉ+O l LL t$ t$ t$@Vt$@CكÅDGl T$T.M$t$ t$ UVt$@ÅH!=ET!4*F !فu։$t$ t$ VPt$@É뚉USWV0Չ\$LT$Tـ1@D$\$؃=|D$\$D9t$t$|$ |$‡T$,L$ɉL$(t$ɉL$$D$ F $$c L$P)D)~T$P*D* cL$P )TL$Tс1Ct!1CӍ ;сuD$PL$LT$P*D*V9!ځXT$P JD$=zD$=y|$(~D$Tw|$gqf|$,V`D$=wK;D$ /9|$$~&|$ | f|$f|$F D$1= )耋T$ 9~OD$1T$T$3D 8\$P+D+)ʊ$u tω\$DzD$Dt$1ɊD$`tD$E1u CD$@^_[]USWV$D$,T$(9͉L$֋EHǁHt1Xt)‰xu+֋ׁuƁ΍V|$, \$c $M|$$T$ \$l$$1P\$St$ W1Wt$0SËl$0U{9uD$$ljNjL$jVt$ St9uޅ|$$T$ \$l$$1P\$St$ WM1Wt$0SËl$0U2{9uD$@l$$jVPSK$V6% $+M ֋U L% $+M ֋ULL t$$T$ ߋl$$1P\$SWV1Vt$0SËl$0Uws9uËL$@!Ѝ4NG$jVWSH9tnl$EHD!Ѝ<0G !сt|$D$l$$jt$VWS9uL$Vt$Pt$l$$t$WS $|$,T$ 9'$^_[]USWVD$4l$09zD$M1PVh{t$Vt$pL$xtEpt$t$4L$p f9] ,$t9]u $@tSD$,D$4uD$8D$44D$1,$;]t +1@D$( fD$(ɉT$t&$pt$0t$ ~ ޅtT$f}D$‰D$=t1f u:$1Au(1 $Au$y$f~f|L$1͉L$\$0tf $u Au $Bu y(D$1|$u BЃǁ|$l$$t$@uBu D$GD$l$4$\$tËT$\t$UPUt$p OuË|$$ωL$ =~uf~|$\$\tf )>|$u l$`\$\z )D$DQ\$\uMf_tG|$t=zzf_t|$ DyuЁ|$ul$`" )T$l$`DQuf|$_tfv3fy}$ljt$t$VPVU Ɓ|$tK|$tA )D$¿!DQf_֋D$ !DAf|$$_8tV|$u)L$ DHuf|$$_u3|$u)T$DHf_u =wu$t$D$PhwPUA D$<(D$@t|$0 L$4$hUt$t V!@wj/V}1ۅÉ^[ËD$L$1҉WVD$L$ T$t$1>:98^_WVD$ L$(T$t$$1>:98^_øøøøËD$tPhZk jPh94D94øK Vt$1Ʌ1t э^fffUSWV$[tD$1dD$V׃1diՉƃut" $4,rƃu$UVjjF|$09NjL$4sD$D$8T$<UVt$Dt$D[FL$D|$ t$ 1Ҹ$|$(RPQt$)F|$@tjjdUVD$FƉRPUt$ ED$ T$sD$L$ |$֋$)lURt$T$2WQPt$HD$HP$RPQt$8W^_[]SWV[$$u^Jw $hPVX_ u=uk+ WhPV_ hPQ^ thPQ^ hPQ^ ehPQ^ hPQ}^ 5hPQY^ سhPQB^ hPQ^ >hPQ^ hPQ] ѳhPQ] t.hPQ] hPQ] PbĄ^_[USWV[ÔD$$L$ ttD$D$D$UPvlǾUD$PUDžID$8t۱PWkPWS|$QD$ T$$MLjPW|$t8D$$T$ tpPWk|$tȋD$ T$$uɍPW趧>|$;D$ T$$75سPW~EPWfѳPWNPW6tPW"|$D$ tHPWPWѦPW蹦iPW衦t PW荦|$D$ tpD$$T$ t|$D$ tH9|$D$ tH|$D$ tT$$lD$$T$ tHR|$D$ T$$|$D$ T$$D$$tHT$ D$$tHT$ D$$tT$ |$D$ T$$|$D$ T$$D$$tHT$ nD$$tT$ XD$$T$ tHAD$$T$ t+D$$T$ tD$$T$ tHх!1^_[]fUSWV [$ @$ $ ,19r 胼$ t+$ $$ FhPW $D$ D$jD$$ xfD$4D$dz/$$ AfAfI QPRhW:Yt$ VPj $D$ $P1D$$ D$1$ FVu 1Ҁ~1 $FȉD$ wD$ V)&hPW誗 j:WnD$ tǃ$D$1D$d$|$ |$h9tD$ D$lD$4$ xfD$dD$4$j jjhQVPt Ĥ ^_[]ÉL$$D$hljD$ D$lD$ 11$D$$ L$|AD$tt$x$T$h9L$B$$ Ɗ%t"#F9sᐐ1ŊOѰ?tۃKxD$ $t1L$ L9s ዄ$ @<CL$|It$tjhQPR*D$4 YqPh$PF$$9s|$$$9s$$[1 $L9s D$HL$H P RQt$ Ph$PG$$9sD$4YqPh$P${$_9sD$hI$/9s狄$ @YPQh$PR$$9s獃t$Ph$P$$ o9sD$ tWYQPh$P$0$9s9sNF9s/F9A9s%Ft9s?Ɗ|$l D$ |$ jj Rjjt$$ $$$9sD$dL$HL$PL$pRt$t$t$$h$P4D$L$HL$HL$HL$,HL$(HL$$H @ T$0PQt$,t$4t$ع mP9u8jjX_ tܹ P1 40ǃع X_wǃX_ƃܹ tʕ01^_[ÐUSWV[Ñu$01ܹ uut!j/VbuSܹ tƅuJPƍ|$[VPQhW=r)?h@VùǍD$ jPWc D$$WjtLD, L$Pjhjjj QD$(PNs Ƌ<$t'Vu D$8 t菔8 联L$^_[]ÐSWV[Btܽ u`P6ƃܽ $tj/V`uANƉ獃[VPQhWd=rӓ?X_t"ܹ VP2tEFX_u7hh%@V= X_ܹ hVP Mع jjX_, t=jjjX_!ƒt"@zع PX_1 1u00^_[ޒ8#uVt׉迒ƐS[Úr>[ÐS[zrt$[ÐUSWV[Lru }JD$<$<t$u$$D$Pdut=k<T$JL$|D$x$L$x$PQ袅$$$Pt$lH$$H$$D$H $$$$D$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$1DPu@4 $\_\_9u;QtE҃TtduDPu tπTtʀttʼnL$@a L$@ʀ.u4NTHtNDHuʀ zuNDPitDH@W$訏D$@j PWc 苏8)L$@DŽ$DŽ$DŽ$F T$\$!L$몉\$ $蓇\$ 8u$$>$0։]D$|D$$D$$D$$$D$ t$t$|$|$$L$PQ\z|$L$11vɻ9ȸ $T$ )‹D$$ȃ$jjPRѺQiQ1ҋD$)ȃ: iπ: ʃ|;)ƿρYT$9֋t$|KD$'}G\$jjdv6@W8G4jjdv6tjjdRPWPGLjh'v6utW`G\\$ D$8D$81 FL$8iL$ ɉӺ)ʉT$ ڋ\$L$11ƃT$,WRh"""h""""L$,L$,\$ ۺ)ډT$ 1L$1σ|)\$VPhjD$<;D$D$,nL$1ɉ|$ x‹D$$@}DpTh["""""""9ȋ\$,<k<1ɉу|$ xщƋD$$@}DpthLl\$ t$|$ 1 9ыL$vP 19\$ ؋L$ ȋt$UZLJPt$FNJ8B4NJ`B\ ;UB4J8t$@B`J\FNJPBLiJt9u1^_[ÐUSWV[EL$XftEׁTfu$C t+t9u11ՉL$!։1^_[]ÐUSWV[WE|$GtB#l$%t$PFt!G t7t9uӾ^_[]ÐUSWV[Dp_tC#l$l_ t$P.Ft!G t7t9uӾ^_[]ÐUSWV[wD`tC#l$_ t$PEt!G t7t9uӾ^_[]ÐUSWV[Dt$0t$,ǍVPF‰t$D$(%D$1퍃TfD$ <$l$Xftg|$ !RPDtG t@/t;L$uЃt'D$ t$j貔…<$uNt$0t><$9tRbPUW? >&t1<$W^_[]fUSWV[Bt$ll$19w3D$hPVV >WEVu܁WEVufv ^_[]V1ffffVt$9vT1f3f3Ff3Ff3Ff3Ff3F f3F f3Fu1ɐf3DJu^1^ffffffUSWV[÷At$D$hEt'1PVCt%D=u1 u VPjMD$@ 8^_[]ÐUSWV[4A|$ D$hEt$1PWBt%D5u ^_[]ËD$@ 40tM`D$jPt$V04 ŋD$18t`r"u## u B\"tt$ a 4$WPjуH WPjSV[ @t$ vv V^[ÐUSWV[?D$,8tD$,1퐐8@uj HƋ|$(WgF$"jUF D$ D$,F>D$Pt$蟐1}nu1ɀ}ouL$D$j=U+tǃ|$D$,t1PUA@tD$,D8uYL$ T$D$,|8 D$0tD$4T$,L:l$;l:u #t$j׏Ņ8 t 4$3V*1^_[]Í UPjUSWV[>$4$,^0 jPU膉 uj:U*jPU] tKt$}/3t$UhV jVEPU"]Pt$UD$P|$ jjWjjV mt$ jjWPjVP t$/D$PV?Ǎ>D$t$jDžjt$WO uj$4$4jWmtƍD$Phzd@VO VD$(Pt$\u"P$0>o$0VPWQ FD$ GL$ jjQPjR8 tqVUW R[0.$0X[0k[8uj/UŃt$ $0UWQ j[0 QPWP 111E[0.$0P$4P 11,$j$4V$4WjUP~'PW.t$t8HPQƌ&Z0$0P$40P 1,$D$PjUa}Z0^_[]Í*,$UPVWܒ1KZ([#WP$8$8讒VfffffffS[9D$D$ $L$T$jjPQjR! yD$[fffffS[×9D$D$ >$L$T$jjPQjRyD$[ÐS[79D$D$ ?$L$T$jjPQjRayD$[ÐS[8$L$<jjPQRNyD$[fffffY8T$LguLgÐS[Z8t$*SWV[88|$Wt$t$M 9r!X?NWVPjLg^_[ÐSWV[7|$Wt$t$  9rW?WVPjLg^_[ÐSV[Ù7t$ yƅuPjLg^[ÐSV[Y7t$t$ƅuPjLg^[ÐSWV[7|$WƅtuWPjLg ^_[ÐUSWV[6l$|$UW> ƅttuUWPjLg^_[]ÐSWV[È6|$Wt$ ƅtu WPjLg ^_[ÐUSWV[76l$|$UWt$}O tV0(UWPjLg^_[]ÐSWV[5|$t$W#ƅuKWPjLg ^_[ÐSVP[è5D$L$T$$RQP ƃu\PjLg^[ÐSV[Y5t$t$t$ ƃu\PjLg^[USWVP[5Pt$0t$0t$0t$0t$0jt$43 Ɖ׋,$t1T(qt$,t$,t$,t$,t$,t$,PjLg ^_[]ÐUSWVP[Ö4Pt$0t$0t$0t$0t$0jt$4 Ɖ׋,$t1jT(t$,t$,t$,t$,t$,t$,PjLg ^_[]fX4L$"wÍ YffffffUSWVT[3l$pMtE\$0 $tt !\$0 |$lL$h|$|t$xt$xD$@PWQ9rCƋD$t D$xD$|$ut ʉD$ \$L$(QT$@D$D$<D$D$$ $D$D$ l$1D$@|$ D$ (:ɋT$ts;;D$| L$ $t.L$)D$ t$$~ v뜐A9sE>؉)v%E\$0t$xt$xt$@PU觊\$(T$(|$@<$9)<T$ |$|ƒ|$<Ɖ|$Äul$L$$L$ \$,$,$;l$s L$L$ \$L$$\$D$@D$UT$,D$,D$ |$,!\$,T$( 4$] ;D$ L$ t $Ή $;L$rɐt$t L$)|$$4ȃ;D$\$,s>\$)v,\$0t$xt$xt$@PQ2T$<\$(у|$u+Љ4$9\$,%(D$ \$D$D$ l$$4$D$<^uD$@AD$DAD$PD$ D$,<D$tD$HD$xD$LD$ L$D$$D$4$ƈ.D$$|$,E|$,։$5 D$?Pƃ,t$Ή|$O|$0P|$T$(9L$H|$?=\$;\$@ D$ ~t$D$ 9\$tD$x \$H*o|$ 1к t1#D$x#T$t L$||$9 D$ D|$,<‰t$u$D$D$4D$D$$L$;L$|$(s L$,\$D$$؋L$L$4D$H1l$M D$Lu D$ |$ 1\$L$|9 D$ tR|$,<‰t$؄u$D$D$4D$D$$L$;L$sMT$,T$T$4D$$B<$tIL$L$$+L$D$ l$46t$D$CL$L$4D$$1ۋD$4$L$A;D$s $>$t$L$)v34$\$0t$xt$xt$@PV茅T$)vA\$0t$xt$xt$@PQΉ D$<|$(D$(|$_906<$ML$L$$+L$D$ l$4|$7|$)\$0t$Lt$Ll$$UPQ范kʼnl$9sƋl$D$D$ }mu$T$|$,<$t$tt$$+t$D$ l$4 $F9s>)W\$0t$xt$xt$@PQD$<|$((|$D$;D$@ D$ 9s=։)\$0t$Lt$Lt$@PL$Q萂L$(kƉ9s$D$ t$ƃD$|9Ɖ;D$@9D$D$ $\$T$Ѕt D$$+D$L$09s>)K\$0t$xt$xt$@PQΉǁD$<|$(|$ D$ D$,<$4$|$L$A9s $>$)ȉL$v-4$\$0t$xt$xt$@PV9|$(\$(\$(4$ދD$D$D9s<D$D$P|$ tD$PD$|$,D$ 1MD$ $$ʃM߉;D$@ D$ $tЃ;D$؉rŐL$ȅt D$$)؋t$ Ѓ;D$s>ʉ|$)v,\$0t$xt$xt$@PV\$<|$(D$ޅuB؉906D$ƒ$D$D9 =1D$ <l$4D$]D$(|$t$<l$4D$1D$ D$ *D$9t$D$D$ $,\$Ƌ\$؅t D$$)t$4$4Ѓ9s $>$)I4$\$0t$xt$xt$@PV~L$<|$(D$DD$ ]D$ \$]D$ \$;D$@ D$ t9rȐ<$tt$$)D$ l$4 $F9s>)v/\$0t$xt$xt$@PQ~D$<|$(|$ u$9/4D$ <D$1D$ h4$D$Ή4$t'1ۿ<l$4L$D$ D$ $/D$D$D9sD$ $#D$ \$D$DD$D$ D$ $1ۉ,\$0D/$|$D$|tAЃT^_[]ÐS[*$jt$t$t$t$t$[fS[#L$T$ Pt$t$t$[ÐUSWV[ô#|$$t$|$0t$(aD$ j/U,$t| UPt$ WVt$8IuULC8uFCt$ t$Pt$t$@t$㐐USWV|[á$l$|hUWb thD||$|/t`j/WtQ)ύG=7=w{l$|<|VUPS WVU82 tNPU1tU#D$= u:$$ YPU=1t=1 =O|^_[]ffffS[ÇD$D$ $L$T$jjPQjRyD$[fffffUSWV['l$t^T$r9n t9tB 1ɀx$u B1Ƀxp|$$t1R(Wt$$t$$UP 1^_[]ÐUSWV L$[à|$8T$D$01DFt01ҐЍ GDFu<.u=GLnL$1D$thЃՉ,$D$tGDFu$L$4PL$ T$ t1D$t!1ȍ WDUu.uYGTE1tFЃu /u4WDUu/t!*uD$<|$tmgȀ/u߃~YL$f~PfwJL$ K<Й~(Ńt$t$DVT$H|$L$$l$D|$tQ~Mf~HfwBL$ K<Й~ ƃQWT$H ^_[]ÐSWV[|$t\T$r9~ t9tB 1ɀx$u B1Ƀxpt1R(DjVjWP1^_[ÐS[j  jt$t$t$P1[ÐSV[)  DjVjt$PJ1^[fSWVP[|$t t9t QD$P7L$QjPWqL$N|$kK)l$kK) ; i)|PU8t;y t0q$t~fuUv7u1 q ^_[]ÐUSWV[D$$L$t@1D$D$>D$P6L$QjPWNL$kL|$kC)l$kC) G!;G!i? )PU6t7q tAy$t+nuUw6u Ay^_[]USWV[D$(L$1҄t@1D$D$8>D$D$Pn5L$QjPV-l$-?L|$ ) i)ʼn) i)k!{!lj*SiŠ)ǍPD$P5t1D$H<tzp t:h$D$t}suPuY5D$uދ} مt3l$,t+Et$WPfuVQ4EЃ^_[]ÐS[jt$ t$t$ [ÐUSWVH[4t$\3lD$PND$ D$DD$@D$<D$8D$4D$0D$,D$(D$$D$D$\j:P5ŋL$ $j:D$`P5ʼnEtۉL$MD$L$}E<= <#l$U2L$QjPUL$ȿNt$kK)kK) 3 i)|PUL3$D$$ED$j=UtƉH$$D$<$|$W1L$QjPWL$Ƚ-?Lt$) i)) i)K!s!Ɖ*SiŠ)ƍPW62D$5tcL$f <$|$W/1L$QjPWL$ȽkLt$kC)kC) G!3G!i? )PW1tD$EE!D$D] $$D$PU-1ePU1'PU0gPU0PU0t'PU0tr'PU0te'PU0tXPU}0u^O1<5.' D$UB/Nj$tP0/ 1L$;D$v==wL$L$Qt$L$uD$ 9D$ tf, UQa,$t'UW`|$BU4+1t$ 1 t]|$uf, FM $QP`4$..  $LD=uVQ_`V. $4D$ H^_[]1|$t4$1USWV[hkWT$L$ $L$1O1DND$uD$D$@DNu.twt$*T$u |$|$t$D$11\$ * $y<$L$y|$QpM%t7,uM $Q$\럐WT$WփՃG\M=1Ʉu/$H $%$H $pD$0 $Q$$P$%dt$ӍP$\$ $P$dmM $H $%$H $pD$0 $Q$$z<$%$z<$̀i\$ B$P$%$P$pD$0$z<$E=$%p0%@p0%?T$р0H$P$T$\$ >Nj$%>%t$T$\$ \$ $%+%;$Ń E=s$%p0%@+@}%m%@%{10@*%p0@ 16}%@%/%{@{10}T$р0H$P$GE= $%p0%f@ %-@2}%*@p0%{T$р0H$P$1T$\$ :\$ $Q$% $Q$ $Q$% $Q$cŃ1 1$z<$%$z<$c1ͱ*L$L$yr+D$|\u D <^tE=w'$H $\D$ttL$))=vt$C_) 1Pʋ$H $$$H $<<$Rt$W[ /$//$H $>$D$^_[]ÐUSWV]2~:^^t@\|,$n*^ÍxЃs.ÉD$$D$DCu1=F^8,$u1\-1ې2^Ћ/DEu*,$P%Txp1t4,t/'t*\t%:t 'PP'{d| 0r1 |'i i ( 0z9kg (À0PP}^_[]fffffUSWV[71l$E<%uEpuEπ r?&уstlu~;|$~,|$t&릿럃Љ9Ή뎋D$D뀉^_[]ÐSP[yL$ T$D$$Pj [ÐUSWVXA$1h ։ͅu4$ u'$h 5 @0t$E4}0u"$hME, E0DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$1|$D$ <%uGpu!Gπ rd$%σstlu7D$ ~ ~$$DŽ또fЉ9N1ҍ$1$$u>D$$hjP6 l$Q9tƒu㐐E,N QU4<D$8%t D$X%D$uAu0M4A9r|$ $Vu,fE,u0M4|$ 뒐Ƅ$,%1D$D$$-1@Һ׋D$D$ȉʍ$,)ȉщ@ÉD$pXwEl$ Չډˋ $(ȉىӉl$ |$uGD$1l$뀋$DptSt$,FЁ'ED$$-1ҍ$-l$6qlD$tT$9l$wF߃]C $d)$t"A$|t+H$D+$"1$uՋ$"1ڃV$*!$H$t w }0M49sIE,u{$H$D~!1ɅЉT$wNj$Wu,RE,}0M4T$$V$0PRQY1$E4$ 1 $PT$ LDl$<'tu<'tT$V$H$D$H$\1t$t$t$%uNV;t?uL$ׅdL$ƋD$$ODk$u$$p$c$Hp$Dh$PP=D$π$O6\`D$TDl$H$th$V{9r‹E0M4ʃ9‰\$WE,y$H$|T$t$1DQt*1ҍBVDQu拌$P1DDl$t <}t<}ut$)19*19!19 f1 [1WtQL H$d1~Ћ$O\DDl$ 1$O/|Dl$$O4둋$1L$ ʀŸw Dʀ¿~4r$1ۋu0M4A9s E,u,߃$Vu,rE,u0M4tڍqu4 $ 1$P$$1t$"t$%uNV;t ?u݅tԀeuωt$uǃD$ct$W1P`DDl$1߁wNj$Wu,tRE,}0M4$V$0Pt$QSE4E,M4},$1^_[]ÐSP[éT$ D$$1Pj= [ÐS[zt$,t$,t$,t$,t$,t$,t$,t$,t$,t$,([ÐSP[9T$ D$$1Pj [ffffX L$PgÐUSWV[|$(t$ l$u9Pƅ>l$$ujKhjL$tfjVP NjD$uj(P/D$@ x |$(u,VqE\1F4Z,9Pk1D$tGuP|$(,x |$(tF|$(m,V|$(,Phht@U  t$t$tL$t RB(JPgtR9PitjjP IA(9P@tjjP_ IA1t^_[]Í8,Pj>,VSVP[ØT$L$D$tRQPVƋ$t P.^[fUSWV[Gt$|$t$jt0ʼnVU|$T$VŸ-Pt$Wt~nTPt$@tk-Pt$)t[-Pt$tK$-Pt$t;+-Pt$uA1 @VK^_[]ÐUSWV T$L$[ǃ 2-PŅt'}/u{L$$ t$  <-P/P\PV:uU,DžjWWWtpL$v u\D$ VP$tIT$ L$$ Pt$ V`'u1-1V='D-P$|$ $~:s1퐐Nt:t됐tÍMwUPW9 D, L$$ t$ [tuP.tGR-T$ PQhRPL~)T$ L$$ t$ $_-t$ $:uw1퐐Ot:t됐tÍMwUPV9 D, L$$ t$ [tu$ $ȁ ^_[]Í;- USWV[ôl$0֊D$ <A L$\$tD@$@ @@@@@ @@#\$jj%\$L$ A ZAthhP+jj!rG(hhP|$ Gt\$h(jP|$ "\$jh|$ G9ouG)o\$UD$p|$ Go\$UVPh W2BGL22ɉtʃЉPt ȃщ‰Kf:BfuQf:JBfωΉ݉B|$unkQft-Yt$v |$4u݋t$v <rʃʋ\$f:yEf:e΅yR[|$4u M\$fuzf8WPhfLt*Hp|$4[tx<,0J\$fD$4t$ ,f\$tP|$u**y|$4us,:|$u( (:y[|$4le *Tht, L$fËt$ t3L$UtM}؋[ \t4*몃f}t1}C$9{ uWK$L$te\$WjPE ~ gC C$ދ\$P6F$ދ\$P~ F$D$\$jWF$GND$4D$1f$\ ,7D$у9P D$u}<<.\5\st\nf\$\$ \$ \$\$ rD$|$4u\$\DoDD7\$D_|t9j|Vt.)9uUt$V8 t6u0,1(Vb 9ſuUt$V8 ^_[]fffUSWV [dD$48H L$@ 1퐐/t <,tEP蠴UWP1 .,v3l$4uWEED$\$cD$HMD$|$j|WhtD$4@ T$L$ t Y17t<,t\$RT$ D$P誳tDl$VWQ6 Ut$P$ 1<$WNjt$D$Pl$8u`EW|$WV WD$D$D$ Džt$]\$4C s,C$C(C C,6K L$1ɉD$)T$fT$ K(K(C,׉x|$u/y ۋ/xЉl$T$ f$k C$1҉l$,Q9v*t5\$UD$0K\$<u3D$u'\$U\$8C k$K($fC K(K(|$T$ t$40MP>p1\$91\$-4$K\$t WPV l$ E|$f>t WPV }t0EfEfF}WuV f},t&E(fE,fF}(Wu V f}<t&E8fEEDW@tE>DW@utiL$p1ۀ:L$ӉutNu:T$t=t#\ \$Eڳxt1ѐӀ^t1ۀ\t1uF^_[]ÐUSWV[|$ t$FN,9vtU6qu]uUU/tHnNT$l$f,Ninf|FFWRP ~F 1^_[]ÐSWV[Ht$FNy9vtW6ɱuCu;W臦t.~NT$|$f<Ny~TF 1^_[ÐUSWV0[l$DEDA@tEDA@utL}1t@u<,t2<^t1<\ut<\tЄt1MbGj|UDD$tL$j|Ut L$U=rҀUPt$P 10^_[]ËD$tPrL$ =rM"D$t+PNL$=rMQUPt$T^jjPݮtt$ $@ 1D5t <,tFP蟤D$4 VUP( D5$(L$tSD$HtJ11t <,tFP@ Vt$P D5$h|$t+D$Ht"t$w $AD$ D$ DA@tGDA@uD$tTo1Et=u<,t/<^t1<\ut<\tЄt1‰1 EL$H  1D$EL$H u<. L$H'ȃ |$x PL$L$<$G4O8T$4 9VD$p0ӧ$@,t'<$O 1҃ ҃f91wуu<$O G$1҉L$‹O(Q9T$0RD$p P$D$t$HjjjPjfWjQNVWT$2PQaG05Gk$@f8f 2f ,f&f ff1f fffF(,^_[ÐUSWVP[v|$ $ ftGt 1WG(f hwU =wb, Ƅ |)ƋtVPUo 9vD|ŃƋGtVPUK 9s D|ŃE$^_[]ÐSV[yt$ tavNvCv8v -v$"v,V19 uǃ ^[ÐX @ÐY @u YUSWV[ñ$($jPRQV考'>T$j$jPRWUQVWdVPjE SV[t$ j:V趯tojQP tt$V!1^[ÐVYT$փ1uXct^1tc^USWVH[Ät$dl$`L$\<D$Dȃ=Xcutc<$yeL$VPj@QT$tLT 9 $ƅtID$\WUtcR ~*)NjD$\u $dVUQ2 ;L$Dt[a1Kt$\tc1Xc"DŽtcDŽXct $;D$Du ЃH^_[]USWVT[$|$pL$ll$h<D$P=Xcutc $t$ u eL$WPj@QOt$t$ T$Ijj GD$Wt$Xc $t$j 9<$u-;D$PuyL$T^_[]WQU ;L$PtNTtcXcDŽtcDŽXc;D$Pu T^_[] USWVD[ԿL$`T$dt$X<}|$@uMXcu tct9ƀeRQt$dPj@W  tRQt$dV. M;L$@uD^_[]iSWV[|$=ujXcu tctVw}tL!tccXcTDŽtcDŽXcW1^_[ÐUSWVP[tD$hT$du!_*0D$#Uv> jjUUȄt0D$Ȅt0D$Ȅt0D$Ȅt0D$Ȅt0D$ Ȅt0D$!Ȅt0D$"ȄOG18 /:&A< T$<: D$t$DRL$D A @`? %e19<$ D$D@ @`ƒ?%e91 D$D@ @`Ń?+%e9 D$D@ D$@|$`D$?%e;|$  ՋL$  <$‹D$Dp D$L$ D1 <@4$T$<`Ń?|$_u+%e19QL$ T$D $L @`ʃ?|$_u%e19 l$ D$L(D$<_D$$D @`Ń?+%e19 ՋL$ T$D |$_$D @`ƒ?%e9uY<$L$ t$D {t$Dt$D *ƉuJ+<$uA"t$Dt$DF# t$DU9ƅuD$D8*ux0tee;D$(Q,^_[]É<$t$D$ VRPQT$T$L$ t$ ?3%e|$D/? %eD/ ?%eD/D$%e/T$T$L$ t$ ?3%eD/? %eD/ ?%eD/D$%eD/D$L$ < %eL/ ?%eL/ %eD/D/ <$<$"USWV[ѯ$1tBD>׹@ veD,|t.tkŷ< s݃1@tt tр‍  1ttDjtDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$D$|ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ we|$| t!qtAD>1tBD>׸@ veD|$t=2t$Fi%I<<fw1@tt tlj瀍 ; 1ttD~t 3f  fABe w~4ABe w~4ABe w~4ABe w~4ABe w~4Ae wʼn41 @tt tlj瀍 ; 1ttD~t_f$Qe$A e$B $u1 @tt tlj瀍 ; 1ttD~t⍃1f 0phQPhQPhQhu D$p D$l D$h D$d D$` D$\ D$X D$T D$P D$L D$H D$D D$@ D$< D$8 D$4 D$0 D$, D$( D$$ D$  D$ D$ D$1 L$ L$xD$D$t1ɐ ƒƃʼn$ D$فfр3ʉрUɀʈǃ ǃ ǃ ǃ ǃ ǃ ǃ ǃ ΀ D$ D$x D$t D$p D$l  ʋD$h ыD$d D$` D$\  D$X D$T D$P D$L  D$H D$D D$@ ʋD$< D$8 D$4  D$0 D$, D$( ΋D$$ D$  D$  ω D$ ɋD$ ? ? ։? T$ځ„ $T$ 1 u E Qu ƃu %?? lj%?  $T$ @D$Xƃ $ ΃   ˄ ˈ J΃    ˄ ˈ J΃    ˄ ˈ J΃    ˄ ˈ J΃    ˄ ˈ J΃    ˄ ˈ J΃    ˄ ˈ J΃    ˄ ˈ   ge 4$l$T$ L$ Ń4Ƅ x 2 2x 2 2 x 2 2 x 2 2x 2 2x 2 2 ƀ<$T$W ƄЃ x 0 0Gƒ  ƀ ƄGƒ  ƀ Ƅƒ T$  Lƀ lƄ%GȋL$o<$tD$;$u 1^_[]vUSWV(]ńD$<X%UUUUʁUUUՍ4P᪪ń ň x   x   x   x   x   x   UUUU   $؃ń ň x   x   x   x   x   x   T$H  l$  ,1~j\$D%?D$?؉\$d$? \$D$\$HD$D$ۋD$ $y| $$ D$T$\$l$ ؉D$$ˉ|$$|$1#|$3D$\$3؋l$ 3 3 3 3 3<$t$3~3 3 3 3 3 3 3 3 3 3 3 3 1#t$t$D$|$811t$3= $3= $3= $3= $3= t$$3= $$1L$t$|$l$3l>l$|$l$ 3 3 D$35 35 35 35 3 3 3 3 D$t$D$D$$7֋T$ Bl$l$l$$xl$   $x   x   $x   x   $x   x = = $x   x   ȃx   x   x   x   x   x 5 5 x   D$@P1(^_[]ÐS[טD$1ɐȊt tT Tt t t4 uP1[ÐSV[VD$t$Vv vV Vv v vt Au1Ʌ PjQQM1LʀƉTTTTTTLu1^[ffUSWV[LḾ?Ճ? Չҁ! tUL$4ʋL$փ#4$L$ӋL$4$L$(L$(L$L$\$$@t$T$0wЅD$4G$)$$\$$@t$Vj1$xUv$@$t$,t$hRj Wt$QPUt$Dt$Lt$T#4t$Po-h4PQR3_h$DUt$@VZ j jW + hjU* hj$P* D$@hjP* D$<;$`u`d^_[]D$RWD$t T$@PQhR-l$ $ffffffSV[iD$ h`rƉPg)Ɖ^[ÐUSWV[$l$0hjD$PU thh`) $)D$j PUF $l$1}$K1D=t<$t h`tt$,Mōh 4$t$L$QWPjbV L$QUt$4Pt$ V<$r'$pD$PUt$4jPnu捃ht$ Wt$t$Pjbt$(V     jQPR ;     jQP ;     jQP ;$     jQP ;(     jQP ;,     jQPS ;0     jQP  Ƅ;4 jjt$X' ^_[]fffffUSWVD[T|$\w Q2t$`tD$@jPV NjD$@9t8tD^_[]8"u trwD$iD$ [D$D$KD$<D$8wD$X$2a$hWQjP 0  L$< L$4t$,t$00ЈD$D$( 0 L$$l$ |$tl$ t$2D$ tKWV(tD(1t$RBt$ FBU=BT^_[]þ΋D$$L$ $PD$s11`$$11҉l$ l2L D$2lD|$2D l$L2L ǃ9$u|$t 1122 ǃ9t$u1USWV[dft$t$$VF$l$ $pD$s11J$$11t2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐS[Êejt$t$t$@[ÐS[Zejt$t$t$[ÐS[*ejt$t$t$[ÐS[djt$ [ÐS[djt$ h[ÐS[údjt$ H[ÐUSWV[Ôdt$jV!F$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[ôct$jVAF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐUSWV[bt$jVaF$l$ $pD$s11L$$11ېt2T 2tD2D T2T ƃ9$uT$t192D= ƃ9ut1^_[]ÐXaL$Q##wÍvÐUSWV [a|$(l$$t$ D$4aD$Vd3UY3D$WL3$t$, 3t$02j#3t$t$4$ ^_[]ffS[*aD$ hPt$t [ÐS[`ht$t$u [ÐWV1L$T$ 4|141|t| 1t1| t|1t1|t|1t1|=u^_ÐSV[i`D$d$t$¹t0u,L$ I^_[]ÊGЀ v1ɺD$wɍ rFĀЃ rՀ|$0uuD$(H8$USWVT$L$$|$(11ɉ‰T$ pҽZ)!!҉T$ֽz)Ս!!ҽ9)ՍX!! \$Ł?Ճ>?҃? ډ5! =tDT$ Ѓƒ'T$4$;2sH4$t$t$1w҅T$ u D$ $^_[]1USWVP[Ä4D$pVVS|$)Ƌ $PD$2PL$Q;G  $ $,t=D$D$lp(t$ jjt$>V菌VR|$)Ƌ $PD$2PL$QF rg $ $,p=D$D$lp0t$ jjt$>V$V+R|$)v#Ƌ $PD$2PL$QeF sM;L$LP^_[]Él$$$f$|$D$lx4 R|$ )σtut$$)t$w$|$ [D$l@11ҋ,$D$D$( ‰T$L$ L$T$?BA!D$׍jG!!!! Ё?҃/ T$ ʋL$ 5?Ѓ+ ˆT$|$nD$΃D$ ?tx(D$(?PA!ʉT$эpG!!ҍ!! ?у+?Ѓ/ D$ ȈEE|$$u $|$sl$$D$$f$D$D$lxD$ R<$)σt u L$ D$ D$ ;D$l$<$^D$l11D$D$ ‰T$L$L$ T$?BA!D$ՍJG!!鍪!! ȉс?҃/ T$ ?у+ ʋL$T$|$ mD$σ$Ctw(D$?PA!ʉT$эhG!!ҍ!! ?у+?Ѓ/ D$ Ȉ1|$ l$J@1l$7L$R)уtuÐWVt$  r!̐cw^_fffffSWV[-t$|$G@hjPA `zj@PWA g j3NɼOg3N ;ʄ3VWO +3Nrn<3VWO6_3N:O3VWOт3N RQ3V$W$O l>+3N(h3V,W,O(kA3N0ك3V4W4O0y!~3N8[3V+G4كG0kAG<[G8y!~1^_[]ÐUSWV[+$<$N$@r8hUtE\EXETEP$t$tAsE@hjP> Ƌ$ 5ɼEEg jE gE;ʄErn+E4كE0kAE<[E8y!~hjVW> h$$V軘hVU< hV1;$u Ą^_[]lUSWV [*l$(16t$ %T$$NP NT  ()`N`L$$WRP= ^@NDL$ځ€V@ND9ٸD$FHVLT$$dž)|$$1rXF@nD€V@ND9FHVL$<ŀw$`UWP< 1 ^_[]ÐUSWV_Ǫ($hRP< RQ3FDD$8т3F@D$Dh3FLD$\l>+3FHD$Hك3FTD$kA3NPL$@[3N\L$4y!~3NX$zL$TNL$lN L$XNL$hNL$(NL$pNL$VT$N$F V,T$ V(T$`V4T$dV0T$+DŽ$كDŽ$kADŽ$[DŽ$y!~DŽ$|@D$ $jPWw D$uuWX D$Xj@PW D$tFD$pFD$lFD$hFD$dF D$`FD$XL$\NE AD$D$Xj@P|$ W/ hj$P. g j$Hɽ$g$;ʄ$rn<$+$:O$6_$RQ$т歉$h$l>+$ك$kA$[$y!~$DŽ$l@j@W$P D$xj@D$\P$P h$PD$tFD$pFD$lFD$hFD$dF D$`FD$XL$\ND$ D$@D$XbL$j@PQu- $t$Wqxcj@D$PW xOt$D$\PWG D$hWUD$|$x2t$D$\PV- D$hWD$$hPD$;$xu D$e^_[]fffffffffffVT$tz tz$t Jt9t^þqwA BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐVT$tz tz$t Jt9t^þqwA,A0A4A BBBA tB0A4?AAAAA$A<A@4ApATAPǁǁ1^ÐUSWV[|$ |G$qof9}]MLT$ x0} $&$tу M8t9U(u $E U(+Qw(T$ ЃE8 $E D$E($G98H@,@0@4@ GGGH tO0@4?@@@@@$@<@@4HpHTHPǀǀ1^_[]ÐUSWV[D$81|$ 8l$tcEE t\}$tlhju(Ѓ tdNjD$}/G8G4?PUtDWu(U$E1*E E(}$uM$뉾1^_[]ÐUSWV['D$81|$8l$t`EE tY}$tihju(Ѓ taljE(@8@4?jUtDWu(U$E1*E E(}$uM$댾1^_[]ÐWVL$ tey t_y$tYqtR9uNNwAL$x)4V@< w)#D$F<~@F<F@1^_ÐUSWVp]$<D$l#~ #~$|#~q#97i#L$|$Y\#t$VL$ t$T$ʋ $v $_"׍BT$2t$Y$"T$BT$D$${$ 7 $ _D$ $< $ !ՋD$l$ MT$P=C!l$UD$ HT$U9؃!|$WL$ T$W|$s!T$ L$YL$\$L$$l$ $0T$ BT$2t$YpK!D$ T$rt$4$Nw.^!D$ T$rt$4$NT$‰ $ $T$ BT$2t$Y$ T$BD$ T$D$$O`GlL$ 9ȋ $ $T$ L$P)¹)t3L$ |$;$r|_L׋T$$lˊADL$,L$,T$$CH?ߋL$ #_  $T$ P t$>|$A2T$ t$~|$$HKT$ t$~|$$Hҋ|$]t$VD$ t$T$$ $L$$_ ] $) L$ $GlGF?1D$L$T$ $\$sd[ht$\\$@9eL$YPIX։T$0l$\$ t$ L$!T9Љ|$4sKNjt$0l$L$L$L$уL$#L$ T$ T9rNj|$4l$\$0t$ tfw!l$)ЍOT$Jlftztω$fl$t\fJ $9s't$>t$|$;$rىыt$t$)ЃJ $9s+jt$>t$|$|$4;$rՉыt$)ЅlL$Tyrt$$VJ $9s't$>t$|$;$rىыt$ t$)Ѓ1҉$|$49;D$@A΃t#|$L,o1fT}9u)t$4D$rfTxtfTxvfTxxwfTxzuplډ\$0l$;|$@L$$\$ t$ $|$ftT$ D$XGpGPGX l$t$Ht$X|$XWt$ht$\jj$D$$և4L$@? 1 t$؋\$ $!ߋl$}D}D)t$$L$$ l$$FQ? T$‰ً$|$D$G<uD$ $ $/u T$ʋL$% T$‰$$L$9D$GDGB?$$`D$C?GDtZ9wD$$9w΅'Vt$t$4xL$ |$ )t$)t$$t$,)wD$ L$?? n= T$D$ $$\$كGdPWh T$ W`\$$GlGE?1T$ $4E,~BT$ ͋T$уGl>fL{tT$;D$ l$T$ wy<$T$ ϋT$T$\$|$,$닍ZFL$Q?T$ GG$t L$D$L$t4G t.D$fD$hD$hjPD$00^sL$ \$(6?1D$ՋD$l$ MT$PCl$UD$ HT$U؃|$WL$ T$W|$ !T$ L$YL$\$sT$ʉeL$ApATA\AdDAtt$Ht$dWqhPj* D$N FL$Q?|$T$ T$ʋ|$G$tL$HGL$t7G t1D$D$hD$hjPD$00qL$ |$ \$(7?1D$D$T$s'K|$G|$D$D$l$|$G$t\$ˉHH Gt4G t.D$fD$hD$hjPD$00q|$ L$(G8?_D$uËG$ $t@L$D$T$Ps'kD$PD$T$T$l$|$D$GDO$tD$A1u $L$EG L$t4D$fD$hD$hjPD$00pL$ |$ \$(1$9?D$GGD9wƅT$ $t6Ot/W)‰)v!29wы\$Pt$Q l$El$ $t)G t#ωVt$D$00co|$ T$(T$ )t$GD)GD $ $$gGDG:?GuG$@=\$1ՋD$0D$ O$t+At$WD;Q sJODL$ |$ t9wGt-G t'\$Vt$D$00n\$|$ L$(|$ \$)t$$l$GDG;?GuG$t@$D$_\$1׋D$0D$ M$t+A$t$UD;Q(sJMDL$ |$ t9wEt-E t'\$Vt$D$00m\$l$ L$(|$ \$)t$$D$l$|$Ys<҉t$VL$ t$T$ʋ $ $$t$$$l$G t L$( 9L$uZD$1<$׋I$t A,A0jjjl L$(F0L$??D$Nj &t$ً$|$tv|$ulT$ (uG(jjjl |$(fD$hL$hjQPkL$ D$5?D$$T$ ωl $O$tA0t"L$i{=B ҆Yt$T$ $uT$ʋL$|$\$ˋD$(^0>?D$$jjjq|$ L$(F0D$??|$dA t)$ـD$$L$N?D$ y$w; KL$ L$L$T$l$D$ $L$ȃGA?~ፅR~GPGX RGTG\GG?$L$u aD?*FQ?L$l$$ t$T$ $$L$$|$T$8)VW كt|$A T$ t$~|$$Hwk T$ t$~|$$Hw@ҋ|$ t$VL$ t$T$ʃ$ $t$$t$ $$|$1 D$;G  mFL$Q? XFL$Q?D$$D$8 T$D$D$G?$|$T$ d D$H?L$$ryD$,F ND$VD$G<$G@t$8V|$F D$,FD$$D$VG $\$\$!Nj\$ \9rL$ Tt$ՉʋD$  ȈL$4D$ DfD$0ȃ|$D$0$ٿ׋D$|$4!$L$ LL$09T$0l$ t$l$ ߋ\$\$L$L$#D$4$L$ | ;9w|$0I $1ۉt$l$ l$$|$f $1ۉt$l$ l$$D$0Et$l$ ֋T$ ll$ )ދ|$L$4ɉ $l$$L$0)l$GD|$4HӋ$ T$ O@fGLGI? ؋\$D\$$EJ?GTO\׋L$!D$ D$9s=Չډl$ \$L$L$!D$ D9r ދ\$Չt$ <LfL$ |$tL$ϋL$ L$4L$֋|$t$0!t$ |$4LL$@9vuD$ T$l$@ރw>$D$L$L$#|$0L$ |$4L$ lL$ D$9$wl$@ŋt$ T$D$ LfL$ l$ L$)‰ƋD$ljD$@l$)‰$ƉL$@ugD$ GHOLGK?\$l$$ˋ $ۉ $9s\ȉT$ t$6> $|$9r5L$$$FD$Q?\$͉]t$ȿ#|$ً\${H|$)t$|$߉$$D$L?L$$T$ D$8)ȋWH)v;O0T$ v't:D$,)ЉWD׋\$$+G4)v G,)G8)G8ΉWD9֋\$$w9w)ʉUDqʃt:t$ 1L$,l$899uL$,)|$\$$t$ ʋl$riL$ 1L$,01\0\1\0\1\0\1\0\1\0\1\0\1\0\19uL$,|$\$$L$ )ˉ\$$Dt$L$T$ L$H?$T$ $L$M?T$ |$LJG??L$ ]$~D$T$ D$Qv(uS(փ9CCjjjgL$ A$F01 =?A$D$T$ʋL$$T$BL$ T$D$$ $=/$FL$Q?P$$NL$Q?D$T$ ߋ t$$NL$Q?$|$ڋ ~p5T$ $ЋL$щL$1҉$D$l$l$ $1ҋD$$T$ ыL$щL$T$ D$1ҋD$T$ ӋL$щL$1҉$D$]D$)D$L$@ˉ\$0L$$1\$P?L$$%D$0t$1҉$D$l$$|$D$ D$ՋT$,V L$$ND$l$ nC<$C@{,t+D$8)ȉPtDD$R?9L$8t"D$=P?w=N?T$,r$uD$ FV\$L$D)L$DND$8)FD$8C C t=|$8t6N T$8)у{Ct RQPG]RQPc L$(F0\$1Ƀ{K@S1??ȁG?B?N,|$ tƃ$L$DT$8t tL$< ;L$lep^_[]É $1ҋ\$mD$,F D$$FD$VD$G<$G@뭉t$1҉$D$$l$%1낋D$ $D$$1 $T$1T$1҉$D$t$1҉$oT$1҉$D$$D$D$ $D$ $D$t$1҉ $%T$1҉$T$1҉$t$1҉$D$J$T$t$T$1҉ $n1.T$1҉ $USWV[ÂiE8u(ʊM(jPr(R E8|$U,tG9vbM4)ʉ<$9w$t$)ȋ4$VRP6 )t]D$)WPu8 }43M(U,E4E09w)RVP E4E,E01^_[]ËU44$M,E019tӉ]49sE0͐SWV[xt$tM~ tGN$t@Vt992u5zw(B8tPv(уVN$Rv(уF1^_[ÐUSWV[L$tjy tdy$t^qtW9uSNwF|$F0t0l$t(N4)N8PQU F4n0)Pv8U 1tN0^_[]ÐUSWV[wt$~ ~$n9uMwr|$} t >?t ^>?u(jjjr_ t$WPd_ ;Mu.D$ljPEtER? E1^_[]ÐT$tz tz$t Jt9túQwA tD$A$@01ÐUSWV[TL$(<D$y y$Q9 $JlD$(xu$z@OS?t$u$plL$( $BS?zUP4)r(94$w4NPMT)4NTMp)4FpT$tM(Pu8RT$ V8w1T$tz tz$t Jt9túQwǁÐT$tz tz$t Jt9túQw|$A t t 1A 1ÐVT$tz tz$t Jt9t^ËqwL?t1C?uAD +AD^ÐT$tz tz$t Jt9túQwAp)USWVXaD$$$$D$D$D$D$D$ D$$D$(D$,V1Ƀr=1ɐtMfDttMfDttMfDttMfDt9uͅt* M1Ґ4QfDt9ut$.ft$ f|$,t $f|$*t $ f|$(t $ f|$&t $ f|$$t $ f|$"t  $ zf|$ t  $ff|$t  $R $f|$t>f|$t/f|$t f|$tf|$19w\$ۉL$lt+D$LtD$f7f|$f|$f|$f|$uwf|$ujf|$u]f|$ uP f|$"uC f|$$u6 f|$&u) f|$(u f|$*uf|$,tȉL$L9rD$T$Z)V|$)G|$4|$|$8)0|$)!|$H|$|$0) |$)|$h|$ |$\)|$")|$X|$$|$D)|$&)|$@|$(|$d)|$*)|$ |$,|$<)r)e$D$Tt L$T $GfD$rf\$tL$4fT$vD$8fL$xL$HfD$zD$0fL$|L$hfD$~D$\f$L$Xf$D$Df$L$@f$D$df$L$ f$D$<f$f$$t11t!LEtTLprftLp$fQ1$tEua|$ :D$PD$DD$L$@D$?? u)D$(L$($É$MQ?D$,HT$)‹$L$8)ы$F NL$4)N!L$,A$1fW9to)rᐋl$)݋$rpl$sg N@PǃT$1fY9tQ)rᐉ)T$1fT_9tL_)rfT_L_)rfT_L_)rfT_L_)r룉ǃl$l$T$ yYV8Vt\$U1FtFt$ ~l)׋F8^T,8nHNXL$D$$l81͉\$ !݉nHr^L$D$$\81#\$ ^HF@D$FD XfL$ n4!L$T$T$ fiT$fNt791u3q~ǃ8w+$T$D$tq01t ^_Átփ*tUSWV _TL$ y y$q9NQǃ8|$|$$N9l$(4$Jى\$!4$f ؉\$V??L$1)t,)9멁f*] ^_[]ÐUSWV[4l$$t} t}$t }t9/t ^_[]ËGHǃ8D$(t wNjT$,x9L$u*@$D$ @$;L$t (9G,OL WDqL$ $t$ 1fj94$J)r=* jUL$T$4}Gl+G\Gt0GDOLfDHɃQjPh )t$t$ sL O@Pƃ4$T$1fQ9,$tq)r)$T$j\$1flr9t$tLr)rflrLr)rflrLr)rflrLr)r롉$s]LJT$,L$IG|1b$1 fTq94$tlq)rfTqlq)rfTqlq)rfTqlq)r뢐USWV[|$$ $w9>~NQǃ8wHАl$([ tWt?t u(t#IO+t*tF(n(~taV:NG9wͅt2Uvw 3 o noG)GN)NuNN1Ʌ $Nl$($*tq1~8F0 1Ƀ!|@| Ƀ ~lt B)) ȋVT$$jnl$l4NVjn~ltPO0V$nUV$ *NVjnG0NVjn$NVjnjjj%3 G0FqoUO9,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~Nl$(9jjj+ G0FNQVFNQVFNQVF8x,ʃxуxʃx$ЋNVjnF@NVjnF@NVjnF@NVjnF@NVjn tƒNVjnF@ NVjnFxt*@NVjnF@NVjnFx,tvvw0~* G0F FEh1҃ҍ,j1҃ҍB9 l$(@G1 FqFNQVFNQVFNQVFNQVFNQV tƒNVjnFNQVFqoUk6,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~+ Nl$("Fx3V Nh+n $)9 $l$)ʋF@F ͋N$RPQ! F NFy,t)vNPQw0( G0$F oUw5l$Eo9wŅt2UD$pw  o D$ho)o)hu L$AA~4 l$+,$V 19> $ $F@F N $UPQaL$ nnFx,t)vNUQw0' G0F FIFxNL$;N  N;N Vz,t+L$vD$FQPw0k' G0oU\4,$Eo9wŅt0UD$pw  o $ho)o)hu $AA1Ƀ~D$ F$nmF PV DQV$ =Fx,t N+L$vD$FQPw0& G0F F[Fx$NL$;N  N;N Vz,t+L$vD$FQPw0R& G0oUC3,$Eo9wŅt0UD$pw  o $ho)o)hu $AA1Ƀ~D$F$nm$F PV DQV$ =Fx,t N+L$vD$FQPw0% G0FgFx,FH;N v[oUj2,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~*1O0Vhn G1NVjnjjj$ G0FqoU1,$Eo9wŅt0UD$pw  o $ho)o)hu $AA~l$(u ~tvet!@UVXxl$(L~tu~tF`F8Nljjjl$(fFtFl;FlbV\xN81)jPQV52 $FlF\iU^0l$E$ыj9wŅUD$pq  $i D$hi)i)hL$AAxl$( Ft=s5Ft=wMF`wNlF`Nln8T :T :U:UL$ D$D$:To:Tl:Ti:Tf:Tc:T `:T ]H $:T u =$|$?1ɋF8jjjfFtFl;Fll$(V\xN81)jPQV0 $FlF\iUH.l$E$ыj9wŅ(UD$pq  $i D$hi)i)hL$AA(!   T$L$ )T$9w‰V`ЋQD QD QD Xff F`)FtFl;FlF`l$(sUVuFuaV;-~l$(džCN\^F8VjjjV*u+D$(D$(Et$(4+l$(Z T$ $Xf:ȁr D$4$f D$D$ UxElMt)уMtJMxt$UxEl9w]HMXM8L1#MT}@|$MH}D4Ol$(m4!ŋ\$f4kt$l$(fO뤐}hE8MlDrrrf;t$(N\F8EhE`ElL$ 9L$U\xM8EhElEt1)Ћ$jPQU^mAlA\uVF}9wDžt)$Wvu հ } ~})})~uFFl$(Ex1Vl)ʋ$jRPV.FlF\uV F}9wDž$Wvu W } ~})})~FF}hteE8MlDrrrfEhElr|$,uU\x"M8U\xM8z1)Ћ$jPQUmAlA\uVF}9wDžt)$Wvu : } ~})})~uFFD$(xy1)Ћ$jPQUKmAlA\uVtF}9wDžt)$Wvu ® } ~})})~uFFD$(xt1^_[]ÐUSWV0Alqxy,D$)r\$Y8i||$;r<D$AtD$D$9D$D$wD$A4D$,L$A@D$(D$D$$D>D$ >\$C ˉD$ D$8L$8L\$:@:Gt$ D$ 1\:\\:\t$ \:\\:\\:\\:\\ :\\ \$p\$:u=m73\$#T$,D$(P9T$s|q\$t$ ,!  \$+D$$9~t$Vp;L$}\$t΋D$9w0^_[]USWVՉ[#|$A9wDžtB)FW6U F@tuWUv0P WUv0 F0>~^_[]fX4ÐUSWV^ƔL$4t;T$8\$0Ӄs3I͉у1&Ӊi9134ƒT$4zR134ƒT$4zR134ƒl$4M1ʉ34xT$  1ϋL$ 34Ã1ؐ\=134\=1349uЉЉ̉D$ ,׃}l$D$D$D$11|$ $34343.434 $3Q4343434 $3A4343434D$ $3A 4343434|$D$ $3A43434Љ34|$|$ $L$l$11D$D$3343434343W1343434343G1343434ȋT$343W 1‰343434\$343_1ˋT$ )343434É34ϐÉ134W134W134W134W134W134W1Љ34O134RЃ^_[]ÐS[Jt$t$t$ [ÐUSWVX$D$$tz \$׃vND$t$41Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVX4$D$$tz \$׃vND$t$41Ҹہ 1߅t1Xu렋t$ |$1ہ 1߅t1Yu1^_[]ÐUSWVPXV$T$tfǃvEt $41ف 1υt1Mu밸^_[]ÐUSWVPXƏ$T$tfǃvEt $41ف 1υt1Mu밸^_[]ÐSWV1t$L$|$ہ 1߅t1Zu1^_[fffffUSWVP\$ |$L$u2v щv tgC݃t)$1Ґ9u)׋$r/1tTt9uցvq\d4qPP7ǰi)Ɖi),WGWGWGWGW G W G W GwrthC݃t*$1Ґ9u)׋$r/1tTt9uֿqi)i) ȃ^_[]ÐS[Êt$t$t$ [ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]ÐUSWVt$xX\$qi)ωD$i)Ѝ,)w A4vv 4v ^_[]fffffffXۉ/ÐUÐX+L$8ÐS[ÊD$D$ PS[ÐS[Zt$ 6d[ffX;L$ ` $ t, | 0 8 fǁǁ&fDf=Dufǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ| fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁ fǁǁǁǁǁÐUSWV_ǧT$ t$|Qډf fFNinNVjn(ff fӋL$ |&FNQVNVZ^~FNQVL$fdždžЋNVZ^\$NVZ^\$<NVZ^NVZ^$L$tFFQt$P艙L$( N^_[]ÐWVD$ u7Pp~x 2Pp~x 2fǀ11|2Pp~x 2f^_ÐSWVT$f f|>BJyzJz_Z9(f |:BJqrJr~z1fǂ1u1BJqrJr~z1fǂ1+|,BJqrf^_[ÐUSWVXD$l$,|$$~Gx,ux1 t3t futft16M$fufufH, \$$  fDŽ$1t)L$$11Ɖ9$D$$F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$PD$$(  fDŽ $1t)L$$11Ɖ9$D$$ F9}9t;D$}t$$f| AɋD$$t9t f| f !  f f 1t19þ)މt$bD$P|$$0 \$f l$,f f f f  f  f  f uy f uj f u[f uLf u=f u.f uf uf~ $@4ƒ 9v uʍE9w#D$(t\$|$0WUPV{N9ui|$0_Ӊl$$f fEMquMu~}|$01(fpL$0Qf fCKqsKSrs(Jl$$f \$PP Cf ,$ ( L$ |$|K fCKqsKs~{|$1(  |G fCKqsKSrs(  |I։ f{KqsKs~{1( L$L~ ڋ\$$f|ȋCKY,$l$$]D$$L$$IT$$RZl$$],$\$$(fkىދ\$t$  t$U |$0tV |OWrw ~OWrwfLJLJ^_[]11fifZfKf <u1USWVTD$T$BX ǁPǁT=ۉL$\$1fD9t1D$f<tL$PxP` Ƅ1XȋD$Pt$t$ l$LL$ D$HL$\ $T$ 9l$ \ P99}b߃\ \ t$4D$f94t$s 7u.D$XT$\$:XvڋL$\ $f9r`$X:9XH$\ T$ |PP0֋L$\ l$Pn` D$ WP\ 4$` t$$\ ,P99}b\ \ t$4L$f94L$t$s3u.X\$D$:)Xv닔\ ,$f9rd$X:XL$\ ` TpT|$ X TpTt$X fl$f9XX8r)Xflfl` PK#\ <6P99}b\ \ L$,f9,l$L$s 7u.D$ 1X$$|$ :9Xv \ L$f9L$[)X:9XFu` TrTX D$x@0t$pt$Hpt$PpǁX ǁT ǁP ǁL ǁH ǁD ǁ@ ǁ< T\ T$fDT;$1ۉ|$D#1T$Ã<` T$DT$9D$D$fT9fQ< D$ +D$P|D$ D$H|$ |$DD$ D$T$ D$ЋD$|$\D$DT$ T$D$L=ۋ$A> ֐nftfnf$A< fA< C<$=ӐtLX 9D$T$)tT$‹T$$T$fD뺐$t $A< < fT$&> BfT$(@ BfT$*B BfT$,D BfT$.F BfT$0H BfT$2J BfT$4L BfT$6N BfT$8P BfT$:R BfD$fV fD$@fX fD$Bt$ T$1"T$f,t$ A9|tT|$BfD|$G1ۃs@1ېЃ ؉Ӄ É,XuЅxՃ uYT^_[]ÍD$1\$D$Pt$|1΍GP` D$fƄ3XtD)E뤐USWVT$YqL$ 1 fщ;)t)T$l$L$ 1\$,$)f f9HL$xOHL$9L$xXKHL$ (f $كU\$T)4f f9Hxl$ $zvt$|$ +`)9~P fHpnh1pXkh (f  fыt$r t$t$ |$,t< )f9~OH $hMH $) $XhMH $ +(f l$|$t$ +Գ)9T fHxoh9xXkhl$ (f  t$)f f9~?Hxoh9xXkh (f щ^_[]ÐUSWVXn\$T$L$o>o4>o>t>fr  f1;^_[]ÐUSWVT$ $D$0ËD$@D$tT$1Ɉщʉ)։t$11݋T$B9ŋD$8‹D$l$D9ΉD$}9tljT$;t$$|$щ|$~ )| f f9~HL$hE $AD$($D$ $I$[k$hD$$(f ZL$ɋ$t9   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( 3l$~ Ƹ)| f f9FNl$ inN^kn(fD$   )f 9fHL$Hihl$\ L$HL$ XkhL$l$ L( T$  )f 9~[fHL$Hihl$\ L$HL$ XkhL$l$ L( 񉈼|g f$@ $IQ<$W$ $I$Rz${$(f+ f񉈼 f$@ $IQ<$W$ $I$Rz${$(f񉈼 |t f$@ $IQ<$W$ $I$Rz${$(f# f f|$1D$t19)ȉD$ D$l$0^_[]fffSWV[xgt$VGR=yaratV=tcidu3VuVStt$PF )81^_[ÐSWV[gt$VQ=yaratV=tcidu3V;uVtt$P耆F1 蹆8貆^_[ÐSWV[Èft$VWQ=yaratV=tcidu3VtVctt$PF 981^_[ÐSWV[ft$VP=yaratV=tcidu3VKtVtt$P萅F1 Ʌ8…^_[ÐUSWV[Ôet$VcP=yaratV=tcidufVsVoƅtJ|$$l$ 4$VD$PWUw 1u-(V@u (^_[]ÐUSWV[dt$VO=yaratV=tcidufVsV这ƅtJ|$$l$ 4$VUD$PWUAw 1u}(VQ?u b(^_[]ÐUSWV[7d|$Gt,/D(UwU*t D$0 1^_[]ÐUSWV[c|$Gt,/D(U蘚wUt D$01褃虃^_[]ÐUSWV[wc|$Gt,/D(UHtwUjt D$0 D1^_[]ÐUSWV[c|$Gt,/D(UswU t D$01ق^_[]ÐSWV[õbPt$ t$ ^u t6D$t7<$D8W`t$WtD$ 01kb^_[SWV[5bPt$ t$ t t6D$t7<$D8Wrt$WtD$ 01^_[USWV[ôat$VL=yaratV=tcidVoV苖ƅtl|$$l$ 4$V!D$PWU t t_V+<D$t<<$D8Wrt$W7tD$(014 8&8V;t^_[]ffffSV[ù`t$t$ePzK=tciduL$1=tcid^[ÐUSWV[g`t$t$3eP(K=loobul$V袉Eloob^_[]ÐSVP[`D$P趈t&Pt$t$f D$VDD$1^[ÐSVP[ø_t$t$Vt$t$f D$V^DD$1^[ÐSV[i_t$t$t$1dVPP^[ÐSV[9_t$t$t$dVPQ^[ÐSV[ _t$t$t$cVPwQ^[ÐSV[^t$t$t$cVPQ^[ÐSV[é^t$t$t$qcVP7R^[ÐSV[y^t$t$t$AcVPGR^[ÐSV[I^t$t$t$cVPR^[ÐSV[^t$t$t$bVPS^[ÐSV[]t$t$t$bVPgS^[ÐSV[ù]t$t$t$bVPS^[ÐSV[É]t$t$t$QbVPS^[ÐSV[Y]t$t$t$!bVP'T^[ÐSV[)]t$t$t$aVPT^[ÐSV[\t$t$t$aVPT^[ÐSV[\t$t$t$aVPT^[ÐSV[Ù\t$t$t$aaVPT^[ÐSV[i\t$t$t$1aVP'U^[ÐSV[9\t$t$t$aVPwU^[ÐSV[ \t$t$t$`VPU^[ÐSV[[t$t$t$`VPV^[ÐSVP[è[D$QPHt&Pt$t$b D$V<@D$1^[ÐSVP[H[D$QPHt&Pt$t$9b D$V?D$1^[ÐSVP[ZD$QP!Ht&Pt$t$a D$V}?D$1^[ÐSVP[ÈZD$QPGt&Pt$t$za D$V?D$1^[ÐSVP[(Zt$t$dGt&Pt$t$a D$V>D$1^[ÐSVP[YD$QPGt&Pt$t$` D$V]>D$1^[ÐSVP[hYD$QPFt&Pt$t$Y` D$V=D$1^[ÐSVP[YD$QP@Ft&Pt$t$_ D$V=D$1^[ÐSVP[èXD$QPEt&Pt$t$_ D$V==D$1^[ÐSVP[HXt$t$Et&Pt$t$=_ D$V<D$1^[ÐSVP[WD$jPFt&Pt$t$^ D$V<D$1^[ÐSVP[ÈWD$jPtFt&Pt$t$}^ D$V <D$1^[ÐSVP[(Wjt$Ft&Pt$t$^ D$V;D$1^[ÐSVP[Vjt$Et&Pt$t$] D$Vr;D$1^[ÐSVP[ÈVt$t$tEt&Pt$t$}] D$V ;D$1^[ÐSVP[(Vjt$Et&Pt$t$] D$V:D$1^[ÐSVP[UD$jPDt&Pt$t$\ D$Vp:D$1^[ÐSVP[xUD$jPdDt&Pt$t$m\ D$V:D$1^[ÐSVP[Ujt$Dt&Pt$t$\ D$V9D$1^[ÐSVP[Tt$t$Ct&Pt$t$[ D$V`9D$1^[ÐSV[iTt$t$5YP*?=gntsuV!t L$1^[ÐSVP[Tt$t&Pt$t$[ D$V8D$1^[ÐSVP[St$t&Pt$t$Z D$Vd8D$1^[ÐSWV[xSt$t$DXP9>=atadu,V)st|$L$tVr1^_[ÐSVP[St$t$Tqt&Pt$t$Y D$V7D$1^[ÐSVP[èRt$t$tpt&Pt$t$Y D$V@7D$1^[ÐUSWV[GRt$t$WP==gntsu?VŃUt$UPV t D$8 W,1^_[]ÐSV[Qt$t$VP<=gntsuVzt L$1^[ÐSVP[xQt$Xt&Pt$t$qX D$V6D$1^[ÐSVP[(Qt$(t&Pt$t$!X D$V5D$1^[fUSWV[Pt$t$SP;=loobul$VzEloob^_[]ÐSVP[xPD$P&yt&Pt$t$_ D$V5D$1^[ÐSVP[(Pt$t$Vt$t$ D$V4D$1^[ÐSVP[OD$Pxt"Pt$胂D$Vv4D$1^[ÐSVP[ÈOt$t Vt$?D$V24D$1^[ÐSV[IOt$t$t$VP@^[ÐSV[Ot$t$t$VP@^[ÐSV[Nt$t$t$aVPWA^[ÐSV[ùNt$t$t$1VPA^[ÐSV[ÉNt$t$t$VPB^[ÐSV[YNt$t$t$~VP'B^[ÐSV[)Nt$t$t$~VPB^[ÐSV[Mt$t$t$q~VPB^[ÐSV[Mt$t$t$A~VPGC^[ÐSV[ÙMt$t$t$~VPC^[ÐSV[iMt$t$t$}VPC^[ÐSV[9Mt$t$t$}VPD^[ÐSV[ Mt$t$t$}VPgD^[ÐSV[Lt$t$t$Q}VPD^[ÐSV[éLt$t$t$!}VPD^[ÐSV[yLt$t$t$|VPD^[ÐSV[ILt$t$t$|VPE^[ÐSV[Lt$t$t$|VPWE^[ÐSV[Kt$t$t$a|VPE^[ÐSV[ùKt$t$t$1|VPE^[ÐSVP[ÈKD$QP8t&Pt$t$i| D$V0D$1^[ÐSVP[(KD$QP`8t"Pt$}D$V/D$1^[ÐSVP[JD$QP8t&Pt$t${ D$V\/D$1^[ÐSVP[hJD$QP7t"Pt$ }D$V/D$1^[ÐSVP[JD$QPA7t&Pt$t$z D$V.D$1^[ÐSVP[èID$QP6t"Pt$N|D$VA.D$1^[SVP[XID$QP6t&Pt$t$:z D$V-D$1^[ÐSVP[HD$QP16t"Pt${D$V-D$1^[SVP[èHt$t$5t&Pt$t$y D$V@-D$1^[ÐSVP[HHt$t$5t"Pt$zD$V,D$1^[ÐSVP[GD$QP15t&Pt$t$x D$V,D$1^[ÐSVP[ØGD$QP4t"Pt$>zD$V1,D$1^[SVP[HGD$QP4t&Pt$t$)x D$V+D$1^[ÐSVP[FD$QP 4t"Pt$yD$V+D$1^[ÐSVP[ÈFD$QP3t&Pt$t$iw D$V+D$1^[ÐSVP[(FD$QP`3t"Pt$xD$V*D$1^[ÐSVP[ED$QP3t&Pt$t$v D$V]*D$1^[ÐSVP[hED$QP2t"Pt$xD$V*D$1^[SVP[Et$t$T2t&Pt$t$u D$V)D$1^[ÐSVP[øDt$t$1t"Pt$awD$VT)D$1^[ÐSVP[hDD$jPT3t&Pt$t$Mu D$V)D$1^[ÐSVP[DD$jP2t"Pt$vD$V(D$1^[ÐSVP[øCD$jP2t&Pt$t$t D$VP(D$1^[ÐSVP[XCD$jPD2t"Pt$vD$V'D$1^[ÐSVP[Cjt$1t&Pt$t$s D$V'D$1^[ÐSVP[øBjt$1t"Pt$cuD$VV'D$1^[ÐSVP[hBjt$V1t&Pt$t$Os D$V'D$1^[ÐSVP[Bjt$1t"Pt$tD$V&D$1^[ÐSVP[At$t$0t&Pt$t$r D$V`&D$1^[ÐSVP[hAt$t$T0t"Pt$tD$V&D$1^[ÐSVP[Ajt$0t&Pt$t$q D$V%D$1^[ÐSVP[@jt$/t"Pt$ssD$Vf%D$1^[ÐSVP[x@D$jPd/t&Pt$t$]q D$V%D$1^[ÐSVP[@D$jP/t"Pt$rD$V$D$1^[ÐSVP[?D$jP.t&Pt$t$p D$V`$D$1^[ÐSVP[h?D$jPT.t"Pt$rD$V$D$1^[ÐSVP[?jt$.t&Pt$t$o D$V#D$1^[ÐSVP[>jt$-t"Pt$sqD$Vf#D$1^[ÐSVP[x>t$t$d-t&Pt$t$]o D$V#D$1^[ÐSVP[>t$t$-t"Pt$pD$V"D$1^[ÐSV[=t$t$EnP(=gntsuVz t L$1^[ÐSVP[x=t$Xt&Pt$t$an D$V"D$1^[ÐSVP[(=t$t"Pt$oD$V!D$1^[ÐSVP[<t$t&Pt$t$m D$Vt!D$1^[ÐSVP[È<t$t"Pt$5oD$V(!D$1^[ÐSWV[8<t$t$lP&=atadu,V[t|$L$tV[1^_[ÐSVP[;t$t$Zt&Pt$t$l D$V` D$1^[ÐSVP[h;t$t$4Yt&Pt$t$Ml D$V D$1^[ÐSVP[;t$t$TYt"Pt$mD$VD$1^[ÐSVP[ø:t$t$Xt"Pt$amD$VTD$1^[ÐUSWV[g:t$t$jP(%=gntsu?VŃUt$UPV9 t D$8 W1^_[]ÐSV[9t$t$ejP$=gntsuVt L$1^[ÐSVP[Ø9t$xt&Pt$t$j D$V4D$1^[ÐSVP[H9t$(t"Pt$kD$VD$1^[ÐSVP[8t$t&Pt$t$i D$VD$1^[ÐSVP[è8t$t"Pt$UkD$VHD$1^[fffSV[Y8j ƅt%PV FF F^[ÐUSWV[8|$tzj k1tcPV FF FW{WŃP'tQP諉~n VX1^_[]ÍLPQhR蟻SV[I7t$ tVVP4^[ÍLPQhmR?SV[6t$ tVVP^[ÍLPQhmRߺUSWV[Ä6D$tfL$ L$QPjjŽ1x@ƃ$Pt+ǍD$ D$Pt$ t$W苎1ɉV.ʼn^_[]ÍشLPQhER0USWVP׉[5gPQ蘃j 8t}ƍPV n~L$N uq$ Us VP?9tBPUK$u v6V-1uWU^_[]ÐS[ 5 t$Pc[ÐUSWVP[4t$t 9.t 1^_[]Fu V5F $P t͉NjFu YPW脆gPQ.j t!UP$ F~$F qWaUSWV[4l$1t 9}t ^_[]ËE D$PHtߋMu YQPD$迅gPQij t'WP_E$ED$E y4$EiZK3L$1t 9tËA ÐVY3T$1t 92t^BBtu Y^ÐS[2T$t 19 uL$ tB ;D$v1[ËBu YPQ裄[ÐY{2D$t 9t1Ê@$ÐUSWV[G2l$1t99Eu.E PtNjEu YPW^_[]ÐVY1T$1t 92t^ËBu Y^ÐUSWV [ä1|$ 19t$$9Gt{o F D$D$Pt[$W YȅtЋT$ՋVtэQPRt$t$V蛉Owo tQ 1 ^_[]ÐUSWV[0l$9ED$ Etp} PWP$PtM}D$u YT$ $RWQP|$W߈M}u tQ# 1^_[]Í LPQh+RGS[/D$t9u L$ t9t1[QP[ÐS[ú/L$t 9t1[ËD$ Iu YPQP[ÐS[j/L$t 9t1[ËD$ Iu YPQO[ÐSV[/D$ t9u L$t9tf^[Ëp YЅtItRP[OאS[ú.L$t 9tf[ËD$ Iu YPQO[ÐUSWV[d.l$$|$ }$tV 1^_[ÐSWV[X*t$NtFt_V9wwu QPtFVL$z~ ^_[1Vt j V~1^_[ÐSWV[(t$~ t1j VHtw;~ rjVt j V1^_[ÐSWV[(t$|$ʃ>tXVt j V1^_[ÐSV[ %t$ jV)tj Vt jV 1^[ÐSV[Y$jƅt5htFFF V1^[ÐS[#t$[ÐUSWV[#D$ t$tP{CD$D$l$$~1̀ws 琐<L$yO!uc--Ot$NO -Ou-u>uL$ye/u'$1ɸ]$T$J(z 1 7>w􋌋L$qD$ tL$9QWP^p 78/u%<$D$@$|7>7VL$A$>tGL77t$ wɋH vHN15t$F FFFFU=tP w싔dNx"u+1Ҁ8t$FHt"tV x>t1^_[]Í닀ztuTz;uN<szuuuwXtEuW?1^_[]Éw񐐐USWV[!D$PZ>L$QPjjj$0PD$PZ$$_HtыxnU5qtUt띐$$QL$ QPƅtׅkUptT$$4$tz1Up$ƅt`L$HtыxnUputUPjQt t뫃tX^_[]Í"~ 6;1VD1^_[ÐUSWV['l$}t^_[]j@肻tƋ|$\PVjP=F,F0F4F8F<}$t7htL$7PUrVPbUSWV ։L$[^|$ *jjWg qjPww Ht(ut$$bjD$Pww (u$uyGL$PQht$0WtZD$=stL$$jt$W t4jjW t# jt$(P6t$}.t1t$$EU  ^_[]ÍPQhIR^sS[ qPt$ [ÐSWV[ltyPtWD$PVQ tEVt8>VtW0G49O,tktklD$jjjWP,tqG,O4QW4DP*D$(Ct(PQhbRgqQ GP9W1^_[]É.dPQh`RqPQhqRp%PQhRpS[ÊL$A4tPQ4I,Dt*P1[ÍX8PQhR}p%8PQhR^pUSWV$[l$<|$8uV\8}4tMqD$ PWtj Wct\D$<9t6$V8$$V8qPW,^_[]ÉL$jjtHl$WUP jΫDžt!PWGwo 1^_[]ÐUSWV[l$19}EuBM1tDm $t: $U:t^Ut$D$P U-;1$D$jt"WPT$ED$E E^_[]ÐZKL$1t 9tËA ÐZL$1t 9tËAÐSV[T$ t19 uL$t r ;t$v1^[ËR1ttVRQ ᐐUSWVP[ÆD$1t 9t ^_[]ËHh t( $tDUĩt؉Ut$PV ątPQhRLcPQhR-cZL$1t 9tËAÐS[êD$t9u L$ t9t1[QPj[ÐSV[iL$ t 9t1^[ËT$19Q ut$tRVq., ֐USWV [t$(~$t  ^_[]ËFTjQvPt҃~ tD$jPv%g ʼn$u 8"tD$NN 9u8"t=SjP F,F0F4F8F<^_[ÐUSWVP[t3Pjwtrj@dDžuUǮWj@I1tE,$UW蔨/GjP$G,w0G4G8G<1^_[]ÐL$GUSWV[T|$1tv9uloUO4ƅtIl$44$t*1G,TSWV[|$wVDG8uG8V.^_[ÐSWVP[çt$~WF8D$WD$^_[ÐUSWV[g|$1t69u,t$oU19O4v G,4tU^_[]ÍPQhRR:SUSWVP[t$t 9t1rnU0F8uT$ L$9N4u;$5vGF, 6若1V蔦1^_[ÐUSWV[wl$}t^_[]Ët$j@ΔtdǍVP7t$jPhG,G0G4G8G<>}$uL$UxUSWVP $[*ts֋|$jjWƥ tC؍jPww 諩t(t1 >jjPUt$wt1U&^_[]ÍG*PQhBRdMS[؍Pt$ ë[ÐSWV[|tyPСtWD$PVQ tEV衣t8>V袤tW0G49O,tFtFt^lD$tqjjjWPtQG4D$(@t%MPQjfRKQEGPW01^_[]É.-PQjdRSKPQjuR7KS[D$H4tH4[ÍPQhRJUSWV[ät$(l$$~W~4tH؍$PU胛tj Ut 9t6$W$W؍PUU^_[]ÉD$jj荚t<=HVD$~T$rL$9F9(u:G@D$8u t^_[]fD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$QfPQfPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHÐD$L$ʉQffPQffPQPQ P Q P Q P Q P Q P QPIHffffSV[t$jt$t 1ɃI^[ffffff$̀ffff'̀ffffỳrS[Ð[̀rS[p[&̀rS[P[%̀rS[0[ḅ̀rS[[̀rS[[̀rS[л[̀rS[ð[:̀rS[Ð[̀rS[p[̀rS[P[̀rS[0[Ḯ̀rS[[%̀rS[[_̀rS[к[\̀rS[ð[;̀rS[Ð[b̀rS[p[̀rS[P[̀rS[0[ḛ̀rS[[c̀rS[[2̀rS[й[̀rS[ð[̀rS[Ð[9̀rS[p[Ḇ̀rS[P[ḵ̀rS[0[8̀rS[[Ḁ̀rS[[̀rS[и[̀rS[ð[Ḅ̀rS[Ð[̀rS[p[ ̀rS[P[̀rS[0[̀rS[[0̀rS[[Q̀rS[з[̀rS[ð[)̀rS[Ð[{̀rS[p[|̀rS[P[#̀rS[0[̀rS[[)̀rS[[=̀rS[ж[̀rS[ð[̀rS[Ð["̀rS[p[S[Zt$t$jt$ [fffffS[*t$t$jt$t$t$ [fS[t$t$jt$t$t$x [fYXZQ̀QQrPS[út$t$t$ [ffffffS[Ê1;D$[ÐS[Z1;D$I[S[:d8t j1[ÐS[ d8t jѪ1[ÐS[ڴd8t j衪1[ÐS[êd8t jq1[ÐS[zd8t jA1[ÐS[Jd8t j1[ÐS[d8t j1[ÐS[d8t j豩1[ÐS[úd8t j聩1[ÐS[Êd8t jQ1[ÐUSWVXW0 ?) R4< ѐ>t1 @u~1ɍ< >t 9u#;T$t$|$d$$jjdPWU$$|<$u;L$duh^_[]Í QPjRyS[JL$T$ jt$(t$(t$(t$(t$(t$( [ÐUSWV[|$<vQPt$@t$@q׉L$ODH@uD$j PW:, Ɖ8"u+"0:Pt$ QIT$91 ,$ .,$ ,$ ,$9,$dT$9މH1,9'T$,$xt*unD$<L$Pt$-u FD$0ht$4eE<+<-m$hL$ hXT$,))D$ $t$љȅuD$+D$,\$؉D$$1L$T$ /t$T΋T$ D$L$9~D$<0D$TuT$ ΋D$tNj$9|D$롐T$$t$Tt4$9|t$l$TD\D,$9|ȋl$$h= Yh h$h()ȋt$()։D$4$t$֙uD$(L$$)ș\$؉D$1t$L$ +T$T < L$ D$t$9~D$(D$T<u#ދL$ D$tˋ$9|D$말T$΋L$T<<t $9|L$t$T<4$9|ˋt$ŋD$D$0 L$$ $\$|$ V$ht hu hh<-u ~h4$<:tkE$<4$P譀L$ tEH<$W;:&L$A;D$PʋL$TTD$:u8t}:t4$P" $? tǃ hǃ$hȃ<^_[]À:uL$:tVL$D$X:L$u^W Yh8t}:tjWP,"Wx:L$~T$0hL$ $_D$h/ Yh:t#j=R7ʼn) h$h))ωD$<$t$יut$$)\$؉D$1|$T$ (T$T  T$ D$|$9~ΉD$<D$TuT$ D$tNj$9|D$롋T$͋L$Ttȋ $9|L$l$TD\D,$9|ȋl$1VD$\8l$ pD$D$1T$ $\$" $>T$tbQWR uW訰 $9D$t0ϋNT$\;LuN;Lu N;L tD$딉l$뎃|$t`\$8D$X8:vRQP $L$$D$ \$\$D$\T$l$ t$\$D$\l$ tyD08|$Xt?:tRQP$ 1L$\|1uD1 <-t<+::_y8tD$X8:tRP? Hl$ t,L$)l$XSA;D$PʋL$TTl$Xu{D$L$ D$TL$DL$D$\uLD$8uC8t}:tRP 1L$\|1uD1 L$ aL$\D1L1 t1ɋD$`<85 Yh8t}:t4$P $E<-t<+u:}:1<: :fffffUSWV[T$l$t$< tlǃ< ,h9}@L9-u7y0hI@ -uK-?,h Y0h^_[]Ë0ht0h@ ::ur??(ht::t8h%4UPQR듍 Y0hj-Rymǃ@ --QRytRx:ue?u%1x:t,hH,h9}gL$|鉻D Y0h,hT$?(,hǃD ?t,h Y0h:D$8:?(hg?ffffS[j jt$f [ÐS[ڋjt$ 8[fS[ú4Xt$ t$ P [ÐS[Ê4Xt$t$t$P( [fS[ZL$ 1t$PQt$' [ÐS[*jjjt$ [fffffffS[L$ 1hPQt$ [ÐS[ʊt$j t$t$蠆[fffffSP[ÙD$ L$T$$RQP[S[ÐSVP[hD$L$T$t$4$VRQPuS^[fffffffSWV[(|$jW%GHO~ H0 W裰jW^_[ffffffSP[ɉD$ L$T$$RQP [ÐSVP[ØD$L$T$t$4$VRQP^[fffffffSV [VD$,t+8t&$PD$wD$D$ t$fx9Hh~4hP訨FFNNF )PQj,^[ÐXL$x9Hh~4hÍÍfffffffUSWV8[dT$L<D$4D$PpVP轨;VP襨aVP荨VPuVP]VPEVP-~VPm+VP\JVPKpVPͧ:VP赧)VP蝧VP腧VPmVPUGVP=)с 0 t9uuhl$t!j2pU xq QPs`YRKD= 6 / ( !  l$YPQj2UEUlƋD$XtPUt$\4 ;D$4u 8^_[]]fffVL$ D$Pt%uP րu΃uru^ÊP utH fɉHf@ ^ÐVL$ D$Pt%uP րu΃uru^ÊP utHffH @^ffVL$ q1v |$t^ʃ|$u^ËL$A)A31|$tA AAÐSWVL$yuTt$wKQ Zt@uvt |A 1^_[ÐD$xtÀx|$ÐL$ytI .wuÐSVL$ 1yt^[ÊY u.wT$~9|ԐD$xtÊ@ u<.wL$9Ð|$t1ËD$ÐSWV[Ȃ1|$u:T$D$9w&t$PjVe FfFF^_[ÐWVL$ yu/T$Az |1z|1:RT1 |1A1^_ÐUSWV[L$(yQ׋t$,<$PQVC N1<$w11ɐTT$TT$ T| |$T$T. TT.T.|.| TT$T. T$ T.T$|$|..9u^_[]ËD$xuHuP9røÐVL$1yt^Quq9rt$ x9v1^fffD$ ÐL$ QϸwD$T$B)J 1ÐUSWVP[f|$ L$$T$,r 4$9u+$1!)1օҋ|$t$uEEFEMPjQ蝓 7D$8t pVPUǓ 7+$p)t&uFA̓PjQ> 7+ $O 1^_[]ÐUSWV[4l$$1L$(T$4z <$9u+$1*!)1ׅҋl$t"uGFNPjQp D$ }+$x)t.u$GAL$L$PjQ)L$ }+ $M ^_[]ÐVt$~)FσwyrrF  9r]T$  t9tq9w<q  9w! 9s9tQ9wQ^ú9^ÐSWV|$)OσW 4 9L$ 4:t:tz9w_z  9wD9s.D$9t7tz9w#z9w9rָ1҉^_[1VL$t"T$ tփuQ^ÐUSWV[W||$ T$$D$(<9D$|$,Ѓt)։Ѝ4*T$$t9wY|$tOL$,|$t u D$ (GPjWpL$8T$0D$, W9^_[]ÐSWV[h{|$L$1uLwt?;t$w6)w*t$uQRjQԎ ^_[ÐSWV[zt$|$D$Vt$P ^_[ÐUSWVL$ ʃT$$t֋T$09}n|$9sTtu&됐^9w1^ރ9v"n9wl$n,$,$l$9v^_[]ËD$(D$, $*)ᐐUSWVL$tkʃudT$t׋t$(9}GT$\$ א?tW9w)o/9w 8t9r^_[]ÃD$$(>+T$吐SWV[8yt$|$D$VPt$ 8 ^_[ffffffS[xjjt$t$t$t$[ffS[xjt$ t$ t$ t$ t$ t$ [ÐUSWV[Áx$$<$$ft$tPQj VD$0D$4D$8D$<D$@$D$(D$,D$$D$L$$PQVuBt)6PPVQ <$D$@tL hPV3 u$ &@PQt9xudPwtUWL$$U$$Ƌ<$t$,;$?Ę^_[]ÍD$$T$DPhQR$X?|$D$Pjjj>$t(D$ PjjjD$ $/x}D$ t$$<$t t$ܻjjt$(L\ t$$PQF  PQxhNt$]jt$xjjyPQ%hjkt$$ujjLx*jt$8xt$ غt$̺t.y(uYD$puMiP6uR$$eu8D$@$8jjD$8pQRj/|$ WL$ $t$$tf T jPQ' j$t$u+b>>jU6$PQt$Wt NjU6$Pt$WX2+Zj/WsthDjUPQW$HWPQMf jiUSWVdT$,L$[És4PVQRl$t$EFS[mjt$ t$ t$ t$ t$ t$ [ÐUSWVH[ôml$tD$`<L$Dft$$PQj V D$D$D$D$D$ l$D$ D$L$PQVt$h6t#6PPVQJ Ul$d $At#L hPV~ ul$d $t$pt$pt$pU4$;D$Du H^_[]DS[Êljjt$6 [ÐS[jljt$t$ [ÐUSWV[1l$$<$|$1 tuMD$tTD$BD$ UD$tDD$BD$BD$BϋJ L$D$"貋/D$D$L$ jjQE Ǹ4$$tu1fD$ D$PWxpD$ f4$l$ffD$ UD$ PW y80u==uWvފ#"ъ0WY0 WG4$;$u Č^_[]BUSWV$[tjD$8D$D$D$D$D$D$D$ D$ T$)QRVPtuS<$t5t$@l$4$N$\$D$PjL$Q$"P )\$D$]$4$֋$ߋ\$Ut$//$$$ߋ\$$PNT$NJ<-td<+$tHɋt$@$t؃L$Q$jP:(!$tHɋt$@$t؃L$Q$jP'؅\$VQ%$$$ߋ\$$PDT$uYoP$赂1u5Ku*@P$膂t"tt]tXuto$WhhU'1D$ D$7,1D$;$uȁĘ^_[]19USWV[4aD$(L$0T$4t$, $ $T$- $ $1 $+L$T$,J $ $T$,BЋ$)J)Ӄ!r^_[]ÐUSWV [[t$ ~Nƃ V҉$t`L$FшT$?r?鍋Q $j@UPQ\$+Q ~t0|$>L$:$u Q uL$>͍ >T$1ҍ -9si$:U;L$s>t 9sE.9r9s34$h9s맋 $ 9s$Q ^_[]fffffUSWV[ÇZt$|$U\pPPWVU<^_[]fSWV[8Zt$hWPPV W^_[ffffUSWV[YD$L$H $xhH@T PQUWt$t$RjV*$^_[]ÐUSWV[tYL$T$ t$|$千WVRQL$QUPt$H 1uA$L$   L$ L$  L$ L$ ^_[]ÐUSWVL[Xl$dƅUVxt$`L$QL$QL$QL$QL$QL$QPV@$uD$L$D$@L$AD$ D$BD$D$CD$D$DD$D$ED$@T$d3L$Df3J ?D$(P`L$QL$$Qt$L$:QPt$<t$`L$QL$QL$QL$QL$QL$QPt$@[$u:D$L$D$@L$AD$ D$BD$D$CD$D$DD$D$E1vD$t$ h1|$IVT1W{1W{ZvD$$;D$Hu ȃL^_[]d.USWV[VL$T$ t$|$千t$4WVRQL$QUPt$L]$u0D$0 $L$HL$HL$ HL$HL$H1u^_[]ÐUSWV8[qU<$4$LuD$$zPQ腱Ǹt$jjjjWAƍ'D$(7tV/jjjjWƅt$(VGul$3UL$QL$QL$QL$QL$QL$QPV$u$$PD$AD$AD$ AD$AD$AU$PtBD$,P0&L$QL$$Qt$,$XPt$@L$3QL$QL$QL$QL$QL$QL$QPt$@($u9$$PD$AD$AD$ AD$AD$A1rsD$t$ 6.|$WV".Wx1t$Wx$st$;$4u 8^_[]*+fffffXR ffffffSWV[õRt$(<D$uj! ƅtZt$$P1 F LFuF ;D$u ^_[1g*USWVp[R$1 F LFuF(;D$u ^_[1'USWV[N$ <$$Pwh@VI1$|$$ $ u#D$P|$WLP|$`l$d$$ʃ|&jQPt$ `|=P$Pt$O ƅ~.V$P$P |) um84$)m8|$$uj)ƅ~$$QPJ1F LFuF(4$W萒|$;$u^_[]1&%S[úLjjjjt$t$[ÐUSWVt[ÄL$<D$pUB$$Uk uj)ƅtVD$\UP91L\F LFuF(;D$put^_[]1$ffUSWV\D$pL$tpxH 1!t$T1ȉ͉L$PʉT$LL$p L$DыT$pZ\$XÙyZ|$H1T$D!1L$tIɉL$yZ1!1T$tRʉ$T$H,$ʼnyZ1!1T$tR ʉT$ ƙyZ1!1݋T$tRʉT$ǙyZ1!1͋T$tRʉT$ÙyZ1!1ŋT$tRʉT$́řyZ1!1T$tRʉT$8ȉyZ1!1T$tR ʉT$ Ή΁ƙyZ1!1ًT$tR$ʉT$$ωρǙyZ1!1T$tR(ʉT$(ˉˁÙyZ1!1T$tR,ʉT$<͉yZ1!1T$tR0ʉT$ŁřyZ1!1T$tR4ʉT$4ƉyZD$1!1ދT$tB8ȉD$0t$ǙyZB<1ʋt$!1ȉD$,ӉyZD$@D$L3$\$ 3\$411!É؉\$1\$@فyZD$3D$ \$$3\$011D$@!1É\$Չ™yZ$3\$l$(3l$,11!1ʼn,$މށƙyZt$@1!1ÉƋl$ 3l$3l$<3l$ʼnl$ ߋD$@߁ǙyZ11ÉŋD$3D$3D$3D$D$މށơn\$@11l$8D$13D$43$D$ىˁán3L$@1D$3D$ 3D$03D$ D$ʉсn113l$$3l$,3l$ʼnl$8D$@Љ,šn11ʋD$ 3D$(3D$3D$D$ ׉l$@ׁǡn11l$$l$(L<>4LuŋD$;D$u^_[]Ë$)ffffSWV[9t$,<D$uj)-ƅtZt$(P1 F LFuF(;D$u ^_[1USWV[19$ <$$Ph@V}1$|$$ $ u#D$P|$W"7P|$`l$d$$ʃ|&jQPt$ iK|=P$Pt$| ƅ~.V$P$P  |) uX84$}X8|$$uj)Fƅ~$$QP1F LFuF(4$W}|$;$u^_[]1sS[*7jjjjt$t$[ÐUSWVt[6$<D$pU$$U uj)'ƅtVD$\UP1L\F LFuF(;D$put^_[]1ffD$@@#Eg@@ܺ@ vT2@ÐUSWVP[5t$ L$A͉?@)ύ‰Ul$P19wct,B$ WUPI 4$t$YT$ H@9w%PR5T$ G@9v19s)ō VUP\I ^_[]ÐUSWVx$$0t$8ZJj l$\ȉωL$p11 L$t rt$l|$ ߉\$h11ʋ$@D$$\$\؉ t$11‹$wt$L 11 |$D/ l$ 11ߋ$RT$ ʉ11׋$ml$< 11ϋ$ml$( 11Nj$ml$4  11$m l$0 Ӊ11ߋ$m$l$@  11׋$m(l$  11ϋ$m,l$H 11Nj$m0l$ މ11$m4l$T 11ߋ$m8l$,$o<  11l$P !D$4!yZ !t$!ǙyZ !\$T!ށƙyZ !T$$ډ!ځ™yZ  !L$ ى!فyZ  !D$(؉!yZ  !߉!߁ǙyZ !t$Dމ!ށƙyZ !T$ډ!ځ™yZ !L$8ى!فyZ  !D$@؉!yZ !|$<߉!߁ǙyZ  !t$Lމ!ށƙyZ  !T$,ډ!ځ™yZ !L$Hى!فyZ  Չ!D$0؉!ÁÙyZ  1|$D/n  1t$ ơn  1T$,¡n ʉ 1L$n 1\$@߁ǡn lj 1D$Pn  1t$0ށơn ։ 1T$$ځ¡n 1L$Lˁán  1|$4ρǡn 1D$8n  1t$(n 1T$T¡n ډ 1Ƌl$Hށơn  1|$<߁ǡn lj 1D$n !L$$ى!فܼ  !T$@ډ!ځܼ  !މ!ށܼ !|$ ߉!߁ܼ !D$8؉!Áܼ !L$0!,ܼ !T$‰!ܼ  !t$Ɖ!ܼ !|$Tlj!ܼ ؉Ɖ$ T$X!\$DÉ!ܼD$ D$!l$4ʼnl$\$\ D$pT$h1ЋL$tt$<<拢Pt$ll$ 1L$,拢P ً\$ 1ȋt$4拢P  1l$8拢P  1\$@ށ拢P  1|$L拢P 1L$H,拢P ʼn 1D$拢P 1T$T拢P  1t$(Ɓ拢P 1\$P<拢P  1l$0拢P  1L$$ˁ拢P Ӊ 1T$ ʁ拢P 1t$D΁拢P  1|$,9拢P !D$(ȉ!э<$M\L$#L$ D$ܼ߉|$ !\$Hˉ!ف$M\D$Xlj|$<$ <$#|$D$P  ׋\$!T$D!$M\ \$!t$4!$M\\$#<$ܼ !l$8!$M\D$lj|$ |$ |$!D$, D$D$ !D$T!׍$M\ !L$<!$M\|$ #|$ D$ܼ !T$ !$M\$D$|$ |$#|$ $D$<  !t$,!$M\ !l$P!$M\|$#|$ܼ$ !\$0!׍$M\<$\$߉<$D$ |$ #|$\$(  !L$!ρ$M\ !T$ʉ!ʁ$M\ $#L$ فܼL$ !t$@Ή!΁$M\ !l$$͉!$M\  !D$L؉!$M\  1|$P߁>pm  1T$<ځ>pm  1t$$ށ>pm 1L$Dف>pm  1D$4>pm 1|$,߁>pm ׉ 1T$(,>pm 1t$@ށ>pm Ή 1L$Hˁ>pm  1D$0>pm D$d 1|$ρ>pmL$D$L$L$ L$# $T$LȉD$ D$d 1́>pmL$#L$T$ʁܼ D$d 1t$ ΁>pm D$ L$X$ $ T$1D$ 4NSىL$` 1\$8ځ>pm D$Ɖt$t$ t$ t$X1D$8 NSL$d t$` 1L$΁>pm $ˉ\$D$X D$X D$1L$<NSD$ L$` L$` 1|$T8>pmL$ D$L$ |$ |$ |$1D$@NSD$ !l$0!vmzD$` !D$(!ߍ vmz|$ D$Xlj|$|$ |$ |$ 3|$D$4NS !T$!vmz !t$$!vmzD$lj|$|$ |$ |$3|$D$ NS$ !\$D!׍vmz !l$H!vmz,$l$,$\$ \$ \$1l$l$L݁NS !L$Pى!فvmz !T$8ډ!ځvmz l$ l$\$ \$ $1l$ l$ ݁NS !t$<މ!ށvmz !D$؉!Ávmz l$l$ $ $ D$1l$l$, ŁNS !|$Llj!ǁvmz  !L$T!vmzl$l$L$ L$ L$ 1l$l$$ NSL$ !T$@ʉ!сvmz  !t$4։!vmzt$ 4$t$t$ t$ t$1Ƌ$D$DNS !\$ !ށvmz !|$,߉!vmz D$$|$ |$ |$1NjD$D$0NS l$11 ͉11L$PD$ D$|$ |$ <$3|$D$ D$HNS T$ 11 t$ 11 D$lj|$<$ <$ |$3|$D$( NSD$  \$$11 l$< 11͉L$0 11T$4l$  11|$l$ |$P|$ t$(11\$L 11|$ |$ |$3|$ l$NS|$$ 11ߋl$TȉD$(L$, 11D$$<$D$$D$ <$ |$(11ω|$0L$, l$\͋|$l$\ |$ 1Nj$NSD$T$8T$0t$DD$( |$,11 \$@11 D$H 11 t$ht$$T$p|$ $UT$\UT$l|$ ‰U |$tL$ω}ux^_[]ÐUSWV [ |$$<D$OGD$ $?17l$ )ȃ8>PQW jPW twGEGEGEEGEGEGEGEG E G E G E GEGEGEG E G E GEGEGEGEj\jW2 ;D$u ^_[]JfffffUSWV[uVP>twoVP>tkVP>t_VP>>6.&8Tpu} 9p D$s5L$$QD$ PVW|$Wt$V W$WVv13Lˀ6\Ёt869sр6 1ұ6\P9r1몋t$E 9FwML$$9L$uE$D$$M9L$t.} WQt$ V0 D$@) >PjQt0t$ |$$WV$$v PWV $uuWV $Wt$V$WV$$v PWV $vuWV $W|$WVE\$9tu t$P&0 D$@L$ ;$ue^_[] L$$Yai qyD$A(tQS[ôRjjc_ [1ÐT$D$ Zbj rz $z(t RPS[djRj_ [Xt@fffD$$X`h px1ÐT$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj~^ [1ÐT$D$ Zbj rz $RPS[ÊjRj9^ [Xt@ffffffSP[YD$ L$T$$RQPk[fffS[*jjt$jA[fffffffS[jt$t$jq[ÐS[ht$t$jq[fffffUSWV [Ôt$ D$D$$|$jjUVjW1D$D$ $jjUPjWD$D$$jjUPjWPD$D$$jjUWjPu88 Ɔ $ɍT$t5u ȃt)kAw T$uDD$D$$jjUVjR1u ^_[]ÃtOw OsҍHfUSWVh[ï uj' D$Pj L$@B1lj1L$ED$$1t$ƋEpD$Pjyxw L$@B1lj1L$EHD$$1t$Ɖq jPu( L$@B1lj14$e^_[]ffffffUSWV[Äl$jPU b u @t tQUhujPUa t 1^_[]Íu4jPVa DžtjPVa 1uú!?E1u<-ut<+uMDHt$}D$j PW  L$9e9$YQH}+t؍ ߃/Љ(!ffffVZ*L$?w5t<t#΃? ?9tA|t^1^fffffVYT$r1>w ^ffffSWV[Õt$(WjV  xqN|$,t?r$t4d$D?r']4- d$!L$jWVj  ^_[fffffffSWVP[t$tB PQhRJlx>L$ $ )QVWRk  PQhRl t@ ^_[fffUSWVY7D$t$D$I@t ~_wˉ"+t҃-!ЃÉ^tu/u4u?t#!tu>uG{Pt̉#.!t,#.!u븉# t# )#>  ^_[]ÐUSWV\[D$pD$$8D$HD$DD$@D$$ *(*8l$)D$ō<D$D$L$EX<$t$!ȉEl$D$$,D$$0r*1ka*D$jPt$x NjD$D$$7*|$$t8"u0s%1*0W)0\^_[]ÁsWD$9r8l$8D$8jj P!# )0)8uD$)l$8D$-@@+x @)Z|$)`EL$ȉqpS+t Xt-u111#Y Y+tXt-uY !!ݐY !!̅t f-xt f+p}fXPmffffffD$tV@,@(@$@ @@@@@ @@1øÐ|$ÐD$L$ f1ÐD$L$I1ËD$L$I1ËD$L$I 1ËD$L$QP QPQIH1ÐD$L$Q,P Q(PQ I$H1ÐD$L$f1ÐD$L$A1ÐD$L$ H1ËD$L$A 1ÐD$L$Q PQPIHP1ÐD$L$Q P,QP(IH$P 1fffffffUSWV[T$(`1d}tPhP|Q bt6D$) D$(8rl$ udPt$)ŋ$t$_O&0 }tPhPQW 4$Kt$K&01UPt$(ŋD$G6{KoD$G  D$ 8tPhPPG^_[]Ët$$T$(,hDs+ZjVPQRWjnUSWV׉L$[>2jeVj+Vt-1|$WjPj]yFu<$|$1jrVantsQ $UW^t1ju%$07,Jw!J$01^_[]ÐUSWV׉[S tuImu?ru<6IFtjP_vI+u4jj_&vItjP_6jI^_[]ÐUSWV[ôT$0P1d}tPhPlN_t1D$D$08rl$ u_Pt$%ŋ$t$ZI#0}tPhPNW4$Ht$H #01UPt$%ŋD$G6zHoD$G  D$ 8tPhPMG^_[]Ët$,|$(l$$T$0#VWUG jUSWVP[fd>tPhP8M tD$9Gt7?t9Gu(>tPhPM"k1P'u E>tPhPL吐jUw ƃu !8tWt4$^_[]fffUSWVH[tl$`t$$WVUt$htUVt$Zǃu.?!8uj~~;$} VPZǍD$9tLVA$jD$Pat&WPUt$h {D$$oH^_[]ffffUSWV4[ÔT$`t$Xu Ytxuut덫tŋL$\tD$ 0D$H|$T|$LtD$PT$0xKD$(Gz9G|~dkd׉<$T$`D$L$D$=SQ|^)k׉<$T$`D$(D$L$D$S<$D$dD$D$1D$عD$dD$ $D$(D$Ѓt YL$V 8;L$Lv \NjL$\0l$$tUL$L)1D$,xt$11d 44rŃ΃1~mD$,$rQT$ j|$WPt$t,jWRPtjWRPn$L$21L$9$}$jt$RQ"9|xjt$RP9|[jt$RP9|>jt$RP9|!jt$RP9$D$t$L$\|$ L$ȋ|$ŋD$(Ћ$19 d$00L$,ȃ;D$LAgfff׺QՉljʼnҍ)l$VL$$T$ QkVQt$$W|$\0URWt$hT$t$jjd|$WQʼnр|$u|$э`t$t$(t$$QPR|$dRt$Ћ|$2jjdPUϋ|$LыT$$t$ r`t$Rt$$QPVWt$dT 9wlj4^_[]jWRPtjWRQu$'jWRQ$jt$RPsD$$fffUSWV[$4$0$,D$ D$D$$uBuB$($,%B JB$$,L$' @fA9of\t u Gt\t @fA}Ef\tuEt\{tL$ftLfAGft:fAGft:fGft+fAA9r $,fxL$P L$P^_[]ÐUSWV[$$$B t%E HM =rf{uf~}uf~t[f{ft"ft:Gf{u)t=hL$PVQ  D$D$ $UD$D$1ft[Mfz~f{t@f}utWސf[u҉鐐Qf]tfuft̓벐먉$$$'191ɉ%9fz1f,tKf[u؉ωQf]tfuftȉ븐f{tf}ut랐uL$D$9s D$f9r1ɐT ffuL$$$$L$"1^_[]ÐUSWVTXD$ <$P1f9~$L$B t$$L11ҋ|$DOff/D LDOff/D MDOff/D NDOff/D ODO ff/D PDO ff/D QDOff/D RDOff/tzD St$LYMLN?O2 P% QR S9$tZD$|$LttD$$NT$t$L\$ PhQRVuD$t @ t$R$j t$(;$PT^_[]Ë\$ Pt$tU1ɋ\$ftzfTLLTft^fTLNTftTfTLPTftJfTLRu\$ KL$$Nt$QhRVPtQLL)196t0N,1 9tDtPGt$FP5F^_[]ÐUSWVY'T$tht$1BtBظkw+tրztЃːt *u1^_[]ÐUSWVՉ[BÐ4B tvzEVP}$uMtQjPD$ t$ L$$l$E1퐐f$NQV$r$ E/%f}/L$@Ɂ1O tgTO tWTO tGTO t7uً$$$VPV$t@uD$$$PQ菆D$$$PQV(u%#D$=@u;$s!E/F$$L$ ;$u Ĉ^_[]Ë$RUSWV[<$T$ f$ $9t$<L$ D$,D$D$$EfR$t%=LEu⋔$B @D$D$PQ迅9j=*uA=*uA=*D$$AD$9$L$ K D$$);L$ 4 f? G D$D$PQR$1 #L$L@ Eft:$tK=LEu$hPQ $A @u$Pz $PQ t#$A @1 $p1ɐDM CDM /DM DM u~ID$4PL$DуP$L$8\$l$0XL$0\$$$W$W$6t$4T$D$I t#$Wrw$v ux .u$f:.u@t(x .u"Pt.uxw T$ ;$w'0jf2fu;$w9;$v%$f8tB|$,tY|$$D$ fD$fËD$;$f|$E;D$8f/D$ fD$f9$r f|$91ۈD$D$ $|$D$D$D$D$D$D$7ڐ\$u=*uLw*t;$OL$ڋL$d$t=?t)=[uBD$G=!D$t?w=D$uyt$f9t$uYt$$w1T$ЉFD$ЉT$(|W]uZD$D$;D$(;L$ $tڋ|$9|$D$(D$T$BD$=]zr-u%D$f9wf;BwD$z뾐f;|$tD$랋t$$|$t$fT$f9ljf|$1t$0FTFTFtTF`=u1D$ $T$D$D$D$:ЉƋD$D$uT$=*uI~*t;t$NL$T$L$؋D$t=?t=[u1umF=!t,~*uU|$։‰}f9|$u:g~1ЍWD$(tF]}D$D$;D$(u6;L$ \$$t$tT$9vT$D$t$fD$f;T$f|$D$&މD$׍W=][_-u+D$f9wf;GwD$wf;t$tD$랉ŋ\$$fEL$0$Wt$($]$D$ fxD$D@uP$P|P$P$P$AD$L!=+=D$ f\$$ 1$A @D$4uPPQu 8t$A T$ $$t$ W$$Yd$0Qփum1ɋ$B u^ZH J"D$ /GT$ $$P$tL$< ;$u0^_[]ËD$ fD$,ɷffffSWV[x|$P1[ƅt6Wu拃 tPǃ ^_[ÐS[ P[ÐUSWV[ t P蹹 uP D$jjVP 责 zL$F#P=YjjVD$ P ^ t(tċL$)D}@tQu18,P}1 T$Ɖ 8t'T$Ɖ 8t%T$ ǃ ǃ ǃ ǃ ǃ ǃ >El$*D$1D$ >D$ ƀ8pjWV uD$FDA@utjt$V uD$FDA@jt$V uD$FDA@jt$ V{ uD$FDA@jPVH uD$FDA@`X.jPV uD$FDA@917jPV uD$FDA@ %jPV uD$FDA@UjPV| u#~=uj=Vt 2jPVC u/~=u)j=Vt ,?V PQRj    @  ||$#u< t< t 1>t j Vt^_[]ÐS[* tP1ǃ [ø[ÐUSWV1 "t!u$\ux"u82ߍy9t߀r t #t9뗈ws9u #^_[]ÐUSWV[<$ǃ t"Plj;$D$ D$D$D$$L$jjPWjQt=L$WuPhQ1zPW4 mzPu4 1;$u ȍe^_[][fffffUSWV[$<$$tu1|$$t D$3|$ h@PTD$(D$$D$ cL$t$L$\QP|$tXD$D$0t$\ |$d$<0fD$PPj7iR D$ $D$1p1$D$DŽ$DŽ$D$|D$xD$tD$pD$lD$hD$dD$`D$\$tV>PVw $D$$uhȠND$$D$iD$,D$ 1҉t$Յt6D$D$0D$4At$,jD$8P .jD$PD$0> D$ D$r€r|$9L$x<r9L$y<r9L$~<r9gL${<r9KL$z<r9)L$q<r9L$p<r9sL$o<r9L$t<r9L$u<r9L$v<rʾ9L$w<r9L$l<r9t$u4$OD$^D$ $GL$m <s9u9tL$n <sI9uD$$$9r4$tzOD$_WY9t븉t$ypd$i$`t+t'|$`jPw u1Wt$裨Ƌ$>xt$D$|Ay DAD$$uD$*ՋD$DJt0DHD$D$"$@um   DAթD$:jPD$pt$$jPD$pY D$ t$xtG$`L$tZ`jPq@~jPD$p -1ҋ$t:jPD$p1҃ t$D$t$$D$ $D$D$ D$(D$$1GD$ 1PD$1D$ D$D$8< Y1D$ D$|$t,D$D$\Pj7K |$}8|$|$ t"$%tNjPw |$t!BD$7|$(8|$ $t t$|$H|$tu Vt$jl$ U 1$u U襪;$u Č^_[]٧S[Êjhjt$t$t$Y[ÐSWV[X t- jhjVPt$$t8 0jFs tPq u^_[ffUSWV[ jjj+  |$  tWQ  th1i  9  wHt Q>  U跘 t$WUP蘓  u 1T$ Ɖ^_[]ffSWV[lhW u jP[(xǃ 1 t  1W^_[ÐUSWV[ÇlhWd u jP'x8ǃ  U";D$wUt$21&0W^_[]ÐS[t$:&ǃ [fffffUSV0[D$D$L$ djjPQjRt_E rT$,$$t>Ut$ t$D$l$tt$$t$D$l$Zu L$(L$D$ l$Ze^[]fffUSWV [P1 Yt\ƀ8tUT$D$j PV7 tŋT$t|zt)VPZ1ɿ YkP&wAL-@lʹ&u Y@9~ $(jP5Z,$BVPZT$t$$D$ t _% RUPjQ1#L$ t>% ^_[]ffSV[y< u*ǃ\ zPV&< tt@ KVP1^[ÐSV[ ǃ\ < tPh[9zPV&< uKVPJ1^[ÐUSWV [Ñ<$ǃ@ ǃD ǃH ǃL ǃP ǃT ǃX ` < hhUXD$ 1Ʌ$t$kL$ $t$ P L$l$<ǃ@ < hhUWD$ \ t$P耜j\WVD t8t剃@ 8#tj\WVWD t8t뉃D j\WV7D t8t뉃H j\WVD 68t牃L ǃT ǃX j\WVC tD8tP腬T j\WVC t8tPUX hL |$$W |$j\PD$ P]C ǀ8tWu͍P$UWthiUWtTUWt@UWtt, UW`t3UWLQP E5xxMf l$<$j\WVwB 8t牃@ 8#j\t$VDB t8t艃D j\t$V$B tOǀ8t扻P 3PW"L PWetbi`L D$l\ PQT P l$tэ3QPuq7H <$j\WVWA t8<$tPT j\WV'A X8<$tPΩX t$t$1ɋ;$u ȁ ^_[]SWV[øt$ǃ\ < t PV.zPW < t2t+V@ u䍃@ KWP϶1^_[ÐSWV[t$ǃ\ < t PsU.zPW+ < t2t+VD ;u䍃@ KWP/1^_[ÐS[z< tPǃ< [ffSV[It$D$ tu)t!: tPt1^[ÐSWV[t$|$:PW\t&PWHt 1t 1t^_[ÐUSWV$[q<$ jj$H$DDžtu!A1Ƀ8-ىL$m|$dW艌D$KWP$H$DUD$&hE|$4$l$t$ D$1t$ D$,8hUPV/l$D, jjV$L$H";D$$~UPٖl$|$UPV$LV$HPt$VW$L$L9u`|$D$ǃ;|$.$D$?11P蓛U芛;$ u,D$$^_[]D$ʋ4$t$ l$1蟘USWV$[A<$ jj$H$DdDžtu!1Ƀ8-ىL$m|$dWYD$KWP$H$DD$&h|$4$l$t$ D$1t$ D$,8hUPV-l$D, jjV$L$H;D$$~UP詔l$|$UPV$LV$HPt$VW$L$L9u`|$D$ǃ;|$.$D$?11PcUZ;$ u,D$$^_[]D$ʋ4$t$ l$1oUSWV$[<$ jj$H$DDžtu!1Ƀ8-ىL$m|$dW)D$KWP$H$DD$&h|$4$l$t$ D$1t$ D$,8hUPVf+l$D, jjV$L$H;D$$~UPyl$|$UPV$LV$H6Pt$VW$L$LN9u`|$D$ǃ;|$.$D$?11P3U*;$ u,D$$^_[]D$ʋ4$t$ l$1?USWV[|$l$t+PWUD uu~uڸ^_[]ÐUSWV[Ç|$l$t+PWU uuuڸ^_[]ÐUSWV['|$l$t+PWU uuuڸ^_[]ffffffS[ʺ80t$t$ [ffffUSWV [Í} 6 .$&(,048)fd t$ sUPt$8o tD$    hUPt$o tD$    UPt$n ftL$f UPt$n ftL$f UPt$n 1tL$f UPt$Vn tL$f 9UPt$,n tL$ UPt$n tt$ fUPt$m tL$ ;UPt$m tt$ fD$4pxD$6fD$0bxD$2fD$,fxD$.fD$(oxD$*fD$$txD$& aD$ `|$4L$ qL$%L$)L$-L$1L$ L$5D$ PWt$m tD$ UD$,Pt$l tD$FUD$0Pt$l 1ɃtL$Nt+D$PD$4Pt$l t D$1vF UD$(Pt$l tD$ 1L$ F L$ D$ PD$(Pt$hL$ L$ t$X1D|$ PWYt,Eu勃1DJtW{t$F t$ }L$ L$ l$|$4cD$ f fD$4dxD$6D$50UWt$~k 1tL$ D$51UWt$Uk tL$ D$52UWt$.k tL$ D$53UWt$k tL$ D$54UWt$j tt$ ǃ` WEVǃ WEV4$nt$D$;L$8u<^_[]袆fUSWVP[V|$L$Wك</@t)9v"9vH8/u)t\9v N8/@tvlj 9thUWVƄ+ ^_[]À|$/tÍAffffUSWV[Dl$UtNL(1DJuK4$D$j PU8 }t֋L$9tJ9tE^_[]ËLJ wӍ<(@눉8"u rL$ <$։q1늾=3ffS[:j t$ h[fUSWVP[t$tttnL$VtH|/t|$/uA29r9vzz/u)ρw hUPVƄ+ ^_[]fffffffUS8[AED$D$$D$ D$D$D$PQjm tD$(|$0e[]ffffffSWV[Ȫ dƃttk|$|$uAP1uP1jjP/ t8jPMjWBjW7|W^_[j2fS[D$t=u[t$ P[ËT$D$ÐT$D$ÐT$D$!ÐT$#L$ uT$ ÐT$HÐT$ÐT$@ÐT$D$ ÐT$ L$ uT$D$ÐT$D$L$  ÐT$D$L$  ÐÐD$ffff̀rS[Ð[Ḯ̀rS[p[ḭ̀rS[P[̀ffff̀ffff/̀ffff^̀rS[[̀rS[[Ḥ̀rS[[<̀rS[à[̀rS[À[ḇ̀rS[`[̀rS[@[ḓ̀rS[ [̀rS[[`̀rS[[R̀rS[[2̀rS[à[ḩ̀rS[À[P̀rS[`[ḷ̀rS[@[Ḷ̀rS[ [ḉ̀rS[[̀rS[[Ḛ̀rS[[̀rS[à[Ḩ̀rS[À[1̀rS[`[Ḍ̀rS[@[òrS[ [ìrS[[l̀rS[[t̀rS[[s̀rS[à[r̀rS[À[p̀rS[`[j̀rS[@[m̀rS[ [Z̀rS[[ ̀rS[[S[ʣ[ᐐ*̀r׋L$Q1fffffỲrJ!Q fffffS[jSV[I tF Pjwts 4+ 4  R ^[Ë H jjjhjPjf>1tȉ uj$Pj j褘S[ÊD$ ); t PU}[à QPz=[ÐS[JjPe uPNg[ffffS[ Pt$t$t$ [ÐUSWV8[̡uPt$t$  D$@ D$ P Pt$t$  D$@D$ PܼPt$t$ D$@D$ P諼Pt$t$x D$@D$PzPt$t$G 1D$D$$D$рD$  H:Ã/lj҃ 46  Ѓ Z|$z|$GDA@ut$D$  N:Ã/Ǎ 4  Y ЃW |$ODH@u9|$T$Z|$D$ D$L$:$F|$|$Ѐ  O:Ã/Ǎ 4d z Ѓx D$ D$ |$ODHuMt$D$  N:Ã/Ǎ 4< F ЃD 9L$@t$D$ @ N:Ã/Ǎ 4>  Ѓ L$|$D$  O:Ã/Ǎ 46 ЃL$EgD$ʀD$ l uYЍxɃ 'H0:s{ɍAAЋD$x  'wTH0rL9wGɍAAЋD$x  'w H0r9wɍAЋ|$'v1lÔ^D$D$$WEL$J|$D$ O:Ã/Ǎ 4d KЃID$T$ʀD$  T$uQ qЍxɃ n H0 : ɍA4AЋD$x  n H0T$ 9 ɍAЋ|$ t$D$ N:Ã/Ǎ 4 Ѓ|$Ѐ O:Ã/Ǎ 4  nЃlt$ʀD$  F:Ã/Ǎ  4  cЃ^T$ED$ V蒵D$Pt$V` ID$ VcD$Pt$V1 1ɿUD$ L$Et$1 ЉD$0D$4Nt$ʀЀ wk119º |{ɺ D$ T$ы\$;L$ |ED$0t$4T$JT$ʀЀ vD$0$uP=L$|$$LD$ʀD$ uQ1|$Љt$D$ wпw MAD$ L$EL$ L$QuPt$\$D$lD$р1 L$8H:Ã/lj҃ 4d Ѓ|$O€Հ/\\$ҋ$dډˉL$D$611DFu%u:<:u6ADFtD$\$CЍB|DVG5iЃ15$wΉljt$(D$w 1|$UD$$1ЃH$wMA D$6 L$1Ѓ$w2MA(1ЃH $v)MA1 uAD$ L$ MA u׍1Ѓ$4[1Ѓ$cAD$1ɋU|$D$ BD$ t \ IBD$_MuW_;TuMST$\$ӋDZ@uCu'T$T$T$DZ@ӉT$L$L$DJ@L$DJ@u9ۉً$t0DJ@u&OtDJ@uOSDJ@HL$\$0T$ЋL$DQ@$/9T$BuR€¿ s1ЃBMA A$$hA(|$€´|EFt PVF t\~tM1퐐t(0VF t((VF t( V;~s F @ƋF PyVF,t PiVF4tPTVF8t PDVV;V^_[]fffSWV[8{t$hW  PVLW^_[ÐSV[zhV  PLV^[ÐSWV[øzhW   PQLWt^_[fffffUSWV[gzl$Uu\Ut$]1tmNjt$l$Ut$b]DžtqV7衚t^oEtЃVPyt Eu릉l$}uEtPME^_[]É1ffSWV[Øyt$hWqD PV[WX^_[ÐSV[YyhV6D P\V^[ÐSWV[yhWD H PQ/\W^_[fffffUSWV$Xxt$8T$D$ 1ۀ0T$u,N 3i=)Njtt+~%L$9N$ut1Ƀ|$tΉx uj(-ƉDl$Ultwn$Nj 0Qx 1 utjh=7ʼnt 0ƃ LltMjуx @1t*n$FeUQj PA|$z^_[]Ëx )USWV[gb| |$i)Njtt+~%L$9N$ut1Ƀ|$tΉ uj(i,ƉDl$Ultwn$Nj 0Q\w 1 utjh6ʼn| 0ƃ LltMjу @1t*n$FeUQj Pѹ|$z^_[]Ë )USWVP[`l$U蘀Nj $tOs;1҉v ljh=5 $uƃ D1҉鐐1QqQuՉׅt!1<19u/>3i=)Nj$,tu~EPt$lt0x tuR:lt!jуx tiE$Sx uj()ŋ$,tIEj |$WPu WltE@E$L$1E^_[]t$lt@ϐUSWVP[_l$U~Nj $tOs;1҉v ljh3 $uƃ D1҉鐐1QqQuՉׅt!1<19ui)Nj$,tu~EPt$|~t0 tuR:lt!jу tiE$S uj( (ŋ$,tIEj |$WPs WltE@E$L$1E^_[]t$lt@ϐUSWV[]t$|$ ltЋt t61=tDtP7ǃt D$L$ƃ  t?1=tDtPS7ǃ D$L$ƃ ǃx lllD$ l1^_[]ÐUSWV[\t$|$ ltЋ| t61tDtP6ǃ| D$L$ƃ  t?1tDtPC6ǃ D$L$ƃ ǃ lllD$ l1^_[]ffffffUSWV [Zu EMD$$L$ D$fD$w6Ef ffT$RQP͟ Hz6fD$QjP袟 t1f|$t |$49u e^_[]?z#fffUSWV[Z$tA$1uhb$ƅtcD$E/$tt$$9ux/Ĕ^_[]w?$9u/ww>w?USWV[WWt$tD$tdPVxaa1ɐ΍,?UQ,t&UPy.ww8"tV1 v1^_[]ffffUSWV[÷Vt$V^v P! ƃ  tj~V:u^tVtDi@u\uRDQ@u말:u~u' t P0ǃ ǃ 1u ^_[]ÐUSWVT$t$L$~ 9tS1tT:u>8ut}Y8uuuȀ@t:utȀ:u 1y@t^_[]ÐSP[ UL$ jt$jt$ [ÐUSWVP[T$p<$L T$8L$4|$ $h$dʼn\$u tu$l|$th8|$t:|9v,t:t|u싌$lhs$ $L$1xjjjUf|$`PQhl$XU)jjjh@U|jh@6, D$1l$t$(1ɍD$L1Ë$L$AD$$Љ|$L9rB19r0T$\$hWt$耗 ƅ4LT$< u|$tT$$$1t$#tT$$l$t ߍX8؉t*s:j|a;$v<t:t|u싌$l덋$$$L$t1<9< t+< t'#<:t <\ut111;T$l$ \$$L$T$$L$)\$QP9'T$)ʼnl$‰$L$\$$l$ '|$t t$t$(D$l$tEFH4$+DD$\$t$(l$L$T$l$pL$T$D$$1L$,$t$(l$D$֊<:u>tuk{D$؊6U8u Xuuu@=uUt @hƀ:t FuFT$L\$t$$Ut$t$4-\$,L$Lt&]u%F:D$L$,()D$ tD$)T$ D$t:u)ʀ| :D$@t:\$L$ ыD$)9L$ |KT$<,$D$)\$D$PU$))\$)D$Ɖ$T$<*)׉ڋ\$QVP> Wt$DU0 t$ t$t$,)/D$L$, \$D$T$l$1ҋ4$t PSЋT$ЋL$89T$v6)RV6$|$ u(Vl)n|$ |$ L$41Wn04$))En0j PCt$P L$<$ 14$($lD$,Pm|$,\$D$0jD$HPWUU t t"t$D<u/t$,D$HȾ\$UU|$ <D$\$V mD$xWt_WVP[ UUxx1ɊD$D$8T$D$48B\$W' |$t${UUl |$ ;$LutP^_[]l0WVƃ|$\$t t$"4$c'\$UT'|$t\$t$\$t$,-'jw$X+LL$lÐSWVL$T$ȉ֊t~8t1t0:t+|t&9vt:t |u^_[ÐSWV[ØK|$t$ tP qǃ ǃ ƃ ƃ WV]^_[ÐS[:K tPpǃ ǃ ƃ ƃ 1[ÐUSWV[J$,8utމ}Z8uÃu뺀@#uZ@tỳ0uB 8/>9v$uPU FN8D} .~ wF F P9uWv t atŃ~?:}|@uH)ƒVԍ+ZF F BBQWPT uvv ?~?:uF:~t j` ]`8u S`F,;8u e^_[]^S[ @80t$t$ [ffUSWV [?} L$%D$"T$ ;UwRPuQ 1ɋt$;D$(u ȍe^_[]S[ú<jP YLh P5" [SV[y< hVt$t$t$%t1^[fffSV0[6<t$DD$@t2D$D$ D$HL$ $@D$1L$VN븉l$WPD11!$P]DNQV9l$VN`D$ $!VML$WL%T$9F|$L1 󫋼$$WL$PQT$ RPt$ #tt! $u*G $~oQ $u D$uD$D$D$ D$~3D$HD$D$0D$VL|$WN$T$9jFT$L1 󫋼$$WRl$,UPt$ "tt(QD$#D$$D$~kUD$1WP"tWD$0"$uD$D$$D$ D$D$0D$~D$HD$WPA$D$D$,|$L$9sȐVP9rG$)X $u0u8L$$QPx6 D$D$T$ -L$$QP4 D$8u|$|$0$D$D$,D$W0"9D$l$T$jFT$L1 󫋼$$WRl$,UPt$, tl$t%)D$ D$$D$l$~UBD$1WP"$uD$D$$D$ D$~VIWP?)ЉFL$$QP/ D$" T$ t 9l$D$D$,q|$cD$T$ u^?|$#L$,|$$L$0 VP]rD$T$ |$ GL$(D$<$Hʀ߀X$uD$VQ $uD$fxWt$,jU:D$eWt$,jUW7 $u&@u(u-uu||$|$ |$fD$,T$ L$ )L$L$ m|$[|$$:|$<VP7rL$׋T$ c|$Q||$|$ D$T$ D$D$8׋T$ fD$9I^׋T$ L$Q׋T$ @݉T$ @L$D$,N @1|$8 D$,D$D;$u6D$,^_[]Í$9v׍HL$@VPs fffffffUSWV[ä|$l$ d8utjU}0u LJE T$uGEt-Ud/E EE}0T$fE ʉ $7to9h};8%fE EMtY9vU8PuPEEi@9tgWVHƉ|$UPW2 l$ E00L$HcMM@(@ )@$|@({@,}@0]@4\@8$@|$T$L$ Yl$L$T$ jWPjU1xL$ȋ;L$u^_[]USWV[Ç |$t$t V.-1 YL$1jUWPV ^_[]ÐUSWV[7 |$ t$t V,1 YL$T$jUWPV^_[]ÐUSWV[ |$t$t W,1 Y1jUt$$PWy^_[]ÐS[Ú  YL$1jPt$t$t$C[ÐS[Z  YL$T$ jPt$ t$ t$ [ÐS[  YL$T$ t$Pt$ t$ t$ [ÐSWV[ |$t$W uGكs^_[!t_t$t%<FF ^_[ÐUSWV[W |$ u ^_[]l$ t$W t t- t(W tWPu뵃!}/=<HFHF ^_[]Ã=t̃~~ŐUSWV[ä |$0t$,Wt$@[D$4$D$8%D$D$ 8D$1>\0G0G0W <$r1Ҹ¸ t1 ՋT$ ‰#L$T$ #T$0 ʉuu#D$0#T$ u‹D$4tvT<$|$Dփ 6D$4)D$4@u \҉L$x MVat^uG?-@w<$L$$\@0|$0 @0@ 0$D$4@RΉ$\@a$\@b$\@t$\@nw$\@ve$\@fS$\@rA$\@s/DPg%0W$\P$D$4@uWu#DxuGws>4$$^_[]ËD$4  !rfUS [aE$D$D$D$PQLD$e[]fffffS[t$ t$ [ÐUSWV[$$%= uRl$g4$"ƅtV(O)1q1G3v$>~ fffFHIF fFHfFLGNQI(| /u/V,nTȃRUP 7USWV[Ü1A(֋Mȅyh@u 1=t}L$QD$Pt?D$3F4L$3N0 u"D$ 3F1fFH%F D$D$D$0t$T$j6,t5D$"D$<u G OJD$,L$T$T$D$,D$D$D$1D$HGW(|/uL$V7 }t!v$:v$:v$VW.5^_[]fffS [wPQt$ t$ I ,$ [ÐS [7t$Pt$ t$ ,$ [ÐS[ L$T$ P[ÐUSWV ׉[T$4 tbn=t= T$4t=uD T$41L$L$L$L$ D$l$ L$RPQUWV=uD"كTw"# $T$сK1 $  ȉD$D$ ^_[]ÐS[úL$T$ t$[ffffff̀rS[À[̀rS[`[ ̀rS[@[L$D$9tt P9u1fffffffS[t$ t$ v [ÐS[t$ t$ V [ÐS[úL$T$ Pt$ [ÐUSWV,T$[~l$DD$@L$D$\$t?D$@|$"v/Z 1t$\$UP \$u+t-tD$D$@tN1D$D$@u90u4 @$fVD$D$FufFFtN ȃ ^_[]FfFufffff̀rS[ð[USWVT[ÔL$pw| l$l1n |$h D$ʼnD$4\$P贫;D$,D$-؃D$ TJL$#l$ T$p $|$h&l$ щΉ $9wՐD$ ŋ|$ht$9v<\$VWT$|\$D$ ~L$p|$t51ҐD L9u֍*|$p)׃|$rσ|$r1Ґ ,, LllLLllLLllL9u4 D$(l$ ؃JL$$D$ l$t$T$pl$ $t$щʉ $9wՐD$ ƋT$;T$vՍ<\$RWT$|\$D$ ~L$p|$t51ҐL D9uՍ|$p)׃|$$rσ|$$r1Ґ l,LLllLLllLLllL9u2t$4l$,.MD$4t$, D$ L$8|$h\$PWT$||$ ?\$(ىL$0D$L$pID$u$jUTƅtF PVW u$*jU!t@ PVW 18t u $tD$ 81^_[]fff̀rS[P[ḃ̀rS[0[SWV [|$D$ D$D$$0L$jjPWjQ81u9 u 01 ^_[fffffUSWV[Ô|$ $D$l$$t$L$T$(PVUWt$<t9tM $)?T 2"1^_[]USWV[|$ t$$D$l$$D$T$(t$0PUWt$ $@ D$~ D$DD$D$\$(t$D$q P$j Vx$9jS9uBD$\$t1^_[WV9dtGPVgtۍGPVdtʍG PVdtWVcVZ*D$ L$qtu0qwY4^ËQ tu*I IH^QPI;@P^@p^^ QPI H^ ^ ^ ^S\$D$ ËT$ D$9s5Wd$\$ L$)ыD$)s\$L$؉_[)W d$\$ L$)ыD$)s\$L$؉_[ËD$ L$1ËD$[1ffìrS[à[v̀rS[À[VWST$L$1t8uЄt`B͉ ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUSWVL$D$utdT$pא?t 8uلt&~Ր}8t ut 1119^_[]1fUSWV4[Q$L< $0=v;$0d 4^_[]Ë$HnwЈl$$Tl$ɋLl$1 r$Xt$\t $X1$Pf$TWՃiriQVP ,$$XtY$\tOFl$0PQjUU$\9ȋ$QU$`蝩 FfN QPR$`U$`^1Ʌ9$Fx$P$T)PURQ*;$T$: 2$Xt$\t $XNu~u ~F<T<O~D L QPR$`$`gl$ 9+t$`D$胼$X$Hl$胼$\x~$`D$dD$`D$\D$XD$TD$PD$LD$HD$DD$@D$<D$8D$4D$0$`p~$PEDL$ YPQ|$W$`Ut;$Tg$P$T)D$D LP|$Wt$L$QRL$)D$D Pt$t$t$RL$)D$D Pt$t$t$RPL$)D$D Pt$t$t$RL$r)D$hD Pt$t$t$RL$9)D$/DPt$t$t$RL$)D$DPt$t$t$Wp19D$F$PED$1$1 YD$ LD$D$׋D$ tD$ $ 1QPt$t$UH)D$>Ń19t$un 1f$PL$$T)fv fD$ VQURt$pL$ ;$T$ T$0L$RQPWst(8WT$\9vpD$0P_;fǍ$0PQhWW $\9v QW$`迣 %1QW$`襣 D$0P(_Fl$<tZ<$Nɉρ$`tǁwׁrD$$$Pl$KF M u)L$ QPtP芩Ņ$y+8ET$ PQhR2=$w*;$(v.L$ UQP艝 $$1%D$1;$ u ^_[]taffUSWV[!$8<$E UPZE 1Ҩk4$$4$0$,uRUW-VUGXt9~uۋ$0tPv u*ft#Q&$4ƃ1ҁD$D$ƉffD$D$hVQPrt$D$L$ T$PQVRug9t$D$ ff9|$$0$4t*G9D$D$u_GRQP uEt$WVUZ24$1E u U>V;$uЁ^_[]1ҋ4$E t_fffffff̀rS[ [USWVP[P\xT$1tJT$ t4i t}um9ujqt$$VF 1$11P`a蘦8^_[]ffffffSWV[h|$jWeG=tjWX^_[fffffffXL$r\ÐSWV[t$V`tF~tP`^_[ÐUSWV[Ñ$<$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$ $D$8D$4D$0D$,D$(D$$D$ D$$\$$b$xuxuxu x$ $\$P U$1t2\$W^tGotP^܋\$$$0$;$ЁĨ^_[]$k$@$QC$FD$8FD$4FD$0FD$,F D$(NL$$vt$ T$t9t5T$ t tu#u u$ D$ D$D$\$$PWti$t$tf1ۺD$11 ߉D$ŋ6t>N tFtI1л t̉1$1D$\$ \$t$\D$ L$8L$hL$4L$dL$0L$`L$,L$\L$(L$XL$$L$TL$T$ T$PL$LuD$ $L$$Pj$rD$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$D$LL$PL$ D$\$D$8D$hD$4D$dD$0D$`D$,D$\D$(D$XD$$D$TD$L$ L$PD$L$\$ N3D$hD$8D$dD$4D$`D$0D$\D$,D$XD$(D$TD$$T$P1T$ T$LT$ t1#D$! ttD$ 9tFtll$$V9t$(\$[$9މuL$ ȅt$utT$$ۋ\$$u <$t$T$(oL$$$PjL$ 1T$FM@t$Fu \$ =<$3\$ t$iEjjPfY x P8wL$$\$$PjND$ 1ҋL$T$uxl$\$j%$U'kD$URXL$)L$D$H$PUl$U$4$\$t$HX$yL$ugl$D$$u&JB$L$$\$$PRUJBD$L$Qs9 0n$l$t$WM\$t$(^_[]ÐUSWV\[`D$PD$x8hD$8D$4D$0D$,D$(D$$D$ D$El$ |$uHt$WT$RT$RPWQVt,t$D$t$D$EML$@ML$XML$TML$PML$LM L$HML$DD$Ut$Ph$gWOT$$pJ{8S9=1t$p|$tu0D$.$p|$!L$, !uD$1B ‹/tу9 D$D$;t$(4$zǃ=r8t/$|8.u%$WhWPVs?Ƅ3& .3 D$ $%1օҋ $4;t$(l$4D$@D$ D$D$D$0D$dD$ 1l$ T$$!)D$Pl$UVt$4Q|.ƋD$,fxxt$ T$<.PH2fD$.P42fD$.P 2 f|$fD$f|$"D$< $$!t$hUVt$4Q-D$D$,fxxUT$<UsƋD$9L$L$PUl$Uoi 1l$4։t$1t$ $T$ul$;l$(gt$uQT$$%T$uD$ftAft;t$t$`D$9ft$tf!fl$ Ut$8V~#hj$Pf DŽ$DŽ$DŽ$DŽ$4UVP$Pj%bUFfwhj$P5f DŽ$DŽ$DŽ$DŽ$jI$%>ID$V1IPt$Ut$LQ$Pj%TT$8L$D$D$1t$ 3D$fuf|$tD$D$1f $T$D$Df|$8D$D$1V/fD$EP.fD$EP.fD$h$!Pl$ Ut$4V*ƋD$,fx$!xUR+Up=hPL$L$l$L$L$t$hRQD$ 9fD$T$ l$<L$L$0t9 ~1 1t$ T$0f|$u 8u|$<tƃu11L$ T$0T$99u|$< t$l$9~Umo4(l$4$%JL$HJL$`JL$\JL$XJL$TJ L$PJL$LD$Df|$tD$ D$HtD$ jP#ŅE ET$U UL$\ML$TML$HML$DML$LML$PM L$XML$`MEU1L$ MM!f|$tЍ$Qt$Pb 1l$ ML$ t T$ ՋRul$ ȋL$L$|$ xxt$1ҋl$UL$)z $T$0Vu y@ T$ D$$@@DŽ$DŽ$DŽ$DŽ$͍A$DŽ$DŽ$$$$DŽ$DŽ$$$%jt$0OtXL$ A"NfFt1f΋Qt֋L$ tѐt$ t$ U'L$t $D$@T$4tC$~|$$u$%ttPx&F=*$!Aff*01|$$;$%u#%^_[]Q')Z$9WVD$ _-ˆŀ߀ſňƀЀ .t<.ttǃ.uu1^_ÐUSWVT[ÒKD$4D$8D$<D$@D$DD$HD$LD$PD$D$4kT$$j Q7tǃt$U5|$L$ t tt,Džtt$PuϋND$FD$0FD$,FD$(FD$$F D$ FD$L$D$D$ PD$PjU|$t"D$ $L$k|$ tމ mt)Ett$#Eސt$xu뎃|$t D$PT^_[]1USWV Չ[ÐIL$8<D$T$4t$@j1҅Ft 1Ƀt ut$<$΋ D$ PUl1!PU|D$@6<$t 9t$Aƃ jP+{ǃ GO ɉOt$NONOVWNON O NONOGMOL$OO!E uL$QPZ\ T$4t$@jVs1;L$ QUP 1D$@6<$t 9t$Aƃ jP;ǃ GO ɉOt$NONOVWNON O NONOGMOL$OO!E uL$QPj[ T$4t$@jftLtt$<!GtI@u!tt$< Gt&@uD$881ҋ<$;D$uEЃ ^_[]ýW!tGwtP}!܋<$USWV([qF$H<$$E UPM 1$<UP4$!U*m$DUtڋ$D0W[ft4$DptPW9ftu뗐$@tP$Hp fj$DWeH1$@T$t.$@dT$D$1L$D$=wu4$T$$L$%D$&hRWP։L$!4&t$$DPX D$L$T$ t$$QRPVu$t?14$E t 4$1E u U>;$$(^_[]ËL$D$T$D$9Ћ4$rD$ D$ Pt/9uD$ Q$DPT$T$ xD$9i֋T$ ЉD$L$AD$։;T$-2"2;D$9uҍBt$WPT$芑T$L$ ut$t$$LUvffffD$@@#Eg@@ܺ@ vT2ÐUSWV[Cl$$|$G? OW@)19w_WT$Vt$$PL$ V T$]$19s'D$ 0L$>@9r|$1T$ )URPV^_[]ÐUSWV)YyL$Tq 1 LXu!؉!l$HȋL$XL$<xjى!T$\T$ ‰!V ʉ!؉\$Dl$`l$4t$P4/Ɖ!Ɓp $։!ȋl$dl$|$L<+lj!ν!׋l$hl$0!|!l$ll$$!*ƇG ʉ!Njl$pl$(!F0׉!΋l$tl$!F!֋\$x\$8!ؘi!l$|l$,!¯D ʉ!Ƌ$l$!Ʊ[։!ϋ$$!ǁǾ\!Ћ$\$!,"k!$L$ ‰!“q Љ!$\$Ή!΁ƎCy։ы\$ \$@!͋$\$!!I!D$@!ǁb%!T$(߉!@@ !؋L$<!4$ƁQZ^&։!\$$!ǁǪǶ!ЋL$!]/!\$!ƁSD ։!L$0!ǁǁ!Ћ\$,!!L$!Ɓ!։!\$!ǁ7 !Ћl$8 *!‡ !\$ !ƁZE։!L$4!ǁ!Ћ\$! !L$!Ɓog։!\$$!ǁNJL*11ˁB91q ډ114$Ɓ"am։11|$ǁ 811\$ ,D꾤11T$0©K 11t$Ɓ`K։11|$ǁp11l$ Ł~(11L$<ʍ' 11t$Ɓƅ0މ11|$(ǁ11l$,(911\$Á Ӊ11t$,0|݉11|$448eVD$ 1<D")\$ 1(—*C L$$ 1#Ћ\$ 1׍49Ƌ|$ 1ځY[e\$ 1 ЋL$  1ށ}Ƌ|$8 1ʁ]L$ 1O~oЋ|$( 1, t$  1Cʋ|$0 1ƁơN֋$ 1э9~S|$4 1 5: \$, 1ƍ>»*ʉ 1ށƑӆD$H|$TD$DGT$LWL$PO Ę^_[]ÐUSWV [ô:|$$<D$O $GD$?17l$ )ȃ84PQWH jPW: EGEGEGEGEGEGEGEGEG E G E G E G E G E GEGEjXjWM ;D$u ^_[]fffSP[9Pt$1Ƀ $ȃ[ÐUSWV$Y9t$8K $4K8D$T$ 1FfffffffUSWV0[*|$jjWjjVEt$jjWPjVD$\$l$1$D$ 119ozuB<tR<uBtՉ t z $D$ D$ 4(ftf9z}B |$t$r t>t 1 tmt t.t |$ ި \$t>t l$ l$|$$xt$\$l$t t$ t$v$1D$ T$Dt$ $u U<VWjPR< |$t$$|$ 1ɉt$!1ɐƋD$9~uF<<uFtF D$D$FD$,PQ|$W < Pt$l$U; t l$ /D$$<F\$hPW; |$ l$(D$D$ l$L$ff9NF L$\$L$(KL$,KCNKn tUt 1 tt F t_MAtÉ\$D$P$t\$|$WUR:T$ \$WjRF:T$ |$L$F t\l$Et Njl$U \$Wt$T$RG: E xu D$L$ H$l$L$~ xl$>Et Njl$U\$WQRT$ 9T$ L$E ED$\$l$PU1t$UrD$L$$9sD$DQP1ɉȃ0^_[]D$D\$S[*%t$[ffUSWV|[%j$i1tGljPW:#t)l$XD$\|+WYjD WCj1|^_[]jjWjjUj#Wjt҃D$ l$<$D$ƅuUW_뚐USWV [$$|$$(rl$ NBCD3EB 3M t D1 ^_[]Ë|$,jL$<Et$81^_[]SV[ét$ tv vvЃ Vp^[fffffffUSWVXd$|$(\$$t$ D$y7 \y7y7D$PX) 1ȍ<)1׍48) 1ލ7)Љ 1)lj1<)148)1э)Љ 1)NjD$1 u|$(t$ 1y7y7D$PX) 1ȍ4)1֍0)Ӊ 1ڍ<) 1Ǎ:)Ɖ14)1֍ 0)ω1)Љ 1)ƋD$1 u|$(t$ y7 r3t t uF F FÉPw/$FFFF‰y7y7 rƋ$#FVjrQƋ$#FPwH<$FFF|$(tƋ$#) 1ȍ )ʉ1э)Ӊ 1ڍ4) 1ƍ2)1ȍ )ʉ1э)։14) 1ƍ2)w1Ήw^_[]ffffffS[*j jt$ [ÐUSWV|[$$$T$LT$L$$Dal$L D$0``D$4 󥋼$D$0 =`l$TD$XD$DD$ZD$@D$\D$<D$^D$8`t1 l$HL$4,`otXǁ t>Q 9quJ :$D$D$4$uWt$YD$<$L$HL$D$ l$D$$$ku$`$ttl$$;G%`t %)l$ $D$D$pt$L D$0^t"l$ $D$D$0t$L D$0v^t"l$ $D$D$t$L D$06^t"l$ $D$D$t$L D$0]t"l$ $D$D$pt$L D$0]t"l$ $D$D$0t$L D$0v]t"l$ "$D$D$t$L D$06]t"l$ &$D$D$t$L D$0\$t"l$ *$D$D$i`t,l|$4tpL$DL$ D$.D$,$t`rkƁ Ot yI uYD$4$D$L$@L$ D$7l$$$.rykƁ Ot yI uYD$4$D$EL$6.&^_[ÐSWV[|$ZƁYjVW[ yWPV ^_[ÐUSWV4[Ä$<D$0D$IuD$HL$j.QPjT$PQj.jR^$tEL$PQVR D.0;D$0u 4^_[]3USWV([t$L$-uAD$QD$ +tD$ +u AD$Qx<$D$Dxu1<$21<$L$QBWu.\$u:Y\$QWtMY\$yQDUu L$! Y\$yT$Q<$L$kdl$ Gf@u/9s+ؐD$ $ QXf@u9rD$ 9ft79s3ߐ|$$ P9_@t9r߈D$D$<$ŀl$ D$|$t 1u1)D$1ɍ ҍ JSWukdl$.u;SWu,SWu  ҃1ҍщ t Qo;s1w |  ȉD$<$݉\$ W9@u9r{@tE9l$s&\$$ P9{@t9r߃t1u+1ɀ.tKl$uL$T$|$ t$@1ɋ$ ҍ JWSukd.u>W$Su,WSu  ҃1ҍщ t Qk;s1s |  ȉD$|$$ P9@u9rߍo@tM9\$s3|$$ P9o@t9r߃t1u"1ɋ4$F\$uL$|$ t$@1ɋ4$ ҍ JUVukd.u;UVu,UVu  ҃1ҋL$щ t Q~;s1v |  ȉl$L$|$ t$@\$^\$^FFFnNFF v V F F nN(^_[]ÐUSWVX1D$8D_L$u D$(1ˍA^D_uk*… )хt 1Ҁ|0.щ^_[]ÐUSWV[}LƁ<$D$P lHHPP0ppp RQWV e^_[]ÐUSWVP[vl$nBPUHPUH@PUHt8PUHFPU~HMPUfH PUNHujPUTA 1uRMDHt?j PU~ 8u$8 L$A. &$0<HL$0t9^_[]ÐUSWVP[l$hPU9GtxF u6jPU7@ 1u[MDHtHj PU} h8u $8 6D$t8^_[]fffffffSWV[|$t$jWGHO~;G~ t H WRRjW^_[ÐSWV[ØT$L$Bpr~ ;B~ t 2~: RQxR^_[ÐSWV[E|$(D$$u|$PD$D$D$D$ jWG0u ǀD$PWjW^_[ffSWV[ølGHt Jt @t A?t/t5Gt9E4'P$ +Pu0 E0M0)u40E HM @PWjdj$+Pu>9E4'P$ +Pu0 E0M0)u40E E PE PWjdj$+P>9E4+'P$ +Pu0g E0)u4M00M AE 9RL$Pt$ jdj$+P=9E4&ƃP$ +Pu0 E0M0)u40E E uEE ;D$ }0L$\$$E0 E0E4HM0@E ;D$ T$ E4PW'1&E E ;D$ sɃ}4w\$D&}4u0E WVu,P &%}4%E0 E0HM0E4@MU \$WVu,E P}}$u E PQjdj$+W:<9E4O%PWu0 E0M0)u400 M t$ )΍VUUUЃ=T$XPRVQ@0}4\$$ʋE0f (E0E4HM0@D$E HM 8HM @D$QE t$T$t$Pjdj$+P;9E4-$Ƌ\$P$ +Pu0e\$ E0)u4M00twE RL$\$Pt$ jdj$+P:\$9E4#Ƌ\$P$ +Pu0\$ E0M0)u40E E uE4w#t$M0fA  QU0E4A|$XVWt$u .F9E4\$##VWu0h E0)u4M00L$M M E4;L$ s]}0u \$"M0fA  QU0E4AMU E4PWu,V""E4L$ 9M r\$"}$ u4u0u jP}$w u 薽E PQjdj$+W99E4("PWu0k E0M0)u40}4u0E MU }$ E 5PQjdj$+W89E4!PWu0 E0M0)u40E  E ֍;T$  D$dD$`D$\D$X)XVPQT$ D$Xu4u0Pj}0Wlj}0)E4u u |$C;D$ \$ }4 E0 E0HM0E4@ E4u0} PVu,W  }4 E0 E0HM0E4@E E \$P誻M ȃE P蓻E E u0P~YPQV E M E4u0T$ PV!  E CKsuPjdj$+W6v }$ u4u0u j脗u0VƉu0)E4E HM @PQjdj$+WW69E4lPWu0 E0M0)u40E E ;D$ M11 }$< u4u0u ju0VƉu0)E4I \$u +E E \$PM QU IT$/|$0\$QPVRj(jW5\$ 9E4PWu0 E0M0)u40M t$ )΍VUUUЃ= E48M0ArintAto pA ong Aoo lArd trecoM0E4I }4u0E WVu,P#}4E0 E0HM0E4@MU \$WVu,E P}4E0@ f (E0HM0E4@E L$ )p\$P衸E M4;U0B  ru0M4B\$ePQjdj$+P39E4Ƌ\$P$ +Pu01 E0 0M0)u40}4E0D$nr3)M0 M0E4QU0A_}4sڋ\$E4u0} PVu,WgM ;L$  \$AE AE IL$1$+E ;|$8t1ɉT$|$਀t^L$ P3qPQjdjV29E4PWu0 E0M0)u40T$|$L$lE 8D$E ;D$  |$XWu u$u, E4u0} PVu,Wy:E L$ )o |$ 1ҋ\$qL$$+р਀tJR$Pt$ jdjV19E4PQu0 E0M0)u409T$ ыE \$냃}$\$u 褵E E \$P苵E L$|$X\$PVQj2jW1\$9E4PWu0V E0)u4M00M u4}0T$ VW~\$E }4E0 E0E4HM0@M T$ VW7\$E }4vE0 E0E4HM0@M T$ VWQ\$TE }4/E0 E0HM0E4@E MU VWu,Pz}$E PWjdj$+P/9E4P$ +Pu0  E0M0)u40E HM @PWjdj$+Pg/9E4|P$ +Pu0 E0M0)u40E E ;D$ L$RL$\$Pt$ jdj$+W.9E4 PWu0N E0M0)u40E E ;D$ r(E4u0} PVu,W}4E0 E0HM0E4@\$u ڲE PϓPWjdj$+PA.9E4VP$ +Pu0 E0M0)u40u vE PIPWjdj$+P-9E4P$ +Pu04 E0M0)u40u E E PE E PޱE PWVQjdj$ +PY-m|$XWu WK9E4PPWu0 E0M0)u40|}$9u XE E PCE E P.E T$XPWVQj2jR,9E4PWu0 E0M0)u40E4u0} MU PVu,W}$E H}$rb\$]T$XPRVQ x?D$ }4\$E0f (E0E4HM0@ \$D$ +E }$t YVQPRjdj$ +W+9E4PWu0 E0)u4M00t$ 9u (D$(6D$t$(jdjW0+M )Ήt$|D$<+t$~;D$ƃ\$T$t$PRWo |$}\$5\$-E 8\$Pt$V8\$ ƃ9|$u؍$+)9u4VPu0 E0)u4 0M00\$}4mE0)E0HM0E4@}4E0.sAD$.)M0 M0E4QU0A~*}4sf E0HM0E4@ߋ\$Pjdj$+P)4+D$$D$} \$D$1҃|$|tL$ L$D$$4+1 D9T$t> ..x\$DK.ẗ$Lx̋D$DH.t뻋\$/֋\$L$ t xL$DA.t.$+)9u4VWu0' E0 0M0)u40D$E E t$ 9PM0+L$NjE ;D$ HM  ɃtڄyL$u2E4e׋M0A  QU0E4A D$5T$RPjdjV(9E4PWu0Z E0)u4M00D$T$L$Z*D$D$D$L$L$ \$t$\$9E4Pt$ u0 E0)u4M00D$ ƃ0|09u4\$^|$W$ +rz4w|$7W$ +r|$7W$ +rz4|$7W$+Rt$W$+2|$7W$+2z4|$7W$ +r|$7W$ +Rt$W$ +DŽ$ +====2|$7W$+2z4|$7W$ +r|$7W$ +rz t$>W$ +Rt$VW$ +Ƅ$+=fDŽ$ +==2|$7W$+2z4|$7W$ +r|$7W$ +rz t$>W$ +rz4w|$7W$ +r|$7W$ +Rt$W$+Ƅ$+=U4{ u0$+$ +^>~}0U4FU MU FD$D$D$D$D$ \$t$9E4 Pt$ u0@ E0)u4M00D$ ƃ0|09u4\$|$E M4U0B  ru0M4B\$QVP2 u0Ɖu0}4)lj}4>r3)E0 E0E4PU0@+}4sڋ\$}4u0H;T$ \$BE D$BE JL$d$D$T$E D$щT$;T$L$t1਀t\D$T$PqPQjdj$+Wy9E4PWu0 E0M0)u40T$dE L$D$E ;D$ \$u4u0Pj|u0V )E4u0E X\$u4u0Pj|u0V)E4u0E )E4u0} MU \$PVu,WM ;L$ t$ )΍VUUUЃ=rE4\$8kT$X\$PRVQD$c|$|/}4\$6E0f (E0E4HM0@|$[D$D$D$D$D$ \$t$9E4Pt$ u0 E0)u4M00D$ ƃ0|09u4\$|$raT$$\H @>rET$$H @>rT$$"H @+<$+D$$L$D$ ^_[]fffffffYKT$4D$#шsьsÐUSWV[|$ l$t$~Jt$~2UVx(ƃ|$tލF9wȉ9v(+t$^_[]ÐUSWVP[Æ|$ D$l$(/W~bMffO~QMffO ~@ufw |.MffO |ՋT$RffWl$ }(^_[]E ffGftC,$RWגxǃ9w,$)xD$ hHGftf,$RW腒f 8 9Xσ95,$)5|$ oGwtc,$RW 8 9σ9,$)|$ oGwtc,$RW衑 8 9tσ9Q,$)Q|$ o G 9,G$G(G,1 USWV [|$$s~t$(l$ 9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$M,)E$L$~jl$. ^_[]Ð~34$UOx(ŃtߍE;$wMȉ;,$v (+l$xD$ h,h,L$H(ht$0Quus]}m,(T$Q,($|$9<(T$*fD$,fy,zffNj$A,|$$tV}L$9w;}ϋL$,$zx,}f BE,;T$v5 (LJfLJ LJT$$L$,U,T$$E(HM(LU 19Q׃U$1tL1E(M,'USWV[t|$(s~t$,l$$9}$u tyf}$DE(E,uu(xID} 9}@E(9}}$DE(E,1t$ M,)E$L$~jl$.^_[]Ð~34$U迍x(ŃtߍE;$wMȉ;,$v (+l$xD$$h,h,L$ H(ŋT$0PhRQuu苛U}m,(T$ Q,($|$9<(T$ *͋D$0|$y,zωNj$A,|$(t_D$xD$9w@L$yϋL$0 $z},|$ωBE,9v0}(LJ LJLJ L$0U,T$(E(HM(LU 19C׃U$1tL1E(M,fffffffUSWVXԱT$4|$0$0}V xn^c|$8XD$4D$~D$D$‰<wsBքu1L$ˋ|$?|$ $LOL$t)L$0<$\{<$|$ LOL$L$D$<$1$ r $L$t|0?TWT$T$ Dzt]$؉ÍF$и rT$ӋD$T$<$t%D$ЉT$;T$8D$^_[]ÉUSWV[|$t$$ u f0x<$|$Vt$~p$ƃ|$ 19tG,00r7 $ r7jB؃u;$}B.뵉ED$^_[]fX;E ÐS[E ht$ P [ffffÐ1ÐX˪F ffffffUSWVX[äl$l<$D$TD$T$ų D$T$E.‰׋t$tD$p1ҁ: rYMn`L$"jWRPj2jQŃ9D$"PD$tPD$pD$)D$iǓ$))ŅtUT$ `T$"jDPQj2jRCǃ9WD$"Pt$ t$Vt$t$)T$ D$@L$)L$tOT$ `|$"jHQPj2jWH9W|$WD$D$lj|$)ƋT$ D$kD$p txҋ9|Wy>TWPڋD$+D$pyffffUSWV[Çl$U6ƃ;D$vs(`|$UW[1tADt!|.u#r|\ur |\t 1f.^_[]ÐUSWV[$<$$hWP! x3l$hU$( xUW1Ʌ;$u ȁ^_[]~ffSVP[HL$t$D$T$ $xRQVPx9raRQP) ^[USWV[|$t$l$tt$$PW+&t^_[]VWh!t W LJWVU ͐USWV[w|$t$l$tt$$PW%tO^_[]VW t W LJWVUF ͐SWV[t$|$jW1Ƀ PVW ^_[ÐUSWV[÷|$tt$O#PW$t0l$VW/ t WRLJWVUM ^_[]ÐSWV[8t$t5|$r#u#jV#tjV$F1^_[S[ڣD$tL$ ttu H1[[ÐSWV[Èt$t_|$G?wSL>1RjV"t3jVU# tۃtjV"t jV/#%^_[ÐSWV[t$tAjVq"t2|$jV"wsf~ 1^_[ffS[ÊL$T$ P[ÐUSWVT$0L$@[DuD$\V*D$ Pǃ \$D$t6"=== uD$`1D$DD$DD$`1D$$D$@x OPr* t+t-D$4D$4|$,0G x\$0$($$$ $D$D$D$\$$|$,Vt$8PQRW9ǃ T$0D$@D$,1|$,D$40Gȉ\$T€D$ L$lwk_D$D$81.T$8VЉT$8\$,ŀЃ sBṽw؉‹D$FЉD$D$HD$8D$T$HȉL$L$hL$ :u`ȊiD$Ht"8,3‹D$ l0Ѓu3T$ T$,3D$ |$X1=\$ \$HD$DD$`D$DD$`tT$0|$,<0t_}D$\\$t$Pj5Q t$\J$W$PQ%\$ D$ D$0u11D$,0tD$ rϹ\$ \$XD$hD$D$(D$ л֍BЃ y|$(L$ Qt>ɉD$~AT$ \$LL$u7D$D$\$LT$ D$˃ۋD$t|1ƃ }8L$8ɍ L$8}-4Ѓ}$4Ѓ |ȉ|Ӊƃ}T$8ҍT$8뗉4؋T$8 |}T$8\$L\$T$ T$({ D$D$8T$BD$8D$ D$  T$BD$T$ BD$,RD$ |$(y|$D$h|$XD$߃EۊL$lu|$ u 0 \$LD$ X\$,@1+t -uD$ X\$,@ƒЃ L0t$g\$,0tFD$(t$HL$lمtL$@؉ډ\$LL$4|D$8$0DŽ$4߬$0$ݔ$8 t$(T$ |KD$pLиD$$ DŽ$$߬$ $ݔ$($(D$$,$8D$$<+t$\$Lt$(tS}t؋D$pL$( $c T$D$ D$,D$(D$@؋T$0Љƃσw]FЉD$@CD$,c< ? KT$@č4D$(pЉL$,!Ѓ< r߉T$@T$(r t$D$ D$@D$(\$Lt$HG|$ n0T$0e|$h D$%s L$\$t$,PV聩D D$,\$PV`uD$,D$$\$L|AɋT$0tD$p)0 %\$L)9D$(t$([ +L$ |$`t|$4t D$T4D$TD$Dȃtt$p $ݔ$p$t΃D$ D$D$ D$5 D$ 1 1D$! t $ݔ$h$lD$U D$؋\$t$t$H L$8@ t$ D$P跱uQD$L$  \$QPޣك|`؋ |$8tWA\$t$ t$蕣wًD$݀Pr{|$tD$t fD$zl$z߼$Xl$t$X$DŽ$ ߬$u{*1T$89T$|$DŽ$߬$|$tDD$!=w2ݜ$$$)$$݄$\$ \$P*D$ Ƀ|$8|$u <$'${|$8؋D$Ɓ\$`|$ $L$T|$D$\$P\$PD$L$$ݜ$$|D$TЁ uD$$|$ |$D$݀Xr^|$rD$r fD$xl$x߼$Pl$r$Pt$DŽ$߬$|$8t\$`ݜ$$$)$$݄$),$$$PD$|$ :\$`\$L\$PID$L$$ݜ$$$|$D$`9u~|$pT$p fT$vl$v۔$l$p$$ڤ$|$8u% u D$݀pL$݁`݁h؋\$WPt$Dt$ 8t$,t$vS$tR6D$D$ـ w|$؋t$MD$D$ D$ۉ؃t)t$p4$ݔ$$D$$~iމjL$L$Ht $ݔ$$L$$ʉ)كD$(NNONt$@\$Lt$(|$L$lt\$(t$HԉT$T$ T$@\$(t$,PV芞tQD$,8("$@\$4PQVݎ  $DD$$@$D$@D$,1ɋT$01؁T$D$ $$ݜ$`$dD$D$ D$|؁|rMD$$)ɋT$0t؋t$()ƋL$p $1 PD$gD$$,jK$6D$p|$ D$D$ D$ |$ D$|$ D$D$ D$ |$ D$ D$8 $t$DD$5%=%D$xu x\$jP谧t$ D$P'D$xu x$%|$8t$|$tB#D$=w2ݜ$$$)$$݄$\$8\$PoD$8$$@|$ D$|$83i4$k(ٿr1Ƀ|$ 9.=t$|$ ؉|$ t$؋D$Dt|$ tD$$|$ D$$\$t6WZt$Nt$ BV9t$-Ū"T$0L$4tD$,$t؍e^_[]ùk)ًD$$ $u=t$|$ ظ#D$|$==ppL$TtJM؋t$|$8t$<$؋D$t$D$X$t$|$ I\$PX|$8|$D$%jF)$DŽ$܌$K(T$$ D$$|$D\$b$V|$t4D$%jw#F)$DŽ$܌$,$$uIzGD$D$$&D$xT$$t$|$ ؋\$Wۛt$ϛt$ ÛV躛t$讛|$$؏$ݜ$H$LT$0L$4QL$4T$0"7|$t%=s t$؋\$jt$ۢD$t/\$t$ t$Oكx~D$t$YS[ZL$T$ t$[ffffff̀ffff̀rS[[̀rS[[̀rS[І[̀rS[ð[USWV[Ô|$l$ ED$t@U1D$t#:D$ut$UWS u1^_[]fffffUSWV[|$l$URWG9U6W%M;OuLtF&t;tu5t;tu+t;tu!tf;tutf;4u u1^_[]Í? 2 PQjCR ^ 2 PQjDRt 2 PQjERX S[ D$ {QjpPjZ[ÐSWV[؄t$V'uE|$WuO;r$vtuO9Nr w1^_[Í PQjeR PQjfRSV[9t$t$ u1 ^[ÐUSWVZt$0~: $D$D$D$D$D$ D$1$ ك˃>NpD$ 븃Nl$t9l$됃wwD$zwcFL$t;D$vML$ىD$Jw1D$4|$ u|$u|$w 1<$t^_[]ÐS[Ê|$  臢 >L$s*D$@--tr0twPu@-G[@x1[ÐSVL$ 1tL1t2v-tru)ߐwt˃xuċL$^[øSWV[èD$Hr蝡 %T$t$|$T |tH1^_[ÐD$t uøÐD$  t tÐSV[t$ >t0V裠 9t t  t t^[fffD$Ð#D$ËD$;D$Ð#D$;D$ÐS[:D$ L$t9u[ÍV H  PQjpR9S[D$ #L$t9u[ÍV H  PQjpRD$t&L$tu1u 1tÐS[ZL$ D$Qss)ǀ[Ãuu ǀ[ÍV H  PQjpR5S[~D$tL$ t 1[Ҟ[ffUSWV[ç~j I1tQ@@jjPЗ v(o8te(W9YU(^_[]ÐSWVP['~|$OGQ9u0$jQP\ 08t  G $GT$pw1^_[ÐSWV[è}t$tRtC|$t3~t-0kX~r4RX;~rP?XV6X^_[ÐUSWVP[6}D$H $t.(1tt$V蒝t 9<$u1^_[]ÐUSWVP[|T$J $Ћ*1|t$W2t94$u|$ l$tWdWE$F;$} $)Qtu<|uprP $كU|l$VPQhUUPUjŽ ttWD$ hjP D$D$DŽ$DŽ$  L$VPQjx|t$;$^_[]ǃt$ Pyt҃¿+w狔t у̃ǃƒfsQS[*yt$jt$t$[fffffSWV^xL$D$˃w\T$t @,t$:8#z0C pu(*@u@tH^_[Ë20RPu됐USWV [TxT$Dt$u!Ǹ1>u5~u/~ -t/9uqL$Dl$@|$<|$ l$L$L$HL$s ,$zl$dl$PRVQt$t$t$ D$(P*k 1t81L$H^_[]Ã~MF @USWV[g$0$8< $ $L$HJ @BLt$FNV6 l$VRQPWhU׿h1zōt$hWj jVP‰$0u uuuVj PWAt$}w$0+i@ ;A7T$ B@$0p t$ Vz $0xD$@ {$0;h/t$v|$$ D$)L$L)ʃQRt$ PW~~/9s)u̍ L$hPQ: =t$0@ W@$0@  $ ;$^_[]WQ@U蜍$0@ V|$0@ tt눋GD$fFFfGD$GD$ @@ t$$0@ )<USWV@[ÔdD$\<L$<(pJ uJ Pt"D$j.PUVt t  D$$J D$PσL$QRPD$Pt$U $tQ>L$TA 'l$TU4$>tɋ;L$jjjjt$L6(Ņt$U6tȉt$VUj ~lVUj ~蛊@ uD$*T$D BBJ D$P螊T$L$@At9$A t 9< t< tT$t$t$W6D$ $D$ L$@T$H< t< tT$$L$ 9r1(Pt$T$H7D$ L$ + $$1L$ t$Vd5ƅL$@T$Hsjb>4$.<D$L'11U<V <(1(^_[]Ë$D$ L$@T$HD$A D$As |$L4$먋D$DA4$D$ )D$ )rD$D$DD$AD$9v |$Lgt$t$t$PD$PVΉT$t FL$N FL$)L$@WL$ƃ)]L$D$ D$D$D$VWP|$Lt$$9ubft$ ff $L\$Vt$P1t$3D Wt$@Pj%Z돍Ef$w rM|$jPD$D$DpOUeOPVt$Lt$HQj%2ZT$L$ t$|$$1ˋD$l$9T$0|$V$PuPtD VuPj%YT$09U |$$f|$Du D$8x|$,t$\$t$0Wt$t$t$00Ƹ1$Hfxx\$t$ x1gD$;D$$|$,t$L$(D$89r3l$8(\$PR{, l$8L$(+ $‰$ȃL$(L$L$t$u\$VJvT$4ƃt$ t$l$D$ )D$ ;D$4D$@$ 9s'D$@|$0WUQLj 1l$_l$0l$+D$xzD$xil$ (\$Uu=!Ńl$ 1$D$D$t$$|$,L$ t$\$Rq01\$ t$$ t$$ˉ\$|$,t$D$(D$@$Hd|$,$D$11T$ ;t$,tZT$ :/1$Hl!9ht 9uf|tP݅uT$ tDtN9|1뚅tb;l$,}\M ;l$,tK~TlPΐ|tLf9~fTtLf|tN멋t$$L}t1L$W\$t$a*\$?USWVX[Q$l>Wt1T$ T$G j(2¸D$$D$ D$(D$k$1ɉ|$ D$ l$L$Pt$ VV%ǃt$Vt$ t=ꐐ< t쐐D$$D$ t$l < t< t~BPW$t1ɀ8 L$L$D$D$L$ t WP#qtT$$9s=ȉ\<$.u)$T$rD$09wL$s>$t$$;L$0u?4^_[]$D$09uڋD$,T$PB D$(BD$ L$$J$_USWV XG8D_u$$ ^_[]ÉD$T$ T$0u+Y t E<)׋$$x`<$1L$D$ D$}T$uUc6$T$E ulD$;xtM 5^E=t܉t$L$8QP`<t$ T$u#D$@=u$ELM D$|$uIt$MtȍL$8QP<L$t$$D$$ʉD$|$ T$4t-E uEjjjuT$ $!у‹4$$t$E0D$ E0D$D$ u?|UPuTE)΋M0E0D$ D$ L$tKE<)‰T$Ή4$Et$ $UE8T$,))Ɖt$ƃE<$D$(14$T$uED$,))t$ $E$D$ D$(E D$$ T$4uPD$+D$D$0|>$0D$9D$}&D$,L$0ȉE)Ήu|$(T$$21+ELt$!!jRVuT$ !ƒt`EME0MtU@9tQD$ e ߋD$)D$Ubu E+D$U/tjU8Ĵ^_[]Wt$t$ uT$ !ƒtˋE0tU@9t Q+E0EEEe jU:81뙍E@L$ 9D$T$$tQE0U fU 뼋L$MEfUSWV [:t$4D$@u 8HL$@D$\$jV51D$D$D$E1;|$,v`\1WtztLEtD$uWjmD$$)Љ$D$P D$$tt)ȉ$  $EWt$UP $E RQUP x$EWQUP t"$tWEЊ RQUP 1D$u7}u1u-WD$$1 PQd  ^_[]ÐS[ê-D$ hPPt$[ÐUSWVP[v-|$t$t!t2ujFQVtZ$$FQVPt=T$$D$ Jt?9:t t j9zuL$(t PVу1^_[]ÐUSWV [,D$$L$ 8͋1t1uOWfL<$1t0t/ƉD$EL$QUPt-EL$QUt$1;t$(MtQЃ1 $u"Pj}D$$ $t|փt )ƋEtot`t$ERt$UP |$t,MЊ [14$VD$$ ^_[]Ét$ERt$UP t$|$tϋM  t$PU 1u%}uDžu4$D$$1눉넍 PQi1gS[ê*h(#t$t$ [ÐUSWV[t*|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[)|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[)|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[d(|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV[ô'|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]ÐUSWV['|$txl$ t9u1EMD$ $GQWPtD$OPWQ:16GQW1t$GL$QWt$L$EM^_[]fffffSV[Y&t$t$Vt$t$t$~>.u^[ÐS[&t$t$t$t$t$:[ÐSV[%t$ D$ t$PtD$ )^[ÐSVL$ tr. t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ *q.Q.ވڊ.t.t.t u#ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ vk.t\ވڊ.t.t.tu$ރ߃ƿrÍsЃ rރ߃ƿr-tsЃ v1^[ÐSVL$ ր1]11u.t-ƀ\ÊQ ր߃^rAtx.t^ֈЊ.t.t<.tu%փ߃ƿrÍrЃ rփ߃ƿr-trЃ v1^[ÐD$t߀^r1øÐS["t$ t$ [ÐS[ê"D$t$ P[ÐS[z"t$[ÐS[Z"t$Z[ffY;"ÐX"L$T$ffffffD$fÐD$ÐD$L$ffÐD$L$ɉfUSWVX!$L$0t$,l$(D$Uщt$9t;|$.M|$]$<@t<(A!t D$;D$$<@AtA1Ƀ ú t$cwكT$;T$3D$\[xpL$iϐE$PQV ƍGэ}L$,|$ U(!Ћ$W|$ƀހ:w7$ w;t$b\Gn߃^rxo;l$1\,, $* wkdT$Ɖ*t$i $* wi (Ћ4$ Wm;|$Yȃ|$ U(!Ћ$PQV xuD$ ƋL$$QPV xR+t$xJ|$\$ |$݄ҋt$,L$0l$ 9u ~~.;|$s )$k>(^_[]Ë$N>ᐐS[*jt$t$t$[ÐUSWV([|$@t$vBD$4;D$rD$ L$8Tр?L$s)=?D$ \$8ΈT$ щؐXʀu#? )L u뗐:uˉL$<L$,t$@1T$@:js l8us 919|$  M (\$ 30|$hT$L$\$(t8D$;D$0s.)=?#|$tD$@D$D$D$<t)@u"t0@u49s9t:u^_[ffffffS[z L$T$ Pt$ [ÐUSWVT$[> t$4L$|$0\$t4D$0|$"v$,1T$\$VP(u+t-u!$$l$0tC$l$0u20u- h$`;$u ļ^_[]USWV[$<$$<$D$$DŽ$DŽ$$ jP*R$<jPRDŽ$TDŽ$XDŽ$\DŽ$p$d$tDŽ$lDŽ$x$dW$$P)g$d;$u ^_[]USWV[ñ$<$$,$D$$DŽ$DŽ$$ jPQ$<jPQDŽ$TDŽ$XDŽ$\DŽ$p$d$tDŽ$lDŽ$x$dU$PQf$d;$u ^_[]USWV[ä|$A|$ 6D$8u D$ L$(A0u ǀy1AD$l$(WuPJ E})Elj|$$t$(V+~6Wt$(Vq t)T$rwxsD$ ;0L$ornEt%  ȉ  ȉ ŃUD$ 0 $tL$L$ )W$(D$(H @^_[]F @4$utD$t0ِUSWV[t$l$|$ jWWUVt$ -jW^_[]fffSWV[ød 8tfTvPQ]Q PDžu:jt.P PGGG ^_[ÐS[* PQO[fffffSWV[t$|$"WV0 ^_[ffUSWV[l$|$4PQVz^ t"t$UVxb wVjjPW3 PQV:^ ^_[]fUSWV<[A$Pot'1t P9tGGPGT$JRWO1^_[]ÐUSWV\[|$x|$|$dD$8tzJƉD$tvW}G tki9t uD$tL$HD$ D$ W*G9$u8; H u(!D$D$ D$ WFvD$POHD$xD$\$T$  $uFø1$t;hF9u;dF\$u^_[]ÃÍxF1 9tn9uF.9uFߐSV[yvVA1 VA^[USWV [BP ɉ$tEW1=$L$T ~7$X $WP$uD$T uhZ@Ƌ$P tDyt Yf|$~X hWPQ P tvvǃ %V҉t$>.hFs/.lFƁdV$vt">-00t!t$t.J"1ɋD$+(dF$ >-00uʅV~{<1\FOs*7ƁdV$vt&>-00t!t$t,J1+O >-00uѻ D$T ^_[]ÐS[oP'[|SV[ùvV?oP=V>^[ÐSWV[xhZƅt#T$#tV3O81^_[ÐUSWV ["t@Հ: jqt;ǀ}:Fjs#u/1ɉj<DžF $~?1퍻b9,$t".dVjEPW uƄ.dV_֋F$lF1D$t$;<$t$EƁdVVrt$VtFD$@$FFF fFdždFƆhFdžlFfdžpFdždVUTCdžZ1 ^_[]ÐS[Êt$f[ÐS[jt$jt$t$[ÐUSWV8[/M 1QT$,t$(}t]\$t_O9މЉL$ |GtnL9t }b_GD$ 9މD$ T$t$\$}c)L$ f11uL r0L dV t;wOZ\$[ыW+D L\$jhY`QP ӺƉT$Y`kiˀY`iӐƐt$T$T$t$)‹|$ˁ€Y`;t$t$ |ىЉD$ L$$;D$U|R}|]9D ϋ}\$1H(1Ƀ\$|St$T$9}'<u|$;||$|}։9|ك}>7dFL$(uW.tL2hFG 2lFсdVO(}t'T$vuEdF1+ 1e^_[]ÍD$ \$uuPW7L$;OL$OH}+L$T$11։Ht$΋\$Ӊ11ىpuSWV[t$vWa9oP2 PjVP W(9^_[ÐUSWV[×t$l$vW8oPUjVP W8^_[]ÐUSWV['|$t$vU|8X uLhZpL t*ǍjH tjRƃX |$U81WL k,tL tdVH(^_[]ÐSV[it$L$t$L ,t)L t dVu tH(^[ÐS[  Pt$ [ÐUSWV[l$|$vV,7X uLhZ L t*ōj tjƃX l$V6 PL +t)L t dVu tH(^_[]USWV[l$|$vV\6X uLhZPL t*ōj( tj2ƃX l$V5t$L H*t)L t dVu tH(^_[]ÐSWV[8t$vW5oPb PjVP WX5t V:1^_[SWV,[t$D$Hm~{ р$u7lF7dV-00tƄ$T$L$T$뮽8D$ ;$$R(^_[]Ã|$1L$D$;D$D$D$$<hFT$9ʉudFD$1t$9|$tT<$hF9tT$dFT$+1F T$jD$P$HPU*|$uqT$jD$P$H$H*|$uGD$$<dFL$ +t$1Ƀ~ N DTʼn֋|$ 论SWV,[U|$<$GD$GD$G D$ GD$GD$G D$ G$D$$D$jP|$x ,^_[ÐSWVT$D$t$>O<4lX~;F~^|1ɉ)^_[ÐUSWVP[Æv$P-T uoPl$|$P tABR lX~;yQq|1)͋$Pb-^_[]ÐUSWV |$(\$$l$ MAL$ I $ lX鐐~;YQq|1L$4$lX됐~;Cs{|61\$()l$$9}aD$L$ 4$lX1);L$$t$(ً|$~;Aqi|69͉D$L$ 4$ lXL$-14$)9D$$\$(}PՉ4$\$|$~sK9C}>3L$$3|$(1 )؃3D$$11 ΃ ^_[]ÐUSWV[vUd+T uoP,|$t$P tWVP ƉU+^_[]ÐUSWV`׉]ŀh/D$ tfGt>:t#>/u*R 8>:u݃>/VD$?=/O D$ @nfo/@ onei@re/z@/sha/usrh/VP/; j.Vj.Pct89tx/ux.uHt/uϋt$ jV<t$ jV&"Ɖht$P! +&y @L$V"cD$4V"?L$ A,D$l T9͉},$9,$Ƅ5>|$~i9T$$1ɸ>l$$<t >st$m[t$9}&t$t$9r1ɋ\$<1\$$\$T$,$M|$$~yD$T ʃ{ s {y  pKl$T$@s $I 90D$$,$uM 1~zQ΃1r?ȃ1;=dVT;=eVT;=fVT;=gV9ut,|$,1ې9u؋T$1T$1\$Ƅ fVfDŽ dVED$D1L$@L$H1ۋl$39l$l$\L$Hyq L$H9D$D7D$\$$|$0]؃l$t$u'M } EyjǁbM E M E M } y Ƌ\$C lj\$T$T ʋL$\  ӋT$Ly ˁ ˋD$L$$l$09t$999l$t$D,$uEl$L$P t!|$ t\$wY\$ׅL$L|$8tt$wt$ӉD$t$ 蘯D$`^_[]Ël$|$tL$4,$i`D$ 8 SD$ | DED$=\$D$ =DHV} D$ D$D$ D$ 1D$D$0D$D$;D$D$L$ „T$,|+~#1D$,\$UP t9u\$U4΃1w$dVUPc%D$8D$D$ D$ND$oD$D$9D$,$} EÃ|+ك,$ >:>u]KS,$|$ D$1\$;T$\$,0MY Il$@l~;uM}|$ |1ۉȋ,$p\$~ L9t }tDE>]][|$1|$L$T$ Œ1u~}z5pFz5lFzZ5hF5dFu~}z 5pFz5lF:Z5hF5dF 9uD$tKMQUt$  pF lF| hF dFED$l$PFD$\$$PH9иL$€Y`T$ $>D$dFD$D$h1T$ 9 $D1ЋL 3L$ u$8>9~;\$~ $dFދ\$; u $hF\$:Ku $lFT$,ЋL$Iы\$QPT$(\$e$@$L$t |Y`ƀ $T$>D$dFD$j  $D 1L1 u$(>9~;\$~ $dFT$; u $hFT$:Ju $lFT$,ЋL$Iы\$QP\$q$@D$L$ɋl$$~z1>t 9uclFdV-00tP> hFtсXF~ 9Iu#hF19t 9u1ZUSWV$[\tJ<€Ѐ r<r Au)hT$@\$1҅SG$D$0D$4D$tbNɋ\$~D TT$,D$$ IdXdXQVR D$ SDža\$G$jt$D$ D$ D$D$,T$$~@ $XXt$4\XD$0u ɋ\$t8 $AAD$<1+D$@dFƁhFǁlFfǁpFǁtFƁxFǁ|FfǁFǁZD$4$N dVUWP8 Ƅ.dVL$PАʀЀ rՀr HuƋT$)օuʅt .~1҉ЁĘ^_[]ÉL$Ht,t ;VL$@L$L|$ uR8tU<;t<,uT$$Rt8,uT$p\$7n8e $AdFD$dD$@D$l؉dFƁhFǁlFfǁpFtFD$`D$LD$h؉tFƁxFD$|FfǁFǁZD$1ɉúQ\$t1ҋ\$CT$ kd)ز=\$u!D$ i)T$i‰D$ D$ً\$p*D$ D$9D$D$,}SCTT$L$T$\$Dt1ɋT$)i)\P(\T$w = ףiQT$L$p\$DCp ;T$D$,|D$DpD$D9ȋ\$L$PD$t$<֍T$L\$t$<\$W$@D$4T$t$<714$>hF"9D$4uD$0L$ D$ T$P9L$ $t$lD$(L$ T$pt$h‹D$ T$Tt1+i)\P(\T$Tw  ף\$iQD$\L$(9D$'|ȉT$8ЉL$8L$|T$8);T$\vD$ D$D$X\$L$$T$XTL$$\L$p*D$X;D$\$,|D$T;D$($>AD$L$D$ L$8\$D$$L$\$(\$L$Dp.L$(;L$D$,\$| $L$T$'>L$\$L$ D$(D$\D$ D$T$?D$8|$(uʋL$8;L$4D$0T$PD$@1$+dFt$0D$@|$4~zD$1 9L$4te4$>hF>qFuT$+T$0$Tt\$$hF:t1$+dFt$0뒋D$؋ $dFƁhFǁlFfǁpF1+D$LtFƁxFD$|FfǁFAǁZL$Hh$@L$ L$ $L$Hu4L$`A T$dB ABIJ$@L$H"$HD$ +D$D=L$H| $f@t$1ilQitQilQiQ9u҅ɋT$l$ t64$4v\$ށ1i4Q9uB ^_[]ÐUSWV0T$ $XD$T$Dt14@lX~Y $yrJ9|*l$tj$)ʋt$9|<1҉T$D$\$$ $yD$D$<1\$|$jhQWPljD$D$ T$iȀQ)ω|$E.‰E.‰l$ iQ)iǀQ)ŋD$4(ƀ=)߉ljE.i€Q)Ɖt$$׃\$jh:t$t$ƉD$ k9黽k9i±:)Ǎ 7i±:)4\$jhY`t$ t$ 麐i"‹D$ ,bu׉蹽k9iʱ:)V\$jjdURT$Gw)jhUt$ 1wT$ L$)iŋD$,|$$t 1)\i$(\i)\Q\9Ћ$(\ϲr:)\Qףp=$ ףʋ\$9l$ |$~Scƍm=$ЃD$̓ظȉL$T$,}PD$jjdUPu)Nj\$jhUt$uL$D$|$s؉D$͉)пjjUt$D$(|$\$jhUt$dL$D$(ЉD$ʃظ؉‰$)ȉ\$jjURjhUt$ t$HN1Љ1 u}$IΉƍ)΋$ӃظD$HH}N؉\$\$jjdUPYt)jhUt$CtU\$T1ڽT$\$jjdURt)jhUt$st$ 5$I 5Ѝ)Ѝ5y <ų|$$ i)ik<)1;|$l$|$H_Ww$u|)\i<$(\il$)\Q\9Ћ$(\t$Hr1Qףp= ףt$HЍR\$|$ 9|ځ1ɐ)Nj9}N~ F D$ F$0^_[]ÐUSWVT$8XD$UyqY QT$QT$ Q T$0L$XI$L$}tMt$$xq*ƉѺʉkĉȋt$$D$|$(xѺωt$$ppD$$xqVй*щp;D$x кUUUƒD$ p Ɓlq!\$Te^_[]RT$)1T$D$ kčIT$(T$@)D$$1L$+FpnL$ 1ui)\P(\w ף1T$r$T$ ui)\PT$(\wD$= ף먹QkdD$ +|$ |$ iʐ)ʉ\$(|$|$ ʼn ō@L$+~'G\$( |D$FQqPƔt$ OD$<|$sD$<D$,2|$ ED$D$,;D$<D$,D$D$ƋD$l$|$Ft jPn~ e1^_[]fUSWV[t$1tGl$)Ήv,|$ Wt$T$,t1Ʌ~|$ 1^_[]fffffSWV[Øt$ Wqt1jut_L$T$PHp ̌ ̌ 1A"  xuxt%txu8u롾W^_[Ã눐USWV[ D$ PȌ ̌ ̌ $Ќ L$ L$ǐ|$$tD$$9G t GtǑ  tGwЃ GЋ̌ 9ť DžuZȌ u';|$r$;|$s<$$<$C<$1Ȍ t$ Ȍ u#t7W脄u^_[]ÐSWV[xt$ WQ"  xuxt&t xu8ujsu $p@@ ̌ ̌ 1W^_[ffUSWV[Ѩ$<$$D$$DŽ$DŽ$$ jP5$<jPDŽ$TDŽ$XDŽ$\DŽ$pr$1TK1D$$d$t$l$x$dU$$P$d;$u ^_[]S[Út$t$Pt$t$[ÐSWVP[gD$L$T$t$ 4$VRWQP]^_[ÐSWVP['D$L$T$t$ |$$<$WVRQP^_[ffffUSWV[t$4}XjWۡE`HM`~;Ep~ t EXHMX WRjW褣^_[]ÐSWV[hL$4B`pr`~ ;Bp~ t rX~zX XRQA^_[fffffSP[ D$ L$ $4XQPR[ÐSVP[إD$L$T$$4XRQPVp:^[fffffUSWV[ÔT$(|$$t$ t&t"T$(qfTN @1tVt$jRBL$0A <$uy‰Ņf1qyQuE)ljuދl$$1$)1t$ ōACAAAjQԡxՋ)v1WPV迸L$4 9l$Qu0}T$RPVΉ芸 )~>jVzl$$jUi$+D$1t$ ʼn^_[]ffffffSP[D$ L$T$$RQP[ÐSVP[D$L$T$t$4$VRQP8^[fffffffUSWVP[æPt$ S1_ht$t$ # x=|PWfF FfFfn vF$`F,xF(F $tjjjV(^_[]ffffSWV[آ|$jW՝w jWџ^_[ffffSWV[Ø|$WG;D$w+t$9w 9w9w 9wPWVy ^_[{fffffSV[9D$;D$wt$ Pt$VIc ^[\{VT$D$11)ʉT$D$T$ D$11)ʉT$ D$S\$D$ ËT$D$ 9s>Wd$\$L$)ыD$)s\$L$؉11_[^)W d$\$L$)ыD$)s\$L$؉11_[^ËD$L$1ËD$ [111^Ð!̀rS[[USWV[נt$F0u ǀFFF tVu"V͗t aV);F|Vu?1FT$i.;Ft F t uV胓u^_[]fffffffUSWV[t$|$l$jUWVPUjU^_[]ÐUSWV[ìu})y1ɉL$0T$to`, $' $L$4D$#L$0L$Dt$T$8$8|$@߃ЍT$t\$@مD$D D$0tD$0ȃ|$XD$";D$XJ9D$@@1D$PӐL$H11Ҁ{D$D$8t|$@)D$8T$PD$D$Hȉ|$@9 $L$4%D$D$@D$PD$HD$(1_)+$9 \$Ѻgfff)À0iT$|\$D$D$D$х{ D$dډˍw CT$ ‰Ћ|$T$|$r1T$t1D$ كT$tˋ$ȉD$ D$GD$$8KrD|$ } $D$PWYhL$|\$D$D$ ك$ \$4ˍ$|$$ 0|$|$(D$9ߋ|$|$\$(rÍQ|$4<00 D$PD$4:$mD$T$tыD$ |$@) ˋL$D$D$ $wCT$ ‰T$L$Ѕҋ}$D$PWg\$D$D$L$t]F D$ G $wCD$ D$L$rD$ t7$D$PufT$|D$D$Ӆt 1ɉ뀋}}D$1D$ L$tD$( D$0u ˉэT$t$AD$ D$ˍJL$rF$D$PWeD$D$1D$ T$tӅ D$ T$t~D$L$tD$4D$@|$XtljL$ D$Hƒ|$PCD$HL$D$D$|$4T$uD$XT$t}D$?\$ CD$D$L$rCtL$D$PWdT$|D$D$D$T$ t1 D$\$ D$D$1ɉT$ D$D+D$4|$X?9Dž~w\$ D$4{|$T$@׉|$AD$rRT$tta$D$P}WEdT$|D$D$D$T$ \$@tEQ1<|$\$ \$@T$t%D$D$1ɉT$ \$@D$X8)Q$w|$ GT$‰T$L$ҋ}$D$PWqcD$D$1D$T$tT$ \$ D$G a$w\$ CD$D$L$rD$t9$D$PubT$|D$D$T$ t1ɉT$ uT$|$ D$1D$D$tD$ T$҃\$P)ӃT$H)‹D$X|$4ljT$H‰\$P|$HD$D9NjL$ w}D$XD$4D$( D$0u1$$`$`AϋL$D$D$L$rDW$D$PRaL$|\$D$D$T$0b$jj WQL$,׉ T$)ʀ0$D$4$D$XD$HtA$D$Pu^T$|\$D$D$хtM1 D$ы$D$0))ˋL$|$|$ D$ G ~r$wCD$ D$L$rD$ t7$D$Pu]T$|D$D$Ӆt1ɉ넋$wCT$ ‰T$L$r;Ѕt?$D$P}W]\$D$D$L$tt#ً$T$t$D$ѐD$(%|$8ˋL$|$D$8$wClj|$L$}$$D$PW\\$D$D$ljʉ|$8G ωщD$8l$wCD$L$r1\$tt2$D$Pu>\\$|D$D$tZ1z|$$}t-$D$PW[\$D$D$D$T$t=}t$$$t$$|$}t$$$t)$D$PW{[\$D$D$ucD$u[bD$TD$T}t$$u <%uL$ D$Hσ s%1ɐ HPЃ r<$uSHZt$w*HЉ t$wHЃ r뀉gt$A1  ,HNAЃ r$5VUUO L$D$@% D$L$D$σ D$L$ L$L$A1  ,HOAЃ r$VUU$u_;l$rD$P k L$9wȋ $D$ @D$D$t$VUU;t$rD$Pc L$9wȋ $D$ $uO;l$rD$P L$9wȋ $D$ D$l$Pt$N|$VUUt;|$rD$P WL$9wȋ $T$D$ ։D$l$PD$uGVUU;t$rD$PV L$9wȋ $VUU;t$rD$P L$9wȋ $D$D$u{E <9VUU;;t$rD$PL$9wȋ $/D$tVUU;t$rD$P.L$9wȋ $D$D$Z uVUUP;t$rD$P3L$9wȋ $DD$uGVUU;t$rD$PJL$9wȋ $VUU;t$rD$PL$9wȋ $D$3 @ VUU,;t$D$um xVUU;t$rD$P#L$9wȋ $VUU;t$rD$PwL$9wȋ $VUUM;t$rD$P0L$9wȋ $AVUU;t$rD$PNL$9wȋ $ VUU;t$rD$PL$9wȋ $D$uGVUUq;t$rD$PTL$9wȋ $eVUU*;t$rD$Pr L$9wȋ $L$ VUU;t$rD$PL$9wȋ $ VUU;t$1FVUUk;t$rD$PNL$9wȋ $ bVUU' ;t$VUU;t$rD$POL$9wȋ $L$ D$jVUU;t$s\tVUU ;t$sC[VUU;t$s*BVUUsk;t$s-VUUsV;t$rD$P4L$9wȋ $,L$ D$l$Pt$9s$L$9r*v Ph*E|$8E|$8|1 uT t$ 9wS$w닔dwl$Pmt t$T l$PU\ / U| 룋$L$19u $P:<^_[]þUSWVP[_D$t/ tiD$ ʉσ8^sMT$ΐˀ0wpt0t0 w0N^_[]1ۅy$̉)0NыD$,$1ۉ rωȹgfffщ )0Eu|$$tË$9u<t |D$(E$xt$rKUSWV [ò]D$ 069rljT$D$uj$jWPv ~}(w}9$T$JHJHJHJHJ H JH RPE$jWPrv }(}8t!}0t$7|0*)4$PjVp $L$D$ 81 ^_[]ffffUSWVP[Ï\EET$@t$DT$$pU }(j1jD$܋T$\$8t$<EΉ7tƉP1t?D$|=WjPo ))jRPA1 1D$t$\$uA\$0΋L$0D$4ʀ\$3D$,L$(D$(~ރƒuuD$411ۃtc\$ \$ D$$ڀt$L>¹!T$\$D$؉L$49؃|7\$|$щ$ ƒ9wL$\$\$} t$D$yq|t <0tut$ID$ ƅt79r U 9se^_[]GUSWV׉[Yl$CXtItp> > H>L>tZL>uat`>L>t.uiL>u9t0>L>t)u6L7g' ƀ1tD$^_[]ÐUSWVx[ÿXm|$hE t$p |$<$_ MM$U(j1jl$l$܋|$Xt$`MƉ2t|$D$QC-t?ƃ|$|=FWjPk ))jQPe- o1fl$\$t$uA|$Ht$PT$HL$LӀL$ue^_[]BffffUSWV[UE \$t*\$4=t =t$= D$4u111111 D$4Eݔ$$$|$0L$@x %$$݄$}Щu)' L$@\$(juL$tyD$0D$lD$ $D$T$D$\$sNjD$L$ttW% ?L$@\$D$4\$1j؋E\$)ju P") mT$pT$\|рD$@t$ (ыD$@\$D$4$DŽ$߬$ݜ$$$$$݄$؃`܋p܃x$ۄ$܋|$VD$V fD$jl$j۔$l$V$$ۄ$ )Ɖwpv؍N؉t$X1D$\yD$,D$,Ext$HL$,D$L$l)Ήt$Hމt$D$l1 wƃ|$0D$D$<~ut$DD$ L$D$(wD$DD$$<1E‰D$ D$DD$$1ȋUЉD$$Dx‰D$ R&D$ ; |$1҃|$0uD$< D$|$(L$\$D$ D$4T$<T$ ؅~'ȃpD$u[j؉p ʃrxvRt q t.vt |$XsT$|$ I|$XrL$v)|$ ~)|$$؍Q؋|$$ ʋ|$ ʉ$ڌ$؃dݜ$$$$$݄$pD|$<ػ |$TD$T fD$hl$h۔$l$T$$ڤ$0L$ q2t$jbM |$ ؃hD$T$1ɋ|$ DT$|$PD$P fD$dl$d۔$l$P$$ڤ$0T$ r u:10D$ 9 ؋|$ND$N fD$bl$b۔$l$N$$ڤ$uz뙃L$bك|$RD$R fD$fl$f۔$l$R$$ڤ$0vwL$vqD$1ҋ|$ t$ ؃ L$T$vث v؃~0vtT$|$ ؋t$pxfapȃ|$D|$ ywsD$؋l|$ G8w1D$D$42؃|$<|$t|$6+t$\D$ p|$LD$L fD$`l$`\$xl$LL$xL$|L$|1Ҟwۈ)щ0Fu؋|1t$H|$)3jbwL$Ht$,΋\$T$4~T$,~9|)L$4))ʉT$,|$~F|$<trt$PdWD$PsbWi^VD$P؋|$ |$(|$ |wD$0ufsD$\$t$Wc\$ Džja|$|$l\$WPac`؋L$1ҋD$DD$4D$R]D$t/L$4t9t\$Qr]D$\$Pa]\$D$|$<|$0|$( ƒ|$@ЋT$ˆT$D$,D$,L$A\$t&` )D$,}؉ы|$ 𐐐@<9uF9uL$01 L$Nt${\T$9M u 01Et1t ¸ )ȉЋ\$T$4rʃ΃ȃtʃ΃ȃ~&Rt$cD$T$|$|$ $3MI;M !D$,D$H1D$|$Q1؋|$T$ȉ@<9uA9uL$01 L$D$ (D$T$D$؋|$TD$T fD$dl$d\$xl$TL$xL$|L$|0uD$;D$uT$D$(؃L$T$*D$$T$ |$<D$tHtJ+D$HD$T$,‹|$LD$~$RQ&Ot,D$$D$H~$Pt$OD$T$ u 1T$ |$tr $t$QbPT$|$t$$$Y|$D~RD$T$ L$$jjt$G D$$Pt$ P\$L$ʅ|$@'D$D$8|$LD$D$0L$PR(NDž~#T$?؋L$؃T$$jj Q)G |$@c΋$jj t$F ‹D$8 |$Dt$$$/L$|$D$D$t$QED$ t.L$t9t$QvED$$PfET$%T$$1|$D$Ȁy0ItL$R2EL$E 8E$tEL$ e^_[]xrL$F둉׉|$ uT$wCO L$O ‰D$ t$QRIE jt$KLM|$D$ D$$t$|$ W_D$,t$WMt$ t$Mt$t$,k$jj P*E ljD$ D$L$L$D$D$QPƉ|$Wt$ )Mt$ t$wMt$,N0L$ x $tPCL$(T$D:Pt$ LVyCT$D ЋL$(uE1 m u ErD$$~ ]L$T$ L$89L$\jj PD D$D$ L$9$jj QC D$jj t$C NjD$|$ L$|$$D$8 |$D~t$$T$ $L$%D$t$$$|$LD$t$L$ QNƒ0~D$9D$}St$$jj V6C D$t$P ƒ0D$9D$|D$5D$D$L$($!#D$xD$x D$|$(#$t$ t$JL$ |$$F|$$t$t$ Z0D$ t$(Vt$Jt$t$z|$D$ jj Q%B D$(jj t$ B D$D$(D$D$9eD$\|$ 9|$9r|$L$(ɾtuIL$T$ $jPEH\$ht$D$ PIugd$ u^xD$xtNL$$G<9u"z9uT$|$L1D$ T$BD$ t$$|$LD$L$$xt$$xt6T$D$x0@tD$|$Lt$$$1˅$jt$ KGD$I$t$t$ HD$ uRD$,tI|$ 9t$,1D$ t$ )L$,1D$D$D$ D$D$x D$xt}D$s|$ 9t$,1D$ t$ KT$D$ D$(|$|$L$ 9uT$D$(D$ ȃD$ D$ T$D$(D$ D$L$ D$|$Lt$$L$$D$xPD$xBD$fffffSWV[è*D$1r 1 9vW<t8Ɖ^_[ÐSWV[H*D$1r 1 9vW{<t:L$T$8ƃXt𐐐Xut^_[ÐSV[ù)D$ PHpR=^[USWV X)T$8L$4z19yID$BD$GD$DD$it\1$19l$ v 4$l$4oD$4D$l$11D$$e|$D$؃)˃;l$vȋ|$?l$44$\$T$8RUeE|1L$ 111l$}׉Ã)9ڃ;l$vڋ4$L$|$4|u'T$ 9v8u 9wO ^_[]ÃL$ l$49v&4$D$\$T$8?u9w4$D$\$T$8D$EffS[ú'SVH[Ñ'D$0hjPI; D$(D$,DŽ$@DŽ$DD$ D$D$$jPjj L$(VPQj)D$$D$ D$D$D$D$D$jPj- jjS[ê&S[Ê&fffffffUSWV[g&D$|$1tt (h1^_[]ÐUSWV[ì"}uu\$D$4PDBD$D$DD$@D$D$ ~GȍQr* ttz+t -up1҉|$(ufD$ED$(1ҋ\$} tD$(tL$D$tPt$u1 t$55L$ȍe^_[]Ã|$(1<0T$,uRO xeD$L$(\$uRPuuQ%T$DD$} fED$(1X‰\$lрD$h wr_1D$$1ɈD$A΋L$$ JЉL$$D$L$\$(рЃ L$s2҃vwԉ΍ JD$D$$1MIL$xʉL$ L$XL$4:uLat8$u8du L$0L$( |$tY\$D$|$P1\$0\$D$4|$(0tD$40u3 1ېL$(0tL$0щ\$4L$ ωL$\$0\$PD$hL$4L$D$X|$ σЃ |$ aT$4T$JD$ t6L$\$u*\$t$hL$Ӄ΃t|1 }5L$$ɍ L$$}* 6 }$ 6 |ˉ΃|։}L$$ɍ L$$뚍 6 L$hL$$ |t$h} L$$\$ӋL$L$4SL$$ |$ OL$$D$ t$ 4ND$|$0OL$(L$0ӋT$4T$hD$X|$P\$L$ 1ۃEu*|$T$,u+|$u$<0t D$ED$(ML$0L$0Y\$(QD$d+t -uD$dL$0Y\$(QJЃ T$ 0u\$( 0tL$ T$ JσJЉL$LKL$(cЀ u\$TSL$LT$ ԍ T$4L$P\JЋT$ T$("Ѓ rщL$LL$4\$P YL$ \$T"L$0L$(1ۋT$,|$LD$E@ tt1Ƀu) J\$T$D$t‹D$Ã|L$ D$$$DŽ$߬$T$@ݔ$ T$4\$|DD$pLظ$DŽ$߬$T$@ݔ$$$$$\$+\$hڃ|$ 5\ڃ|$O؅‰u1Ɉ\$t$ΉD$|D$|PH/)ƃ16pT$L$@\$@L$@Ut$Vt$$Puug1ҋ\$؉ލD$L$@U\$Pt$$jhڃދ\$p)1.%+D$9Y+D$ىދ\$p ) \$@D$L$@UPt$$juut \$} |1҉؋L$+L$ȃtT$pL$@\$@1) L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ىȃtT$pD$@4\$@}L$A 1ɋT$DƉ%?T$DL$@T$@Fݜ$$1ɋT$D΁?T$DL$D$@t T$ )ڃNN|$ ONL$L˃|$dT$,t̉L$ |$|$R<0\$} J|$XL$ %ȋ@t$(PV'T$4D$(PV'uD$(D$D$(L$(PQg'T$4tID$uFMD$(D$8(PuVD$0PT$8 D$2D$D$0D$(U1ɋT$D΁?T$D~*L$D$@rt \$@\$D$@D$HD$ D$LD$$\$6D$t$t$0)& \$L\$Vt$ 0D$Y t$8T$P\$L> D$\$L\$t$lt$(t$t$@W#ƋD$y؉D$hD$\$v' lj D$ $D$ $D$$$St$0y(t$4m(t$$a(t$XU($vC'Dž$b FO PRQ( D$p '3 |$4t$N  D$0P QVR( t$8|$؋L$T0)ЉL$T$ۄ$D$\^\$} wT$\\$3t$d/D$TD$\ D$`\$} ݜ$t$dD$8L$<$|$T$lu3t$ )~+Vt$ +D$k)t$vt؋D$\ D$؋t$FD$PD$|$t *L$ht$D$ ؋D$D$D$ \$L\$T$ 9wы|$)q\$QhPR 7T$t (hD$D$,BBD$8t$ D$PD$|$tD$P|$l$HD$F9r\D$ BD$9<$D$\$D$DD$1\$T$t$2\$D$,DPD$D$ D$$!rF0 M))Ht$L$ T$}|$D$u"D$|\$Wt$%D$L$4\$Ul$UD$L$WU9K \$Pt$L$D$H +D$H $}Ջ\$P9l$ ~8ŋD$<"9ƋL$D$D!9x/!\$tf  )9\$jUD$<$;P!L$DfL$DT$t$|$J|$HL$t"$@t$D\$|$<$|$Htދ\$4$}"P"L$D$ffffUSWVt$F98[ |!1Ƀ9Pl$$L$ T$|$H@ |3 jQj P tJu|$$L$9|6 9}()1퐐 /Qj P t 9u1^_[]ÐUSWV8[u }D$PWG\$,PV7L$+ $G+F~!D$,\$D$L$D$ L$D$!\$ L$ T$$)‰L$T$D$D$,e^_[]ÐSWVL$|$9u1t<s 1^_[USWV[t$D$T$<n~,D$9r9s#L$9w)QjP^ ^_[]ÐWVL$T$ B9~t9}׸|u9vx@t1^_fffXǀP ǀT fǀX ǀ fǀ ǀa fǀe USWV L$$|$ wW9$tP< $9߉t$s\ +$D$7L$ Ћ $E9r(𐐐h9r։utt$|$ )Gu ^_[]ÐSVP[D$H~( 1u 9r1$PƉ^[fUSWV[ÇL$d?tPS8 w t{ ?u1>P衷ƅD$t/Fn?tP7FF ^_[]1?t򋃬P7(w )ʉʁ oΉ(woUSWV[Çt$tbF!r VVOd}t3W=7}F  tW7  ^_[]ÐSL$t1uqua^1futttt#9uuu r[ÐUSWV[tl$,ED$D$T$4}D$}D$u~\$l$݋D$0D$T$ $\$t$0D$ W $Ӊ\$ډG1Ƀu\$l$,D$D$t& $L$0T$ D$ $D$u&;E}֋EPt5NjEM PQRm E!r&U(E!r\U1d}$P4}T$,B ti4$4\d}th$P41}F  t14$}4$ T$, D$TG^_[]Ë  1␐T$1Ɂsrr@r"y(6s@sރx @tS[j,tL$H@[ÐUSWV$[ÔD$9| 9}T$P7P|$, $r0wD$PjR% $L$ >L$uM<L$,tS\$ )ȉD$1ې. ݉*L$9rۋL$t D$\$ l$($ 9rL$HtiE!rU蒾9zu/9wj@@ɍ< yux M $l$}V L$ D$ƒ11ې)؉͉;t$ rۋD$ $9s)7)޻29r:RtD$H1^_[]ÐUSWV MQ|1É<$srIrO@su \$QT$ x6@u+ ds@r믃 ) 5 )‰\$$މ1L$;L$ vL$y S19v \${ƒt9щ\$$+) $L$1;L$ vA $ lj4$?|$t$D$e^_[]USWV [E\$jz?D$\$\$t$L$tD$t$tOD$tP1D$ED$)\$#1f‰ut+t1t7t=N1f|$\$uσuɃu׺ r׉˅uX1,ىt$ Ƌ|$ ؉Ft$ |$|$xxx\$tttt#=uuu r \$\$ʋL$H@ M]tց35)Zt1ҁsr;rA@sx @t)߉9e^_[]Ãs@r뽐L$D$t PufffffffUSWV[A$|61P$1jjU1" ʼn$tƒ9tt)D$P$ts#D$ =uXi/tZfx $tu f~ $fFvF$`F,xF(F AOĀ^_[]fffffffS[ t$t$jt$[fffffSWV[|$jWGHO~ H0 WSjW^_[ÐS[zD$HQP~ Q[P[fffffUSWV[7L$atrt!w 11Qt_tGҍzwP@ؐ+u˽뿁뷁 L$) 1^_[]fSWV[h|$f jWZG0ǀǀ 1G t WRƋO twуy y wG0tW@9t QʴG0賴G0ǀǀjWG GG ^_[ff̀rS[`[SV[It$ F0u ǀV"uFH^[fSWV[|$d8u-.GG Ⱦ uuL O @G0taW@9t QyG0GG81t&WG GGfG u W-G t'V$`(PVp$GOQPwW$ GO fO 1!t Gf@f  fG ^_[ÐS[ÚD$H u P[1[fffSWV[ht$t`1mT$ |$L$D$t#t8uӉ6@VRQWP26@VRQWP覂6@VRQWPL^_[ÐXL$`)AA A AAAÐfffffUSWV[Á$uthjʪ1$džt.%u%D$PQq1t+8$u!8u $t4D$P$UQ)VD$\1 D$` ϋ$<$ F8FF F FFFF4 DhjP$ t;$PQp|$=|F P#FEt$Pt#FV EtF4Et UMtЅBt N&tEu hV VɉʉVNɉNN ɉN NɉNNɉNNɉNNɉNN ɉN N$ɉN$N(ɉN(N,ɉN,N0ɉN0N4ɉN4N8ɉN8N<ɉNaFj P ;F@NF(șdžHF DDN ȃN艆8hPjQD MPV$$0$tNC?(1Vl(1^_[]14dž$j$ʛtJp1H1HP2H 2H 2H`3H`6H 88oUSWVՉ[jq<lj1&NL$jP$$UT$ T$d$ 1ۉt$t$$݃D$ LL$]}D$\ L ]؋L$D9\$ ut$T$t'4$ߋL$ u18"8^_[]ÐUSWV[U4jQ@" t D81t>0rPtթ/t u8~)1 9}8tQ蔩݋t P,Vot81^_[]ÐSWV[X|$tOW%^_[ÐSV[D$ p|$s t.jt$ 1dž,dž,^[S[êL$tAt[[ÐSV[iD$ p|$t_dž,1t$t$^[ÐSV[D$L$ qt dž,&t 1҃ƒt$t$a^[dž,빐USWV[Ô|$(D$p$xudž$dž(dž 11Ʌt f9 tSHt ()9bf|Qf9udž $뢐V($19jjUV5/ Hf9uxV(9vo(f|Qh QjPQV Hdž(fytV($9 (tdž(f|Q댺f|QRu(f|Q^dž $dž(Cdž,^_[]Ë(|iw&jt$(t$(PV:uƺm tXiD$$ËD$ ÃrLi#dž$뀋n tD$)K$L$$)A(1ESWV[Ø|$t^_[ËD$tx4t&jjWQ uЉuLJ01뷐USWV[$|$(o(o(OG0!D$;G9} $wD$D$ PE$L$L$D$QPt$͉ $L$QjPX t$h$D$ Gjwܜ $tNG(PO 9~ LDLDG G,9vG0 G,Ut$WI ^_[]ÐSV[t$ t$t$ #F,;F(~#F0^[ÐSWV[â4aAj P F@N $NL$NL$L$NL$NL$NL$NL$N L$N L$ N L$ NL$ NL$ NL$ N L$N L$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$NL$N#L$ N"L$!N!L$"N L$#N'L$$N&L$%N%L$&N$L$'N+L$(N*L$)N)L$*N(L$+N/L$,N.L$-N-L$.N,L$/N3L$0N2L$1N1L$2N0L$3N7L$4N6L$5N5L$6N4L$7N;L$8N:L$9N9L$:N8L$;N?L$L$=N=L$>NL$a D$`$^_[]Ët$ |$L$$Jl$Dijt$@URV肞uD$`뒀gt$l$UV ut$ 7l7\7|7<7\7l7L7L7f\7ff\7fL7Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPH^_[]Át1f9v|pff|p<0f\0ff0f|0|0f\0ff\0f|0D0t^ ~ N n n N ~ ^ N f~ff~ fNoUSWV D$ D$(|$$GHL$H hd$Z1f!fDp9t$1\p<ɉ LflfflfLLtÃtID$CcL$K cCD$CKfkffkfKL$V ;L$L;L$L;l;,;L;L$L;L$L;L;fl;ffl;fL;Php0hPHHPfhfPhHHP h p ph P H H P hpp h PHHPhpphPHHPhpphPHd$1ffDp9t$|p 8l8\8|8<8\8l8L8L8f\8ff\8fL8D8tO o _   _ o O O f_ff_ fOiPɉʉPHɉHH ɉH f@f@ ^_[]ffffUSWV[|$oEtjPuW EjWuLEtP菎E EtPnDžDžtPGDžDžU$WV^_[]ÐUSWV[|$0D$,pFtjP6Q Ft^_[]Ë 1uʃtttjj6 t$b1D$L$T$ |$# l$hxP H@b1jP6衝 6Y 1KfffffffSWVL$T$t$r ;uwt1>:8u 9u1)^_[fSV[ÙD$;D$wt$ Pt$VI ^[輊ffffffL$1s!t11҃9rfWV_)D$tL$ P11^_É11Ɖ1Ɖ1Ɖ1Ɖ1Ɖ1ƉtfffffffUSWV[dL$4T$0t$,t#D$8yt9W t11҅1116n!ՋN σu1҃01Ʌt3OHOOG8^_[]ÉT$L$D$l$ D$uTD$,FuBVQV N u€thV:l$4|z<$jj蹃1hƋD$,p j蜃Ft.t D$,l$4D$0F Ftu1V͉1NT$,NL$N1jt$Pt$<$H*fJ<$uD$L$USWV[äT$0l$,t$$F( :N;M.N9"$F(  D$(ƅt$,$BfD$PVWYT$< $E9v$,$BfD$PVWYT$< bE9uUEtNjP77 $fD$QVWD$"Y  jt$ 6 T$0,$fT$|$(u -,$fT$GjjjPPQWTWT$L{O(,$fT$wjjjVVPWWT$LEO(EjP7Z $HfL$QVWD$8X t*jt$ u T$0l$,O($l$,L$F(jQ6Ά T$0$FD$fFDU<(DtG PV [tjGt PVZtMO, F)WPP\ fnT$0DVNft>uf+9f9sf9L$,|$0fugT$,zT$0)Ӊft~ft$ty\$ 1f1f9t9Yf9r1ᐃft9f9sf9yf9sfy)|$t$$\$ frR\$,t$$t$$fs>\$,{T$0f{N( 1uN; uN9vfN^_[]1fTYf9\$t|Yf9r1fY|Yf9r1fTY|Yf9r1fTY|Yf9r1롐USWVT$[A,D$L$\$ ;t$dFjvuZ $FD$Du<(DtG \$ Pt$ {XE%\$ uI}Ut$ VUVmk@$} ‰$E)QPP;Y $fEDufD$ftZ\$uWً$t$fdfEt$fEE \$ jUD$0 Zf%Kt$f9$sffuwUf 3fL$1ff9tIO$f;L$r1ސftf9sfWf9sfW)D$$L$frD$$fsUfUt$\$ jU6\$ D$8ujPu $.PU$ut$Uki1Ʌ $$^_[]1D$"f\Wf9T$$VLWf9r1f4WLWf9r1ftWLWf9r1ftWLWf9r1뜐USWV[çl$|$Et$jP7 tBMHjP7 E1t+jP7~ tMHjP7賀 ^_[]f1̀ffff ̀rS[[SP[jjjPt$ 1Ƀ $ȃ[ffffffUSWV[ñ<$$$ T$$xt$%Gudt$ $1|5vuN| 6?2+$ $<19rj/P讀tR1ɋD$;$ȁĜ^_[]Ðj>9r?Xt|$W$)$hPT$RQL$$ $t 9vϐ?/(9w$)L$L$  D$D$$tht$U t*$hU.Ҳ1Ƀ89t$1$8j?Pt$ tWH0tȋ $9:<D$ND$19ubD$PU-um9t$uC:3D$PU-/1Ʌ#D$$=@L$1ر1Ƀ8ifffSV[éD$;D$w.L$t$ 9w9w9w9wPQV蒥 ^[jffUSWVT[T D=AP+T$fPL$fTHL$lHŋT$(хuL$$ MM|$$OE D$G D$MЅuPt$ t$%> Gl$pjw uWf H jPu-h L$ω‰ȉL$uT$ B|$DT$H\$k1t&1f1TS<у9wl$HL$DLM| T T$ J+L$fJ|$fLzN\$t(1f1|~>9wL$T$ LJ D T$Éх҉u\$ K1ɉL$TSL$y<9|E+D$fEL$fDMD$DENɉLL\$l$pD$P9D$,D$8L D$ |$T$WPjjt$u@f jVu2f D$ t$ \$l$pD$jPuf jVuf u赣5jt$$ue jt$ue jt$ue 1\^_[]Ë\$gUSWV׉[ zD$PQ~M^ƋT$0l$(D$fF $L$fNONL$NO N OL$ u-Of9 uGfFf}D$,0t$jMŋD$EEGEfED$fEG E D$ t+jPD$0b t~HjPD$0d $t$4t$4VUD$$UW D$ 9tUSD$(8D$,0jVD$0#d US1^_[]ÐUSWVXxD$|$$L$ D$fBfB$GG ȋD$(u"t"1f1lo4/9w1$4LL$fJfJH@ u't'1f1lh<(9w1<2D2fBB B \$jRD$0b^_[]ÐUSWVP׉ $[qwl$D$fJfJ D D B uD5OP )fOfOɉEDDD5 L t5PQ8 D5tcju t$6G` twH jP6"b 7E (D W)fWfW7PQR7 ED7fGG G jWD$0a 1^_[]øcUSWV8L$X vD$L$TD$LD$$fD$T$BD$,1L$ L$ T$ɉL$0L$D$(111$9D$ df9l$u1ҋt$Xf9l$L$I T$T$LB4 4$4 T /\$|$LG$tփ Tߋ\$f9l$v8DL$TAʉ$T$LB4 4$4 1f9l$w;L$0s~9D$ txf9l$tFŋL$LT$4I)fJfLBЃ|$ߋ\$Vt$P5T$@|$$ 9D$tD$(tD$(L$LfAfAD$@(tB@L$;L$u3Af;D$rfAf9s D$LAʋL$P J)fBff9l$vD$Tf)D$PD$$D$9D$ 11st$TF$\$ $ ͍p\$PC)fCfDK؋\$Rt$P_4 9D$ |$1ɺf9tT$T$R t$t$TF$\$ $<|$Tt$ KT$tB։t$ 't$TF$\$ $1D$Pfhf;|$,uD$PfhD$$8^_[]Ë\$_ffffUSWV[r|$0D$$pFtjP6a] F wJrr GF(uI1G@T$(:zD$ PWltGVD$ PULg|$ $NL$fNjP6\ jv6Z >1ɃYh &5F,jj6=Z Hʁ@ TP|UfMjP6[ jW6Y u\F,jj6Y =H+@ )H| fBjP6E[ jW6HY uǏbN(NPf9$fL$N,L$;|$^OjP6Z jw6X COPf9t$&$fD$N(uNftx$fL$N($FfD$1fOLH|jP6Y jW6W 1Ʌtz@ t닁$fD$N,L$;|$t7OjP6sY jw6tW t OftjP6EY $(|$FtPHF FF($nf~ F(jQt$4Pt$8RV{(!@u$Fjt$6X ^_[]H@ nfOLH|jP6eX jW6hV uxjP6?X jW6:V 1xjP6 X jW6V HUSWV[Wl|$l$t$FtP#GF FF($nf~ F(^_[]USWV[lt$,VT$RQ ǸD$(>  .,$OfL$ D$ŐM;tjUD$0V /GfD$ wfteL$A ;Mt jl$l$UD$0V El$ jPD$0T HfOD$fOWt$t$' ulHHf9Ou8pjPu6V thjVu/T fGOT$(‹OJ/L$;EtjQD$0U D$((fpL$ fH1^_[]ËD$;MujUD$0U иfffffUSWV([iu~,jj6aS )|$FD$ VƋʋfqDBtjR7T jV7S D$ L$yftZ1ցϋD$ t@t$΋Mfq Pu Q% tKOT$뵐1ҋL$A uN1f}%L$A }ED$ 1}  fueL$ItZjQ7Q D$t=@fD$D$Pu W$ Ljt$QS D$ L$If9uYL$ItNT$ jQ7~Q D$t-fD$D$Pu Wn$ t,jt$Q9S D$ T$ MfW e^_[]j|$WQ S D$L$N FE;t$1ɋ}L$Fjv7P tVHɃ9jt$V}7R L$;t$uD$1ҋt$jt$VQXR D$L$O GE;|$1D$Gjw6P jPu6D$Q D$;|$uL$1}fVL$tgL$}LHLL$fFjP7jQ jt$7jO L$rL$1룉jWE0)Q D$ ufzD$tguD$DA|jQ6P jW6N tFP9fyD$uujQ6P D$ Ufff̀rS[d[ÌrS[d[Ḉ̀rS[ðd[̀rS[Ðd[ḹ̀rS[pd[S[Zdt$ t$ jt$$t$$t$$t$$t$$$ [fffffS[dwt$t$t$Ѓ [fffffYcD$PP|PxPtP pPlPh@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐUSWV(^bL$<A$iA D$AQT$QT$IL$1t$$l$ T$|$ L$L$L$L$T$11T$!T$L$#L$ыD$@ȋt$(77)(QjPr F\FYFUFQFMFIFEFAF=F9F5F1F-F)F(N( $?t?(WjPr <$WV<G4G0G,G(G$G GGGGG GGF(N V$VdN`PVT$r1 ɉ 9ujhjVgq^_[]ÐY{]D$PPPPP PP@(@,@0@4@8@<@@@D@H@L@P@T@X@\@`@d@$@ ÐS[Ê\t$t$t$ [ÐS[Z\t$ t$ F[ÐS[:\L$T$ j[ÐSV[ \t$ tAj@PV p FPhjPo F@FDFHFL^[ÐUSWVX[$T$dQT$hQ T$pQT$lQT$tYQT$xiQ$T$|Q q,$q($q4$y0q<$I8D$D$8D$$ދ\$t$l$D$xD$$T$D$|$$D$@$D$D$|$ $D$$L$$$D$(|$lT$pD$dL$hL$4D$0T$H|$LD$(D$,D$$D$Pow(o)PQjPAFQjojPe FP3nPtPWjPe UVj~jUe FPNHVLN@VDPV^_[]ÐSV[iQt$ tAhj@PVke FPhjPe F@FDFHFL^[ÐS[ Qt$t$t$ [ÐS[Pt$ t$ [ÐSWV[øPt$|$t}>v6Wv vW GvvmWGvvYWGv$v EW$G v,v(1W,G(hjVc ^_[fffffffT$D$fSVP[OD$L$t$$hjjjRQP $^[ffffffUSWVX[ÏOMD$<D$&xdḰ v~A:D$L$/! -D$D$D$PjD$uD$PjX1 D$D$D$ D$D$ D$D$D$D$D$D$D$D$D$ D$ yD$D$ 6D$D$ !D$D$ D$D$ D$D$ D$D$ D$D$ D$D$ D$D$D$D$ jD$D$ RD$D$ED$D$ %0D$&LD$D$ ( D$D$ )D$D$ *D$D$ +D$,D$D$ < D$D$ D$<D$NQ;WvRPWt,NQW QRP FEE1^_[]ÐSWV[eCD$ Puyu A tgt$TQA LuH $D$0 L$RWQPVu$Pt$ ^_[ÐUSWVT$t$nJ)rͅt+61> :8u 9u)ˉ^_[]ÐUSWV|$D$Ho9rt+?޸T:Tuu9^_[]fffffUSWV [BT$0|$,D$(L$$)q092sVP$D$00$D$ jU0:+ Ÿtr|$9rL$EQPt$V jUD$(0,D$ )t+Ɖ4$juD$(0* ŅD$u1 ^_[]ÐUSWV[$AL$$D$(T$xD$PQk1,$ŋD$EEEE E9rʍET$ Rt$P EtFjVD$,0+ L$,+|$ $t*D$D$Pt$(L$njUD$,0+ 1ɉȃ^_[]ÐUSWV[@|$D$ hj07w) tk@ uVxPQ4$9vDt$jW66) t9<$)HL$PV9|$w jP7* 1ɉȃ^_[]ùfffffff̀rS[P?[ḿ̀rS[0?[̀rS[?[S[>[ᐐ̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fUSWVl[D>$$t$T$l$$;T$ 1$t$L$)v-Bt RuD89D$"9s$)lml$ `uD$8x4xI+`|$ LL$1t2`r/j`PWD$ CD$ `1t`rŃ`j`PWL$ kCL$ `댃$t!$9b`Y|$ D$荫P$ $` $hjD$ PB tF;EuED$E$D$ETt+hPt$$VD V2Nƃ t$ $tVD$PQ[BL$ t$$uO$;$uSuO-wBILux||$|$ $u5$t&M0;$^_[]Ë$lD$|$ $$Pt u|틴$L$t$T$9rD$Pt$U>A 1gL$Y;L$OM :$ffS[,D$L$ AQ jQ0 [ÐSWV[È,|$t$t+jP6 tH  W6^_[ff̀rS[ ,[USWV^,$ 89uL$)у|$4sk1Ґ  9u|$h)׍ փ|$8siу|$41Ґ<,,<|ll||ll|| l l | 9uk|$h|$8r^1Ґ$$DddDDddDDddD9uD$$hD$ht$l$L$HD$h9L$\$VWT$tL$uӃ|$,\$h|$ tOD$tY\$1L$\$0899u\$)|$4T$ ًT$t71t$ \$  9uL$h)|$812<0<20\2|0|2\0\2|0|2\0\2|0|2\09ugL$|$4rZ1<t̐Gtu1uOHO tww$Ѓ gq?81pjPQwa1;uOtww$Ѓ glOWL GO tH O N^_[]SWV[èt$tst7T$y H@΃|8t  1)<΃ DP@VP N@^_[ø4b'Pjj%QUSWV[D$L$Pt prxxp| pPxtz xyV1^_[ÐUSWV[t|$ l$9v`wDt9xtNȅuT$81$Xq36<61*׋PtIQPEjPQD$ pD$,_L$9u{,$}D$$u~E{T \$$ Lt DxHPp tr p u@UP MuHhs~y;5ObE T$EDEt (lD$EEJM )BtuW$Ѓ m^_[]uQjD$pv( D$ L$Q$ЈA1ÐSV[it$ V P1tHP tQ P V1^[ÐSWV[t$>gthGt tww$Ѓ gpNjPQwu];u<tww$Ѓ Xt3^_[ffVSD$ L$t 8trtl@͉ ѐލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffSWV[øD$t$tA|$1ɐt 9u)tPjQ7& ^_[fffffffSV[FD$ D$D$$jVjU ̙ uƃ̙ tjjjjVjU jjfffffffUSWV[ät$0|$,ttq1TD$4H @ft]D$(D$ l$l$D$ $D$jD$8P< Pt$8=t +l$1jt$81^_[]fffffffUSWV[D$(@x>T$$B tzu?Rt*0 0F \$L$()}u(D$ $L$ L$)1ۋD$()xUt|$ $u<ut}\$Vj Wv t) FT$$|$9rË:J|$ ;z$vLz9~C\$Wt$ t$# D$$8t$$T$(thA9},ߋ\$Wt$ t$h#T$0 )z:.\$Qt$ rD$0P,T$0 Dž)<$\$RDT$(1Ʌ$\$PW2"D$ )G|$)1ۋD$()Huut}ZB B|$ug9sc B)z $19rɃ\$QPT$$+ZZZBz $ B |$uO;Bvh9vd$\$4$WP" D$$ $t$$L$T$( 9J9s\$VWP! t1)=rT$$1\$PWrD$0P,T$0 J @e\$uut}rPWrD$0P,T$0 ~)ƋL$()Au1ۉ؃^_[]ffUSWV[ç |$tpjWG 1o7)/1ɨuOOtVUwW, ~f)uODt_wу;WX0PLWrX, jW ^_[]ÀO @1USWV[ t$N 1tT~tM.)>1uFFtUWvV, ~)uNDtvу N @1^_[]ffffSV0[F t$̀rS[ð [S[Ú jPt$t$t$[ffVD$L$ t$}t :tw@Nuo͉ ѐvR1ʃ€t㐐:HPu88ъPu )8ъPu 8uHt:t@Nu1^ffffSWV[t$d8u]N uRt8F0t~@9tRdF0N FFfN ~u VCN u1uVVF11+NN^_[fffffUSWV[$<$G G$=tUL$QPxC#T$ L$xt+OLuo(1;x $1D$G u9tiU.t Go,$̀|$t)OtPt ,$́f o GfxH(T$PQj@RT_1ɅD$PuQ(P1҃/w,'D$1T$ DQt$L$ QjhjjjjP |$ t:L$u $O GCGG;$u"Đ^_[]ùT$tщ1USWV|[ô$$$F=tYQPxI#L$1 ED$ht1FLu*N(1;x E|^_[]fffffS[ jt$ [ÐUSWVP[d8|$t$F0POF0PR9tnPj[SF0Pt8PQPjt$"SRN0PǁTt!ǁXN0TtXXu\QjRN0QN^_[]ÐSWV[d8tR|$G0PNG0PQO09t,Pu'QO0PǁT 1T1QKN^_[ÐSV[Id8tJt$ F0PNF0TuǀP8POF0PM^[ÐSWV[d8tn|$t$F0PMtF0Xuj\PQF0TuǀP8P|NF0PKM^_[ffSV0[FD$<<L$,QP1;T$,uȃ0^[Dff$D$4̀D$̀fffffffT̀rS[ð[Ḹ̀rS[Ð[S[zt$ ht,@t$! [ffffffS[JL$T$ Pt$(t$(t$(t$(t$(t$([ÐUSWV[|$t41 |t$t$ t$ Ww uD$ <=u.|$$  9ttD$0 M9u; s|9v9tfPǃ ǃ $jWP 08uyPD$0t$ )$jWP v0o8u4)  $PjQ  $ L$ ^_[]ÐUSWV[ t 81t0 DtPVt Hى|$ jjD$P tE t5jVt$^ F: tVt$cV6ŋD$ 9tPǃ ǃ  UjP ^_[]ÐUSWV[ 881tR/tL,t4t$t$U uD$|=uօt D$1^_[]ÐUSWVP[f |$1|PWtfƀ<=t^8tR)tI1 $ $lt+Vt$U u|5=uمxD$8.1^_[]ÐSV[ù dxPFƅt0^[ÐSV[y dxPEƅth0^[ÐSV[9 dxPEƅt(0^[ÐT$1ɸ;T$ rщÐT$ 1ɸ;T$wщffSWV[ø t$D$L$~tQPR = x FPVTf ^_[ÐSV[i t$ F tBNtjjjP !ƒtF /8u;F %T$L$%fF vtRQPe; ^[øUSWV[ t$D$L$|$ ntWQPRt !N tfN FPVT fN ^_[]ÐS[Z D$HtP<[ÐD$L$AAA USWVP[ D$(1t8pF$+~t$Wv T$ t lu1^_[]ÐUSWV[ä D$(tO@$@D$1lt#$+pt$ Vp T$ tԉЅt$+p1^_[]ÐUSWV[$ D$(tO@$@D$1lt#$+pt$ Vp T$ txԉЅt$+p1^_[]ÐUSWV[ä L$(|$$oE4҉t$tp΋M)VWu ։L$ у t+򐐐4t!+}t$(Wu T$ uډl$эU$]ʃx!|$$F$^11|$$ ˋ4$9;TulMB M M,D$(J $jl$1ɉ9Uʃ|t _D$;ubt$Du44p p<$7 Ɖ7x11x$304~04t~S ^u\w4t,s su މu{11{3uVUTtr JD$$`D$(^_[]ÃL$$D$ $ 9l$ tԋUуMtċZtl$J $\$݃1ɉ9Uʃ|_uMoo M M,^USWV[ T$0l$,EHtW0x\$pdڋu\$0XM $9ωڃ49D[X1҅‹p 9E _q+P9DuLP}T)ʍ<\ڃ $\$D$9t tT$ Y\$T$ $ \$9‰$ q q\$X1M $11]19R9t"9:v9u)Ή 1T9$V LP\$YT$ 9t\$Y$2$ q qOXރ OH ΉwtGt 211t(tAuOtAuZO t YGA1D$L$$t6 ruLQU$t?$L$U$1)L$^_[]þT 0ېffffX L$DHÐD$L$ DAÐX L$DHÐD$L$ DAÐXK L$DH%ÐD$L$ DA%ÐX L$DHÐD$L$ DAÐX L$DHÐD$L$ DAÐX[ L$DHÐD$L$ DAÐX L$DHÐD$L$ DAÐX L$DH%ÐD$L$ DA%ÐXk L$DH ÐD$L$ DA ÐX L$DH@ÐD$L$ DA@ÐX L$DH%ÐD$L$ DA%ÐX{ L$DH%ÐD$L$ DA%ÐX+ L$0DHÐD$L$ DAÐX L$DHÐD$L$ DAÐD$ÐD$ VT$D$11)ʉT$D$΋T$ D$11)ʉT$ D$1S\$D$ ËT$D$ 9s7Wd$\$L$)ыD$)1҉11_[^)W d$\$L$)ыD$)1҉11_[^ËD$L$1ËD$ 11[^fffff̀rS[À [PS[i m[fffffffD$t8t9@€tuuuuH+D$ÐffS[ d8t[Ë`[ffffS[ú Pt$3t[ËD$y1[ÐfffffffVS\$ t$tCFtU8tOu9CV9u !€tސCFt8t)[^fffD$1ÐÐÐVL$t$ 1t|$t1Ҁ>1 U^ÐD$T$t|$ t1ɀ: 11ÐVD$L$t|$tt$ t1Ʌ 11^ÐD$ 1ÐUSWVl$L$t|$ U1u9)tt2<2t1ۅtރ1ҋD$(tU01^_[]ÐUSWVD$tT$ l$$t8|$1)t 7tt1ۅt1u1^_[]ÐL$ 1t|$t T$ t 1ɋT$ɉ øUÐD$L$ sT$1t UÐUSWVL$\$tl$ 911t=w,tu $1ۅtuЅuU1t9L$(1^_[]ÐUSWVt$t|$ l$$tB\$11 w*tu "1tu11 UU^_[]ÐSL$T$ 1t\$w 1 U[ÐD$ L$r1ÐD$ L$r1ÐUSWVPD$$$T$ L$t|$(21ۃ|$$tLtH$1퐐t.<.t 1t]9,$tЉ)u1T$ D$0t21^_[]ÐUSWV\$ L$t$tl$$D$,9tAtE1ɋwMtu E1t=Q9tхu 1҅u 1҅tL$91ɉ^_[]ùU1uߐD$L$A@1ÐÐ1ÐWVD$$|$t'L$T$t$1~961Ʌ21^_ËT$1Ƀt)|$ t&Uu/T$w#D$1 T$ÐVD$L$ t|$tT$ t121Ҁ9 11^ÐD$L$s|$ tT$1t UÐD$1Ð-|$ tËD$1fff̀rS[@ [S[* j1[ffSV[  u# VFu蠵1 ^[ÐfffffffD$@@#Eg@@ܺ@ vT2ÐUSWV[t l$$|$G? OW@)19w_WT$Vt$$PL$ ; T$]$19s'D$ 0L$>@9r|$1T$ )URP^_[]ÐUSWVD$T$8 MÉ19Ɖȉr$򐐐t$ À019t$ rӍi$tz0tu0n $rFNj\$jj VP/4)0M1ɾc9ىr0E$)T$ 9‹t$$L$ǀ|$tD$ D$<p $F \$$=U $1҉Džy1D$D$s $tD$ T$ D$9s 09r9s 09s9s09r9s0붉L$L$(ʃ.D$9tTFl$@E;$u ^_[]蓗fUSWVP[F 1($t5h$~xX~f tWT$ ^_[]ffffUSWVP[־ D$l$H1 m \$D$H1yt9~u~f;{uًv;suD$t~u밉΀~t뉋t}u ~vD$$*jt$P tAt=}txuHT$f;Ju׃xux uxuxu1^_[]ÐUSWV [q $,<$Vf1f $$0~ )$,$0hL$ QWPV菖x[9wQWGPҚ;$$u;$(u$ D$ Pmȋ $ $1 ;$u ^_[]衔USWV [Q $ <$q if;$$$(J ;$,Ѻx$ #ȋI(ux(u ff9<$|$~hWV$0W$0 xS 9wIVwFPh$,$,PW|$Wu11<$<$;$u ^_[]9USWV[ܺ ED$} PjjQu2\$P\$ $PuT$$\$XT$$M%5u %@;|$ t$xQt$4t$"D$uD$Ea !4X>Pjj@|$ uD$Ea 4X~>PjjQM94XQPuutD$T$t$,jhP諊] L$ t$,u$t$t$P .D$]L$$T$4X<>PjjQ3T$(L$4] ut$t$0 V3D$1Ճv8o0D$t$W%>=PQRt$4 ;0 D$D$D$t!4XN>Pjj Q=180D$W膰tD$tZ>4XVPQq uV2D$D$4(fp8i0D$t$W7 =PQRt$4 50EPZ2D$1ߋ] 0>D$480D$t$Ww%>=PQRt$4t 0D$kt@\$ 4X>Wjj"P裛M9\$ WPuu$u|$ V[1|$ EP]wm4scD$t@4X>WjjPM9\$ WPuu薑EP0]`t~D$D$D$ cMTt4X>PjjQ芚uVl0D$1D$D$D$1D$D8ut L$$ȉƊFD$<t1D$,<tL$,CD$HE D$ENL$DD$<D$$t$LS8EP/|$6L$u/D$46D$ߋ]t$L{D$lL$lQ$QP] x]$:FuQ<t <uI$f;Fu;$;Fu/D$f;Fujt$H$P] tu.]xusEP.FjhPP蕄 D$E>|$t$,VE  Et$<ƉL$ QPjD$$P$P$$L$\D$XVt$$P$$L$dD$`jD$\PE ;D$$D$fD$ fuPVE sL$ f)fL$ uωufD$8;u~5D$D$t4X=PjjQEfL$ f }\$ PWE fL$ f)fL$ u̓|$|$ tOEHL$8Ef)fL$ t6=rP$PE ~L$ D$M f1D$uEa 4X=WjjP&M9\$ WPuu襌SD$08D$VG==PQRt$4DD$t$@D$u`!u(4Xh=PjjQj]D$u a t-L$@U9ȋ4XQPuuVɋ|$D$„u%uu*])D$@Puuuu t$hуuE˅R@u*]C L$h9L\$ +D$ 08D$t$V==PQRt$48uV *߉D$D$4yD$80D$t$WT==PQRt$4Qy0뒋ՃR8K0D$t$Wx==PQRt$40D$4ߋ]D$4D$=Mt$,V0 uV)D$D$4qD$t=4XPQRi uV((D$4+f|$8]KT$HT$H9W؉Pt(|$D$4uA|$tJ(<D$@؉P1(<t0j=Xf|$ ~80D$t0\$ WLx==4PQRWA|$ c0u'x{USWV,$[ 4PD$PWt$ QR;0E;$(u ,^_[]Mzffffff̀rS[ [D$L$ T$HffffffVD$L$T$ t$pH^VL$L$ t$t$D$T$ pT$Pʚ;|p6eĉP^SWVD$L$(T$+T$ |$|$$t$19}ʚ;)ڃx)Ήp^_[L$D$+L$D$ t1Ʌ ËL$19L$ yÈÐUSV[ð uD$ Pjjt*jPix/$iL$T$VN*D$FD$ L$NFFe^[]D$L$T$ PiL$HUSV[ uD$ Pjt*jP蹨x/$iL$T$VN*D$FD$ L$NFFe^[]L$D$T$ QMbl$‰QffUSWV [A $0;t$ s E$EtJoCP|QEDt%uHBPW u퍃CPAQBPBtBV[ML$0 ;$u ^_[]\USWV[× t$xPdžft91 9s)tQDŽͅtMtt|E^9utxt PW^džtP^džf^_[]ÐUSV[Ð Eu jPL$D$F$F]fF e^[]ÐUSWVx[/ E $CPyJ뤋$H 뛋$H@뒋$H뉋$`뀋$H@t$Hh|$]kPV=?r?D$PVt$k D$L$Ƅ|$kPV?r?D$PVt$j D$L$Ƅ($H^_[]ÐUSWV8[4} t$P|$Ll3 h3 p; t|W9h@tV|x$D$D$%D$ D$D$D$@BPjjjQt_tt.@BT$QjRjjtv_w"t F F 1.jW!t N N 8^_[]ÐSWV[ø{ t$xP=džft@19s)tQDŽ^_[ÐY+{ D$tÍ ÐYz D$t(Í]BÐUSWVL$A t$yt(:u,T$t't( r t(rt(D(B2!D$(G B GBGwr΋L$A 9}퀍S9|^_[]fffffff̀rS[z [SV[y t PP zP@z ^[ÐSV[éy t$ t P zP@z^[ÐSV[iy tP^[ÐSV[9y t$ tP貞^[ÐX y L$@zÐUSWVD[x $X$`0@D$zP@z$FED$$PC;1D$(D$ D$D$ |$|$'}$XD$|$D$|$#EL$H@ u uuPt$sV0n|$t4oE1tVPInEub|$tT$D$ D$L$9AD$(A D$W=)D$$QPt$| |$|$D$@1ɅtbL$ #WPǃ)|$$=WUl$U- L$ l$$XD$@DuL$ D$+D$L$(L$;ED$@ ;D$$|$OP1R踊 L$l,G )D$$L$D$D$ l$$X|$D$'h 4$؛u 4$进4$貛|$MmxD$(AT$ $Q D$ ) $iL$ )ŋ$h19Rt0U͉ $A,Q )׃9t$uы$@L$t$ 7ƃ)Vt$$U| $(|$ tM1D$D$Pƃ)rWVt$U= $@L$,9D$ u$@L$ t$O@4$d$XF t$Ov D^_[]Ëu WnO֐USWV[gt |$D$(HJ @BzP@ztLƐw ww7Vt5Hp U1 uV}'G V]G ^_[]fffUSWV [äs ǃ$ ǃ( ǃ, 4 @ 8 D 1ɾ\{4rfC08J1t tD )L F'CǃL  , ͅyy1, upDǁw 9DPKtw 9D( ueP$ ( ~), uǃ, hPǃ( 4 8 )ǐM\{rƒƾ#$su*9 8 D 뽍Gr;< MD 8 ;< dD j8$P PKso1<$ )ǍKKPWQRj/s?ǃ( 0H P ǃT ǃX ǃ` D ǃ` D HD 8@ ` ǃL ǃL ǃL ǃL w0 'с''0 '='l'b!` 8 )8 D )艃D u[VwSO8 GHD L H, yy1, JJor?J΁w.9Du% G;< s) $K;< 0 ҉L$t'='r '4 D$$PUTDn)4 <8 4$@ #D=@ L$0 < L$ W8 OPD L P $,UPC4 ,8 P@ C@  $0 < M8 EHD H H<4 D$$PUC2)4 48 4$@ D$BT$@ L$0 < GV8 NPD H Pǃ, ( ~( p0 t'wu'r '8 $P6tBƉ4 ʼn8 4$@ At@ 0 < hPj ^_[]1USWV[l 81ɀ8 )σX t\ UVNtqT U09t\X t*1퐐T V4tV;X r߉\ \ P PQiuKZL(LKPWQRjAm!IL$LVPWQRjm^_[]fffffffUSWV[j p ƃp t  d  h  x t | u' hd x | p @ d t ${O:tnq6w LKN{N9u 뷐KNf;{NtKRO;|3Oҋ D$ 4$t$CM |$)򉓔   t_PtU tK 1ǃt2<2 u,Dz#)փ  D$ L$x | ,},T$t &M d E,E, E9c9 }(RL$ |$щ)ʃ|$  $sQ߉ʐ JHJHJHJHJHJHJHut1 : 89uD$|$,$},uǃ ET$)E uY$}u}M QW<Eg)Ɖ D$L$,E <$t r }ts1l$ d %t% t x | I9uʉ x | @ 豆x | @l$ d WjPƉ d uUU8yGd x | @d WjP` td  x | ,u1u?|$ tE,1(d  x | ,$|$D$ ;E v:Vu:l$ A Aq NjE 8L$@DP $1t$hL L$ D$ 19S<2 uDz|2 uჃDz؅Bx | @  t ։L$9Tt$t$ 2 t T$kO9tt Ly6w KNt$kN9t$u 말KNf;kNtKRO;|;OҍQ6w KNS N9u t$.t$KROKNf;S NuSO:t D$ :${O;L$tL p6w CN{N9u,럐CNf;{NuCRO;|3OΉЋT$T$$Љ t 4$kO9tLy6w KNt$kN9t$u$뗐KNf;kNuKRO;|;O΃ 4$-h j tOƃt d I4d h =4Xh )  v:tvƊt_L$9 $|Gy $ DAD.D$8V9s .1%0PPjb^_[]Egf|gggSV[Ù_ x tz N9|  QP 5x t{NDDDDD DD .j)x tǃ ǃ| ^[Í+hUSWV[^ j03)ƋD$F P)FF~(Ff~FF,x t | 1ҋL$9u<| F(x th| 9tF F$F|(x | r R d  ^_[]19u뫐S[\  4QPRڷ jЮSWV[[ t$8x t3| 9t^t, z x t7| 9u | ~t v5V5^[19uΐS[Z t$5[ÐWVXZ L$ tsAQQBQQAA,x tD| 49u4| 4~ v d  ^_19uSWV[Z t$trTx | t/<t) z l$ E)VPP? f}T$$DUMft0uf1f9sf1Kt$$fums)̓fftg,$T$1f)f9t9Qf9r1ᐃft1f9sf1qf9sfq׋T$),$fs$\$ sl$fs1^_[]1ftYf9tljTYf9r1f4YTYf9r1ftYTYf9r1ftYTYf9r1럸ffffUSWV[ÇF t$nEtjPu1 EjVtE 1tM u1@u誋)k1Ƀ Vґt^_[]ÐUSWV([E t$@l$<}GtjP71 G ujUz0 81qujWjjjX 4G$D$D$ D$$D$!D$D$ L$jPQUU$L$D$L$jD$P L$9jD$PD$P밾L$jPQUUu*t$t$҇ ;D$uTjD$PD$PˋL$O$t:jjjV!уtRPg u !1(^_[]fffffUSWV[C |$ t$tGw#jPRdžL$G|$$1D$@DA,Du!@Mu:O}GQWPUVu^/|$$KQ;v RPt2MQUQRP EG/1^_[]ffUSWV [äB |$(l$ E,D$jju+ $1\$>\$LHQPu- jt$u+ @ )HfOTH9t,y;l$$vًl$ $Yf_T$|$(<t\$M)1ɋ\$+a$tg;l$tY1<Eju6* t%MLH<jP6~, ;l$u a $1MED$$)fE ȃ ^_[]fffUSWVP[@ |$ L$T$iD}w QR jM $uJ t t})Ƌ $9u>EDEf $fDMftMftMfMB8D$H1^_[]Ë $LM))PRQAT$$ fL}1fD};<$L}D}ftfL}fD}ِUSWV\[ô? t$pF D$=tD$jjt$|VD$4-jj$VL$4I H Q*f\$D$<@D$01D$t$D$T$$t$$D~ L$ ~)L$t$0D$ DF)D$D$ Ut$HP D$ L$ f FD$L$)ȉD$.Qt$P L$ Af,FfɃًT$уfLFflF $T$$tz*9 $f|zz t$)ŋ\$UL$HQt$xv ;D$tT$$DzL$f+L$tH)ЉL$ *\$VPQ ~ff+D~t$frflrD$ $ $t$t$D$9|$1ɋt$4L$4yf $T$HCT$Qj1Pj(t P1ɉȃ^_[]Ël$,\$DDL$%>$D$,8J 뿐USWV[D0 T$B =t $|$ t1|$,t*|$$|$(tMj<tuW~T$ D@aHf=tfWtfO1 ŋJ D$@ ) PhQ> L$D$ L$T$fB81^_[]ÐUSWV[Ç* D$t$@ 1=r L@%,;V$n$NV DHjWPVr`HP T$IL$$f|HtQH$,T$,*h+,$j1|$0fdž $dž(HT$hW T$DHjWPVq+l$͉ $l$,t$0t$ED$9G u*D$G4$P- L$,1TAGDHjWPV^q t&dž(@f8u$dž  ^_[]ÐUSWV[r! zA =tl$$G)B fT$L$D$ uf͋t P,$Uj|$(todž(dž $FDGjRPVNptiL$T$$щ $t$(t$$~AL$D$ 9A u$GAL$$t$PQ ,$d@^_[]DGjt$ PVo t׋@f8u$dž wSWV[ |$t$T$t$ t$ j$ Gt 1^_[ÐUSWV[â T$$wA =tF)G D$ *$Ffu^L$t P:4$jL$t$,t$,jWQPt$DFjWPQ|ntjt$t$,t$,t$ $t$~>D$ 9G u%FGL$$T$UPQ $>Ѓ^_[]ÐUSWV[T l$0|$$D$jPj t{t$ ..., where is one of: chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodmkdirmvpax-shchownchgrpdmesgfsckfsck_ffsifconfigmknodmount_cd9660mount_ffsmount_msdosmount_tmpfsnewfsmount_mfsnewfs_ext2fsswapctlgzipgzcatgunzipchrootcgdconfigwsconsctlping6jѐ) @;.y!tvM! : )=EjxjjjkX!k&khX#k,k+k4k [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortinvinv1inv2voltagsf:CHANGER/dev/ch0%s: opencan't register cleanup functionunknown command: %s%s: too few arguments%s: too many arguments%s: inappropriate modifier `%s'%s: CHIOMOVEinvalid element type `%s'invalid unit number `%s'invalid modifier `%s'%s: CHIOEXCHANGE%s: CHIOPOSITION%s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOGPICKER%s: CHIOSPICKER%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: INEABEXENABACCESSEXCEPTIMPEXPFULL Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu %s: CHIOIELEMunload%s: CDIOCLOADUNLOADusage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s status not availablefm~6vivӔvߔ@@nv;virvs@@xv~vv! vv@@i0@@vunblock and -DNO_CONV?@`~ unable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipconversion record sizeconv option disabledblock countfile countinput block sizeiflag option disabledskip blocksmsgfmt option disabledoutput block sizeoflag option disabledseek blocksprogress blocksposixusage: dd [operand ...]%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicescase conv and -DNO_CONVdupfd IOfsync stdoutclose%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input3rrrrrrשrrrrrrzrrrrrrrrrrr˩r'3I100 0abcfGgHhiklmNnPt:Wonly one -t option may be specified.only one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %stotalCan't get mount informationempty type listcan't allocate type arrayNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1024-blocks1K-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on %-*.*s %*s %*s %*s %%CapFilesystem %*s %*s %%iCapiUsediAvail/home/source/ab/netbsd-10-llvm/src/bin/df/df.cprtstathflag == 0blocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Usage: %s [-aclnW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... Mounted ony!vvvvvvvlzvvvvvvvvvvvvvvvvvvvvvvvvvvlzEt:"vRvWWv          WUsage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp fileinvalid address/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileEnter key: bad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileinvalid pattern delimiterunexpected end-of-file& no previous commandcannot open input filecannot close input filenewline inserted newline appended cannot read input filecannot open output filecannot close output filecannot write filestdin: %s cannot read stdin%ld  \abfnrtv\p:sxES ? interruptinvalid filenamewarning: file modifiedscript, line %d: %s invalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionno matchfilename too longshell access restrictedinvalid mark charactered.hupHOMEno previous patterntrailing backslash (\)infinite substitution loopnothing to undo@ mdT! mmm]"mm{mm mm mmmm@m@Ȉ m҈mوmm mmmm8@mmNm  m TAPE/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%s: block location %u internal error: unknown request %ldasfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d WriteProtectMounted76543210%s=%o%s=%xusage: %s [-f device] command [count] ""$W"$"$$$$`"$!RCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloc468KLdel:np:u:wtcponly super user can use the -u optionshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrpollusage: %s [-46dn] [-l login] [-p port]%s [login@]host command [-u locuser]port must be between 1 and %d-FFkF'GF'G'GF'G'GF FtF'G'GGFGFp@?B?%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dbC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: needs_cleaning returned %d%s: clean_fs returned %d%s: shutdown/home/source/ab/netbsd-10-llvm/src/libexec/lfs_cleanerd/lfs_cleanerd.clfs_cleaner_mainnfss == 0LFCNSEGWAITALL/home/builds/ab/netbsd-10-llvm/i386/202506021310Z-dest/usr/include/ufs/lfs/lfs_accessors.hwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xlfs_fi_getblockidx < lfs_fi_getnblocks(fs, fip)usage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progressincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorcoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blocksbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost tail/home/source/ab/netbsd-10-llvm/src/sbin/fsck_lfs/bufcache.cincoredepth <= nbufsgetblk!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)brelsebp->b_flags & B_BUSYpseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%x/%d /home/source/ab/netbsd-10-llvm/src/sbin/fsck_lfs/lfs.csb0 %ju, sb1 %juAttempting to verify newer checkpoint...** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data check_summarybc >= 0Not enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x lfs: ifile read: cleanerinfo: error %d lfs: ifile ino %d read %dlfs_valloc: inuse inode %d on the free listlfs_balloc: bread bno %lldix < ULFS_NDADDRlfs_dino_getibix < ULFS_NIADDRSuperblock magic number (0x%lx) does not match expected 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) lfs_dino_setdblfs_dino_setibFirst alternate superblock is no good, using primaryPrimary superblock is no good, using first alternateNo -b flag given, not attempting to verify checkpointdone.PY't~>>!0 [_   8ßܟGܟ0addwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgekeeplabelyes | nomakewedgessetcachenone | r | w | rw [save]strategy[name]synccache[force]Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flush'badsector retry' must be used %s with character device%s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge dk name too long; max %zd characters%s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable not %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s successfully scanned %s. rw%s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s forceUsage: %s device %s device command [arg [...]] Available commands: ;,^^*e^^qK^^^^^^^^^^^^^^?^]^^/^^^^^}Z^^vܭ=     /Fܮ[zǯ+C_ {!#$&123456899ǰ:;<=0@?ASBCDEF G H J#L@MQNXOhPxQRST²UʲVW\a!c+dfefghipqstu̳vwҳx=\i~4Qiʵ+Gagȶն߶$7BLdvƷط???Xwø1MUֹ'R2ͺ1Tgzٻ; a1B0123FSafgiIluvA:b:c:E:r:s:w:z:Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.bad disktabInvalid sector size %zdBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.Cannot allocate %zd bufferExtended partition %d is not defined.Which partition do you want to change?Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table/usr/mdec/dev/rwd0dusage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing E%d: link: Bootselector , infinite timeout, timeout %d secondsFirst active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: Partition %d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d %s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*s Extended partition table: %*s%d: /%lu/%lu%*sInformation from PBR: %*s%s: PBR is not bootableNot bootableSector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found read_disk(); fd == -1read_disk(); secsize invalid%*s%s: "%s" %s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicCannot determine the number of headsCannot determine the number of sectorsInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?mbr_bootselmbr_extDefault bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Timeout value (0 to 3600 seconds, -1 => never)%d: The first active partition %d: Harddisk %d Default boot option%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. decimal%lld is not between %lld and %lld. The data for partition %s%d is: sysidbootmenuThe bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sector%s: [%.*s] (space to clear)'%s' is longer than %d characters. Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsDo you really want to delete all the extended partitions?Extended partition busyExtended partition outside main partitionreallocarrDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Do you want to change the active partition?Choosing %d will make no partition active. active partitionAre you happy with this choice?Making partition %d active. Do you want to change our idea of what BIOS thinks?Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectors%s is not a character devicecannot opendisk %s%s: bad disktype%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionwrite_disk(); wfd == -1 [n] %s: [none] %s is not a valid partition number. secondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld given GPT header location doesn't seem correctcan't delete %s GPT header We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Geometries of known disks:Start sector already allocatedNo free spaceNo space in extended partitionUndefinedPartition table:No active partition.Extended partition table:Extended partition table is corruptNetBSD disklabel disk geometry:BIOS disk geometry: Boot selector configuration:Select the default boot option. Options are: qfpz2r!Hն(,WW!W2r!&(( qfpz2r!Hն(,   fqrs:wsector number (%s) incorrectly specifiedsector number (%s) out of rangeUpdating in-core %sdisk label. and on-disk usage: %s [-fqrw] [-s sector] device get labelInvalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSset labelNot updating disk label.No change; not updating disk label.# %s: type: %hu disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10hhu %5u %5llu %5.5s %5u %5llu %5hu %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%hu partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashdmrumpdMP +,$-   $0@: W!/A 6@,@A>getmntoptsmount table fullspecified device does not match mounted deviceincorrect super block%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedasyncgetargsrelatimeusage: %s [-o options] special node Warning: realpath %s"%s" is a relative path.using "%s" instead.MP +,$-   $W!6@A>bdiN:no:s%slfs_cleanerd:m:%s.pid/var/run/%slfs_cleanerd:s:%s.pid/libexec/lfs_cleanerd-b-dusage: %s [-bdins] [-N nsegs] [-o options] special node e'((k''(''(('MP +,$-   $6@bcaseinsballnamesaiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s usage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir unknown %s id: %sinvalid file mode: %s  U xb  @U <?Sr%Yb[Z\[Z\[Z\Z\8[Z\Z\X[[[Z\Z\ZZZ=YZ\Z\Z\YZ\Z\Z\Z\ZYZ\Z\YOZ%s: can't read disk label; disk type must be specifiedp@50zero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%x%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too big/home/source/ab/netbsd-10-llvm/src/sbin/newfs_lfs/make_lfs.cmake_dirspaceleft == 0lfs_dir_settypefs->lfs_hasolddirfmt == 0lfs_dir_setnamlenlfs_copydirnamereclen > LFS_DIRHEADERSIZE(fs)spacelen > namlensuper-block backups (for fsck -b #) at:WARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.insane maxpartitions value %dAB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:interleaveminfreesegresvseg%s: bad sector sizefragment sizeinode block sizeroll-forward idfile system versionbit widthbit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume%sr%s/dev/%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Apreadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).%s `%s' is out of range.usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version /home/source/ab/netbsd-10-llvm/src/sbin/fsck_lfs/segwrite.clfs_writeinode!(bp->b_flags & B_INVAL)lfs_gatherbp->b_flags & B_DELWRInblocks = %d, not %d %s: fragment is not last blocklfs_updatemeta%s: no clean segmentslfs_newseglfs_writeseglfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_numberdevvp is NULLCould not allocate %zu bytesunlock to 0 with no summarySeglock not heldlfs_writesuperdaddr > 0lfs_fi_setblock%s: ulfs_bmaparray returned %d looking up lbn %lldlfs_update_single%s: bread bno %lldlfs_dino_getdblfs_ss_setocreatefs->lfs_is64 == 0unknown disk type `%s'DIOCGDINFO on %s failedgeometryPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %ssectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitTV*D؀)QV*RCI0/1<4I5VEoecV*Lw)`888F88488g8T88888888888878y88!888?88$8aR**************************************************************************************************************************************************************** v6<A"E*9>EE*9>Can't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sabsentConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'Can't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytes%s: Unable to allocate tablerf_ReadSpareTable%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingstat failure on: %sinvalid device: %sa:A:Bc:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vBad last unit %sUnable to open device file: %sRAIDFRAME_COPYBACKRAIDFRAME_REWRITEPARITYRAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANioctl (%s) failed|/-\Unable to create RAIDframe configuration structureRAIDFRAME_CONFIGURERAIDFRAME_GET_INFO%20s: %s %s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYoptimalreconstructingdist_sparedused_spareraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure remaindisRAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure # raidctl config file for %s %d %d # WARNING: no optimal components; using %s RAIDFRAME_GET_COMPONENT_LABEL# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c fifo %d %s is not a component of this deviceRAIDFRAME_FAIL_DISKComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d YesNo sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d ForceSoft*invalid*RAIDFRAME_SET_COMPONENT_LABELRAIDFRAME_INIT_LABELShardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTRAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity RAIDFRAME_CHECK_PARITYREWRITE_STATUS%s: Parity Re-write complete RAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. Parity Re-write is %d%% complete. RAIDFRAME_CHECK_COPYBACK_STATUSCopyback is %d%% complete. gettimeofday failed!?!? %3d%% |%s| ETA: %s %c%02d:mirrorusage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev Bad number `%s'Initiating re-write of parityCopyback.Copyback status:START array# numCol numSpareSTART disksSTART layoutSTART queueSTART spareComponents:No spares.Parity status: DIRTYParity status: cleanSpares:Reconstruction status:Parity Re-write status: B$tI_`o7~{B{{Q{'%S'%'%'%'%'%'%'%'%$'%?'%'%u%)))))))))))))))a/1///.:00l1l1./.../hihhhhifjvjjj|mnnmn o|{=}L}=}{=}}=}%=}"+ތ&+++./restoresymtableb:cD:df:himM:NRrs:tuvxyillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0none of i, R, r, t or x options specifiedBegin incremental restore Calculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %c%s: not a directory %s: not on extraction list extract%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sAvailable commands are: ls [arg] - list directory cd arg - change directory pwd - print current directory add [arg] - add `arg' to list of delete [arg] - delete `arg' from list of files to be extracted extract - extract requested files setmodes - set modes of requested directories quit or xit - immediately exit program what - list dump header information verbose - toggle verbose flag (useful with ``ls'') help or `?' - print this list Debug - turn on debugging If no `arg' is supplied, the current directory is used / quitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help canonname: not enough buffer space restore interrupted, continue%s > %s: %s: no filename match. glob() aborted. unknown error! command lines cannot be continued missing %c ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char Warning: undefined file type %d %*ju dir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s missing inumber %ju type should be LEAF|NIL|NAMEFND|MODECHGExtract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXopendirfile: %s Root directory is not on tape Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju Cannot restore %s%s extended attributes for Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d no memory for directory table %s: cannot write directory databaseTry making space in %s, %s %s or set environment variable TMPDIRto an alternate location with more disk space.deleteino: out of range %ju deleteino: %ju not found %s: pathname too long no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTbad name no space for string table Checkpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c %s is not a directory addino: out of range %ju duplicate inumcannot find entry in parent list/dev/ttycannot open %s: %s /dev/nullCannot allocate space for tape buffer Verify tape and initialize maps Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump header read failed at %d blocks no header after volume mark! Cannot find file removal list Changing volumes on pipe input? You have not read any tapes yet. Unless you know which volume your file(s) are on you should start with the last volume and work towards the first. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree file%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s Set attributes for %s: %scorruptedremainder %s, (%d bytes), %sextattr_set_fdextattr_set_linkextattr_set_file (set using %s)posix1e.acl_accessacl_set_fdacl_set_link_npacl_set_fileposix1e.acl_default (unable to set)ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s MD5SHA1RMD160Warning: %s %s End-of-input encountered while extractingCannot have multiple dumps on pipe input ioctl MTFSF: %s no memory for %s %s: inconsistent map size %s: map size changed Cannot extract %zu bytes %s for inode %ju, name %s of extended attributesoverrun attribute buffer write error extracting inode %ju, name %s write: %s seek error extracting inode %ju, name %s lseek: %s symbolic link name: %s->%s%s; too long %d unallocated block in symbolic link %s mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered tape read error: %s Tape block size (%ld) %s (%ld) is not a multiple of dump block sizeTape block size is %d Note: Doing Byte swapping gethead: unknown inode type %d Checksum error %o, inode %ju file %s Volume header (%s inode format) newbegins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks mktempname: called with TMPNAMEnot on ino list%s%ld%juRSTTMPwarning: cannot rename %s to %s: %s rename %s to %s newnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s warning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s symbolicwarning: cannot create whiteout %s: %s Create whiteout %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump core%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndstrdupO%s %d C R%d W%d L%d %d I%d %d ioctlLost connection to remote host.who are you?/etc/rmtinvalid user name: %sProtocol to remote tape server botched (code "%s"). Protocol to remote tape server botched. (rmtgets got "%s"). ! ǟl<`<M><=)4=  ==F=:! ͩi ! ;!(mZ= b= =`! &3j  ah= 0 ϫl== k=== Y=l= ==23Ldf/aĴش->--YDDUDDDDDD EE%E5EAEQE#ECEEEF.FEFfFFFFFG"G@GQGhGGGG/HZHHHHH I 4I JI aI uI I I I IIJ'J>JXJmJJJJJ K K !K QKKKKKKL.LCL\LyLLLLM;MdMMMM#NRNNNNNO6OYOkOOOOO'PP!P=P`P vP!P!P"P$Q%Q&1Q&QQ&iQ&Q'D(Q(Q)Q*1R*,R*DR+[R,R,R,R-R/ S00S0NS0rS0S1S1S2S2 T3$T66T7TT9fT:T;/[;T;T;T;U;'U;1U;MU;lU; }U; U; U; U; U;V=-V>NV?wV?V?V?V@VA WB0WCWDaWEyWFWGWHWIWJWKXL#XNJXPhXP{XP{XPXQXRXSXSXSYTYUDYW\YXYYYZYZYZZZ$Z[CZ[QZ[iZ[Z\Z\Z\Z`ZaZa[a[b%[cA[dl[unknown %s command: %starget lunSCBUSIORESETinvalid target: %sinvalid lun: %sSCBUSIOSCANSCBUSIODETACH[primary] [grown] [block|byte|physical][blocksize [immediate]]identifyreassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#unable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- %13u %8u %4u %10u failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %s: scsibus%d target %d lun %d <%s, %s, %s> unable to allocate defect descriptorinvalid block number: %sSCIOCRESETSCIOCDEBUG%s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable unable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun : noneentire track defective SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s, %sError in %s, Offset %d, bit %dParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d%s: Check Condition on CDB: %02xNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionWrite ProtectedBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare ErrorDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This Track%s: SCSI command timed out %s: device is busy %s: device had unknown status %x [??~??????????u??ǹeG)ʽPFPF0* XXX,,x<<%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rShutdown at %.24s. shutdown: forkshutdown: [pid %d] /etc/nologin NO LOGINS: System going down at %s -n/usr/bin/wall%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** FINAL System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY poweroff%s by %s: %s/sbin/reboot/sbin/halt-v-x-zCan't exec `%s' (%m)Can't exec `%s'/fastbootfastboot file for fsck . /etc/rc.shutdownnowTZtime is already pastillegal time formatUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] Shutdown NOW! System shutdown time has arrived but you'll have to do it yourself About to run shutdown hooks... Done running shutdown hooks. 444$,44444hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname  #   ZudL7B!)H19@ fWffffg) gf$g2gDgkQg`gngggggggggh hh!hh1hhChOhbhnhOh{hhhhhhhhhi*i@i^ifi^ii^ii^iiiijjj(j/j@jFRjqj|jjj3f7f>fCfJf = secondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthAabdef:Mnqrwxmalloc regex%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zu, flags 0x%x<%s>, func=%p, ver=%dCannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! INTSTRINGQUADSTRUCTBOOLREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDENALIASregcomp: %s: %sregexec: %s: %s/kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%s: failed query %s: '%s' is an invalid mode %04o (%s)bad size %zu for kern.drivers%s[%d %d %s]%.2f %.2f %.2f bitmask_scanInvalid port: %sPort out of range: %s%s,%zu%s 1bitmask_print%s 2%x:%llu(%d/%d/%d),%x %s: size mismatch %c%xunlimited%s: '%s' is not a valid limit %s#%zu: %s: the value is not available (%s) 0x%0*x0x%0*llx -> %07x%07zu bytes \x%2.2x%s: this type is unknown to this program ...(%zu more bytes)destroydescribeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s Must specify -w to create nodes %s: already have %s for new node symbol%s: missing value %s: '%s' is not a valid address quadstruct%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set %s level name '%s' in '%s' is invalid %s: not a number %s: string too long usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dneq] [-x[x]|-r] variable ...[-ne] [-q] -w variable=value ...[-dne] -a[-dne] -A[-ne] -M[-dne] [-q] -f file(no description) '0>;-M-h---oK^pp0J  < < A H M M Q T b c   < < A B G H K M p q   < < ? ? A C M M V V > @ F H J M U V A C M M 114:GN557799q~-0226799XY__24RSrs   "'(229;446:<<BBks *0/000 %& #      8 : ? ? gi{BD psvy0WX``   ;?__KLn : ; N O U W q z      ) ) 1 1 4 4 7 7 : ; = = C F I J N X ] ] _ e u      ) ) 1 1 4 4 : ; D F I J N U X [ ^ ^ b e r     ) ) 4 4 : = E E I I N T W _ b e p      ) ) : = D E I I N V X _ b e p ;>\HHkp""((++35:?ZZ^IINOWWYY^_[^}w  7?T_mmqqtx,/<?ACnou LO}FGNOXXZZ\\^^~  ( ( ) ) * . ` c d i j o r s O!R!!!##'$?$K$_$&&&''' ' '('('L'L'N'N'S'U'W'W'_'`'''''''''''++$++/,/,_,_,m,s,x,,,,&-/-f-n-p--------------------........////@0@00011-10111111122D2O222MMǤ",?x./ko77==??BBEE@O$/SSgglouu  '';;>>NO^46$/K  669;=>@            4 7 ; > H O Y o##c$o$t$')szFW_rUU  ::??EEGIQQצ _)#*#./000>0A0MNƤ0k`66666+7`7l7}7778d5d55 655X8d8 )4)H)6KMIIINJIN;MIIIMO\OuO@KWKKTKK4TeTOOKPCPPT)QBQTlQQLTUCLQU,VhVQR6RII_LVWRaRVVRRW S MTT0S7SW^SS4LWTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTF SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. S-gsBBBB'2P'>p5EWg?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t ]c|}LESSSECURELESSVISUALEDITORLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionCannot allocate memoryLINESCOLUMNSkrklkdkPkNkh@7kDTERMhcxndaticmsobc|^LESS_TERMCAP_DEBUGLESS_TERMCAP_Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread errorch_ungetchar overrunFinishing logfileWarning: log file is incompleteseek error to 0ascii8bcccbcc18b95.butf-88bcccbcc18b95.b126.bbiso88598bcccbcc18b95.33b.latin38bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.arabic8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.bgreek8bcccbcc18b95.33b4.2b4.b3.b35.b44.bgreek20058bcccbcc18b95.33b14.b35.b44.bhebrew8bcccbcc18b95.33b.b29.32b28.2b2.bkoi8-r8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.georgianps8bcccbcc18b95.3b11.4b12.2b.tcvnb..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.windows-12518bcccbcc12bc5b95.b24.b.windows-12528bcccbcc12bc5b95.b.b11.b.2b12.b.windows-12558bcccbcc12bc5b95.b.b8.b.5b9.b.4b.ebcdic5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.IBM-10474cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bUTF-8ANSI_X3.4-1968US-ASCIIlatin1ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6ISO-8859-7IBM9005ISO-8859-8latin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047KOI8-RKOI8-UGEORGIAN-PSTCVN5712-1NEXTSTEPwindowsCP1251CP1252CP1255LESSBINFMT*s<%02X>LESSUTFBINFMT^%cLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF8utf8invalid charset nameinvalid chardefchardef longer than 256.less-history-file:.search.shellLESSSEPARATORLESSHISTFILE.lesshstLESSHISTSIZE"%s less %sCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next file(N-th) No %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: [Press 'h' for instructions.]There is no --%s optionThere is no %s option!done|doneNon-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found(P)/usr/bin/.syslessLESSKEY_SYSTEM/etc/syslessLESSKEY.lessWarning: some commands disabledWarning: some edit commands disabledCannot use lesskey file "%s"Warning: environment variables from lesskey file unavailable@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"LESSMETAESCAPE%c%s%c%s*LESSECHOlessecho%s -p0x%x -d0x%x -e%s -n0x%x Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable-cLESSMETACHARS; *? '"()<>[]|&^`#\$%=~%s %s %s...skipping... Cannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeMark not in current fileMark not setInvalid mark letterlog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalid--%s-%c (--%s)Value is required after %sNumber is required after %sLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parameterssearch-skip-screenauto-buffersclear-screendumbquit-at-eofquit-if-one-screenhilite-searchmax-back-scrollignore-casejump-targetstatus-columnlesskey-filequit-on-intrno-lessopenlong-promptline-numberslog-fileLOG-FILEquietsilentraw-control-charssqueeze-blank-lineschop-long-linestag-fileunderline-specialhilite-unreadno-initmax-forw-scrollwindowquotesshiftno-keypadold-botfollow-nameuse-backslash... (interrupt to abort)Invalid patternNo previous regular expressionPlease re-enter search patternNothing to searchGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not foundLESSGLOBALTAGS%s -x%s %sD"D#D%D' ^ r ^   ^  ^ ^ ^  ^ O   ^ ^  F  Bo+0 'Ź*jm ;!Ψ!-sC~***** ***H**4*8*<*@*D* *7 H7 8 7 8 8 8 7 9 : 9: !: 9: 9: 9: +: ; ; ; ; ; ; unknown ACU typecan't open phone number fileunrecognizable host name disconnecting... call abortedhayesminutehourLocal file name? %s: cannot create List command for remote system? [take] cat %s;echo  %d lines transferred in Local command? %s: cannot open chars transferred in [put] cat>%s stty -echo;cat>%s;stty echo timeout error (%s) can't find `%s' away for can't execlcan't forkcan't create %s [cd] %s: bad directory %s%d %s%c [set] ~{[*?$`'"\echo %s/bin/sh"Echo" failed "%s": No match Buffer overflow expanding "%s" write error usage: from [to] can't execl! can't establish pipe timed out at eol usage: from [to] can't fork! [sh] ! [EOT] receive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakphonehalfduplexnostopE:F:P:a:p:c:l:ns:hefot0123456789only one escape character allowedbad flow settingbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedmore than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection HOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdldvcudimust be interactivev0123456789%s, unknown optionphone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKConnected connected n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value usage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s/.tiprcset %sn r t bf record%s: unknown variable %s=%-5daccess denied out of core beautifybaudratedialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftprawhdxlocalechohardwareflow dialing...ATv0 ATTD01234timeout waiting for reply NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 AT Cannot synchronize with hayes... ? ? B @@ 4@ B B B B B B A @ L@ B B B B A @ A k  04<H@@Gl8D @LPT)Q0 INSX]emu +alphasumioaddrkeymappasswordresetvideomodulesbootconfboarddtb$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSb:B:cefm:no:t:u:vInvalid block number `%s'-m-tDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown type/home/source/ab/netbsd-10-llvm/src/usr.sbin/installboot/installboot.cparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s (to be cleared)(none) (directory)Secondary bootstrap: %s EditClearPlease specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'no_setbootparams != NULL%s: bootstrap installation is not supportedno_clearboot%s: bootstrap removal is not supportedno_editboot%s: bootstrap editing is not supportedparseoptionsoption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'Valid options are:=number=word=string, getmachinemach != NULLprovider != NULLInvalid machine `%s' from %sSupported machines are:getfstypefstype != NULLInvalid file system type `%s' from %sgetubootpathspaths != NULLusage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap /home/source/ab/netbsd-10-llvm/src/usr.sbin/installboot/sum.ccompute_sunsumbb16 != NULLset_sunsumOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x i386amd64/home/source/ab/netbsd-10-llvm/src/usr.sbin/installboot/arch/i386.ci386_setbootparams->fsfd != -1params->filesystem != NULLparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s'Reading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)invalid console name, valid names are:Patch area in stage1 bootstrap is too smallcom0com1com2com3com0kbdcom1kbdcom2kbdcom3kbdBoot options: timeout %d, flags %x, speed %d, ioaddr %x, console %d console %s keymap %s Cannot enable writes to the label sectorWriting `%s'Writing `%s': short write, %u bytesi386_editbootReading `%s': short readInvalid magic in existing bootstrapWriting `%s': short write, %zd bytes (should be %zu)i[ r[ [ [ [ [ [ \ \ ] &] 4] $)Ğ);J]a:d:g:hi:m:or:s:A:M:R:D%s is already specified to %sNIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: WEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: usage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCG80211NWIDSIOCSWAVELANstring too longbadly formatted addressTransmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d SIOCGWAVELAN(wreq %04x)[ %s ][ On ][ Off ]UnknownLucentgeneric PRISM IISamsungD-Link[ %s ID: %d version: %d.%d ][ 0xscanning ...ap[%d]: Host initiatedFirmware initiatedInquiry request from host ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] SIOCGIFFLAGSSIOCSIFFLAGS[ Unknown ] No APs available AP Informationd e e d d e e e e e d e d e e e e d e e *e B:beflnstuvUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] %6d %6s %s: not a regular filemalloc, using %zu bufferp Ip Ip &p Ip o o Ip Ip o Ip o o HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... @q r r r q r r r q r r u u u u u u u u u x !x y Ax y !x y y y y HLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).directory %s encountered when not expected./home/source/ab/netbsd-10-llvm/src/bin/cp/cp.cpushdnednesp < MAXPATHLENpopdnednesp >= 0lutimens: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %schown: %schmod: %schflags: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory %s => %s %llu/%llu bytes %d%% written [   s      FLPfhinsvwwarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file                 ֏           '  @ O  ^ m |                ֐    - H  W s        , ;  T j  ҕ 1 m 1 1 m X          2 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxusage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] %s: %*llu humanize_number%'*llu %s %*lu %-*s %*lld, %*lld ????????????????????????total %s total %'llu total %llu ls: %s: %s out of memory!m:pusage: %s [-p] [-m mode] dirname ... hifv%s: destination pathname too longrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)/bin/cp-PRpv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fhiv] source target %s [-fiv] source ... directory  ' [  e v v  v  b l   !            + M  \          w 3+ / 3+ e 3+ 3+ 3+ 3+ 3+  3+     3+ 3+ 3+ 3+ t O ^ 3+ 3+   3+ m | 3+ 3+ 3+ 3+ 3+ 3+ 3+ 3+ 3+ /  3+ 3+ 3+ 3+  T  3+ 3+ 3+ 3+   3+ 3+ / T 3+  3+ o 3+ 3 3+ 3+ 3+ 3+ 3+ 3+ 3+   3+ Q  3+  3+ G  `  3+        V   3+ B   ( (    ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ! g! ( ! ." ( " " ( ( ( " .( .( " Q# ( ( ( ! # k" ( " # f# ( ( ( ( ( ( ! 1# W " ( 5! ( ( x i # B ( # y#  ( G! # # - R! *! ! ( " ? E@ $@ L@ G G G G G G G G  G G @G Z [ [  [ Z [ [ Z Z ab ab b b c c g e e !g g !g g e e #g g h ././@LongLinkFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...cpio%llu blocks Unable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %ld blocks.Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %ld pad blockscould not pipecould not fork-dccould not exec%llu bytes%lu secs (%llu %s/sec)Cannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCan't fchroot to "."Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.Write block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.Archive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot close file descriptor on %sCannot unlink %sCannot rename %s to %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sFile seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%b %e %Y%b %e %H:%M%s: unknown option %c %s: %c argument missing ustarinsecureforce-localuse-compress-programgnutimestampblock-sizebunzip2bzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkexcludeno-recursionCannot create directory `%s' These format options are not supported for %s %s = %s 0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled inDestination directory was not suppliedInvalid option nameUnable to allocate space for option listInvalid options format%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578write_opt=nodirThe -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory usage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistentIgnoring file containing `..' (%s) ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s File name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s /../Can't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingLC_TIMEUnable to set up signal handlerCPU time limit reached, cleaning up.Signal caught, cleaning up.Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for interactive rename tableNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sDevice map table out of memoryBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offGNU Long %s found in posix ustar archive.File%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.GlobalUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDEVTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %sHeader checksum %o does not match %oInvalid type in GNU longlink %dUstar %s header field is too small for %s/.*\/%s$///.*\/%s\/.*///^%s$///^%s\/.*//Fatal error, cannot open %s/./usage: %s [-LP] w w w 8x w ]x y w w x dfiPRrvWxfts_open failedremove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %s: is a directory"." and ".." may not be removedusage: %s [-f|-i] [-dPRrvWx] file ... ׅ        چ       "           )  0 F K a l r {   2    ‹ ҋ ؋ ދ  2  \  z                    FN RNdNpN}N3 pN}N3 7NNNENZNNO%O#/O /O_AO^AOFAO<AO>VO?iO|O 5 G f   - h     ʢ              / O          PATH=< 6  @ J           P T X  6 ^          N A      8 k        ' Q  R H   # # # # r n   r \ A  % A A A A A  '  ( :( * * v( ( ( ( ') ") =) ) * * * #* Y* +* 2* ;* D* K* R* ' ' * * Z+ + + + + , , *, 0, - }-+?=###%%%} ^~!Ҿtxf&@XdGX@Xs,cTX@XmMX@Xl[Xr ũ!`TpbXSnjX@Xv rXb    W W W W W W W X W W W s] s] QX YX s] s] s] s] W W  Y s] s] OY s] Y }h e g 6f g  h f g g *h Vv jh Oh e e p y y y y p  k m y 2n An y y y y y y y p y y y Pn y _n nn n y un y z z y z z { z 6{ L{ ZZZZZZZZZZZ[ZZZZZZZZZZ[[ [[[v[ș![U&[,[R* UUUUmbEOF reading here (<<) document}-+?=ى 0 ?   ` `   J U_UUUU__k 0@:  _)_/_5_;_oM A_K_@abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'(,0`<,1`P,1`d,8`x,0` ,0(a,0/a,06aM ȵ,0?aP    $ , ?    m   ֹ    m . m C L U m m m d o Ϻ           ʼ   # ; V Ld . fi  e! ]c A o!s_/b}G z !l/  ( _3 J b                >  ( +w!< c< m Gd c c" d  d   K  dM w! T+ S< >!  '֗ : d dն $d& υ!+ )d? /d t 1dJ 7d7A >dķ :!ķ .m\ Cd$ =  ?F Kd D X5 a+ T+ qi Ŀ 3 fM L օ) ^! L& Y [ 6 x [ [ [ [ [  [ [ G [              g g  G g         {           - -     7    7 7 7 k  k k k k k S k k k  k S k k S        V g g g g  S g g I ]  g g g  g  g  g  Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionexpecting end of expressionexpecting ':'expecting ')'incr/decr require var nameexpecting primarytoken errordivision by zerodivide errorvariable contains non-numeric valuearithmetic expression: %s: "%s"PeHOME not setPWD not setbad substitutionCDPATHcan't cd to %sOLDPWDunexpected argumentUnable to find current directorystdout: %sCannot determine current working directorygetcwd() failed: %swrite errorinterruptedpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too longNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failed: %sPipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%s: not found%dm%ss %dm%ss %dm%ss %dm%ss %.4fbcefqrsuvhash: I/O error writing to standard output Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %svVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... [-p] [-v|-V] is a shell keyword is an alias (multiline)... for: is%s a tracked alias for is a shell function is a shell builtin is a special shell builtin : not found %.*s: parameter %snot setnull or %.*s: parameter not set:]not compiled with history supportCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: turning off NDELAY mode sh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dNo current jobsjob not created under job control[%d] %sJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processeslpZnp:more than one -p unsupportedinvalid name: -p '%s'%s readonlygjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d No such job: %sNo current jobNo previous job%s: ambiguousCannot fork (%s)You have stopped jobs. && || ! | if ; then ; else ; fiuntil ; do ; donecase ;& ;; esac() { ... }>|>>>&<&<><<...${#LINENO${LINENO${#${(...)$(...)"(([%d] %c %ld Done(%d) (core dumped): file changedyou have mailPOSIXLY_CORRECT/etc/profile/.profileENV Use "exit" to leave shell. Out of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtraceBad -c optionPScarg for %co missing+-Current option settings%s%c%c%-19s %s set -o defaultUnknown option %co %sUnknown option %c%cUsage: shift [n]can't shift that manyusage: getopts optstring var [arg]OPTARGUnknown option -%c No arg for -%c option OPTINDUnknown option -%cNo arg for -%c optionnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"thenelifwhileuntil%d: Here document (<<%s) expected but not present2nd "!" unexpectedBad for loop variableBad function name (use quotes)Bad function nameBad fd numberUnimplemented form of eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}Word "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)%d: Syntax error: %shuge prompt: No mem for prompt: Unterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceEOF in backquote substitution-o promptcmds not set: Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sinsufficient file descriptors available:vs:Usage: fdflags [-v] [-s fd] [fd...]%s: too big to be a file descriptorfdflags: I/O error '...'Missing +/- indicator before flag %sBad flag `%s'nonblockfsyncdsyncrsyncaltionosigpipecloexec +%#xCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)Can't set status for fd=%d (%s)Can't set flags for fd=%d (%s)<<EXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition \"$`Could not allocate formatted output bufferIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1PS1PS1=$ PS1=# %.*s: bad variable name%.*s: is read onlyNBSH_INVOCATION|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: not available for export%s: bad variable nameNot in a functionINxList assignment not implementedefvx%.*s=%dUsage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]missing ]unsupported expression when built with -DSMALLeq!=%s: out of range'%s': bad numberunknown signal number: %doption requires an argument -- sbad job id: %spgrpbad signal number: %sbad process%s id: '%s'unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... chdirletfalsefcinputrcgetoptsfdflagssetvartrueumaskunaliasulimittestwordexpevalPPIDNETBSD_SHELL20220122 BUILD:20250602060319Z SMALL#-+ 0'%s: missing format character%s: invalid directiveprint failedincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'format "%s" too complex%s: invalid field width%s: expected numeric value%s: not completely convertedUsage: %s format [arg ...] pB(k0k {6km.m;k+! Ak=`! 3j  1k ^~!nn7Ik:^! l4 Lh! l l  l Cn5 ls Fl .G m6 EG Slg lo U  l l  Gl( $G onnn o@@ oo%o-ollll #l3m#l3m2m3 m3 m#nnnnnSn bn@in[npnvnv}nn mmmmm%mmm+m nmmm@3m@n ;m mmnn@'n/n 7nEmC$DmCJmC$ImC;gQmnnnnn n@\m[mdmcmllll       discarddsuspeol2lnextreprintrprntoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedillegal gfmt1 option -- %sillegal gfmt1 optionillegal option -- %sTIOCSETDTIOCSTARTTIOCSTOPcbreakcookedeverythinginsaneostartrowscs5cs6cs7cs8-parity-evenp-oddp-pass8-decctlqcrterasecrtbscrtkillctlechoprterase-crt-newcrt-kerninfo-litout-tabsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extprociflags-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-oxtabs-onocr-onlretcflags-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctscchars%s = %s;%-8s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZusage: %s [-a|-e|-g] [-f file] [operand ...]    a   B   B  , 3 HLPRfhvthe -L and -h options may not be specified together.%s: invalid %s nameUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... owner:group|owner|:group   [  z   M    ' p  F                             n 7    e     z   i     R  &  & & _ &  & &  qfpz2r!Hն(,}}}@}@}@}@}@}@}@}@}@}@} @}@}@}@~@ ~~~ ~&~-~5~;~A~F~M~S~Z~d~l~s~z~~~@~@~~~~~~~~~~~~~~~ ~&+C}~KPW^elu|&}A~"~+3 ~~2r!&(( ߇'IVtj_Έ# # # # & '  ' ' ' ' ' ' n' *' & '  ' ' ' ' ' ' n' *' ~  ;rQ Km% v~" > H%k d" ׉I" |6# N# %y# D2r!&(( qfpz2r!Hն(,+ + + + + y+ + + + + + 2r!&(( qfpz2r!Hն(,AB:CDFIL:M:NO:P:RWef:ilmnrtvw%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %stoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderioctl DIOCWLABELsector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %huboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%hu) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %hu to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapsorry, could not allocate memory for list%s: unknown machine typemvme68knext68kalgoralphaluna68kmac68knews68knewsmipspmaxsun2sun68kx68kvaxamigaamigappcevbmipsevbppcsparcsparc64sun3atarimipscomvmeppcbeboxemipshppaibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeor1kriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipsia64zaurus%s: unknown archaarch64earmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfmipselmips64elriscv32riscv64sh3elx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebm68000m68kmipsebmips64ebpowerpcsh3ebchanging %s byteorder to %sioctl DIOCSDINFOioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskioctl DIOCGDINFOcould not read existing labelfailed to read bootarea from sector %uread sector %u len %d looking for labeldeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xno space in bootarea (sector %u) to create labelattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d\ :%.*s|Automatically generated label:\ :dt=unknown%hu:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%hu:%sil#%hu:%ssk#%hu:%scs#%hu:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%hhu:b%c#%llu:f%c#%u:EdDk.aXXXXXXre-edit the label? [y]: /usr/bin/vi# line %d: syntax errorline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: too few fieldsline %d: warning, unknown file system type: %stip: use -l to see all valid file system typesline %d: invalid format[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)usage:%s %s %s %s Enter '?' for helppartition>Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table%s %s [a-%c] define named partition Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors Automatically adjust partitions [%s]? Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%hu]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%hu]: Invalid sector interleave `%s' Sector 0 skew, per track [%hu]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%hu]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Label name [%.*s]: Rounding [%s]: Label disk [n]?Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraInvalid answer# Current values:Rounding can be (c)ylinders or (s)ectorsLabel writtenLabel not writtenD5can't get msgbuf1 5 p2 5 5 5 5 5 &2 5 ;2 5 !2 v2 5 5 2 5 _2 5 B2 v2 $qfpz2r!Hն(,Ɠkkkkk[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]returning to single-user after filesystem check dfl:nPpqT:t:vx:yrq%s has unknown file system type./usr/sbinfsck_%sstart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %s-oInvalid option stringcannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supportedv7fsusage: %s %s [special|node]... ** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%sdisk %s:%s in fstab more than once!P    A  A A A A A A   A   A A A A A A  " 4  \  u ! \  9  9 e { $      returning to single-user after filesystem check  r= n= = n= C EC -C ZC C C C C D +D D BD tD D D D ?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@hhhhQ R R R Q Q untitledlost+foundwrong type to dirscan %dNAME=%s %s=%s UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASINGADJUSTUNREF %s RECONNECTNO lost+found DIRECTORYCREATESORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu DIRECTORY CORRUPTEDBad dir: ino %d reclen %d namlen %d type %d name %s NO SPACE LEFT IN %sEXPAND (ADJUSTED) (CREATED) (RECONNECTED) (EXPANDED)DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluCLEAR I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s %lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block PARTIALLY TRUNCATED INODE I=%lluYOU MUST RERUN FSCK AFTERWARDS (CLEARED)aB:b:c:dFfm:npPqUyx:XzAlternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o Cannot use -x or -X without -nCan't check %s can't take snapshot of %s-%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... %s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo EXCESSIVE BAD BLKS I=%lluCONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld)UNKNOWN FILE TYPE I=%llu (SKIPPING) (CORRECTED)%s: phase 1b: cyl group %d of %d (%d%%) ROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'ADD '.' ENTRY FIRST ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '.'BAD TYPE VALUE FOR '..'MISSING '..'ADD '..' ENTRYSECOND ENTRY IN DIRECTORY CONTAINS %s REPLACE WITH '..'EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORYBAD TYPE VALUEBAD STATE %d FOR INODE I=%d (IGNORED)(FIX DEFERRED)%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORY%s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCG %d: ALLOCBLK: BAD MAGIC NUMBER DELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x USERGROUPCLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockLOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO fsck_ffs TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** F** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group appleufsisappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEoffset %#x, original 0x%08x, alternate 0x%08x VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEBAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP SNAPSHOT INODE %u ALREADY ON LIST%ssuperblock mismatches (FIXED) (TRUNCATED)bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes cannot allocate buffer pooldeadlocked buffer poolWRITING %sZERO'ED BLOCK %lld TO DISK PARTIALLY UPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storecannot allocate quota entryCANNOT %s: BLK %lldDISABLING EXTATTR SUPPORTENABLING EXTATTR SUPPORT ***** FILE SYSTEM MARKED CLEAN ***** (SALVAGED)detected ufs1 superblock not yet updated for ufs2 kernels%s: unknown fs_fragshift %dffs_isblockffs_isfreeblockffs_clrblockffs_setblock%.*s/%s%s/XXXXXXXXXX/dev/rfss%dSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%lluALLOCInvalid quota magic number no user quota inode no group quota inode CAN'T READ QUOTA BLOCKDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%llu (ALLOCATED)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu /home/source/ab/netbsd-10-llvm/src/sys/kern/vfs_wapbl.cwapbl_replay_free!((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_space_usedhead == 0wapbl_blkhash_initwr->wr_blkhash == 0wapbl_blkhash_clearwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_blkhash_freeUnrecognized wapbl type: 0x%08x wapbl_blkhash_remwapbl_circ_advance((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_readwapbl_replay: corrupted recordswapbl_replay_stop calledwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-OWry!0 z         <))T)l))))Ъ))))4))T)l)))ȫ)@ ŷ ط ط ط ط ط  ط   ط  ط   vܭ=     /Fܮ[zǯ+C_ {!#$&123456899ǰ:;<=0@?ASBCDEF G H J#L@MQNXOhPxQRST²UʲVW\a!c+dfefghipqstu̳vwҳx=\i~4Qiʵ+Gagȶն߶$7BLdvƷط???Xwø1MUֹ'R2ͺ1Tgzٻqfpz2r!Hն(,T  % % % % Z % & % % `   &       SFH0eC+BSFU0eC1նHah!IdontNeedEFI;@(s*K>;JN|nQn- q+Ye|nQn- q+t~|nQn- q+|nQn- q+|nQn- q+,=rGy=iG};Mt?mWC 3KOOyD<#*=(3Dh&H\ M}-+<-чHM-чH(bZIчHk|IчHkIчH2IчHqS'@ )Ѹ*1@ )Ѹ1x )Ѹ 7  7 L 7 7  [-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]a:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llubiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]Ac:i:L:b:No valid Protective MBR foundError reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootable/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'[-AfP] [-p partitions]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-r]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juPriSecGPT partition: type=%s, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Device already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableAlready set to %jd new `%s'Number `%s' < 1-a is already setUnknown find option `%c'Partition %d %sHeader %sUnknown alignment/index/size option `%c'Entry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedCan't parse uuid/type `%s'Can't copy string%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u Header Information:- GPT Header not found-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>label changedab:i:L:s:t:f:l:Can't label from `%s'Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it*unknown*mbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrHm:nqrs:T:vUnknown command: %sCommand %s needs a device parameter[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'migrate[-Afs] [-p partitions]Afp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBR*%u*Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sUnknown FreeBSD partition (%d)Partition %u unknown type %s, using "Microsoft Basic Data"Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'Bad table type %dAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]ab:i:L:s:t:resize[-i index | -b blocknr] [-a alignment] [-s size] [-q]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresizedisks:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBR-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]a:b:i:lNshow[-aglu] [-i index]gi:b:lua %*s %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part [partition not found?]%d%s (active)GPT part %lsUnknown %#xCould not find index %dDetails for index %d: StartType: %s (%s) %s: %llu%5dGPT not found, displaying data from MBR. None index contents-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypetype changedab:i:L:s:t:T:l-a attribute -i index-a attribute -b startseca:b:i:l%s%18.18s %s %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleapple-ufsbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuUUID changed[-o outfile]/home/source/ab/netbsd-10-llvm/src/sbin/gpt/backup.cgpt->secsz <= INT_MAXsector_sizembr_arrayGPT_HDRGPT_TBLi <= INT_MAXstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurerevisionguidstore_gptle32toh(hdr->hdr_entries) <= INT32_MAXstore_tblgpt_array[-F] [-i infile]Fi:Device contains a GPT/dev/stdinUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBRUnable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary headerEntity index out of bounds %u > %u k s)z)<)z_<'38H       , 8 @D P \ d  m 0v @   Q# !      @xO ziб)myi1d1d1d<)d8)31d1d<)d):))J )x) &<)X) 6<) \) \) <) <)2r!x/G:/QE=2r!x)))"")![ )::<):= /=`?G@?G:=QE 766666h,,l--l-i.l-3l-3x55e7?<)|)г))xG VVXYXXXY\\B[[[X\\\\\\\\\\\\\\\[[\ \\\(\2\<\F\Y)XR<)`)_`tI<))8J* <))e)kd)jR<){Ĵ)z{I* <)Z) 8)lQS[^ad_]]`]` ~ " "ia6flagsia6flagIPv6 keywordsin6_constructoranycastpltimevltimeeui64inet6%s: getifnamein6_status inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6eui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addressinet6 address lifetime not allowed for the AF%s: getsockin6_addr_flagsSIOCGIFAFLAG_IN6 [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] inetin_status inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVESIOCAIFADDRSIOCDIFADDRSIOCGIFADDRin_addr_flagsSIOCGIFAFLAG_INcommit_addressbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cdo_setethercapssizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s broadcast addresslist clonerswait DADno commandslocal address (address 1)destination/netmask (address 2)broadcast address (address 3)optional commandcommand-rootiface-opt-family-onlyifcapifflagclonecmdmiscopt-cloneoptional silent familyiface-opt-family-A is deprecated%s: prop_dictionary_createexec_matches%s: prop_dictionary_augment%s: lookup_af_bynum/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cafp->af_addr_commit != NULLip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2trailers-linkstr-descr-descriptionNote: trailers are no longer sent, but always receivedSIOCSLINKSTRSIOCSIFDESCRSIOCGIFFLAGS %s%s: prop_dictionary_copy/createprintall%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s SIOCZIFDATA input: queue drop, %llu unknown protocol output: collision%s%llu %s%s, %s byte%sclock_gettimeparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)do_setifcapssizeof(ifcr) == prop_data_size(d)SIOCSIFCAPSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesclone_commandsetifaddrd != NULLprefixlen_to_masksetifnetmasksetifbroadaddrsetifdstormasksetifflagssetifmetricSIOCSIFMETRICdo_setifpreferenceSIOCSIFADDRPREFsetifmtuSIOCSIFMTUsetifprefixlen%s: prop_data_create_copy%s: prop_dictionary_setmalloc linkstr spacegetargstr linkstr faileddescription too longmalloc description spacegetargstr descr failedusageusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [-m] [-L] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy no carrierno networkmastermedia keywordsunmediaoptSIOCSIFMEDIA mode %s instance %dmedia_status%s: SIOCGIFDATA%s: no media types?SIOCGIFMEDIA media: %s supported %s media: media mediaopt media_constructorinstanceanymedia-mediaopt/home/source/ab/netbsd-10-llvm/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.csetmediainstinitmedia%s: prop_dictionary_set_boolinit_current_media%s: no link type?setmediadata != NULLsubtypeunknown %s media %s: %ssetmediaoptsetmediamode status: [#%d] no ringinserted [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] %u.%u%n%s: prefixlen_to_mask(%d, %ld)paddr_matchunknown keyword type %dtundsttunsrcdeletetunnelSIOCDIFPHYADDR%s.%dsettunnelsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR tunnel %s %s%s --> %s%s [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"print_link_addresses%s: getifaddrs%s: ioctl SIOCGLIFADDRaddress:SIOCGIFADDRPREF preference %hdVLAN tagvlantag-vlanif%s: getvlansetvlanSIOCSETVLANvalid only with vlan(4) interfacessetvlanif vlan: %d parent: %s [ vlan n vlanif i ] [ -vlanif i ] 802.11 keywordsieee80211 boolean-bssid-channwid-nwkeySIOCS80211BSSIDieee80211 listsioctl(SIOCGIFFLAGS)The interface must be up before scanning.socket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)SIOCS80211unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s S:NCAPS%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID RATES XRATES DSPARMS<%u> COUNTRY ERP<0x%x> WPA WME VEN RSN%s<%.*s>%s<%c%c%c %u-%u,%u %u,%uBEBKVOVI - , -2-?-U-f--->! -@----@ .Ɠ*kkk,.1.kk*:.>.F.J.ffsAadfo:rwt:uvOnly one -t option may be specified.noautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@realpath `%s'puffs|%s on %s type %.*s: %s already mountedmount_puffsrump_%sexec:Cannot open fd to mount programexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]asynchronousnfs4aclsposix1eaclsextattrnoatimenocoredumpnodevnodevmtimenosuidsoft dependenciesexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount arguments%s,%sadosfilecoreudfsysvbfsefsnilfsUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node MP +,$-   $W!6@00000000 bnorripbgensbextattbnojolietbnocasetransbrrcaseinsegjo:rextattgensmaplcasecasetransnrrrripjolietrrcaseinsMP +,$-   $, ,0@: W!/A A,@26@,(ksoftdepќל%.NMP +,$-   $0@: W!6@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorGsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath V/ʢ$08ApxnۥMP +,$-   $W!6@ O:T:΄ ^: d:@m:t:|:p:: @999:999 :@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoac23Aa:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXwsizerdirsizeleasetermreadaheaddeadthreshtimeoretransConflicting version optionsIllegal value `%s' for option -%cconndumbtimernfsv3rdirplusmntudpresportnqnfsnfsv2maxgrpsgetnameinfo: %saddr=%s, port=%s, addrlen=%d, sotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d Usage: %s %s %s %s %s %s [-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh] [-g maxgroups] [-I readdirsize] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path nodeUnsupported socket family %d%s: error = %d rpc_callrpc_getport%s: reject, astat=%d, errno=%d recvrpc%s: short write! (%zd < %zu)sendrecvno : or @ speccan't get net id for host "%s": %sְααααααααݯαW!MP +,$-   $6@A>g:m:n:o:s:u:failed to parse nodes `%s'ram/ram%failed to parse size `%s'cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%shw.physmem64can't get "hw.physmem64"syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%susage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point ?wV*yNZw%s: can't read disk label; disk type must be specified%s partition type is not `%s'HHH IDI~IIIJ7JTJ{JJJJJK@KhKKKKL;L[LLLNR| WTWTbSS-mfsNT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:WARNING: -G may create file systems which cause kernel panics 2easector size `%s' is not a power of 2.expected files per directorynumber of inodesunknown optimization preference: use `space' or `time'.invalid quota type %sbad mode `%s'Apple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %d%s %s %d%%Warning: changing optimization to spacebecause minfree is less thanmfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameunknown gname %sunknown user %susage: %s [ fsoptions ] special-device mount-point usage: %s [ fsoptions ] special-device%s [disk-type]illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. preposterous size %lld %s%*llu,Error making filesystemNo space for superblocksetblock bad fs_fragshift %d isblock bad fs_fragshift %d clrblock bad fs_fragshift %d fsinit: inode value out of range (%llu). rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s ilog2: %d is not a power of 2Cannot allocate I/O buffersuper-block backups (for fsck_ffs -b #) at:Panic: cylinder group too big Too many cylinder groups to fit summary information into first cylinder groupinternal error: can't find block in cyl 0first cylinder group ran out of spacecg 0: bad magic number 9n%s: can't read disk label%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file SSSWTWTbD:FINO:S:V:Zb:f:i:l:m:n:s:v:Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthusage: %s [ fsoptions ] special-device block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lld%s: read error for sector %lldrdfs%s: can't allocate block for lost+found fsinit%s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: large_file rocompat feature is required to enable resize feature for this filesysteminit_resizeino%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: inconsistent bitmap%s: can't allocate buffer for inodeiput%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: write error for sector %lldwtfs%s: %u is not a power of 2ilog2super-block backups (for fsck_ext2fs -b #) at:@BDDDDBDD4CDDDBBCDEBDDDDDDDDDDDDBDB7BDxCAC@DD?CDBBCACJAADC AV2X2XXXY2X2XLYYYY7ZfZZZZ[C[BY[[[Xyaaaaaaaaaaaaabb`RMb@A{Gz?-C6??333333?(knNK AzDCannot create socketCannot shutdown for readsetuidac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Bad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sMust be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytesCan't turn on socket debuggingSO_DONTROUTECan't set special IP headerCan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizerecvfromenablesignals: sigprocmaskpacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x LSRR: (same route) RR: NOP unknown option 0x%x%d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f ms ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d%d bytes from %s: TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%u%s (%s) %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s 0.0.0.0Can't turn off special IP headerfailed to clear cached routesendtowrote %s %d chars, ret=%dblocksignals: sigprocmask"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCannot resolve "%s" (%s)%s only supported with IPusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Vr HL TOS Len ID Flg off TTL Pro cks Src DstmnnnCnVnnnnn^nn9nnhndlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()(can't restart init): usage: %s [-dln%sqvxz] [-- ] r  r rr rsssNyvvvv w1wBwvvvMw^wwwwwwvwwx%xAxKxvUxvv\xvvrx|xxxx2vxxxxxxxxxxxxxxqzzzօ݅\sf fff΋Nj  dfLnqSsTtv[qnqqqqqrGrgrrrrs-sUsusssMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGJRUGHRBD M@dmCLS1@2plbRXcnatalkexpirehopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsbotched keyword: %sUsage: %s [-%s] cmd [[-] args] SO_RERRORRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifaceroute-sysctl-estimateactual retrieval of routing table(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %hhu keyix %hhu key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: sockaddrs: locks: inits: not in tableentry in userouting table overflowold usage of trailing 0assuming route to ifold usage of trailing digitassuming route via gatewaymissing destination specificationmissing gateway specification-host and -net conflict: gateway %sInternal Error%s: bad value%s: address resolved to multiple valuesprefixlen is not supported with af %dsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; Examining routing table from sysctl (truncated)sysctl of routing table%-*.*s %-*.*s %-6.6s FlagsInternetInternet6EncapAppleTalk Protocol Family %d: %-6.6s (%d) %s%u.%u.%u.%u/%dillegal prefixlen%s/%daf %d: %s0123456789abcdef%6s %8s link#%dRouting tablesunspecb\x4Ξѝڞ@.Dhw.disknamesswaponADUacdfghklmnop:qst:znoblk%s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab usage: %s -a [-t blk|noblk] %s ... WARNING: %s is readable by the worldWARNING: %s is writable by the worldcould not set dump device to %s%s: setting dump device to %s could not get dump devicedump device is major %llu minor %llu %s: adding %s as swap device at priority 0 %s: removing %s as swap device swpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umount%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z no dump device setno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)KBytesMBytesGBytes%-*s %*s %8s %8s %8s %s DeviceCapacityPriority%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available %-*s %*s %8s %8s %5.0f%% Total%-*s %*ld %8ld %8ld %5.0f%% fR%s: not currently mountedumount_%s%s: execvpUsage: %s [-fR] special | node кrH%zGH%j~"  d/?kpydqyyywyyyywypqyyyyyyqyyyyypypyqyqypyyyyyyyyyyQrryp.pqqysyyyy`rorrwpsqIs-qRqy_s*************************************************************************************************************************************************************************************************************************************** ЦԦئܦY][f ݎ +Using %s mode to transfer files. changetype: unknown type %dTYPE %s %sTYPE %sbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileAPPESTOUSTORlocal-filesGlob pattern `%s' not foundr+Restart is not supported by the remote server. RETRremote-filesmregetSkipping non-relative filename `%s' Can't open source file %s Version: %s %s NetBSD-ftp20241129%s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSD is not supported by the remote server. MLSDnlistNLSTpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. %-*s %s No such option `%s'. Setting `%s' to `%s'. Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %s%s: unknown mode. nmap: unbalanced brackets. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list accountbyecdupeditepsvepsv4epsv6featuresfgetformidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoteremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverify'%s' macro not found. Invalid URL `%s'http://file://ftp://Unsupported URL scheme `%.*s'localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Can't connect to `%s:%s'Requesting %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'/home/source/ab/netbsd-10-llvm/src/usr.bin/ftp/fetch.cfetch_urlrcvbuf_size > 0Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'parse_url: invoked with NULL argument!Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$init %s: HTTP fetch timeout. (%svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldHost: %sHost: [%s]Pragma: no-cache Cache-Control: no-cache FTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:WWW-Authenticate:BasicNot expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileReceiving HTTP reply: %s %s: HTTP fetch aborted. ;type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'%s: unknown transfer type %dfetch_ftp ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Can't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. No control connection for command421 Service not available, %s. local: %s %s: not a plain file. REST %lld/home/source/ab/netbsd-10-llvm/src/usr.bin/ftp/ftp.csendrequestsndbuf_size > 0Writing to networkCan't access `%s'Can't chmod `%s'recvrequestReading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't create socket for data connectionEPSVwrong server: return code must be 229 PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s Error aborting proxy commandError resetting connectionrunique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR Usage error remote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. remote abort aborted; closing connection. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftp:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%cCan't lookup `%s': %sanonymous/.netrc%s/.netrc: %sFTPANONPASSPAGERFTPPROMPTftp> FTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... prompt: no such option `prompt'rprompt: no such option `rprompt'Sorry, input line is too long. %sommands may be abbreviated. Commands are: Proxy c?Ambiguous %s command `%s' ?Invalid %s command `%s' getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETA%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled)KiBMiBGiBTiBPiBEiBCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. 4 KiB macro buffer exceeded. Unknown .netrc keyword `%s'Token in .netrc too longAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-print Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dName (%s:%s): Name (%s): %s; %s aborted. Login failedSorry, arguments too long. (%s) operationftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' %Y%m%d%H%M%SCan't parse time `%s'. %a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longCan't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyMDTMREST STREAMTVFSInput line is too long (specify -b > 16384)_R5h 3 NetBSD gzip 20240203123456789cdhlV(stdin)can't read stdin(stdin): unexpected end of fileread of uncompressed size%12llu %12llu %2.2d.%5s%%malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.13failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%csnprintfcan't stat: %s%s is a directory%s is not a regular file.gzcan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %susage: %s [-123456789cdhlV] [ [ ...]] compressed uncompressed ratio uncompressed_nameN-UIy{}abcdDgGhHilnNpPqrs tw xy !:#= _*J.Yv a9~E"e9\ %lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c command%lu: %s: filename expectedw commandread commandbranch%lu: %s: empty label%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: extra text at the end of a transform command%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: whitespace after %s%lu: %s: duplicate label '%s'%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: RE error: %s%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: undefined label '%s'%lu: %s: unused label '%s'EGI::ae:f:gi::lnrusetting line buffered output failedsetting unbuffered output failed ..."-I or -i may not be used with stdinrename()fclose()%s: %s %sin-place editing onlyworks for regular files%s/.!%ld!%sUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] malloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty%lu: %s: \%u not defined in the RE\%c\abfrtv\%03oG:g:u:too many supplementary groups providedsetgroupssetgid-ino such user `%s'no such group `%s'Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command]    6          j|             -   Z H'  L%i :l@|######5$ 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-a23334/4M4k4444455=5[5y55555---5*3C3 626p3}.33    !!       06`0`6`~}|{z ywvtsrpnmlkjihgfcba_^]\[ZWUTSRQPONMLKJIHGFEDCBA@>=<;:98754321/.,*)('&%$#"!   %w{wvwtwtnot}lzutsgkpomigg]\`_U_eRQX`RZZaYZ^PFSLKFLJIGO@LOGEH;E10)'(.#(+1#")("F.JNQ  !"&;Bi<'jCk(~}|{z+++yxwvutsrqponmlhgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDA@?>=:9876543210/.-,*)%$# ?>?????@@>"@7@C@>P@e?w?c@u@@?@@>AAA@AAAAAAAAA@@A@@e?w??  & !"#$./01%( *)+,-  4    !" #  { }  )16J78SW          :#$%&+',-./TC0=?@ADEFKLS>MNOPQBRWYGUHI' VX123456789123456789  ;J<() *!"0+<_%zCOd6/*-- ZL]-Vſ4rոXe9'YjI4O.-NؠPL|YZǂrqA^Y 2u` / 6wq0Ły>LCOucq_*/!~aP>)66 ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[                                         Crypto self-test failedCan't lock memoryCGP:STUV:b:ef:gi:k:lno:sptuv-P is only for use with -g/-G action-P only makes sense with -S flag-S is only for use with -g/-G actionundefined actionusage: %s [-enpv] [-V vmeth] cgd dev [paramsfile] %s -C [-enpv] [-f configfile] %s -G [-enpSv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] paramsfile %s -g [-Sv] [-i ivmeth] [-k kgmeth] [-P paramsfile] [-o outfile] alg [keylen] %s -l [-v[v]] [cgd] %s -s [-nv] [-i ivmeth] cgd dev alg [keylen] %s -t paramsfile %s -T [-f configfile] %s -U [-nv] [-f configfile] %s -u [-nv] cgd can't open cgd "%s", "%s"%s (%s): clearing wrong number of argsdevice %s already in usegetfsspecname failed: %sparams invalidverification failed permanentlyverification failed, please reenter passphraseopendisk_werror(%s, %s, %zu) called. getkey("%s", %p, %zu) called unrecognised keygen method %d in getkey()/home/source/ab/netbsd-10-llvm/src/sbin/cgdconfig/cgdconfig.c%s's passphrase%s: (echo)failed to generate Argon2id key, error code %dpflag set inappropriately?failed to read passphrasefailed to generate PKCS#5 PBKDF2 keycommand failedcommand output too shortcommand failed with status %dunrecognised shared key derivation method %dfailed to derive HKDF-HMAC-SHA256 subkey with alg %s keylen %zu blocksize %zu ivmethod %s unimplemented verification methodcan't read disklabel areapread: incomplete blockre-enter deviceunsupported keygen methodcan't read mbr areacan't read gpt areafailed to parse key lengthfailed to read key from stdinFailed to parse key lengthinvalid parameters file "%s"no keygen in parameters file "%s"Failed to generate defaults for keygeninvalid parameters generatedcan't preserve randomly generated keyinvalid old parameters file "%s"old filenew filecan't generate new parameters file/etc/cgd/cgd.confcould not open config file "%s"\\#action failed on "%s" line %luopendir: %srcgdbad name %sopen: %sCGDIOCGETnot in usedev %llu,%llu keylen %d blksize %zd encblkno8encblkno1printkey1flags == CONFIG_FLAGS_FROMALLprintkeynbits <= INT_MAX - 7ret == (int)nb64Can't disable coresfatal flex scanner internal error--no action foundout of dynamic memory in yy_create_buffer()out of dynamic memory in yy_scan_buffer()out of dynamic memory in yy_scan_bytes()bad buffer in yy_scan_bytes()foofatal flex scanner internal error--end of buffer missedfatal error - scanner input buffer overflowinput in flex scanner failedout of dynamic memory in yy_get_next_buffer()out of dynamic memory in yyensure_buffer_stack()%s: failed to parse parameters file yacc stack overflowpkcs5_pbkdf2: calibrating iterations.../home/source/ab/netbsd-10-llvm/src/sbin/cgdconfig/pkcs5_pbkdf2.cprf_iteratetmplen == PRF_BLOCKLENcould not determine key length for unknown algorithm "%s"encblknounspecified algorithmunknown algorithm "%s"(warning)unspecified IV methodunknown IV method "%s" (warning)unspecified key lengthre-enterparams_setverify_method: unrecognized verify method "%s"keygen argon2id must provide `iterations'keygen argon2id must provide `memory'keygen argon2id must provide `parallelism'keygen argon2id must provide `version'keygen argon2id does not need a `cmd'keygen argon2id does not need a `key'keygen argon2id must provide a saltkeygen pkcs5_pbkdf2 must provide `iterations'keygen pkcs5_pbkdf2 does not need a `key'keygen pkcs5_pbkdf2 must provide a saltkeygen pkcs5_pbkdf2 does not need a `cmd'keygen pkcs5_pbkdf2/sha1 must provide `iterations'keygen pkcs5_pbkdf2/sha1 does not need a `key'keygen pkcs5_pbkdf2/sha1 must provide a saltkeygen pkcs5_pbkdf2/sha1 does not need a `cmd'keygen storedkey does not need `iterations'keygen storedkey must provide a keykeygen storedkey does not need `salt'keygen storedkey does not need `cmd'keygen [u]randomkey does not need `iterations'keygen [u]randomkey does not need `key'keygen [u]randomkey does not need `salt'keygen [u]randomkey does not need `cmd'keygen [u]randomkey makes no sense sharedkeygen shell_cmd does not need `iterations'keygen shell_cmd does not need `key'keygen shell_cmd does not need `salt'keygen shell_cmd must provide a `cmd'could not calibrate pkcs5_pbkdf2can't generate random bits for storedkey(u)randomkey keygen cannot be sharedstoredkey does not make sense as sharedkeygen already shareduuidgenuuid_to_string: %ukeygen not sharedargon2idpkcs5_pbkdf2/sha1urandomkeyshell_cmdunrecognized key generation method "%s"hkdf-hmac-sha256unrecognized shared key derivation algorithm "%s"/etc/cgdfailed to open params file "%s"keygen storedkey urandomkey; argon2id { iterationsparallelism}; pkcs5_pbkdf2 { pkcs5_pbkdf2/sha1 { keygen_fput: %d not a valid methodiv-methodkeylengthverify_methodunsupported verify_method (%d)could not open outfile "%s"%*sshared "%s" \ %*salgorithm %s \ %s %s; bits_decode: mangled base64 stream %sbits_decode: encoded bits claim to be longer than they are (nbits=%zu, stream len=%zu bytes)/dev/randomcalibrating argon2id parameters... failed to calculate Argon2 hash, error code %d failed to calibrate hash parameters: broken monotonic clock? failed to calibrate hash parametersArgon2dargon2dArgon2iargon2iArgon2idOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesPassword pointer is NULL, but password length is not 0Salt pointer is NULL, but salt length is not 0Secret pointer is NULL, but secret length is not 0Associated data pointer is NULL, but ad length is not 0Memory allocation errorThe free memory callback is NULLThe allocate memory callback is NULLArgon2_Context context is NULLThere is no such version of Argon2Output pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureSome of encoded parameters are too long or too shortThe password does not match the supplied hashUnknown error code$v=$m=,t=,p=w 6,.2 ? {c;1"J³XS6L5\vFqJ?@_D$,q{3odߖYgvcwCL)<ABCDEFGHIJKLMNOPQRSTUVWXYZտ[ss0\l ==      z,:T      %& &  &    222Gv0 0 "0 (0 .0 20 :0  B0  M0  T0  X0  }\0  ~b0 f0 p0 t0 0 0 0 .0 0 0 0 2 m~A2 >>!m U!D2 )  I2 : {T"   5{!M!p s J kM2 T2 0 Z2 g2  n2 @v2 ~2 2 +T2 : 2 2 2 2 2 B- 2 2 2 / Lk.4 4   4 4  4 5 5  5 5 5 5 5  5 %5 )5 /5 35 :5 >5 {C5 H5 L5 U5 Y5 _5 c5 k5 o5 ~5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6  6 6 '6 +6 16 16 56 96 D6 H6 P6 T6 \6 `6 `6 d6 h6 m6 q6 z6 ~6 6 6 6 6 6 6 6 6 ,5 6 5 6 6  6 6  6 29 ?9 K9 W9 c9 p9 {9 9 9 9 9 9 9 9 9 9 3; #; ; 9 : : w: :  {@^~ ?;  {@J; nN9 <U; N 9 Wb   9  {@ 9  {H 9 @ `;  8XY[q9 @ H XY]t9 P XX}9 \ 0 XY\q{9  @XY\wk; d1c9 @ & W9 $0 & K9 3p  ?9 $q0`(v; T ; @@`ad;  '; `; D@; 0*; 00*; X*29 ?&<  H @ADr3< `8 @AD@< T@ pqtM< e@ pqtZ< ( g< (P t< @`pqt p9 " &< xhX(:< `xx(B< $q( < X < =@Pp)< =@Pp&< P7hq&< VEhz&< VEhq*< +1@Hx*< =@L`*= =@Hh* = PF@\x*= PF,,-8%"=  N,,.:%-= a,>AM%8= `,,.8%C= m ,,.;%N= W\x5Y= ~ P*e= | P*p= ϙ8%{= H%= P*%= @` %= TXh&= %9  "`%`; L%= L%= L%= 3`%= h< @8XXZq%9 V @8XXZq%= $q @8XXZq%=  @8XXZq%{9 > @8XXZq%k; bH|h  %= $&= & > ^@&> 2P& > h&+> Dx(&6> o@88:M*A> ~@M%L> H4 %W> L0| !%b> @T*m> ,@H*x> .borderfontbacklightbrightnesscontrastscroll.fastlinesscroll.slowlinesedidmsg.default.attrsmsg.default.bgmsg.default.fgmsg.kernel.attrsmsg.kernel.bgmsg.kernel.fgsplash.enablesplash.progressWSDISPLAYIO_GTYPEWSDISPLAYIO_SFONTWSDISPLAYIO_SBORDERWSDISPLAYIO_PARAM_BACKLIGHTWSDISPLAYIO_PARAM_BRIGHTNESSWSDISPLAYIO_PARAM_CONTRASTWSDISPLAYIO_SSPLASHWSDISPLAYIO_SPROGRESSWSDISPLAYIO_GMSGATTRSWSDISPLAYIO_SMSGATTRSWSDISPLAYIO_DSSCROLLbell.pitchbell.periodbell.volumebell.pitch.defaultbell.period.defaultbell.volume.defaultrepeat.del1repeat.delnrepeat.del1.defaultrepeat.deln.defaultledstatekeyclickscroll.modescroll.modifierWSKBDIO_GTYPEWSKBDIO_GETBELLWSKBDIO_GETDEFAULTBELLWSKBDIO_GETMAPWSKBDIO_GETKEYREPEATWSKBDIO_GETLEDSWSKBDIO_GETENCODINGWSKBDIO_GETSCROLLWSKBDIO_SETMODEWSKBDIO_SETBELLWSKBDIO_SETDEFAULTBELLWSKBDIO_SETMAP +> WSKBDIO_SETKEYREPEATWSKBDIO_SETDEFAULTKEYREPEATWSKBDIO_SETLEDSWSKBDIO_SETENCODINGWSKBDIO_SETKEYCLICKWSKBDIO_SETSCROLLscrolling is not supported by this kernelBackSpaceLinefeedEscapeexclamquotedblnumbersigndollarpercentampersandapostropheparenleftparenrightasteriskcommasemicolonequalgreaterquestionbracketleftbracketrightasciicircumunderscorebraceleftbracerightasciitildenobreakspaceexclamdownsterlingcurrencyyenbrokenbarsectioncopyrightordfeminineguillemotleftnotsignhyphenregisteredmacrondegreeplusminustwosuperiorthreesuperiormuparagraphperiodcenteredonesuperiormasculineguillemotrightonequarteronehalfthreequartersquestiondownAgraveAacuteAcircumflexAtildeAdiaeresisAringAECcedillaEgraveEacuteEcircumflexEdiaeresisIgraveIacuteIcircumflexIdiaeresisETHNtildeOgraveOacuteOcircumflexOtildeOdiaeresismultiplyOobliqueUgraveUacuteUcircumflexUdiaeresisYacuteTHORNssharpagraveaacuteacircumflexatildeadiaeresisaeccedillaegraveecircumflexediaeresisigraveiacuteicircumflexidiaeresisethntildeograveoacuteocircumflexotildeodiaeresisdivisionoslashugraveuacuteucircumflexudiaeresisyacutethornydiaeresisAbreveabreveAogonekaogonekCacutecacuteCcaronccaronDcarondcaronDstrokedstrokeEogonekeogonekEcaronecaronLacutelacuteLcaronlcaronLstrokelstrokeNacutenacuteNcaronncaronOdoubleacuteodoubleacuteRacuteracuteRcaronrcaronSacutesacuteScaronscaronTcedillatcedillaTcarontcaronUaboveringuaboveringUdoubleacuteudoubleacuteZacutezacuteZabovedotzabovedotZcaronzcarondead_gravedead_acutedead_circumflexdead_tildedead_brevedead_diaeresisdead_aboveringdead_carondead_dotaccentdead_hungarumlautdead_ogonekdead_slashdead_cedilladead_semidead_colongr_Atgr_Etgr_Htgr_Itgr_Otgr_Ytgr_Vtgr_itdgr_Agr_Bgr_Ggr_Dgr_Egr_Zgr_Hgr_Ugr_Igr_Kgr_Lgr_Mgr_Ngr_Jgr_Ogr_Pgr_Rgr_Sgr_Tgr_Ygr_Fgr_Xgr_Cgr_Vgr_Idgr_Ydgr_atgr_etgr_htgr_itgr_ytdgr_agr_bgr_ggr_dgr_egr_zgr_hgr_ugr_igr_kgr_lgr_mgr_ngr_jgr_ogr_pgr_rgr_teliko_sgr_sgr_tgr_ygr_fgr_xgr_cgr_vgr_idgr_ydgr_otgr_ytgr_vtShift_LShift_RControl_LControl_RCaps_LockShift_LockAlt_LAlt_RMulti_keyMode_switchNum_LockHold_ScreenCmdCmd1Cmd2Meta_LMeta_RZenkaku_HankakuHiragana_KatakanaHenkan_ModeHenkanMuhenkanKP_F1KP_F2KP_F3KP_F4KP_HomeKP_LeftKP_UpKP_RightKP_DownKP_PriorKP_NextKP_EndKP_BeginKP_InsertKP_DeleteKP_SpaceKP_TabKP_EnterKP_EqualKP_NumbersignKP_MultiplyKP_AddKP_SeparatorKP_SubtractKP_DecimalKP_DivideKP_0KP_1KP_2KP_3KP_4KP_5KP_6KP_7KP_8KP_9f3f4f5f6f7f9f10f11f12f13f14f15f16f17f18f19f20F5F6F7F9F10F11F12F13F14F15F16F17F18F19F20PowerHelpExecuteFindSelectAgainPropsUndoFrontCopyOpenPasteCutStopMenuPausePrint_ScreenCmd_Screen0Cmd_Screen1Cmd_Screen2Cmd_Screen3Cmd_Screen4Cmd_Screen5Cmd_Screen6Cmd_Screen7Cmd_Screen8Cmd_Screen9Cmd_DebuggerCmd_ResetEmulCmd_ResetCloseCmd_BacklightOnCmd_BacklightOffCmd_BacklightToggleCmd_BrightnessUpCmd_BrightnessDownCmd_BrightnessRotateCmd_ContrastUpCmd_ContrastDownCmd_ContrastRotateCmd_ScrollFastUpCmd_ScrollFastDownCmd_ScrollSlowUpCmd_ScrollSlowDownCmd_VolumeUpCmd_VolumeDownCmd_VolumeTogglevoidSymbolL5_GbreveL5_IdotaboveL5_ScedillaL5_gbreveL5_idotlessL5_scedillaunknown_%d%d: keycode too largekeysym expectedparse: %s [%.*s]keysym %s not found%s: not a keysym%c: illegal character in input%03o: illegal character in inputsampleratescroll.reversescroll.distance.xscroll.distance.ycalibration.minxcalibration.minycalibration.maxxcalibration.maxycalibration.samplesrepeat.buttonsrepeat.delay.firstrepeat.delay.decrementrepeat.delay.minimumWSMOUSEIO_GTYPEWSMOUSEIO_SRESWSMOUSEIO_SRATEcould not list calibration samples%s%d,%d,%d,%dWSMOUSEIO_GETREPEATWSMOUSEIO_GCALIBCOORDS%s: invalid calibration dataWSMOUSEIO_SCALIBCOORDSWSMOUSEIO_SETREPEATinternal error: field_by_value: not foundinternal error: pr_field: no format %d%s: not a valid encoding%s: not a valid variant%s: not a valid color%s: not a valid attributeinternal error: rd_field: no format %dlk201lk401pc-xtpc-atusbhpc-kbdhpc-btnarchimedesriscpcadbhilmaplesunsun-type5sgimatrix-keypadbluetoothdec-tcps2logitech-busms-inporttouch-paneldec-maxinedec-pm-monodec-pm-colordec-cfbdec-xcfbdec-mfbdec-sfbvga-isavga-pcidec-tga-pcidec-sfb+generic-pcinext-monodec-pxdec-pxgdec-txgeneric-hpcarm-vidcdec-spxdec-gpxdec-lcgdec-vax-monosparcbook-p9100egadreamcast-pvrhp-gatorhp-topcathp-renaissancehp-catseyehp-davincihp-tigerhp-hyperionamiga-ccgrfsun24sgi-newportsgi-gr2suncg12suncg14suntcxsunffbukczbeponeonodeaddeclkswapctrlcapsdvorakmetaesciopenermachdepcolemakblackbrownbluemagentacyanwhitehilitblinkunderline%s: not a valid number list%ld: number out of rangekeycode %u =adf:kmnwonly one of -k, -d or -m may be givenexcess arguments after -aonly one of -a or -w may be given/dev/wskbd/dev/wsmouse/dev/ttyE0"%s" not shown with -a; use "%s %s" to view.'=' not found%s: read only%s: can only be set%s: write only%s: no kernel support%s: %s Usage: %s [-kmd] [-f file] [-n] name ... -or- %s [-kmd] [-f file] [-n] -w name=value ... -or- %s [-kmd] [-f file] [-n] -w name+=value ... -or- %s [-kmd] [-f file] [-n] -a AACAcerViewAPPApple ComputerAST ResearchCPLCompalCPQCompaqCTXDELDellDPCDeltaDWEDaewooEIZEIZOELSAEPIEnvisionFCMFunaiFUJFujitsuGSMLG ElectronicsGWYGateway 2000HEIHyundaiHITHitachiHSLHansolHTCHitachi/NisseiHWPHPIBMFujitsu ICLIVMIiyamaKDSKorea Data SystemsMEIPanasonicMELMitsubishi ElectronicsNANNanaoNECNOKNokia DataPHLPhilipsRELRelisysSAMSGISNYSonySRCShamrockSUNSun MicrosystemsTatungToshibaTSBVSCViewSonicZCMZenithUltrascan 14XE17GS17PSVendor: [%s] %s Product: [%04X] %s Serial number: %s Manufactured %d Week %d EDID Version %d.%d EDID Comment: %s Video Input: %x Digital (DFP 1.x compatible)Gamma: %d.%02d Max Size: %d cm x %d cm Features: %x Red X: 0.%03d Red Y: 0.%03d Grn X: 0.%03d Grn Y: 0.%03d Blu X: 0.%03d Blu Y: 0.%03d Wht X: 0.%03d Wht Y: 0.%03d Horizontal: %d - %d kHz Vertical: %d - %d Hz Max Dot Clock: %d MHz GTF2 hfreq: %d GTF2 C: %d GTF2 M: %d GTF2 J: %d GTF2 K: %d %dx%d @ %dHz (%d %d %d %d %d %d %d %s%sH %s%sV) Preferred mode: %dx%d @ %dHz Number of extension blocks: %d 1280x1024x751024x768x751024x768x701024x768x601024x768x87i832x624x74800x600x75800x600x72800x600x60800x600x56640x480x75640x480x72640x480x67640x480x60720x400x87720x400x70%dx%dx%d Analog -0.7, 0.0V Undefined monitor typeChroma Info:Video modes: Default GTF supported Preferred timing Standard color space Multicolor RGB Monochrome DPMS active-off DPMS suspend DPMS standby Serration vsync Sync on green Composite sync Separate syncs Blank-to-black setup -1.0, 0.4V -0.714, 0.286V -0.7, 0.3V640x350x85640x400x85720x400x85640x480x85800x600x851024x768x851024x768x891152x864x751280x768x751280x960x601280x960x851280x1024x601280x1024x701280x1024x851600x1200x601600x1200x651600x1200x701600x1200x751600x1200x851680x1050x601792x1344x601792x1344x751856x1392x601856x1392x751920x1440x601920x1440x751152x768x541400x1050x601400x1050x741152x900x661152x900x76320x175x85320x200x85360x200x70360x200x85360x200x87320x240x60320x240x72320x240x75320x240x85400x300x56400x300x60400x300x72400x300x75400x300x85512x384x87i512x384x60512x384x70512x384x75512x384x85512x384x89576x432x75640x384x75640x512x60640x512x70640x512x75640x512x85800x600x65800x600x70840x525x60896x672x60896x672x75928x696x60928x696x75960x720x60960x720x75416x312x74576x384x54700x525x60700x525x74576x450x66576x450x76yT In7 KW9-]  ( 2 < F P Z d   w!H"h"""'%.%5%o%v%}%%/G//G/J J J K K  G I I I I a:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %sinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %s-p: No fill space; increase packet size with -sgetaddrinfo failedbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> recvmsgnew path MTU (%d) is notified --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNodeInfo Supported Qtypes, compressed bitmap, raw bitmap-%u truncated(TTL=infty)(TTL=%u)Destination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subject, subject=%s(invalid), invalidNode Information ReplyIP6HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) %1x %02x %05x %04x %02x %02x %s->IPv6 addressDNS labelIPv4 addressSuccessRefused HbH Options: Dst Options: Routing: nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s sendmsgping6: wrote %s %d chars, ret=%d patterns must be specified as hex digitsff02::2:0000:0000usage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host no addressRedirectTime to live exceededDestination Unreachable Beyond ScopeDestination Administratively UnreachableNo Route to DestinationESPVr TC Flow Plen Nxt Hlimm>>>>>m>>>>>LLLLLLL>LLJLVLLLjLLuLLLLLLLLLLLLLLLLLLLLLLLLLLLMLLML#M,ML>MLPMYMLbMLkMgfVU%I@843.*c'$#" rbFCV{Jh ~}~h ~h v&! :h NL!bh xh h BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~h )h |T \ h |X \ h }h h v! h L!h  @h h .!*!(!vvsssDDDLDDΎEՒ**********գգգգգ2գգգգգգТ:HbHHbbHHbbbbbbbbbbbbbbbbHHh }`h h vP! h L!@h h 0h  i $i (i ,i 0i 4i N8i >i Ai M  Wi  R Z Ki  Ni  [i  ^i  %  hi  xi (ш{i i i i i i i hsi i i i 6 i vi  i !i "i #i $i % & 'i (j ) *j + ,! -!j - ..j .{& /j /M0I 18j 2j ?j @j [\j \j ]Z" ^j ^! _j _j `k { k { k |.k }:k }f" ~5 1̾f (EUwG%[0 =M^s000@000@Warv"Yoc ;6wuuuuuuuuu'9L_p  &{{&&{{.{{0Ot<` )N'}''1~S,A`pSSS6cSSSc/etc/group/etc/master.passwd: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: '___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: PuZ CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena alnumblankcntrlpunctxdigit646towlowertowupperUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSbackspaceVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4NAKSYNETBSUBESCIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signleft-parenthesisright-parenthesisplus-signhyphen-minusfull-stoptwothreefourfiveseveneightless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflex-accentlow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketshut up gccYP FAKE error %d %ju%s%0*jux#|#|hx#|#|#|#|#|#|#|#|#|xx#|#|#|y#|ysnap ,archivedsappendschangesimmutableuappenduchangeuimmutabley|||}}}}}}}}}}}}}}}}}}}}}_~Vffffffffffffffffffffffffffffff ffffffffɀfffffffffffffffffffffffyfffق6666666666666d666666link#%hu%d:[%d,%d]sat_len=%u, sat_family=%u, sat_port=%u, sat_addr.s_net=%u, sat_addr.s_node=%u, sat_range.r_netrange.nr_phase=%u, sat_range.r_netrange.nr_firstnet=%u, sat_range.r_netrange.nr_lastnet=%usun_len=%u, sun_family=%u, sun_path=%*ssin_len=%u, sin_family=%u, sin_port=%u, sin_addr.s_addr=%08xsin6_len=%u, sin6_family=%u, sin6_port=%u, sin6_flowinfo=%u, sin6_addr=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x, sin6_scope_id=%usdl_len=%u, sdl_family=%u, sdl_index=%u, sdl_type=%u, sdl_nlen=%u, sdl_alen=%u, sdl_slen=%u, sdl_data=%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x%s%s.pid˞מz##ݡ429[֤ 1&Pէ@b @@g,2/ +0-*1. )#'"%56!  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444   +: UO+Gc9ca.m.p.m.januaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaymotuesdaytueswednesdaywedneswedswethursdaythursthurfridaysaturdaygmtutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdtmidnightnoonmiddayyearmonthfortnightweektomorrowyesterdaytodaylastthiseleventwelveagoautoselect11a11b11gfh11na11ng11acEthernetetherTokenRingtokenFDDIIEEE802.11CARPmanual10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmesh-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT.sysctl kern.root_device failedNAME=sysctl hw.disknames failed/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]sysvv71kv8otherhpfshfsraidframejfs2minixfs3vmwresv00000000000000000000000000000000000000000%#jo%#jx%s%s%s%c/dev/zvol/%.*s/%s%s/dev/zvol/%sdsk5MS7)  O TT  T FbwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9#$ !     rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-^G^M^Ikbskcub1kcud1^M^Jiviivi~I886d8|8~108?HZcluTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalansivt100vt220wsvt25xterm$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfo%s.cdbansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL{} BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P <G [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @}OM1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbxOwyOyzOu~OqOsOPOQOROS[?69lf[?69h[%i%p1%d;%p2%ds[<ODOBOC OAOFOH[21~[23~[24~[15;2~[17;2~[18;2~[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h= [?1034hJNO [%i%p1%ddZ<@BC{V[?1049l5[?1049h [%i%d;%dR[?%[;0123456789]cIOrmxxssmxxskp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s,,,,,,,,,,,,,,,,,,,,,,,,,,,,,a,,,,h,,,,,,Z,,Z,,,,o,},v,_ti_getnamepromote num,v3%s: %s: unknown capability%s: %s: cap name is too longno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number %ld out of range%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digitbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxonbitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswslacscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom  # "  !""$  b A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cReRCMD_CMD/usr/bin/rshCannnot exec %sR%zu W%zu L%lld %d *1*02a./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz   #& +6 )4%/7(3-!0,1'8"5.*2$ 91)! :2*" ;3+# <4,$?7/'>6.&=5-%  :2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'       !"#$1234%&'(5678)*+,9:;<-./0=>?@                                                                                                                                 argon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789OrpheanBeholderScryDoubt6789:;<=>?  !"#$%&'()*+,-./012345 1Ѭߘr/Ḗ~&jE|,G$l iciNWqX~=t XrX͋qJT{YZ90`*#`(yA8۸y:`l>w'K1/x`\`U%U攫UbHW@cj9U*4\̴ATr|*oc]ũ+1t>\3֯\$lS2zw(H;Kkē!(f a!`|H2]]]u#&܈e>#Ŭom9BD . Ji^Bh!la gӫҠQjh/T(3Ql n;zP;*~ev9>YfCoEå}^;uos D@jVbNw?6r=B$7H ۛIrS{y%P;LylO`@ž\^c$johSl>9oR;Qm,0DE ^J3(fK.WtE9_ ӹyU 2`yr,@%g̣饎"2u<kaP/R=2`#H{1S>W\o.ViB~(2gsUO'[iXʻ]=!lJ[-ySeEIҐK3~ˤAb Lw6~д+MەqՓkю%ǯ/[{AI~-%^q h"W6d$ cUYCxSZ٢[} Źv&ϕbhAJsN-GJ{RQ)S?Wƛv`+t恵oWk *!ec.4dV]-SGjnpzKD). u#&İn}ߧI`fqilRdVឱ¥6)L u@Y>:䚘T?eB[k?ҡ08-M]% L&pc^?kh >\D}W7: P tAu8/;21>8TNmO Bo ,y|$ryVw.?rU$qk.P̈́GXzt}K:zfC cdG27;C$CMQe*P:qUN1w_V5kǣ;< $Y,n<pEㆱo ^*>Zw=Ne)։>%fRxL.jxS<- N=+6&9`y#RnfE{7(2åZl!Xeh;/ۭ}*/n[(!pa)uGa0a4c\s9pL ު˼,b`\ndi#PZe2Zh@*<1! T_~}=b7w-_h)5ǡޖXxWcr"ÃF T0.SHُ(1mX4a(s<|J]d]B> EꫪOlOBBǵj;Oe!AyMjGKPb=bF&[$ti GV[ Htb#*BXU >ap?#r3A~_;"lY7|`t˧@n2w΄PU5ai Z .zD4Egɞs͈Uy_g@Cge48>q(= m!>J=+hZ=@&L4)i Av.khq$j 3ԷCaP.9FE$tO!@MpE/f m1'A9UG%ښ ʫ%xP()Sچ, mbhiHפh'?Oz|Ϊ_7әxB*k@5 ٫9N;VmK1f&tn:2C[Ah xN جV@E'H::SU kKмgUXc)3VJ*%1?~^|1)p/'\,(H"m?H܆AyG@n]Q_2Տd5A4x{%`*`lc´2Of#k>3b $;" r(-Exb}doITH}'>AcG t.no:7`L knU{7,gm;e' )̒9 i{f} ϑ^و/$[Qy{;v.97yY̗&-1.Bh;+jLu.x7BjQ满PcKkؽ%=YBD n *Ngd_ڈ鿾dW{x`M``FѰ8Ew63kBqA_^;Z4ٷ,Q+:Ֆ}}>(-}|%rZLZq)GW;()f(.y_xU`uD^mm%adâW<'*:m?!cf&(3uU4V<wQ( gQ̫_QM08bX7 z{>d!Q2Ow~㶨F=)iSHd$m-if! FEdlX [@X̻k~jEY:D 5>ʹrdfGof,ҏ"W##v215VbuZ6ns҈bIPLVq z2E{Sb%ҽ5iq"|˶+v>S@`8G% 8vFšw``u N˅؍芰z~L\HjiԐ\-% ?2aN[wߏWr:j?$.Dsp"8 1).lN!(Ew8fTl 4)P|ɵՄ? Gy$1$ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[                                         wYj{qOkfis@ 0 >x     `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @incorrect header checkinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check inflate 1.2.13 Copyright 1995-2022 Mark Adler  #+3;CScsA !1Aa  0@`@@011111111111011101111111111111111101111111111101111111110e2G2G2G2G2G2G2G2G2G2G2G2e2G2G2G2e2G2G2G2G2G2G2G2G2G2G2G2G2G2G2G2G2G2e2G2G2G2G2G2G2G2G2G2G2G2e2G2G2G2G2G2G2G2G2G2e2Z888888888888Z8888Z888888888888888888Z888888888888Z8888888888Z89999999999999999999999999999999999999999999999999999999999:::::::::::9:::9:::::::::::::::::9:::::::::::9:::::::::9f::::::::::::f::::f::::::::::::::::::f::::::::::::f::::::::::f: ;;;;;;;;;;;; ;;;; ;;;;;;;;;;;;;;;;;; ;;;;;;;;;;;; ;;;;;;;;;; ;<;;;;;;;;;;;<;;;<;;;;;;;;;;;;;;;;;<;;;;;;;;;;;<;;;;;;;;;jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,need dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible version   L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c             (08@P`p  0@`  0@`/home/source/ab/netbsd-10-llvm/src/common/lib/libprop/prop_string.cprop_string_create_cstringstr != ((void *)0)prop_string_create_formatfmt != ((void *)0)prop_string_create_nocopyprop_string_append_cstringsrc != ((void *)0)_prop_string_rb_compare_nodesps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_keyps->ps_un.psu_immutable != ((void *)0)hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh&&&&&&&&&&&&&&&&&&&&&&&&&&&&________yy__y__________________y` /home/source/ab/netbsd-10-llvm/src/common/lib/libprop/prop_object.c_prop_object_externalize_append_charctx->poec_capacity != 0ctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity _prop_object_internalize_find_tag!((*cp) == '\0')?xml !DOCTYPE plist