ELF( 4!O4 ( """CC[!"\\@0 6QQ O @@( @0 fH!@P@Q?H3}Р -L/[de@c@kdmain() returnedlmd   ! X(@@T @@ 0/|odxodT (/// P-eN8d@c@-@PL00S @0080 0 0 0Ȓ 7ЍX}cCC6>P/00S 000/X}c4DeA-@Mp}P @ލ0s nPP 90 00t`wV ) h寳@ ၫl 0R(0R  rOoB6>edA6>\ 4S/0!8 00 (   !/@cddd@-댳nP|Q0 !!X0T0P0H000, !  !.7>67>@cdddG-bM0SpPpP7P ~\ЍGe ;q@T ~P~ ^~  P qPP 00 B4R  04!@a0C0 qT p@ qP@ qc~P _~P ~P P sp~P|~Pl~PP F~PC~ 8ɲ$ 0@ WeG7>7>We6>Q7>T7>W7>Z7>@-<@b~P*~$\~PV~@ )`7>7>7>@-l00: ST 88S!~0Y㔺@ 00 @kd@B@-0@0PS@!@/ӽ 4Sʀ0! 0    !B? SO0 !! HMDK%<H8夽0Cc4De-@cddd7>7> 8>@B8> P00  /$@$0P  000/dPd<0 P0/S/0CQ/@kds@-A0S<`P`GP. BP, =P P0000 8NCPЍp@茵x&P`h@0: S P0RЍp@@P8P0Ѝpc,8>38>:8>p@XcA8>@kd` @ @O-M-&pP{帶 ?WM家!7GR  E0~P00l'0d'd7!`' \7\'0QL7尤ᴴḔἄ e U `P& 6  ::f&fST6 S0匸?6~P L "01%6PQ P!! *!x& 1t !p&pf0l6#6$1  1 @P *<!$1)0C$1ek0!10C0PU0S 9#9S  @P :$1I)0C*$1,Hk1,!p1c001 1 @P :|5*$10C$13k 1 @P :$1Du*0C$1%k0! 10C01 @ P:$1t*0C$1k0! 10C01 @ P:$1t*0C$1j0! 10C01 @ P:$1lt*0C$1j0! 10C01 @ Ps:$1*0C$1j1! 10C11 @ Pa:$1)0C$1jP#Iq㰃 uIW#I# Ix#x Ip#pI$p`3`` \3!XT3 0C 0p 0I! 0I 0I H": H": Ht: H\: H0p09 H 0p0 :HXp!I!p0 wH<YL$1Q 1!0!>0>00!1 ! B"&$! 03/03/03/ 03/xzG+- 1I0II010! ,1,! (1(!h$)G! 1"n}F ЍG8>@\8> 0 DSBO@kd4Deᆳc,8>mdAiPc)i<c` A8>?l?e,wd`89>O9>wd(odPododdodhld|ldldld@ldmdwde CBhmd clmd@vc(ct $c @cP @- @0 PЍO-p@㬱LM P 1 0LЍ001!4 S6QU1S1S1S* o@ }TTU   ,0PP<0P 008{@P`\  0<0 0^*0 00 \S 0 9>O-0`(Pp b@ nP bPPP00 ɃP 0 0tP PP0 0@ⳃPp  p@?P 9>9>9>G- @3`Pd1.0\\$p0PfGpU' 0SI 00P(0P pW4 pGW=f/0} 0<0 06003/PP000( 0 0# eP  _P8S PvCP f/|$0P`  `Ѝ9>WEV9>9>A-` 0pd 0@h 0Pl0`S X, P I/ 0V 048<S Q PU nP0 R P  0`PU0 0 0` 04 8 <0H0(UPXá R  $  (3/O-@M`Pp @h(0P  X0<0((S 2<0\0Q00 08@:>*:>@-@p,M `POg(eS@0(`S00,PP 00S00 0B!000P,Ѝ [7 >@-90@-@0zP0 0 000@p@-0M`Px@fP00 0 0000 02`P 0Ѝp@貯(Pz0(@400800@00D00H00L00P0@{x0 00 0Pf00T0  0 0(00< ,00g0ЍpS:>e:>g:>       :>+,00 SP/o/@kdA-P0@Q`0p$ 7/0 V0`08$ A#8/p@-0@P0` 6/05`8 p@#8/p@-h0P@ TT0pH00 S /o" p@Sp4mdc@kd` s@-`Pw`0@0O尮 qwPB 00,R P, 305/PP Ѝp@`0 SxwP {\0@X0Ѝp@ @0R Ѝp:>:>@:>@kd4mdc` @-@dP/o@"Slcp@-`PLd@Pp  E$00Spp p@:lcp@-P`d@PpIFU  ' p@"  lcL0 H0R/p@-P4yd@Pp&U p@ @kd` lcp@-P<fd@,bdP  Tp p@lcp@-P<Qd@,MdP Tp p@lc@-@$ ``06/Tp0$ 0P5/`P?>$ 5/0$ 0P5/ 08`$ p@#8/@kd` lcp@-d\cPTXcU@ $ ``06/Tp0`$ p@/lc/p@-0 P T@``06/0 ``6/`0p@ /p@-P@u@0 T000S 0d00h00p0x0h0x0p@ S0d0i0h0^0 S0d0i0h0^0p0j0l0]0t0` @kd) A-0PST@ Sq yu Bu 00 `0*b6/`P hu  0@  0`p7/< `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0 `p 7/0`pS0    07/0 `p 7/ `pt0 7/`` 0 6/ ``D0 6/0S000 0 00$0Ѝ@:>:>@cp@-P0 ` T@003/U U 0\  p 003/p;>ᐰ@-00  Ѝ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-0`@TP Vp V h00 3/P0T00 T0 `@4/A0T0 `@31;>|A-0@PT` Tp @DT0S $ 003/@08$ `@#84/A~R;>@-@00 S @0 QP@oЍ@kd@-0 00  0 0 0ЍA-PS@`p ~ P PA蓫W    P 冫UA};>;>p@-P`3tP0|P@0@ⱫSP`00 P0M   V0 0p;>cA-p`KaPP 0S  W000V0000 @1 #W  R0 W00S 0$2V  R0 0#V00S0 AtLcc@-@ a0P Rl T0@0@000@0#3T  R0 0#T00S0 @@LLcc@-@`0P Rh T0000  "!0"T00S0 T  R @%Lcc@-@`0P Rh T0 0 000 02 #T  R0 T00S0@ Lcc 0o/8md/0@-0M P@ 0^P 000 bЍ03 p@-0@Tp@t n0$0dP 5/0 dP5/00| 0p@x8md;>A-(MPs@D1P<吪40100: S$ 0A㫀p` 0000 (`0w?C$004  p,00 `0@ 6/0S (ЍA#05p`WV xxp Pd Qa0 0@0 0^(Ѝ8md<>@kdc<>pAl6 <>3 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@;A-0@TANA⦩0P`dp 7/U UA UU U 0dP5/0dP 5/0 4P5/ 8md;<>p@-0@TxP\AbpPP0 4P5/ 0 4P5/Pî 忮8mdI<>C-1M@TiA<Ѝpb0` dP5/ 0dP5/P 囮噮央㜱pPP p d09/0 49/ ㇱ0 49/ 0 49/PU ljh0 dP5/0?<#8mdV<>A-1@T PШP0` dp7/ 0dp7/ 20;30dp 7/0 4P5/ "0 4P5/ 0 4P5/P 8mdh<>O-,1P@`(,040p,坭(嚭0嗭4唭 @P0 ٭ ް(խ ڰ(ޭ ְ[P0׭ ȭ (s ,p0m4jOTŭ8md0S@- S S@@X,<>0 @o/@kd@-c@PЍG-@Ђ2PRp`0CRdh2R 3C7CR0 0 $ G貴,2RW 3C7CR008#8S800 0A &A004004 0(0L00P0  , Q  !% b ,R!X , % , h0l0& d  '!00 !11  0P008#8S308#8S0x`0 p@ p(`8p<@00500``5008#8Ss308#8SmSW HdHd<><> <>@-@`(pPh @廲`0`` 0X 0P0` P00y_04 4;PRЍp<>c=>8k,cP@ l@ @-p+@-o@00: S/ @kd<>c00@o/@kd` @-\@PЍG-@Ђp2PRp`0CR`P2R 3C7CR0 0 $ Gy2RS 3C7CR008#8S800 0@ &@1414$00L00P0$  Q  !%!b$ R!X $ %$ h0l0& d  ' !0 !  011,P008#8S308#8S0x`0 p? h(`8p<?151``5008#8Sy308#8SsSW HdHd<=>V=> ^=>@-@`&oP@d `0`` 0X 0P0` P00w^04 49PPЍpp=>cx=>8k,XcXD tD @-nv@-n@j0 0R/  Y@kd` p=>xcp@-@ 0R * R< RU !0 1dPa05/x1x!dP 5/d1dP\! 5/<dP D!5/ {0d,!p@/ !0 1dPa05/0 dP 5/0dP !0 1dP!05/0 dP 5/0dPp 5/=dP !0 1dP!05/H0 dP 5/5dP[~ _f-/4/-/-/-/-/-/-/A-PpX`~0@ 2/ p 0S0@0 @0000@A-P M@`ᘥ0 0 0  p7/0P   p*7/0P  < Ѝ "( p7/ P\ 000 00@001 R `  @0X@p0$0:0d0 00!S   1 0 0S0h006Qd  {*|000040J> 0 0000Ȅ 8/0$@0\0` S()=>=>=>=>>>> 0 />@-@ 00 S@@@kdQA-P@@@DT@ 0S 0S`T p` 00  刬`T@T@A-@lP@D奣`0p0```p0P0 PT0x Ph0X wP@أ04 mPAͣw>>|>>HmdxN `N >>N N @-}l@A@-wl@@-ql@ |0 0@-el0 0@r0 0@l0P/fHmd@-<0@TP [0 0 @SHmd0P/QJHmdp@-0@T/ 0S S* S& P 0 0 P PU, Pp 0%D0P0000C00 0P  ppHmdRW SW 0o/Lmd///<0Q 1CQ/ 0Q0 /00 W@W@p@-PP2S w@tP0T00S,0upG-M`k@P2`0p?봂埢XPF F0* Rp "Sk pd2d P00 000!h8" p-PP΢0҇0$̇P(0SHP㰑0SKP 1@^P 1@VP h1@NP H1@F@10S h ,@00h0 01@0b0!ZdЍ0!p P_ a` P0p 0㉧P0qw ဧ0* R t0@ P S T0@Lmd@>@kdT ` ?>cxT @>P T P c cc ,>>clX DX @-j//G-s@dVʀ 0! $"0""   !P 0x ᎧᘧP0S P0SP0SDP0SK( ]0T Q0S010R0P"00 S]0 ?0y N e P0S \ GP0p (P ,0S -0S (05#0x %<P0p LP Q 0R(0l0 S$00 S YX0S`P\ d_$0PX0 0 0?cIE 0!D d08 0   !=E@cdddLmdEcgfffp@-T0P@0`0\00`X0`0s X 0\00p©Lmd'@-@0cEP @-0 @o/@kd//0000/QR R / /@-MP`@pT0 P0 S0 P @0S*0 TQ 0R @Ѝh`@VUUU'800: S/@-@@"@kd// 0!< 04 0 (   !/@cdddO-`@P ox0pS㘀|P xPW PL t0S 0S ʌ P00 0SӀ0.X01 S5p,`P< [ p0S7Zy0S2W 1x0: SR1!0?Ac40DSڀ t֨pS9PipX c 0&h0W00 S00S Z W  0|0S+ p0 |PŏX 'Sd d C 00PECP 0 0C|0`  0 pX0 ԝ ЍOP0 ЍD>@kdEcgfff:(D>Q@-Mph`@ p.叟C4P CC C p10: SRZ e0s(@  1o@  1iP0P0P 00P0@ 0@ 0@ݜ 0@֜|0x 0t00 0@WP <@00HCЍF>*F>_ _ @kd_ _ a Pce#Ec@-@-@<0 @0(CEc@-7@-0@P1 p00200 p0000 0000000000 p000 Ѝ0\ P/0 !8 00 (  , !/@cdddp@-P@`0 à  00CS0 00p0 SpA-`Q`pSP@P1W p0S0<000S0;,1UP 0 00000 0 000 0 000(020<0F0P0Z0d000000X0UP000000000000D>D>D>0 @o/@kd@-)У@P0%㉣@-s@-P` g@增P0F.0 P05/PP Ѝp@O#f p0@# )\ H0@) dP,05/Ѝp@1F>GF>`@IF>c d @-//s@-P`fP@ 10: S)Q00*'@ 0崢P|+ 0@00D00<@H00L00P0%0P |+0|0Ѝp00!000 P,Ѝp@ӝ@kd,g iF>d |f df Lf F>F>@-"P@-o@- 00* R | SQ@ 4f H庚000* R S@kd` F>@-@+᤼0@-C9!: ^SpP3 @4T004 0040606L00L000 @cc0l4/@-@, @$0 0Z?tЍLg G>G-P0 VPU0p`@T qp YX-!Q0S@p c@P \;HH@C @塔@TmdG>2G>PG>A-` f`V@lPp@T 0Q`H0̆ ޑ@zځ TmdG-`0000@p0PU t0(60\ (0S Z00qP, @\@ "TmdP/`0@-M@P 0 P @  0m@Ѝ00@-M@P 0 P @  0l@Ѝ0@-P0M000@R4`p,0Sf0 P@ 00 0`0l@0 0j@P@JЍbtTmd$e0@-M@P 0 ]P@  0l@Ѝ0@-@0 HP @  l@pЍ P@- R Tmd0/Tmdp@-`PpPDTʀ 0! $ 0    !0 2/P 0!H D0< 4  , !p5Tmd@cdddp@-HP0PSp P@ `6/!0  0p@/Tmdp@-x`0SplPP@00C00SP 0 `6/T 000pp@PpTmdcG-pP`P@ P" P PV `FPE╘@P P #P`匘T00Y0S<4 `@zyG>wG>}G>G>/@-0,\ @T 4/ЍTmd00S/ R//Tmd00S/ R//Tmdp@-@P. f.0p@80/lmd 0 S)p@-@0@` !P0 R  P RP V0S0@@ P@@00 , !p/cA-@0@p !`P0S#P ) R00 @T tt@PA0P !!P  0S R00 cr r 0  )?)/ 0  )?)/^/@-@q dQ0P0Cؚq 8Ӛ q (Κq ɚG>G>G>G>G>@-H M@ 8廚 Q000 0zN ЍH>s 0@- 0@ ,MPr           0 040$0[NP 000 mR,Ѝ00cr /0/!//A-pQ`.0  P@ x0EG1P Hpp`@tT:80*0 3'J Dc@|>@-H>@-*H>///1/8#81/1/  R/ R/ 0s S40@o//0@3S0/@c/ؖI>p@-@0PT3/>p`S0p@8/4$$#   p@/I>I>!I>Q0 Q Q // CI>I>FI>II>O-P`$M 0 3/$Ѝ03/@yQ  0R $Π  M3/0 0Sp00 `"R 3/ 0A0CS000 3/00u00d0 0Q 0 3/$C H! 3/(!0AYS-000(c0C S#0x   03/ 03/@ 0t3/W  0\3/0 L3/W0A CRS 000 0R(3/07  1 2/0 30 r#03/ $:$(0". `: S0P3/$&0$ 0$3/0 0 &6z R'zppF0$03/60S 6&0S Z0  |3/03/ Z0Hp083/$O8 OS   F0$03/5t0S W0  3/   0 3/W? 0t3/0t3/0pd凰Jq" W  'pS 03/ GR03/0pW03/0S3/ '$0W$ 0FL0G$80 0C2/$01?3 ?3!?#;00 2/@ 0q0 00s00$* "0 : 0#$90"?  :$#: `0H#0$"<407S0 S0s03/ 03/ 03/ 03/0x0s0n0|i$3 l0$2 \0$0LD, R$03/ᴡ$03/t  03/03/0t3/W6 0t0q$0 3/$($0 :/0 oPq0 3/200$($0 %:/ $8$&$p0 7/0NqS>LI>pS>S>S>U>PH>I>S>S>S>S>S>S>I> T>&T>3T>8T>I>:T>/@T>`S>ET>mS>JT>@PT>dT>`T>pT>rT>T>T>T>T>T>U> U>U>U>U>U>U>U>%U>-U>0U>bT>gU>yU> ?U>//`!//` `! /0/c 80/c#c4 4#0/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ 0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/00 R/ R/00 R/ R/0cĠ,Ȍ 80 R/ R/00 R/ R/0c#c4,4#0 R/ R/ R/c 8 R/ R/c#c4 4# R/ R/  R/ P r00 / R00/bs_notimpl_%s: args at %p$O≔- mmap- r_1- r_2- r_4- r_8- w_1- w_2- w_4- w_8- rm_1- rm_2- rm_4- rm_8- wm_1- wm_2- wm_4- wm_8- rr_1- rr_2- rr_4- rr_8- wr_1- }wr_2- wwr_4- qwr_8- ksm_1- esm_2- _sm_4- Ysm_8- Ssr_1- Msr_2- Gsr_4- Asr_8- ;c_1- 6c_2- 1c_4- ,c_8P0 PQ/0@o//- /0/-/-/-/- /$0/@-`@P (pW @/ ,pW0  `//p@-@$0P`P K!0"8`<` H @ , H H L  H  0  (0pwwwwp@-@$0( S Uyp@4@c ,00,0/0 R,00,0/@cp@-(0cg0@ TcPUp@cp@-2@02 P<0#0P20C22S Upp@ p@-\0!C !2 Q02(0$! 塔 (0$!p@@cR/L-, 0((((S l R B|R/xRi-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R  /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L-ȩ 0((((S l R B|R/R}-0 B RE@P`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p`p@P@P`p R@P / R@P`p@P@P`p R@P /@Pd R@P@P@P@P@P@P/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/R/L- 0((((S l R B|R/wRh-0 B R5@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@ / R@P`p@@P` R@ /@Pd R@P@@P@@P@/0 R/ R Ф /-0\T2 ,DP`pL%T\&dl't |@P`p R / R@H,D R L@@@,HP`pH%XX&hh'x x@P`p R / R@',H R H@@,LP`pD%\T&ld'| t@P`p R / R@,L R D@@0 / r/ # ($0(000(/ # ($0(000(/< # ($0(000(/@c -L R l\000Х000 R 0 4 8 <0 R  /R000Х000 -L R l\000Ѥ000 R 00#40#40#40 R  R000Ѥ000R/ 0 R0#40/0#8 80 R/R/ 0 R 480/0 R## 8##,0/R/0@-0#88@$HHP%XX,ȠȌ8 R0R/0@-0P8$#H$8#0@8%#X%8#0P 8,#, 8#08.#.8#0 R0R/C-R :08PHpX hx R R:x08PH R R:080 R R:0 R0#40R/}A-R:#H#8##H$%h%X%%h&''x''(,,,,.Q R R :#h#X#%h&$$x$'( R R:0 R#X#H#$X%0 R:0@ R480G-`PM0SV 0 S S SM !Spp W 0 @0 R =R DJP 0=S0@V20V 0  SR0T=Sp'p WP@ W  RWP  $( ;P ЍLY>7@- 0@P P0P R Ss @( Ѝ0@-@0 }P !W OJoЍx-2`? @C @P(PP`5P6(5?3`x/x-2`? X@C @(0000]ߍ`@P X@P0`(0 0PN@ @0 4/@TnP @> 4/@qG8H@c1 !0R$04$0/|uc/s@-`P@P!0P0sJX03/03/0?00?Ѝp 0P 0S00S 0@ S 0@PQ chmdlmdp@-AQ+ 0S R[ xhY0_03/UC 00<000S: #: " 8! 4^#30 00C 300% %6 P"8 U#30   00C3000C0$00pB@噌lmdAi!iL cRY>1?/ //0 ?1@o/ c//0/////?  22//-P/6 c N?  "2/!N80 Q @-*O@P O /65/ N N N5 N:6 N: N c c c c1,   P QOO/l  0 Q!N:O56!N:O6!N Q* : QO N Q* :65 QO N Q* :6 QO N Q* :5 QO N 6 Q N N//$04s@-0@S  %(00(0/O- R\bY I* b$\" Win_cksum: out of mbufs p 0 A2$$pgQ/pWq'2'/QRppA@Q@`  `  @  `  @  `  @  `  @Q@  @/ Q@`  @  `    Q/0@cQ@0  0  0  Q@Q /0a131 /!# 0(0000(0 # 0(000000(0 # 0(0000(0 # l0(00(0\ # D0(0!0(0, # 0(00(00(0@cH00S/@-@0  "!$0p03/0 !!(ndlmd03 /0@-$@4 W< 4 @ 8 L < @ 0 < /p@-P$@4 W40 <080" @0<0 L0@0200< @  00p/$ 0L 0 00/1 1400 001!/$0</p@-$0` @ P         $  ( , $ 0 ( 4 , 8 0 < 4 @ 8 L<0@0p<0001X1070 0 0\1pO-81MpC0 40$P刢!.!n@&B0` V1017800[` !.pxW 0000 0 00 `L<`划0@0 0S101ߍ@c@00S/A-P@`q& @00S8$0            $ ( $ , ( 0 , 4 0 8 4 < 8 @ < L @  X!101101V 0\! 6 SSO-0`@p0M 46CSЍO1t A000 0$0L0 0C0C004pЍt!pppV 0  Z 0cQ  U J<!PP)1\Z 0  PP P0  0  3/ ZPu U  u 0P200" 0 0 0L0 0C0CL0P@-0t 0@@$!0   80$ &08@1011@2/L00C @cc02/ $0 " 00000 0 0$00(00,0000040 080$0D0(0 L0/S$! 0 S 0@-0ZCU lPC^   LL& &0/0@cpP 0@- @ |M l Q \\ QQSH0t S@0  !0 @|Ѝ0@c0!R 10/Xndp@-@P &nPp Xnd0 S   n0@-4 0S$ @ Xnd cO-2|Mp& &  , !`LP PEPELP`0F?oQ26  V@A! 1B T : V HX! 0"@H      "RD$  0YV#  圇 t ?0  !0 P|ЍV@@ 0 ;/P t ?0 !0 P$@|ЍO]V@ccXndY>^ < l "O- p`0F   0 00p(`$  0,!% 0    0p(`$  0!% 0  ,  0p(`$  0, !0`%$  *  0 00p(`  0!% 0 9   0p,(`$ m0$,00 '!$ 0 B   0p(`$ U$0p,(`$ H# 0 L  ,    @ 0!0 S   0 00p,(`$ + 0 !0_  0 00p,(`$  0 !0m  0 00p,(`$  $ 0 !z 0  0p,(`  $ $ 0 ! 0  0p,(` 4 0 ! 0$  0p,(` < 0 ! $ 0  0p,(` D 0 !0  0 00p,(`$ H 0 !0  0 00p,(`$ L 0 !0  0 00p,(`$ j0 '!0  0 00p,(`$ S 0P!0@0 0 0p,(`$  @=<ЍZ>c p 2 (nd @cndG-`pMP `  @Q000P00p 0@R 0 p0 00 00000 0?o2P0S0 SЍS0(ndlmdh A-xM@P`` pQP0HiN0X 00 000000xЍcC-0|MT@T 0S P`p` QH@AN0X 00 000000|Ѝ-ndG-锐xMZ- @P`` piQ PNHMNN0X 00 000000sxЍWep@-@0 dd @QSQPQ0PS 8P@803/(0t@p0p@/ л lmdhmd@- @p03/lmd@-@0 @T  0 !! 刂@HcZ>A- ! 1M03/j0P `X@P pX0 Ju T@X8m@@@ K9@p`p0g /|<~]0pL p4s<0$p00 Ѝclmd|>nd0mdDc@vcc/@- 40@P 0S$020 0 P 0S 0 P 0S 0 P 0S 0 P 0S p0 P 0S 00P 0S#020 0zP 0S"020 0mP 0S"010 0`P 0S|"010 0S Pd 0Sh d0I Pf 0Sj @0? Ph 0Sl 05 Pj 0SnЍ0*Poq!000l0 Pn0Phj`!0@00e0 Pfh0!000cX0Pdf!0:0a,0Pbd 000_0P 0800Pp 0800P@ 070|0P 070 [>4De#[>*[>7[>>[>J[>R[>U[>X[>[[>d[>Z>r[>1[>4[>;[>G[>O[>a[>l[>o[>y[>@-H00S<00Sx0 00000yЍTldXld00/G-Sp@` A S5 S11P0 @D`Fp@03/ L03/X(@`pGP pD03/ P03/Y@Pl`@03/ L0G/R8P@03/L0 PH03/T0 nd$ndlmdO- 0@4`lTD r0PhqX pYG  X ЍR:B Z: PN Y  L\!TWX D p(p W*Y )  p 0S p    0@pWr P@ \ @-0QBQ*   P0 /[>A-Pp4`@gP 0Pp 0<0`@P00 (@0 0,0 @yc4gG-P(p0,P0PS!@!`!*Ѝ V1Z 0 00 07P  `FP@VU0,00,0000,000000/O-0p `0 W W W Ѝ@04"0 S )4S 0"4PS| V1d0 ЍO/ @D P T*P0IY!80 0 @ `FV @DP T*0Z*IY! 0CY!*0 0 A3A3C?o20 0` @ `FJ0V @DP T*0Z*IY! 0CY!08 0 07 @ `FJ  .|>}[>lmd[>G-@Pp @ЍTHЍb2"0S@K0j0O-@M<`N@N;@5TpP3:T#3p0 ?oZ20S 0 PH 801P;0; 0 X0=Ѝ`@ 0 SPT喀0 0 0Q0 R0S 000 R!>S>0 jJDV:FQ: 0 Dc|> \>p@-PN@N@ 0 p@0c|>Dc@-0 PS@0S 0#G-p`@00hTЍ PZe 0 UP! 000 P`@D@-P0,00000`S3 :RP00p 0p0@80$0p00P0,Pp`0 Ѝ@ycO-p M, 0  (0P @0800T0R0S R(0p,000d1000ЍPU @0A#AR F   P P P3 0 0000s HP0` B0 0 0 H`P0``>0 BB6*a"*UbY :0 0  0 P PE 0H0 H B @ycO-@P0,08p`00 SP Ѝ0W0P0S` 0 W10 0  pG0P,00000O-M Sp@`Q:LD0  0P0 T FP%@#: P @[H0@@ ::S P%0:0PD0@S F Ѝ2 O-@MLT) Pp` 㸰@0SЍ0S   0 00H0  0D0 0@00 0P `@H@ D@xP@-@P`U^p^0.b Q  0 0 ^ *4 0L0\!>00P@-//G-)0PS@XqM` $ R H (0+0  VPV0P00 0 Ѝ R H *0VPV0P00  0 | $ R H (0+0 VPV0P0 0 0(\>h\>\>\>//C-M`@GPT#LB~,'@>~0'4:~UF/$ 2?0Rr 岟LQ PPPL P `1|pQ } 000<0 } cЍC}Ѝ]>]>"]>ndndndndndndnd,]>C-HCM`PBGT~ЍC~Rn  "Ÿp"0*P*P l. ({D3SQAP 0S(c]>(\>Df>Hf>Yf>ff>f>f>f>f>f>AXV,f>]>f>f>f>f>jf>`A`Amd,ndBf>g>C-`UFPPF@P03/sTDc03/0L30HP3,G?b07@lF60C 00nT0  00`T0  00XT+0  00PTH0  00HTe0  00@T0  008T0  000T0  00(T0J 00 T0N 00TC?0R 00TI?0V 00TN?0Z 00SS?^ 00SW?0b 00S>0f 00Sa?0  00Sgoj0 `S04L ЍC @| ЍC>}lmd@cxg>(i> P-`@P p!c pЗ!P  R $LopL 4D? 4/!`@S`!W , ,`! !oDЍ@c{Reset vector called, LR = 0x%08x-DMO-pBS `!W , ,`! y!oDЍN  0O   ! "`"Рowt>t>t>u>lu>Gu>Zu>t>C- @`p(P  0S 00PAP 00(0Sxp(Q 00(0L0 Ѝ@0?  0 L0 00S 0 qt 2  p$`u>s@-@ \ \P`t 2 00 `$PЍp@-1@``QPM R' $ pz? 0    !6x0600x$0W0*x40(x0$x080L00xЍ@fcu>O-@D@M0Ps3/03/10100S  !0 0Co 00嫲Š4041 @T 00 04/P7[ 0n`S5 L0  w@0 v V%* Q ( R 0R6BS 20000St 100 0(00,008<0 N`1000 :S0L0L - 0Q0 1 ,212:+*B*R8 L>; T S3 RLDLOoB@ 0 s P 4(S$ [009gw 0S00&R ! R &R h!h R \A@X1T@@@(0 0 P0( 0S ;N  R [ (0L0Ѝ0 %wt O10 Z0o Z ZA``PzO@0 m0 T w 0(0^ 0Y ( Xlmd@cs>hmdDcv>v>v>O-PM1s0100S , !QL@5xxxT6 T*h10S0 1  00 `P6 0  P/ t 00 [0 0a`Pzo`0 l0 v 0 0 0t 00 0 0$  00@4@>0  P0 @TL@0* R @VЍ@chmdv>O-`1`d0P@3/tHHaWDʀ 0! $ 0    !U U( U1 ?oT20S00 0!t!0   , ! Ѝ ?oT20S00 ?oT20S00 xlmd@cdddw>00P (031000Co//,c@c!:!P/ 0 00S/@0. 04S/Q0 /0,c @- 0C.@-0O-0@|Pod0*4S/0S0 0 /000/lmd*4S/@-0@03/0BN0lmdQ(QT0\0 )Q/R0 S,0@0D0//S/0H0lmdQ@-@ (4S80BNX03/00)4S0<03/0)4lmdp@-@0Do A("(RP p$$Ph$! ,$" \%R 8AZq00CS0p0 p@ Oq,codqd@-@|0T0S$D 0SX宺 0S@@<0QD$   D$ @@DD,ccod0 04Ē Q884/0H4S/e,codT H$R e@-@@8P 084 $ 004od,cDc@A-P @`pTQ 0 "A2P 0`PR  V`p@V0A31003@c0P/- R   B B  P^^ $ B$ , Q R!! B B!!,cP/0S0S/A-@P Pp/ 0`00 00  0 $  B$p 0V !SA  B!! SA  B  ,c0S@0S//0O-P` @P\Q pQ00ЁU00SE R㴑; Ѝ ^^p1Q@` Wp0U0 WU0 `` 0!&Q0 !SL   0E&  @T00 ЍO/QᤠT ``  U [  R`` `!& 1!L0L  o@,clmdodG-1pS@0!R00R0P  \  \ 1!1`V0`0ó?0`QP 0  ^ ` 0S 0PR" S 5YY 0S 0h0hS 1S 0h   PU0S0`000x>,cp@-0PPdL4S N@l $60L0V L0?4`003/03/+;-pod,clmdp@-`P?@塸<@1tڸ[TP_X[_P`\003/`003/03/`\T4PX4P__pcodlmdp@-D@[PX_0``003/03/`X4P_podlmdO-Ph4dpQLP4Q9 @䀟䠟fU*%*1Qh \ : 0010?0@03/@0Phvt%!1PLP L0]뚟@03/@Zodlmd y>/O-p64M@00U6PH4S 0 &? 0` Tfg0 01000X0000K6T =0P0 +60$00$ 0(01,0(010Sp P p >pV, 0Sey>O-@4M` U TU2T 2x4ST B>0PS0 4pp0V :|W @@gp&: :6S1!0P ` 0 &5?00 V:U 000 Uc0SP0P 4  4 0C4Z% =P <00  T)[ 000 U00 1  Pj 4p pS  U0 0?$ 0?, 0?0?0P 400? 4Sj0(4S   0x W4Ѝ,c@csdcO-@p@P` <PP`<` 儵  *60Q000  ԰ @03/00 3/03/奵  0P4 0?PUP'S 0h<0#GOT00  S  S80d5 ,0L42 S0`5,clmdod`0@-0@D0PSM[+PЍ00 0N.P b,40 U0*0)4e@O-@pgT:B003/OO$ZZVUP!N`$5ᔠ?`U0 0C0<P @0  <@0H 00?@03/003/J`,clmdodA-p@`P!$4$*$00S(DF0@00V@U($<01S  2# Rڴ$60ҴX 0S(H$HJ$J@L W000 ,c00 p@- 0$@0P000Sp`H4S d0)$4$K=H P4ph5hE000D40@@DDpod,cy>O-`MlP@;0I 0000 T : 0 S:0SMhЍOw$jjf V `!vP@ p$5?pT*. , 0 *; ᚯ7뚯R0 <>+0    d*0  R!* Jp +4S 0,03/0+4ЍclmdO-^PPE@pȳ댐匠ZT:O `fV`!P@ $5?0CT*0 GQ!803/@ZlmdO-@p$M`!ᗳ'<01S 01 0  000Y' ^'v00100PqW X [  G E:P Hj <WP 0 垳Pᛳ$Ѝ @00@0 00 0匳0皿  w뚿$,$$0 !R3 0?  PXH:P $! <P 0 @00@0 00 0M0皏   8뚏P R0lœ\l% 0S 00 LGm0 @  0p>m 0 )9mcody>y>0 #!R/080/@clmds@-@P! %609`P 8峲0 00<Ѝp@cO-q3Sa100@-4S[0,4T倁勰U !0 PU ,$$#2$$0 SQ8 0000xdV B.TxX 2/ 0! 0R  2/ 2/  / 2/TT$$  2/03/00  !!000T(4xDT U0-40-4|D Ѝ|03/VBn@c,c clmdhmd10 P0  044-4/@c@- 4@S 0 4cP $0T V0(4 0@0/,clmd@-$a  eh @ 0 4$(4@T R0D4 p000 00S 000D40P0D4 $TPp,tq0000'0$4$0!*10 ,$020 0 Ѝodchmd@-@0 4p@-@Pp 4S u0 4CP Pp 1T 0(4p1q*2h$T勱 0S0Q D$,$ ,$ B  B R @@TQD$h0 0T娱X0x$R x$^p@ 4gDPD$,chmdcodsd@cud@-@P@CG-`xCPd}G@@@ @pW0S   gYQ @T0,03/03/YP`ᕱP N JVp0t0@U4 (0C4 040C4 0 @(ac,clmdsd@-@(Pm@#z>O-0P 0UM0 0@p0 0 0   P@?Pkᷰ屰PUЍ0    0* 0 100R `0A  S + + 1 L4` 0 0 V'! B!! ! R 0Y0 0 皟  *0뚟ᨰ 0  0 5  B    S 00 "cod,cp@-P',B@@@ <e@xpcp@-Pw',1@@@ <T@gpcp@-@p@Qp@px>cG-0X`TL4 90?003/03/@`pP 0` S@03/@@@00?003/odlmd0' 70/odO-xBMgV<*dZʀ 0! $@"08"0"   !嵯&j aw0W:Q<03/,03/03/ 0!!0 !!   !Ѝ!':'|00QU9 '0 Q P*0?P0.71p p00 R'  0 (P 0  Y) ' 7+';7pP P P h5 S7`67$ 0od@cdddclmd,c(wdp@-PPP@}$F@0S0?@003/0p@/hmd,clmd@-$^$!ʠ A@ ! R  L" !R  ," R !  $P/$0!10/O-4TD,M`w|T0 0=$4ή ʮ Ʈ!0S2 $ ,P$ k&20PYpjh  0000# `ˁ \ $4P$ h` V (P hb<03/03/03/2 x嘧Ћ唗P  )5? T唇\딇(P@j(5? `X唇 "0S70977'3C?6C0C#:%. "&0#2>0#6!' 7,D h@p1q $4!*$010y,$020 0@,Q,1 00C0@@ @@ib1 0000 @@[0 0 000@@ @@@Pb+0P000@@ @@Cb |ܭ<0,ЍO/@c,codccOz>{z>hwdz>z>lmdxd{>ndcsdhmd@{>\ udhcsd@ qd !od@c@-3)50@ 3.5 @G`0H4xdodO-$M,d($d 1@`vPQPP(PEOܐ(Vᖨ(:$Ѝ0 @Pi0 0000009  ^1Ppp@W T:`$ 00JpodqdEcTldDc^{>Xldu{>@0!S@0d4 S00h4 S$0;00;010?/odxdp@-0`S0@LT!* Sp0PT S`0dUP0SHP,ei$EOR0?pod{>{>-!01; 00? 000$,cO-~0PP04 :ip~R@p R R1!ěd`V Ѝ|!t1d弋Ld!\1h帋PV[#0$ ! \ /FVfF<R0 R  h P -$%/("(VR#  U뚿HXhF /JZjF{>xdod|> !:!/ .,cA- p@P` X0 X000 0p_Ѝ p@-@P`++`%L 0+L$;;d4;hdkPd ;/0SPddkLd+;+ ;;+ ;0+0 ;;x;p;0+.l;0+U.h;0|+.d;,0t+`;$0\;0?00?pxdod !i!d!G-`@0匀pB00>0>0PT0?0?0000?$:aP(7h$5?[%J c ci|>O-@ᨐ娀zT:00ЍO/ 06Sx`1`!-P$5?PT:0?L0 HS @03/003/ Jlmd,c0$4 /,c0  ")//0 !Р!/0 ! !/p@-PM5P# @,` ~0t00 \ 1(Q$  ,0(&#,0 <@0?6/ߍp@cHldc002'0 S#3/Hld 0P/Hldh0qp/@-R8P p< 0BS B 00@ccO-@2@BM<03/ sr $R0S0  "S  & P~eЍOpxex5`Ph 0Se 8@letЍOfeiP;0Q@p1į0 00S\>0p00 I06SP1A?e 0 G0:0 0 0 0@KL|>|>|>Hlddm}>}>|>|>0}>`}>}>j}>}>?}>J}>s@-0P `R0  @P1 00 @Ѝpx0d03/00 `40P0  @P4000400040@@x}>lmdc/0 93G-p `P //3&~M0@:0$@P $$3U 00<0 0@0$000 0 00@D@$ //C-H0M00p0_f00LP@0` 0%&sx00@`@UЍ ~0 00 Z|}>3e c|>A- t&f0P0>0\ @X0`@Dp@ u00 L0000L0}>|> cO-pRMP P`010000 P= 0 R. R6& DF Fd˃0 0 1/1/ Y @1FI UR0 `0/003/03/Y 803/ J$JQJdcЍ|>lmd}>0/c0/ᰆd0/ᰆdT0@-@0 @RS ,0 Ѝ0000갆dcl0P/0 S/@- ^@LS:0 0CS(0 S谆dl0P/0 S/@- ^@LS:0 0CS(0 S谆d @-*g0 0耼c0p@-`!P DK@P$P`00@p@$ꀼcA-餀`@ި0PU |ep R0P R 0L e f 0$A  Kꀼc}>}>p@-PgX0@T !gT 0PE0%VE$ @p0S 0ES:@ꀼc0-  0@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P  0@@P \ 0@0/ 0 Q/A-(P`p@P @ 0 !10PT`\00XpD0 0L0$0h000'3 0@0_00S/彥cR~>p@-@P0Ppp@0/cp@-@P0 Rpp@0/c@-@P 000T0X0\0`0d0h0l0p00Pt|x0 ]^~>@-@]@O-P@M800Y*Ѝ0 S+ 0R'`T- p6P I- ` 6P >-  6P 0p` S @0P#/////|/x/t/p/l/h/d/`/\/X/@-PcL/H/2~>e~>o~>w~>~>~>~>~>~>~>~>~>~>~>~> >*>">j~>0 8< 0/P0  T0S0CT0/ 0S/0C 0/M 0@ 0S*0 0S*Ѝ/A-\0S"`0PSp`?X@ 0 A @TX 0?@0VD0W @@0@-\@M0SP P 8 00  TYЍ0@ Ѝ0踆dt>@-@`0 | 00 0H0 S 0HP 0p0040P@岓P L c6bЍp{>Ho!p@-@P0⪦t00t0]p0S0p@ܦ\p@-`D @@?\P0⎦! 0PQS0  @ Pp@0⿦0S   0 /0W0UG-p@`00kPY0 S<80  Z7   3<80S.8倀+00W00⇦<UPP+ *0W@@8`<000300x0W 0P0x000eW P8008000\W00X00C0 80<80W00A00 03/0XCU`d>p@-P @@ 0R8` 0x0 0  V00C0 80<800S80 080\80 080p@\00Sp+Pp0p@0/dp@-@P4`V0ⱥx0Vxpp@0L00L0/L0CQL/80/x\8 @0 |Q 0d0#/@- | R |080H^|   @\H@^ RQ @p@-@P00WL00Lp@0⎥p@-@P00H0p@0p@-P@`090Sp@0q800800)[p@-P@0`03/0Sp800800[p@-@HP|p_020C0S0P8ՑP@c_Upt>>A-@`@00S>l00%S P= S< SC S? 00 03/l<B_6Sn0m o487_ 5_zpS qS00 03/n'_6Soqnp2p Ww03/pP 8008080@Q P80 PP8 <203/P00 03/1^6Sb1pG Wdp\ `0R0C?o20S0`0W P8008080@x :RP P  80  x %Ry R P Px0)Sy0SP80080808  PD0S0CPD0P^ D0S ^P0 ^s0SL^o`rpX~^s`pGs 0R8u^>׀>>>P>ct>^>`>>>>>>40: -$M00  (  0 0$Ѝ/'C-$M`P@p s00$0 pJ0 0@ P0 S <3P J0 00@{$Ѝ'>@-4@$MJPp` >0040 000`0 @@p[$Ѝp@- M@P` #00@0< 0  ` 00@= Ѝp`'@-@ M , (* 4  0   @" ЍA-(M@p @`PZ00&4#0D0 :00 0L00H0`00p$`(Ѝ-$M(000 ,0 $Ѝ@-,MPp` @U00$4#0@0 :00 0H00D0@00p$@,Ѝ@-@PP $0P0O-4,MD(,00C#   |D1P100@00a0q$00 09 0 0`P@PU,ЍP|P ˘P0U  RTPژ E P!0  ` P  YpV Wp0PE\q@ `A-@p0`ᒢP0P0ʢtPP P0t0p0`t0UY0ⳢA-P@4`pVd0iT# T) T@t`@H P 0 S08 @TVA0₢00S 3/|@T Y\0Td0Sp!@8 0  S   8 d  @@@ P 0Sdp`0WQ Q QG-@@P(M`0d0Sl0Si8 00 03/XE\?0 `0\SA(8\$40X3/p(Ѝ0 @ 80 ;808pppO 0/xz 0p l0  l80Pp;80夐 Pd P0 d00 03/<[0d080p 0┡d0S p0ɡY0ád  R 003/p&00 03/[d0S60(S3@00D0 00 R0B0CS$000 03/,[0$0 p0Lw_0d00<00<0H00H0P#pQ0u`D0Sp 0CD00,80P0 0d! \00$0[|p|PL0$0L0!0D @P D0S0CD0pp00 03/R[00 03/dI[d0S ?0 0 0S 3/0נ80 >3>cV>h>z>>Ec>j!>ҁ>O-q@`P\ d0P0C?o2?3\0S0v`` V)`0S&0⥠ U0ߠd0SpP P 0͠ P0↠p W|0Pt0Pl0Pd0P\0PT0`/0@ 1/0000q Qt>P P P P P >/0( 1/0000t>P@- P P P P (<00 010000ꀖt>00/00/G-@0x0S G0G|PU @p 0R,L0S)80k&  80! P(P  0( 0P80 @00 03/2ZPx00x0t00t0V R00 8080;80 @P0S  RT0`F6T00bV0 0 03/ HY`0000ٟ }c0?o `c >I>p@-@P4`V0⅟x0VCxp0⻟x0Spp@`p@-@P|0l0P 0⡟p@It  t 8Vp@0╟p@-@@`P0O<0 0∟KP0 0T000 0T0@ 00C08080;80  @0 1T"T <08 0<0d0 0S00L 0L0d0S0S80@;8080 p@0MS 0@0Ud0S0=p@0000@@G-L @p@R` P0S P1`SRL0003/<0\ 0<00` d008 80@   # 880   080p R   080PP9 0U0 0$3/#Y|(788080 ! R"  R R 00 03/8AXZ 3/X#0⼞e0x 0Ⳟ\0oY U 0@0 03/XVD@00WT<0 0⒞Qp Z 0I[&>>|>т>>A-0@S 3/`07P00P0Pt0US0(Tp 0t003/ 0t00X t0 00!/@!b0 0p 0t009 U R00 0)ppT0 GEcgfff>A-@Pp@@ @`0SЍ S`P@ 00 0X q- ^ /$0/p@-`Pm/P@ $@T @P pp@-@p/PPp$0Spp@p@-8@Pᆝ@Tp0U @갇dp@-M@PW $0HS 00 03/W$00$PU !R00 03/W0^0 @P` 066 99000000PЍp@>J>u> '갇dA-P@`h0C10 @B1d0S10\0` 0C 180000A0J lA!%0C1plAq %Cq00 03/@RW00000 03/d DW >>>O-Mׄ>p@-P`t@Tp-VPd`s@>C-`p䑟`0S Ѝ @@PX  008  @P 0SM$0SJ(0 0S0@S $(8> P? D+Y 0B F $:dPc 9_(0eY 0 Y 0B  $= 0PQ PCU !0_AeXX 0  XXp0P0*!D00@0L LXDX<XQ>>(>1>:>MbB>[>f>x>>">Q>p@-P`@`0Sp 0P 80 @   R @R 8   X@z>A-@p`00Sd0SA3/p@ l0!#B@ T_ Q@+P\ `Q ` T\@|Q@tQ< D0SD 0C\QD01TQ8008080@0 0Q @80 ( @Q00 03/ U8008080&8 # P D0S P0CD0@PUT @@|PlPLP@00 03/lL@U @ꋅ>>>̅>>>,>F>e>V>6>>>i>@-@`pP4P J PG @0 0L0 T Ѝ耆>>@000  00T0/@-0@0^ 0L 01@ @<00 2$0S8$0ʜ@-`@0P p 0  000 |Te2P0210 @T0 $T Ѝ@!1 Ѝc>Ɇ>>A-@P0<`  pc&8  0 000L0 P 0 ,TT0d08Ѝy>A-@0!< `Pᒃ(p 80C 0 $000 ,T10S  V 00 0 p'$P0$0H1L R 0#3!0 #31P0 Ta80d0Ѝ0 S8 0 8  `\ Q  C40l0@0d 40 0 d0Q 0 XS0 l d@S,8!c(>cW>MbEcv>̂!>‡>p@-PL7@8p@l\0O-$M h0 0$ `0̴@< pP  0 00 S700S 00P00 S@fU 0 0S70d0%t0S 3/ 0 $ _020 \:/Y L0  0 pY `7$Ѝ000P00 AS0d07x0S 3/}? 0 ,03/ ,0 3/<〓 ,03/0   C$   0S2 Zi 00P` \S @T04/80 00 0T7~0 R0I Q(0 R 儀 0 8/(X0 000 0C00 ` :/H0 pR0I Q(0 TR 0 `6/(Q]0 R0`0[, 00S 0 d] ,03/ ,0,3/ W R  0B$ dl  \}R604c>>H>b>>>ӈ>>>.><>r>>>p@-RP@ ` R R0 <WR8:Td /p@0d0/>>p@-`@ 08P]P Up] z 0< P 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-p0@PW@0`@0Lp0 X0 QgP0 0/@P0d0A80帀 00 0 00 0X00\0 P040h00$0P 0/Ac&>L>O-M0`LL 01 >>>>\ O- h0,M/0 p0 `P<0@08010030 * 008 | P 50Su80\ 4 0\ 89/t0SY0 $ _02\0 9/d0SO 0L $0000 08 P0 0 00 00 0a $000 0? P$0% @+0H00 WP%TP0d0%0l040\@ 84/ [f;,P,Ѝ3/0040\ 89/ [80|!L0Sl!0 0!!0 T!!1t0S 3/0 $ _02\ 08/ $0000 0p P 0 S0 8   #8  @000`0 S8 00 0 $dO0d0PP0 8O0d0(cQ>t>EcMb%>B>>I>A-@ Mp0HP   ` 0 4   ,  ,  P PPP0H00PP080PP0p  `( 0P` D Ѝԋ>!! !p! 0R://p@-P!@`P0 P.p@0CA-`Pp@l0S 00PP&?JJJ4&P0ܔ0 Ec>p@-P(@ P@Ŕ Jp踇d>@-`@0P PQ`@Q`0\ LS Q 0+RP08 X0 S1> >a>h>o>c!du>>p!8@- (@0000lcX@- Hm@P 0 0pP000lcG-Q@M Q0a@DvP 0!0T` 0Ap 0 PR 0@0 P 0Q @  P00fQЍ>Ό>O-p`MZPPP3p@0Dh0lJ 40@ M0 s 0S 03S 50 * 0ES$ PPl0 , &R8  8 n  H  R 0@SP0,0S[l0 P0m0P3T0t0X0|0\00`0n0L@dh0000H PPR8s0 0000 00  00@ 000000000R 0 0SS ST 000900000:000000000 00040 P 00P4P 000 L0$g%RPPP%* qH0S 4@0000000L @eЍP3/Pf ],0SdY0000000:00LePK> >5!>00S 0L0Sp //O-qMp P\00C(0w!0`p$0pG3 3100 0P0(0U ЍQP\0S(W`0S$pd0S @ 0`@@D@H@3`@P0D@h0$ 40L0P0uN00SH0㴒 4_0 (@0*8G0 4"<42@00`0 0 @@B@F@0P0a0 8< 0 4 Z*" S0!@41@C0040@,0001000 0 @R3 4440 8<  ,4 (0` $uL04, 000, Q>00  1V U4&0S` @ $@+ $4"49#9V0@0$0 S00W0S  T ,4  P)  P @W00!@cU >'$>!@-@@A-`@P0P p @O0 ;0 夑pP0V Gpؑ X哑 R00 D iH0ȑᦇ0l~똙>EcddćdA-@aP |0 R p T T X0T 1 00AA0A lcUU UP/p@-Q@P N0S L Np(>6>R/0@o/A-p/P`0'\0S @P 0S `:A0Op@-P` @0@PP6OFFF4"P0p 00s @ S/Q@-@ PdNI0 @00^ C 0 0 SNЍФ>ʤ>A-@P@P`0d00`0M\:N4s"P 0⠐pFFFpp0 •P\MP\p@PWA803/@>>>>>>Q @-M/7>A-`(M0Pp 00 P40 040@0 0|0 0@P 00 D0@(ЍWM\H>!Ȥ!>0 8< 0///O-P`#L1@ 0PP3p1 !)0  ! 0 pWWe0L0,e  d ЍL!>Ԩ>0@-,MP@ `508 00  L  @ 00},Ѝ00up@-LA0PH1 8 !o.80080f p@-,M@p` P&G00@0P "0D0  #0H0 $000 00Lp `!P;,Ѝ0u0@-,M@P K08 00  0 00 L$P!,Ѝ00up@-(MP@` [008D#L:8 00   0 0`B(ЍpA-P`CP@000S3 S  pd  d + W0LQ0000P 0X00080 080KPL0 8PA,NLH0 SH10H1><>X>H>Z>p@-@@0PhQpP`0U0$00p@/dp@-@P@0Odp@0؎IdA-l0@P~0pSSn0@0SLx0SIypWF|`&P^1 0n00Sx0Sy0S|` PD0 0n00Sx0Sy0S|@P)00( 0Ecj!@-@`Pp<<0$M((0 00bcЍ,cA-@p F`0@PlP L18 \9@L VS(0 0`0gЍ,c@-T0( P@"6 0<rH1 (0$ 4cR$0L1@,cp@-T@P0`S 0S 000 0000S 0S000 00000Sp Rp00  Q0S0$00p@y@- 00 0 Ѝ|>0@-P$0M 0 0 !Ѝ0t!!@-(0 0600Ѝt!!G-P 7@P  ᩃP0m bbH0$ H08<06000000 0(0T000$0@!A-(M@Pp `DB00@00>00 0<0T000 @0L@p"`$(Ѝ0uA-(M@P @p`C00'4#0D0pT%0:00 000 000L0@"$p(Ѝ0us@- 0@P La@0P40   H0b",4b4#04!400 S0S000Ѝpp@-M@0La Px04K?4X0 X 8  !0 X0<0 00 0  0ߍp踩>0@-LM4 $Pd@ 00 @0LnЍ0 @@00@0LI N@-S\ 0000L Ѝ0 0L i NC-P0,M p` @P 0 P 0S! Ġ"Č  Ƞ,ȠH p `  P ,Ѝp@-0P(M ``P @P 0` }P 0S $!$("( P   (Ѝp0@-,M@P S00$ Q>4PT6 1Q0 P00P"0pԀ(80 pH00PN0S A0$0(<@ D0 pl0<PtcP@0cS400Ѝ QH;00u RƩ>G-(M`Lq@0 P?`aL0V SH1H 0㩜H1  PP P PU Vq(Ѝ-PP80L;L  0PIPX 0 S 000P ~P0S $!$ ("(R  $(  R%E0 0!$+PX!T1808 080 T1 0P1$ (0d0,0000dH1 0H180080    ^P;L  0P 0 |>F>O-$MPLA0  0R80 080A#@09$Ѝ@ $PJ4@pd#dD0[h0030#P00S&h+8 4 )  ``&  0  0R0pR@P0 W0 0D 0+&*(0'4a `0p0 0D040PT`Xp\L0hP@  Ec!0uO-$ `p@<<4!44Md@H 4  `d0@d/P2 MF0ZL00 T0P `40LPp#4"48#8S X P [h5 50Z00 ^00pX`pPN0 4d#d5h&hV`` hFh` &4_0X0``P30F c `$0 ,($0S*/o\" RL\  LRࠑ (0L岠RR 3 ##@000 0000 `0 Ѝ R R pRoXQ 'Q(0RRR 0<0㑓#K0RA#ᰐ 0 S` S ,0A(Y X, Q   $0 0C$0Q X<0RR!K0R0C1#0S  P Y,C0X00 ^0 0pX`pKP0 $4"4P"8#R#hB#< _0 0X``5P0 0 p 0 ᰠ`FV 岠 RpC; 00 00 p0l 0*Y Y 0 \Zp@pG\ \ 0`F7N &j4"48#8 S㴸͑ f040 g04i 00000"20 00 0@0k 03 0Q<<< 50lp tx| 0uRCs@-0@ CR 00  P0`P0S L140  Ѝp0 h0C1Q   L!4  l(,"$l$" A0C 4"40O-MPO30 F0@pᰣ)@K0R0La8@@ @\?W Z2C7CW"0CWX?WE 0 0 0p_P@B0 0 0p?c|GrGWpp>W >W >W0d` @00@PL140 0$#$  ;@h>W ?@oT<>34ߍ$>W >W Y?C0CWT ?=W =W@P`PU V 0 @0d0@Pf g0@0C10 0d0@Pgf0UVJ@ύP?3Q#QQPPL@=W^@D`80 @P4 0 @PN0dp0 0@P80S  "L !$ $l("(          ;W ;C?CWG 0W ߍO;W@PM@ 4"4e xE0d0& c@pd c@d@!cpdcc ccccd*>c(c c<dB>@ > Cu>L>>٪>0u > N eR0 d00D H D k0j0  d@Dpm0 0 0)@P40-piz`P  eR0d00 d@k01#n 6:00 00p000 0L@P+[ bz dpE R0D00K0?0M0:00 01D@00 00@P6$#$("( 0BS 3y,rz`Ps  eR0d00d@pk0h26:00 0L2 000L0@P 04$#$("( R@   $@y,px j fF0,0:02 @ 00004@P0 $4"48#8RS#00@ӑ;@$ 00@P$0 ,09F0,00 300:03 0000 @OPi 0 S0 <   0@<0;0 9 Q080"0$h8@@0  d0&@P 0S  fy$  G $:$ F 0L 0  D@P:   B# D# F@K@#0 @ 0 L@P #   B# Ky@P T*04#!A 0 (Q(0(Q)  +!Q0Y    +!Q"00;000 @@ 0000;;>0>0@0@00 >J?000 0<< S0 00)S@}7 0E1C0D00J0:D@0  (0LM@Pe+ *00C8#833##Yfkm 00 10000h0n43i0g 43oj0# b 4303000 p2000@ }0| 8< ~ ,4 (0 $"000 000 0(0000ߍOp0GS W Q )0GS0*QQA9!31  ߍOCQAQ@RQ +QQ 0AS8 e<0AH 8#8# 8d: W 5/QQ AQ B0ASRQ <@ dq00:0@  d0p@Po0W?00o000:0<0d @P W  WߍOg+QQ QQAA;!31 A AQ A e X0 d0d@4"46: ,00  0 0 [H u0S<0 8< 0/O-P`[L0@ JPP5  p1 !)0  Y 0pSW}WU0* 0d1_2A UK Ѝ!h>>p@-La(MH0S4@LH1P@0H1 500<0\ 000P0 @@(Ѝp꠆p@-LQ0`H1  @PH1`0 X#=H1@0H180 .80080,pЫ>@-H1  @PH1`0 <H1@0H1Ы>@- 04Dep@-@0@PH1h@`0H1QpP`0U0$00p@Tp@-@P@0Tp@0TG-@P@b80P0p0Sn00Sx0$Sy0S80 00 03/\980<80`l0~0pSn00SFx0SCy`V|p9P0 0`n00Sx01Sy0SO`V i90800800A9(^`P` %A<0~800800.`7>E>Ecj!h>@-@`Pp<<0$M((0 00SЍ cC-@ Fp0@`MPP P L18 P9@@ WS00 00pWЍ c@-h0( d@"6 0PH1 L1800S (0$ 4cR$0L1@e c@-`MtPpH@ET 10'*"*0*00(00,00 $0$00Ѝh>p@-|0( x@"6 0dLa80 80000$00p@P)P p@S cO-PL,MxQPH1p0H1 `'t@PP`D  1 1%H0j `S7d1 00 0`0 PP)`0 hl0Pd0\ ` 0X 0x10T P`$4"49#9003H10H1s,Ѝ pa%0 0[X0P00`0 0 Ppz`P`VSP N@-LP4 D@  \\ @@ @00L09Ѝp@@ @ 00L0pC-`@pLMP0 00 000Y0 (0 0P XLЍ0S!04"408#80S 0?0S 0Č 4,48#800SQ\Q00 $>4"48#80@- 00 0e Ѝ䨬>C-@P@@0$M,kc 0`SЍ cX p@-`P0 & P<T@P P  0p@;Sp cA-P`p%0Mx6@PЍP L180 0040 00000pGS c0@-P$0M 0 0 ~Ѝ0!!@-(0 0600~Ѝ!!p@-@Pj `14L180X00X0pO-,DTM$ F0@ px|)0@4RLaP83W 0CWg37W@ B27WE  0 SP@  0 \3\0S00@TЍ QTЍO 0S0`2X0 \0@ ~@P80 TЍOH0S0  00@0 l@P0S(0$00# p" ppS40xx0   00H000 IP0S(0$00 t|pZ H0S=0  `u00000 (@P\( $ 0000S0q 0&?00\0L     0 @[   0 k-@P H1 0S H1@P@0H1@`0H1@<@:@8 @6 cvdX>pO-4"48#80C-1@SP\Mo< 0|0p`\Ѝ4 00000L(0P P00/ $4"48#8 0 L P< 0@00 005:5 020,30(40$10VWSQ! p`3 0p` #$+4"8  > C"X!\1, P!(00 T!4 x!2L0^?0n/ P0x 0p`| 0# 0(0,0002 00 L(0$ OP`_ Pr+0So 000SV Si ,0p`b 201 483 00LP<0'6#$+4" H1 0`=P0 (F00 00 0( P0S"+0, 4"40 8#8S0 48L1 80 P-  {P&wP#   3/P p > NI>C-$M`ps@P ⨁Rn MX409400000Sv S  M! +M 4 J /0LQ0100P 0X00080 0805h540 PP ^Pa5U< U< \hl!<# E! \10X10P1T!5x1S \A5Q V}5{5py5U X \0\}PL,5$ЍH0 SH10H1rh>>>>@!!6>G-PLap0@P<?PQ$0U S @ @L @PP@  P@@ T 880P P800Y .P.PP 080P0@-3@PdM *QL3dЍ0  00R( 0 ^  03l>>>p@-P!@0PS ?!600#Q0SP(?0` ; S00,0|0YZ2Xl0%XS40T10P3/P14 X3P@- X3@  T1P03/X3;X3O-Mp؃@ 13`Ѝ?0P X3` t0P H` 0 @p$1$@ WJX0P0/ r@ $ ) B$ H$  ))`, 0徲4 #(08 <#T! P2/P!a < "`P!BV0p@@0u>A-P1l@P`0$S PDP0V*0@8pV4 !$0@TA 0خ>>>>O-(`pqT@_[00P1P*02P1P1p 4 d$t"<402X#  p3`S002ձ02ű@202(0@P<4T103/Dl0Q0X0T0 HD@0,^200lc\>>>6>J>\>e>@-@P@wKG-pPW`@(  8 @D (,$D00PT`H00#AD  (,W00 02X3  D(0p, 0 Q0000P0S202l4S P10  W0 202 0< 0m4S P10  0S2<2X3@20202X3 0<2X30 0 2022<20RoSp40p4uT1P03/G|uG-p{@RotuP1P*p'P1p$0 S 0!R* Pd0P_POP08 Su#PCuEc"p@-R_@=ux#Rp@vud0x3T-p@-R_@,u#Rp@eud03T@-@`Pp<<0$M(X(0 00 JЍcC-@ Fp0@`M?PP P `3d#0 X3A> S9@A WT00 00pMЍcp@-L(0H@P#04X3 @t3$0S$@p@=wc@-`MtP9p@T 10'*"*0*00(00,00 $0$00Ѝ舯>p@-PP@.00$000P1# 0P$P L.`0P1 V`p@ 09SYS! 0C023 0tQqPo0Sl 030 30303:303:33030400,0.04 ,$0 00$00202120080$0<00T!P 2/0P13= 3 00*00`aS_S<00SS 3 00000 ,00*0020 00#0- 0 00 0#4>`n괯>>11@@p@-l0( h@"6 0T%X300$00p@mPP p@IcG-@`2PY P1ЍG\ D0T`0"R0L0Sl rs0 00000 R!--Y 0S<00L0S,3d00!C=ЍGslq 0 P1 4P *0H P1,$qP R  qqqx3 d00xC0s00 2@0S *"*.0S 0S$00P1 9sp40Cp4ssxHЍGHlca>L>b>e>>" >7>F>*>T>H"Ecz>p@-PT1P @0`3/P P P1 N/T1 0P3/T1 0P3/P` P PP10S p( L6@00;000000 e66P1 p衰>>p@-M@ PP *l0B8#8S 00܍p:< 8000lP!Q     8@-M` PpP`-*0B8#8S) ' Q#P10 0,00@400300r2T10P3/P134 P1` ߍ-`0u԰>@-@8  t6> "(Y?0,0W?000X3@V?040?0  R   L?0 Q29#9P0t$@lp@-=T1@0P3/PPX3VP <q/T1PP03/pX30;X3>O-MpP`@ HQr 0pdT10VP1 P1& P1  xcc=.w/ PE 0/ p`F%Fi P1  Q L5LvP< / pPFL0 $0,(p$  `ʻ0P $0.Ѝc moP0Q Q P\ P d` t/PtQL1S 8t/0T | l| /L1  .0P!00P16n .?0 X3<X3n?0 X3@0X3X3|w -2 $”`!Rp#p3?0) R pt   -/ pjt 0s?`9 Si&i `!<#ĠhlÄ |Z 6> #W?0D0Y?ⰰX3@0 D ?_0t# D h | .W tL.V  04.0~.|.t#>>X/"/">Ҳ>>>>>>>> >4>P>R>>ı>ձ>>C-@P@@0$M,c 0`2FЍcX p@-`P0 & P<@P %P  0p@lFpc0@-P$0M 0 0 |qЍ0""@-(0 0600mqЍ""O-hhS@ 0M`L8@@0uO-p@ 0 `P[x7pGP~1 !)0   0 PURgD nT1߿P 03/   =   鿄    nM `CtTU 0t4sF Zn0P!0P!0 Ѝ ">>@-TT1@0P3/P UT1P03/p@-P>T1@0P3/P00<p]0   " ""   00H00D000h0ܴ>p@-2RP0@`2 R R0L00QP0 <0L 6#p@ /0L00P0 C(&*>>p@-P@` Pp0D02( 02<06# 2/p@ , 0    , /  A, 0/ @  /O-@`DMX(h000 P<0 $0W YH 0 \0p 0+ p t0S 3/0 $ _02\ 0:/ 53@ QP8 7P  $$3@  T7yP80!0d R2  R00p + 3\ h0;>C>L>U>Ec%0>>5>ӵ>>>A-0<`"Pc&@p/ 0S D0q00 %.' 0 0S0L0 zc 0 00X0'<0fPX ` Ѝ000$00 %x0S 3/ gP 2  0 ~%  p@07/8(0< ,0(000,4000 04 @ 0000CS00ӝڰ2 >B>s>p@-@P0 g  pR/ 0 0Rs00#/ 00 0/Q@-@ T( Q(Ķ>Ѷ>Q@-@ G(0C(ݶ>>A-@PD0S0D08 R0p`8 RSp &< `V< < 0< X X <00<00 R p0>A-r@p 1SD R8 < #" R0Q `P\pRj`00PPj 0A; 0!pdp@-=@]P0 Rp   D @-0@\`\P 0A0 00p@@0 @0j H ЍpĶ>pd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-  MP@ 0 `O00 00 0@ Ѝp>=" 0/@-@ 08 0(0!3R@-鱒 /@c@-@<P80 080<0A-`PDP@p80S: 0Aop0 0AT2P <00Q@Q<00P P 1 RA-80@SP <0Sxp `<0S<`  0(S8P<  @< 00A-P@h003/P` P P>Ah003/pW h003/O-0P`04@T p p 4 ЍO  0S0 00 0S     0R <0X2)QA    Q!PX @ $nP 0\ R 2/P \   0  0;; 00X0S000 0,\ $ ` @$( ?Ppq (    PP X 0R{ R\ ` $ @` >aꀈdp@-@P` 0B 04@0 0/p@ 0`0S 3/ 0 pp@Iꀈdp@-@P 0<X00X 0@0 00S` p@)00X0S0X  0@ 0 0 04 0 0 00 R0S 0=@Sp@A-`P@0pS `P 0\ ; 0`0R`0$0`0\ 0( ?S0010(000C0 0 <AA-@p`p0<00P P ~h0 03/t<0P0 kA-@`帀p>A-P`0 @T\p.h0 03/$@A-@P`Q p0S 0SA 0R 0X00S0  h0 03/ Q\00 005@-@Y@ 00C 0/G-p@P" U  U  U 0  0; 00 0AG<0 !8#  + ꀃ A#$ `` 0`0 0 U  U#  U0 03/08 RV < #"0@-@u0 0Sq80S0,XA- @Dp<1`00 ,1T0= 1T> 1PT 2C7CT4B0,X=8 R<0Q$ R 4S @t T``@ppV80S@<04#P P -Lcξ3A 2A4Ap@-PZ @`0T@ 0 <0S 3/@P 00C 0.pC-M`@/P`##@P40S X  jpᴀPlf00ppIfxp `d0pR P A#0@ @ kP0ЍC5#Ѝ>c?"pd÷>S"PM"`?">T@- D @P 0P000Lcp@-@ 0P CS <0S 3/p@C-@P 1MSX03/<e4`0S  eV< R% 08 Q pI_@0 00@PvR P! ЍC" \0-Toe R00 < E,e ЍCaЍpdpd>xdP]"G-@p`0 Ÿ8 R4聟 00S 0SA2 0a 0  0; 0p P\ 0, 0S< 0 <  0  80S 0: 0<05#0  0*P 0  P)3 0R S  P 0BSD!S46!PAQ/RB>@>4@- $@000LcO-@P|80S Ѝ<p0S P r`o0 00$00>!0C;!P>0SA*@-@@0@Q00. >0,! ,1Q 0 @vEcMb-  2 05S=00 a`09#80 8802 0<<0A-@`Pp<`3  A9G-`@PP@  },p0S S8 @p@ D1. 尓 ,/ 408p<003/3 3@ 0#S0RR00R0S @ 00R80KS 40\$ $ S 0&$ $ S ,@ 4"4T0ꀈd NEFXPi'TDG-p`P@PP 0,00202?Sb40003/S3 PP9耈dO-M M`0P @0MpP00S:0007/<,Px )000&0度dRS00X2PZ< :  R+00d [fd R  PWW Qd R  QH000 0SA R* p0S'=pW*0@ Q G@000S0S00ąp 0p0p00S ۍ ЍOp[*Wۍ ЍtP tp0pGWpX8PLHD@Wꤸ>>>>>׸>>>>>> >O-0@4MPbpb80S<0:l=S08Q D R< #" R*T03/80 S%d0S 3/ `l80SGʁPb R00 @ [(b yO0<` `00SQ  00  `00 00 00< `V X<0 0`; <0 0Q Q<0` 0 pd->pd<="Q>p@-P@`%b PU_bp0S \P0 P/ 0 /p@-@P b@Fbpp@-@`Pa0 @T8bp0S \@ Pp@-P1 P#UDP3;0 P0 0 00(005$ @,08,0P 4<p蜹>@-@4<@D@-@ a,A0S赹>p@-@P 00P`aaaAp@A- a@TpUʀ 0! $ 0    ! 0  @ 0! T0t l   ! 00 0h0 03/@T \p P @cdddCaa/0S0!?S,0/8#8S00  R 0 0 000C00, 3,0/?Q0, 0,0/00 ( 0 ( /0( 0 ( 0 / 00(/0/O-ZW0P R @pnp u=,p0帢,<zpsL!DH1003/}#-  Ѝ_?0Q R 0he100100100 0O-/@@@>>G-@p`Nzh12>w""W>`>Ec\p"Ѻ>@m"G-`Q04@B P1J_pC RIZO1 Q PRH R\qPUPQPRPZG $1Q PU G  v1Q 0U ( l0S fd `Qڼ[V0PJO`C RUZ\HZ@DZ4UDDP9U5>>>*>P>>R>Z>>>@-go@-MPh0`@ Tp@@d00@0 000`KP Ѝ@ЍPAd>z"p@-@PL`^ 0S 000 P0H0P0@@H@jp@^A-@`LpP^ 0S Q H 0 0 00@^U ^PX0S U ^U _^Y^P @R^G-`PPLp@I^0P 0@0S7~^qcP,(0 ц(0 PR' x \t^^^~o75P P1U- @-$0\@[A-@tp]0 03/`$PY.^V 0AEc0   Q @-0 03/P0S/A-P(MsS@P @(Ѝ0`P0$0(0 `0 03/$0 (0 q?00008 <0P; p 0 `p*08/0S)0=0 888/P< 8!!P r? 8 P &(<03/ 403/Sꇻ>p@-P@$0 (0 (<03/400 43/p@^S"-d}P0.X X%,à1 0")!0 <"#1o\Q "'MbEcCc>@-XM@X   010 H0XЍ6$p@-P0@$0 3/L`V 1SSpp@-XM@P`X ~701H0T@9C>H0 @H0P  0( 0 0 XЍp@-XM@X  [< H0XЍ0@-P(@\M hn\Ѝ0X D$0 010408020H0P$020꺻>2p@-(0PXM I`XЍp00@S SQ 0R0@`X  0T1008020 H0iTP`  P0@>>@-(@00 3/ 40S 3/00 3/00 2/p@-$0@ `8P8P08<0,4p P  `PU$09$0P@-@t`M\0 03/$0PPy99$0R\U W$09$00<0S 3/ P0p03/7/PPl 0 4pW  7/PP <5(0 ,n03/(0 /PP(0 $0 /8PUQ  PP(0$0$0 O(0 $0 P $0 P PU8P0S pp 0 0S $0p p00 00 P PU$09$0o[$0 9$0Ѝ@[W Ѝ@Ѝ1>L>c>|>>>ż>$k"A-@`,LUN[PpDPU  0R0H0 0 XP{[03/7[X 0S+$0 P  e["[P@P[[HA-@PT   @ `840D 4p P `84O-`0.40$M 0v3*@@R  '$Ѝ![z [ [ 0  3"[ [ 0 S,  P P9 0 40 0 0@R TP P)TPA  0RT@?4  k h e2!!1 0\1 Tl04  0QPP 0@EG?0 0B0P[ 9 6P @P +P@  %P[@pk[ 0 x _ PP   0@40  0400P} 4 0 0P 0  0Pf 0P 0B ! YSV@ Roؼ>ľ>>>F>>C>>ս>h>>>>>C-0@Pp`*0) /*,0J)00S V m`VL`2" /  ЍC>>$ X0R/0p@-)00+P@*0,, JoNOP/VPp(!Q>C-OopPd`【\MBX  0 1HiP 0?4/`V<?oU20S 00\ЍC'O-`lMp0pV Q ;T.;P"PP@X 5020t!(ST0TpU`10W ,PLPpX0G S<<000 0``āP7 R00,`0 ́0@0`P0 ὁV 0UpC00 0 lЍ4 80 P垁`2rx>A-`MpP`6@P*U@x 0PN0X TBPU402|0PSd020P0$P@P(00 <T 80U`C00 05\`Ѝ2@x>@-$00$00 00  0@PT P P$00$0Ѝp P$00$0%>0S,0 0TP P0 3/ `PP, PP ꠆ʿ>>A-@00PP 0004P<0P0<00 03/pP` Hj`0p`0<0<,0S >">@-000 00>Ѝ@-1 0 1ЍA-@04pP0 3/$`Q\@    0 03/P t5`P X-00018  1\1\1 Q004`V 6/P`  M@T :c0  603/t.yPp`P>>V>Pi>>Mb>>0S/pp@-0@4PQ 0# WPL`0S 04A0P30PU*<p cEc>0S/p@-0@4P( 0# p@-@-0 03 0Ѝ@-!à0 0 Ѝ@-0 03  0 Ѝ@-!à0 0 ЍC-Pp`Q P 0  0 Ѝ@P@@@0 P0`HC-Pp`"Q P 1  0{ Ѝ@P@@@0 oP0`HC-@P`pQ P 3  0U Ѝi@P@0 HP0 P ` GC-@P`#pQ P !3  0- ЍA@P@0  P0 P ` G@-0000  0Ѝp@-0@4P; 0# p@@p@-0@4P, 0# p@1G-pK0(0S PAL@P :LP`RL@ `⟬P $V0S40(0 3/0000@00PVp@-P0(0Sp@`V 0R000 Q0 (03/42VLp@ L@-0(0Sx@Cp@-@`UPUV0 p@,0/0 3/Pp@-0@Q4Pp ` 2/P D$ @p 0`( "4`#/0S 0\/-48 \$ 0 /\!\R TR /\@ Q/ 8 R //᠆,@ G-`0( MP0K p  pp0@*4/@PD00p8@0 4/@PF<1@ 00}@P8p0 }X (0 Xd000p0(00(h`X0l`射@P(0 00 0} KP@P (0 } <03/ 403/ЍK rZp@- P@@@4?`;QpC-@(0\MPp`x( X  i< YD00010<@1`1d`H0(0 00p0 0 P 2"0 2"P \Ѝ@ 0b0?o0cS2   ( (0` 1011SX  010 80t0H0uP X   01(0 080H`cP 0  rr2 6$O-0@Xp`P? P9 `!008S/00 RL 2801 0000|P3 0|0 FZ!0 00||t` 00 0|0 $Z | Ѝ0 0 0| G-@(0XMPp`x@ ?0 S㣤030#$ 0 X  o011 H0P-X  `< YD00010<@1`1d`H0(0 00p0 0 P 2"0 2" P XЍ@ 0b0?o0cS2   ( (0` 1011SX  01|0 H0oP X   01(0 080H`]P 0  2222 6$O-0@Xp`P? P9 `!008S/00 RL 2801 0000{P7 0{0 0Z%0 00{{t` 00 0{0  Z { Ѝ0 0 0{21BP31 a1/G-0M01S`P`1 @o (0O p00 pp0@0*@4/@PG00p8@@0 4/@PIX1@ 0@0T{@P;p@0 c{X (40od0@0h0l0040(0D00p0(00X0@P(0 00 @0@{@ o@HP@P (0 *{@ <03/ 403/TlЍH rG-`0( M@p0c   0P*5/PP@008P< 5/PPB,1P 0z,<03/ 403/T"0`R`X ( 0408(D0p`]H0@<0 P 0 ݍ0p0 22L2L>C-\M`PX p 0 X100  H0,@P$ U PE_oYRPU 0XP PX  (0 080HP@P  0 D\@\Ѝ   Q6$6$2 2 >>p@- P40 S" 3/P@000S@  3/@P\0 4`V  @6/P@p 2/03/aO-pMp\1堠@Z 0100P4` V  6/P < 03/H1S< p4`P    ߍD1S R0Ԑd1(0    p x Vp@  p 0P0 0 3/W +(0 `-21 1\1Q00S  40S- 3/PVQ < PԐd V T| W```F0 VPW 0  03/[VX [ 0  PgPI040S=   3/P>HX1000 R0L!00V,a`NP)d1S Se! 0 Ԑ 05h1h1S 0 !t P000  \1Q00S 0 4PU 5/P 03/$><>[>}>'>>>>>%>+>K>O-頠\1@Z!0P4` MV 6/Pp DR 03/(0L ` 000 ``00*8/PD00`80 8/PF9p 00wP8`0 xX p00000\90308(0p 00DP(0 00 0w f-EPP (0 w <03/ 0403/X Z pߍ+Ex|SPp`< !4 4tp00P  'P " (1pS  PXp(0o1S\1Q0Z0 S 04pW 7/Pp2 7夐8#t200( 0   0p*@7/pP008p@0 7/pP6p 0@00wpP@0 ?wX 0 0@000(60 01(000wpP(0 00 @0w@ 0N (pX 012000 0SpP00 3/pP0 0p  H -`1 k 00PpP VWa x  06$0(0 Q N  003pP 0 [  pP$08$0(0         Ho48#|2婒\1Y0 3/(p\@CPUpP (0u v@ <03/ 403/W p0 `0 n0 c0 0 0 R0Zp ѠБ[0 [00 !0D 0s1 z Y xX h0S T[ H W8 4W0A($pP .~C(1S 0 Pt000ᴡ S<#0 0 R XX :1S* 1S' 0!`Pt161`!A?;`V)      '. !R尰R , [0 " !(   尀|000$> rw>>>>>>\>z>>>>>>>c>m>>>>>>&>>A-P`@v $0 DS P9 PJ0 0(0 `L rPaH TXX p[1q#3!?A1c L\1`06 SQ 6 `'``La H` P  r{ 6Hv `'q`` HLaiP`d T_XX[ p[V<0q#3( ?A1c\1L!4L1>gfff=>>p@-$`P`@0  p7 `l2 Xp-Pt)Hu%@v!8w`0xya |  pH!R0BS2l> p ` XlPtHu@v8w0x(y z{a |  p `l XpPtHu@v8w0x yza>C-lM@d p(X 02X{P*00$0`80 ` 0 0 `h0&hS `PbS(0P 0(0 p8P0`UlЍ40S04P0<0P(0P@-0000000cЍ>C-oo@PpdԐ\MbX  Ⴟ(0H010$0 )0 1P( 0 U 0 p\Ѝ0 1X<UG'p@-XMP`@X GL0 H001`?oT20S (0$0 00XЍp2W@-$0dM@8 0$0(0 0 03/(0P( P $0 R0$0a PPPE_oR_0[dЍ(0 X :021$0;P0RP,000 03/ `lP0`(0$0Q pn |P0SQ0 03/T .P$00 X Ȿ20P0 02PP$08$00@-\M@PX ᗾ010 PH0\Ѝ02p@-(0P@ ,Pp$0 SP000pEP pO-P @`pI(0  PdW@ 0 @Pp\ J Ѝ0 `@0 0 RrP 0 00@00S (00  002@Lr00 0Gr`0 @P00 09rO-P `p@vI$0 0 03/P p@ I Ѝ(0  PdW@ 0 Y@Pp\ 0 `L@0 0 qP 0 0000S (00  00@q00 0q`0 @P00 0qY>C-P@(\M@>R`>:pHX  ᇽ$0@ #0 01020D@H0@P X r$0` $0!01020d`H0@P X ]&0160 H0@I\Ѝ@A-@M@! `PpH$0 1pA?!0@P !0E@P 1 4MHߍ0 >@j>!0RP/TX QX !X T T !X T !//T X0RX01X0T 0T0!X T !0P0//@-c$O-P\@tP)m_QH01naV!no1SKHqU~o p\`;Vn52HvV~TRA}$pቩP HpPW VH$00北H[ tP*1 sPC-MPppQ@101U 0|10p!]?lg 0t$0`Ap19l!;M 0va 0~v 0 mGn010ȁ1ԁo @㎨01$ F40 00\` V10㨁 t1>><"""A>P""@-@p1]P1haq婕1p Q V  0 {1 0 @ PU:h0  \p04W 100@,o>}>c>Mb>>A-PL@L`m GP0n`A?Gs@- 1`QPp@p000#@0R'Ѝpm_FRP 82<"0820 <"0G0P0t0L`000 01no%1010s 10CS1nvd@c"p@-pP@moFP P2""N0 0 FpPP0P0 P1"p@-p@PmoFP#@ @@(0 @0 @1Fp"A-@`$0@PAQ E UPm_FU 101FUPAޕ101A-pp@`P@oL!?R01 AA-p@`@D0L!mϠQ  p d00$PPFOFЍA膕0 $0+ "PP 0S0 0000AlO 00 0E1S$0P0<0$8 0ЍAFY>>>Ec"p@-@0P$ mo E$>1S1p@E 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd (0 R 0 0040/|ddO-P(pP`@\p!RWㅡ& W5 @ P`p1S0 0@0 A\'0S0S  @ T   R 0 00qT 0 Tk 0S 0S0S 0Sp>|d#>Z>>@-0@S f0l S 01 0000S>@L  Q Q  0|dPA-+S@`p0 100PU0S0 8/00PQU0S0 8/P>|dPp@-P`0@0 P`00 R @p 4@0@ 1Sp R  R ,      0>|dd>@-@ R 040 @|d-^ 0/$0a(!"$a$"  b"!4b4#0/0@-0#? d@ ? 0#?00R0S0@#? u BP.?  0#? 00R0Su0@#?d AP.? 0#?00R0Sb0@#TSxAP.^ .?o2^0SP@^D 41PU @?o2T0SA@^7 0PU @?o2T0S20@#?) @P.? 0#?00R0S 0#?\p!?Q0/o"0#?S R000,c Zp@-P@Q P p@0S@G-P@`pW XP @p@- 0 Pdchc>/@- @q <Q 0(Aq >">)>0@-4M@Pg000(00 0 0    , 0 0壴P 000 ⵸4Ѝ0H"O-4M`B@2`2020 00 P0 5/0P  P 5/P `rZ pp 0< h9/P\0 ! U0>0 4 9/0 4 ;/Y  Un 40 3/[  Ue^ 0 !0 < 8/ሁ PE(_CSe(/C#b?0ET)Pr@1P  P C F000!(00 01P0 0 P00P0 000 P (00 000>00Pw  0 0|0 0ݳ4Ѝ>~^괉dcpc@>0AY>|>@>Mb>9>H"@X>@`>"/O-`0A3vᣁᣒᣣLP \[ \  P @P@ PD  \ # ZK0/ᴉd@-D 0S 40@/0S ^贉d>@- D0Q d@/Q 0E봉d>0/ᴉdA- @0PS ` p 403/0dU00 A/ R 0Q000봉d>N  0O   ! "`"Рo@-y>@-u->p@-@PPpH0. `@@@D$0 p@0f|>Dc00! $0 /@cd 0(0S 0@o/d@0 !!/@-0 !@@-0 !@p@-Px@x(Pe $0dP$0 ,0KO R0(X,04S00!pdS>\"@cp@-@p  PPPDUT ʀ0 ! 0$ 040pk>d0$/dG-`0p$0PUG|U !03 0#(1R$10C2r"0Cr!0CR@C@C1,Pf10, TP2/@cd @- 0 ! 0^ Q    D $ 10@S@@@d@cL@-0DPO@cp@-$0D0P !;3p@cG-@`po  P00TS\_0 !HP10,p1,a(0 ℑ41 0 , >d@c@-@o  Pl ,00DQSQ @00@!,1!,0,q@d>\" $0 0!0 00 /@cddd,0P 0 Q>0//pd@p@-@0dPH 5/,0p@ /p@-@0dPH 5/00p@ /P @- 040@/00S pd>P0@-  d@/  R 0pd>@-P`p@`0000  p 07/PPXG0Lq 2/y/,ݳ 0 4 8 < @ D H L Pn  P   O R0 P P@ Ѝ@X0,0 0@ Ѝ@ >3>pd"I>m>0@- !" 0 !0@- ! 0 !`QO-RrpxPGx`q<@U@Tp  G210@ 010n  P `U pT X Ѝ@U   0 @[X ≐@0 4P0ڬ 2/p[>@cp@-P @@@@Ln  P`@p0/pdA-`1@P0_SL b0 _SL0_S Ip0 _S I0_SO 021   0 0Q000S$ SvApd>>A-|0 `pR_V0@00C{ 0@@_V=Pp @pdG-1xPPxp@ \;W 0GSD ,0S 0.9 0 @0p,0Y`0,0 B0  W30# W _YOO@A$ 5Y0 ` _YOpq _YN @pd>C>r>>l""G-0`@i0 p R, * 0 R& _TC _TP@PQP$B@  A0P% _T Fpd0@-@, _S= Bpd( 0 _S!Cpd( 0 _S! FpdA-PH0_PB`@@@Ap0S  Apd( 0 _S!OpdO-00Y @b_[pLpq0 CX_[ `I`aPPp0Z 0 @Z V O  @  pd@c>>p@-@@0SpP"0 PpA-`P8` `p00p D1@ v0P   8/P Ѝ0t B| x0Q  6CQ@ 6Ao0, N 0AoXc>p@t%`A@-P 0|!SF &BS &SG `ЍpH!S0Sl  P(A 0SlA1  P@`p2 0@0  0P` ` 6/P@0 \` 6/ z|0` 3/0Sk\@\0 0SkD@D0 0@  p@`AcccXccccc/!/!`!//` `! /!b!b!b!b!b1/c 8!0/c#c4 4#1/!b!b!b!b!b@-`P@LP0@00 p0 7/0P P d`6/0d` 6/ Ѝ@1">c$>=>@-6o 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-Qp@ 0d`6/0 `P0d 8/0 48/V00V*U03S 0`4P 5/ P0d 8/ PV`!U0#02cEcA-0p@ 0dP5/`P Pd08/0 48/V00V*U03S w0`4P 5/ P0d 8/MPV`!U0#02cp@-D00@ !0 4P5/0 , !pcp@-T0@o04P 5/0 00dp@/c@0A-\!\Q\a0@0cj  PD p8J $pA =`0 00`0 00`0dp 7/0dp 7/ dp 07/0dp 7/0dp 7/0`0ЍADecDeP1EcO>""7@-0Â"6 @FC$0S0 XPV0@T :@@Dd0 0S B @DT Ѝ0cQY'A-pP@`0!0 48/0dp0 7/0 dp7/0 !!c@Bp@-8 0403/8 0d`6/pA-0` Pdp@403/ ;7/0 4P5/P0@ `dp403/ ;A/-8/48/-8/-8/-8/-8/-8/-8/A-@`NiO-00 0B ( 00Cp 0 00S 0F0  0G V0 S] 0J$00 3,000  0 C 0壐 000 000p4$00S0@0@0000$0@A QIP QFJPPBEQRH P<Ѝ@03/d03/400 冈P4 L0 0R0@ 0R0?ZaPT (Q <0 3/ R 40(3/0$ 0>c$tclmdxc|>>|>A-PM@F0 00 ". `6/`P # 001! 0@0P $ 0 dp7/T1 R `   P ,pЍ@(0@8p<0$0:0 080 S@   1H0D 0S0009Qd  y000040I> 0 0000 8/0 @00 W,x>>>pc#>xd>> e> 0S/@-@ 0S/@-@ @0S 0CS/A-@M`pP @T1 H00000 ᜃ@P@܍ P: h0R1ʖQ001  d $0` pX@Oy000040@ 0Q Sp@-@P  Pp/C-MP  p`P): @0 0( 80<  S@ ʜS0H|0D 8  y40 00T 5/00 @00Ѝp@-0PS @  00C0 0S0 0P~;(Q $ <03/ R 403/p@_n>$p@-@R 0 0R 0R pR 0Rp/00   ,000 0H00 4P5/ @o_W@@W@AW@EW@- o ϜDH R< o    @03/Ѝtc-0 4 0/-0d /40P 0S/0S<0//ᄋd0O-@<0`ZP R \ R *R!SF  R < &    q D @ D<0  D!'LT \\LXp` ,^^N\^ Q  R QX<0SL Ѝ0::0C: 0S ,0S \ 1 !1R !0YH <<  Z TL TYPLITP,Z`N `Y  \ pXp B`\  ::0:0 & SC-M`pֺ@p0000S 00 P0 5/PP \ЍCpH2傏@   p@Wod  P ("( 0 00 00$ (0,0 0S3 Un"0" n2U]"L" ]2L2PUP*00 PPp008/P  1 000:88/P )>0:! \P!: \P<: R? p@ P 0j=0:* 00 Ѝ>>d>>,>X>#O-0`SP@ Z-0S* cp   P00Z0000 ЍpQ3# 0c  P  0 p@SHG-paPP@::S0YL M"L"8 R Pc  P  d0(S  D  "O-@ P4 pჟ0  Q ` !PU h0pW㋰   Ѝ5c  P  '0`S V03/<0SNVU 00020L MLr0 D0Q @ P 0R \Q  R> @  3 r B"4AQ4 A!, 8\, ,0@8 @8  V 02/0 ::0:0oP t1 R8 8  01Pjy> 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddhh@- 0(0C*s` Ѝ1pP0d0 @0 L~`P 0SQ BQ0 ,Xm`P,pWQ 1Q0<00D00 87 H0R/ R0 0SH01H0WH01H0 0ps8 4\0! @ 18 0@@0 0s S#4  4 hX2H02,00@008000@@0 0S%40040ꄋdA-@2PVD`q@pWA40@00S 80S0p 0sBPh 80S80S808   YpDKXDD7< :RD01 "0D20LML q @50@0 ** * S#4AQ4 0,W 0,@ 0S#,8Q, 0 ,00000! @ 18 08 @@0 ꄋd>p@-h2@4Pld 5/`Ph”l0d`d 06/@Kh2ld 4`6/h”0ldd p@/'p@-P`}@6PPݻP jX hp"R h2l`6/0p2pA-P`Wp@0h20prx$0`1h?0  0 8/ P ЍA0hp2(Pl5/ -h2d 4Pl5/4Rh”d 0dpl07/h2d 4pl7/h”0d dpl7/h2d 4Pl5/1h”d 0dPl05/h2d 4Pl5/PGh2d 4pl7/h”h1d dp0l7/h2d 4pl7/h”0d dpl7/h=dph l7/h2H 4pl7/h1 dpl7/0 P h2p"lP5/0p2gs0P  PX4 Ѝ>>'@& >*>#p@-P@O`  P#Pp00pp/-0*T00/-0 T00///- $00/$00/@-@$00 3/$0@0//@-@$0 03/tns@->0`@ P  B` 0ŒQΌ Q @k0T00 P05/P  0 ЍpI>p@-0P LS00T0@4`X 6/TX0d` 6/p@e>O-,Mx @ d0SS0 p(а d0S ,ЍS CS 0C$0P剡(0``03/P坵 0PP0  (0`P  p>P+#>p@-@$0 03/$003/` $00) 3/ $003/P$0 03/ HxF$0 03/\>XP$003/Pp}4PUp3/$0 0 N'p@-0P`@ 0 0T @ ` BT0 0p@/0@-@ ң T A-0@@@q`PU P Pem0 !l R00 C1l$003/P00P$003/0P RR 00`(d0 U T0X 4P5/T0 dPX5/PEc>>/O-@,M1 !dQ B8d0S1 TX00 P0 5/pP L1,ЍO d0T 0C?odP2X5/x d0SS0p谟d0S 占,ЍS CS 0C0(P` 0pPP3/p0p 0 0 $a h p00 po h00>c`(#>$'#,'#p@- R 0@P5/00 cp ^p@-@9dP8 5/0dP 5/p@ H@-@@s@-@00 P0 5/PP \v00Ѝp000(` 6/ 0000>G-`0 p9d":/d0":/0"d:/`0dh":/0d\"0:/408"3/0d ":/40 "3/0d!:/40!3/d0!:/̡40!3/@B @0d!:/40|!3/0dd!:/40P!3/0d8!:/40$!3/d0 !:/40 3/ d`0 6/40 3/=d` 6/Z :Z 5pWfdp9P 7/0dp< 7/d`0( 6/=d` 6/'G-`0 p9d":/d0":/@0"d:/`0d":/d"0:/40p"3/0dX":/40D"3/0d,":/40"3/d0":/40!3/@P 40!3/S@0d!:/40!3/0d!:/40l!3/0dT!:/ 0dH!:/40(!3/d0!:/40!3/@ 40 3/d`@0 6/=d` 6/ Z oZ jpWYdp9P 7/0dp< 7/d`@0( 6/=d` 6/'G-p0 ⁀9d`!6/d`0!6/@0!d`6/.`0d`!6/0d`t!6/40T!3/0d``d!:/0 0 0 40 3/?d` 6/00 40 3/0040 3/dP <0l 5/ 00dP=  < @000(0"(6>G>p@-@ dP05/pp@-@ٮ0 4P5/0 0p@-P`ɮ@`00H00 p 0 7/P 凮 Ѝ@$ 8`0p<SxH)8008080(040,0 Ѝ@賋 0 00$0c>v>>PG#G#D#D#@-@%P 0SEX  P0<00 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-@?`0p4P 5/0P4 8/`?0 0%3?0 00 02000%VP4 P0A-P 0 3&*?=0 `p?x0@xp x0@J4 F@".PpP0d 8/0 dP5/fd/// QX0S/X0@0/-0d$ /> Q/0>D0S <//L0S <//H0S <//@0S <//A-0@ 4P5/ 0`( Pdp403/0( 7/0dP 5/PX`0 4p7/  U 0$ PEeU AEc>"> 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-P@`U$ V  P0UP0p U /0S  \U@t x0dP 5/0dP 5/@p&6>p@-@`TP TV  P @ph@@p@-@P0d` 6/0d` 6/( d`\06/T00T0app@-@Pt`\00\0dP( 5/p@N@-@$X H00H00X0@dep@-@`UP\00\0d`( 6/p@/Q G-@P?10 d`?06/4 d`16/18 d`6/H0` ``` `@h0@`SlPUDpPp(Q  0L0GP0 d:/ 0dp 7/ dp17/< P000QH 00@00  00004040jP  L_0L0H00H00X0( $00040(0U  P,`T0XP0T0@`0dp 7/ d`x06/0d` 6/E`pX 0V0R0SX0S<0(@0P0T `. 0 hc`F[>|>>Ec>O-0@4P, 5/0P( 4`6/P cPX0S   P0_ X0@0S X0<0X0H0@(_ X0L U  X`H0p8 ē0p 0< 4:/04< ;/ 0 'X0L00 4p7/pH0p  p<0 1 / U  P+H0 0S'0L0@ 0< 48/04< 9/04< :/2$p 4 < (p,pLpL0S@0SP0<0T  P H0@(Z P Pb@P :PX0Sk  `  X0L P0 X0<0X0H0@(2V\P \PJV "P` XpP X` `0HP0H0@% V P0S+`P + Y'0T,0@ T09/`F0`F\T0 T 0D 9/VX0d`$ 6/@>C-4MPᄪ@P0,f {0P 0 P05/pP  ip4Ѝ0"-P 0P P5/kT  PNh2h2ltp0T  P<;PP`d0hP`O( 2P0vPp "0 0@0!`0P00  0 0 P0`0 P0$P0( 0,`10P,0LPt(? @(0d!`(0P(0(0  (0  (0 (0, `(0,P(00P(04 (0 ` m0@00 000l00p0 0P00$0S  PP0$00$00 )PZ|P0P (P >>A>LQ#> N,L>@A>\I#DA7>H#S>TcY>p0\ ?R"0/A-P` VPЖ@P 00S lp#P U@ X0@0X0@#`VX00 @@cdp@-lP VP`⡖@l`PV#UX0 U0 X00\0`0#p0X0cA-L@`ზlpP9#A@ \0S@m#謴cA-@LlPU `80lpph0#V#謴c>p@-@p`lP #p@D#X0 @-\0@S ` 0\00s00`R`0(0C#p@   t sX /舋dd0S/p@-`d`@Pvrdh0 0!T0$LH @   !p@ꈋd@cddd\ P/0 !8 00 (  , !/@cdddp@-P@dPi\0 0T ?S5%`@0\2 03/Ppp@Ec>d P0 P!ڠ 0@ S0/P P t`S /d/`/\/X/T/P/L/H/ /</8/4/p>>>>>>.>Q>p>>>>>>-3@-@@-pS@ 04MS 2 03/Dc2 0 3/00 P `V 0 0d0S e00 00004Ѝ 0B S020S' 0S P000  00 0203/0 000820S 0SP0002 03/203/ 0S P0000 000 0S2 0 3/} d0Sq n 00 0$0Sf2 03/2 0  R05"105%R0 0f d0 `Sb pdp4 t0 0l ?0^(  203/PJ cFꈋd{>S>c><>&>Ec]>p@-@@`lP2!m! 0 ^Ech>A-p`alP@!1W 1W 0W$ @I!d1W# 1C7CW2 03/P0 ,@ 10S-@ ; !000@3 000\0S#@ `L0|0 cR(0L,p\00C\0p0$0S 0000000 @ꬴcA @A A(@n>cdQ @-,/>0( o( /ላd@-@acd>>>pc#>p@-@PP " " " #p@r@-奧op@-PῘ@P/%pC-4M`pK?0S,0APT( 0S 0s S$Q0 0$1 0(1@0`008 0$Ѝ0$@T4Ѝ5dl#p@-@`ὥPLD=@00000 81$Ppp@l>n>p@-P@ᡥ01Sm8 p@ R $ R $ p0>@-,0D ,@ 04/01/@-,D@0\ 0@/A-ppP0AT <1S 0,03/@-D0AT0S $P @SG-`P@0<   P@Dp0AC0STW0l0l 0PPpW@DT >000XT0D 1 01Ѝ>>>p@- 0PQ@ `M ` 8yU < 0 n܍p >>G-p`@ V@0s5 S20s/ PPE_oRP! Q aP P Q XPP Q OPP Q FPPY U @`FPY P 9/P@-@ᒤ0@00/X0 @-(/">@-遤<1 Scp>@-(0 `MS$l@(0X001T PЍX L D ARF:@ PA,,00@@D  BD H0H0L {M wN sO oL0P  Bi(0  c _(000Q?0@  Q T RC G NX00X00S 0,p P 5/PP H 0 D  pP 05/PP 0  2/$z,t>>p@-(0 `SX@ 01S 0S P X00X001S 0H  2/ 0,  2/p@X  D  BQ:@ Q0t>A-pX0@`P  h0 p 07/P  0L0Q0CL  QL P R*P0Ѝ>p@-X0@ P 00p@/>@-pX0@P` \~T0S L^  0p p07/PT$UT Ѝ >8>]>p@-X0@P 8\T0S(< 0 $ 2/0T0py>>O-p`@M 0SP㸐 0S5 0  P 5/PP,7P UPU0E U0#3S\ P  00;/PP$  0S@XЍ 0 @ 2/$p0S 0 S @X 0  @ 2/, 0  2/$p>A-@`(Pp 0S `p0S 0 ` 2/,p 0 ` 2/$pG-`p(@ 0SPp㸀0S%  0   P 05/PP,p 0!PP$p 0S$4@WЍ0S$4 0S ,0G'T 0,@  2/A-@P$(`4p 0SP,p0S 0  2/PPp@-@P`Up6/PP Q(Pp@s@-@@N@-@h0 01 0!0!!01(!10!0(1A-@PUP@`PPqO-0p"SMSS ЍD/0C@ S00S0S00001I0S000S 0 0,P5/1 0 0,P5/P`1 0 00,9/P V 1BP0 !0011P0`!BP001UV0S 0 0,P5/ 0P 0,`6/1TQ 0 0,P5/ 0P 0,`6/1TQk0Sh 1S& 0s01! 0 0,P5/1T 0 0a,P5/1SG 0SD0SA0S S<P: 0 0,P5/PPP 0pRP3U_&W\p"P  0 0,P5/\ 0 00,9/P0S 0 0,P5/` Q0`PP S:1S 1 0 0,8/11 0 00,9/! 0V1 01 0 000,9/!0U100C/Ύ    0 0,P5/aPV@? 0 Sb C'C/` 011B/X0`1 aP 0 0,P5/P000@000 000000 0 00,8/00000P 0,   ,03/P:8   ,03/PX0C/᪢X [0S 0 00,8/0S0PPSPPP0S2 0S 0 00,8/0 000@0 00 8 000 ,8/00S 0Y0P00 0 RU 0S3 0S 0 00,8/0=@0@000 0<0 0 00,9/ 0 00,8/ᴚP0`0  R S @S7 0 00,8/00S0_1>  [ [ 0[, Ys [YcY   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/PY- 0$000003   ,03/P   ,03/   ,03/P   ,03/   ,03/   ,03/0    ,03/P0 01P000P:00 0 00,p7/ 0p 00,8/0P000 0S 0 00,p7/ 0,, +  P1+ k 0 00,`6/P00 0 00,p7/ 0p 00,8/p 0 00,8/ 0 00,p7/P>  10 01>  0P 00 R0Su  ,0   \=3/J0 Z㬠P1>  X  X,0   P3/J P0尠S  ,0   \e3/J0 P 0崠,0 0\ 3/   ,03/3/   ,03/   ,03/  00X 3/   ,03/3/   ,03/   ,03/  \ 3/   ,03/3/   ,03/   ,03/  pO-M$( ˜8@@  03/ P400\00@; P5/P  03/Pߍ80`0<0d00X000 0X P%6R0P0$0(P3/0P 0) 043/P 083/`d,03/P\0P0 P X \`,,0 d3/P ,T0BS00\04\@0\00[08p,0 043/UO 0 S000 ;p8/80`0<0d00PS\0 0\00 0`\X ,0d3/PP&X \`,,0 d3/PT\ `X ,0d3/CP\ `X ,0d3/IP\ `X ,0d3/SP\0T 00\0ZP/0B?o\ `X2 0d,03/\ X@` ,0d3/\ PX` ,0d3/\ X@` ,0d3/P<0\0T 00\0%P\ `X ,0d3/\ X@` ,0d3/\ XD` ,0d3/\ Xp` ,0d3/\ Xt` ,0d3/H\0DH @00 S3 1* W 0X 0p`X d,0B"3/P @@Q\ `X ,0d3/ 0#T pRhT($0P3/P \ `X ,0d3/@o\ X` ,0d3/\ X `0 ,d,0;/\ X` ,d9/ 0\ ,0`X  ,0d3/@P>P,0 [00St <1QU! !,p!;!  8/U\0 0\00 00>8>@-@M. c 010K/0  $!(! 111 1014!, p1>  ލy#A-P凚  Q'R R@v`0Sk(1$!0aVKO0S] AlhhV XP`VG ,$#0 S(0  @T`\0S0 0S S||t 0SP0S Xp0S\Q 4x0v0 q0 l0 g0 b0 ]0  X0@ S0 N0  I0  D0  ?0  p:8AwX3p 0S<+Q 0(A#$pQ 0AQ ,pM>^>j>>>>>}>>>>>,>>>>!>(>4>B>M>S>a>q>>>>>>>>>/>]>m>{>}>>>>>>>>>>>>=>S>X>h>O-P@pa$!0r0C?o20S (!0r0C?o20SPA Q> P;P8 Q5 P2W10S  R(pW h7 @h 0041@041C( C/0Bp Y `W ,q$pmW >c>>>> 0R  BR//G-(0PȀ!p0r@0C?o20S !0r0C?o20SP(㕉)Q v`P 1S PkP(㕀 0S>p@-@ 0P` P@HTppA-`PᮘX4S@ @Tt~@Pp@-0@@ ThPPP T[PP PT0P4p%@-@TPTu0P4C-@Q4MT4P 0p`  8/P 4ЍT4  0   p  09/@PE |PT4 0  2/0 , 9/@ TT4 0  2/8>W>A-@Pp`84 ,<8/p` W`VP `pE84 ,<8/` VO-Mp @\p PT P <ЍOB 0(0  RC> 0800P 5/P + @ 8$D0<4>`P2嬢42 4HVG 0 P Q CPP`P$0 PP 2 ,42<0424 242$42(484,;/P00@4$0 00  1, 041<4141$41(484,;/P00@4U 0S R !0R "0R@$R0\`6/2 ,`6/PP2 ,`6/pP0,4004040$4|0Py pP0 fP}0X4Ѝt>8#v>>#%D#>%%%%%|%%%%%l%% %Ț%%%%>> 0R R//@- 0 R0  R0 R0 R0QS 0 P ЍR00>A-`pBT PQ@Pp@-b@0 P  PpPP  0 22D 0(1S5Q  "t%`>b@-@ 0 2p@-`Pᒖ@P  P p@ 0t(0 +PP p@0T1x0p0p0L1l0P1?`YP0P PP@0T102p@#~> #إ#>%X%%> 0R  BR//0P Rʬ  R: //C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &T09/P@D P 0C-P @hp\ 0s'T Ѝ@0 T`1k#XD  &儐09/P@D 倐 0p@-@`|4S@ Pᖂ@Ptp@- 0 R\0S 0 000P00 Ѝ>p@-Pἕ00S PpU@t 0  twPP xQ t0x4< 0pPxxQ txTPL00 8/P ЍO~04 04 0S E> L00 8/PB4X 00 $#X#R>n>>#$#>`#Ec> #>> 0R R ?R//p@-饔Z1S @VpPp$Q p0@-01 0P Ѝ>p@-@T=X PS0@  ``\6/0  LT-X=\RB  0`6/T-00X 8RB  `P\#85/L 0 KT=X \S`PA0@  5/p@0  KP?O-@M`V 0 SV0 SV0 S H BPV Z @00 0 0R5Ѝ0S0`pX d0`\h0Pl0UtT=S3: 8t #8;/T=X \S< x 0`;/X=p`T=S00> 0| \6/P p`$ (,tx| d  0hl 0 Q Q 040C0T=X \S3: 8t `#8;/T=X \S< x `0;/X=oppT=``S>  0| \7/zA-BMPpᖓU@a 0L#^P$  RPP $x0$=1S 0"P( P0 "KT-X=\R ( 0`6/ X= R\``T=+ S  x26/T=X \S  ``X26/T=X \S  ``426/T=X \S ( ``96/PUvS  06/T=X \S  `P05/T=X \S  `P05/X 00`P \5/dQT-X=\R0 ` 0`6/8 T=X \S4 h `P05/T=X \S: t `Pb05/T=X \S< x `P05/X=P\@`T=S0> | 006/0 S0x x 0Bߍ~PU$Q $]8p%?P?#EW?5?G-`@ᩒPh@ X P G@ 0( 0X= \ R R! R pWT-0R@  9/APqpP0,=T}E 0\ R`k0P x G P 01o?#q?#???/ 0P/Q/c@-@5 R`0S0`Qd\0@-@!T0$0-p@-@PH2Sp$0SpH20$J (\003/$ @-@$ 003/$@8 HA-p`@Pp 00%010HdXB0$0[ptt GC``2SᛑS0$03/00S $A}@@#cL##A-@P0S},$  0H"$ L}$ b@a}fcd,cUtUUĈc##@-@ @: ddH0 60S @-@, (0 x@* 0@/cdcp@-@X & R@@P A@ 000S 9@  pdcdp@-@TT0 60SP<0p@8h0 ,7 ppp@ddp@-\@ RPP Q.ᄒ5S0(0(000C0ppcc@-@P Z /0PP0x 00cS0`0e@QN@H@,B x0S Gt&BI ЍpcddA-P`U0@S"%0S }00@0$@-0@0$e0 00@0$@-@@p@-@P0P03/0p@0 Ip@-@P0P03/0p@0 < P00/000/P0S00/00/P0S 0S8020////-0 $ B^\\^\^p 0 /G-P@0弑4p X0IbS 0 $0SP0$0W$0\0S000 0 0  1P" P"0,0$0S 0R*10$0P003/0S PZ kP  嚌(0S V0@@0$(0$ 3/V 00$@`Duoob` oW 000$0 0S0SGBXX0S pp@-@DP$uqP 00$0S0$0003/l$p@A-p 000 ,`lPPP0 @$2100 P 00 $0(P.,X0  0  Ѝ@-2>  0 Ѝ@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ#@- 0 0 Ѝ@-8 "  Ѝ@- <  0 Ѝ@-<  0 Ѝ@-MpP`J@P   ,0 ` P00 0 Ѝ! @-`P1@P  00 00 00 000~Ѝp@-`P@P  n (0P00 0 fЍp! A-`pP@P  T80 p `00 00 0(00IЍ! A-`pP@P  780 p `00 00 0(00,Ѝ@-  ! Ѝ"7@-P@P Ѝ00  $0CQ RR!Q Q @-pP`@P@ Ѝ0P @ 0P X0 @P O00A-`PL,( p0@0 `OT Ѝ< @-,00@ t=P@Ec@"@=@-@@0 4@- CRS<0S'RHE@@-@P 000@-@PP0S0S @-@0P 0S @7@-P @ P 0St 0S Ѝ0s@-PSЍp@` @ P P 0S St 0SЍp0  R0 0S00/ SA-`p Pᇡ0 @P ~@@@-0@0$0 !0@0$VO-@I0HDpF`B0 80E0PtG0@Adf R \ f  $0Q \/ f f f f f f ft R lfx R Xfp R D ЍOf Ѝ@@@@@@@@@@ @@00S/Pc)@Q @-@() &#/4@=@O@O-P0tMp@ `ڠ0PW E0DF IG0T@H$H0L 刱4PP0<`!`@hPlp `E W ḠtЍd !R8 "!00SA X00X0\0000`0000d0000D00  r @R( Sr$ (r0 00 $0000< 0,s P  0 0QdP!hh0W]@5#@-@\MDT0E0DFČG0I`H0p4@000@8 HA00LB4 <P o  xrd00\0\ 4$00p(ЍFsPP ,dP`phpo\Ѝ5e@D#@-BP 00000 000A-`P`p@P   03/@0 +cn@G-hP`p@P@P L@0 4/@@0 c{@P0$ !/@- @@4d@-@Jt ,Kx (Lp @#G-@P` $(P0Q0p0& 0 JP 0 KP0SD0E $|0SGEF0D 4$GtQ SxQ  S@-00B4 壷 Ѝ@G-`P @a-0p 0 G0F $ E D040 0့U@ A0` 0@0u@?0>HHI0t jP H/0@@0H @0H( W00ЍG@@ @@p@-`Q@ Pp P $ 8 2p@4@p@-P` @ p0I"RP Q 00#E-, $ ,# :cEcMb%@ A-p 0` P0 ?@P 2 @P0 0X@Ѝ @#@-@0P 40`CV^^p`W ^^PU\@p@-P04@Pp0S0 p0SSQ QS Up DQp@-@00$!srPP00$+pp@-@00$0 0P 0P!00$p@-0@0$0 !0@0$p@-@00$0 rsP P0 0 00$p@-@00$0 0S00  0@$O-p8@PU`P. Z P ߝPP 0$0 \=BP 00̝@P R ͵U ༝R4^R R^[ 0 R   R,    00@^(r@  ^ "$ ,@O-MP,MUPPqPU 况P7@sP0`x',ЍO,8D8rP7U8[P0VTP 0O080P0T0 007 PPZ 9`p 0 pPP f`V0  7%VP 0T0S0!4R P` 00CS`( PQU`0 `P )[`0S0!4R T`0 PRY 0LV 0 P8  ״ P0P#30 0PP[)  ᷜPp80弇 08P 2 0nB 08- P 08tU Hx8 ᕜ080Pd8k8R_[,Ѝ@@@-`QPp@MЍ@ :P 0S Ѝ@M0Sp@-`0P$@0s S@@T00 @0$6pp@-P@0$00C00p@$'G-$ p`PPP-0)000@0PP4P8`p $ $ @04A04B04 04 0S004 04``V5 bP0`V3\0S  0N΅ P P R'4ЍcpQ  1Md0P J. p3} L 0೤``0X*V`$\ @!< R 1 0$    AQ     A-@P 80SP0P`2PP 0oTP 0h`Q db0`0tP [xP VpP QAM8'8rPU8>C- @PM|T pe`0S40$ 0 1  0$ RЍd0Y | 2M lP HQ 8  ``0S0` 00@4@@A-pXPQ0P` AT \Q ` Rh `PU0 X  AT  R- 0 \ 0$ 0 4D\\\\\\ @ @-BP P< Tpp@0,0Spp@/r@O-0M@DP00(Z pD`3S0 $0R  ЍOT( 0R$E) $0R*PU 0S000000C07UZ0 3[ 3ⴼ 0ᓉ(0 03/0P   "  XP(P 0 SD00 03/$ry 00 0$'(ep@-`_OP +`Up000/A-P00S A/@`pD44Pl00S0 0S `0S 0 03/0S ϖoO-0D@P 0`S\ po0/00pfs ` s Y s  zS 0 r Z I D0OP WD03S00S 3/Dq3@033 @/O-@$MD03S `$Ѝ3P@  00S1DPc`/ßXQ. V00 S$ 0 02 0000@0?Pp D,`b (`Ds3/`P 0 `V` D 0V:` D& p@0S  (  Pn` p@0S  , PU`$0V:5@050 0S `%?( 0 03/00` p{cDpܠsc 0V:`j0ctR00SF]?oD 23=!2`00o$卮7`c$@$Ec@@G-Dp`P $J@P(Gb520 0,P00 zGA-D`P/@P(pAF5 2yAD0%/D0/D(/D(/D0\/D3//D0/D0/A-P?70`D20@2bRQ R    v `:3 Dp $Dp(r0 /(33$l$@dC-DP@(`mv < G1X`01(p⸕01e01003& D`(021垟 2|1|!2x1202D0\d1`0 0 00 m2S " " 0SC0380ScV0 0 P08/ 0 fPx ЍC{d8P` P ậ Ѝ$$$$$\$$$,(e@$@A-vD@T\ 3SY 3PS\b(pV 5@ 9V 3S 80S;3S80003/pD0\rD`P  0*pD`P $0!003\ P3S  K?0D0V(eA-PuU`D@(cpccpc-00S0  S/8cO-`u\0S庫P U\0 E2#<@T `0S0 Pd Qh 0 Bh `QhpWd᧑dp`p$@p@-QuP@J0/0pG-pAu0\`V3 @ P0Z/f  DP 0Su0EHo 0\ $P (g P (bP (] 0S P O-\0$MP 0.0S 0`S 000/@/0T$$00 uP A  @\0 D2#<Q 0 @ 0 0S@p0 \D⚃#88 $ !R!  0㚃#<P \0S 03/ 00#"0 0:Pu03 2pt 1 0  0Q 070S  弫0㚃#7 R7+ 屫 0  p0  0  p(@  "  [0㚃#< 0㚃#<0S  L  B  K P#  d@ 0 0S_0( ,0R PN $v( bj@-0SC$Ѝ0㚃#0p1 pW20    0<    p ppWp0GS  hQ 0 @00 P  Pt 0㓊(7<0_0-0R@r@@@@@Rp@-@p@ kRPp`( U:,PU 0 ,0$v( bp@ 0000PC-\Mp`s@P-_`P00v\ 0S 0 CRS G0G G0G $pP 0S 噪S_\( 0a 0S^ 00CSZT5$ $p07pp 0 0&pS  W   !R00.0700v%0' 2p103 *0"60#X02pSIڤ$ W 00Q    |復WBhr$P (O P (JP (EX 0GH=0\030 0 8 0/o20"S R 01 0"000 #0X !! R0R!0GH L3\0@0 00CS R  B. 0" 0C&0$C4'0( qP$ jP0S$jP ̩$Pp 00S \Ῡs((徎 (幎 $[[( $`0,0001 0(0$00@0 05P00S  0 CRS0 <@P6 78Qd}A^DQAD W0\0  P  0QW00S 0.0-00 "PT9\Ѝ,@7@T@*@z@@)t,$@@@@ @) @A @1$H @d @ @p@-@qP0 $\00$p@Z`V 0p@-P`q@{dPPP P$P  00$0 :,⟡(pQ@-@   Q  @ @ 0S$0]S(0S/GS(0S 0SS@-  /O-M`Plq@`0PK (R,R0@0D048< p 0  ֨ 0 i P
 5R0CS S<00 0 00 S 0s!$ 0P ЍOT P R0 R 孧 4R0S S0CS  t4  VCS P$S p  44  F0t0 0S$0]S(0S @!@cmL#@B$dG$tE$H$E$,H$I$59$j!@s#@@-@ MP  0T T LgЍ H`R @ 0R0C 0`P $04$pS 0S HM0 3/#@RRG-`@P P9(ps0@00X\40X0\0,G 0G/000/000/A-`@ MP(pL0P PPASP<0S0<00S,Pv Ѝ80S <PP 0001380<0S P0<0080UUd0H 0P1 00@ L0 PGq: P00PP#T @ P PP`0( 0 1000000P0TP T0SPPP R0P0LP sLJ0L0H0H0<0PaT.TPP@cA$ `p@-P@(`000P0S @0S D0P(0,D0yp@A-`@(P0D R P0,D0a<0S0C,p<0 8X0< 3R800B<08M000+f00 0A[T0S PTTPP 0P0LP L0L0H哊H=@cC-p @R`00@ ЍvP0 0 q  0@g@-00  ЍG-@ P0SP- (`P,0'4pWDy P Pl03400@0# 000 PTP@4p峞ЍP@cO-@PP0MS: (p0-4`V,Dx)0400 @0<0X0@0\0008008#80T 0T#PP UЍ8أ4`@X`\`,mPPPTB$#@0/@-m@p@-@P{mP  $     p@zJ$@-0PQ@M 0Q 680Q 0Q 000P  0pЍ vP`P <0 0 p,07/K pUDiU@nUc##$0 0!0 00 /@cdddʀ0$R/ -0^ "G P Q H0Q -1CQ0 /@-:10/ W@ WQ@-@ :04Sh=  LPh=0h=h=9h=0h=,X$G- M`p P@o 01 0SđS: 018#(!#( 0 R R0SG 0: 0@ T Ѝ@-l0 $2@-@lT0 04-A-@`lPz1DT" l=S Nltՠ h0 $P [Gm@G8G0  h= #@Hd@-:! Q \ \ !R0100  ЍO-Mp*lPp0@000000 0 0h]040 ?P喣TP  d]Q`سծhP|T]PFmR, 0 #P8`G0#` 0 X#P 0 8#P h=0h=h=0h= 0!  Ph= 0h=>h=;"Ql0l=02$@Z00 0F2`1081 aaAaF|.@2 b04"0 ("!F0"Z0$14Ѝ8 h0"Q+ P(Ssl0 h=0h=p:txl0Q`4P\p! Q \A٢ LЍO蔢S IU 0C#pTtXx\0T,P;@Q @t0 S 0t0x0 @d=S ~@p00t0 0x0`=t0d=l=Sd < \$@$@$@Hd$@N$EcMbT$ ,%$@$@$@o$@P$@7$@@-@ 0 !PЍ: Q/@-<0DT 0 !0  !@c0@- ! 0 !7@-P@ U H :(000U J(00C0 Ѝ0HdG-P@0pS` 0S00h=0h=,2S h=0h=,2S0P #.P0C ,2 20l 00PX0PGHd$@0/C-h=@`M 8! P(!14  "R. S>4h-<0.p XS ,h-PP Q 4mU h=`   0m,Rߍ ,h-: p $`  (UߍC=x%@G-@P` XpTT-0GR8`-!d=Q?:h= F h=P<h= < h= h=0S/:!P l0 0@a0 GDP T< 030p 0S 030G?%@&@EcQY$p@-@Z1Qp+ 0 /Hd0 -  /00Q/-0 /@-ui 0 @-@niT00-A-P@`pP Vx`@P V@P @UA-PpDi,`@=00xkpP W0S  PP xX10PSSU SA@-MpPi`@,P儠 N` რT00000 0}`P 000010040 0800S 3/00S 10S$0 '0CS 0c4`8`(0S S0 ЍS PS0000010001 0C0S B1 0(0R4 `&\VV 0S 3/P8a `p0S 0R S 0Q+QeƟ0000PЍ@赟 0 SR 00SRR`Q:40078%0 0 %0  `P 0FSh@ 喜 Ѝ@y0S80 080 0 P  iЍ@00 0P D00S 0P  x0 p W00`Su 0CS|000 0P  0P  0P  0P   0P   0P  P000 0P~  Pv00Sw 0CS|00Sp 0CSH2n1 (0RjRjlmP`i M000 0PC  0P;|  0P3  x0P+  p0P#   h0P   `0P  XP 000 O0P p z@=|:70R- 0 =POPp&@r&@0&@P&@&@&@&@&@&@'@5'@U'@w'@d&@'@'@X&@'@'@@-@P p 0S$00CS (0SSPS@-M$@\ ( Ƞ,Ƞ 0EPЍ7@-0PS @ P P2 " 0  P   Ѝ0@ Ѝ0!@-`@V Pp1WT0P 00$0%`b0 P   Ѝ@ Ѝ@-@\ (8#800 PЍO-P4`0U@DHp@B 0  ЍO/@N  0IJ <00D`@0000I?o2K3H0!i00|0帐弰`PȀpP 0 0<P  ЍOa ЍcUSBCR@-@  0S   Ѝ@P t0BS00U  Ѝ@=000S 000 vP ЍS  h00 00S 0 @U U0Q 0 Ѝ@,0S hU ep0@cS`6 0$0 0CS000000[00U R0 04  \[04]8^<SU0[025S0^0 B0A@ 840_ C <#$` #(#p@-0@0P0b10SZU - U p00 00P00p000p@- MPd0`@00@00 00`PP,00$ 0@`cQ Ѝp訤>.@0!@-@D~00@-$M`tPt0p<0L0@00@0p8 000` dPdP( 0@pP5Q$Ѝ-@Tv$p!P/p@-Ph@N1 01  hp@Wp@-P@T0SpPT0`pp@s@-@P`TЍp@00S000 DPЍpp@-0@( AR P0(00(0C40(pp00@-M@P0}P Ѝ000  00  P05P0@-M@PdP Ѝ000  00  P0P@-p0@ R 0 0>0LP Ѝ ,0RP 0S 4.@!@-P`@)0P  0 00,     `0Ѝp@A-p@` P %(@ p@P ({ pW< &("(A-`@pPP 0  00@@ 0 % (`@P (E`V<Ѝ@&s@-P@`* |D0  R= 080#80C?o2S  cD03  Y R@0 D0  R= 080#80S0S [m@P @0  0L0 0nЍp@V p@-@ PKPp PU`t刔@0~$  & ~@0  { p@ɟ/@'G-`RMp`@⃗Q ᆗ W00H000(00 ,0L0d0TH ` @ $ P0P T HЍ  Pm0 00>bE0@080 S 00S 10S 20S$ (0P   0 SR0 R2R1M`P l #h#YN_LՓ!8X@9`0 /@o0@J0@0@A-pPj`@P00P `4VGP  'H #   @-7 @  @G-@(`0P00 0SH L2H0L2G ЍGBT pTL2H@0L2/z  P @TЍ hP0 #  Q0"Z-.R0W30B00@p P/O-peMP^@囕6` 9 0(00,00 0$02P @001 00 0P0@0@``  $0 PX,,0P P 0 S,010,0`00SP ` E Y00S 1`P eߍO葕c0S 00S! 10S 10STP@ 0 Q0S0  S`S1  f 0$Pᡕ*0804 9`]=0 |Yoeߍ P 8}P0@0@0@>1@S1@1@f1@1@1@1@1@@-@@0`A( @0CR@Pp0@>@0 (0 (0` Ѝ@-1@00  4P  0S$@oЍ0@@-Pp@@0` T@D T h"0 0 0 h Ѝ@+000 F Ѝ @-8@0,00Q #^  P/0@-M@PuP Ѝ000  00  P0-Pp@-0P( 0CR@00(0 0(0 C40pp@-000 P  Ѝ<2@@-@8 P@0  0 P \u Ѝ@H2@p@-P`h嚀o@P 0 0 0 i 0$ k0/ 0$  0$ m0/ 0$  0$ 0/ 0$ hp@胀@-p@PT` 0$ R00@DR0S hZ0 0 0 h Ѝ@c00 Ѝ@-0   Ѝ@@@-P`\P@吓+p x. hP  H Ѝ@Փ0(00,00 0$0<q P`@p00 SPP 0 Ѝ@輓p0S8  =P 4\廐0 | Ѝ@0P \  0 SR0 R2R1PZ2@\2@`2@2@2@2@s@-`@PD P (0  0` P Ѝp@@-@ `@p@-Pg`@ "P00P `FaVP  ` $ # " pO-P@GpP0 HL2H0L200Y HO SHbVL2H0L2p:!H00H0 dP+!H0[0H0 00 `V0 0 IP lZ@ -001 00 5P XZ@     GP DZHˎ   ?P0P q  0 SR0 R2R1`~_00H000 `P K8%]W0 0X00v0\ D ЍG3@3@3@F@ G@aC@F@C@|F@F@F@F@G@O-`Mp@5P005PP HL2H0L2;%  % ЍO505HXWP    ((R  cP\  \Z   PXL2H0L25 0500\008 #8d%@-@M`pT DP00000R !X0<BP h-}0 0 0 hЍ@6}000RЍP/@-000 P  ЍtG@p@-P0( R@0(;Pp0< `G<pp\@-@h|0 0 0 h@|s@-@P`MTЍp@ D0 4  000ЍpC-(p@`CPP W G ЍW@000000  @0PP0P0W0S@  G@- @0@PЍ@-0@ 0 0@PЍp@-PQ`00R@ R 0@BT@ l0R X\ 0+P00p QhG@7G@BF@-0 0 0uЍ@-  0kЍ@-0 0 0aЍp@-@PpXL _Pp$z <PUp@7.'G-pb MpXP@T  000(00 ,0<p P@ $ 00P Hፏ Ѝ PP m 0 0000PF0@0`S2P0S 00S 10S 20Sc0P    R 0S0 ĵ1 ĥPR 0S2 ĵc0.080 P 0KG@lH@RH@~H@A-Pn@pHP00P `5VTL ,   &/.p@-PQ@T T |0@DT@ T0T vWD 0BPpQmG@7H@BFG-p0@00PKPHzrPL2 0HL2P ЍGbV0L2V H XP  `P L2HP0L2? 1  Y!  00 `Ѝ&*P/@-0$00 uP  ЍH@G-@00`P@(p 0h 0&hPS@6Oo0XB%XA  BWpS  `P&d%T`P 0 ( `T 0    @-( PO:W0WEc@-P@`pP  0@0@DF  0p`@ Ѝs@-P`@P0@ D0FI T  "@@ @ AOCO R= 080#8S S S 0D P 4Ѝp@4 @}LЍpI@A-p`@4X@@P0 P@0 @00`0  @VЍ! C-p@MP`V4Y@@0 @j0 0 0c0 h@\Y Tۋ@Ѝ`Foo0b0@  R`V00 I@@- 40$a S00@60 PS!P `0P% 40 PPS 00 s 0P0 pSc  0P0 @S Ѝ@QEc"@-P@x@-@hHy0 0 0 h@RyO-M@ pP` @` ( RЍO 0@ BD0P40#0 @R03`1:0D00`B @0?VPЍj& R000Ƞ40# 0^ @@R::P ,ˠ 0 0 Q0  Q0`B @D@0C-`MPD0@00L0P   T_PP HފЍ0H00&PL2 0L2H\000 0 AbVp0L2pV HGU000000 * 3^P L2H0L2000i00Q - 2W0A00`Pp I@O-`K,MpTPⷋR U &000 (00` P,0 $ P - H,Ѝ0 0$0D0 @0 tPm~@0p< 0 0S;9@00C2@0S<K000 P^L0?SSK0?SP4|@0@p pT0 p0 <00P010 p봡9Z3 9 p X000P    0B?o 2 00S0@^00S 10S1R00S2R5p4 00pB0 S-  10p20 S  0p"0 S@  v10p d``0 p L0 *)@ aZpl0 0 )@ Q 0 p0 p)@Cp0 p 9H0 p 00 \p  '0p ,8000 PI ӊER00܅ p0 pS꤅ 0p0 S p \<00 Sy 0p~0 S@i <0pZRp Ĕ 0p嶡e0 SP 0 x 0pT 0 00S>  40pC0 S@.   0p30 S XA40 |0 4w40 14 0l0 4g&B 0 4p( `40pS+0   T0 p< KH0 p B0 p(0p  300 0 \  (H0pp  $02 p0Sq0  0p1 0Sl0 Pp1:040 $P @垉011pW0H#40H40 0p@0 0 040J0@0 ;0 2@0 10  @0 <00wH  hIP \`kJ@ J@  H@J@EcVUUU"`J@`J@ U0J@@-Pp@ P㰑@`800`Y0 H0 `I0 ` J0 E`@0 !nt40 0 0 < <  K"40 0 0 < < @0 00 !;@00 ?  ?f?P P Ѝ0 4J T@0*@ 1L  >;5@0:@005@0:a.*aUP/@-000 P  Ѝ4K@0@-MP@hPX0 00 A1#P  P 0 Ѝ0RK@G-P` C@P 0   pW@-@ht0 0 0 h@tG-P`@ pPxx T0l!将ЍG0 $0( ?( (!00@007c *0J8#8 S 0C 0S90Q"' Q/o"3 QRA000@ P0@  0*   |@0 0S8#8@TPЍRB0 0?rK@@-@P @&A-Pp0(`0CV ,@  @00Veڰ!04Ѝ1V04@00T@3 S0!H00 00$#$S  ,!S S A/o,0"<,& R!0%0P 00 0($(̠ ((   $($L @0 0 07R5 9 P  0 0@ņņ3@ @K@p@-MP@`#PP0 00 `A1P P 0B⬅Ѝp@L@C-p@``PIPE$     0 PP    0PH  oP Ѝ$[X (L@@-@@  `p0PP 0S SL0  Ѝ@ ЍO-@p@pP *p&iI1 @=P` B"<`@0  QV Ѝ!@I; 0@1`P BDXBL@@-@@@ @Ѝ0 P@oO-0` 0?   `P `3Y 0 p ` pW 0 0S  S  t+p) i" b ^ 0?   `P 0S  P $GF`&8 $& & 08`b  0\ A0  >0 20(0 PJ80G9 0: 0; 0< 0= 0< 80?9 0: 0; 0< 0= 04 eL@gL@lL@L@L@M@3M@NM@UL@]L@aM@C-@4`Y @P0 @pP VBA⚂ @ Ѝx0#-5  0 @P 0 <@RBA} Ik("(}M@A-4X@ p0 Pz`P [BA_Ѝ I\0#-5  0 `]P  WBAB<M@p@-@AP*A jA#@< ?( A]AA p@U?p@-@j@0P``` 1 ++U **p@ <@-00Q 6 0Q ui p@-@GPOPp@00SD0  R= 080#8S0!23 $3Pp@0# 0 0SD0  R= 080#80C?o2S+ *+D0V ` [P R@  . 0 0S0  S(  p@CH@p@-@20 00 P4 T8 G, FQ.pO-@PUM`pPPhB/H6:@ 2:@0㰀`B_HPPS \L20L2\H|XH`@0  j fp  a W0!$005P!aB!$  $ Lp` ,F0 B (>0!0$0PT `!]BA ,Uߍ` 041H0 0b[V4 8!0H PHpWM@P/@-0$00 7P  ЍM@p@-Ph@kn1 01  hp@tns@-`P@0   Č \@D\0 Ѝp@ L(00"(tЍpp@-0@( ARP0( ;R< b%9< B4 0ppp@-P@Pp@0pD0  R= 080#8Spp@tA-@`pPP 0  0PpP<@P  8ЍG-` R MpSJ@7ҁ Ձ 000(00 ,0< ` @ $ 00P Hp Ѝ P m  000$E00d0@0剿03200 S 00S 10S 20SE v0P    R 0S0 ĵ1 ĥR 0S2 ĵ0208 0b P,@000,N@N@N@N@07@-@P0P Ѝ00 BPs@-`@P P  =  0` P }Ѝpp@-@PPp   _Pp >PUp@9'@-@P`pP 0P0 ЍU  @    0  00@-@pP``P =  0p` Ѝs@-`@B 0P L0 a qZ0  iP% N ]F U> M6 FU  PЍp( PP @-@P`pT@  @ $0  p     ЍC-@PPs@0     ЍCP HL2H0L2 0 009Hb pV L2H0L2 0  *= > SY  C 00 `V  QP L2H0L2   Ѝ$0 0!0 00 /@cddd-0 ,0/-0\ /@-00l@ 4/Ѝ@-0 4@4/-0d /A-Pp@`T d08/< S   S Co    / 0 /c0~  0~  $@- ? 5̺cp@-t0P#0\?50@ 0 0$1(10  000 pp@̺chp@- T?P@4T1S `GP 0 p@0/p̺chp@- T?P@4T1S `aGP 0 p@ 0/p̺chp@- T?P@4T1S `CGP 0 p@40/p̺cA-(0P#0?4T1S@%GP0/``Phx`F $a0tp000-191910919!03/0 Q$1UP!`0 !6/$10C$1 10 1A#̺c@-@8@e@-@ P`  F80U C0VH0{ЍpO@0110   Ҏ@-<0DT 0 !x0  !@c0@- !i 0 !G-H1@pT`(A- $0S)h0L3/# h03/h0P03/00S "YZ 0 00++R4S0000 1 PtPh0L\3/ PUl0  83/00 (P05/ЍGcTdcXmdIA-@p`h P40000p`h0$0Pl00L p0A"Ip$$$DO@p@-@P0d %S 050pp@-@`P0d &S 0U60pU 0h00l00p0p J|$ $4$O@ B/o P" RA-@pP* @& --P_P`P 0 84?34?00??C S0cVS@@@-@l0D 3/ l003/h0D3/Ph003/8-|M 0V|Ѝp@-D1@S@00tP919!03/03/D1SEt0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/t 0\` 6/t0\` 6/t0\` 6/t0\` 6/t0\` 6/0p091D1S91P0 0CS910919!03/610616!0p@/A-P`*E0pH@@ CP1S T!R 3/0T10@ 0 0 0I`DP 0 A'0APP P  0 4~ؾpTdXmdO@ 60D31Q0@   D91/p@-@x`tP03/D1 0CSp03/ 0 3/p@d^`V 03/Pp@-@tPD!0R@  3/D1S 03/0 03/=!03/0  03/=!0 3/D1Se;11S/6!Q0061210/-!R $!$10(!21//0| 00Q  Q  BQ6!0 210/-!R $!$10(!21/6! 6!6!061 ltG-@ |?p(,0PP` T1S`ЍwCP  0$` 06/p` 0  rp`ܑ TE 1TV 1T0CT 1 C T 1?A3c0?̺c\t]t@{t ZeO@1@Xt@1(@jt@mt1(Mb?1S/,!t       000 l0/p@-@P,10,1@1  ` `0d 0 `0d 0D!@0 0910BRS91091R91@09109!t3/P1Sp3/0T1pp@- ?`/P0@ @003/T1S oBP 0@0Sp̺cG-`0p#0?/T1S@MBP D(pZ  SPP⨏ZȀ F0P * 61p061 Y ( A6p61P061 $0( S S00@ 0990`1S@1Sp8@/80OτB 003A1+ \R? 6!@  6! i R6!@ =!@!051( `1RgS61>!0gD!0ETPR;1v011,1 ,10,1,1 ,10,1D!0R3003/08v/!Rs /1AoR6!=!@ 6!6!6!  S61>!061$0 0!1B8̺ccO-0 pLM?.@P`LЍ0  1S 8AP P0 `pP 0nP0 n0`@0Sp̠L1S 3/P omx`>0T1x`0d 0h0S  В0 ` dQShP0 h00&091@1 91091D1S91P0 0CS91091t9! 03/0 3/3V? k/ ! 0@=K,!D0t0 D0@00$ )$ $ ($ $06$00`1C|1810<1l1D11 1181 01,10,1 `P0  03/`P3 0@00S-*eSw Rh00SZ=9 R = ?A3c2#d S 0"#!0 "#1R 3~?4hm M̺cO@MbZeTd+cEcDBp@-0 P"6 0?-T1Sp@,@P ?1S YU,1 ,10 Vp ,10,1S,1 ,10,10̺cp@-@P X@peO-T!R ?P 1!PR 1! A(0q 01pBR0  R<" 0"  @V`0@S @DWb A!  BR!V:,!K ,! ,!9! 9!D!R:9! 9!90@`FSAV    R<1! 0 03/p,! ,! ,!0@`S @D` BR9!@t4/,! ,! ,! 0!R p 0q3a 4A4qA!@ 0 2/@!  /! /! .!R .! $   h0A ЍO ЍcEc$0S/&O-T1S @?P tPI03/0`S E ЍD1 SPf03/c8!03/03/`D1 S 0S @0V 3/1q0 R 03/ Q  $ P\ˠˠ \ Q  D!R0 ,!Le `V03/03/`j0Sf0S`Vu3/0A  3/8!0 3/;!03/ < @010;0a>03/ 0p3/ 03/03/P0,,0 3/03/0P 01 03/1Sa S`0 3/1@S` 03/q QdQ@TdXmdQ@' O@ %P@Q@Q@c$$ $\$t$O@Q@`%Q@P@P@Q@Q@Q@Q@HQ@+Q@?Q@P@P@xP@P@P@P@P@Q@%0@-@PM0  0 00 Ѝ0p@-HP0S p`@P 0ST00pTd@-:0 0 t3/p@-:@tP 03/03/p@-9@]G-p@ `APCQR I U010! A-P@` 0$ pE\:Wn X0 A\ ^G- P$`(p,00 N\:6n AY Y@0 G V @ AT/C-@P@@0$M,&c 0`_ЍlcP p@-PH0 & @4& P t1  0p@蛉plc@-@xPt`$0M\p&P t1 0040 000p`00ᯉЍlcG-p0P 6 0`0q&x0@U  Z40 0 0JЍ0 00:/p lcvd@-@( $0$$"6 0E&@lc@-@`Pp<<0$M(1&(0 00Ѝlc@-@dP`p$0MH`&P t1 (0 00᠋Ѝlc0@-P$0M 0 0 Ѝ0%(%@-(0 0600Ѝ%(%@-@8 1R0@-80( 4@"6 0 %$p@lcA-pP`@8^ T 0pA/@-p8@⋒s@-P`i8AT 0( `4/@P  nЍpvdR@@-o/@-p@-F8@R_?t1nS#P@RoıT!t1Q< S 13/PPT10T1S n#P\R@A-@pQ (MR`㘱Sgt1 ! R0ót1 p^X"\@1]S8Ì1\1S `1S X1SEB9p0 # *6p0 #**6p0@ #*5p0 3 #?0\!#b`1?%p1#X5X1%  /0#!0$+4l1t1h!@040.7@ /0#!  0{J E!1 0`10\10X1nQ 1Q nQ nnn8 % EP"1(0`1!,0\100X1401L01P0S@PS@|S@p@-@R_Dž~T1!0CST1STgᳰp@p@謰0S$000S 0S/0 d=;d=/0S0 d=;Ód=//Q9 )R4 -09/00@-DM000@P,00AP@(0 $000$  @<0C P '1jDЍ0S@A-@PT=X `S8 0 `p\#87/T=X \S8`p 8 #87/pT-X=\R 8 08/  pW0 t:m9<l=D=Su  50 ,03p U@,U@ 0!< 04 0 (   !/@cdddO-`@P0ȠY p3 շ LPh ߖP U v"0 0 @ T0 ЍVU@\ P/0 !8 00 (  , !/@cdddp@-@P T^9S 9S 404 0@a 0 (p@,%EcgfffL1%D=S/p@-@=P0C==0CS=>3;3p@hCA-=PS`p @PVD=S@ 0-s '=@S蠆A-@p !P`P  0P Q- 0T  \jЍ0A S  ,j 0  U@U@@-@00PPЍ7@-P@@=S 0 1 00009Sd=000 PH=SQ  ^0d 9S 0Q Q   Ѝ0  DS@G-0Q@pP0MQ 0ЍQ z 4=3/|7S ( h70?0?h70?|7S 0 0@a 0 (d |7S H/ox"΍"0 \%  R # 7501^q .5BU@EcgfffL1%A@-`M MP@P#EP0U0C0S0ۍ Ѝ S;U03Qd + Q  QG @=Sa2Q 0Q*$0CQ 0Q-0S00?600p2QY 0Q XP2QG 0Q *0CQ@=S d= .6M04 2QF 0CQ0Q 5>8#8STp 40SSp E /  ("( E #@=S d=  0EIP6M0000@=S d= N@=S d=N0@=S d= N09S >S$[0SW*L  S* 0C#1L 00W4H0QN0 pN0N0%*:iFA-όp` 0P@sP 0 `kP Ѝ!@-0  ЍA-`P0@p8=3/h7 T 5h72A9#9'@s@-HMPT0 S* S S@@S@@n R 3 t0Ue X@Ѝp@ S S@ S@S@@@ЍpU@O-@dM@=S D=Sd?`< $0W=0=S >S3;3dЍ9S9 YU 0S990090C9R0 05 p 0 P 4 0 03/039Sb.030@]  *aP303TW ?9S{P巪U tPU 0S000000C0奪s R0(P 0 S30 03/MpP[2 0 C-t ̛PP#\"(0傿)0Rd-! "G\ʔG 0 D9Sㆍ P0S ` P 0!:> *00! 820a08/ᠾ(0"0D100 0>00KC19- S) 101/0< 20F(0 501=0$0P( `!0 g/d=  P 0 H00YXZ Z!0  b 0   0 PD10=   =0C== S-,0@>0>p(e)V@p@-0=@S 3/`D]U'o PP `V|fpT=X \S2 d 0``6/T=X \S4 h ``(06/ P NJV@C-CdMpL 3` <3`0 dЍP RU`@ D80D?o2P0S P?ᙄ  1V00P`@UHP/DH3@<30G-MMpG@ l$-PPnW`T$A0Vk  V7* V  V @-R u$VD ? V Vo  V@=S0W GS0N0A Sb*$AS0N08 S06M02 AS0N0,d#VP(  V * BV @ RVd=; #VT  BVd= 1A  `10 ҥ0 ۍЍ \ R\P@-R 6  -?1 P Pd= ,S0N0 S0N0 VAS06M00 PwP 0C. P 0SP0@-:R s.0?T@=S 9S H=S S S!v0>0P30 G00PP00G G0@=S2Pw 9S#Ps 0P Pl P9S9  09b sPP [@ VF x9i*F%?- S/@-@pP`,M 5 @0"0 G,ЍC-3@@DM >  H=S  CR})9 N L)"" FPP> ?PP@ [0 l U CR0@PU0@0 `P3@ > Ud=;d=DЍSP-1R >  =H=  S9S PPn PP`0 S 30 Q ;S h`T{0 PP` V@pP * !(#@$ 0d- /p7/@=S/D=S/QG-@@=S`떟p  43/=S-D]UT=X \S2 0d `:/> AP=0 .:^^XW3XR=3 ,=3/@]G  O-@P@MX,=3/`P0@= l,`>?oH-2R0S 9l&89d=0d=9S00`P  ?;< ?5989H-R%9" ;Sږo%#}> p ;IV("( ;t0} 0%/0 D9  )%( ~  d=   d=  d=6   d=  :S0?ӥ=x D9S H=S)> P @H=S (>$CN0\  ; 9S 3   9 : 00 0======H=St3X| >0 0Q. 3;@030)9R332  T=X \S2 d `P05/X 9S HQ(  9S9xR:@+R S  - L.@Q YUH=S 0 `Ѝ  H=S ?  00C0S00[2ӕ Q1ڮ۾=-  P  Pib `DebT-X \R0 ` 003/ j1YPb<`T-X \R" D 003/T=X \S4 0h `9/= [0=PS 0CS>02t_p@>S 0CS>02p@TH=S >S V@C-PpMe*P@ `@P NЍ1Y0CYD1Ye 1Y 9 - 09 |94P@4 =#@=S M\1Y7 1Y . y@P#@= S7 9S    @y S 4 ᶯ4P@3@ @U0 @0 0XW@P4P@3@ UH=S@2iii9iO-@=@SdM )P 3@  T=X S4 h `;\dЍO/0 000T-X=\R0 ` 0P5/P   T-X=\R @ 0`6/<00  0JP L0 `  T-X=`R" D 0p\7/=-0C==0=1 c k& T-X R$ H 00\3/00` (0P㖯) 0X*7B`= 0.`3 ;3B& T-X R$ H 00\3/<0 0` 0 P▯= 0)B`= 0.73 ;3 T-X=\R  0P5/` 0p`1,)S { S  BS T=X \S=4 8h `P#85/= l3  d=0S $P #0=00 S0"( 0=T=X S2 0d ` 2 9S8t$8W9Sp02"'`P' W&0 .+0< p0pTp(p320@@00` P! (Tǟ:|"!($΃.$ *00! " ( (.60 p07/0)0RSК 1P 3 "*8S00C8D4 ᶋL 0ScX(\L9_ 8P 0/⻢)` V%0 c ~ pQp  -0H(མ=[8%)0p_= -JZ%8c_=0= 0F&>=~)0 S$IBbῼPp H_W Y\ U\ Q\ T⼄ͫ lH\V\C\XA\ )W n`` pQ 0 /fp0G'བྷ=[#)08B _~= -JZh#B^=0= ᜊ0H(>=nf S0 0 042<#_0CSy0d=0d=9S9Sm `43/acd=0d=_H=S >Sh"PS 0>P9SMd=09`S 4Q`PEUP#8뎄 U >^pP>PJ 0$ 0 0$ pJ&00 02` S08#82́ 000H-Q0R RH RI xp^  0> hP``:g>  L0>YP 1>#F&V   01  ?& )22?2 ?"LP0C.>2>2?5?# R #.)D2V@0W@W@(eW@c8dW@W@W@W@W@X@X@S@X@O- @ $M:P( [ $Ѝ] ⫠&VT=`X S2 d `P0\5/T=X \S4 h `Pp85/0D=0P0D=U_}0 4[P  /PXB  f)Xw Z0 00 =&Z0HeGQ R)Z0SH=10S"lZ0H=0 000P0 0d1!,2# 0L=Z( 0(=v pZ0H=0dp0 0 1!ᤆ2# 0H-P=R0&SS+ 00x0  P0@S0.S0-S0 S0H=0 00C 0 B2# 0 B2# 0 B2# 0 B0P=%H=S% %S0B 7ZH=嬥嬕S L}d\:9"a0@gh!ZPd:9ȏ"a@h 0$Z% ( )+4),|04p@04\r0404043099!= 0 _P ]:0㠠 0I10S S2 ԊO베YH08 >PG0  SBQQ Q"< 1?0:H=S0 d=  0 !P0 d0מ0d= d-H-R' R RB d-Pt#Qb?d= d#Qژ0d=T3)Q8<9 9<9< (S:Se\/d-P-R j>0d=2R 9;998<92R 9<9<  : (0 P0S909 0 0T 0 Pe 0SbڴyX '> 2 t=2(x=6=⾀ᰀOᵙp44=4!8=141:1:141=1=1=1 =FR@p1X 0>9/  ,>pL1a  8#>p0T8 p@-@#P3 3@0 X-0\`PT-R2 d 5/T=X \S`P4 h 05/pR2 d 05/T-X=\R0 ` 0P5/ T=X \S`P02 d 5/p( /,4S //0l#R" /04S//G-@0Rbi?0ഐ(0 :/03\"0:/(0 :/0/ 00\"0:/\#0 :/#)4\:/(0 8/03"\08/0/ 08#8R0003ЍA-B肐P`,0 3/,0 3/,0 3/p,0 3/tpO-P8s@0S䢐Mhx&h'x0G`+0 L`F HH2$43/02002WT`pm!: d0@000t%r%%\s%t%v%%D%\@@-@4S@/G-3PA@,p0 <300 U SHebVH坛3<3ե> - 2X>00`V  *P 3<300 UHGzO-pPBbM?spHs 0(:/03"0\:/ 0(9/23H0\p$#7/0\p#7/0\p#7/13\p# 07/0\p #7/,3S 0\p#7/\p^3"׿7/\p0"7/6>\p" 0`37/0\p(#7/0\p#7/pp0 (9/03"A0\:/p(p0 7/p0 0\00 p:/W +pŸ0 \p/0 S j]@Ȉ%x%$%H%x%]@]@Ț%%% %p@-@P):pp@-@4P P]p@-DA-4@@000c"`\p0P7/2",p7/$  #002#,p7/ @&& 0\"A/p@-4@@000S"P\`06/"\`06/2#,`6/l20  R= 080#8S  ?00#\`6/2#,`6/l2#0@000\`6/"\`06/0\"p@/A-@0P03 \P05/2 ,P5/2P,` 6/ `OM P@U! HM P03\` &N6/0 `xp0 `)VAHH*M$P@ 4$M0P, M#P^@2^@C^@hq%Lq%h^@I^@R^@#_^@O-P \h ( ` ,@,4/ R@ WdTX0 0 ,P5/0D(0@0O-p\h@R`C$x102c000 0Z PPP Ѝ00$10P t0S 3/0 \$8/ X ,0,3/" t0S 3/0 \$9/ W ,0,3/U d0@ -PU PEcx^@\0O-0Q05ph` @^ |0 3/}W0 ,9/p +40\89/  hP l0 [ $0\p 7/0 ,P,5/t0S  3/0 \$9/ W0 ,,9/t0S  3/0 $\;/ nW ,0,3/H XʠYY Yp0 PPYp0 P t0S  3/0\ $9/0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/0P ,9/PP t0S  3/0\ $9/0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/P0\ 9/0 ,9/0P ,9/PX ЍX;6 t0S  3/_0 2$\ 0 ص%!@-@R0Q !@\0@00A-`AP@0S P 0q@P Pt#Pp@-P@%$p@p@-0`@hPP 0 \00 ,@,4/p*P 0 0 0 0h0 03/P 00 0pp@-@P+p@0,%G-P 10!Up0 0$C! $C1`(,+T 0 S0 (ЍG0  PЍ#PP  0 P  0$PUPEcMbu_@O-@MphPQ+lA#`P ߍOJ+qP$ \0W%p,,4,$0"Z:@<0 R80S@p<0$Rt'+%R80SOʅߍ"80S<0Qt0S 3/0 \p$7/ R0 ,p,7/p<00St0S 3/0 \$9/ Q0 ,,9/<0 R@ 8 R4S@0"'0r0S*<00  *<0S( 0 'P *0"g'* < 'P *<00 Rp    *`mt0S 3/_02 \$0:/ QX0\ :/0\ :/0 ,:/XP<000 ,:/P@ 0p<00 \0(0 2 \$C\#<;/. 0040p1 P3 3 p +4 0\89/3,   $r -0P00 pP* 00 0400Ba 0j3<3$Ѝ 4à@  P ^8pP pP#8 OMbEc%A-P\ 0@ph`t0S 3/_02$\p 07/(0\ A/p@-@`' 00 0'PP 0S  0  0` $q08 v$U P 0,! p@w!_@\ A-@P0hp`T T0  ,0A/0 0 8/@D@4S/-2 \#10/@-2 ,@4/p@-P@2 ,`6/”0P\0p@ /@-P`p@@$0PL p削 Ѝ_@@-P`p@@$0PL pߊ Ѝ_@p@-@P0 \`6/2N 0 \`6/)NU0\ p@/PG-p@d尐PV㬀ʀ 0! $ 0    !&∉ 0!d!0    !0G>@cdddEc7@-@ &^k0202020 DR2|0O@4S0000  2S " U" Ѝ0@u%%%%Lq%hq%@-@  &@謈@-&Pp@-@P&:2020p@-@4@SS& 0@Ec@-@&@9/@-00  Ѝ_@@-@ 8Đ<0\ @/@- 84< ,@4/@-00 哉 Ѝ_@G-p@d尐PV㬀ʀ 0! $ 0    !&Lj 0!d!0    !0G}@cdddEc7@-@&^ 0202x02p0p DR2h0厛0000 P2S " ᙛ" Ѝ0@蹛%%8%4%Lq%hq%@-@M &@@-&TPp@-@P&~2020p@-@&C 0@&Ec@-@*&@聈/p@-@DP0`,0Sp$=//p@-@Q P` 00T0 0 00DPSʁ@p0C0Q/ P /P  /C-.04@5 01D`00pP$M ՀP/0. $4"4H#8#8SA # SS $#0CS0S1 #S- CS" BS(  S @$@墂$Ѝ S @q"S ʤ"S ST00 S x"S(T(@#h 4T90{@TT D" 8C8Sm  SF  BSb  S  S0ST@#  S  S+  S0S T @# T@#0 Sʤ/!T 1 #S@0ST@#d 0 00S*T*@#4 >@I2,pS$Z0 $09/I2PS$@0,@<UiPh  T 0@0T00Ņ0{@0YP8tY9ƕqJ_@  `@>`@`@`@`@,`@]`@v`@`@B`@@-0 0`( "4`#/0s@-@Ph0p2(`l 6/h2 4l0Ѝp@/0P/0?0/ D00H(/0-#20$A?0R  $$D 0 QH$ /0/0 0H00S00A-0TP@0 `p 0 z(T0Q 0000A j@-#@R 2S00H^0\ @XA-@P` p 0  M0 0 0 0 AP(8S_0 A0 2O-`$MHpS00H@ H(8SZ@2W<7 0SPX 000 S0 Z0%ZZeZ P0PE000C0ӏ 00((0R0 0(8S0Y   (8S00R2(`Z 0 㿏 @0W   P @(8S W0000  jQ0 㛏0  0p0Pp0 p,p(`L0P$ЍG-D0p唨Z b@` 0X0T0X?  4XP 0  `(Z`( 0Q 000( 0Q 000(8Sf  0 `202P05 0 0(8SO0( Q0000 $Ѝ0s@-@_ 4h @0 400(`p2l6/h@0d` l6/Ѝp@-A-@0MxWe` PČ T $"d% P ʿ/BPA  BP@0Ѝ %P3 @ %P *BP PQ% ?@ PU $8UQP 40 8 0Q l$\`$0ЍAU0$8U84PLQ\ 0h0p2(` l6/0hd` l6/0h0p2(` l6/h0d`0h0p2(` l6/h00Ѝ0 D68@-0 D8@P *s@-@PЍp2S PP 0h0 (`p2l6/h 1 d`l6/ 4P  T80T8~P CT(\;0T8P  z8: 1; *;0h0 (`p2l6/h0d` l6/@( 0h0 (`p2l6/h0d` l6/ 40 4 000S  R7U|Fa@ba@ua@p@-@  40 4> 4p_ep@=~G-D0P唨Z w@p 0X0T0X?  X` h0  p(ދ`( 0Q 000( 0Q 000(8S  02`020㺋X0 ` 0 岋(8S0( Q0000 㞋0h0p2(`l 6/hlP0 d`6/$P`~Ѝ0yO-D0MP.008S .04005 XpX00p 00X`@ 04T 07 00000 %(8Sw 0`0J000 HB(0P 000(ȕ \Ġ0 000 +\0 `0.\ 0 ("2Q0 0(8Sv40(8S-0(8S$"0 ,0(@C`p0 0((<RC0A@@-S>  pBFP`;!@0Sq@P~0T*01S!! <(@ <80A0(P徒1 0p@-0DT 000?P  @-D00000 T ?P A-D0`p<0P@@BT0A#6T@1@ @V:YPOV  00(P异1 0`0`Fq~@80@~G-0T` 0 \p@` 0P h( Q0000 [(8SvsP /⥁0P 0S0 0 0  0 4 R X0<( <8T08( 880s00aR1 AG-@ស ~HhP<V P $P10CSp!p1W000$0yL0@  G%~P 1 21PEc(%D H(R/ $ yO-M0P唨Z @ 80@ S 0S S@33P0@Ѝ`P@  YT`yP@&0X 00S :"; p&pP 0Xp 0 0  B/o"   $(8S00(8PS0(8S 0 0lY Y Y 2\@ 0@0$崇P@OL}$82TP080s0S 7@W 5}<80$ذ", (88S000 4,48#8? \0 0R0  0$ S$ $0 ` S$ $0 X $0S`Pub@O-D0,MPQ `RT 0H00S00ʄ\0s 0 „((2R\0X@0X00 @0 0H00呄:~#:0<0p 00`@pQq0X 00 000(00㊄\0J (8S0(8Sp0p(8S0(8S0 020(`#20&a?0R  1$F$00 Q\0 @ 0\0`00`00 00$0 0@(8S_0( Q0000 ,,Ѝ 008$ 0cP :#:K 0 0PW\$ fZ WQJ 0$00\1 00J (8S0(8Sp0p 0(8S0(8S0 0(`0020#20&a?0R  1$F $00\0$ @ 0\00~p0 (Q ! Z0G-D0.TP@`P pP 000`pX 00 0 0 sP Olx<80a.0 PSP.PS  (X.000㘙 PP PP,D+ `pIp&"0H pPr5XV`` $+500 ,Ѝ 0 ,0p$3Pb2,2 S[0 4P/ ( Q0000 ⼂P ( Q0000 ⩂P ( oQ0000 │ PPPQ)nV <025( P 0U000E00140(8S 0 0 PY?UV⯄0(8Sr2 Q,0Dk4<P0eH$a X P81S0h0 (Pp2l5/h1dP l5/G0Pdh0 (p2l8/h dl08/z.Y\ Uh (p2l9/h1d l9/U (4h (p2l8/h dP0l5/dTzPhP (p2l8/h d0l8/d@zhP (Pp2l5/h0dP l5/ c<P Y3 VP   `h` (p2l9/h2dl2 0m 0  9/h` (pp2l7/h4 dp0l7/h` (pp2l7/h4( dp0l7/h` (pp2l7/h dp2l7/z0hp` (plp29/h d0l9/$04yb'yN@ @h ` p2l (:/h 04 dl:/h` (`p2l6/!qhdP1@ l5/,8 04<:0PhP (`p2l6/h0H d`l:6/hP (`p2l6/h8P d`l6/]yhP (Pp2l5/h0H dPl5/0 P$8HyHPU$#0 0d000hP(L(0(Pp2l5/h 4 dP1l5/0t2b@%b@b@b@b@c@(c@tc@@Lc@s@-t2S P@hP (`p2l6/h d`P0l6/hP (Pp2l5/h0dP l5/Ѝp@A-kP@hP (`p2l6/h2d`plH 06/hP (`p2l6/h4 d`0l6/hP (`p2l6/h4( d`0l6/P8S hP (Pp2l5/hP(0dPl0 5/LXUMPphpp2(`l 6/h@0 d`l6/`xhpp2(pl 7/hP0 dpl7/2wx0P8L8Ѝs@-@L8PS0L8P0h0p2(`l 6/h d`l06/2NxЍpA-@P$ otXUP M2S 0h0 (pp2l7/h2 pdPl 05/@tЍ@P/ 0\R/@-@ 0^   \R@-@0U. V? / 05Ѝ@L.c@A-PQ+ t@pT'P P `0d .\0 _@P 0t000 .Ѝ@c@c@d@hBd@ 0`( "4`#/0@-PϠ ,@ / 00@-P@M0 00000 0 0 0 0R 0R 0R  0RPU @Ѝ0$;(8,5.`d @`ߍP$0 (040,08 40<00<008 @ 0 H P 0 X00 D 040 L08 T

00L0D0<04008p@`HPn\0 P0h0DS 8 0H0 D( ,0@LDHpDD`D@P0,!B( 0'= 0 &90%$04@@ 0J04*P0&4#000#0PeU1! 0< <0  P `F@00V@0 00W`V 0  @0 4 i0<0 Ѝa+v 0P0000#000&<#00&8#00&4#0 00# 0C-P`80<@0CQp80 aX!0 P<$0 I<00S<0,@0 0`pPE<0U @00 0`pPU 0  %$- @00 

H0 0<00@-P@M  H ှ@  mЍ0O-yM00 00P0x0S0pCU0D0y 0` $00(00$0 , 0 00`0@0 000x  0F| 40F0 000E4  P 2  pXQ'0 X2P$0 E80P |2  pX=' 0dE XP(0 ,0$0` 0 0@0050 0800x  0<0| 0F00 $TP (&P P l1 > pX&0 PXڽP $EQE0 ,0#0E0(0`0$0@ 0 0000 0x  840<| 00 E P | J&PpW@@#x0S0S @Pd&D0SSU0SS Px{&yߍ@e@f@6P P /@-Pp(/g@A-@pP0SUA@0A` `FV`! 0PE@G-@P`0S 0X  P @0PEp pGWp! 0%H0ppGWp!P @@`FVO-PDM %  !  !  ! "+P%PP0#0P%PP! PP0!0#$0P 00#$, 0+<0 0"00 0#0@0+(0 0"0#,00 "`@ 0,p@,`P` @`&! @@$$p +! p p' p' , ,,0, '00#0#0#0# P(`pP!!@!P P%`#, p'p@$@ `! @$0#0#4(#0% (8,%p# p'p,$ !$@8(& @$+  4!() ,, 0,  , " " $* * 4 P< . , 0 0#!.(P%P%+0# 00$ 00#0#08000#0#0 00 ,,0#,0# 00DЍt!t1G-P@  P@@P਀` ᩐPP`pP0 `0 pQ@! P A, @.p  q)1 0` p%RPPR$BpP@P@PB! ,"0 @ @  說UUUU3333-$M  $ЍO-RM  RO R p pG pP` 1"A0 9`TT0000h`ᄡ0V,`0 0`T0 ` S@F0@ S 0`` P   YߍpV \ h@UUUUp@-8@8P`\p 1001UUUUO-R`M R. R P P& Pp"Aq  TT00 0F[`N`0   T  WЍP[Q 5h@O-EMP@PC 2 00`$00r(0 0,00 0000 0 0`pG0( 0 V000000 0 >0  >2  >2  >2   Q  Eߍ0@A S " /@ 1"à ?; 0 0  0"  0à "! 0?$0P0/O-0`hT ctPfTPnT' P%#lT% P%n'.* *nDjX%(P *hT$h*P%*bT%b*lT% P%jX%P.hT..aT%a.P%b.bT%l.lT% P% nX%!P. P".@$iD$a.@$i.lD$). @$ @$ .d. (i.f.f*. *b.*l.b*@& .**.j.# 0#i4#0#&iT%a.b4#bT%f.l4# `&lT%0#P%e8#00 !.a'b4#b.b!0# l!l.l$" !l4# ".!0# "a.b8#0 ЍG-` 0 ,Pp.p p!!!#0# "0# 0@( ,,(.  0!p0 P`,``!!#!0# "0# 0p' p',p  0p@-P`@PEUp@#! 00#0 00#0 00#0 00# 0 00#0 00#0 00#0 00#0/@ "1à ?< 0 0"  0  0"à ! 0?#0P0/O-p@`X:iObPa!e%a*ek!l,l., ,a, i)i!l!b"b$.0 " "a(" c$#c4.0#0#b8#0`4 `$"c("  b$"a4#.b8#j.0~000/c00 0/cO-@p`PDM P800,p($@ @@ @ձ008 <0,(p$@ @@ @ƱP0 P000<00,(p$@ @ @P< ⳱DЍh@J&A-xM@P`` prT00H 0X 00 000000}xЍcA-@PM TЍQ  0`P #pq P V P@TP@P 0P0 `s$0SPPPP 0g$0S(  #h@i@(i@c6i@cQi@gi@0/c @-7  @-2  @-- @--  @-(  @-#-/c-/c-/c-/c- /c-$/c-(/c-,/c-0/cO-M @0_0 00 S0 0SPq020`0 03/  003/ 0  K0C00 <,p 003/  0<3/00 \00V 0(0,0 !" 000 03/0@0 4/ 03/ 0 3/@@00p0  l02"  LP aP yg0 9s0 000  $0S !&.LEPP &> 0S !&> i&>ş 0S " &> ZP0p0 59/5 0S !%tP p5 0S !P5<< 3$ş45 0S " 5 $P0p0 49/4 0S !$P 4 0S !|4dd Lğ`4 0S " @40( P0p0 49/4 0S !#P 3 0S !3 Ǭtß3 0S " l3XP ⸬P0p0 83?9/?0 0S !? mP ?0 0S !?0 ⑬?0 0S " ?0 ℬP0tB0&.088/&.AP &>, Qn/&>hP&.00!08/!"P 1 O!1IP&.b00x!0x8/`!DP H1P0 0!01*P&.C00!08/ P 0  0 P&.$00? 0@4/? LP ?0X8 $ ?0 Pߍx@{@x}@6}@x@_x@}@ 0A-aHM0 @1P4/@ #@P @0 cƫ@ 0`00 !p7/@ 1Pp @0 qⰫ@0pp0 `X0 6/ n`P 0, ?⛫`HЍ}@/X@r@s@-X@ F @TDP\ `6/PQ 00C 0Ѝpc<- \$ \ /cG-pP'VT0PU@TЍ|`1S hTh0.R@PHT1S (  @ 04/@Pa 00 0Hdc@ @-bTHd-8  \$\ /c@-<@  \$\ @/c80 0S$00S 0///cp@-P@X)TUP0 !R@ Q@$[Tp! R! @Hdc1S G/c&00 R RP//cP P //@-<0@T00S03/P@9Ld8@@-<@ S S  㶴Ldg@@-`@S@T 03/P 400, 0(0᯴@SLd8@Ec<&`dTd@-d0S XPk>L@P<@ 8/?P@( @Yc&̠&Ldo@&@cp@-X0 QPIPP 8@r@?<F> j gSeSpcLdP P /A-`@0S RS pPU0p $0WD0P P0D00p0H0 @0@0{SPP@c&PdLdcp@-@)SP?o 2R0SU T D00CD00S   (RSps  PPdLd׎@p@-PHSD0 @T0;SpP@ 00 0Pdcp@-@$PR 0 0C 0 p@ SLd@-@R 0 0 0@SPdG-Ѐ`  FRp@0SP03/PPV0$0pPW`ͳSP p@V(0$ 00ᡳLd`dEc<&p@-\@RPU 00S  @P  Rp@Ld@TdLG-RP 0$ R\ AAR3 RA @ 2RW _2C6CR00W0P@  00e@e 00E`P 00@|DR j@`|RLPA7R@T 000@0iR< A$RPU 03/@P$01`0$0@00S $00ꠐ RX@D` `@|0 pD0S0W0T0SP`@`  W|p@@ww wTdLdcPd@-00@T P@0 Ld@/@- 0p@-P@,PVֲṲ 0]p蔍dp@-P@P0,`000<00@卲 h<@P P(0 @VPpp@,$p@胲&L&H&p@&@@@-]l 0O-`pp@DM!s0 00<0,(`$  pPz<0400 ,0H0z@  00!(` 0 $ @`pcDЍp@cp@-P<@L0,`P@00E4  V q  p@/cEc@@dP/P0z/ᔍd@-0 ,*0S s<00,Ec@- 0,Ec@-0 @  00P %P `8PP tЍp4 0PP P\P$!lꔍd%@\&/@c cQ@4/0|'RI032'Q 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-P(0@Tp0S @, cp@-@P 0T 00Q 1S  0<1i1Jp91S!!1! ef6P(0003/p@jZ, c@d@(e 0P 0CP@@t #/d @#/ N @@80P 0CP(0P #@// ̇?0S@-c. QAAL0Q Q 0 0,1&'1 0Qʐ@ΐ@ P P/  N /P PP0// p@-`%P80@Tp P @, cp@-W@U" (R  BR(13/4WU PEU4WiD73/4W(8S 0CS(8 88 3/(8P8P 0"pA-wn0@S!P !R d"00ЍQD@2厏1p0! R U T 0 S1S !0h  REVv|@WpS 堁Q 6Vv1Wp舄U} UyLxP qG PLM0 S'0 Vv|Wp'e 0! R U!VV0 S|Q0!V&R! 1?0|8|Q| @A@@ʐ@@C-@p/X2 0iP>05/cw^ E0o`000S P0? p /00p W`0S1001^n80 Sd001c00N8fN0S00d0Q00@Sg/1!p11S4H\!01\(  1!66- R    R    R   "-" R   .R 0  S0@008Sh0 S~ 01 1S  0310@0xj.1S(01 ЍCb(e@ʐ@, c0 cdؑ@X&0.R  "-" R   wP/P/////|0R 0\ R\ !L/P x7S0S/ᐐ@@O-`@u_Pw>0S4 0!. px0Sl& @TP P W $ 00 p4 cƒ@@@Ւ@p@-`@%PP0p@ .00007wnS000q 20|7S S S0< 0 0CS0|7Sx8D!0 0<00;080p0808070B;0;@@O-@0`pTM 0<^0 aa qw>0S9+ 3 a0 ap7  0 wap7  0 oap7  0 fap7 0 ^aY YpPP0S] (RDnaX 2 0PT TЍ\I0X0 S0   0P 0p &ap7  0 ap7  0 ap7  0  ap7 0 a0 0RʻP 70A  `P( 0 S0 `` `p7  0 `p7  0 `p7  0 `p7 0 `pm@@B00 S   P 01А/᠐@G-P@PX"B-\8 Q2 +Q  Q/ QwⴀXa` 0 S&100SP6 P Q$u?0XPpQ0Q Q 00 P PWP2q?0^ PP00p |p  ppWQX" 0S `P48S|74XS h0|w7h78 TI:J4`Vh78h7|@J0000 000/s@-@d ^1 R S00#0 0S0:1D!0CR 0 D10D1! 0!0 0 0 00 0%00n\0D1S 0S00 000 R 0D10CD1! 0  R0Ѝp0!0 0  @@΀\Q: / AA!  ////p@-@8 MQn1P 00#!" 0 0000 `0V :3/P 1 p 0L 10 18003/@ ቿ808003/000<0 ЍpH@S@@G-@pl0l`^:d0媎`8`:/@PsEsEᾓEU,0:(0:$0: 0::@؍d &x&p&&0S4 ( QQ  H/ǔ@؍d0S< bA0!RR    4A!/C@؍dP0P//؍dQG-@p ڐ1 0  $10$1Ѝt`PXQ1L(10(1<1P1 .0 Y ,X  p7岠`7 1  0 `W p71 ! `80S0S% `03/P1 H!A0 베,10,1W11!1P10o0 8003/ 0`R ᤚ0 9/P  120!S 0! t I0v W㲠`0`4!S 4!j 4 W0f c0000h@؍dH@i@_@p@-@P:3/:3/p@-@:3/:@/G-8p(MW$1@P` ᴐᲠS0 0#!"! 0 03/P1 0 00R0000 101(Ѝ \0R 1 <  101 :(ЍG/H@@@C-`@ 1RP~P1US^1 (S0 0x1 000P Ѝ08 R<u 0 RppSh7p0pp 3SH0L RP00H0 00@Q$@0 00T 0(0 0(00S*Du@P  # 0 3/P u@ꤙ@@ؗ@C-Pp(0`S!R$  X 0@ Aq0 0R@@@N@80S*uPU 00 0@ Ѝ (0 S*!R ,  $03/P@@/A-`P@HM pt&40%SV   0EP0D00`0 0(0 0 00000 0d0HЍV 0 0>0?P0A-<0P 0S`Mw04@0S00Qh0000@04@0  # 3  4  4 "$  <@ p! !(``F@#j0 p ?*P`Ѝp@@-0<S !  0 b Ѝ0ꔘ@<@-@ P0@00̘@/O-P0 #`1# $ ( #$0  #(#< 0$Ѝ p0R@-P@0  <0`101(0 0C` F%ЍpG-R@P<M0 % ` 1 01(ppG0G  0Mk P 80R  $Ѝ|k$"P//O-@<`IMP 101p     000 S0 0E>1Q X 0 0>0SC Dd(0HL@@00C pS0!@D\pW*T+ `1  CL0 <΀ Y  ZIJY Ό \ ,ਐ, !,00@P^ ΂ a\aNL^Q !^UIߍD@D@A-@` 1Qp W 0 0>0SC0 (p PpG@ BR !pG RQ+W, @1  K0 "IߍP PQ#4%^QY  ZIQJY PP^PQU @ 00 >@1TQ QPQD1@AT00>01S0#0 #D@D@p@-  0 "000e $P$\ 1 >  0 &0C   0SH Q1S=Y 00 0 0S9x 0 $0P 0 P 1 $ 4H0P HH(= G CP 00[0Z0S  {P   V%PPl 0p000[|7S0E00S0S !R 0<<0ppW9p090& 05 !# #^  #P  R\ Qʐ! +0 00 p' l000101p0S5 SE 1S 0 0D; 0Sp10p180080|7S00S2S14+ * 00?B D10D10 q7/00` 00(0 0pP iP 0`00 01 |78*`S,0X 1 8*0 Z000 03  0   P1 90R?C0C?0000`zX0@0. h71 H)00}?B '$00$0101Xx8S1 (00Q?B 000 00 0 2S1 ("00Q?B 0 a6/ 2" 0 S!-0002021 HF!= 0xS!-00C02021  HF!= 0bPQ1Sz 3/w1  HFP1 8M HQ 0SH1L1 P10CP1S0 900S000000 0P0101? 0t 0S0t0`0S*h`P0`  Hv0S0S0S0S0SXG+eI0 0Sp S SLXR RN00 4(04$0$04Sqh `Y (0 0C4!<0V0` 20 %S ! ( 04  C00010100`00$00 d붡0 ,0$0 00SG X/h0<0倀0G<X ! Z 8P   2P 00#@  h,0S 101h000d(`e(0 0(00嶡$0S `|V0`+g080 R ,003/P 1 # ?B B2101M00 0@00 G^d2L XP40  0@004th0 0 0040a6/4*fZ S  03  CH10H1EHqW1 HC n*L10L11S 3/0SL1H100PHP1X7S  HC I1S 3/ S  H~C0 709000000 0Spp0p 000O-S@Pp`MD #0So Sl 00 |7S7S  40040T@S PS- 1S ?-Cp BP000BSh S] S70CS40040500CS 1 ?/0=>C( 0C0L00L0"h7|7S2S 0J S1 4?D/Gr0=>C!0CL00L0S 40040Ѝ, Tⷭ0d0252 5$YX0Zp0S1 =.Gr0;C!0CD00D00J S*1 >(.Gr0=>C!0CL00L00SS  2St *St 0S ! -00 P00P0SPn xl00phQ1 =-Gr0=>C!0CL00L0zx7S 0450!0P0C2X00Z0Q1 <,Gr0=>C!0CeL00L0Wx7S0X0Q1 <0,Gr0=>C!0CML00L0?0`0H5Q0[0 1 0; \H00H0Q  04 8 <+S0S JP |~0S! 8+0Gr:!H00H0l0S1 \:*Gr0C>C!0CD00D0 R1 *Gr9!H00H0X VY1  D*Gr9!T00T0YQ xQ 1  )GrX9!X00X0A=P:1  )Gr9!d10d1xU !/ ) W101<00<0101|7hWSPm2Sj U   Pd d7![0R 1  @\A[ 71w. h7R7!66h7[071?%0#  1  @0S)  45?|Q 2  yP5`0S ;!0:1h7 0 000T0"08U l7 ?l78l70 000T0"5   cP! T P 0`P00 0QP  x8Xh'* 13/?S PT0- d|wW 7S 40040  0 RY/1 5%0N>C 0CD00D0BP*1 @5P%0=>C 0CL00L0P 2P P00S ! $04 zH00H0lZ1 4$0C 0C-`00`0x8Up W - pPU 1  T? 0 00 00 1 p2"0U>C 0CW   RP   -P0P a6/1 HR  ,2<"0=>C, 0CL00L0㸑qἡ  @? 0 xph:S  0 3/P1  B 000|7S0 a86/h7 1A &00Y>B l00l0|7S0 a6/xYE1S h 00]>B J@@Ϫ@@@@ @!@4@G@]@@@ @ @8@X@@Ȭ@@@@@X@,@H@@ͭ@­@@@@@@@#@F@Y@@@@ͫ@ի@x co@@@@ @(@L@h@PP@@Ѯ@ 0 C  ! 00 B000 0|Q4px0p 0S0HP! 00C0\!00 0- B00000S 0GSX 1 !O00]>B 0S ! !0 0M B|7 "S ! "00m Bo7S ! h"00} BHW W㐑D  2I/Cp BU0000x8U,  PP` 2 020000P ,.1#  Tv>H3V P 0 0, a06/r2 o`x8U f #00=B ],P^ #(00=B o P  $>00=B h00h0H(4  T->` Z7S.W) W7,P v*0,0Z 1$  T > 0 x8U<10<1h00h0 1 3/P  ,0 a6/1 |5I/Cp B000Q7S 13/Y 0S! %0J?B y000|7Sp x0p |7D&S ! h&00 X7WS 000x8U   PP 2 020a6/1&  T|=  6 0S }2 z7WSZ 1d'  T^= 0 x8 U<10<1h00h013/V 1 3/O1S 7w/C BOd00d0|7S?0 a 86/7 W00(000 0 I(S1 t8d(Gr0=>C!0C)L00L0x P 1S 8(Gr0y>C!0Cp00p00S"0 $0000 0" 0A S*1 X9H)Gr0=>C!0CL00L000S0 S  S   0Q 0S"1 9)Gr0N>C! 0CD00D02S0 S P P$0 0$0 00S! p*0Gr:!H00H0Y1 :*Gr0 >C-B 0 a6/000  C !0pp$W,1 > pM.C B0L 4P 8P <S 0C?o020\3bqE0p01D/ d? ,B>C B借! 0?Q.C\ W1/ ?p/C00Z 1/ ?E.C*0A@0P ! ;F.C0 G  00 Q 0  1p :I.C B.D<08 q8 <0 HXB i pG p  1D*R D: >CK.B  C !0pp$W,1; 9 pM.C B0L 4P 8P <S 0C?o020\3bqE0p01`) h9 O.B>C BLL00cWF01 441)  T:0 00S8C0FD CA@8,P &0,0,01S  Tj:0 Sh8C0,T 0( a6/ox00x0]00 /Ph7 1S  T=:0 S7C0Y0( a6/C|00|01000040?,0?x80101x8M? M? x861610S @000D0049$0S 4202( 0P P&0004P I&$04020|7S7S 400400LS1 464&Gr0=>C!0CL00L0꺁xXX 1  T950W 0 0tx8U<10<1h00h0 ᐕ 0\Q<1 h5T%Gr0N>C! 0CD00D0LP*1 4$Gr0=>C!0CL00L02P  P P0Z   P0S! X$0GrX4!mH00H0_0ḡἑ  1  TF930W  0 0x8 U<10<1|00|013/;X㺯ᴒN  pH 202-wh7Q / ? 67Qh7 !, h7R7!66h71  T8Ÿ h0WR 0 0    Ÿ   13/20276h7'0R40040 0CS1 1!0=>C0 0CL00L00q001 01(P400401  T80 ^|7S S 40040 1 3/x8U 0q00101 P400401  Tr80 +|7S S 40040o 1 3/hx8Ue pa@ @(@L@h@y@@o@կ@@x cX@.@P@@O@x@@@x@@Ӱ@ -0@-@PM0 0 P+8 0Ѝ0@Ѝ/@A-p|7@S2S0!1R004 S00R  0 u``R8P`20100010020 0083/ ? 071 0!GR # D1"022222220 " 8," ZN292S988-#87 0C2c70r0Q   0   04Q   ն0PP0C03254ʐ@A-P L0R8pL `@^|'R"ⶶ(R# #0 83/G?G/ @0?@D00Q0000L00 Ⓐ00 R  ⊶001H0O-`qF尡MT9 0 Yd (  00 4S! 0+ 0Q P0 S0#  "0 000083/? 0? 071 0M!GR # E0S/S10C1ߍ(0 5 0" R 0Q   )0   0" R 4Q    WP0pG@ʐ@@-1CMS@CߍP` fV@P p  `P 0,ᔡ0Q    R,!0R 1Ł_W@p@-2@SP 0aS 0 6/p@03A0AS@-@e /C-@px8 ATMBR h'0 01PTЍ"}07p7 ~0P00 ! U BP Q 0009h75S0 S0 S00!e R #TЍCV7h7#20k70k7#1p7#81p71i72k71k7#200#8S >!0R1ā !@RUPPa4VA  MPP` 8. 0000000Q<<0 0 0000n P00'  0R 000U @ mVPDVOxc n  | xW!_o`/R χ166S1 000P U0!01S 13VP!TЍCTЍC"1S UPP  `P !ZR !ā B VP2괁X TPP  `P 2 01 SP0} pl 0"P1UP0UQ r! `(0PE("(!p7 0/A0S 0(( %=>000Q00000s#N90r":9?o2{N8y?wh78s"}0p:S| (0TЍC/0@@;'.'@0|7S2S/004 S00R  0 u0000/A- MPp!%@MT`Pl0$`S9 BS` BS!? S* SU  S `Y$02010?0x8D!0100"]00 j"]0h78h75^0x8?00h7#2^0n^0`P V C VȲ@`U0"0t"]0h7=$`B000i;0d 0k ଲL 000X@ڱ@ޱ@*-OYe0'G-p M@`'PR`P0'XHS^ + BS*? S* S  S `@'?;CS00$'S?  Sj BSX0Sj p7 h70h7s&Sc 5, BS  BS&?;C0CS0&SDX @0SC00P0S Q>⪎0pⲐWC嶠C ĝ @0Sp9%S BS6 BS  S7 / BS|7SR c8P`K 13/8x%S r S}`=0X SQ`4#=0 ᇝ  (03A0ASXa0S^!V&R!X 1?0|8|7S3A0AS13/4P` XD3   R<  ЍR <3X100$S- p' & |'S|7x'Rp' p' X\08 w0S 㴀u?0Xp  R0\ Y "q?0Q  \ X "= w X "= q X0S p7  h78h7|7S7S03A0AS7S7S4`|h7y  8h7u h7 O ;X > h7 E 0X0Sx( 0•zh79 0Xs0S.0‘mXk W?B0CSe"= |7S! H  tx7 ?op2X  0RQ ÑVP P6P   Q A0 S - @%>@EOB@O-?@Q`|M pX3C>6CQ+ *3>6Q P?Q 70Q  |ЍO#3 ?Q0 00 0p0PPM.x0@FS00>Q >Q F0Q0 0CS,4PP/|>Q7S|'R h7   כ0>Q $ QL >Q>|ЍOh>W0.|ЍO;=0S-S001S S Sh740 03A0AS[7SX4Ph740h7h740@S)!P& 1(-0CS0h70h701!x8 h750h7h750h75!0B8#8S"= Ñ P1Sʄ7w>0S3A0AS13/p7  1 CbR.0‘!1R7P!h7R00h7!h7R44!@R8OPPH<0 SPo;XK=0S|7S=xhb >ȵPYp:3/0= 8PP <0S0#0$" 0#0 < XXV > PP 3S>ñ:3/V H4U< ' > ` `PPXqs`~!Rj8OPP8Q|7SxH 9nP 1P|Ѝ 9 5 @P DQCA!*R;8dOPP80SS*0|7S-9 iR B0<PP" @P>0CS|7S < @P 80S& < |'R R0<P  < @P 81#3/ @8 f |7S PpP P !NPP x!> J!h7R 331Sh'5h7Q Q%h'r Q5| n4y1S p7h7:qh7:m!h7R33g!h7R22P 60"p7 10h7FP!0B8#8S ȕypဦ1S7 W 0p' Wp WUPdP1S\& "0vT!0B8#8S ȕnL!18p7h1019q W> fNPP 8✙x7 ?o2x`QQ 6P  x@Q @A0 S |Q x0@`P|V` x01@0S S2 Q_P|Xe 8⿭03A0AS7SP U|7S cP 13/P]!R8zNPPTW pP 03/P z186S003/1ZS$ 8#8SU $03/SU 0:03/U 4SPP 03/P Z0U 03/!R8MPP  8 m 0P > "p7|  2/@0SX1X  pŸ&%-  PHŸ.  P  B"P9 919"p0000 9100000000 910 B"0k9990 9100 910?o200|7SS!0B8#8SN(ĕ|7SS1 C=R.201: !h7R 0 0h7w>0S 108p'1 S"-08|#8,C("(RiiiP@i9ii:ii8i8i(7io?޲@@) 4'@1@7@@ @* *;@ʐ@cA@@cddid! 8LPPj8` V#=0  h9wx! 87S (#8 9h! 8MPHx 8  0BS !R r39S0S0 p Q ARQz0W8@ ۗ  R@ WpP:3/>00S 0H pH0P-PpW@:3/UJp媎0SD@pX0 0CR00h'4PS4400Rh7VLPP 0 0H-HAP h7~N#2000@000S@@T`'O 0'PP0T0 T=MPP  > 0S p7  h7 ; h7h7 ; h7N50000> 0 ♫ h7P:: x⍫1($S,48 S!V&R! 1?08|87Sx|'R8$S x(0!Sm|8R8h x(0!R7S|7S|j|ЍO^0 00 0p0PP- |ЍOHL P   03/P |ЍOa[ꔥ唅唵Yʀ 0! $%0    ! @aRa/#L6PPWa/ᦖ 0!4&0 !    !0G-@M,00 `p@(0#00a0$  @<0P lP0(0(0 0Q@<0$  a,@kP<  1@ЍK@@A- 8MP4/ ! A0     P,`p$0 0 a,(P @4 k0P! @   '.$00 0 ap,(P@4 k0P P#!X0X@XP R T:8Ѝ4 03/dc'@P ceBB@C-MP 0`p` @Y0 0 00 l00P 0@ 0 fg?o2P@@T:0PЍC-p@P`M(` ,X0  w0 000000X006gЍO-QM0|MЍOjQGR0 0P0p 0p;/o0"/6$R ʀ  !Ā .! 0 @!( , $@TR$@lU 1l #T   $`Q)  S  @*Q PP R$@M @(@@ P R$@iN@xP R$@@,@ ASXx( T(Q@, c@$ ,@Tu \ P,@$ ( x(Ri. Q - Q UWX H0/0$6 3DT <Pt20!R0 o` BB!$ PN 0O 97!Gq "|'- "bt x  *D!(/( "# 4)%)M/ )6! 0`2$,(p0/0H0E  0<0@ iP| <400 00!@0 $ 0,(p<0riPe <0 00@!0 $ 0,(p<0]iPP < 00@!0 $ 0,(p<0IiP<> 0 00@!(0 $ 0,(p<04iP'w> 00@!30 $ 0,(p<0 iP 0N@?P!$ ,(p @P<0@ iP  AG\Ѝ@@ c'F@P cdb'@ck@-@ᶰPᨰp@-@`PUp0S00`00C0  `J-@-0 0 Ѝ Ѝ/᧴@p@-PP UlU`F@P G0000 ( H@P@p謴@˴@.C-1P@`p x8圀QHZ( 0x8 S ZVed0 JU Ѝ KV0 lg;U@@-1P@` x8pQ0Gp(( 0hx8S 0 fU Ѝ@ 0 hU Ѝ@@@-1@  0@ iT@O-1P0S000P-00@@A-0Xg~@U p, QP v6P5v61Pt` &F1 S2  PUAeၤʐ@L@w@A-0Xc~pU@P8l7x8l7PUP{vfvV``0 opk v6p7v61 _p[p 0X020`003/0900*= 20T1<00 0!` 0@0 00aS0@`PpЍAd@ʐ@@ ) @0) 8408008,08089!= 01/t'Dt'Й'r'r'2 029 0/202/@-80000#Q0Sl78l7 .0 0 ( ( #- x Ѝ1@-@ h70  (0(0Rh7=h7l78l70@$@+@p@-@P83/p@d@-P` PQVxw- w> G" !@ Br 00# B1  c @0@ GG?0@ Q  Ѝ7SD10A@ Z@e@v@@A-`P8p3/@P\00\0  s@-P8 `3/@P\00\0. 1 *#0  +x &00x822x80!H0003/090020T100PЍp@@A-P`8p3/@P\00\0  x8 0 0x822x822xx80!x8 99p@-@P`Z@$pp@-P@P xG G¡1S 3/pA-P@p`000 ⪡ ⦡ ⢡0?0?x80101 M? 061071 N? (Q 4 $Q 0 0 ,1SA/@-P ` pk@P 00 0t ЍA-|7PSS` h7M @ iN@pi0 R0S P@xH)A-|7`SSp@ h7] P i^PB0S TAT20 R0S P@xH0S i V1Sp1 !0H0  0#PݩAHЍթܹ@A-pymP|7 `S 0 xH©.T |7SS @P ⳩O@1 !  0!R000@C-P@@@`pAT ݐ  P01S⃩P1 !40 $0& Ѝ@\@G-`X  pR 0S R@ĦOoB@PU@ ⱦP 0R01 S  R 0S R❦P0 P0T@`C-p`@PO 冦P@T Ѝ0S uP1 !0t B0    AT  ZP0S QP @ꕺ@@A-P@U, p&P ЍA=0S0S i V1S1 P0 !f 0!P ЍAЍ謺@@-@xP 0x8i <P 0<8HP 0H8p@-|7@SP yn089,8xxXP 0 022220000990{w>018|'R 13/p@A-1@`  y^s|7S118889,8  PPp G(# @x8 """" 99>0?h7?0?x'RM?6!|7Sh7!QGQ AR@@@-@xQ `P :P P 1  r<10<1Ѝp⹧+1 h'0HH <<8 8 0 >Qh7@A-@M|7S< pin  `AVU 1V6 S2 0S! q , !RRPq ܍A 83/0<0!SPRC57S &1R6.S ( "|7Sh7 8S|i^ Pa6Sh70h7Phs܍A"U i^` Ph70h7Ѝp@4 c$@+@@O-M80i~ 0<0p`P  0@P 83/@P\00\0 x8 0 0x822x822(7x8 991* h7' G000p 01X'r /@1 q? X -000 0SR 00S PZ R 00  07 00 0 00 0?0?0ao`0a M? 061071 0S ;!0:1 N? (Q4 4n$Q0 0h0 XЍO2M0 [ 0DЍ<@x c\@@C-`@yHPP⾙08pS% 4(Y" U a !V T  `P1 0@0C 0%- ЍU` ꢼ@@A-2@P !m00C02021 m0  `2Pq 02HQWP,RP ,PP?P?P?PA0SH1L1`P10CP1~?1S 3/ @G-PpR```J0V x 'G~|;@T 0V `n 9/@,@ v'A-x2!@0SP` 2 L9|QI0S1 $K2Su :0S 3/"<2< "!0!-200C0w>0SX? $~Q A1 0 lY0Sp7  |7S 1 4 &HE2-~Q A1 0 10S1  &h76h7p7  1 t h767h7V @AAp@h@@@ǽ@@8@W@O-P`|7MSS00 0lppp1 p 0%[0W  A@ЍO J@T 00Ѝ0W p|7S2  0S \4"|0 0PH>00x8S} 0 0C8C80Q Ro P1S: 00! 00 00HP 0SH1L100P10CP1>H1S 0 R B0 Y 1  0 g1P 0Q113/0Sʐ1  0 X 2S 0 ᬑ9/000`)Sʐ1\  X 0$ 9‣ LS@\꼾@ƾ@Ec@@S@,@C-2@SP`M !Ⰰ8#8X 0 q7/ЍC`< p 92<2<! !000w>0SB p!,20S B2 hkCWAⲂ0 ؁P 1S 3/9-8C800ᬁ0 8/: 0S 3/ ЍC? ~0001 0 GP202~0001 0 7S 1  th76h7? 1 P eh776h7rpq@@&@,@1@ĸ@@G@@@@%@A-|W`U U) U@w xP 83/@ ? 83/P@pWU!3c@PwW 83/Pp@@PwW 29S 83/P@pp@-@1 4 0BAP00Qp@@p@-PiN@ @P`xh7VxHp 0^ 022220000990?p@@@@-!]0!@S001 ŁC<<>HP1a 000Z.  yG 070$8@1}p`Uwh,884X P10XQ 00% E 0 Ei~  F  0' 08' jn P6D'@7<7f(Wox8 p  p'    H ( < ) x8 k Ѝ@l'@u' A-pʀjPuQ` 0ES  B2U U U ,U UPPH$H@}Wpx@'x@@@p*0000>0h'0S0000@/p@-P@ fs000 0t u"    @v w 0  " @x 0S @@p@A-0 0S@P p `*|7S00 0.  * &003213030 0        @t0/C-@`MP7PP000y Ѝp0 `ݐ0=0 H02 |7S0000(001011 `ݾ0T A   W00L7SPP7HWLW0P7)@-206 2S 101 , ʠ,ʠ\ 101 S&0#*R0 BR00 \   0R"  R  (R  B/o"S0|'Rx  *60R R  R R  1H0S "N)R@O-0LM S< P@ 8Jh7 |7S 808 7Rᘐ>0S 39S᚞ $7R.㲢 $7Rpph7 4@ppY80```& #RH L0S0P !0 >0'S 3)6R1 8>0 060000H  0C FR{86@P000 Vڸ d.460Y000040  B    004@]4@Th 6U 0      $D"$  (00 #RH L0S0P  9@P000> 40H   CW0C00000 (0`0(00 0|7S000 0p > l 8h0 0 00Zl 060S  S  S#:9S00w0 00#"!# #"0( RR0O+ +Y $3R h7 |7S8 3 R 0@0080 R  (03/P1 8 d 81081 8   > x 0 08   >321303(Z !%*0$@00 00 0J(000( 0 I 0 0Z 1! Y0: L$$`Y  6P`PPe5 I50 0尕 0 010 1 00 0 0 I0, 0'5, 00(0080$0`0000 S0 000((0CP50 8000000C001!0110/1!LЍP`8Y0 S  048P 48@8@[80[ 0 00徠SX (t@@@@@@!@2@ @O-0S h'0 p  0j000   J0  H)0IS0,00S0Y  R Yx(  B/o"Z00S  0uPP0 = S  岀崠 85 0,Y 1  00:0Z(110011|7S 0H   CR0C00000 `(0 0(00000=00y0  , R :01  0D0@001 PW|'R  3Grq穸 0 1 0100L7SPP7HWX0P7080LW2z@$Ѝ j0 PP 0ᰀ00(0101u|8S>HHPP |7h'S000 (  0/  p' ; W00  . x 1G lwh'0  4 R  O0Q  0 00 0C0(0%3iPP3 h'00  0  ;X00  岀0  " 101G%0h'0  4 R 0C0(0p 101#RH L0S0P  3PP@@x@L@3@x c@@A-`p0@P 00(0K0P 000p⛐  ◐p@-`P/@P 0; 0(0 `  ‐pG-!=⼠p7p# 50`G@- PP1S  0 000Ѝ {0/ |'hR    0  + h  10 pw0S 00000   0-0  00|'RE00 0 ! h7   h72h7 Y0Sl7 00@10 @( #RH LQP   3PP$    N  0 00H   CR0C00(0p 0(00㲀0⥏  ⡏ ❏북?@@O-@fMP|7h'S000 0 0  ;0h7  9)+ S09h7  h72h7|7S{hgpe_ !PUP0!2!   # 90 9G9S!  p L 90 96PSH(Q PU Q0CS*e1 S`0 `!  0ٍ ``` 0 Ⱑ PH!h75h71 |  008 S0R 0C00 S 0S00DЍ0`,@@@-`T1P!pR@MX1\!^0 X1\!1S 200 @E@a1 0 -Ѝ@1. ?1S_PP00L1EUS0 `HaPE0PLaPa`Pa1 0 4`3V1Ѝ@/Ѝ@@-0 /2S/p@-@Pa0 6/p@m 06 08880 8077090(10101/* * ''H'@-:@0S 3/ :S@0/p@-`@0SP0P    00T ,P1S 01pp\ cdT@P0/dP 0!/d@-@ 啿0@@\ c0 R  \ c@p@-<@P0S,d@T ẌP@p\ c@ Qp@-0@P PS lg`0FUp@P` B^R <Z`0FUp$S0M@@@@C-1@pg 4!1000$Z4xX倇X0d4`FV`|7S S 0 8C:0S 3/ Ѝ0 a6/  K|7S S 0 a6/x3V0|'R/I032+ D3Q' h7  {1 Q h7C 2 P@ qWX  4@@-0@M 60b1c2d3eI{J|K}L~S|7SV 9 h7 "w>0l!1@ABp7h4 D2! i  j9k9 0 g9!01"\0Y|7S!=0S* 9'w>0 02 9i9 00/\0n>|7S 93/1  |7T S499Ѝ@+x829009h72h7ЍT@@\ cp7/p@-@f_rp@p7/G-`Pp㬁嬑Mw@WAL WO WO10@|'RN 5) 6) 7) 8)099!  089 079(!%069059000N9 O)PQ R   00 opWPx8S  19ЍGl 08 @\ X 00D 0590690790890Ѝ c@x@@̰@ @@@-h7#1 @  |Q7S8(00S8. x (0   Ѝ 1(Ѝ@/@@O-pM`0`  P庉0@0 00P 000 0_o`@FRPPU!R:"R :"R:0ЍC-MP 0`p` @~0 0 00  00P 0 0@F?o2P0S R0 Ѝ0O-DM ,00`pA(0a0$  @<0PvJPJ00<0$   a ,(eJP900<0$   a ,(UJP)0'0000㨐$ 00a,( < @JP0$0h0@00 00a,( @< +JP   fDЍ1@' !c'Y@G-SP Lo `0@4p8à St# 00000SW  0` 01`P1 0e`0 d`)Ѝ@0@T@AJ0^0P0᳐0Y:0 !c@@-  0 @!  Q3  4W000 P1#9P00T0ieX耖C@BC-P`尀p0@ A0 80S H4P `T 0` 00ʹ Ѝ !cd@O-P@0MP00p1W;*0S`0 S00qp0少  A$0 [! P p 0PQ`1P  0 dPP0p 0 0\~Ѝ[ <P 1 0CЍOj !c(!cd(@@O-@0pM00P@`Py 0SP S P S0P0܁ R@*00Q:0S  P 0 ≐00)  0d 0  D A ቐ 0R 0 j0S0 fP 0P0S" XP PxP @GG_PJ!0Rd X@Ѝ` `Kd벰 0(и !cdZ@(!c}@@@@@@-@@@- 4,4 8 #8޸ Ѝ@p@-@0M SЍp@P` 00 0ŸЍp@-$M840, (  0 ;$Ѝ䄾c@-`plM_&@P@ !0 0  ( 0  P0000C0 p0!0A0 0C0000 0d@S2 001 00@0&rH0L 0 H0L }lЍeTdcO-0HADM  0@ 00士P.Ppl0!   0 0 0,P(p$  `G0  0 0 40P,P(p$  `G 4 d @ 0   80P,P(p$ @`G 0DЍ@@ccl'O-\F,MPp 0 0 0 0d#dh&hV *0 0 0 ,ЍOo)0 0S 0S*)PP Ҧ0 0 0 ,ЍOۦ00C0F@P 廦0 0 0 00C0000 `P' 0S S S/堦 0$ 0 0$ 嫦3"0ZT$S 匦(0, 0 (0, 嗦 )< P PP  /,Ѝ0V 0 01`S0300 000 P@ 0S0S 04S J2a @ 0SʠZ @T 0S 4S 0 SR0"0CS00 S 2"@ [ @00004 0 004 30 R S 80< 0 80< d 0S :P`0 0ºD jPc 00ӥ@0D 0 @0D ޥ0S 0CSQ00N0 0S0z帥004 0 004 å3 ᏺ70 R S 塥80< 0 80< 嬥 { 0SP`0 0 o P 00倥@0D 0 @0D 勥0SSSꄾc@c@c@0p@-00@4S 3P1 00'R0 0S0St%P 000 01S0H00``<2S@ap p@c@c  BR/ $R/ #/0 0S/d@-P@1S `pv 0 @1j @Tr  Ѝ0S 0CS0@q 0S0 0S;00 : @@c000pp@-@`CP@P a^pP/ap@-@PP !p@-@P ! @- @ 0 >p@-@P!!p@ QeO-$M`@P pP 0$ЍT@ @ ` X0@00S @T  k00S 000S00 0T 00B=0P` ` @Z 0 [0 T1=0P0T *=0P ` 0b 00`0/G-pP@0`P !T 4 06 S H0S 4 R30 bPP* @P8 0x00PPH0 [Zv 05 06 06r  `SH0Y 0S 0C @ Q*  "  D'H@,0/@- 0MP30ppp"`h1@T @DT= 03  !H%,0 , @ 0 Ѝ@6& 0#000S2 0,0-yp 03  !%,00,0 03  %P,00,0,0 0 (=&VЍ@ d'0A#$#"$#"4#/l0Sp p l p0 0S  0 00/A-@|`pP1hSl l0p AD0P1p00`0101S0@@6cq d@-60!0 0 0Ѝ@-@Td$,d,lH,l $.` G-@phRhb@M#0 p00 @@٦0A10A b>  Z EF? P 0`p!+0 000,`(p$@ @@ @B0 000!T1000 004,`(p$@ @ @B 0!:0 0040@,`(p$@ @@ @B0 400'㸐!=0  0080@,`(p$@@ @`B0 400MP!0 80@,`(p$@ @ @P`B@ЍH@ dl',!cp@-Pᴶ0@0T@0S 0CS d ` R 0\0X 0S @T @DTp@,!c dp@-`Pዶ0@TB2S D0CS  Rd ` R H000S\0X 0S H@T D@DTp@,!c0S 00P0#///0  S /0C\ B /@-? @d0S0CSR$!@X Q \@D R 10S 0C dp@-P@ Yl0!S <S21p@-@]@4d@-@B 004d@-@ \@ (0@s2p@-3P @2S  D0CSp\ T T h T \ d\ ` T X TpH0S D0C/,!c80S/@-3`A0ASM;,p᥵PBT D@DTЍ@%00S%ᴵ0 00}P0 R00-0 0003/rPH@Ѝp@-M@`cPBT D@DTЍp@00Sur0S 3/0000->PgH@@-@$1@Qzp@-@P 4}001Pp0S 0Sp d@ p@- @P8@P@p@P@@dA-pHQ`P000 @PЍ0 p 000!>00H `(P ⎧P` (}1S0 d }1@0H` }A0, }(10(1 d1i@d0@-@M&PPEUP xЍ0@t!>00 T ( P0@PS   (10C(1]8Ѝ0@d2i dC-0@SM 3/> 0p3  ,P 00ЍCHW`P00S0CSUVliV V"Y e   P `RPVU0S 0C4d dp@-@,0P `0,0EWt x0Rx0t 1x0 0S  0 00 000p@ d4dO-@,MR||`SpPp踰 0S YP R R0 00R0P00080S000 Y P 30Sڸ0003Zʀ !  , ! vp !D3@3 <34300  !ḠW㸠 00踰,Ѝ 0SP0 0 00Y00帰Y `P帠3 00 0Sh24d\0Q0d00\00 X0` H0403: $d0S00 0` 00\0X 00h0P 0# 2 +U0```&10S 0CS-C 03 7 O pP,00,0. W-+P0S  P 0S0S  S      R# !,  p3S0St00XYV 0S PO 03/K0c@cddd d4dO-<PQtM p!< R$ 35Q +X@ 0W@DlW<<W26,<,,0 S00<Q 3C5CQX U   ;W +W !BW-`S R R   `E  @ TW" h;W 0 @h 0|@ |0S P |!>d6"00 `0i0 0  00R 0`-BT D@DT I1`tЍh:W 0 00 RVd  00 S^ H@ Ehh0 @@h 0|| @|3 P |P | 0|0 X{ 0  tЍO00000 i1@Pk 6060X`\00` CC``` 9W 6C 0CW 80S8W1CWf 80 S`8W0ST 0j롱| yt80AT @DT ᷱ@8@(WW00W0S( T1`@ 0S0Z @0W0S00}0SZ|00SXSTꀠ0Z0SX,7,'WW| T$700 a`0 0 `0p5PeTz@P7`o 0| 000?893 !>8e|y000000dV/P600 0 0 P3TEy& SM0050SE%SB00| ? `3  3  00 < 03 P `P )T Y 0}@,0   3 PY0 `Y 4T$E50t01x0@t010S ؀SS P0؀ \ZV EP0P0Yd0P0 PY`0`V `000d0尳 !0S` 0S ` ` Y%00 0 -`3 !0S P 0ST  LfR000<2 `  `@Y> `h0S 0S000PS 0 [PsZ V`[ 1 6 /``` W003 P R0``0@Q 0S0|`W| @z  9z 0Q R0`1 0`峯ii ii io@ i@iii@%iߖo?i@'i d@oi@:@!i#i"i4dYd08 P R/ !  / d !  d@d-@d@dO- MP@Dp `0@0@@P261@T @DTO QT100#Ѝ!>00  0 0%`P H03H0BT D@DT$ +T 0Y00C?o20S. 0S+ P@ T 10@0L0S H@ 03@@P 0  80S 3/@P  d0Q&@- 0@R0S b$",0S R \00S 0CSƮ #  Q0/ dp@-`㍒P 0@0L0`0D00@0 0<0(080,040D00040,000@p'''|((@'$'(@-@@@c0O-,M,00S@(`K@P 0 0 0T1"T00XS%X6@P  00 ")a! 1 00 $a$" 1040  0pP 0 F0 8#8 !0Ƞ$,, " 1., Ƞ4,< `8#8 !(R,B B8#80]0$0$0Y C *,ЍY 0 PP  0P00@pV @`PpV`[P 0p0(0 4p*4 0Ằ 02p0x p 0c8##4 Ib4#00 1 00 2 0 p0 0`p@`A-`p(@P P PU@0 PTCC-0@SPP @A0S`Დ;pp0 p0 @4"40 0 a2W  0  0 @ 0CM20 P00 R0("( ,00#,0 Ѝ 0Jp 07@-0P 4!4 8A#81C 2 P,000000! R ݑ0  0 Ѝ0 0`( "4`#/03" /@c@-8@Bu000P@P0S(dA-@MlPlpP@@ @0 9D` P0@@ @P ,Ѝ@EcLd 0!< 04 0 (   !/@cddd\ P/0 !8 0 0 (  , !/@cdddA-P`@0p Pፆ 0ᇆ0  ၆?;$2020S AB4!c@.(0p@-S/@@`JP0SP \0P 0Pd0 1@\p0@ 0R/!&   `b 0R/!&   RbO-0PXQ p`H ($H Ġ)$Č 4)4 Ƞ8,Ƞ#80  qW 0S0U 6S 6 S0V,8/pQS/A-p`P@T0S0S6/@A-@PP2 R0`0p0V0C0 0XP`U0F1 A-P@T0S(4P` (`pB0W e4`pV (0r@@-pDMW,8`P<@P& 4  a<00004 0000"40   000 PU'$DЍ 0S/8p@-P@Tp0S 8`0P H R@O-` TMx@xoT$0'x0$04'40婒Q0UZS TP $P& PTЍPPP\V P ,S \ P 0V \ P0;/ 0$ 0Q  ;/P 0 R Q[QV [ ! SQ [ 0 V Q G-P,`X$0p0$0@븢! 4Ġ!Č*4 Ƞ8,Ƞ#80 1 !@T X $0S p 07/PP P  PVTЍ@0S  1S0@ A A-p `XD%XpD%DH$H00!1P03@@1!P\\ Q \\\ P0S 0S0 Ld0SA- 0@SP0S   U U2 P&,4"4 8 `#80 !R   0 1@&,4"4 8 `#800A&,`4"4 8 #800p&,4"4 $,$8(#8"(000`01S0 001@p&,`4"4 $,$8(#8"(0 000Ap&,`4"4 $,$8(#8"(00 0p@-0P0`l1 QkP@P 000S  _0$!00$ S00,P(`l 0  000Sd09d0@0 ` R00@&P4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0Yp7pLd0&cG-(p0@0SP,``M く ROd0" 0 0  0 P" ݝP c  iP]d0"@0d04"4 8#8260S   &4"4 8#8 !R   0 1 &4"4!0 A&4"4!0 1 0&0 04"4 8 #8 S0#03 00P0p勝P 0 ⚐P (00 0`ЍD0 X 10R@10S 0 9P/D00 X +0S 0 'P  (0R R  @!@1 0RD0  0 @1 H0(00 0^@-0S 6PS 0SQ@` 0S  @(000L0!P00!P00Ѝp0SG-0PSXM70S/30SU 0` R@( RK 8r R R S 0S0C00匀XC1#212(0 00p08wpP P1XЍs0S 0CS # 00Ч0ꧧP d0 §  1꺧 က 60 0,P.<0+0SQ 0006l0S (000L00  00!0bPd /P /0 d@cA-p(`@pPL0S   !R, 00! hP z8 p~0SP V '0S0 ZA0Ld00 000080Ѝ8@- <0b",4b4#  #$  #(  #< Ѝ@p@-@0M SЍp@P` 4"48 #800Ѝp@iQi<cbK7Q 0S0C0CS0#0/Q 0S0C0CS0#0/p@-@PT 1 !RR # BwwPpEp@-40 R@  000  K  Ѝ@-40@ R  000  4  ЍX0 0&-$M840, (  0b$ЍXdC-M 0P`` @pxp0 P 00 00 0 0@-?o2P0S B~Q Ѝ!cC-PMp@ 0` p`0 P  00 000 0@-?o2P0SP @TP@P T(@P0ЍT c!cO- @p`0SDM!  0 ,@P 0(p$  `1 0儓!0 ,@0 040`(p$  `j1 0 0 0'! 0 ,@0@ 0 84`0`(p$ S10 400!2 00 ,@0@ 0 80`(p$ <10 0 0!#0 ,@0@ 0 84p0`(p$ &10 0 0!/0 4,@ 0@ 0 80`(p$ 10 0 0!1 0;0 4,@0@ 0 80`(p$ 00 400!h10H00< ,@0  0 80`(p$ 00400 0 0!N0 ,@0@ 0 80`(p$ 0 0400 0 0YP!  0 ,@8 0`(p$ P0 XP <10@0TE.DЍ@!cH(LI(DH(cXdU(sccp@-P 㻈@lgh 0S Q 0P @@@040p@Pp@ 㡈0c!c!c0 `.XdO-P|M@0010pC5#21 2 P 0S F`|5 V#2!12 |Ѝ 00f<` l050Z РJZ]}Z  <}(PZ  R` 30 ?Z DJZ@ [Z| YX\ !>00 ( P0 $<_Z0 0P 0P Y7  ူ< jl30Z РJZ %Z" |' Y Ԡ  R R  H < [ V Ԡ  {P (VYˣ2`ZؠJ   # ܐYr ؠIZ <|ףY5  Z   <W`0C `P  `P 0"00 0SG0 d 4"40C(4"<00 0000 (0 B 0C(00 Bl0P,0,00  q!B pP0$#$("(B(0 0C00000PP  S Y  YZ#DSS  S R 0  l0 00 IY ʙs aR R000 <=@c(d dTd@- Q504 Y,0?A`"b8"#b ЍQMbO-p`PLM @ ,Y *p`&Y0(p)`t#tx'xpGW U 0$ 0 0$ '$W$0S 0 3SH0L0S@P LE 0$ 0 0$ LЍ00C0'P T(0, 0 (0, 00000C00(Sfdύ090! !׍0h$0CSR0PD40؆#W 00S00 R0S 姍004 0 004 P嚍0 0 0 奍%PP0S9@Pk   0Q ,HH(00<30#0S  $3/ s20S 0  ]H0L 0 H0L 00R80< 0 80< 00! !TlKW:004 0 004 020S 0  *P0T 0 P0T 00 1 0S W0 Cr 00СpΡP | Z    R # 0 0ϡPK0S #W  R1  0S R 0$,00 00(000(0006P 0S  p `P  80L8 G8_P (}00 `$`02L0 00 P2S>0 0 0 I0 0$#$ (0"(DRD PP  P0$"0C0H0 S=40:0Z @ 0 0#P00S1 L 0d` 0S*@00{! 0 S0!0m X X0\ 0 X0\ U, 1@ @ ҉H L0 [H L ` d d` ԉU` 0 `ɉU ? 7X (X.0P H0@`'墉0 @0 0 嬉@cc"c@-!>@tPM `0@@冉p0 M0P叉ЍL000光cO-=|Mm ~@P=|ЍOPX X 1$!0 1$!c ,=D@0S S E 1$!0 1$!PD 90 0 0 DD0 <   DP"0 0 0 0S P@0@S 0 0 0 @AT 0$ 0 0$ 0T PPD 0S0 0 0 ;`( "$`$"",R a(!"4a4##<S3 D1, @000@S SLj0 0 0 3 :0S "P 4"48#8T嬈(0, 0 (0, eD(S埈0 0 0 X Q0(0 CD D0;00 000X0P(0DP 0D0{1!0 1!40S& PDG 00001S0`0 R P0D0U 00400S D0 @p0,P0$800010C 0 0STz 90S@s 0dPPm  d0D0Z Z\ 0S@10 0 0SRQDZ Z 0 0C 0PZ Z fR0d00e070S| $0S @E 0S [@@D 0h0妜<d?0P0<0œZ.@0 TG0҇0 0 0 ݇꬜ 0R*+Z 4 0P $0g$0J* 0$0@K@ hfZ`d0P00$0  f w$0Sh00000@@@T@hLP Lf @ fsR0d00e0,0Sx 0SJ Zz 0R: hfd0PJ0   f 70000,0= /hLP@i L fYF 00C $RYFY0 #"  02R0; 0IS  S> S! @E@/ fR0d00e00 0S 80h0˛ɛ0P 0S H @H e000dc0 Cf ʛ000 fQ0d00e00 0S  h,f돛d(0P0  ꁛR@T 20S@0@A@@$0pc201S 0CS# 2SD0CK ႛ00SG =Pi咆X0\ 0 X0\ K W T  X (  (  J #G0  R  Q W7 h W4 ` W1 X W. R+ H0S D0CS@p#@10S (0DS 0 0s?X0\ 0 X0\ JP004 S 000S D_ PD0S 000010p0t 0 p0t !,0 @0<01# 0D3/00 0@@PPPP 00@ЍHP P@UP1@P P00fA-@ PRp   tP 0SR`Pږ1IP 00Ж0\ Q @a0 0!0;0L 0!A-PS@` pPl0 A/4@8!< 8!<́DchP/A-p`0PPQPEU `f @ T T@ @T@  `0PEpO-,0,M00@0104 4`Q : 01 $000pBpWʴSm0 0 0 x(,Ѝ0000 000000#![< 0Cq 0((04"<00 00000@ <,0@0,0VP *0C SUR'0 0 0 20 0 0 7PUPP(R 0 0 0 V7PPTt70P000010 00 0$() 000S *000 0-0"> 00$ 000K1 08#80$!$ ("(Q: pB$#400  ( 4"<0 0P 0( 000@ xP址0 0 0 娀000:, ,0@ 0,0 00800`P@ceO-QM00@ذ (0 Pp `G4"48#80SY:00(@0000NC10@00Yx0| 0 x0| d0S( GK00!>,00000408000S 0 0S 0 0R 5$@Pn@Pi,PP,0 0b m0 p0 0 &`(0S004 3SH0L RP0/P e0 0C000000<@0 @A_(0P 0(09_000$#$ 8$#, kH0 00@V0g0 00]0010k0R ``P[0 p0 0 3P 0LP [p0 0 0 @0000 0^PTp @z0qS>q(0[     Y Zp0 0 0 {0 sR 0 W [U PR LP dZ`R0 p0 0 \@0`0X0` sR 0 PP3 P 0^PT@P H0S Yp 0 0 0 +AP@0D 0@040 D 0  PW0p/T@PY`~0 0 0 p`0H4PS0@0D L`0@00 @000D 0ppW 0P0X    J0  #RV  3Q 0S# tPP X~014!0 014!~1P80S t80,3/PP t0 0t  AP* [ 0S% (WPP 00S<PP ,0 ,00,000u0 , 0S 3 Vd~0 0 0 o~(PW ` 0RX L$PЍ 0S80S W `w80,3/`Pr `p0 0 00S U$~0 0 0 hU6 3 lU~@1D!0 @1D!Y0  8U~@1D!0 @1D!~ P @4"4D 8#8Q ( %0%<#*T}@1D!0 @1D!}(P( 0<00 (0(DQ ,   40#0 @0AZV Wp 0 ("50 @000PP(0Sc}1 !0 1 !}`J`0<  )0 !><0 0 ` @0DPHPB`P/ 0P+0S( 0#p# 30S  tP3#3 1`00t0Ȓl}0 0 0 w}WpMpp3 20S ( ,0@0,0 (4"4 8,P#8S G04X 0R0  8}0 0 0 H1P00,0 @ ((,0@0,0 3  10S |10S (,00,00 ,0 0 0  /P%3  10S 00S ( ,00,0  (VPP((Q Ut|0 0 0 |tU U(0   0, Ppcecc@c@<"c%c(%cC-`!.p0MP00  @S00000GTЍ0S  Sp BS0S 0 00000 000B00SQ QR [0 TP R 000*A-PpU@(M \tPP7@2 000$30P0# 0CS0 @P0S@ `0P #R1@0S  2R`V\t`(Ѝ200S0@0 P@ 0 00S"00 0 P@* Q& 3S#`0VV;@ aP 0007@00 0 ' ^ R `1@ D0@ 0S 0 EP@`0  V1@ 1 0 `aR0C000 0S S Q ` -@V(@s@-0@ SP& S) S- T 0S000 Ѝp0S"`P 0P0@0008P00P 0  0Td0O-,M00P`Sd@ %S 4RN *P PG0$0CS00hP &0h0[5 ApP7,Ѝ  F [ 0Z'`V&[$ZZV0QZ `F` ,R0 FZ`hpd@(V 9Z`pP0`#0CS000000 CR0ŕ0S@@0S@@0S@@0S@@0SKKꂂ0 00+0 0p0VP0SJJ}P0SJJ  fPn$0S 00 <`$PZ1_P 00Pp PQ}OPK0SS @ģrS @n {?P;~O0P CR hPX 0 P$ ?!0CS0gDD R R D0$00  0&p 00$ .@d@~@@p@-@PP`p0Sp@\rPp@-@0x`S   !00C000C0PUp@\ R0 0 R 忆xdG- PDpȀ`H@Tp@W< 00C@S@p0S00C0S0 y@0D 0 @0D y @1!  ꄐdxdcxdO- Pp0`@DM!  0 @ 0,P(p$   0!0 0 040,P(p$  0 400!'>o@0 0 80,P(p$ ` @PFDЍxd@p@-@`M0P0@@ @0 [dP  <@@T 0200 R00C1 2"Ѝp@%@EcxdEc@- PBA@ꀒdA-@i70"0R S  B! "2 2R'2S0p`P"0#Q00S qPP@UP#00C?o2PAvxdEc@"cdO-Mp 4"4 $,$8("( H#8! CQD0Gx0 0 0 FCSC 00 Z V` "(?AT0&x0 4化 0 4x D`PEqx0 0 0 |x8 Ѝ R:F^x0 0 0 ixP R\ \ @ 嘕0`R =x0 0 0 Hxh Q 0 p" 0 崡10T01A0000W2SS}$@Px 0000 001<00 00 0010 !0 00001S0@0AL4000S0`0 ``0p `V 0000S0  !Rw0 0 0 wr0`X1p01W 0 !1Rp00ZY !ᲁ!HX ڴ!X  !( !! B! RA10C100C0w80< 0 80< w3 ~ 9!AQ ڴ! Q Ƞ,Ƞ B! RQ  p X! B!  B WZe 0R ` ``d1S 0 0}1`p[ |0R  B   B  `  X0- 嶀 q0(t"|p   0 ! 0 1C00S,00V(`8 v0 0 0 w-00    [  0cxddxd-//-/-/@-@XV-@-p00d0@ ` P d0 (00  0 W(0 10S(^-+ Ѝ1M  @-C0@@-?:@p@-@PR0S 0S 0Pp0Pp*P p茒d!>C-@pPM0 0@@ 0 4!4 1C 04"40X1`V T, 0p Ѝ0S0S S0S  S0S ST@`P 0 ], 0  02# |0R0@l@ Evh0l 0 h0p0l t 0Sp0 t vꌒdXd@Դ(c-/ 0!< 04 0 (   !/@cddd\ P/0 !8 0 0 (  , !/@cdddp@-@P<`+0{.`pq0T0 @0S0ppp@ 0@0 00S0ppp 0 dD"cG- @`$p…P0P= Y YH ܅,  Q. Q Q 3 ,10S  0 PR00@ 0@ @,(#(0 4 <8#80#Q0P @ᡅp0 0 0 p,0 Q Q 0@ 00S  0g(%cdO-@PDMpp4UXDЍ`0V V X `XV0CS0V  0 ;S0000 4"40HPV 0 ;S0@000Sg1h0 0#2S S . ,1. g!0ԁg. r V0 0O O 0 ;S0<00h1h00l1V 0 ;S<00S0 <00 @@@d@%c@-00SJ@ R  a``  B BM00C0@0CT厂@A-8AP`o80< 0 80< oPqW: AAdpT1WpT@dCAD@T@0PqTA0S 00S 00S01S *03PX!AQ1DAT@1T0@#H1;@0rAPqTAd$c$c %c$cEcO-CM0O0 0yo0 0 0 o Xj:0 <D0< 0`0SP% 0%* h0?P h0 QP%*8PU No1!0 1!YoCߍ PP 0P 0#2S S0 00S00 P0d#d 0h&h`F0P0000040 0#21VS(000% o1!0 1!o0S 0S0S0S 0S 0(``F 0P0000(0( R`F 00 RP 0 ( 0P 0(  QxPPUy (00CD0080D0 S  0Sw<P  0@0X0m\j8@`(0  0  00`0P@0@@s00 S000P 00 pP0n1!0 1!n  pP0p 0h0e0$0e0 p00 h00mpPpp`n1!0 1!kn0 D opP0Ln1!0 1!Wn;0S 0 SZhp%   $ p4"4$!$8("( #8 x:xx EP| 0080f L @000$000000 00zmpPdpp`m1!0 1!n0 0opPO0Km1!0 1!mT90S 0 SZhp . ]p.$ Yp p4"4$!$8("( #8 . . 0@ 0 @HX3 001HS00C8@ă#8"@ē1V0:8Sxm!@ ! !$ !$mp0`F001X00C @ģ1V/ wlmX1\!0 X1\!wm_ 000 0 jS  0Rk(wOm(!, (!0!,4 0!4Tmp0 0HX,v5mH1L!0 H1L!@m+m 0l1\0h1)  1R ;.0CS 0gP1T!0P1>/T!6040^;g0 0 0 go=00 0 !0R0000C000 0  0T R,;S+ 0C8#8S_ 0BSH00#V00Sn 1$ Soqgh1l!0 h1l!|g1P 0Q/ 0;`80  BR0!0CSlxQg0 0 0 \g\0`0`SY/4!40p 000C17 ;S;08C8S; 0  10C0CS103/P;S41,041jV0 P \1  BRm103/0(0( 010BS fp1t!0 p1t!fU0404 (0pCfx!| x!!| !f,0SC H!R 0L0CS86A 01R8B1 03/ W91X0C10 00    BR901!Wq0 CR 10 BR!0 BR1;P%0CS908KP(50!10CS0X110C11W0#4 500( 50C01 0S 1  bQ 40?0 0; % 0S 0;841B 0S 31V!0R1$ S *sf1!0 1!'f$0$ 10101\1S$05\150 0 !$10BS$!% <# S <0 W0P00J w 0S0 Bm; S1 00S220 0S010;0 0;@821921-1 PFj00000`0_Vx p>W  R0Q^:@(Tf ;SX 0Hd1R$0 d 010S h0 h0 0}w0 04 S0 70P0000  hR0 N000S!>6 l 9&00090 S   hKdD"cd@Ec%c%c,%cH"cd@-0  0'S(P L@e1!0 1!(e$0 Ld 0`( "4`#/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0:0@p@-P!T1PB1AP \lwX1+8T@1D01@ xSx0 S 0&; S0Ҳ;p@t@EcO-0M@S 0 S/p`V 0S?(<(PFP p( !R `0d  Sp3p# RppWO^hPPC D0S0S0S ግ PEUڼ; 0CS0!0; 0CS0!Z<0 0 0R0100 Xʰ\U 4cA00P4%4158YA00P8%8150<01@00D00S_ P0Se P.P%p0'T00Sg 0 0C1!4!R4!480P00L00T000(00 :0Py  10S00(|! (  0B00  00!0CS41a-V`!;p00\00  ;SP0PJ000S Vo`0 Sȃ0Sq0P i ;Sf1S PC0 PE 3Ucڠ!410\ 0C 0C?SPȳ(̟0S" 0  0 !!R: !BP: P* B R +X 0S1 P0;00UA(0SP kUP!@0PEU00(00H00S 0  000CsC Q$1S  A0CR0U,0 0U'1  @0D S 0 0S*0S\1U*0!00C ? ,0Se:, 0S 1,1 0C?SR\0B< SQ 0010CS  010CSPP8P90t%pwHp30 @P&QR P0S0S0S0s  `,B1S`PpU1S\PE8D0P H0Q8S;890P H0 8(/@0D S8D!00C S:08P0 RP 8P0STP 41R1'!0!0S01Q441q0\=0P0 !41\PRPePe1 _APBQ0CSP10B P0PCU000AQP180;V PF03 PE UV0k80P Po0H00(000S4 P08P, Y( 0S(0<080``0 RR PP  K . 1`P0H   0% &$!$&  @ f1l`hdX50S?`0`d 0P p(WA00 005`p1`Fh@1SI ` [) 1$00p RA$  p(WA0|a   0000`K |aa[%`$ 6 `)V/5p0S 0 00C00 0#Ѝ1 @a0 40K0 _0  W `4000:80U040<3 Oa00S0U0S- 0 0 0 2RapP 4 00S<07b*a024"0 024"5a p`)V00/0CS202000000 000000 0 Z00400 P 10Z1  PHs0QAQQ0 3SH L0SP0\ 00<  0CU4 00 0000 Z 0 S 0 0$00 ($ QbT Os0 oPe"cd"c@x"c4%c|"c@%cd%c \)@e@8%cdEc%cdl@`0 0 0 0 80`"pP@ t4 00S$,0 P1 0 0 0 1 0CS0 0 0 0 0 0 0 00400 80RHr8 ? Q pQ   AQ U 0 BRU RZ ȡ`X"\ X"\` ( @0% 00   V  `F? & " <0,"!R R 0 ,e!@ Q P00S",0(!Q", " "! BR ! 0R !$!,!  00 S(0S0 40< ,00S000S00!0 CR001H1S3cL0H1_004 0 004 _`HP 0R 0!S S{ 89P 0;t4040` 0(`Sy8d#l$0`(`0Sg0$ 000 000Sh!0 R 05P Pps 7P @0@2PS;S> l   '8P0S 040Q: Q6 @ Q1J0 A\-Pap S= O=0 c(#"$ c$"a8! #4 a4# CQ 0 CQBQPE`FPVpQ[4Ѝ QA0 B^0"A10IS1夑S CPP +0p IR GQ PUGPIQP0 CR 00 0AS0PP 1 0CSQ0p CRpp P0CS 0BS0 P 0 BQ000p CRpp%c%cp@-0@P CR@Qp00CS00CSp0@0CS@p@-@Q0  00/ 0 0C0 P 0 C\ C\ 0 0C0/1S/ AR/- 0 S ARR A^ 0  /|1 0/P/ 0`( "4`#/@-0(@+R@ A3QR> R+R. R !j1M  S0MX @Kp@-PUp@`z0P 4 )n0Pp`d  H Q1Q44!r010p@x"cp@-PUp@`[0P 4 \W[0Pp`d  H Q1Q44![010p@x"c@-0 1DJdd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-@0  :0p@-T0@00SDP@n <T$3Sp0p@Xee @x"c ))@- @$2)A-0pS@ S P0S S0S0S0s0S0S0sT( PU X( < 0S P00pPP   ( & 0R` R: 6P 06 00001 @  00(100p 0;00S0 0001  (,!( 0"8S0SPT0(W 0$ 0 0$ d 00!/dA-p`OPUA舮@T P P (W0 0 0 (W~0:0aP20 2 0 $080  ɽW 0/@Дd)dl4(p@-0P@(T1 01  (p@TdA-8pP(`@T1!01@@(ATd 0`( "4`#/@-0l@ S \0C# 000S  , \0C#  B  =0C=d@-@P 0;@0:\ P@ < 04 \3\#  t@Ec$B)O-m0@SM S( /`P@$00#.0#A0@.H>@$00#|/ 0 00 PU `0S l8P  7PPd%@-0@ 0@00 00@@V$$00S@ Ѝl@dd%O-4b@=PS)Q'Qm0S S8 > t00#.0#8.> p00#` / p\V 1  xQ6Q1!0 1!Q 9 W00;f1S 0 0A0 0g!P00@0@00=0=Q1!0 1!Q ЍO-0R:Q1 01Q 0SH 0 A SS0!\ 0 d%H%cddA-P`ATAAp@O-Q< NP0T 0 P0T *NPT1X! 1C1S01S01S0# 01S ;SM0 0 0 N01;S'P!T11T10P1000110H1;S0;0103/2_@P@删@@80 0 0I0P (P !ZPU 00! @0 0S@P5  @@Q(0s00 @t@@Tc!AA0S\0D 8@x+@O 00!L> 004p0,`(p008P$@ @040> 00!$0 0,`(p008P$@@ @"040= 00!+0 0,`(p008P$@@ @X= 00!/04 0,`(p008P$@@ @= 00!?0 40,`(p008P$@@ @y040< 00!P0 0,`(p008P$@ @a 040L< 00!Y0 0,`(p008P$@@ @J 0 !c04 0,`(p0H08P$@ @@ @20 400!h0 0,`(p0T08P$@ @@ @0(04; 00!p000T ,P$@@ @0 (00 !:H0z0$0T 0,P @ @ 040: 00Dʟ!0 0,`(p008P$@ @<: 00 ɟ!0 40,`(p008P$@ @0409 00!0 0,`(p008P$@@ @0409 00!0 0,`(p008P$@@ @040(9 00!0 0,`(p008P$@@ @z0408 00ȟ!0 0,`(p008P$@ @b040x8 00dȟ!0 0,`(p008P$@ @J0408 00ȟ!0 0,`(p008P$@ @20 400!00 < 0,`(p008P$@ @@ @040d7 00!0 0,`(p008P$@@ @040 7 00!0 0,`(p008P$@@ @0406 00!0 0,`(p008P$@@ @040\6 00 !0 0,`(p008P$@ @0 400 0 0,`(p008P$@@ @040H5 00!05 0I?0,`(p008P$@ @u0404 00ğ!K? 0,`(p008P$@ @]0404 00!M?0 0,`(p008P$@@ @E04004 00!= 0 0,`(p008P$@@ @-0403 00!S? 0 0,`(p008P$@@ @040x3 00!V? 0 0,`(p008P$@@ @0403 00!Y?0 0,`(p008P$@@ @0402 00!>0 0,`(p008P$@@ @0 400!_?0 0,`(p0P08P$@ @@ @0(02 00!=0D000P ,P$@@ @0(01 00!b? 000P ,P$@@ @080\1 00 !D0 40,`(p0H0 010 f1 SRBA{zB0 0 0 B0;0`1k 0@ @P a @@P T0S7@S=0f1,cdEcG-PU@ p@`R000S S @ ᰮ@( @@P0S0S0s000A-PU@ `#0pS 0S Q @@P Q 0@; r@P p@-@T P0`SkpS^=pp@-@T P0`SB0S2=ppA-0`SP-+@p0S" 9@@+0S ;2XR* 0RU 001000@0x7@A-`@pPЗ000S S/@X= 2D>4h ª@PP@`Pp%cؤdG-@pP1?o0` 2PUS!QT@ x`! 0P@ T @ PT` W <ZX 0,0C 001 00 0厒p%cؤdTdA-`pPUA@ P00@@0TPPp%c@-@@ 8 <P4@|h@Td(00S/!Q  B /p%c( 0P/ R/p%c0 S%7!3C" 3/0Q0@@/-P, , " " " " "    /@-@Q  088700 @0000C0%0 /0 0/%0$0 0Q: QA@/ 0Q: QA0//ᣋ. -%0  0$0s,P^ Q 0S3 X#Q R!0$  @XR5/p@-@`P@ VU2 %0%00( c&$00$0D0403$ 238P<`2%0 00$0%0$ 0 00$0%0$ 0 00$0 0400,0000(0(0$pA-l@Pp`$ $0S 0 p0V00$0000 0 hd0p@-P@@ UT0* % %  (R%$   $ 8 $ 4  #"#8@  R78 0S34 0S/#0R+#0R'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOV   hdxd@dddO-,MBP $X 0 L0 0qW `2`P1!0 1!N0000$0VZ0 S:p0*b 0`& 0 0$0  d1d ! 0!!aPPL 5PB  R;#0R7#0R3 DP- 4P'0 0 0 004 \1@0545\1@55p P PP50305 <,ЍOJ   hdxd@dddO-$M@ZPP $ЍO+10`V 0 0a0`2 Vz 0 r08800000W  S R  Qd:f"` 0'O 7"0WIt 0 0 00 H1 !0!!PP4 ~P3 E R$#0R  p  r0 C P 1 90C P 190 Q 35 5Uyv   p    4 P000hdd@ddȦdxdO-%0 @ x#000`0$PQ 34 8Pp0'r0sGs 0 S*06 $ 0"!" ! "  R' :#'(0( 00 0   QQ$Q-S$  (( 08800000$0 PP 34 D0 P:~ yPPp匡'r0sGs 0 S)05 $ !0!@ ! Q&#7880000 0   PQQ+QS+  (( 0880[000%0 0%00S0 0C00000 00 Ѝ0 P:hd@\< C-M@pP `؀0S  S*Ѝ% %0 0R z\UP RQ 0RW0 0 0 P0 /hdp@-PP@p`0@`TV@@Q= @%0% P 0 0%0P*0%0C0000}>0`0"#0 0 J/0`2Q 0S@@iV0 =A0 A 0 Mb@BA-P` S@|pG M @I(PU@T D0D 0?8cJxЍ 0@0$@ 12! P0 P $00S"(P,PHpWh P 0Xp  L0ⱴP L0 Qp%p :W 00USx 28 Ⰳ&0 N3T⼄&04` 0L 0jvp 0(P\j /(0, 0 (0,  $cP2!0$0岙PP4(/80< 0 80< (/"$TPP$P0S&2R0S $ S0S  S &1R (0  (0P0u pqtpW x00( 0 7/p P 0 0R: (0 PX 1/ 0$ 0 0$ (Xp0 0A0CS0 AAQ  ^0 V.QP00C S0 pApGW0pC-S W0ApCW 00 PR0 B Ye@-`P@M 8p.( .h`' .' `p0[6Ѝ@0@-ASS!0CS0Sf L%B +1QC%A 0 0 0 B:%A 0 0 0"1%A 0 0 0 0(%A 0$ 0 0%A (0, 0 (0, %A 004 00 00 Q Q%B 0 0 0 $B 0 0 0 @%Q Q Q$B $B $B $B d@@O-M @0(`PP5}pPX T60SH60S  0F00V  <⟩P 1  Qd7ZE$ 8$(0 8$($Pߍ0P0@`0 ;h P6hP 0S!00S 450S  .'%0 60S 40S  .&0$0W05DP_$C 0$ 0 0$ i$|40P2 0 R 0S ,40S 0  $05h   0P0! 30S .&0  #05x30S 0  X#0N;@0S ,30S 0  } #0^z00@ S1 Ko0 P [20Sy  00 ]"0nZ0 ((CTTPL20S 0  E,"0R5P@ R" 1050 00S  10SC  .7&0  5"0!0C00)5-0+0000UP[?DDy嶡410SS'z  fn j  e0086lBύd`0p0 0嗤P h傡}Py<0Bύ1`&c&c@ dT'c@%cc(&c)O-PM'U@50S xx50E00(0 004ᢥV(UM p0( (E20/S0㽥@PF ( p[((0K0:00p\(`)2P440P,0( HDP PPPH0 p,&PHkU! 840S .p^% Pp0cZ40/S0v@PЍ/PPL 0`00:00pPW |1000p7P( :0,PR0 <0L30 P0#1 PEP0: S |!  |!  V )V `F|!V.`2xtPp0P!7pwPP 0P` 87UbD200S F  R"`F|1V,`  [ w|1 000n 000f 000^ 000V 000N 000F 000>1!0 1!60!  ! . 000& 000 000 000 000T'cd@%c@X&c@O-(POM@PEhzP |1 00U0! 8$(0 8$(!|1 0 00  h0'S(A@P! 8$(0 8$(!|1 0 00 @00000 0S0% %` * D0EP D0 Q`%` *t 4@V   !@P 0 0`0: 0P,0 >0S 0P. `#,00 0P2*!(8,(0 (8,( !0儝B?! !'!X2 0HS%@=0S 0p. #0B. #20 0220SN,0H S00,H|1X1800S h0|00 R0  0⫥P 0 Qg:Y ,<0dPPW { 000;[3 00/U]  8$(0 8$( q|1 000  0040004 0$0[ 0$. [. o 8(0 8(z  (0,0[(0, |1 80<0[80<PPP @ 0 R 0 3SH0L0S 0 `P0@`ἢP@0 R0  H0P H 0Q:00S U   88<(0 88 4<($$0 4 $$ T#|1 @0D0@0D[ U%|1X0p t p t᪥P Kfx | x |vK|1 000U084(0 084(W(80S U8 U}P 0P0S0%0 * L0⊤P L0 QF: 000S 70PP4`tP*0S00S# g4G0S[ ,PP 0  3S H0L RPp\0p0pG4pGWfC400$0$ 4"4 8#80(00C(0pC0S0CS `p0<000SW 00S S6 `$0 SW`` W  0| rP  b0S|4 P`$0 S 00CSd50 0T%0CS00<5PP 0S `Brv ၡ0S  0R`%` *  P0ţ`P P0 Q``V 0W 0 yP XW(00C R  RQ p H0 \ ?^R(00CS7\HQ RS8000S4 >P4 80 ISp G0 Rʈ 0pG00Sp3```-P{p`dp8`pPPn ӝX((  (0S0  R R )02s0 (0נ0bG88<(0 88x4<(|$0x4 |$L(Z0嶐<(0 0 ?o2R0S (Pp"`210pWT 0 09 ~G40W02p P0P$0XDHX$0S5 BTy0208 X`p00S(0S `$0P0$0``P P P  0 40S PHX DH   0q0W 0 ~G pp<`Uᆜ0X d@T'c@@@@%c@@eYeYed,@ped)024 80R)0 280`0P 0S(0 0(0?8 )0 (  00E0 #R HL R\0P  0800B00V0080$00 V *2V481Y~I0(0 00980Y rW DpGWVY~I(0 0#R00 S( *00S 0(0 S 0S 0 0HpS`000`P P P0  0 80S 0S2<241Bt,0800}0 0 0 000 < $00< P000000CP100 $E$0 0`?`$00$000C0,00,0ppEpn|3( 0Wp' (# 0 4Ѡ04pp(p2l|1 H0L0H0L0S|1 P0T0[P0T00US bP 0XX|1 X0\0[X0\UIP UU|1 `0d0[`0dU1P QQ|1 h0l0[h0l'UPljo[Uz00`0S0% % *0 T0P T 00Q:00S' 8$(0 8$(2 hcOߍPp00,W0{ AWC +W_ 0V`0 0 d0P d00 Q:``V d@0P0^ 嘰0 0  _Pd|0 ~_0SdU 0;3W <W R00  X0⤠P X 0Q`:00S  3W Q  Qp R00  \0↠Px \ 0QB:00So  [00  `0oPa ` 0Q+:00SX ,Ro P_00@`:0000|000P̐Sp`0`0,09 492#0S  3/~X9`V"U d t90S(00  0 |S-g(|0 ŵ0S(h|忝0S80:S50S0S0S0S  P#0S0S0S0S  P R 0!0# U ῠpPP`d :0S(00  0 |,(|0 f0S(b|`0|0KVP0T 0S P0T [ I\ O-LMP`p췟 =000p,P(`$  :@( 0!0 0@D4p,P(`$  T70D74?00 0@008p,P(`$ '䶟6 09> 00@008p4,P(`$ 0406 00!6 0? 00@008p,P(`$ ʺ04086 00!?0 0@008p,P(`$ 岺0 400!5̵ ?00@ 008p,P(`$ 噺 0400 0 0!L5 ?00@008p,P(`$ 债 0400 0 0!4 ?00@008p,P(`$ g0400 0 0!4 ?00@008p,P(`$ N0 0,4? 0 0@008p4P,P(`$ 6 0403 00!3 ? 00@008p,P(`$ 0 400 `!;0 0@008p,P(`$  040,3 00A! 0 0@008p,P(`$ 0402 00 !0 0@8p,P(`$ ֹ0〲40 0 00!<2 B>00@008p,P(`$ 弹040 0 0 0!1 C>00@008p,P(`$ 壹0401 00!0 0@008p,P(`$ 勹0400 0 0D! 0 0@008p,P(`$ r0400 0 0!00@ EN @0@8p,P(`$ XC .o4o0@傖D0~Xho\XD嶶LЍ@)&c&c)'c'c\'c%c&c%cT'c@c&c d*p@-P Z@loh 0S Q0P@@@040p@5oP0op@ @0ꀿc%c%cG-S@`pp0 0 0 {0  `0 0 0 kX 'R 3SH0L0S(@PG  0  RV WV R R R R 0S 00) 0+P,0:S) 0R% * 0P 0 Q% *H*Q  8$(0 8$(Ѝ0 #0C?o231 P (MQMa   #RH L0S0P  0i@0 0 0 o0H   C/R00C00000T  10S q? G)0( 0 (  /R 3SH0L0S0T@P  [ [(`)p0, 0`1 01  (Hz d@&c%c(dT'c8@O-0p'S(,`(@P  P [ P [P  0 ЍO@ЍOԙЍ@-0  ˵ dC-0@4Mt02`PPQ7P(Rrm[V 00SS*4ЍCmm 1`1 VP Z0S  +4Ѝ+0@P 400   0 ҘP  Ym@T;mP XX9o@Fm  ~mXT 40 X`0d 0S S :H0$U0*`B 004 0 004 `Pd03/@%ccL) dO-ppP70S . 0'0000"g1堷S 0 qgǟhp`Lp DdxH\TPD c0P   0P 0 W4 X0006`  ఍1P ~H U  0忌 0HP80 >>0PD60Sh  .0D&0000  0Xg! 0R 1gZ 5% 0  P 0 >PBt50S  .R0t%0000L" N0L00 M0[0RTP ،P  HP! Ό4 X0004`  ఍1tP tf1hS 0 )gH0U  +HP ᥌0 =Pl f1S 0  gCP 3(0,0<,0nP0 dp p-0* 81$ <=40$0 00}~~0S`P L !X=V PX=$3`U -FDpKY @c;;P $0S(P[ 0SX0S `P H0S 0S PpPԀ pH0S 0S  PP H)0S  0P (h0s0 0000s0 ֵ000d0 8Q00 00 TmP 10S000d0 00崵[ Z 0Xw W ble?$2SD0CS^$XX H0W40㖜$&cT'c@ojuPiku( iJi(?Ni0Ki i > i ~$niji ߖ>> i i %i Qi Ti Hi l@ixYdO-pCMP`BTD@DTU  2SD0CS5UWPP0S0 00SpH@T D@DM PU v` Y` `$4RPPQ <Q H0S D0CUP PP8&c80S/A-3`A0ASHM pBPT,D@D?HЍ00S1]0 000S+gP' 00000S .` X 0V0 00h0/EsP]H@T D@DT0Ζ@&cT'cm@Ec@-@4@A-HM`rpPBPT쀟D@D6mn|1S  00 0HЍ00S"]]Z~E00S .`  ` 00000刖PD]H@T D@DTT'c@@-@|1@pQDp@-@P P oppp@-`UPUU49K *p:*:*:*p@-P@p0@`0a_9_yUwU Kp@rU00000pp@-@P 00000000p@-@ M Ѝp@-@UP0UPp@-@0Q$MG 'R`l P'RXB("($( 0t0  0 P *Q- R00S"!10!0!0!0!0 0$Ѝ@聏PAQ R000CS1L@x@A-`pP@2SD0CS+XN 40GSDV`#0F0F P@  P: V< j010#S0 8 o` o\Q\ X ^ QPQ `P H0S D0CS #S S %S000 00 00 00 00 00000V0S  0000%c%cQRI p@-`@M 0 C^.^ P?R1 9 000 C0PU'X XD XP XLXs }`0 0<000 KP`ЍpA ER PPC/C-40@SMM  S|1 0 0 0|1 00 0Mߍ R@D  Q *40S $0 MߍCS S #3R l40S `$09|1 0 0; 8T$ M`P2 p ⭲3̍a```0(1,11 0``1P l30S p#0~|10 0(0 S@#2q12D PP ` h2P<2034P09P 20S 0" IXU uPPP20S `"076$20S 00"00000000 00000000 ,JP1010 (1,1P /P \10S t0 X/3"p'qr 41PU ~_EU4X IX0X 4P X0408 0000 0S 0|T P0 D00S T P0PayQDZT'c@<@@@@cc@@^@@@eYeYe@-@ X3@6C*0O-M,00(` S@( ᣈ@P 0<Sᛈ@P 0R 0 0b"#2(1 040 b( 0/pP 0 K0 0 $!, i()Q"TiT% @ Q         R/ R !! ` , 2 0!%Ȍ 00 #8S  !> 0g00S0 aVP,d0)1PU  PP 0@0Ѝ R S 0S0S0S d07VP 00`'c@0SE0@-@8P<$MP 0S$ 0R R?P6P0S0S0s!.0  BP $Ѝ0 EPS0S ,0 @@/8O-p$MPhX$ P $ 0 00帤&h00 00000 0 #0 " "0# !! *! &!   ATX $ R  0 8/$Ѝ R9&R6& R3 R R R R'  P! R R R R  P0  {R 0  0sRd   @0O-M0 00S PЍ0`S0S/P0S& 0@Sp(00S 00t4 BPP 0SK 0SH0sEd0 0S0S0S0S090sX3#21208S- 00$`0D0 ` 0 X0P 0 Q S R `3CP W*0S0S0s0S0sY vj!>7l0` x0(0t 00` 0dP 0S10 0 P_04 @4帐3 4SQx ADV0,%S 0S0S0S 0 0`Pc0`0S0S 0sS0SQF 56l0S (0t00L0|0 t7P +i 00000S 0`( "4`4# :000[ MV' PU1P iP P1P0P`'c@c<&cO-p((T"\P ,w\M0 0X " %X " app@T W% Pa@TFЍ R0S d  &R&R W d   !PD @ j(E a0@1T  R0S d  &R &Rd   P @ R0S d  &R &R W d   PP @T R R @@@0S/ 0@-S0S   Q Q> (0# ,0# 0#$.$ ("(0  !R   0 1(0# ,0# 0#$.$("(0 0 (0# ,0# 0#$.$("(0 0 10)0# F0# ,0#$.$$("(. 0  " " "0  !R   0 1)0# F0# ,0#$.$$("(. 0  " " "0 0 )0# F0# ,0#$.$$("(. 0  " " "A-0@SPM0S0s  0 01k!0NЍ0:p|PPU1\Q:  Å0S0CT* S 5 A%CUPP`V\Q:Å0S:350\Q0``ÅQ:P0PC`RQP&b`Å0V0`RS``5U0X0`RS&`5U0X0`RS``5U0X0SPp50@WAp@-@08M S8Ѝp@uP`.p 4"48 #800 8Ѝp@ 0 /%c2>@- '@(㩠1)5HCB]w<A-P0H RP' @0D 0 @0D `p\ Q00P0SP 0S @@XS  00@dG-@Q M`@pI YF 0S BPu`0d 0 `0d /@P Ѝ  0/{PP 4@@ W z zPAR0 0 0 ]A@ H\-PH0S |1 X0\0X0\0S1 0S.0s+ N 0 zPP-TA  0S# UQ H0Q SppW |1 X0\0X0\z00AR@T dO-7|M#2p夠1 20Z800004SH000[\0# 0S P )T@P@ @\04 6PP\`VH0T40@P= 3PAP4/z0\00C?o20S T@PP Z@[V `VS 0S0S0S 0SG  ^5dpT5<\PP(Z1PL0 T NPRL0 @V ?PP ZR<5 #2!12|ЍPP`Z@&W 0S0S0S 0S PT ( >PP(0p0p4P0`UA_E0 0pUV: 4 8>PA40 R=`0\3d 00h0S/ 0 \>P), \>P#0 ,0R030S `0 8$0P```0s 0@0PQU A_EV 0S8=`=Y 0YXpf0p\ P0P 0  0S0s0s 0@0P0s Sꮠ0@0P0@0PD 0RJS 0S 0<0s0 X 0<< <R6R[ | r5h! 1Q4 R pX`0/=0SX0W08`0"p`r0s Z0@0P}SzRXy R QRX  #  RN 8`$0P$0GpR ZP@n@c8d8&c&cP P/Q|1 00/X&cp@-@PL0@ 8Ppx P H@fxpp@X&cp@-d0,`P( 0 0@M 0  0"` `P P!PP d0!3d04"4 6Ѝp(0 @-HL H  < @dC-騁M@t`W0ʀ 0! $t!0 l!d!  , !Q#PTPV  R0S  p0T@ @ @H@T0 SPPPPPU 0 0! t0 |  , !ЍQ H0R:H zP0H000H00@@cddd@d10SYp@-HMPH <0sHЍp$P 0 R0 $1aUH@, TPwEPH \@L00PLP P ,$P @ PP ,$P @T0U0L0 -/ꔊmuH@d0-C-0008`0,p($@ @ @ϔ'0404 00!E?0 008`0,p($@@ @巔040<4 00!I?0 008`0,p($@@ @埔0 400!>0D 008`0,p($@ @@ @兔0 (00!`3D0O?0 $00,` @ @l0 (00!3D$0R?0 00,` @ @T0 (00!2DB0>0 00,`$@ @ @>040`2 0V?0 008`0,p($@@ @&0402 0Z?0 008`0,p($@@ @0401 00^_!0 8`0,p($@@ @P "n0P @@@!0CC10@ T0 !0^$6'#c@!6r0LЍ R  RR  CB! ,0*Ŀc@`&c\&cX&cP&c &cH&cD&c@&c<&cT&c8&c0&c%c )%c%c%c%c*&cL&c$*`'c4&c)D)),&c(&c$&c,@.dd&cdc@-vPp@-0@0SP S S%p`0 0 0 0 npL`00000S 0  ^udO-Pp0M)S0 (0 (0wP  0Q*$g00 C0 0 0 Ѝ0 0⃱(0R`%(`"* (0wwP 0 Q`` `@ 00K R: R R" [" *  Brp*R[pW) 0S0K e0 0 0 p*0#[ AV0 0 0 at"[ R \q@0 0 0 K+0 0C 0   $!$("( K[@00Pv s 0b"!b! R 0 0 0 ,0Q*P 000,0 0C@dO-?MORH?d`Pp?ЍOH07JPP <,0 <,Tt|10 0 0;I( `uP q 0 G R= 9)0 9)|1 0000 0 0  0M 8>(   Yt PJ0 0 0 |1 0 00 0Hl9)0 9)R @ `=02F?! !2SP2M8(0 8(E8(0 8(0'S(s0 `R 10 0 0 <|1 0 00 1 R  RQ Q$Q Q  \| R\ |0 0 0 |1 0$0 0$ ysy0'S(sP _ p 00! !0(  NsP <,0 <, 0` 4P 0 0 0 4 P N4 PI40P0:0 00S1|1 000P8:pWP p0 0 0 @0D 0 @0D |1 80<080< n99LD00H00 \0 $0D#o$0pSB Ppph5l%0 h5l%7@<Pp0@0Tp겠PT(/ "R;( ,Ϡ ( 8 ,< 8 <`0d 0`0 h0d l 0h0 l ,0<0  .@P .@Pd@ T0 0 0 x $Ϡ  0 $4 0 4: 1<02 88#8CQ ##*3'$ ,[.P C0 0 0 @` 8#(#Q@;( <@.P $0R (0R(0, 0(080 , 0< 800 < a ((@z004 0 004 !iP "0 00(00*pP l0 3SH0L RP0H0 0AaT lP (@(@@42P@TL000S;  U+ . LP. 0#0;P00|;<3 0&&'0 x000C0吠Z Pᐠ唀"Q  3hi h3 ~P" $xP|;<3x0S00C0xP唀R P|P;e2`3 0  Gd7@-0@ Q)R*SP S yP0sS  Ѝ0 :R0S00:Sx@- @m00t0x0|0qp@-``.Q00S@P P .00/U00S00=U00S0t00U00S `P .001U00S 8P .080#U00S <P .0<03U00S @P .0H@0`2U`VppP .0p0pA-`P0 ,0@p4(ЍR GR*S # GR$1R # GR V R  R R  R  R R.c\00S 0S0S0S 0S0S v`A9PP.PQ  SV0  R0V0t0V0  R0 000 0 00=PxV0 Vr0So R/lSi0S 0S0S0S] 0SZ 1$PU0-P 7I0 000 0 00P>V1q V8 00V41-P 80 000 0 00PVR V 00VჁ#W<`p`-P kV39V0 SRx03V\0 R000&V0 R|08@r@`'c@-@0PS`pMN-P7 a,0 00000(000Ѝp@-P`5-@P J [P H-@p@-@PF@=-G-hMP pሠw@P0S( 0w$0 @@@0 0LP @ P 8P@9hЍRsZ ҿ0S @( @j0 ,0" r!.$  ,00( $@^P@@^`P H0 8@^@^Z 0(<$0G- pMS@P  )S *@B pGWP P @9pd@4pcP P*0+`0G<S000 000 0 00@Pv@P9WgWl;pGWp0  R0@pЍ d0R88d0 A/0 d0R88 d0R77 d0R77 d0R66 d0R66 d0R33V  d0R116S0S0S|0Sy0Sv d0R99 d0R55p+0 @@0 0E@P d0R55 P^v@PY A0:P^v@PM A0 +P9 ?v@P +m7 A 0h@`@`T +@P 8@`0`0000( 0CS0 PvP`PP  6P 0'3Sб100S@7 0R;0S8@T5+@1PuPP0  R00sh700 uP0S0ĕ07#2120 000P $0 (P &@$0( 0 ,0s phb P>6  `V 3S100 $Z"PpW0 $ P 0S 0 000V $@P p4 muPr408 0<0sp!bfD\ 6P` P  "PRpWO V 0S  P p 5XpTP04P hq!P`5X00 *-0E)u@PN0S S Sd04M d044Hd044Du@P7QWW > 40SKW$It#0GS##pc`V S19@ 38`8p40 00@=0 0 pG=g' !4gt# q@ @(0`0(000 @0R] TQ 0# 3SH L0SP0\ 0p<[ XZP Z0 E^`0d 0 `0d u< 0CS00S  00 "^ 0000 000(4"<0 @  <  R  T     0Q T < 0Q T{ +  @ @z3(`Th0`0T :`0d 0 `0d DP ` @0S 0S0S0 000 `0 0 (-P@]p+0S  `0 0 0 X0\ 0 X0\ <0S 00(  < X; @0t SH0<0R800 0 S 0 b8 4b:#000s 0@0x8000S 00< D0/PP`0D0H030Sx1S800X 0Sx1S 2P D`@V<.YPP `0d 0 `0d m0P?o20T00S |1 P0T0P0TD0S`dp H PwؖPl H0Rhtp H P^ܐpPT H0RP3{Uyh d00l 0p 0q  $>ⰐJύd0x/P^ Ԑ[  Jύt0h/oᩒYL 50S .d D5`%3 1`00>Xu`0d 0 `0d V |1 X0\0X0\Y1P@ DL P@ Dg `k,P T`0d 0 `0d P5QD0 S 4 R000<0R00o @ 0<01 S@<0SD 3Jύ$ 1T0 P08\XP T`PH00U@P  Up3\3:$R*PX&D0S W U0X x0S 0SX x0S\[ Y0S L0(0@ 1P>LPpm0 @JP@0S~R pB<,0 <,MU@ T0<<0 |1 0003S R$0 0 0 /T |1 X0\0X0\3P P x1S 0S  @I0S 30SR00SN <1 0R00S  @ P @p[D<cW<0PpWT0[ O00%UߍT@PUPe\c X ( ,0 <"  W hP0 0 0 (P@c@T&cT'c@d'c%c(%ced$" 0@/D0Q0*$ PP刣P0<1 0.nTYW=0S RG 80P 0P @ $(  $L@ 1,PP0 3  10S (10S @ ,000,0D0 00 "p_mS Q<0 0 0 GP U*Q-0 0 0 8Tt |1 h0l0h0lk00S p0(0 0 0,pGT2UpppW@00(00S1 0  , @P,00 #  " R 20S @P,000,0 8#8 0 0C400ZT, |1 `0d0`0d#0S ,0R  0    0lVP@#s7`0d 0 `0d 0@0 p1Z@PWTp0t 0 p0t 0 0048900(0@0(0l4 000$0( 0S0 E\P 0X    @P 80UP  80  00J04!< 8Q#8<000,0 pA00 0400(4"<$ 00 \Pu @0 0S @  ( 0x0| 0 x0| )T |1 p0t0p0t,WPpP @0$ ( 00/ 0$ D000@ p@PEvYV0 0 0 V |1 X0\0X0\APP/80< S001R  ! @0pS001P0/03" /@cQ/C-@M }0(pP `Po T0P4`@0!Q8P=A` A0P4`8@ЍEc@B(0s/@-@$T@ S0(0cO-2CS0J-0P00%U?0T000Pc)AT ~ODT@O00C0p/@-0@0,M`S6S 6Q0C?o20S >,Ѝ@ O@0 P pt0\ 00 00P p$p_ONN|1C9`&cp@-0PM@\`P ^(0(S00 S 000 |0 00@X0<8@400 `4 L@^PЍp0  @`容@C-1q圑1!M0偈}'#2a12d1P@TAOD23"`&ab'ЍXAH$0s! w0@0P PR'z#P$'@TP $@T$0s v0@0P000]0 0 'c6T'c@ d6@@40GS #S 5S S 00/S S S/O-0MȐS `p( H5PG PP@P@P 0PUG0HЍ0W 0 0S0V<002101@0` 0(00WPP00d YXpp Pk p0,p20 Y (0 0(0000@⩓0@00 A0B p4(4( :00r000Y0ppH V |1 000|1 000AyP4T$0 P4T$HGzp1p 04 0 0$00 $0 P HFJf<14p0,00 0 H0,DVP 00S  .p p0 -iP 5p(0  pp0(00 00@0q@0Ap 5 Bnne dT'c4@A-0 p003A0AS@`?PE%DP  0  P` Ѝ@-PP>-@-B@-Q1M/ 7U@-@(0((0M @X)UA-P0p`0`A@P( d 00S(00  0 : 0 VPP@ >>x80< 0 80< 僻*UЍe-/p@-@4P(p   0 08p0,`(P$ Z 0!'> 4   0 08p0,`(P$ Z 4 0!0 !'>   0 08p0,`(P$ Z 4 0 ! 0 1  8p0,`(P$ Z 0!t 9@ 0  8p4P0,`(P$ @sZP㾺$0DЍO詈@d'c%cdt^)+e0SWG-0`SMP@ 0@S>PD PP 10SЍU8 0 Sp* ( 0R*Tn 08T 1!00 PX100!L7<@ЍV0dS*@P6P@P0S S @d0C0CV a?V0|0.2Vh 1CVQ^ Q^ Q00`0V0 SBp (V@  UT 0S p0S1 dЍp0L@p0S1 0    R+#  k0S  0R0S7 P-xrxr 0$0Q Q Q0 S0 P 0$000zc}fUcvtUp@- @{ ` ?o2R0S@ P(U@P|0(S  P@p 0cC-xM dpU{x0P @0@T@0S7@ rP !@Ѝ`@0S@X '#@0S  @ @P ,@ R0STQ S0#S@1@!  % @Pcp@- z@P$ P0S `  H)`Xp` Q((`,y%0000x0pccPp@- @z@P Pw00QpcTA- Dz@PP `^0SPU PကxP,p %p0 PᓩP(P=py PP  Hp.hpj Q(y( %!00x000V Pcc+A-@P`p , %$Hp0S (pP >7 2A/c7@-@HH IP 00 0   t0$|`"TP @⼼0  P Ѝ0AA AAp@-@ DAP`x0 Ὲ᜼Hp4A//C-M@ Py0P@h !T@d  Rd*  Pa Q^` V P RW R Q RP  0  @F V 㱨 `/@P5pW 夨0p  /@P s 0p0 00 0@ | T@  Q 0 0@W vV  qЍ@cI@- @00C0LeXp@- HIyP@@U:p0003pcep@- PR@0 0S   Tpp@+@00 ⮼A-`ϋPp@T 0V `000A00屻@0@-$M@P 5z00 0 0Pv$Ѝ0+ 0Q @-/pA@-@T  0L^ S0   $@Ѝ }AApAs@-P`@P0 @Ѝpp@-P`@P @pp@-P~@Pv p @-30eP@- P H0S <f0@$0S ^[l'cP+ep@-@PQ000p@0S p@-@`PQ0P00p@0S G-@:p⼠P0`V S0PP@p R 0 pWppU 0 0崺`G-(MP`᱊@峊vpP1孊ppPHq  )y0 0 00sV  S1!11%*X!:Qax|0SxZZ PU  uP<]K\D1 P 0$1;(ЍᢔpP [tpP បWRtPMtPpGtPpqs0 *㄀P  7/P T0y P #0!AA+yaraA.A+AA++0@-@$MP Q: |V$Ѝ0 P 0 0000L000@ 00Ѝ00\y P wA5+A-PMpP@ᄂ`pcP0p0  pι 0 P(嗉plj`‰ ujPV0 80;x0V404001 0`,@ɉ1$00(0$0ƉP00 ROPPЍA%p8100œ`Pœ8 jP < jP<D0@ j0P@0D0,0$ jP0$0$Q  HJ<0#S@0S  R:t,0S⭈0H0 0L04*PЍAAAx+AuAAA%A0A:A@-@6@-  xPZPZ   xp@-@`PP 巊Pd00 PpPpp(00S0000S01/cc0   (0S"" /P/@-@0 sw 00@-@ YoBA-Pp`@P@  0S 3/@P @- @R 2/@O-LMppt0P|0 0W0 2`@xQ [Z 00Z 0!) Z7 Z< $0r0# $$00 } QH00$C0#t p0$0 "0 aQ$%00$00 @p0 ;/ LЍ[ 0 |LЍO/W5  03/P 03/ (03/P Xo `100@r[ `[0@X" Z V@ $0I3/PZ0A@ 03/P  03/P Z00S (0Y3/ 03/P @-0 0  00 0 00%Ѝ-$M1(0  00000000$Ѝ@-  0Ѝ@-   0  0Ѝ@- 00  0Ѝ@- 000000 0 Ѝ@-0 0 00Ѝ@-0 0 00Ѝ@-00 $ 00   Ѝ@-00 $ 00   ЍP/@-Q@ Ҿq ;AAP/p@-@P03/03/  03/pp@-P@`03/0 V p`V pp@-@`03/ 03/03/PPP03/pG-@0Pp3/`0 3/ 03/`P` 03/ 0`pW0 3/ p03/03/q03/Pe03/03/0 S \`G-@0Pp3/တ ` `03/B03/TP `303/pW⩐03/& 03/7P03/ 0``0 3/03/03/  QA-p@` x0xS  &0 A Q*PP Z%Z@0 !P0 0  /TAp@-@P`P $0 p@0/pO-PLMpt0  0000 /u @P P40080d(׵4004000(p00040  00(0C00姶LЍOk µ0 ;40 B0 0PS40(;40叶LЍ8pW H0q;/P 1|! 0,01 0 :?<u3Q#3?P [@P # [P0  R= 080#80C?o2S>^N0 7/,0@ 3 #R(0\\Lp>0 0,00 <0\]Ec3A,+A-(@  0 S0000SA} 0#dt0  ~~P ,0]@[ 3 [iL0 8/,0@ (0LP0 5/(0LP0 A/A7@-@(0HPށ 05/0<0(0LPӁ0 5/040 Ѝ07@-( $ 0# 0@ Q 0HP币 05/(0HP封0 5/04 0R40 8 S0S 040 Ѝ0s@-,0@!;90(0LP刁 05/}_(0H`0 6/0S\PU 0S , P(0L`j0 ;6/Ѝpp@-,0@"Bmb3  0 /"#B^plb3S 0 (X"1BN0b3 Sf:   080,00,0 0 +!;B4a3S 080,0p0,0 0 !FBda3   080,0@0,00<0 0 00!UB`3  r 080,0p@0,00<0 0  _B`3   0 mBշW ,0  F05<0AA/Al+1AAAA#AA&AAA+AA0A*A (Q-/@-$,0@< [p@-P @ Pp 0P0 C2?0S Dp @7@-,0 , @(0HP 05/(0HP0 5/,0 0 1! 0 0Q+R ; S@R   Ѝ0;   S@@@ 02#/A3/@-4Pp@-@4RD00@00pA-p 0@(P@pD0(0 `Hl 08/(0Hd 08/0@00@0(0HpW0 7/0  D00D00@0Ѝ D #D  i 0 D00H (0H`: 06/(0H`2 0 6/,0`p@5 3 2 (0H"  08/(0H 08/ D0   6    60  R  D0 R  <D0 !D00D0000  6 60 60@6 0 600@-P pAA-@,P`V(0Lp~ 0U7/AA-@,P`V(0Lp~ 0U7/A7@-@(0 LP0R0S~0 5/(0HP~ 05/(0LP~0 05/ Ѝ0~ 05/(0HP~ 05/(0LPx~ 00 L7@-@(0LPk~ P05/(0HPc~ 05/(0LP[~0 905/ Ѝ0pA- 0`@(P@`D0(0 pHF~ 08/(0H>~ 08/0@00@0(0H`1~0 6/  D03D0 I 0 `(0Lp~0 7/(0H`~0 6/0D002 (0L` ~ 06/(0H`~ 06/ D0Q Q0 0D0Q0 D066D0 5;D0@D05<Ѝ 00D0G-P`~@p븒  w`<0 000n 0C2?000(p000,0}P0l0}P0m0}6S t _P p ^Pm0S x ^P| ^P,0 1 1RQ0St1 ?SKh1m$ CQ0$0$003/(00HZ}0 9/3 0 3 P(02HK}0 8/,0  j,00,0388033883m0S t0 0 h  TߴGD0pAA(ABAKAcAjAAAAAA A A5AAA-@8P`VA((0Lp| 0U7/AA-@!}P] 0(S4 (S lpW ,0 t0ht0ht0  t0ht0  p8R 0S(0L`|0 6/t0|ЍAF0SS (0C S0.SgpW (0L| 0V8/00S(0L`| |76/(0H`| 06/(0L`|0 ;6/(0L`v| 06/(0H`n| 06/(0L`f|0 ;6/(0L`]| 06/(0H`U| 06/(0L`M|0 <6/\0 0CSXX&23T Ѝ(0L9| 0V8/pWP(0L-| 0V8/pWHK (0L`| ;6/(0L`| 0 6/(0L`t0@ | |56/(0L`|0 6/(0L`{; 6/{ (5(0L{ 0V8/pWm0S p` $&8Q8 R(0L{ 08/(0L{ 08/(0L{0 8/(0Hp{ 07/(0Lp{0 07/(0Hp{ 07/(0Lp{0 07/t0 (0Hp{ 07/(0Lp{0 07/#:0`VS (0L`{ 06/(0H`x{ 06/(0L`p{0 006/(0L`g{0 6/x0@ 7S (0L`Y{ 06/(0L`Q{7 6/(0LPI{0 5/?Rd(0L`>{ <6/(0H`6{ 06/(0L`.{0 006/t0 (0LP!{ 15/(0HP{ 05/(0LP{0 05/(0LP{ |15/(0HP{ 05/(0LPz0 05/(0LPz 15/(0LPz: 5/(0LPz0 S (0LPz 05/(0HPz 05/0<0(0LPz 05/ ,0 wXAAA TA@A@  WW Pp Ws@-@(0LPz9 5/@P(0H`z0 6/0 nPUЍp:A- 0pP(@@pD0(0 `Hwz 08/(0Hoz 08/0@00@0(0Hpbz 0 7/0  D00D00@0Ѝ D #D  K 0 D009 (0H`Ez 06/ D0, R0  R3  R/  R6/ 0D00@0 R  R  R6060D0(0H`z0 6/0 D0< D0 ;D00D0660D06600A- 0`@(P@`D0(0 pHy 08/(0Hy 08/0@00@0(0H`y 0 6/  D03D0 ' D0 0 0D0(0H`y 06/(0H`y 06/ D0  66D0 D00D0Ѝ0A- 0p@(P@pD0(0 `Hy 08/(0Hy 08/0@00@0(0Hpy0 7/0  D00D00@0Ѝ D #D  8 0 D00+ (0L`ly 06/(0H`dy 06/(0L`\y 06/D0?, R 0 R0 066D0 pD00D0 R0 0@ 0 0A-@40$003/,0 , R^`P(0L`$y0 6/(0LPy <5/(0LPy00(0L`pv 06/=S  0"Sp!A@-eP 4"AG-Pptv@`V᠐<S O pp<0 00(`0`0$00,0V$003/(00H$v0 8/3 03G4"As@-,0@!;90(0LP v 05/}dP(0H`v0 6/0SݵPU 0S , P(0L`u0 ;6/ЍpA- 0pP(@@pD0(0 `Hu 08/(0Hu 08/(0Hpu 07/0@00@0(0Hpu0 7/0  D00D00@0Ѝ D #D   D0 0 00D06 D0D0D07@-@P B 0R  0"S44 0"S (0HPsu 05/(0LPku0 ;5/ Ѝ0$03 0 0"Sp0"A@-_P 4#AA- 0pP(@@pD0(0 `H:u 08/(0H2u 08/0@00@0(0Hp%u0 7/0  D00D00@0Ѝ D #D  0+ 0 D0 (0H`u 06/(0H`u 06/ D0 R60 R R6 0R R6060D06G-Ppu@`᠐ + pp<0 00(`0<0$00,0$003/(00Ht0 8/3 03G4#Ap@-@(0LPt0p@ /7@-@P B 0R  0"SAA 0"S (0HPt 05/(0LPxt0 ;5/ Ѝ0$03 = 0"Sp0#A@-lP #AG-Pp{t@`]̐HZ [ p<0p 000 0C2?000(`00l0$00,0R$003/(00H t0 8/3 03G#AA- 0pP(@@pD0(0 `Ht 08/(0Hs 08/0@00@0(0Hps0 7/0  D00D00@0Ѝ D #D  $ 0 D00 (0H`s 06/ D00Q0066D0 D00D007@-@P B 0R  0"SZZ 0"S (0HPs 05/(0LPs0 ;5/ Ѝ0$03 V 0"Sp#A@-P $AA- 0pP(@@pD0(0 `H`s 08/0@00@0(0HpSs0 7/0  D00D00@0Ѝ D #D  0 0 D00 (0H`5s 06/ D0  0  0D066D00D0G-PpEs@`'᠐$$ 7 ⼪pp<0 00(`0H0$00,0'$003/(00Hr0 8/3 03TG$A7@-@P B 0R  0"S 0"S (0HPr 05/(0LPr0 ;5/ Ѝ0$03  0"SpD$AA-Ppr@`岩Mp<0 00$(`00,0< R A p0,0$003/(00H}r0 8/3 03AI8%AK%Al%Ap@-@(0LPfr1@S0$0|$ Q`$003/(00Ho0 8/3 03AU'A'A'A@(A (A7@-@P B 0R  0"S 0"S (0HPZo 05/(0LPRo0 ;5/ Ѝ0$03  0"Srp'A7@-@ 0S ,0 (0HP)o0 5/0  Ѝ00(0LPo0 ;5/금@-!P (AG-Pp0o@`᠐` s ⧦pp<0 00(`00$00,0$003/(00Hn0 8/3 03?G(AA- 0pP(@@pD0(0 `Hn 08/(0Hn 08/0@00@0(0Hpn0 7/0  D00D00@0Ѝ D #D  ( 0 D00 (0H`n 06/D0 Q6  60D0 D00D0 6 0 6007@-@P B 0R  0"S 0"S (0HPUn 05/(0LPMn0 ;5/ Ѝ0$03  0"Smp(A@-AP(*AA- 0`@(P@`D0(0 pHn 08/(0Hn 08/0@00@0(0H`n0 6/0  D00D00@0Ѝ D03D00D0G-Ppn@`ᤐ + ⑥pp<0 00(`0<0$00<,0$003/(00Hm0 8/3 03(G(*A7@-@P B 0R  0"S__ 0"S (0HPm 05/(0LPm0 ;5/ Ѝ0$03 [ 0"Sp$*A/G-PMPm@뺐 Ir?p`0D P D 0SA 0   k<0` 000 0C2?000(000$000,0g$003/(00Hp5m0 7/3 0 3 P(02H`&m0 6/PЍ 0 ɤ*A*A+A*A7@-@P B 0R  0"S 0"S (0HPl 05/(0LPl0 ;5/ Ѝ0$03  0"S po*Ap@-P0@ P@T0 0pep@-@X0S LP0@` P$P(P,00PP00@@p@)cdL,ep@-$0S 4 @,P R00 p@+AeeA-@ 0S p`P@UT P T 0R: $ $0R@pP@@p0<0 0S 0 0 ` 0$00$0ee@-@Dq0 000(S   0$00C$0@ep@-PPL[@T  0R 00 0 Tp03/e 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-4@P0 P0  | peN,p@- 0P@48<0 00 ` 000@ 0@0 0 ,0 0@0,00000003/ 0pP 00 p@ l#,+AA-@pP R00 0`0C 0 0p0 0 00 00S PP0p 0@@@ mAZ 0 #e@- 0 8 00 00 D R 0 Ѝ3+AeA-p0S `P ؛@P D ZX U nPP @ 0@P4 0`e@- 0@ @u0@ ޛe@-04 00 ( $  0 0Ѝ`c9+AeA-hp0S@ @`㛔PP @ s@P 00@0 @Pe@- 0S Z@@?+Aep@-P`@U@p 0RlP PE @-N Ѝ/ 0p P/0S ///$0\1(0`10@1/@-T 0S 0S 0S 00 @0 4/Ѝe(00S @- 3//e)cp@-LP@0 S   R 2/$0Sp p@/eA-P`P 0003/D,o@p 0 R @T\j$0Af+AA-@4P. 0S+ 0QP0000`0 `06/#P`gp00 g0P00U000tW,p@-PLj0@ j 垞  p+Ap@-P@`1U000000p@dp@-P@ ``ԠUPEPàA0@00张00 0S 崠p@屠+A+A,A ,A,A|p@- @l!`P,AA-`Pph0P @R0PP0s$040000U0 40S R p R@0X 4/#P P A[000 A[,A},A,A,Ae`,A-`Ppth0崟PЍ@qU00004P Q嚞 !R 嘟P000U00000SL0 H0 0S800 `8/#P  ЍAc,A -A1-A`,eA-`Pp&h0fP@QW P UP0stN040000U R000 0 & 000 At[-A}-A-A-An 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddA-@0 A`!(T00QU0X<000hp 0`0h   8/`P 00h  P 5/0P00P 0<00QhB,cEcQA-Iq@PT`B 1Q@ 0S= 0 8 n40S0400O 0 a0Pp 0 R   8/0 800@ 4200 03/ 忝Ѝ e-AA-Pg`@P p0S`V P @-@0   00@A-pQ0@`P VP0QjhP `O-Q4M`0I@PT`C P= 0   @ i0@000,  ( @$0 4/`P# 00$0 0,0(0@ 0 pS0 @ P 0  03/`4Ѝ0@00 ;/p 0 T 0 P?o21 0 @40pS  0 8/04@_ `O-RM@Pp8; S 0 0//8eQ/p@-0@P 05/0 00 p@/@-P@ $`$ 0 00' 0 0,00$(00400p 0$7/P 00 004`$00 0(0`0, 6/P400 Ѝ0$0 0(000,00 0S 4 3/BQ;Q%Q 0Q0 .0 /`0<AQ0 .0!0 .00 .00 .0/.A5Q0 .0!//0 A Rh0 S / l0#"l 0 S 0;Qh0 $Q  /1A-3A@Qd0SЍ`0 p 7/P0 U:D0C` 6/0` 0d0P`d`VpPPPEu0V:0` 0d00 00CR00p 08/PED0 P0 5/`@ 0  E08/`0SP 0Spp`Pp/A@-0@000\P 0\0`P 0`0P 00P 00P 00P 00P 000T@\e\Q@- /6Q@-A/%Q& 4A0&S0&Q  @-.0 .0!/  / /A9Q/Q$Q !0AS h00 S 0;Qh0 @-&Q>0AS/h0 S l00A!lTX 0 AQ  R 5` R  R  d    BQ / d /O-`<0@@PpM  d03 8/V䒟䢟0 0 0S<0@  d03 ЍO/`JK[۰ 0 SW0080S0C 0<00<00\ d0P22,c R0 A S:0Q0a BQ00000V 0 S0 0h0S  RG <0! !R[00<00<0  2 R. . !R p q d 1`Q A02 ";/0 Vd0#0@000;/0 d2!cR 0 . !<00~1 803/JЍ/A0/A0S 0S Ҡ /tQl0S0000 /`0@-<040@@0D00TH0$0L0 0P0 0X0\P  0 00  00 0 K0 R\ 0Q Q Q/@-@0 00<@ @/@-0@ S;? 00 S;?0@cQp@-@6Q 0A R p27A,Q"S00p|Qg nQ` oQ00}Q[ ~Q00P( hPl4KYp<0<<00000@00D00H00L00P0001010 1010001<0  00000@00D00H00L00P01010 1010001<00<0<0000&\ 000000}00T S tS0C0`0S  0S 0d00 00CRb0`0d0]( hlJ p'00(Ap,Ap ppF/A/A@-PP@ p`E (0 0 000@)$080 \ P`dP      Ѝ\e@-0 @04 80\0`0d000000 Ѝ\ep@-Q@<0 Q Q!R0 ,R0Q *Q !R0 ,R0!R0 ,R0<0p!R 0 ,R 0!R@P ,R@PS00 `@06/Q/!R<00 ,R/<00<0/A-XP@U`1P3p1:PEU`p0T 08/`0S T ]0T D08/`P T0 PI`0S  0S 0d00 00CR00d0A-X`@VP1p1:`FVPp0T 08/`0S T \0 `TD06/`0S T I`0S  0S 0d00 00CR00d0Q@-@( Q`Q Q>d 0D32aP2"5/ PPEPEU+0 pD07/`P!  00]I R 0PD05/`P  MI0Dd 0P2 5/`0S  0S 0d00 00CR0 Ѝ0 PD05/`P  0d0Q@- Q Q Dd 032a@2"4/ЍD0d @02 D 0 @0C-0 @480tS$M ?S +@0C4S00*SS *S *SU  SW $Ѝ*S 8$ЍC?*S ! BS;  SPh`h0S! lPP*S7 l$ЍCbPh`h0S, YPPh`h0S, PPh`h0S! |Pl$ЍCl$ЍCd7 l$ЍCkl0S d8 0TipFQ D\PQ R00)P _  8 0 l0d S031` SP1 P!01cQ2 `"6/Dd 0`2"6/]0T lR Q3 CQ0C` 0C0R 0S 0d00 00CRC0A0d0>X T0l0 0CS 050C2Q30CQ  `0 S d031bl0CQ3S   l 0R 3R0C0C0<00<0l0 S0C BR 0 l0<S03 TX AS` R  R p0d S031"S0!0C0< S0!C TPR:X`R*l0S03@S10B!0FL\X0T TPX`0d 0l1cP3 PP1 P!1`Q2 `"6/d D02!e`!1ClQ3$ЍColQ3$ЍCld 0Q3D32`S0!2P"5/0S l0S ! 3\0P0C0 SS0s Qo\0Cl0S ekl0 S0C BR 0[l0S SV \$ЍC)G\ 0L0HPLPph Q@0 0` ` 09/P5 `` 0` `  0` 00 ``009/P0@0 0l 1R1R aRYRPRB0dBPP\pB APR40@0D0HPLPpPPPPPPPPPB R p\&P A Rt 0$P(pB R p\P A RtpR  p \0 AR00Ѥ pl0S0D!0 0 c  8l0S S S< 0T 0C 0 S S w o s p ml0 p S03S0!R 0CQccPW< T0X00\0AJ?u&p$c>0Al?p$?1A0A1A 1A1A1A0A(1A81AO1A31AA1AH1Ap@-PUpU- @\ F0  RS\ 0  C00p  /R 0 B P S@S00S\ 0PC0响 X1AA-@P` 0!0`3/V0p4`e%n 0!0p3/ W1Ap@-@P 0!0P3/UPd` 0 0P3/ UP8` 0 0P3/ Up@2A3A; S h20/ <8#8SA3=8#8SA@A$210/>08#8S1AAP00/</ >8#8 S1A0A`01Q#0CQ 0CQ 0Q|1 /p1A+AQT1P1L1H1D1@1<1 01Q 0CQ1AA Q>08#8 S0AA Q0000/000000000000000pe4A/x5A4At5A|5A5A5A5A5A5A4A4A5A5A5A5A5A5A5A5A5A5A5A5A5A5A5A5A5A5Ap 0S S"0A(0,D R  Á(,//0C-DM (00`p@ a<00,$  @P< (0PL @   p  a,($00 0@< DЍ6A*c<0S/@-@02@%cSA-@ S t hP`p6P   03/@:NT@@AS6Ac 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-@p`P p@@0S/p@-P @ 00 R PD  q@ 0P4p*c,@0S/@-@@q0@04@O-D0X S(@3=:Pp `0V. 0 V0lf`Cx @ UV`@0  A0@0000@Y 0S@ T`` 0@,`@[ L#@080 0 @P >6AA-@PpOA@` 0 RX@)A-PU 80p`h0@6p_6A @-@V80S 080 <0S4@A-P0 @R <"p0CS3 :  `pWЍ0@ 0p00000P Q D0S/0D00/ 0p P/0S //p@- 0P @@ @ @  0@Spt Rpl p 2/ 0t@p@-@[TT00@-TT00e/p@- MP@l T`[P 0 R V ,TL ЍpRV RW SW lp@- \`PdA0S@0 00P00CS0p> p c@p@- 0@PEAPP  p@p c8@- (@2APP @ c0 000/G-P`SP0@x000000S0Sp 0pWG0S1h0$h00h뜐 . \.h0  @0l0 0p000000t0h0VP ׉h0|0000(00,000000S 0$@j TP KS]Wo P h宊0\ PL sP8G螊*c7Ate,7A*c/7AB7AM7AO7A,`7A7AC-M`MpP0CS5@V7 =5V 4V! 4V 4V l00 04V 4VU 4V|@0000 0 000g|4V P< S0< S < 0ShPQ(4V^ 04V $4V X 0 p4`P  s Uh Y3Vr 0V`Qd3VB \3Vt T3V |@000000000 0 0 000`2 l00| 0pލЍC/ 0     0 0 000l000`Be0 0000 0`P0B ލЍq @000000000@00000FA0 0000 0`PA 0S*` ,@p 0S 0 S0`` 0P V`ҙ00S> ! @ Up 0S0 ލЍC|0h0 00P0`P PލЍCk ``W W @W@W @W W@W @W@WWW W W W WW*c*c@-@p`Q0P000T! 0CT( 0T 00 0@0TP0S# 001@0P R 00S0<0@00CS0  ЍP R 0 0q`@ @T@@~fvtA-@aP( >0 pA c40( R/$ R R/  /te-4( \0^/teT0Sp@- @RP 0w,l0p0p@//@- @ P@A- `>PP@ @T@`V X0S PpW@0`P`p@P Pp cD@- 4`>P@T  P  c 0!< 04 0 (   !/@cddd RP RP }//C-QP `M 0q<0 0dV@p# 䀖XW Ѝ0 8/P 0S 00p Wp04&08#8 S$=;G"0C S04W00G?o  2`4W00G?o  2<4W00G?o  2 0T00 0W  00 a @DoQ] QZ > QW QTa @z 0T0 0 0&T 00#T 00# 0T00 0T 0 0 0T@0@0 0T00 0T<<T 0<#V T 0;# 0TP  t0Y S l0 0p3/tT  . @@a0D8#8S @DH$H>; S-< S* < S 0T0+ 00D8#8S00T0S >; S; 0 8T'.T T( 0 0@H$H* 01A c0C S@0{C 0@; 0/0D S0@@0D8#8:S@@DH$H@@AZ6A01 7A$'* 7As@-@(0S1 $0S 0S+ P`40 CS4 ,0 0, !; S Ѝp0 0 3/Q Q 0 0 04,0 te*cA-PNx0UTPS@UTp W `W` 0 `U`RT0 0)l00p3/`PTPTpU@ N lN 7A7A\ P/0 !8 00 (  , !/@cdddp@-@0Sp@z0PS 0p Sd :!)T0S` 0Sh0T0`!EcMb@-MPaNX0@S `})R)x0S 0$ P`V% 00S" 0p0CS00 00yP b< p00` P MHc<R@M0 7JЍteEc7A7A7AQ @-唅/48Ap@-`P0@   `P0(0pte`, ,,p@-P@PPP(Ppte@-Mp`PM0@S 00( ?0S$  hPP: TP0S4 S P0 0!! !1Ѝ@(h0Uh0TPP @ R 00`SPU0P00 P kM 㸂ЍEcMb@8Ap@-@  Q != ^Q‘ @@HPTlLoV  \Qڰ 峂A9d9Ap@-0@SP S`} `Z < Rp؜0000 0O-,M @ p P@DQa|t(,Ѝ0PU T PU0 TxZ0@  0^LAoY YPQ ` 00V@D"* ; S >08#8= \S 00 \ `:Q ڰ 0Co[ 0 S  02"9A9Ap@-Pl@PTpP0S003/\@@-P@Tp@-P`l@TpP P0R003/P`\@@-@PG-(`pKPl@TUЍ0Z 0 :/PP\@p@-<0 0QP`?o2CP@p,0c@-  001P,0c@-  001P8,0c40 60 0 1P;/,0c/@-P`x@fp0lpp000 P$0@@0 P0tp0 Ѝ9A00cp@-PP@0S ``0Pp0p,0c9As@-PP3 0XP\0p0@`0\0p0T0S 00S 3/ t0S 0 h `0t 6/PQ 003/P 0\ X0`0R`0p0`0\ ЍpWp@-XP@T0S 00S 3/\ `0R`0p0`0\ 0X0pP0S 003/O-`$M@HJ3PV +>C 0CV 0CVP t300 h3VPz $ЍOH3V, P0ST0S c lpWX\ 3V0t02V" 6C0CVQ 0VlPUR 0 0RoJ0Pj;2V`lPpU``PP \r\\RdXVʀ 0! $ 0   , !0 00 0J 0!d!0   , !$Ѝ0S S S $ЍO{PL X0SP0S0 Q X0S$ЍO$ЍO\P Vp 0`00I\PP R 00S0<0P 0 0q`w PP0S 00100  0;/\pP=vt`W~fWdWcW@cddd$ 0,0cp@-`P f`z@P   pPU X0S P0S 0PpppG-`QT@T` PI PlpWXPVI@ I <00S 3/PP\p9A9A@-@%ITT0 TQ S S @Q @-唀/P:Ap@-@PX8PpHP >6P X0SP0Sp@ p]:A 0`( "4`#/R/`0  B-"10 S0   ,(0 0//C-Pp@(`V Ѝ 0ᤔ9/@C-P@pW Ѝ 0ᤔ9/`p0S@`A-pl `R#:Pp@Q:AQ Є A8/ 0| 0&l0CS%p 0a B BR%0)0Q*Ѝ 0A-Pl `R:pp@Q: BRЄ B8/ 0l0AAQ%&< 19 P*Ѝ0 P Q   @-:#:^:,\:( 0 /l:AA-Pp`@@0@Dp@0@L$<#@`W I0pG`@A-PlL0pLALA$ `@`W I0pG`@O-T@ L P0   lA 0A`Pp2"0PS0VpW* Ѝ pA0 A   Q  0 Pe `Fh ! X F!Y P0`!pW:X  QY Q  fJ 0Pl:AS/G-` p P#"Y@PX H0S  ;J00H@PR/G-PQ0Fh pY@p`V8h J0S h J@pG-Pl @R`T  Vp P匀`#801U "0S  I0`0PE V hp `G-@ p,Ƞ 0P  XPW 0S  I00pGPp@-@P0PQ@ R   RQ@ R   Q C@Q@@R 00pA-`T0@Pp 43/UT0LpP` 0T04A/0T0A-@p`0S  bP p A b Q0000000PL0cQO-P`p@@DT 0 <p0 SX Ѝ0 'p0XC-RP`p(@@DT00  000 0 X ЍQO-P`p@@DT 0  p0 SX Ѝ0 p0XC-RP`p(@@DT00  000 0 X Ѝ 0!< 04 0 (   !/@cdddO-`d)@4pS0ʀ0!4)0,)$)   !@WpVP`P 400 $a0@04 00$00 , 0 4 00CSTa40, PR@0 00 P  [  H ^0  L X0SPTUP0000V` W p0``00V `Wp `dp0@ J{E { lEp1ʡhPL|00 10000000  P 0 Tp ` 0h`Waf`` E`Fd 00C0c& 0R0 0C $0`,0` 0RS0C2x05A45t454545454544 W%00t%W$43 W 0倀TV{ Ѝ R97;BSA S S  @<Π` P BP RY 0 S < b0B)2 $ ,. .8S<Ƞ4,<(8N"( #8PE Q ἐḐ Ḑ  ^  [꼐 ἐḐ Ḑ夂01 `@380!A!Q Q ^: 0 0S  u _`@2Kzg( '2b`0{pGDlpGW04 TP    ̈́I 000404040404PTP!  ̈́I 00p04l04T04P04X0@cddd;A,,,,,,,,,,(,,,d,,,,,,O-Pp`( 4M10S=0,0 T0$WpVP` D@ J I+0@@ @@ P,pEz004ЍT0     ,o,9 P,0D0 ,@@ D0 m /0P00#0CS04<0@pspp000X [0R bQ" B3Y 3R b\Q" B0Z 0R b] BP"YY !1"0202 e"_"Y0XZ0cY0[\ ]0`kX 0D2$ ÆahFh`bV`aA""A 0Qc2 5"0A$ Q0SW ASL 0CS>T0H90 P U=l0 S00P10000@!@1P@@T(T0 [!1P@@TZZZ0X00X00X0 S 0@00 pYD8#  T0,88 < T0 >Ad:Ae  P""$,  Ϡ0 0<  P 0"  048"$0,0 00S $ ?0`0PA?APAOA00 04040404/-,,(-O-MQ@8@Q\1 C\-*P`!!)( !p),!V㜠P` S(P p "(& 0$p(|'"([$* 0t 0c xpPR`)W:ЍpS0S  4?0 `0P[:004!48#804pQ 0S  ?0 `0Pό\00PE0 S 0S 0 `F>pGO-Q@,M@Q\ C\*P`!!P pV" ! P` P S"! P) 0 $0 剐<*4,2,2  )00XR:0 E 0=R0S  >0`0PX<:0 Q0$ Q0! 0 a`0X0@0cP[0$00k0僱 Y0K0c[3\;$;b!Z A bQ"]100 0 S0S  Z>0`0PP0 0t 0c xPR`)X,Ѝ0PE0 R 0S 0 `F4>HeXP  X000 0?mPXP  0$00 ,00S \0@RP\d0 S/ 0 B @-0(  0 0 \Ѝ`cXA e/` e 0 8?o20/@-@cv _ e@-0 00@998090R (  8[?08000 P  Ѝ R 00!  b? 0S 00 R (,( @(@ ( ( ( ( ( ( ( @( (S     @-0 vN @T0 1 <0C PrPA`Du" (AdB( RPPT  @B! b$!nE1Cnp R 00 0C##< #"02#0 dR, 2/00 0Qo98|7@-P@l@  0 0 Ѝ00C-M 00Rpx@XPh` (   P W Ѝ R 00 b?% 0S 00S=P   PPX7@- @P6 000 # 3 @ `,3 Ѝ00( x00/0 <#<0@00( x0 0/ /@- 6 Ѝp@-P@` ` ` pp@-`P@ H0T *4@0* 0 0   @000pp@-@P0`` 0 000pp@-@P 00   00000CS p (p@-0P@ `0%R @h @ 0X  @ 0x0 000p !h0R@h @ 0X  @ 0x  !h0h0p@-0@S$!S20`P`PUPE 0(  0000p S`0P( 008#80"$R*0( 0000C@0$0p`\gR`P`P 5$0V0$0000pXAXAYeYeXAp@-@Pf p@XAO-0pM0 0! @@0P 1S 0l0`@ 0Y":0S0  H j0` Rp00 R SPSP2/`0S0S-  R*  8?\0"0,@0/O^@00 C)@C)0c<3" P0 0@0@ 0S@P k 0SЍ 3/0@-0MP0@ 00P!0000(0$ P$0S S Ѝ0.00(0P(0"0 Bd (0 XAO-@( 1p$P0` :C [ :(0$Pp0`0S%000!V"R/ p R,R ` pW50( 00$00C$0 Ѝ`  R f"  `PE  p PEp`V.1 T0T ``` , j4 P  XAXAXAYeYe0Sp@-P` U U@ T:P  @ 8:P0 <0p/pYA"YA YA0-T# ;T@ p&  Ѝ0QCM?0@0S0P?06?0H$H`pG@00C Q4#0@CW` pU@D 0 w0P6&0`FS A CR R a DR @DH$H@DX ^@;@T@PBcZAO-8P@Up=04<P0XY`LLV 0 @X0` ACP  50 R ;SU0T.SPEP ЍY\ SeP#ʠ?0,̀0@P  P ?#?0<<00P 00U?0P0PPBc//O-0`p,@` 0ЍpC-0000`C-p@00CSʺ0 V0  =# C!+ R92P 0S = C!P0S c> Pc>O-P 0 00$ $/ S h0S)B.0_# 0 4P 40000 P4000S 0 ,00/ 0 S _R Qrz4P e> 0X&  ( , P B R   ,0[,0 $ B~ 0 h R0 `2 20S00(< 8$+ B/o0" 00!000 #200#020-4S S 200h0S P .0-400 ,, b0`60A00h=\AT0T \/@- 1"\0?0A@P4CcgA0@-PQ0USL0R @@T00APES Q T03=?00QS^T ?6?0000-A\\^CS0Q Ӂ0ѳ 0ҁQ/0C-P0M`00@V5p 'u 0R  (: {>C 0C"4T0 0  ?d @;c U l0<#\0B#'E'@@Ѝ0U00T0;k_kų@-@PM`(p! P `40{> 0020 050 02?0@  0 @ Lt@Pod'0PЍ耖0@-0S00R0100 ^ P^ @R@@A@0S*? ^ .H@0 ^ RP000`A G-@`0A S0 00.SR0 .QR 0@0S ZP00VPPЍ \.\ B p0P^)ZSC QCBP A R\(\P0CC\ ؑRSp6SPR_0 0S00U^ V X .XQQ0 pW UP^  BP R00 0S B.Q Q P Q Z pW UPQ BP &)0g W1 `V 0 B Q  HcR0b~  @Wm*00p  V[`AC-@PM0Q s.R R 0E $2 `S YA pb0 0 2`P 0P 庁(  (  (Y@PPĥߍC-M@@B pS pߍ 0?H `T ) P)U0@ PE UP (  ~( z(`TF`% @P TT@@ YV@@@$T P 0!1RX 0SRR`AC-P@?00CSLM`LЍ@0 `p0R -( )( %( 0 /Q 0S*h0 pS  0 A\0S  '0\ \Q^ AB 0  ("(R ! @ B& '\ Q?,? Q, ? ) 0 #  Q/@-0Qs.\ \ R 0 #@aAON/100S/0 00/0M000Ѝ/ 0P @/0P0 @-@tPt`0 `x0` @lLT` 0` 00 @@`L" Ѝp@rcA`c e/@-VP0@RP@h e@-Q|L AЍC-@$M` A'0pS rBL S?xxM@x  !08p 00$0$0 0040X& 0L00!s0X0P0"L0X0\00M0400X0SV  0Pfd 02\0H00$  0 PP \O$ЍP @&0 H0 0I0 0J0 0L0 0M0630-*'X&0\0800sX L000 @X0@0000H0H @0P0`0>00C000\ /ЍA dAO-@L8`p0,MP 0s @$ W,Ѝ0 /\0S* ppd0Ep7sUGPX0XP 0000 h c SpO $ld0T 0C@ BÌ)0@ @3)`<0"$P$0p 00 B {0$ - \P 0;P> r 00 0Pd0;0hl0 Q! 0LP  AH B"     w\P0 00S\P00#Sb%dAp@-@PlQ P >0 0`!d卜`ɜMp e@-P`~ @P⶜K@q0 000 001 0! 00埜Ѝp e e@-PWLz @P4叜Ѝ F!凜OM e e ep@-0`P@ R@ 4 Rʈ0@@\0S  0@0$ 8@0|@0 0C?o20p@@-D@<3 P$HFЍ0 0A e e@-0Pp0 0d. @TH-Ѝp 0S ( ` L@ e e eG-P@|xp"X `D2 H.W L R ! V xh"x 0 e-   11 1`00C`0`0  0`0 11 1/@- $ Ѝ0M000Ѝ/0@-`@TPPtPU \ PU*x^\  0O-`0<4M(00X 8@0000( XPQ)L00" d0\PV l 0CP 230Y l0CL30V00R d\01CpS04ЍVRp0 00 00p0JS 0%0 p00h0000Z00#Sk(P YY l0d H BT02000V`pd000 0SNX\0S*(P 7 !$00,0  0[ $ ,0(R:P (P 0(l ,0 B$"|P 00s000p0pD 0S (VpP pGhplg e h00\ %S/A-@PP`M/ `0S 0"!0#0\.0l 00p02 B"0$0)Ppp`0 00zO#0 {0I#0 e0808!<r0"\!o0C00D0l `$0 B"0$0F$ 00#0 60P T Tp.0Sp$ P 'qTЍfdAO-R4MXP0v\0@Sq:  00$0 0(l $p0 B$"`P5( 0 z/E 0 0! $1Q- q5 :CQ0 : 8 #8#40 (-0(00t0(P 4ЍZ  R 80 #8R#4P00 0RP ,,P"`@-M`pP0 0 0q@P ЍU 00@-@  11 c0?o0c0CS1! aQ\51: Q030# P03S 1S c0?oAQ1O-P`p}0800S 0s \ S00\ !(0$000 0QPP30$010,000t010(0@1- 110  00 10:0000l0$0d0 0_LЍx|e00P@8P 'T P 00CeAHeAMeAReA@-0Ms0P@ AE@PT .0 00 |00 0t@x@`@T EЍ@T bq6` g@ct]eXeA@DeC-PRM@Ѝ R `  R@ @@ptx| 2|000x00000S0x3 p R0 -@   @P 0S0 $I3= 00` 0&0005?@@T0100S 1 @@P0S ?.@0d0S5.@0HML30 @`0&00 0?@@T .g0'pp2 =@@T0 @P@P Gl2 =@-$ 0R 5@00 0 0@+@chBG-@0S0s!sr"sr00s(sr(srx0s` 0Ps8p  S0s  S0SЍ(,0 sq 0   0!P08< rqHL rq0 000 T@ 0>P00 8< rq 0 R 8$sr 00 T0V HL0 0L00000 r 0 0 T,0@>P L000L00000| r 0 0 T,0@>P~| L00 0L0000ЍGB0Sk iC-0M@p0S   RP- 0X0P S 80 \p`Hu@X!V0 @P 0`F`80l A)A<>)a21, Ѝ8 d0l 0C 3 ?SR`O-`,MPP,Ѝ 0SPPp\ Q00S8* 衟 Q@ \@ @T0Q0  R H0C200 00 0@P 000 0 = SO P@d 0h @b<p@ RS"$ \ @DSQT@!\  R0R0@0 PPl A)A)0a$ "03$PP p00 0CS0! 01@OT0PSWTPnO-`$M0S S@ d-F 0pP 8 0 \000 0 P0S@$Ѝ00S\0S0000 @\0/0S00-p0d P l0  \RQ B01@ 0:@PV 0 \ t\ >0>00S H0A0W0000 0H0  C200000 @P[; 0S0\ 0T [ ;000D 0 0 >0 .0 0>@0T002  0 - 0  H0S 0 h@Pp c 0* I(C8RP p000 #8 *(80( 0>P @ [B$ЍOr@<@:eAM!Ѝ/A-0 @p0`SP , PW+++G-` P@U+@P pp, @P 0 -00@ *B@s@-@0P000CSD#SR`88 d0l 0C S c10PQ0/`P 0##sr$ 0"00#sr  Ѝp@=8l A)A0<)a21 #ЍpeA7@-0TP@6"XB0@8 w#( #$0BB Ѝ0eA00\ <b0X 0C S0 0 ! /+ 0 0 0ReAG-0 S*S* P 8pL  PS  P;0S2  I00 > `!O 0;S   ЍmO-0|M0(0L0 0@00S<0@ p(08P<0!0}0`S0040 0#240} 022$0(0X0S rwL St@T000H00G0s L0ld0S A A! a,3 1T$0 0 #0X 00000,, 000SF:  PF0 @pS  @p   4 R70X@0#d Q a30PQDh00 808p00CS0!H0(0\0HX<T00(X0` Pl0d` C)CT\H)0c03"$0PD0\ T00CS0H08 S  8 \8 000X :t0 L0TRQhQ 0S0  00R0 0p5 0 @ p X 0l00m0~00l00m06d8l @T4L0 @ `0S  .3,0$0  0#0 0 0P2  l0 lt0 0u0 0v0   ,0S*\ld0S A A! a.3 1T?002 0D 0  P+ \P,0@ 000 000< 0C( 00\ @TpTp0S [   0|0P0P| |Ѝ 0,00000S , 0     4 R00 0H0000 00,@0p?L0@0,@0p0"@0,@0p0D ZfAfAA-@Mp0@P`00 R@@s00V T0L0 0L0800"0 VT\@`00R 0 W@TJ@M00N0P 000Ѝ@-0`P pMX0S, \0R@#0*x dP @P&00h@l@!0 0\0!" 0080H00 0 0p 0, x@P  0 000 RЍ80 000 m7@-@P噅&P ʄ҅ Ѝ080 000 V0C-0@P8`rr eL dl0 T@d X0S 0S @ `.3,0 2# $0L0!10P  000 00HpX0000(0""p 0 8080B  0M  0 0|0L0 8|0080xp000h \0000000 Ѝ 000  0SL 0S @ `.3,0ǃ 2#$ 0mA-`0M0P@ N80 000p L040S }P3 @ PH0 0I0 0J0 0L0 0M0 0L0\pp 800s  Ѝ`@- `P@ P 0   0L 0 0<031007 0P Ѝpvd@cG-0p` M8P0X0S, \0R@#* 0@P~x 0PP(0(wl0dT A@! 0C#p00$?G@ p 0@ 0  00!e   XpLP:!0.e2-8640q."@* X %@P&0d00t@p0!# 0, $00@P 0 Ѝ 000 |@P *fA 0`( "4`#/p@-@(0Sp0PSP 0 R@TpO- DMhR/@lp0-`p0P00`$,`@P $ @P#Wk`Fhp &h$ 0@o V㨂X@P =Pု,~$TDЍ$ @P P0`ᒫ< 0P0 8 \$ }$ #  R( p0(@ 0,00(000 $00 @P(`0@T \PI@ PH@P@0 @P M0@SI@H@ R B᭫(0W0 ,000,0uA8Cc-C-萟M8P Qo<01 @`p000o, 0 < 00 0 0 )P0SP7 000ήЍ蠆A-PPP Up`ɪU@ 0,@P0 v A-0Sp@Ȯ@P 0`PP`P0 P$00`p@-@㋪004P0 pp@-0`S@㏮@P P0S00  |pG-0`@ `Pp2@lT Ѝ 4 VP0 00@0`@`@EcO-M@Z0`@P %1 1PP0Z00008p+08 p0 P8ՁW(8p ([( (( (  (P%u<00<0%#0 3!0mLVP0@8003!0I@T#%XT9>0 SC&P02#@ 05::!0P0 @ 0000000$000 p᪥@ 0 SS$ 0$R00S0} @噥0刔pC 0Sj@#!P$$(00D 0(0#00$ 0@@P$p00ʿW0~!G"Т3" R 0P03Py 30p 0Fg@P 0! 0B"@0 Z0  0U80(, <00PQ=0 1 000$00 100@p0@$0  0@ 0 0%T8<$p 000A~$0/0 0 v!P"$0/0 0 !P (p$,0 pW@ 2 30p 0f@P0S 2!@0P~;T!@@ޤ0 R. P0R 0M  0p\! 0  41T 8@@8081T#\ ~#0S 壤 0SI0p}!@!} ጤ0\ Rܤ 0  8@@808-e@cuA\.e1uO-DM00h08 <00S\ 0PS` 0SDЍ0地0083$000  01$00 $Q!  0 0\:Q0p@(0,040 00 Q0 DЍO<0$ 0P Q QE Q'0008000S  0 Q:Z0 0 KQ Q Q w70S S 1H0C200<00 0P  0 P0*&00000$0 0;00@Pap| 060QP )T0 ;cS10! 0p$00:0 @P 060 %.P   X- 0 0$00 "$Z 8S  0RP a$0 (000J ( RY#QQY*  R, ( RNڸ \RD  00$00 _($80080000070 pP 00 p p8Sn0RPh #000  I ( JRY ,   J Q 13 145  0(0<00,0(0Y*0( 0Rp* c 0 $00CZ00 0( ,0)!00 ,0( 00 0 0 0(,0 >% 0p0 %,(SR0 ,0 (0 000H10S0|0S8S$00:0 P 0 5Ѐ0600  P) ,0S )!00 AC000  0  0   gX0(0\0,0p5B(00,0 040S W X0SZ%Q@c-evACcO-P $@p @@DM $c T<✐0娰 ` $P  0 DЍ`&W`V `x`P  0 0$3 0壴  ! 5P+X 0S68T08ݡ0TSJT,0S 0:{ 0 R #1 TġX T 0V 6 01 Cr T 0!z!O!C{P0 ! !0Bq  H@o/@-M@P` . 0 0P @P 4Ѝp0@  4/@P2V@002d0  4/@P H4 fV 000( (0#vADciAvAi_vAEc}vA-C-p` 0TM P p@P 4TЍ. " +!>V4D`Y2!>3`04\@ 0$p 4/@P 84 (00 0࿷vADci@vAEcvA-p@- P0@@`L<04 @ 04/@P 3 司+wAiDcKwA@- 0 0000 0Ѝ @-0 000 00 0Ѝ@-!>0004!4 0ЍO-@Pp`LM$@Wpl3X ᫨P0 7 |8/P $c LЍ ``  4:/P 3 $M $`J88000`8 `` 0( $;/#PJZ@T<P|p0 3/Pt0 S$x0S $0x 00$0awAwwA 0y-p@-@P$ Bp@ 0`( "4`#/O-P@P00z1m@P@Pf #P Pz R R 00U>000 C[1H)10S@0   @U. p)G1000 8Aᤠ4/P#P  p000@P@ Ro 0R  CU800000008A ᤰ4/@ X0#T00S 0 #T T0S0S0<10T@0 OoB0CB001 tb00 $Y @ 17匀00008A ᤠ0 4/#P@L  @P #T 0 T0C00S @T@ @嫡0 00 S00  P  啡t60Q &(10(1Thfud6@Ty 0S0Y @0 00000D60S: 8, 5(6P:# 80  <0L P0C1001008 ԕ 0`000d0嘚*0<00L 0  ! w 000d5 000 s 00bR0d`0Y   P:dd0 00 0`0542(8p  ,?$<'Xy,XX0Pra0HS^@2 00?:DV;000S  0  0,( 댐48$ <8<@|@00!>0 R03.: QZ# Z3#8#(,  PU0 :89̘0 0 0\' 90S<Ѝ8< 8    08 08  0`HlA`.eABd.e0@-@ P0 M0   0CD T P  0 mЍ00@-PM8  @:8S9j0 00 & ,Ѝ0@N9Ѝ0S O-@$MTP`L Hp RQJPP0UPPӔ0U  QS 0Q P=`0S00S pQ0R@6 Sq1 1H!W?Q000 00U0P00H0 00000`00X0+181qjq$ЍP0PP\0001 1pWÏl0Wq1 0<Ud+181@q/xAxAQxA8yAC-DMP` p f <  0$ 00 0@ "4E00 00 0 :%0|0 0 P0 S  f P fDЍL\ 0 \0? 0 0 90 0 0 0f 0@-8@ 7h0l P 0P3<P<#/G-@$q`0d 00000`P`0d P Z000Pp"SR \ R3#. 8 8 68   088  H@-e 0`( "4`#/O-$@ !p!&0q00 p0a@S 0F  `UpF` p0 S  0 `@HppPU- 00?pHoo?0尡Z | Q ! |! BR!&%p Qo0S 1S10C1p0S p oo0S hp 0XS  0 oo%o$]%MyA$ e( e0,0000t> q删!!  *P!X& e! ,++:10 0 Ꭼ4 ,P !*!0l 0 }4 ( 40  ++!EcbyAkyAG- MP  p@`F ?d@T Ѝ Z@EʟZ R00 00@@dTP0T00PP۾ $ P0Q\(0  S  @0 0000(0O-@,MP0p T0P`X 0 T0 0C S 00   @P ^Z? 0 ׽0P0? P!KpC!0 SH080q@ 뷽  004005000@@g?0 S0 ^?0 V?@P?-Q P@ 0P 00T 0,Ѝ@0S   R00   S @P ~LCcp@-@Pm0 .Dp@mG-1MsmQa0S 00$mЍ@T0S_@mZ  PD 00 0m0  $P! N"" S R- Z03H0 $0X\ RP(0` R  X000 R 000Om 040 0$$@0HL RP0P R 00 !/ R#@c0 eDCc8 eEcQp@-@ @QC\0@$0@0$0ppPm$@UmTp\0$00$0$@p@-Q@pP @QC@pld 0$ 0S (0, 0@@/md 0$ 0S (00, @@p@-p`PIl@T 0S4` 00S0C04"0S00  0S00@p@l"@DCc0 e@- l@0"0 etyA@-T@0S l00w#,"0Sl l@"0 e8 eA-pM0S S\1 @#P1P!PCh0 4a4!@!jl R100 0UY@P lЍ̀`V@0@0P `X0 h00|400:"0@00S`000pP4#kl@yA|yA@c0 eyA1.DCcyA8 e- $\/p@-@,PP 0SH0b&U"4p@$K%3yAA-@P`p㿒W0 A,㷻p@-@P`0 x0 @` 0 \0 @0`@0@ 0<0@@9P 'ЍpyA`cH e8e8.(e@-@@M9H eA-P`p @ (@V 0L00唀@0 0Ls 0h,hd`dPTP333 0&L 0 H eh.e8e@czA7@-P0@P x@T00  Ѝ0@-@p0PS` H`HV 00|03 80 2008o<080S 0S  V 0 '9 Ѝ@cH ep@-P@0S  0S p 0 @QLW \P P P 0S0j2p,e8eH e 0`( "4`#/p@-@Pj0Upp@kA-$PU0@$0H1  j` pv1SjA謩!! @-P 0`S4 R13U  @Ѝp $`V@ 0@ 嬖@ !00 0C?o2 104A04/@P U 7T0S 0@0 0 0 0U>0% T 0(T@0 0 07T0S  Ht% DR2320   (T @@c$zA>zAO-@Mpu84@P0S0げ0@0\<`4IW00 Q, 3Q00 3`0 0'00C0@@0SPD0@H0`2 #101Ѝp#0 00\30 0400D300P0@0 00  pF|Z @H96[ @ R20 030000 3SH0L RP \0 ڑ0@`00^ P ,00 B R  R@0 00  `!H0GS5040v400 3SH L0SP0\ 0 㘑0`@0 <  0CS00S0$000 $ `J430W0B 0 3SH L0SP0\ 0 f0`@0 <  0CS00S0W00  ; e,e,e,e-ee,e,e,ezA@-8@yP(0, 0(00 , @0e-e7@-P Hh dA \@200P.0 800(.0 D@@0Dp Ѝ00eV.$zA@-4,$0@HhP(p@0e0/0e@-@Hh00H@h0e@-Q0   0P0"3 g 0ЍA0C-P4 " @ 0ҥ@P s0  000000) 0ǩ@P t2h"1᳥@P 00 Z9@  `1 $R00S 4 `P 101@@Qq0 A0!0!0(0S+p@x0tT@1eeO∀@ @P1@010@00@1:\@LHD@X@T@P@d0`@h@<ЍS p@x0tT@1@eKN∀ @(0S $  000000t <0 R00/tp@ሀ@M@Ec@vc-eszAO-P`1 @Dpᐑ吡!@P4|qdVʀ 0! $X!0 P!H!   !,lg0S2g 0! d0    !tT# 000 I@P&8#?P 0 R (@- 0@Ec-e@vc@cddd0eezAG-0@@p` !4#Q!PP00j0p Y p Z I00000C00& 3SHL0SP0\0X@@00@ 00/ #RHL RP \ &0<0CS @ Z  0  0 J    0   0 B  ,0B<0CS00S 00ЍO-p`@X   Vn   #RHL RP \   R H`W(000@, BR(  #P`0 0( 0000 0 t #R H LPP`\ `  `FVTNQV P %P @H P H    0`  B 7fXPa  P `P[XP HXPPP@H [  P0@ V`!V  0 0       B @```HR000/ B\0H/O-`@pP0MPPEY  0 BR`AЍ0SF0SC Y [0 R& 00 B I`V1 PU [ 00vP 0  Ϭ@KPE   00C0U0000ЍOHO-P0p` 3SH0L RP@\0@ @U$@0 00 ЍL0 0@DT@DT000  0PE`00<U@f0H0\0000[@ 00C0 R000UE!  0  00PE`M 00SЍ/p@- @d0@AT0P` 0S PP@0$0( T0aUp0p@ u,ep@-P @T0`H0SH@@T0`Tpp@L0Q/p@-@`T0`(PPE(PT0`Upp@0{AG- 0 p$@: @T6 W` r@"\/XQ@EDA@T0s`W@T SR @ l00P 0S , 0$0,(00(0@TT0`{A,eO-M@0P0D0 0000 0dB 0SX0 H0Sp`000 0 0@T0`T ,0  SR$0H SR 1T (00CS(00S@pT 1XV T04`0C0(00`08@` H$Q,@Q@$ 0 e 00QA000(00@0(0(00(0T0_V ЍHQH {AIp@-0@`8888 0SpT0P_0#100#0$0 $`V U@` HP H`T0p@_ ,  , 0S@-@ %P 0 S % 000 0800$<00 $0,1}S00p}?  $ ( 4 "3@0 D0@ 1_1 P,e,eeEcMbee@-T@ LP 00CS0<(_ ԐP,e,eep@-P0 @0\R B@ CUp0% 3SH L0SP0\ 00P00 P Up@AT 0 S00<  0CS 00  p@-P@O L IP0 H2!0< 0?,R:,7(41. *$0#0#0(,00$4 88<@@HDP HX L`PpT @1R10(,0P0#01P0S 04 $ (8,@p 0B`0H4Pp `0B`8X<`0s 0 ?@c@p@0p{ABMbG-@P 0Q`pL ' P 3SHL0SP0\0 )0 @0 <0CS00S000800@P 3SH0LQP\0 0 @0 ̄00LW\\0XX00400,eO-,p@0Q0P`( / R 3SH L0SP0\ 0 ʅ0@0 <  0CS00S 00018000 @(ЍOdR 3SH0L RP\0 㚅0@0 ̄0 0L\\ 000P0400,(H PX`,eP P /0 R0@o/0S@-0 hoG-@`pPhM㘀X @ @P& 04 a 4 a bb 0P'/ 08 0"*0>\191%]hЍZ.0@-04 $   4 0P@^@^ñ@- 4@R 0P@- 4 @$R 0P@- 4 !4@T  R!@-@4PU@` PpTpPp!@T`PPU@- 4 "(,4 @$R""R 0(,@-@4(P,U @$` PpTp $Pp"@T`PPU0P  H R L01x0 R R// /bQ 00/{A@-(@D0SDP @x,e -eO-0P !ppW`.000 3SHL0SP0\00@0 W (τ< 0CS00S@ 00 L0P   8 04% "Z Z   #RHL RP \ 㣃0@0  #RHL RP \  , BR ㄃U0@0     EQPE X    #R"HL RP \  B/o"R  #RH LQP\  ,.fZX @  K Z 1 4 40 0 40 JZPGUX0 R PPM, BR  RM<0 S<0  00 #8 M8[808 000CS  R 00@0(p0D0p0 0H0(p@ Ѝ0, 3SH L0S P0\ 0  0C?o2S 㭂f[PׂP@0 3SH0L RPP\0PP 0  <\0 0PE[ P1  <I0K00<00<0,e{A0}A@-@V0 (0AoK00Ѝ 0`( "4`#/d0SI /-//s@-`P80Q30 : @0@(LЍpG-w@ Z181HZ ` "PPWPP PP W Y181%Z1p 01>PP$4⥀Y ovz0  ×EcAp@-@0` P@PP pC-MHoP`p㨂 h@PЍP  `` PPl.O- QDM` @p ,0  0,@(p$` `` `<倣S/$ 0'   0  <4,@(p` `jP P0  0<40@,@(p$` ` `XDЍA-ex.A-0MP0`0 0p` @0 P 00 0000@#?o2P0SЍ@Ccp@-M\  LP00  L?\@ R` 0`@P  0T@@]  \ @P `Ѝp@-t-10 0S0! 403e\.e@-)@P P /PCcO-$DM00p@00D $0e8 P``8`# #RH LQ\P AVL0S0P0\ 0  0CS]㮀Vڠ, BVOL $8#`P C800008$00$000$0$000Fa aF1(LE0(04000 0 `P a4( <000CS0(0 ,  PP,  0M`DЍP 0 0<^PPV 04 (P0 00C/S00(0 , 0 rPP,P t0 PS!t tPXXt p0 PS!pPppQ00 S Qppx0 PS!?0x0S Y ?0Spxp 0 Isp p P0r05q5Q0ao0a 101V-eAO-6LM$3@ 0080 0p圀0> |W 1 0 %W000 D ,0) WP@ 8Q```# #RLH LQ\P AQL0S0P0\ 0  0CSboVC, BVTL ,@`P0080000<0  0 `P aWq 0<0 D0000CS000W 4  wPP4 N 8%` LЍ@0000@,00,000,0000Fa aF1(LQ #RH L0SP0\ 0 ~@ 0   @, <  0CS00S0 ,  0 ,0yP 0 0DPPV 80S 0S H8< W00 0 4 0CR0000 4 PP400'R 0<W0N 0=P:?;;0P4;T0P.p +_[[PpT[tPp?;;0 4;PUĠt (P,pP  0 0$P4P0 P$ 0$8C2 |2 0<0:t0p0x00008|0l 0 0X 00Pk4p 0 (00,0'S0 c0?o0c 0$(0SP :000 0?PK0 TPJ!` 0  0SDp   0 J P0S00000@ \0 Pp0p  A  P ~ &{LTK  I oG vE z`(@Cc'A.A5A 0S& p@-`0 CSR!0@P P  F0 P y <0 0# KPp 0&p p@cG-p0M0`0@8 ;87PPi "\D00D0 D 0f U@(w 8QPPP# #RH LQ\P AQL0S0P0\ 0  0CSRzU3, BUDL (!PP00$ 0 0 0 013 PP Q 00 0,,PPK o~0Ѝ(0000(000000#000EQ QE1(L!Q #RH L0SP0\ 0 Kz( 0   ( <  0CS00S0   0 0,00S00  R,0 U-eA@cO-0lM 0H)@P|0圀\0|0D  0 p,0 @@U`< 8P  " Q.HLP\P@@ @DZL0S0P0\00C SyyZH  AZkL ,<P@P }P<0000<,00, 00 0,0r000J! !B1(Lp<8 @@@ #RHL R P \  BT|H L0S0P0\ 0  0CS yT<0000<,00,000,00DA AD*00010(L)TP QH L0SP0\ 0 Sy< 0   <, <  0CS00S0 ,  L 0 ,0<0 D #RHL RP \ ;%y< 0   <, 8, BTL ,<@PDY2P}?@ X808 00U0@00S0T0S@lЍ, BR  R ,  0,0 0r<0 B #RHL RP \ 9 0 ,<J@P@004000080 0 4@P AU 080 X0000CS000( (  PP(  4|@P, B[ ,@  0,0?0 0K1 1C! =2P 0 0 XPPX0 080 P000CS (  `P(  4L|@000(2 0R$78 00 00CS000 (   y`P(`X\` `HL`'S R00$00PS;#S R7800C?o2080 Dp000CS000 (  @`P( PP" 0 0D`PDp[`$0S0S P00`X0 `?o2X H(P 4{P0%'TZ-eA,eO-0pdM00 ,0`0SPdЍlV$HH&圀t00t0 $0   , V@8u 8QPPP# #RuHL R \P   BUL0S0\ P00  0CSPrwU` , BUBL $8PP U{`800008$00$000$0 000EQ QE1(L0SI5{`?P V8080 0!',00S0U0SPqQ #RH L0SP0\ 0 w8 0   8$ <  0CS00S0 $  0 $08 ? PHLPP\ 6 $8fPP~,00(004 00 023OPP mQV 4( `000CS0(0&  @P  0zPP  @Q0$P000$0]000A A1 [2 0R44 (0 00CS0(0   @P 3P T.X+'' SR0 000HS# SR80Co4( A@-@8 0 ,i@P AG-8`08MP0 0C, S0, 0 @8Ѝ 0R@ #p000D (08 P@@$@# #RH LQ\P AQL0S0P0\ 0  0CS]pT , BTOL ($f@P t$0000$(00(000(0000DA AD1(L T2, 3   !  3@P A , 4000CS0,0 0  PP0  t@hNP 0 04PPT  , 000CS0,0 0  PP0 00CS0! 0  0 0C?o20 0R 1 0 c># C,0!0 0 0H03!R@P  08ЍGTGA-eA@cA,e0 X7@-P@0LP! "Q0S, ,00 13/E Ѝ01ABeUA@-@0S 6@EC-`M @@P- 00 0SS S p@0 S2 I00>00 P 0  q 0@=ЍO-p0PDM,sr`l90V0< 4%P00P0H $078 `@@8@C #R7H LQ\P AQ9L0S0P0\ 0  0CSoTHh0 P@ X@ @T@ T0S@DЍR 0, BTQL $8@P2 Cs TT0S ,sr 0S 0T00 0 @800008$00$000$0000DA AD1(L80 3SH L0SP0\ 0  o800008$0 <  0CS00S0$000$00P# @04 R S 0(0400 0 0 013Q@P A4( <000CS0(0 ,  `P,  0r@fRSiP 0 0<`P<T 0rTN0K 00G 0S S@A4( 000CS0(0 ,  `P, 4 @DЍOsS@  0@0T -eA@cp@-`P@M8  ;8@P00   08 H@   0 013/ЍpLBe@-p`@M8 % U   P00  0H X@ Z 0 013/ЍLBep@-@ `(MP0} 0 0$00 000 Pa@P A q(ЍpO-dM000/H0p0H0 <D ` $0O X@4r 8QPPP# #RaH LQ\P AQL0S0P0\ 0  0CSMmU, BU?L $4 PP xqX400004$00$000$0.000EQ QE1(L,4$^0q  R[ 3SH L0SP0\ 0RRm400004$0PQ #RH L0SP0\ 0 9m4 0   4$ <  0CS00S0 $  L 0 $040 3SH L0SP0\ 0 m400004$0<  0CS00S0$000$0h<004 0q s R> 3SH L0SP0\ 05l400004$03R 3SH L0SP0\ 0 l400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0:00 M40q u R> 3SH L0SP0\ 05{l400004$03R 3SH L0SP0\ 0 dl400004$0 <  0CS00S0$ 000$000<  0CS00S0$000$0900(,4q|0 } R> 3SH L0SP0\ 05l400004$03R 3SH L0SP0\ 0 l400004$0 <  0CS00S0$ 000$000<  0C S00S0$ 00 0$0800,(80 ^0P3l:0S#S$Pe PPe"؀(,x1 3ھPP!  0vE0CSHL0sq 8<0sq0 r0sP0 0"P""0 3"srP P P0$sr#sr0s Q003 卾PPЍP@cO-00$`pT0DM|0T0 D $0' WP8 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS_mhT@ڔ, BTQL $8@P00000H3(4  3@P WA 4( <000CS0(0U ,  vPP, L 0$l@DЍ800008$00$000$0000DA AD1(LQ #RH L0SP0\ 0 g8 0   8$ <  0CS00S0 $  0 $0P 0 0<PPT 0k4( 000CS0(0 ,  @P, w P 0k?@R 0 @P@T4( 000CS0(0 ,  @P, M P 0kH@\WAT!-eA@cO-0 0p0/PTM:0`<00SP0,0(00P 00[M%X00X0p0( [ 0$0400 @SHt 8QPPP$ #RaHL R P \  BUH L0S0P0\ 0  0CSN&gU >, BU@L 4HPP!  k TЍH0000H400400040000EQ QE1(LH0A 3SH L0SP0\ 08fH0000H403Q #RH L0SP0\ 0 fH 0   H4 <  0CS00S0 4  0 40<  0C S04 00 0400$ ,0W0PS5 QN0!0D008@0 00 023PP jQ0LSf D8 000CS080 <  D@P @YjPM,P< P 0 0D0Lf@PLU@4D8 000CS080 < 8 Dz@P< D8 000CS080 < 8 Db@P< p0@P@ jHP0 0D0L"@PLP 80DP @i P@i 0K0 00S Oo0BS@T@$0TPU-eA@cO-M<00`D  T P0 @0/P:0 <(000=00(0`SX040H00L050$`40 P 0S`Vڨ+tPH\00\0 0SP1<0,PS    T0(0 pSd 0Q8```$ #RHL R P \  BRH L0S0P0\ 0  0CShbeV/ژ z, BVZ TdL `P: Di 4:<0S =00C00S{ʐU==D0$ V 00Ѝd0000dT00T000T00Fa aF00010(Ld0\ 3SH L0SP0\ 0Sed0000dT0QQ #RH L0SP0\ 0 dd 0   dT <  0CS00S0 T  0T00 Ld0 3SH L0SP0\ 0dd0000dT0<  0CS00S0T00 0T0^[XD0`S` <0S~ `d HL D`P   T\P$ A# d X`P0 0C0000 00C00 0 0A<000{<  d B'00X0 0`00\000 00`63`P a(0Sp `X p000CS0X0- h X `uP$ \$h `<  0CS00Sb0T000T0 } T0d`P h L5 0RK` X0 0 0CS0X0 h X `6Ph8 0pt|x8 x\^00@000\04\^8HoᨂhlP\0p 0B?o200080@08`X l000CS0X0 h X `Poh YP0 0X 0`0lP_80lSp @0S*X P00pX0?o2 pP VV` X0 00CS0X0 h X `pP \Ug`P0%'hUP\Eg`U0PE 000,0C0 0000 0S/0 000$0pS SPpp ;Q> 0PQ 7;$p[ P0hH0\ gV 0, X0C 040040_ 0 LP0$0, ?oU20SS 0 E000 0C0000000 0S 0 59$0 0P  0$0SYQ0X 0`(0‐PP \f`wꀐ(|`VbWAoA-eA.@c,eO-dM000&@`p0圐l0p0$ H pp  $0 8@(VP4n 8P  " QHLP\P@@ @D[L0S0P0\00C SJob[ A[<L $4@P Rf`400004$00$ 00 0$0000K! !B1(LZD3f`?@ V8080800S0T0S@dЍP QH L0SP0\ 0 b4 0   4$ <  0CS00S0 $  0 $04p0i 3SH L0S0\P00 0CW_L0S0P0\ 0  0CS aWe400004$00$000 $0000Gq qG 1~800,000(00  0 *@P KAV 0( `000CS0(0  PP  ,e@. < 0CW 0 $4@P 2 0R p50 (0 00CS0(0   PP pP TpXP@Dp 'SR0000HS#SR8ppGor0( <000CS0(0  nPP `P 0 0<5PP<YP 0SW P00PX0?o2P @ZP ,dP0%'Wv[-eA,e0@-00 : ЍO-p0@0lM$ `H  x00x0000000 00 @@  ,0Y[P<{ 8P  # QHLPP@\@@DZHL0S0P0\00C SV`Z  AZHL ,<@P d `<0000<,00, 00 0,06000J! !B1(L4WOad `?@ [808 8080V0@00S0T0S@lЍP QH L0SP0\ 0 :`< 0   <, <  0CS00S0 ,  0 ,00<@0 3SgH L0S0P0\ 0  0CT}H L0S0P0\ 0  0CS _TW<0000<,00,000,0000DA AD $1< [ P8@@@N QHLQP\ATDHL0S0P0\00CS _T <0000<,00,000,00DA ADV00010(LU < 0CT0$ ,<@P ATL ,<@P0S 0<@0 3SH L0S0\P00 0CSL0S0P0\ 0  0CS K_T<0000<,00,000,0000DA AD 1@0000 08004000 00堾@P A[g 80 p000CS000G ( 0 8KPP( > `4b@P QHL0SP0\0 ^<0 000<,0 <0CS00S0, 00 0,0 0@ < 0CT),<M@P 7t 0Rp`p58 00 00CS000 ( 0 8PP(c`X\` ^`[L`HPVP'SR0000S#SR8``Foobp8D0 000CS000 ( 0 8PP( l,P 00 08DPP`DWP 0S&V P00PX0?o2X HP 80 `000CS( 0 8PP(  41b@`P0%'0000 R p58 00 00CS000 ( 0 8ZPP(pX\p `LpHPP'SR0000S#SR8ppGor8D0 000CS000 ( 0 8#PP( `P 00 08DPPDZP 0SW P00PX0?o2X HP 4aMP0%' `TT1T Z-eA,e@-4 0Ü   Ѝ@cO-p0\M0 0@ 0 00圐$<S0  D0 00,0*0 00, <00 `SPu 8QPPP+ #RH LQ\P AU!L0S0P0\ 0  0CSPI]U a 0 x0?R*`b, BU:L <PPP $aP0000P<00<000<0000EQ QE1(LؽP0[ 3SH L0SP0\ 0R]P0000P<0PQ #RH L0SP0\ 0 \P 0   P< <  0CS00S0 <  L 0 <0命P0o 3SH L0SP0\ 0f\P0000P<0d<  0CS00S <0    <                0@xH00L00H0000  06 3PP Q0SZ L@ 00$0CST0@0" D  L`P HS`P\Ѝ<  0CS00S0<000<0D P 0 0LTQ`PT0$0UHL@ 000CS0@0 D @ Ld`PD 0000L@ 000CS0@0 D @ LK`PD `PFPL@ 000CS0@0 D @ L,PD  Z#3PH_[0k 80 08#800C0 0C00 00 0 0C0V` !8888YL @0 0 0CR S 0@0 D @ L`P?DXU(R0@S`H_HP1S0@0 D @ L`P D9(,kX04 ӧ04 0000C000000C0  A0XN0 [p(00`Ḁ 00 L 0C00 00 0 0C0 @0XP H._ PH`0 H ᔧ0 0C0000 00C0L @0 0 0CR. S 0@0 D @ LQP H_PL @0 0 0C R@@L`P`DV$ 01  S0@0 D @ L"PDV  000S U-eA@cO-0M0@00`p$ h,00+000\ 00;8 PPDP+ #RH LQ\P AU!L0S0P0\ 0  0CSYZU" 0 x0?R*, BUCL 0DPP$ _^,P Y qЍD0000D000000000 000EQ QE1(L D0 3SH L0SP0\ 0 5ZD0000D00 <  0CS00S00 00!0000 400 0 0@000 000000 00x0p00<00$0 08 3oPP Q@4 L000CS040 8  P <]Pi8 P 0 0L߿PLU<W@4 000C S 040 8  P8 0000bPGP@ 40 00CS040 8 4 @P8D [#3P<v] 0Sc0 ۥ0 08#800C0 0C00 00 0 0C0X !8888@4 000C S 040 8 4 @Pm8 0 00@S</]HP0,cX0 呥0 0000C000000C0  A000XV0 ` 0 000 S0Ḁ00  0C00@ 00 0 0C0 40 P <\ P0 H H J0 0C0000 00C0 0000@4 000C S 040 8 4 @P <\ PR@ 40 0 0C R0404@P8 X 01 00CV@ 4P0 00C SST040 8 4T @P8T D@4 000CS040 8 4 @P8 %PQ @4 000CS040 8 4 @P8 0@?S@ 40 0 0C R 4  8@4|PG88 S> LCP8 R,Hp0 ,ƼX H0,P0 11x C60 0hd,P YM 0,0@ 40 00CS040 8 4 @=P78M<0 H0aPH0T0,0S040 8 4 @P8 P@4 0 00CR4ղ4@P [UI-eA@cBO-00p L0DM✠0L0<$ H 00$0 P -0 `S8^ 8Q@@@# #RH LQ\P AQL0S0P0\ 0  0CS9rWTڜ, BT+L $8@P U[800008$00$000$0 000DA AD1(L W47[?@Pl0SQ #RH L0SP0\ 0 *W8 0   8$ <  0CS00S0 $  0 $08@0n 3S9H L0S0\P00 0CSdL0S0P0\ 0  0CS VTv800008$00$000$0000DA AD 1璷p00(40  h0p ?@P Al00S0T0S 0S> 4( 000CS0(0 ,  @P,  0Z < 0CT0 $8@P )E0@?S`0yZH@Pl00S=T 0l 08 U6 o3 `4 (p0 0 0C R (  , @P,pl00SQ  TP 0| 0 L`p 0 @P  m05ZDЍ 0@QLb 0 L  L 0h`L0 0 0  N0-@lЍ, BT3L 0@@P NY@0000@000000000000DA AD1(L0S;/Y?@` V8080Q #RH L0SP0\ 0 U@ 0   @0 <  0CS00S0 0  0 00@ + PHLPP\ " 0@n@P@V0  R- 3SH L0SP0\ 0$T@0000@00"  @Q00@00000y0A A1 x<  0CS00S00K000 00;Z@0q E R 3SH L0SP0\ 0 T@0000@00 <  0CS00S0000000:00'@0> 3SH L0SP0\ 05YT@0000@003R 3SH L0SP0\ 0 BT@0000@00 <  0CS00S00 0000000<  0CS00S00 0000000@0 3SH L0SP0\ 0 T@0000@00 <  0CS00S00 0000000@0 3SH L0SP0\ 0 S@0000@00 <  0CS00S00 00000008<@tz 3{TZ@0  \ #RHL RP \ S@ 0   @0 , B R  R 0  000408C@@HL@tz zTZ@0  \ #R HL RP\ A Q bS@ 0 @ 00  00040H P 00CS@0 3SH L0SP0\ 08S@0000@00\ #RHL RP \ !S@ 0   @0 , BR  R 0  00040@0 3SH L0SP0\ 0 R@0000@00 <  0CS00S00 0000000U k\ #RHL RP \ R@ 0   @0 , BR  R 0  00040]@0 3SH L0SP0\ 0 R@0000@00 <  0CS00S00 00000001<  0CS00S900000002 '0#0 <00480 00 0|2 3ұ@P `AV <4 000CS040Y ,  <|@P, P 8R 3SH L0SP0\ 0 %R@0000@00 <  0CS00S00 00 000D1R011 0008@p 0B`HP0s0 ?@c<4 PP000Cg S040 ,  <@P, 0@?SP8UH@-eA-e-e{ABMb@c,eP < 40 0 0C R 4  ,< @P,e00 H0 @P]H0VT6 <4 000CS040 ,  <@P,  8oU`Y> o;*[PP <4 000CSST 4 T <g@P[UPP% 0 0<XXd@PXV <4 `000CS040 ,  <xPP,  8&U@[@(00@2300 h@P(0Tl2 0R 7< 40 00CS040 ,  < FPP,PX\P `LPHP'S R00 00S;#U[7800C?o20<4 Dp000CS040 ,  < PP, `P" 0 0<DԶPPDp[P 0S 0S P00PX0 P?o2X HP 8TT# $0 A[P0%'T+p@- P`0 PP@0 op0O-M , H0 , R 0 ЍO (00 $ $8 RL ( D <  @ /``00`0@0D   L0 0 PS`y 8Q@@@) #RVHL R P \  BRH L0S0P0\ 0  0CSSPT-0$00, BT@L L`@P S`0000`L00L000L0000DA AD1(L姰0SHS?@80VT00S $0S S V@0S T0 帎Q #RH L0SP0\ 0 O` 0   `L <  0CS00S0 L  0 L0` , PHLPP\ # L`@P` 0Q  R- 3SH L0SP0\ 0$kO`0000`L0"  @Q0L@000L00A A1 <  0CS00S0L000L0$0S]40`0 3SH L0SP0\ 0 $O`0000`L0 <  0CS00S0L@000L0zx00P0 0\00X000 0:3w@P A 0S \P 000CS0P0f T P \!@PT ] X$`0q E R 3SH L0SP0\ 0 N`0000`L0 <  0CS00S0L000L0T900``0? 3SH L0SP0\ 06N`0000`L04R 3SH L0SP0\ 0 {N`0000`L0 <  0CS00S0L 000L0,800<  0CS00S0L 000L0700`0 3SH L0SP0\ 0 ;N`0000`L0 <  0CS00S0L 000L0,700`0 3SH L0SP0\ 0 N`0000`L0 <  0CS00S0L 000L0|6008p<@tw huTW`0 S \ #RHL RP \ M` 0   `L , B R  R L  0L0408x@uHpL@tw ,uTW`0  \l #RHL RP \ cM` 0   `L `\ #RHL RP \ M` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 XM`0000`L0 <  0CS00S0L 000L000, B R  R L  0L040HP\ #RHL RP \ M` 0   `L , BR  R L  0L040`0 3SH L0SP0\ 0 L`0000`L0 <  0CS00S0L 000L000R 3SH L0SP0\ 0 L`0000`L0 <  0CS00S0L 00 0L0 81R01Z 10000 08Q@p ,C`HHEP0s0{ ,?@c;t7\P PP000C S0P0 T P \@PT 0@?Sp`PXPPH@z-eA-eB-eMb,e@cp `P\ P0 0 0C R P  T\P}@PT[00 h0⥸@PSh0T00 0S+ \P 000CS0P0 T P \Z@PT 8WPP \P 000CSST P T P\ @P!WUPP* 0P \x00x0@Px00 0S \P `000CS0P0 T P \PPT  XO@pW@H00,2300 @PH0T0d2 0R04\ P0 0 0CS0P0 T P \PPTXx|p RPNlh0Ipx |00\R  4 RI0 4 QSD80I?o200(0S> &QW;pppGor\P d000CS0P0 T P \PPT 0P<0& 0P 0\d`PPsdY`40SZ00S P00`X00(pp?o2x h~Pp ( <0R0(0XOTA80$ R00S x@Bs#sr8$srH(5 3 )@P/09 ,0 @0  808(0S0ЍP0%' ЉTO-@ 0lM/00p0@@P0\@h00h0;   U (0 L0  <  (0= U`<x 8Q" #RH LQ\P@@@DYL0S0P0\ 0  0CYJY@, B RL (<@P gNP`!<0000<(00( 00 0(0000I I 1(L00SKPDN`?@0D?o@2Q  RTT0SQVt U8080lЍQ #RH L0SP0\ 0 !J< 0   <( <  0CS00S0 (  0 (0< 0 PHLPP\ ' (< s@PyU <K0q ` R/ 3SH L0SP0\ 0&I<0000<(0$  @Q0(@000(00A Aw010 w<  0CS00S0(000(0:00Y<0> 3SH L0SP0\ 05I<0000<(03R 3SH L0SP0\ 0 tI<0000<(0 <  0CS00S0( 000(000<  0CS00S0( 000(000<0 3SH L0SP0\ 0 6I<0000<(0 <  0CS00S0( 000(000<0 3SH L0SP0\ 0  I<0000<(0 <  0CS00S0( 000(0008<@ty epTY<0 S \ #RHL RP \ H< 0   <( , B R  R (  0(0408u@rHL@ty )pTY<0  \l #RHL RP \ cH< 0   <( `\ #RHL RP \ H< 0   <( , BR  R (  0(040<0 3SH L0SP0\ 0 UH<0000<(0 <  0CS00S0( 000(000, B R  R (  0(040HP Z 0 <0 QHLQP\w 0 (<⎾@PU<0 3SH L0SP0\ 0{G<0000<(0y\ #RHL RP \ G< 0   <( , BR (  0(040<0 3SH L0SP0\ 0 G<0000<(0 <  0CS00S0( 000(000v AR( ( F0 0 0C11C!0 Bt<  0CS00Sz0(" 00 0(00$1000 08@p 1B`HP0s0 !?@c@004000,8 0 0D13左@Pp UAn T`8, 000CS0,0 0  `@P0  4K`"PPK 8, 000CS0,0 0  C@P0 0@?Sp 4J`H@P-eA-eB-eMb,e@c8 ,0 0 0C R ,  0 @P0``H0 A@PH0T` 4J`8, 000CS0,0 0  @P0 jU P-@8, P000CS0,0* 0  ٻpP0 ! 4J@P 8, 000CSST , T  ዼ@P 0 0XX`匬@PX` 1 0R88 ,0 00CS0,0 0   㝻pP0X\ ` LHpP'SR00$00S#XW8Hoᨂ0 00 0$08, D000CS0,0 0  _pP0 PP 0 0D&pPy 0DSp $0SX P00pX0?o2X HJP 4IP0%'@ 0  ل0X0X00,4 3 00 0@PX0T`00@`yT U`YEUO-@ 0tM/00p0 P0,@\0U 0d0<0d0$ H 0<@  00 ' U`H_ 8Q" #RH LQ\P@@@DZL0S0P0\ 0  0CZ;nEZh, BZ-L 0H@P QIPp H0000H0000 00 000000J J 1(L0S3P/Ip?@`]Q #RH L0SP0\ 0 $EH 0   H0 <  0CS00S0 0  0 00H0[ 3SJH L0S0\P00 0CXQL0S0P0\ 0  0CS DXtH0000H000000000000H H10 勥HU0 | KqU R$ 3SH L0SP0\ 0DH0000H00 < 0CX 00 H@P 9<  0CS00S0000000:00>H0> 3SH L0SP0\ 05pDH0000H003R 3SH L0SP0\ 0 YDH0000H00 <  0CS00S00 0000000<  0CS00S00 0000000H0 3SH L0SP0\ 0 DH0000H00 <  0CS00S00 0000000H0 3SH L0SP0\ 0 CH0000H00 <  0CS00S00 00000008<@tx JkTXH0 P \K #R HL RP\ A Q CH 0 H 00  000408`@]HL@tx) kTXH0  \o #RHL RP \ fCH 0   H0 c \ #RHL RP \ jCH 0   H0 , BR  R 0  00040H0 3SH L0SP0\ 0 =CH0000H00 <  0CS00S00 0000000, B R  R 0  00040HP<00@0004D 0 043x@P AU( D4 000CS040 8  #@P8  @F`pP U8080<00S0T0SpV Ỽ,003 3 00 0@P,0T`0K?o 2R0S@  00@`J\ #RHL RP \ BH 0   H0 , BR  R 0  00040fH0 3SH L0SP0\ 0 `BH0000H00 <  0CS00S00 0000000:R 3SH L0SP0\ 0 6BH0000H00 <  0CS00S00L! 00 0000,1000 08@p 1B`HP0s0 ?@cD4 P000Cg S040 8  &@P8  @E0@?Sp`@EH@-eA-e@cB-eMb,ep `D 40 0 0C R 4  8 @P8 @E00 P0@PP0UT`2 D4 000CS040 8  Ѷ@P8  @Ep`>WP D4 000CSST 4 T  {@PWX 0 0```z@P``@U D4 P000CS040 8  ፶P8  @;E@jp`02 0R $4D 40 00CS040 8   iP8`d hX' SR0 0$00S#YX8IoD4 L000CS040 8 4 D3P8 PP 04 0DLPLZ㜀 $0SY P00X0?o2` PP @DP0%'T V [ ᶺtЍ źXZLO-p M0`0 00S$Ǻ@bhAὺ3 1 H`PR 0 081   E"   E$EVP  0P 0P3 00 P" [ 3 000 0EVPP PU 003 00 0H@Ѝ000zS0PT$lwA@cAWAG-P `MpPLJ0S@ P 0003 P@( 0U&2ЍH0S0 RP@PP @ AP0SH0S300 10 CS 8:8׹ꙁA@cG-`@0 S_Tp  SX᳸Pڜ0H0S0S 0 P᭹@1 3 00000 00 0 P UU0S 00   ~T 0S 0w~TᏹT w ቹᇹЍ0 Pg@cO-0pdM:A@tdЍp%`000D $0ܳ8 P@@8@# #RQH LQ\P ATL0S0P0\ 0  0CS%?T=, BTzL $8⚵@P C800008$00$000$0000DA AD1(L弟80V 3S HL0SP \0  B R >800 80$ $ 00 0 $0 0(0400 00 00<@P ]A4( 地000CS0(0 ,  PP,  0B@B0,2 0R `54 (0 00CS0(0 ,   óPP,7`P T`2X/P@D`*'SR0000HS#VU8``Foob4( 40)l"0< 'Px0q c\%<3R=Sc0#S\$0( 嵏0 $0 (D RP$0 00 S21 00S  0IB˱ Q!iP  iP P<@@ 00 PE000 ; cP_oQeP?$00P40S 00 .4000P0x RH0x0T3S !!!$0$  ?00 1>  00C 040S4L3,0A`0 : S 0003#0 #L#32024P fr0dr0$0<Ѝ(0 (0 0r0P q4P q7TU TA@-003!z?` 0H Ѝ@cA0@-qPM:Ѝ0@@v80@ 3P@z?00`0 *Ѝ0@cAC-M8`0@XP:@DŔ  8TAVp pϬQ @$ @T@ ` 8Ĕ< R d(P`/ЍBAAO-,M 0%!@ 0 PP``Zb\%1R=SQb `1R\0 嵟 p1>0S100! 0 $=$S 01000W 00p50 00Tp{4$04L3 $2   :  S 00C03#0S #L#320C2T3S! !,ЍOTU A؇AO-L#" R: Ϡ!800L#" R*080G-p$0P` (0@  ` L 0l6p0t ̠\ "rQ 2I!0Rt0 0/V  0㌀ 2Ϡ!8 Y I100 x P?{,`ΒP0A q0V 0S ?ZL#" R: Ϡ!800L#" R*080O-@pP4M ů 0<`\Ŕ5$!\X    0 T0 L)L,)l"3<|m0P0 ,x0P0 S 3 S i004ЍO[M[  ?0Tp S`  00 ST0[C`R P  ,i0 #0 h00C030S3L32  B T3S  `&  ,1j00S0Y   Q8i ` Y" P ! $080$084 04L3  0  000C030S3L3 0  B Y0 0!   804 lPQ0$ 5$ Y$?A$ QL   0@ 0 080aP0\00z00S031TU @-M@0pp08`PP 00pЍ@ЍA@-(Mp `0@t t```PP (@Ѝ     :p0P/AAA-@P 0 S 00 p  `V00 V Ǭol j A(㻬O-`0$MЅpP H@! 0 @oPm!   0@F PbX 0 H@$ЍOB  7 Y T0 T3?Q\ 00S P `0S@ $ЍOY 00 U Y   0 00K  T" TpP `@0S 0 S2 Y @ 000(  $ЍO$Ѝ AO-TM|00@ 00sc000P40`0x Cs cq6rc4D $`<0p@$!c 0 ~`pVp0 00000P T ( 00 00 0 00t0"T0,0 0S  ?}p, 00`2@0(0C$0L3T 2 0$QS8$0<4Q4 0000400S S<0SD@$! 0 }$ 4P`p`7` 000 0p40P0`0080S 00S" 0 0 0 $0 0Rh  h    $  0 0000S! T0H C)C) c1<62 8<0iH00( C0}H0H0 , 4 H0 00S@;H00000 00jPW TЍ08S@ 0<0 ?D0 0 0/0S 0/<S X0T0(0  7Ϡ "\Ŗ%\    0 T0/ LL    )pL)l .3<[jPL0堤00 S 3 S6X\%x4R=S-X ?|800p ST 0`S"80 ϣYV8<0D80N,00 ,QZ A!40Y0C40 A40040(\0T S"80YUT3S   , (Lg$ 0  Rhh h 0 0000Sz TH A)A)@a #;̠S RV Mb?001>00^33 0^ ?001>,00  ,0 $00C$04 0S4 L3@0 @ LP "f(b  $  gH000$ P|H0H0 , H0 00S  00S  00R<0D@$0C!d 0 {$ 40`R0A|00S p 006@4",0S HeꐈAA,Ad/TU TCcAʼnAO-p`0P4M 0 ?{0@00 !0\%0$01R 00@ ``&!! X0 00?P@? j4*!, ZS QS:hP ,l 00\ Ó\ me4Ѝ $0 R  X   !,eT#AU O-P0@Ḡ $MQ{0\ `#,^ 00 0T ? A)A<)a>21,, X :@ 0@PhP h 00Q Q  e $ЍH  0 0 PeT0AU O-PḰ@ 0$Mz0\Ŕ00`0!\   ?  ?` a2! Q,S QS1, X :@ 0@P@ 'hP h 00Q Q d $ЍH  0 0 P!eT`AU C-`PḀ@p 0Mz 0\Žß0.S\! 00 Q    ` a 00T40 1<0&$40 `001`0 0p0$0d0 01010000 $P 0 PUP0s40\pdT80< L31)l< QR>QR!<`0d 0001 P ^d40P 1`dP<040 pL `l\0<726, @ P0Hd6:0000@ (0 00fP0d0(&T0(d C)CR)0c\1S"8 QR!<`0d 000100T<0 &"40 `0010 0Dp0$0101 0 "p `@ H0PP0805@U50P%P0L05P000T40 `001 0 0p00101 0 0PPfd001Pp 0 0T0 C)C)ct00<21 ( 0cP0 c0S C\1^1 U  U `  Rc ` < #.36,P Y*85@%00L 0404 00R  Q RH 00T6\%40 R  !!p0p01@ @ 0 0Pp0$01 0101000040 0@0 0-PP <0 B2 b061")(!᠖''0001S 1' b X0P 0 PL< l52>p, ᇱV Q0:1S 000000 0(eC`8U@e8 L0PP`P`U1S 00P000T\% 0 R qq p0@01 0 0@0p0$01 01 01 0` 0Pp@Pu''000Q0805@U50P%P0L05P000Tx0 p001 0 0p00101 0 0PPJ1S 01Pp 0 0T0 C)C)ct00<21 ( 0El0000 0(*P(l00Cl00 01 0g00T01 P  0 p001 PH000 0 0 LPPx0gd000 000g0T0 C)C) c1062 *(PPd bPP0 0ap0T000400`0  0 F Ϭ 0f2fl`d000 00 00  0OPd0+ X`pG?o< 2R0S R&0 T 000`p<0嘐l0Xyd  0 ` 2( $Pdm_i_< 0(bd0000000%FbP pNH0p`d10 ``040E" 000 00;R.1S0!0Y3 P0 c0S C\1^1 U  U `  Rf ` 4 #.36,P \*85@%00L p00W00W0SN 00T\%0Ra !<  (001@  0P 0p0$01 01010000<0 0@0p0 0P~P 40 P B2 b061b 0`` 00( #0p !0001S P 1 ~_ X0P 0 PB2 b50>" pPG Q0 :1S1 !< \8U@e8 L0PP`P`U00TB\%0 R qq(0@01 0 0@Jp0$01 01 01 0` 0Pp@=P0p Q0@558 50P%P0L05P000T 0 (001 0 0p00101 0 0PeP1S 01Pp 0 0T0 C)C)ct00<21 ( 0l0000 0(l'Pl00Cl00 01Sb00T1 P  0 p001 P@000 0 0 HPPx0d000 000p`0T0x` C)C)ct02160" *(PPd^PP0 0a0T00|0400`8P<0d000000(0!3aPPd00L0L 0ql0< R 0P00 ]x0PT40@HP d]80slpJx`40V:[ h04Ch000TF1P Pl0R 0 L0P 00 0 0O@H@0H 00 (0 0B@Hp001 P 000 0@00H00 0PPp4ph0400 0000T0 C)C)ct0201<" ("PP4 dA]4ph4]PP480< s0L <001d ]<04p80P0`X]10J`Pu00TL0 010l02H0 0 0p001 01 0000 0#PPV4 ppt0p!R  !  0  T B)B1) b072  0(PP400407l0 2H0L q[]\1S !00h  0 0(2`PP  0T0() C C")0c7#10 0 ad 000"00  ( QPHd0p ἐ?00T0 `C0)0c VQQ? Qr/" \5 S 0?!>0  0 F Ϭ 0f2f*]d000 00 00  0 Pd0) ]pG?o8 2R0S R$T0 000`p80嘐l0Xd  0 ` 2( Pd-\)\8 0(bd0000000%F_Pd0H 00d\|040n 000?Q00cTO-@PKp(,`PT: [0 S0S ҌPZ@V 0000000@@000@ @O-需TMpP40S;@TЍ@PUPTPU z"衒( 0  (04 0D \ 0S,0@0H*: 00@0地<0 08000  R0%0%d*@|P# `2P P\SQQS8$0`AV`!QI ӈ@  1/@PE$0  00V$ 0q$@80< \0/\ \00 U0 P0P \0 @A!$ a5.QϠS =0P000 PEUP0 _o@RTP$[U000@@T9  @ ZQ ;Ã9ˁ0T @0 R 0@PPEUPPPPw;8%P@5PL0P@vc@ycAO-p|M00-P `V븰[ 000ZP|Ѝ0 00\@000S/ :0 80P0X00 \00&2T 00PT@h@p0l 000<0h0@S < `\P/ d U$4$Q4 P@P ZU mP n9Π ^RQR.L N @n 18E \H(@@NUO@&0@( ,,00 IY!$? Z40 0$Zů $00:@  $ ]PU@7 VZ0@0(@@@ @L @ Q  N. n*< Π U 0 D   L @   D  H  $ @H]( LP@% 0@D TTw 0,0 X PU@m ZV 0080\0000!Pi@yc0   R  R*4 R᫧@-ŠA000S -/0   R Q   -//@-P`00S-@! < &@P@P 0@0 0 P]@ 0S R @ ЍpO-P$M`00S 00CS 00S  R 000@mY0   P A> a2<! R0:0 ب@P 0ST 0S@Pu@PL 嵀0pI@p p G pp 뼰0@0 0  Cp 00 @W  A KՃ@K0P L" l1. Q*  S0 S 0 S00@$Ѝ 0p@ 0 ^ pZ ⣃ T  >o  ~@P   z  "o弰帀  @-@@A-P@00S= 00CS9< )PP0Sk@p?oV20#S 00W: 0R R 0000@0` R m~@@-A-P`00SE 00SC 00A0 ݧ@P 0S 0S@Ѝx@Pp 뼀 0@0 0 Wp' ]@ @ A HHp ЍAp-@@@O-dM(00p400$00 0080@0000Q.40S$005 0 4$$n8H\0`0P00 00 P (0 P6\0 44#T20T20$ ;60 0Rڼt ?0:# 4080$0H0(#00咮\'V@P\嫖@P \WdЍ\0000S00$00?@D0@0S@@T @ 0庛\00 0O800t RY\fX0 @0S 00004L0?tPP0(0`E 0/#\00000,< 1P(080< SH007D0 R00S 00S`0 1`0 0 400$0C0 0km T0 C)Cba)0c9c00, `Pg  R !00 R(  ) 080S03 S300S P" 00 00p00S01 0( A0L 0 0P 0 ,0 0,000 000<0`V0<0(00C(0~S 0 00T0C00 T0 C)C) c0<;2 , 00PPT 0U0T0S 0S P0 _o$0R_P@0S \WUS@c׊A@-`Pp!0MV @ p~0 W p0 P  $0 Q D 0  0V `0 P ( ,0 Q @ @0D 0 @0D 0  U P0 P 0 40 Q$ H 0, 00:00Ѝ    O-`0Mpp@P0 s00Su 0@ 00@`p\%1R,5S0 0 0 4l0 o."\哞T1`Z 0 ?  Ϡ ,2 0 `x 0l`0 C c00T0 ` C)Cba0)0c"03dYP0000x 0`0k\0\%R ,W VЍ0 XV TTO-]M 0 0$0@ C0CSR ]ߍ0S1  ;100P`S00|hp 0\5pSB\\?@5D0L 04; pW SØ,.1  0 Su0R: pSWk00S(pk 0)PY 0000 0 Df8(\$Q?00 \0Y&/ 0Y& 0 0 0 0Pr  P$P$8ŕ0 @L (QcY!0800<00PS 0Z)R 0V:0 0 $00 01 $0加S 0 0kP0$ c2# S,P!Q  RQIp S1Q\Q\3PR= $08u< p 0 H0pß $0YW/  0F10$0  W 00 $ 0H P 10$ 0X ,#H0P$ p  ~p. ?ಫ 00 S100 0 P 0u0S 0 000 0R    0弈00 0/SP0 c0 SRQR3000Z,00004000 ZP t0T RX  R?&4D00\h p BW, W pq0S*0p ,Y ! !X4@X Y   !0 C 0[00 0 0pQt1(( R@ 0pPi1XXϠ R$0 0 0p0 0R$       0 0000v0P0[0 S0&t 0( 0Sp0 0St0Sx0|\% 0R  P ! P01@ # 0@0H  p 0T0 C)C )0c8Ì"h0 30P(0@0S" 00 0 00 0S(0 01H0DL0H0LpW* p,0S40 0,04 rs \%5R,00 0!!0 ,0 S400 P00 L ᜐ pl̠: S?:0p000000S00000 00,0 S400 P00 A1ᜐ a8:<P0%:00S-8%$"6600Q 00Si 0_P 0 b R320 QP1Q SQ ☐ pBᜠ b<  YS:0 B z'z b~3p2z0W p11$0 吓S 0  0H0$p5 5C20000 0G00=0 p 0~pY 0X%0'00 0ᤩP 0 S100 0 P 8@ŕ L     1ptpt1p@0S(0#S [ 0(0$ 0墆$0(80 0<080 H0<00 0R8   < < L   0 Rh  Bh    R  ᢻ000c\%P0R !0 !08 P L@ l0 ^85@50%00L508Q Q0(0<0 0S 0 01H0L0H0LpW8up@5pL0p85@00L0TAApGWm8Q Q0(0 TS1 p?H0L0H0LQ 0 R !/P !!0/00S1/P11/@-PM`0pP B2> b<1^Î0"7@P 000 {9SR@ЍOG-p0 `$PP@000 0$0` B2 b>6<bT H B)B<>) b62l@`8`D0<000 "000mOPS@-`00pdPU@ 0 Sp@ T  ЍT80< @31)` Q0RhP 0h0Pp P0PN* 0Pp 0E00 B?*c0U00Z0 60Qd0X0000,Ѝ@c0O-p0 0008<Ĕ?bP0 C c00 0 )P `峨 0#0OX  0 h 0S000 0`,``000 008 1$01B0I> 0008<Ĕ?}bP0 C c0 ,$0P `rV0L"P0 0 40h00ي000R@cTAxAAɋAA0G-p0`@ PU 000'W Gh؊ R 00 0h Rh9S000 0O-P0@`H00/85L0<%0/@5D%014%0Q0Q 455405S944S@04TO- ,MRPYp p$`W0@: ,0W0:F,Ѝ\0Q.0[ 08T @)@)`"30HPd 00\ Ó\ ~ExzE0哸+0[0: 0 TU p0Sp/p@-@PM 00@0@ @@@Л|`0 0@0@ @@@›P0 @@ @@@P 㵛 Ѝp@CcAl.e8 p00CSp0/@- @ *(@%Ccl.e@-0 R  @ @0b ` 0oЍЀ-M :yPUnoЍ.AO-0,M H P000 gplW Xբ@?n /h+p+ 0 $+4:HP ̈  0ao % ! % D\%0R004\5 P  ᳈ ,Ѝtl4RR  ᥈h0 S 0R$%$5R, ,0R`FL3 L3P3 P3H3H3=0T3T3o  ႈ000j0P0<(%0 0R@0@0 0T`0$S> ) %> 1S 0DV<3<30AP4T$0X4S E>0X41'40`ASL V$5S0P=$`x $?``P TPP/ 80HL0S40pH0pՓT0 C)C)0c"03lGPP  0n  C80`$%!0, R0 f0P T:꜀ \Yἠ_<#| YP  0 ?<#Ή p 0Px 0Y`0 C c00T0P C)CRQ 0)0c03"GPP rP$_"   CbcDA8 TT]A7A8A0O-PRp@0[Y@ %   ' 0S> ) %> 1S0T$0P40X4S E>0X4h04 SB0400P008T0<P C)C44)0c03"F0P440$ R:B4 5Ҡ  0 Z00C?o200004圀A%R$%,0R00僆L0Yg$5S0PŒ, HX4dS944S@040T3 0P1<`110 1<(%0 0R@0@00P :>0 $  * NPf 0L0F0T h0?0㕶4P ,BUo P .$)00b0(V 2 20800080 H0S0L0 C40œ T0 C)C4)0c03"dE0P4 0,0l,04 A,04080g$%0 , Rh 0`p0(0 0t0D0t 0b0?o0cH0T0 0CL08048P0'Z 0 <Ѝ\4S  5  0|V000\ \ =0^* a@fdA8 TT 8TA]A7A8AA@-0S0iP@  sA@^@0T d Ѝ 070@T \\070``0u/PpW0Y V-:C^@\h@ct]eޑA@DeA-P00`SP p]@P {]@PH0  d`寗@Ѝ̋cC-@p3$M/P++  h0$+4`P6T0h 0k0 51 50@0\%R=S04, 030304040 50|k0" " 200(0\5WA`$Ѝ>T8 O-,M@40AWPp PL30U/o[" R ,Ѝ80HL0S40`G0`ՓT0 C)C$ `)0c"03=P$ 0%k0$000S>A8 P>G-pMR R`@A ZP   hPV!P4 7[PP0 RPq0]lP V 0S 0 0R\!6V 0\P 0]0 P@0&00 0P埖U:040000 0fPP,V,`L``ш ӓP倖U0v} i0Pu}Up`z 岈 œbƒKp`=S0 Po04=S:0 0S0SMP(0 aPPP 0 0S 50ó 5y=S  0  PP Ѝ0 5< 0HV0004!4!000C?o20000\4S Xu/VC6 5 0 5=S# UiTP=S 0 0C>00:}0SUTO010(PWPU@chBA7A8AA$AA-@`L1pPP ;00' pPB=TSFP 0 <=0S [ȇ= SؒÂ$%0,RL1hP ^݂000:0@cO-P@`=$MS =S  ⴜZT㜡T00p@0 ZP9ZT 0Y0T RdXX Te œPpT8=S+ 00/CnmP$Ѝ B P VT 0P6 p 0   吓F`AG0p@-@  # Tp  Q000P05/M-@Mp#Ф!0P  ` 000X S%*9  0000'0fP 9 ;909  000&00PSP 9 ;90[ 0 }00p!1/ 0  J0S 0  Ѝ0Z } W0 0 00ЍM/O-0\M0(0 0 0 ) 0% 0 000 ) S RQ0Sd0$0$ 00 0 ^0X:$0S$> 00嘠 =4000H 圐  0800Z08@0 @0<5 L <$ ` V p ࠱pZDppHpDP ``:` pPkYgQ VYp,pp8 p` P<nj pQ^njQ^,P V- p  0`p W V%  0q80 V 0(00 0 0P40S #H0 .`np`` ? B0:P00S P0S 0) 0p0`085< `F V`!V"40S #H08<Ř  Ÿ   . ?xD HLW  < W Q  #&&  "00`0,00,000"R0 0 00T $ PS!QS0 @ @`98E R@(@@D@\ @@Q:0@(,,0N X !$[0$ [ $ D:8@%?P80' @DXT $@0,0 $aY8 ;080[ 0 0 0 \$  0 $ R0 8P ; 43LЍ(@@@ @L@ Y @  `9 \*(L @ 8 <@@<>O-@P `R0 pM0 ЍO> 0 P0?:P= 0 6S ЍO0\0:  ЍO㠰0 00S Y  ) R 0P0 1R H0C200 00 0;% P ЍO-需,0 0/\*0 ,\0 0 ) n,0 V00P `0 B2>@ b6<bP0:0`40 00`FV` V`@P 4q:" 0 @P4<Ѝ8e@5``L0`(04S ;oobT`V 00 0S~8:@-P``@P0 0@P   0 00PX0 ЍpvdC-0 P0`\M0 0 0S  \ЍC0 ?P p p 0 00000.0>000 @P9 W000 04@P, 0S) 0 @@T0S3 00S00j@P  0  0@3 100ㄎ\Ѝ2 7pP 0   0,07V@PTd@cvdA-@P0@P l20 p\4SQ^Sl4L@ ^`P @Dő L0 ? 8<őH 0 ?00@-i ^`R`    O-Mⴀpᜰ0X@P尐`00  0000^0@ 0 T 0X*Y   R  L \ B Pb<P" P VU Y PP\H 0  BUP$7#L A1 a<20! 00000P Cp R 01!01/P 0R0*@0 @!0L A1 a<20!  U@PY<  0Pw0 \000X0,00A0 0P00S<0 00$00 0(0( $0WT UcY000 &R00S P0Y0uL0 C# c 9!300 m0 6Sn 04 UD0 000000$ 00(0$8PP 0 =$05L0 C c#3800 9!600< 02#T20T23P $95 Ѝ`(0$ g34D"40SU %5!500 Q00 R, Y   R 0@ D0T00 S 00!1 001/P00C0000Q0@p00 R ,  R0@ D0T00 S0 1 A1/P 0@p00  X  R@ @ CP R ' '1/P 0000@cTd@-0S    P (000 00 0 <Ѝx0 p@-0@00P`06/ 000`06/P Wx00pO-PLMt0pp,00@ 0S 00,00 0"R 8 01/0eÿ `"80<n0>`0E&0S R #6:RAƠ 0401$00xPEP0W(0,0ů _t1 000040 0 0pP ᅝ$xLЍ0x 0 | P ( 01/Po0@ 0 p 01/pH4Q}OpUp(6*C/Q @ ?QD   00ã 0bPMMM\C-@p`P(圀0 0001/P#P)SR Ѝ@- 0\ \ 00 0 00 ЍA-Pp@` M9S% 9S0 0 R( 0)9+ 00000 0000 8/9 ?o209S(0 0R  RVoBh 0l!  0`MLc/ hQ Ѝ!ꁚA@-0,@00V@"4/Ѝ6`6A0@-@0@000@@PD @DPPP0 0 P: 08S00P00008A,A AVALAp@-@`P(0P0  s] P bI000@09#60pO-P@p0KM 0`@`0U0:KߍP1 00P0 0 ;0!Q \0:V&0'0S(.^S(,0S ^ P\)0.SP PO-P10DMp @0! 0pv 01 0iv 0d0 8 "1/ d:41 TU2Q D$ d( /UTI, Q$ 8( 3$ \<,V  R 00PPV! 400p0A 0000000 5@P0 h 40R 0 h`F ` l 0v vDЍDcO- p`0MP$00$ 00@0000D000 t0P @"D0900 00 0KS@$00|00000 p7P |0S080$0@OoB@ЍᝈPM@`00 0`0|0S0800`0007X000C?o270L00000L0000[00CT0T R ?R5:0X80@040X0  <00 @0C0?d00?\00\0G0H00,008#8@0 0h0X0H S80S0X0T0 H00(80TX :0t@P t MXT0 P D10X t00?@Pq0 00(0t0(P0000ഐYg & R   0 P 0\  R Rj 4 R      IRLXP^P`z( ( (L R  A, T R? 4 R  R8 l0aPl014 RB  R?\0XH800,0tP 0`0Sw [08S 0$00 "8d$X 0h0@0 C 0)X @<  X 0S (<  ,  8 R\0904 XR@@)@@@@R0*#f @圐 0R@ @000Pz0X0[00SW 0 cX00T0 0 儀0"XQitx`$0x000 7{00S6 9S3 D0  jP@0S 0d \0DF0L@X7H@Pi@[0 @<0@J,0,@0X[Q@T[=00S X0  <  C 0L 儀0"XQ tx` xp@P9  0 0F 0`pDP @s! x05u@Px0$ 0@X0[00Sf D0  P@ 0 儀0"XQ@  x0u@Px0$ 0ȃ x0u@PH00SRDc^AiA@A-Mp@ `0- 0?PP$ 0 T 9 0C8C8900000TP00 0 9S00003/Ѝ0 B?PP 0R    A-Mp`0@8PP$0  @@  9 0C8C890000幂0H P000 9S00003/ЍO-,M00Pp`0 0 00 P *0 P0 000000 00$00 ?}@Pm@00$0@T  R@@@@@`ᴰK [00S S% _P[,Ǒ ƌ @ `@ T@ 0P@@@@@B WY0[ᴀǑ@Ƒ`0S 4"40 DY "0@P00 R ?R *  1/,ЍzAO- ,M@RP0Sp0 P刐`0I $ f0  ?1/P6 0 00P 00000)b@ 4"400 00C0 0   X廁@U0 00`06/T,Ѝ ,ЍOꡛA-DMLH ,  0DЍ丛A@-0"HP Ѝ@-0 \ 0 00\hЍA- MP8@<`P^0yᨀPPP)0P p@`_ Ѝ 0 喕@-)@0吕 Ѝ@- @ 0 0)0 Ѝs@-`@0 0HPPPP &L0 00 ЍpO- ʠ,ʠ`@*᠓0  l@R  @ Ѝ@P@$A-`@0P00p0 7/"!""9:#:0900 000"" 0 0CR=S0  0(0 000/< 8000@000/L H000P00 0/\ X00 $0`00&0p00h0+40 0x00|00S; S8000000$)S 00'(0"#0D0@00"$0@0P00#%0H0`00#&0L0p0 0 $+O-PM0SP0sM!srI"srE00sB(sr>0s;x0s8|p q`0$E @100&0! DLQ# 0 K#0 0 p~@PX0|0#880'00 Rd0X00$00|0 *P\P1Ѝ z0s8 0@@z 0 { @*0 pJ~@P 嬰0 Rt 娠0 Rp000*P\P0"sr AQ@e@P#sr` $sr&srxG@00w0FG 0 “@@ 0 p}@Pm#sr 00000$sr 0   00hl rq 00S08< 0p L 00H 80@04/@P <0010 P *-00)0 p}@P# 9  :(090*P\P70-@@@@AA-`p0S t 0d0 0 0P0 Lf@P90VkЍ@kO-` 0M0pPR@X1)RP##G*D1 0PA@0 02}PPP79 08C890 000000p07/P p 0 L. [ P ) B(B()    )~U } Ѝ.eC-` @PpTLp T, T4000S-@ Ѝ贀 @00@ R   b= 00 0P @  070 @J.e0AO-3cp  :c  6c  2c0 RS00P0S W $c0S c0S cZ  c Y0 U0B$00 0V  !I0U0 00Z  ! I$0!*5U V  !I0W$0j UP  !sI$0!5 0$pR0 B 0H 0 P 0Q b bb0Is b0 `C0 R ! B!0 0!0 1I  0 !0 0 !"I0 C 0$p 0 0H0`F0D`Y0$0U A-`MP `p1@0%T00SK`Ѝ,0(@0P,0(0,0(0SX , X00(P\0aP<1 <(0SX@ @S , , , P0X0S\ , \ 0P0SP0! 0 R00R0S"000P0000SH嶿(0X@S, , , 0X0S\ , \ 0UPc.e A 0 !6/ ! !}Hp@-PS`@!V 01P 0 [ 0ap0 1 Q000 !  !AR !  B /A-p@P`,0 00A0p@-@P`0S00p@S000 p@0{ /-@ $M0 4  *( 0 0 00vs$Ѝ0A1e @-puP001eA-P@T* 0S' 0p 0S e`P6@0 L 0S 0 ; 000C0A p@-@5 P pP MPp { PP `[N0 09767V pp%A@-@ P>N0 0p@-@PT+ 0S Q 0`ᑾ00C000ɾ 000,Ap@ L uT 0 0 0p@~6 0S(1e3ep@-P@ 0 0 0J<6Pp@a 0s/ P0( $ A\ @-4 00A A"1S@ ^\01,0//O-(0`9p"AR0,0Paq04`0AAbATW" |m@P 1@ S0@A 2PQW`p V000 YZ @`W``fV00C00S0S   n@cO-tMp0圀P@`@, ` R80 S6 ?8P K80 `oᩒ tЍ(P,0PU0%VZZB8 00`0 < 0!8 V#80J0 0^8P "SR 0 !r5R 80S ^8 0J0 00p8 `$6:00@ 000R  0  0 0}6Pw:Y% 7n  5NY PL5XV 7 !17h0S8 0Jp@0 00`v8A@A|1G-p VZ`'v& TA0$pp P(00@0?o20/ $ AP0# pB"   40XU0X (00(0XH)_$p@p P(p@_,V0h )/Y L@/DP ⹼@18@AS8 80< <@@3eH3eLA@cc@/0@-`0ML@T LPL   @A叼0 0,0 0X0@@ijЍ03e@chA @-VP@LO-plM $@6 `@ lЍn @`  t!@N@ S * 0L0v$ @$F 6 J0 0 07PPi6"R0   "46 6Z(`,  [t_x Zd4/4p4j 0S (0,#6~o4qAAA A-?Pp M     6  %:&p` @T @0 ЍQ#443-4 0D0 06O-$MH L $P!AYpZ `4!C20(2>B"  YV[ pf$ЍO%0 AT  QPP SPUR QP  RQ  R R  0R~l0@P 0 K000 A`P X0P`@ď T0,0PJ`@$Ѝ3e@c 0s/p@-@`M>% MP19%<:800`S< < # p 5 0`5PP50  RF $0AQ0%4 0S-H^]`Ѝp5 0 P 25(0,#6j[3,?]@cѝAC-Ap @QU` Ѝ<0@8PU | "AR0@4 R`001S B XWP Q00P `ZV U T,0!X00W0S `"V0P `偺U@c@cO-@M ` @VsC f %  ! . R  .  *0SI@!$04r    BR - 00> $!*T  ( R,,(, 8 R<<< 8 #, R0 4, @, 4 ЍO30 @ <P H2 2 T2X    0 ,  4 @, P3e|>G- P@V RU `D`(00@0$V0:Pp$01S0 H0L 0 H0P0L T 0P0 T %R0XP5\p5`P(0pܝAAP3eO-4MX傉 8d娉0:hR 0Ph?)v%t(0$ 0AT,0@T3 0B!O0U QY (@ 0`0DC3f0S   $03D#0* 0 /$0~(0S, , " 80S< < # 0P 02( $ (( P( ,A( $0p1,00S8 80< 0@<00\"S040Q,400400`0 0000000\0$08`09 0 *"*0 # 30 #6: ,00$0 0! 0 0*h0 d!s-l!0 \    ,  d . 01/pP6 4Ѝ 0`0DC3fd0 R  R Z  ,d2x:6d0$0 6 0/0 p,0W o 0h 0 0,00P3eEcA|>O- 00S #6:(00!  $ (01/#P1 0B!70S@(06` 0 0T:0J<Ѝ0@s 0,  }0J0S Y5 1P0,,10*50$0d2P,2/$0   0 ,.0,/,/,80, Z 00 0 0P3eEcA0@-,A,Q0  M*ZP &  Z0,0,  P0 P0$( R*0 000p0&P ps ,#004 ,0  $ 0,,Ѝ0@EPP3eDcA$Ax3e#DcIA1ܝA/O-pP@+0 2 00 0`P 8,+,D, 3P ` n1` Ѝ0S !,,-,. !  {6P  ,+,꿞Ap@-`$0S 0$0P@eP   04p 04pO-`P 0M42 p3RL"H"  L"H"U =0@T 0S p@cT; 00  0j4 Q, w 0P"V+> R .[i WQ PB0 0  ; Y HW;p9@!Pa 0U 00  @@`[,@P  6 0&43PK <0 ( 04   Dpx+Y  2Ѝ 0 J+++T+ 0D0 0-YU  0DACV  0 3SpMp p@c˞AԞAݞAO-`pAM$ P@\R'0h0i0j00$0Xp>0S .82<082$1<0S$10|$1n|: R$ R l 7<K<@D0H@T0 @HP X P<< 003P@0T  BRT 50 H $@ H@L   P000 <8 /H$ | XY p X 0h0h R 2˟`A&f,P 0V`!0CFAT#60CS  00`00\@d`h0YpD 00|0|P0 D>PP0V200C?o20S6 Y 1S Z 0 * ) * VX P x(0,p0 06?  0 1/Y Q0F\@0C0`00d0 pP0H0(00d`WMZ <0d!P0rH@a <#PP |p P0 @0S k0Sl00l0 0SP0XHp0 <P P@q < d< .0`@\`0d`0_X0bcX0P0x0g(0S [00p0W0 `V 0S  <0 P3P0Sd)W)p) 0# 2<0P(l0[ 0ÃQ 0   MP uY i7 0/ O0 X<0Pe Gk0S* 0S'0P 8`t0H 0X<P6 01p00 80<p) P P680  B  X<P 010 Sl0 0Ãl00$PU XZ xB 0@ P 0<5/ PP0P <;xd 0"10P@800 " 0 R002` 81/80S1O E q Gr  Y R; 6(0<0P3*PZ2P0S(((0 $:1l0Z0P 0   0 ,0R< 0 0(0p' ,0(  0 SZ <0k0ASTt0CP0@`X Hp,`F( 2<`0 0 P ^ < 3!#L20L2 000 800 8  4  @ 04@1/PPN #UIX3 X0/ 0@t03#H20H2t0S0 0P000v l00l00S k0Sl00l0 P0X<Hp0 P `Pf <& 00x.-0@ X<0P000#10yuP<jW``V@ |Y40x PT4'4'4'40 0  V P@ 0DAP@ <t@4 0 0 0'4b'4'T4@T  0'G04' 1 R"P'D'' 0@0 0P0X<Hp0 uPp00 80<bp PZ8`t 0 00 0u 0XSj0De@c5eAA"AEcA-A7AAAĩAC- @ pP)6k0 P RSPP P M:P  eP 0@0S 5`P '&)'JT03P5:P ) ЍLAp@-@P`p  p@2QG-@ 0S`pPU@# * 0 @P U  ZX 0 DcX 0DcA-@p@`@P0 ΄0 O@Dc@- .    Ѝ0.   0/Rp@-P@ 000Dp@00@- 80000  0 ;  b0ЍDcxA3e 0 d3e 0 d3e 0 d3e / /A-D0Dp0Pc00S@k0000bWA@c@yc @-,0@ ,0,0t ,0 1,*,*n%& 00S:d%0@ 6, P0T|c|c@-\0C40h0H0a⛞6t1(@+0 @cPAEc~A0 0@c@-@0S#3003e@-@0SiP  &"+0  C$3TU!( 8s~0T<^6 : vЍ3eAD?e?AO-P$MU p0E0`#*DW`$ЍSZEQE(PEN1@@@TH# p 0 0U 0 00`P 0F?o T20S 0@ TJ3DQ! T1`PE000 pP  VDc4 0S/(0(0 S;3S8#0/Dcl?eC-pbDMPA  p101U 00 1 000! P |i 0  0P$P(0PD1P 000  P  0 ! B)1PPp[000P P0:PP00 wP00Px0 00x(0x0)0:00 T PwpDЍDc5e?5e|>'A5eܟA6e A6e@?e 7P7A :eNA-, N0RǠȠ̌' @N@  0 `p0PP |h000UNP(0 @00 0 P rhЍAPAG-p`0P00@ @@ A0   T0:XhGU 0$pP 0 d #$P$fW U$J`5eDc|>3ezAO-DM@p ᄠT:DЍ! ZZ`VU3#:E V@P`2'$|>@-. .   Ѝp@-N@N@`P@ v p@4  O-@@0,M^$00h10 NP  ^P  $P0$`.00@p5A00pF0Y 09$`0S D+P (0  {$0P 0S  $0`,Ѝ zI ~"@0 j5eDc|>AO-N@N$M@0`uPP$p`AfX0000  :$0PV l(`0 P  u$Ѝ H 8"@0 Zz|>ADcp@-P`N40@N@ 0 p@uDc|>p@-8PPpdw@`w0P3#pDc@-@P  0+ n  0R 1 0+A-p`V@0ᢪ 0SP%PU! 0B0 0S0S 0  B;  0ɪ0S 0S0S"U `FPP0 tꔠAA-Pp`VX+ @$A0S0S2"000n""`0 0@tX @"$Tp@-0P[p0 >"@t"0S @"}"K"Rp@-@P CU ?Tp p@O-lM(,$0 0Z @p (0TdL0,0P0(0X00PX` P LXk@$0 SV 0 RP0`PX000 00Cd Sd05$0000 R0X00\0d080D0<0H0S  0` 68 4000 R 0F 0H0S LX.9Sl `0< IpPe 0@ P 0  Q 0S `0L$ Hs@lЍg000pD`0 HL P r #RM4 0/x z[p 404 J,00,0f@0S `0LHE$0 S@ $ 0CA0S,!000h!!@ 0S o`} `0R $@Hp 0Q L@@`0 ( I @,0DHD0H 1/Pc L`0H (,0 I HD 01/P #Ph2 d0/ vL(WX D0 @D0 0 &X `P 0DA/P LD 0 !D D!D 00 0Y D 0  !<Y 0 |D;PsD00^0 B H@1o 0 pP0 pp0p 0!pP 0D00 0    0K0@x000岨l0\0 LID%LP T 2 H'EcAA$=eAO-4M$0X0 P\!@lX0T)X0 `CV6`  $ ?0\0q 0 ,  p 0,`1/P #X% T \n4Ѝ,X 7Y , !!  !0 / @EcA/;@-$0 @@cĠA$=e@-`@ 0 ```` PP  " 0@0 0 00 0 0SC!ЍpC-`M 0 ````p @P 4 P!lv"W' 0`0C0@ 0; 0! 0WD0 0tW1 0S1  T 000Ѝ 0; 0p@cc 0S:0P//0 R:P3#//ip@- P@800^p@p ]@=e0 @0 (p@- ` H0@SP`B   DD00 $p@8p(0, 0 (0, $0Sp0Spp@/0G-8M,00@p00P  0P0(p$@ @ @`0,0T0P 0H00'>000(p$@ @Pp8ЍX|1ADc$M1G-M 0p` @`/P0 P 00 0 0 `@?o2P0S0S 00S00Ѝ R 0000 0YP DcP @-\P010@=e0@- P 0@T @,6,\ U@ 0C \0C0060* 0 0Q0P3#0\0R 0B  UL b  003e 0R  S01 R  S0100S/0/-0 0R 1Q 0^ S01^ S01R 10 0  S0p@- 0 P 0@0C0000 S   B h*0Sp@A-Pp`^@P .0H10@0P 0A!&0D{$P 00S 3/000L00 @ 0@A-00@SP  Sppp 0X  S```*0X   B ZWW 0 R 00W L XGVV 0 R 00VA8A-@lp`L0S #S Pn0S d[ᣥ000@cp@-P@P 0S }p000p030/@c@-P 0c-@ $M0 * , 000 00P Y$ЍAEc@=eA-P`pP @.0 1000000 @ 0@AA-P`poP @-010 000P 0 0 @ 0@A-00\ ^^00S Q : Q*0000G- P`(PЍ@p0S 0X  0S0S$0SH0SV $ 0T`0  00 J0 `000V Y ,0pGp00000@l `0T00T0000C0 00 O-$M 00@`pVPX\0@p` @$Ѝ< R:0[0*=) 0K& WHk8W R@W@% 0 0 CR:0CS`1`! 0 @p`p P 3  0/P0 SW0@@@`S@ 0 0S:0CS:0 @0 0 @psp P W 00 S0 `V 0S %@# : 0W 0Q:T  Q*Q%*Q Q@!PR*Q \:`PT \Q*Q Q*@ RR#Q W 0CR00R: 0 `pp: Pc 0S:W@?0BT. W 00 00C0@ 0pp Pp 0S*W00W @0S  R*0S*W00@0W 00 00C0@ 0pp PF 0 00CS0!0 0@pp P4 W00 T@@ @T@@%PvQw*Wq WO- ;@00CS@0Z p@cA-P@pUPP0` 000 PP00`V D#&R  p@0S 2 PU000pЍ4 R @ R  00B W $6SV X130ePPV40S @0S00 80$0S0 0 0@00@0 P@0S P080 VpP 04 R@  B@  0VP`U"40S @00CS@0  `3e@cO-P@4M0`<0UP!@0, T@1T@!Pp4Ѝ,` 0 Upt2300 000C0Uw0  pQ @ R p U 0 R H$Z 0  0 U01 C0`0 0C00[ C$ U1Y ( ,p  J0Qp   D @J0@@ 1/p @ `D $ 0P P  $R  0S0S 0S   W 0 S K\P 0 0  BR @c@-` Pp6P@0P  Ѝ\ 0S400@ T:p@-@P000000p0O-Hp Wp1 @00 P$ 00S` A0BpP00S  P0 'n H R  R0 R1 1 "$ R44 Q88 Q<< Q22 Q@@ QZL ( ,(  R,Q RsXH ? QXH0 Q Q0 Q1 "$ R44 Q88 Q<< Q22 Q@@ QZJ ( ,(, Q RXI @QX5H RX  P*Z   R 2/"" 0 00U000U0000C0 00 wX D0D0H0H000000p ЍXXX  P>Z   R 2/  U   U    B    AX D D H H 0  0 pG-|@ pP`"00LP0PP@/L 00C100L0 @  0L0 ! 0L00 00FN `@` r0 S0 S00P0$00 0 0H00  FQ 00SP3_ !0P0P `@IPZ0sU P3hĩAALA@-@pP`MS  0p@ P Ѝ@0ЍG-0@P0`Sp0S 00S R 3/000 <@  < 0 00s0SX@`@@@H0 PHP0400 S00# 0 0 000 @0S VLP 00SD  Y  K0 C 0 < D@P 0< 00 0 00C0, QS00$P0$ 00S 3/(,00(,000 00080408 400408080<0<00@0HPHD 0D ) BD80"&020( 2040S10010$00$000 0C(00S @@ 0  R*0Q~ R{`H0@8 @PB`@ 00R0 R0%`@@HP0 0 S* U#Z00S n`Y@@hT  V' LP9@TЍT 0 PH0 |  0 B  H00  M0 P L00(0D 0$0 00:@(T@@@3eO-P`@Mp@0 0h<0V`!@0 T!1Q!@P @@ 0S*0Q* 00Z R:㈱Q0 Z8Y $ Q\  M 00S  04S0 08p S40 004 000 E00 $0 S40 >0 @0 W R00 0 P  @Z 0S:A⑾Ѝ ĩA@-0f ЍC-` <@"# p0 2 0@P@00T@g20S R 3/ Ѝ<0S0 00 0C0 @00 0 0  00P 000H0S 0@0S 0 0@0SH0 S vS 080 =40 0E00000 00P 000HP 0 D B"&0{0D0H000 $00S 3/0 $00"00000ADcO-2*M00P`[0pr  0P 07/ Ѝ@4 R @ RO0  F 8  $Q@S ⬽0q0 0 00H R, S > DJ0P0H0匽[ \1Xq30儽00 80 P[  q  E0SH0S  DJ0P  0  80:#:00 0H0LZ0 $0 03/ 0, `F(00 0 7/nLN1TK1@c\K1p@-@P0S@ S d;R003/p@ | `00CS0CIA- 0 ^: 0R:   0\ P00O-Щ$@ 0@00@(0 B0 2@@ R"` 0p0?U0 0S?#03@, 03030300ߍ3e[eC-MP@P`` pc0  PqH1 R*Q, k! 0L CT04 ,  0000<0@0D0H008  00000000MЍ1L0 ^ ^ N^ ȠLȠ^ !P0202 $00P210221cc3eEc0a/Q/0S //C-Mp0@`00 0` P0 P 00 000 0P?o2P0SdQ P0 04?2c0ЍQ0 a/Q00@-0>00G, R0" R:<0Sb^ 0 B 10^ 1300,0堰0#3[ I: 0$ S80@4600 0 0 SP Y 0 03/:#:SSX  0 7 0D %6SP0S 0P 46Se0 x00 0$Po 0 i|>@c3e@- J$JL^ >00>0^0 s *0#03<@ Q03 R0S O-,M Z%ZU@N@>0 0Y*1 000003$6 0 0U:@3,Ѝ 0FpC W|#$ QP9 @Tk0 @PP Z P R:Z 1 0 $`  PR0 HX V ۷0V00'0J R$0 0$000$0S Z@X 0! $0 (,0 D 0PJ0SV X $ DD'P Q @w@xꌞAO-LM$ 0qP,04 0LЍ   P@D @\ 03:N@ @@v 0C,00 #@3 S:<0S03:QT0P`0 008040 { OP 0 0(0S 00 0<00800400 0 @00Fc|cC-0$M@؄SP`p0 0Lp@07/p `P ,0 `00000 p00\$Ѝ@-0@SP`p0$M0 0Lp@07/L0, `  0 0  0 08$ЍO-,MP\  `P0Tp@000:X#:SQQB,  R Y :< R ,ЍZ P I   RPZ (0$080$000 GP'Z0 ! 0L @0:/ 0   P 0U 1 !00 xP0 hUh*Po$ PG $ 0UV 0RR$0SOH0SL4YI00[E 0UB$P ( , 0\0R !  R 02/ $$(,0 00 0001001040408080<0<020@ 20]Y ZX 00 0TZd t  0SXZ   R0OK 0S]X[0IXU E0 P0'X0p@-`MPD@T@ HΌ00 .   `P@@ЍpRp@-@`P 0D00 Pp@p@-P@U 0p@p@-P@P &T@@pG-`@P $޳ T0G/ 0pIUJPO-tM@$0$0圀@T` 徳0 $$FJ0H0 p T 000@  ,0_0 000 000,00 0 1/pP  $0tЍ P剳p,0Q P,Q,0,0@TÏ6 ÿQ Q00   {0P000P0尳` T0S P   p֡A@-" "&*C6uP Ѝ@-" "&*C6t Ѝ@-" "&*C6 Ѝ@-" "&*C6OP Ѝ@-" "&*C6N Ѝ@-" "&*C6Z ЍO-A11 0R tqs0\ ,R 0 (R 0!L P 2` Ѝ P @`V2 QE A00S00S  R 0  zT PP\ /P101101@@@U4ec3e@c0cG-` PpOP |0   ( $ ( $Ѝ@0 @@0 pP@ T@ T c4e 0p@- @P!  ` 0( 0SmH0;H0-奋 P0RDP  0.T  0+P  0< 0000pĩA 0p@- @P!  ` 0( 0S=H0;H0-u X0RP 0.$  0+ 00C0 0< 00 0pĩA7@-""&*C6@PP 0 Ѝ0 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-@P@͊T@Ppcp@-@P@T@PpcO- s@0PSDM@0S^ D0S@Z b10  B0S#0 0,`0@`F`0`0@00E0S @0U=DЍO, ?@@D @00r@P 0 Q"0p`0[) 1 pW1 @  P T ,DЍP 000  00Y+ RQ3 . R!: R*  @0>."    !P@@ 0 ATQQ@[D   3e4eEcT?e5eA@-T R*0B 00 ( FR0\ 3eAA-`Pp@P @P0SPD0S TE P  >P4eKAA-$aP0AS 0!>00000000 81Pn 6810`U 0CS*E뤀p0WW000N@N@W\0AЍP< 0 JEcT?e3evA@?eA|>̢AO-B2 ApP LD P9U@@_p|E_`@fP$Q(@少!T@0D 00`@061@A0@e0C@@@ s0 ᄠ0S 0iP\P`EK@0   S0P  ~  @P 0>0000000x (0D0 , 2`%`F `뛦*@c@cA3e4eB}EcT?eEc/p@-`P@+0`P @ pT?e0@4ep@-PU@Ep@x0@QX00 1Ġ  S0 Rp@D@cZA3eA h @- 0pt0S[es@-P@ ` `"""&*C6 00#  0+0 0Ѝp@A-@ PP` ""&*C6 U`" 0p1 P(,`0p S 0: ` S 0; 0\`P PĩALA@-@`P0p0:0-0 p Ѝ0 /@-@%0:0 /"&*C60S/w 0S/{ 00CS0/@-@3e@-@| P@m @-0@S0003e0S/@-@d P@Y 0ⱇPp@-0@0P*᪇p@觇᥇@-0@ R0 @ه00և@ A-@ P ""&*C6T0S7 0ℇ P 0 0; 00  0:0 08$0 00S) 0SA0S 0 00C0 @ 0 ; 0(0M0 00 0S0SPU 0CP `V' 0S 0x0MU 0  :0^V681` 0 >>⣂R P A 0S 0 `(0`0p 0s1Q9 0 6 &! R  010@ 0"61@ 0"601008 000003e@cc4e3e0cO-M 0DP @@pH뤲2 a  00"603S P0 PYYHP TBY  V PY ,"($($ W     " " 0ↆ0W @(0 0p,0<  0+ 巆$ X  Z0L PY 0 P0 PI ЍP  00P0SX  R * |R + 0`l  P & ` @c3e}A ccĩALAA-Pp`VUAA0Ds 0 0 0P 0P 0  0 0b`0 00I4ep@-0@ RP0 !@00 R TpP0000 TUpp@@-@@Bp@-@P0p@@-  @-  @% @- 0S Q pzP0Sp@- 0P p @nP T  0Rp@ppĩA000 //000/ S0/000/G-@0 P0LS#%p"&A6 ppYl`Q ` p*6/P0U00000Ѝ pY`Q`*6/7=l6=\5=h4=@-@QPЍ@Ѝ /A- @@Q pPW`/ Q 000  0 +P(P]0@/@! R!/! !A;T |P 00S 3/V@cp@- 00S@ SP` Q @p@@-|@|p0 S 0R``&0000P0Q &0( Ѝp?e3eDc0@-@t0tM@@@0 @$LP @~ @4P00S 3/@TЍ0EcDcp?ecAO-ph1,M`\1PLL1H! 0006001 Z,A   0 00 0 $$P ZG 0S 0 0 0x0 6$0$pU0 $,Ѝ d)0X 00L b0 PEz@c4e3eDp?ecAA@-PfM0@0 06S 0 0)Ѝ@2pqp 0 ^P 0S  p0 P FЍ|>p?e3ecO-P0M  R0 Q" @K `pᑪ0Z000 U00 0Z$[ T{ ЪЍU Z `@ p ( , "&Ep@ `p@` T@ 0S0`S 02000S QU  0@ @0 0T  0 Q00S+ U 0S 0 0 0 0S  00 00`T 0 P0  ( ,"6 Y U $uU }z3e@-0 9 Ѝ|>G-`@M@fo PrEVY)X 0   P0  ( ,"& 000  V0 7(@Ѝ0 C-@PpȐ΂`V686P@`pV 0 t@fh0@P:`X宂EF@8PTPE_o@RPPEcc?e£A3eTdp@-P 0?A3c S 0 S<` , R0L <0`ODS0@y @@@?CD0p3eQJdVUUU?es@-`@#L0R>Pc#L0Rp00Sd<`0@AX X 00 000 004Ѝp@@c4eˣAc3eAEc?e5e3e@-X0 < PD0@`@0j@0PQP P3ec5e0L0Co/4e`3eP/@-aXYT H0, P<4@(>,@ R +0 03ec3e5e?eA- 0@S0p# PU# OP`ᰨف 0S `U 0S 0  ; 0 B 0SP0S`PV p@- 0@  P P A0 0p p(0, #6 fP +O-EM 倁7 5@5 `pn`P =\5\Ep#T5 8L  i 0S 0SC0S@40%0'000 00 0RV `P000@0 0 0S#1 D@0[:[ 1 0 1T0 HU.2h !0S000C0< 0S0 00 00000/4e0c@-@P R00 O-TMPx0 @S@S#2[@T U0!:3A00C 000|00  U00 Z0Sl  z'(0, 0P!0SZ H0L00H#6$000c,0x00c(0{0J600P @0$#6CP0#v0P,0  $0$ 0S[@jTЍ6$0Pv0#fVnWj* @)P@!@1 V`!x0@D @#60c@(00S00PIW@1@!@D @P`1,@x0S (00C $ 00C 0@0D 4 B Q 4 R00C@<08 8<0 F A0|00Z ~Pl 0 ZPR 08 0H0S0H0L0H`0 pS00R0S<D ,0P`s 60C00 0@G @D@ @T@1T@1x0S (00T@1d0VSP1x0S (0px0pUP! E R %p# 6`F :  T* 804  80 $4  Q* `F$ R 0U:Z @PZ@HP z$ p 0 p R0L0 0P@8 0|000|0 R0L0 08 0|bM @ 00# "(0, 0P@0#0P00S 0S @*T 0S^  P2[+X'*PPUP1[`! `1EpV.PppW PFE0 S0 0Z" l@XP1P!pP`1gEp 0  |Z PP @|uA J@h3e?eAA y?e04 S/P @- %60cA/0@/c/0 \/у0P1cA-@p`H1ƒ RL R^!^D*   R `V`F`P5 E@V P^@o#PA A B R`V`F` V P L@cۤAp@-P@y2 Q*    0R p`VH5`F`V @ LPpcۤAO-10S|5쀟`Pp U@30 @33W00 Ѝ/ Uڌ2Sᅢ \ J 2PW@` P @ K3eAc"A]AA0@-@X0S0/"R\:@\*QL0@0C?0c@- pP 02 0  Ѝcp <0 P 0 D R 2 P///c4e@-P@-@@-P 0c@-P 0c@-P 0c@-P 0c02P 00 /c02/c02 /c@-@P02 cO-pPP夠R I W6` @#&G$0<`@`D`H`L`#Q0R* 00 00 00007xpc3e@-@PL0"D0S 03>4000 ,02Ѝ0004eA?ecA@-0XP`B 0\`R 00P@0 0 0< Ѝpcs@-P0@D0S00Sx Th14P: T+4`A P8#40`P@Ѝp4eƥA3eAA(ARAc0O-M`  0p0P0p200ЍZ4? 0$$Q0D0BS0S Z5*a3P .0P Z`V30`F`@V @ DpD @R` 00C 0R P 06# 00 P 00C 0rA4ecuAۤAc3eO-,MPP@P U.` 0peP 0㤠N@T P,Ѝh ``F&&$ $    01/ 00`@0/@- lP00 hQPC-(P@D Q0 3S 0!  U00P`\ ࠱P` \ 0 CQ: U 0 00P`0S6#P `0 S 8P`P`P `0 Ѝ U00 Y  0X^A- p$@P`ၝ0vw6 00D͝Ѝp0 P/0S  4\Q 8< Q < < 8H  BH /80Ce3e P00S/P 0 (Q, Q/8Ce0P  /xEcp@-0@` PU` S R   P00 `800d <0@8@@H00H0pQ0 P0S  00Ce3eP0P/@- T000 kT0 @SCeG-@0Q00P00CP0AvP'۵P""R,40Hq0S)4$4140P !( uL00CL0$ T00CT04;P 2 `u000P00P0 v`0``FV`dC``u, (@0<0+ @ u `3e@cCe@De4AxEcp@-0@P uuuT00T0uP00p 0 CCe@-P@D`M40 00` v@ 嘜Ѝp(CeP3,2@-P@H`4<0 060`0 v@ ~Ѝp(CeP3,200@-"sr9 (b ?  0&" 0BS0000L Q`P( 0 0 $ 08  <hpt0~% Ut0PÿH X @cxEc$(2bA@c4e<2O-QMM`M6 1H`V1 Q` q`, [P` 6PD嶚@s<1p@0T tV000p00000CS`4@0U MލЍ R @ pV 8 aJ. 01 0; 08  @0< $ P$ 0D0VY 9/ `P @3e(Ce@cCep@-`@0M @H@U xsP0 PPP 2/ %@PxM9(000!X@ @@@@?P0p  (0 ЍpCe3e@c  e0 0000 0&@P0 S 0  P!l6p+P  @0S &($0P0&00CSu00h&`P0S %h= P$0T T0,0h0X 00$\,`Vh @@p0S@0P$5 5+s`P~rP`  `LrV @ P? `0Sr04p00S 00 < #Q(JrP r0;r @ pr$~ 0$ H0P0 e. !h340X !;$`PY& Y p2`0P 30X !4$q[6r0oEq @@b!hY$`P0 0 0(0S0,2?d4;&fj0S0F0Ye1 0o0 210X!10 0 4C#"#04>0CYC 0[1 +1 I "+넱x!(0<Phm0S !0S     , $!Q?P  -(0,`(0rq00000L L P P q`V`qPdq@0Hq ?@@3e(CeAxEc@cWe@DeAA$A@c/A8AԚeIAmAACe ̨A٨A2A1 0S/G-H0Sp+"qPUz+YqGC@T P 0  4 ( V` $\qV  TX+#R<00# H00CH08@xEc3eA(Ce@cCeCAAG-0H0SG0P SQ@ 00ppW R00S0 00@T p 0$  0 0S0Kp` #R<00# 0800X<0@800 00 0T0 0T0p(08@ p3e@cCe@-T@L0S@ DpdX40 0P@T@@ӻp3e@cxEcp@-@4Prp@e$0 0$0p@p@c3ep/p@-`LP]p@( 0F 0 0C 0T00CT0p@p@c3e00S/O-4Mp>p bPwpV# &4ЍO( 0C  0 @+ 0&0:@;  e`W4Ѝ@@`xEc@cp@-0TP@S` 0S00$ 0 B&$ 0$0 0000S$000T00p@/O-lM 0003`3sL0PQ2Z@P 0  plЍ?&6&:$+O4X  0 [   ;XM T2XH0 000<2H082t00800<06$0 00o0T  T o0Sp 1 01#1L0R000$0Sp(:P00Sp  % ^X0go0o*0S Zo 2pS 0b @? K 0 2~o00 U( 00C 00@ 0030 &0:;  m0 0@c4exEc0 0 @-@jnH0 0@nꨋc#O-$MPH0TQ@`LpP0#0@ 00S 0So"0S R0 0`P60 0 H00\XTPLp$ЍOr#TkO-Mp8000 0 0RЍl ` 0 ,` BPT  _2d]2 [2P Q /BCFcO-|MP`x Dh@ pT PF 000000 0 000000 00($00(0 000040 080(2<0}>@00  1DH00LP00 0TX0\0/S@)@T& 0`@hP`0 E0PT00PE 000 @ᙑP @@ 呑P0@00|Ѝ`Ps@-@P`AP Ѝp@rЍp@- L@?P 0S 1(S2S PdAO-0|M3S `PP1S S2S @$ $w @P $|Ѝ22 0 00 00 0$pP $@E  000,080402S-00l0@T D0D0 04/@PD7Z\ 0@SB T!3P Q*J 3J@D@0> $Q@"R)0&0CS$D@ 0000 0$>@P $10SW00CP $$@"R"T@10 @ " 0TL000@ @,@2S0$0S(0 40s0N@N@4@800XSB 0tp<1W00 @P tp0t0& 0S3 @$RC0S S0,0p 00D00$@0 P h@D0480 ,p 0P*,00@0S0000@!(@P00( 0;0^ @P40〰 0D0@PDP5S7S 2$0$00` 0w@P[ 0 x400 \%Q ß>0 l0 4 0  @L40038/<000 0'T$0( Rc@dPS01Q PJ[<4 qP0b B 0 0<0@0 0 0<0'P# @0S4 $00 . Q 0 0A B0\ 00C \ 0@R:0R5 B0<00<00@ @@S 0(@1!00L0 0H0GT ,0 S0002 02000x0h@|0l0$03/@P! ,0@H0 #0@0@ [2G2A-PpU@` U RP  Q 0P  R@T P iA0O-Mx02 CR@#2` 000 00 0$V@P  p2 S OoBA Ѝ0S%P U"0P0 0$1P PEPPE0PPEw@ U @-P@`pP  0 00ӔPX0@0X0 ЍG-X0 `Ѝ0@S P `P 0PPPS*0 P000 S S S 0  R   R R0 R 0S `R p@ )Pp$  EZ`    :`{p 0ٺ00X $p0 $0X 0  0;`P0 !;` X0V X  R !X0`P 0X0 0\0kR 00dX0 "Up^W L ! pP ꔪAP P P{>>//@Fc@-0`*p"*0C00@ 0 `0 8q> 00. 0.0 0 (03100 >0#60ЍЀ@cA-P@U 00 ` 00000paU`  Y`hFcA- $0p0 $0 0@R`P:    U@` P 200 00$00hFcx @0D0@0D0S/p@-@P`0S000p P PhFcA-@T1  0`/ @+ P!p@P0| 000m0 q 0  0 0 @P 003/Ѝ@@-$Ma01@00 0000 9 PP0p  勯W 0 00 .  00`P$Ѝ0@-PMP  @:#: B   B  X0  00. 0.0 PЍ0@Ѝ0 -,M $001040 00000 P$P,ЍA-X0 00$@0#,C04@ R1D@(2Dp<`C0PB` R 0 00000H0Es 0 0000 000H0P 000 0 PPЍhFc [2$0 0!0 00 /@cddd@-0`iM0 0 kBP 0 iߍ@P pj0 tpPd U00> !0WeWeWeWeedA@-<0DT 0 !0  !@cO-Qz ,M₶ Ua0S a3D `P䢟D{202 000*0@P w/Q0  ,00 p 0Q  \PxPU Dr@pD⿂P`$DP{PXDP D0/SY0`0DP0F-0p 0pa s0!00 "0RPSq`0 U  h 4 00`9P:0 0C4/,`000 P0@`@ 8 c"P#$ ,A00    P0U0P0S@ PP@U00@p\ЍԪAc0DehB٪A (AdAOApA~AAAAҫAAAA0@- ! 0 !@- @0S 0@/WeWep@-T0PO`d !0UF Ϡd 0!T@!pl?e@-0`M0@ 0 Q00 00 y @`T#ʴq@Q   4/0 0 &#:S 4/?&6 :  GX 4/`ЍHe@D0De6KB\ABBgAFclAt6BΖBpAl?euAAjA 0O-p`'DM@O! 0 0 0 00`(p$ 0,0> 00!0 0 00`(p$ ˩'0 !0 ,0  00`(p$  嶩 0 ,00!= 0"00= 0 00`(p$ 堩 0 ,00!= 0)0 0 00`(p$ 助 0,X !/0 0 00`(p$ pu0H ,090 0 00`(p$  a0,0G0 0 00`(p$  M0,0O0 0 00`(p$  90 ,00![0 0 00`(p$  %; 00!e00<$ ,0  00`(p S0,0 0$!`;0o0 0 00`(p 0 ,00!x0 0 00`(p$  0 ,00!:00 0 00`(p$ Ϩ0,0: 00!p: 000'> 0 00`(p$ 帨0 ,00!:D00 0 00`(p$ 壨 0,00 0 00`(p$  叨 0R!0 ,0  00`(p$  p{9 00R!0 ,$ 0 04`0(p d0ɟ 0 00R!0$ ,0  04`(p K0ȟ00$00 0 0R!0 ,0  04`(p 3%0,00 0 00`(p$  &0+,00!0 0 00`(p$   (0,00 0 00`(p$  )0,00 0 00`(p$  *0,00 0 00`(p$  ϧ+0,0< 0 00`(p$  廧,0 ,00!>0 0 00`(p$  妧-0,0;$05 00!50>00'> 0 00`(p 匧.0,05 00!K?00'> 0 00`(p$ u10+,00!N? 0 00`(p$  a20,04 00!O?0 0 00`(p$ K30 ,00!|4 0Q? 0 00`(p$ 660 ,00!(40S? $0  00`(p 70 ,00!3 0U? 0 00`(p$  90(,00!W? 0 00`(p$  <0P,0Y? 0 00`(p$  >0,0]? 0 00`(p$  Ϧ?0 ,00!= 0 00`(p$  廦,c? 0 00`(p$  姦@0 ,00!1 0f?0 0 00`(p$ p呦A0 ,00!1 0g?00'> 0 00`(p$ zB0\,0j? 0 00`(p$  fC0 ,0m?0 0 00`(p$  QD0,0q?0 0 00`(p$  <E0d,0u?0!̬AT2<2Ec2p9d54De؎2Ec22}c2P}cpA22Ȍ2ܑ22 c2@2l2DDeGct22KBSB2 0 00`(p$  F0|,0>0 0 00`(p$  G0,0}? 0 00`(p$  ۥH0,01 00'!?0 0 00`(p$ ĥJ0 ,00!1 0? 0 00`(p$ 寥K0 ,00!1 0?0 0 00`(p$ 噥O0 ,00!(20#>0 0 00`(p$ 僥 0!?0 ,0 <00`(p$  pn 0! =00<0 ( ,`$  pZ0$03 00!3< 0?(0  0,` C;d$0 0 00!|30?00'>< (0  0,` (; 0 0 0!%>00'>(0  0< ,`$  0!?0'>@A( 0< 0,`$  0 '!?0< (0  0,`$ &>0,0> 0 00`(p$  ̤05 00! 00 D,0  00`(p$ 嶤5 00!? D,0  00`(p$ 塤 0!5O@,0 0 0`(p$ @勤DЍO-ADMP/ `p  0  0p,`(`$P P P<l , $ 0 /      <0p(` P PU ,  O@ 0 <0p(`$P P P@ADЍ̬A2X2pC-QM`p \@ ,\ \ 0` 0 P 00 000 0@?o2P0S R0T8R \70Ѝ8874DeĬA@-p|0M@P? 0`` 0 P 00 000000἟ЍPcC-p0MP0 0`` @0 P 00 000 0@囟?o2P0S  ЍWeC-p0MP0 0`` @a0 P 00 000 0@r?o2P0S R ЍEc/uA-MⰀp(0@P`` 6 0R R#  L,* Ơ$ d `  L\# Ơ1 00X  00 000000+Ѝl?e3eC-@0M(0`SP0 P$0p ` $0 P0S S P h00X  00 000000ЍXmdG-MP 0`` @p 0P 0  00 0 0 p@מ?o2P0S  0000 0 P00  ЍO-P|M p嬀`@` +0H`000 00 0@ 0 埞0P?o2P0S 0000 0 PPP0SP +H0d|ЍO-P|M @p``  M+0H`H0 00@ 000 0[?o2P@@TP0SP +H0+P|ЍC-|Mp@P` `0X X@0 XϜ-@XjX H0XS  00000 00 00p0000X@HI|Ѝ@Jd@cC-@|MpP`` $1T0 T@@Y00?(P @6 (V(RXX @HQ YR00 D @0  00 Q 0 00 0000p00᫝X@H|ЍJd@ccG-pP`0Mr 0` @m0 P 00 000 0@~?o2P0SD0Q 04QS03"# %05ЍucEc NMb@-1P3@[k `q0VM P0 ! 0l:01 00$00剤$00$0P@僤$00$0T0(00,0 0S00@000H8p0900S  @F0VH00L0H0 Hq0 0P00T0<00 %0`00d0`0h0$Ql Ѝ0 `U 0 H0N l Ѝ@\@cxAA@BA-`MPp@ r 0` 0 P 00 0000@Μ?o2P0Sq0PЍG-@Q0Mp000` @`0 ` 00 0 0 `@塜?o2P0S, 000 0000 P 0R <0 $\ @ 00/( 0$ Q0 0,0 $ 0(0 央ЍEcɚ;6eA-M@P`p (0` ;0 000000X00LЍC-`0M@0 0p` P0 P 00 000 0P,?o2P0S@0S@T0"K 0%PS0 0{@PPЍEcDcG-`RMAxp P` ($1 0 1 010P 0@Hp?o2P0SMЍC-鄐|M@P`` pHa0X 00 000000ᾛ|Ѝt]es@-P`00@0S 0 ƎЍpWeO-PM@`Ȱ0U0s 0ȰĠp@ЍOX 0UT@@ p堝wXqU2U`010# 0ZC L R?0|P XUZU|pWU4SU}|Y[$EEU  P  f| &6U| RpU[|# W!`IKq@paUXQ 0`FV`G: U`pP0QU  1 ;?0r|`DUV UU010#`| 0Z6U!|Y[ WE ^E'U 3 PT|0S Z1`IK@ Ѝ0 M@XH ccO-PR`@$MB @pT0 RTϜ@D @$Ѝ Z X  (     DT  (TZ0 H @p ꘏cx]ecO-|" 00,p$@ @@ @` 0(00 00,p$@ @@ @` 0P(0 0,p$@ @@ @P`ޛ0Ѝ脯AP ƒ #60 P *R  P 0 / 0CA-0@`P P(0p, UP1p1:PUp0S S0 0!d 0 P*0d0 L0 0!d 0 P:00 HDescAA@-L@P 0S  00P 0000HDep@-c x@`PUpP_x>00STO 4Qx<0 80"wҰATDeHDescAEcA0000 wHDe0@-M 0000P 0`@PP8 _@P 0 @@0@ 0 @P -Ѝ0S  @!!H@P @0Dp?  @Sp!@@Dp@@Pp w`0S@|w0000 @P L0S00p 00=@P HDeTDeAH2O-RM0SP@ AX Ww0SPzs,0 Ёa,0zX⚥mP08 0(qP0(@8(0H> C'᭠(HP(1P01QZ=P 8 (0<0, 0H0 @L lPP0= @ @H0L PD!@!$0$0 ( $0,0 !@0<]|x|P[0) 100S$ ,(FP?0 00000000 00 @0X PP  @ ,0a0wЍ 0HDe@BEcEccATDeO-MQ@L @pP `VTP@%ЍH0 0D00@00 01/PP P@ `p@-P,0@TpFP @(sc@-@o@/D/H/L/P/T/@/D/H/L/P/T/00X\ /0\ ^00-@-P0S  o` ЍX/\/RA-PR`@P\p 0!S :P d!X@xPP@@-X^ :S!\@ y s@-D0`P @Pr`00Ѝp\De@-@0c\De 0 3\De0 G\De@0@ S D \ DSR///@- 0@ D  H  L P  T QR #X z ЍX R #D00P0 00@-D 0R  ЍP 0PRpX0S` @W ,0S ` 0 D  P  X R # \!00@00H00L0 0T0000/03/@cA-pP `V@P PMuP uV @000V 0 `@ 0S 0 00 P000 @  yu`De(scp@-@PM`u@@ @@@`0      7 O h    $(Ѝp\De+AEcP/H0 R R 0N R R (scp@-@`;Plt2@PT u0p0`0 00$P 00000@t@`De@-@Pt 0S 0 0S0   L00C0t@ 0S 0S 00  `De@-$ P P PЍ@-  Ѝ\De0@- 0 Ѝs@-@PtM`B`M0 0Ѝp7@-@a=PP\PP8P 0\   Ѝ0@ Ѝ0\Des@-h` P0@0@PDPHPLPPPTPXP6  0PPЍp\De7@-P@0@@0D0@ D0H0H0L0L0P0P0T0T0X0X0\\0 00P Ѝ0p@-P@pp@-0@S P@p@- IЍ\DeB\De=\De@-p@`MGZ1 P@0@0D0D0H0H0L0L0P0P0T0T00P6 ```1 00pP  G!1 08G ! 1 02G 0 0,G 0 0&G 0 0 Gp@P$G @PG @PGh @PGL @PG0 @P G @PG @c2@c2c 2cD2c=2c 1ct1A-p@P0 MW  00  0 0p_`P0 TW!` 0z/0@0 `  Ѝ P0P0}AO-`M Ap0PgHeH 0,06:/S `#P#!+*L0  3`V |c,Pа GHV`P0S.0P |HU`?P /v`P$0000SPSPhHfHUVW 2 FR<PX W hЍ%S) n BR$ t"z?0JP`Z``0D"104"J000y(0> CJ "p0?P.001P PP0SPPSU"`P P 0 0=0d1  PP 0S @ \TPP 0P80S101?1?11` P@V@@pp@-@HP[E@080C@00S  0 Ep@FEc@-!2 !@!$!!!r!E0!311Sp@-0@P0`@ PEహ!E @0 PUXEt#[p0@00XPS 0  P@D003`E>EpJdcEcTA@c@c@-@@BTp@-!2 A!R!!r`!U!,!P!,!001SpA A2S^ 20Q 0RQ Q !p0C B 0 Q2-  a>Q 0 "Rq0 o`/O-MAQ( <0@@|UЍOQO(0pS<0(00 0 00?o 2?@0HS=0 $00H?oR20S30H?or20S,XPD`xW01x0#L0HD4`P(000U L0S:Z0S7 $0S`0$ S02D0@0 P 0B@dDT`?D0k`P XD `=,0D1@4008040 0S`,FDDD/kP80Z80 @T XH3$ 0R 0 S030#R0S 0H0C`0H023W`x XgVX@\0P XP@T`1 0dV`0(0h000l040p00|x0P00P xT` 0V㌐0P00P T` )0V㜐0P00P T`(0S V0000P00P T`"*0V0000000P00P T`ؐH0000 0000t0C,CL00 X@0`,`CVT00000 00C 0X0 0$000000Cs  0007X @00S0000PxCX<tCV(0S 0 '" <0 Ѝ`Wecc\sc@cO-p3tM3$WW3@03?0 tЍZ0@3T`3 0((00(@˅P 0B,B(3(JP`U L0STZ0SQ B0 0000P 0@CT?? 000>U"00002q EŠ0 3 1@cDcO-13A1Lp冨gbPP넁`pU/^U 8 Q020?SP ! 011QPk?QQ? ?10 O[ P 0SW ( R 尐U4 P00@cDcp@-0Sa @1S@ @A1S1SpPk?Pa`1Sp0S  R R    PQ @cp@-@T 0`QT@dPT\=rIPHPP >UP@pT 0d3xIPvtc@c1R  !/1R  !/G-pPt3a @P    T\@@c@-@`Pp0P @! W#!! 0@@ @ 0  @o  0  @P@ Ѝ@cO-%upWpF@Pd3졓10S?` R= 210030 10 .11 R`` y=%+ e- ThX 0\P0 03 [V p Ѝ3 S=)0P  =  {@cA0Q`/wt@A-@PxM␀ Pp`x ~dp` P<T tHP  @m, =xЍdmHP 0 XmcA-P`h0hp@0 0"+ - 0(00  03 b3@cQ-//-//-/-/-/-/-/$0 0!0 00 /@cddd0  c P0 000 cP000/0 P000/ 000#0 $000#$0/Qp@-P@ Xh<P0 R 0SP400S! 0"PT <pc`scp@-XP`@ PD03 1pV T( LP p8#pc@cc0 100S/Icc@-@%<07@]<c@-000S 0#  Ѝc@-@0S0 R `000S 0s0000S0SpL00``vVPT00SH$A<g70 0 0 `sccгAAAhFecpcxc7@-@P R 7h0,t 000l00p00 Ѝ0H2p@-@P, 800 00 0X0$00(0tp@h2@-@ @ `@s@-@`P0 0 00h1d`S\PZ_`0} 00 0u !`0`@mЍp AAp@-QAM0 0$0E 0S$0 S*D;01S< `10XZ00a01t;V  ⼯0  f ';!(0,0(0,Ҋ Њ z ` 0R1!0CSQ B0 00 UP tY.S1! B0C 0/;0  4xcc 2EcpcX2`scc4De@AxFePAAA-P`P p吀H0L,A0 U P#H0LTp0    0S:|03/0S:@`sccc@-<0DT 0 !0  !@cp@-00P%@00/pc0@- ! 0 !A-p@d` PՉ0S C C0CS0#T X$ h0l0h0lAc`sc@-00@0c@-00 @0 0姉Ѝp@-PHM` P@ (P P `#:( ၉ (g $ w  ]L:HЍpc0@-AP0,MS : d0S&  BR,* ⪉ hT00 000L!h0l0h0l,10S0P=P,Ѝ0 R t,Ѝ0@ : ,aR !00 0` 0@,P(p$ } 0!(#w?P  0 0,P(p$ } 0`!2" 0y?0P0 0,P(p$ } 0!2"P0B>0 0 0,P(p$ }0 00!8"~?0 0 0,P(p$ `}0 00!!< 0 0,P(p$ `}0 00!!? 0 0,P(p$ `q}0 00!P!?0 0 0,P(p$ `]}0 00!?00< 0 0,P($ `H} 3/I21 S|,AT0t tl00 <8r 8PDЍ8ht@+AAFe`sc33c2<2c@- ddej`0PT)P@0   040 P Ѝ@3c׶AA2/d 0 0// 0"/// Bp@- ` pP@TMpA-P@0`Q ?P@ptcA-`PD0@XppQ &P P@FeRp@-P@ R" 0t  0!R4 0 R R 0`00  0t0$0p\ 0\0\ 0\0 0`0000 0|Ap@-P@@<2tPx2pp@-@`PP02'00p`t0i2pp@-@PP"2(0, 0@@Z2pp@-P@@2$PO2Upp@-d0Q@P` 2 @0, 1(0@S@U 82pC- M` Ѝ0 SpA" S) S /08P@H10@ 0`01 X 0!0 UTQ30 ?P@0 P@`S@T0P@`FV`@Tt0P@00 P0 0 000 0!ʚ;@Bʚ;R7@-@P R: 0- p⟒X0 0X0 0Q 00 0@00C@0X0 0X00"eP 0p`00q 0 0\0 0" Ѝ004 IꢷA$3p@-@P41@081@0 p@k1X0@/p@-P 0X0p@0PX00 0@008@0$p@,p@-@PP 1(0, 0 (0, `q p p@91p@-P@@0p@.1p@-P@P00`0$1p@ ޑ(/p@Luc@-P0^<@P 1`Ѝp0x1t0 0@ 0000`P 0 ` 0d@ 0 0\00\010Q0c@c@-`@ |0@-@|0@O-X`M@``x0p0x00P000 00@PT``p dp`0 0h0h0l0l0\0\0`0`0`0000 $`%0 00"00x 00A0X005 \`$0`0/(00,  G0@0#?0 0>0;0 0 000p 0J`P k0 i0 `10b0 0!#4#0 !Ala O00 0x00CSx08ЍT `[ _@cC-pP V`P' 0堐   ( H6@ /@87,`0@@<%+3 1 03 Ѝ̷A@cA-PU@d0p00`h0/:+/Ap@-@d0`P/++p@/p@-@Px0Sp8UpA-@P pP/X0 @ 0P  /x0S/o@0x`X03V00  ///@cA-R@P` |p[/h003//h 0 * !01 0 R) p D/X0$ @00C@0 R 00 X00X0r/ p/h00  l@A!#4#0!10  W/p@-@`P ᜣ@0 1p0@00F=00`'t`fi pA-A@ `p.@0Q0@Y*)/@c #2X #EY P 402 /,0P/0 0R03 0@2#/ptcFep@- @`0PT 0T@)0,7]@P"UPP@ 00tUdrUP , <U0,]@p U@k FeA-P` p@0U @TP o. A-P0@(PP3pa].[.@01@0.1S1S .H.8G*H1 Q  PP10SP@ch0 0///C-@LM@ ⭢\0 0`0 0PPPԿ P:$ PLЍ(V`P pp-` qp` 0"1.0 Luc$3@-T@ Fe\3(AO-P 0pQS lQ`T%P40P <T r @ TP$ @0R @R0@ @ D 2[  ቶ  @@000㓔$ 0T 0DC1 00  lV00TFeFep@-@P 0S CTP |Tp@P\TpPU @Tp PP  PwTpFeA-PD-hAT h0pS ``8-\0$ 20S$0 l-@Ag- AA-Ppᘀ!-ATAZ-h0S ``-\ $00$0  uP$00$0$0S <-@ AG-p㔀oATPP,P0 C;00",p4(0 0\ 0 0$0!0$0X00X0101-0S 0h0/DAO-M( 0$0 0P 0 (0S $ Pߍ3S 3 083/PP803 000000 0S 0S| (0 P $ 00S0#003 @04/PP0`3,00:00 p` FSP 0S< SP3S 90?00P03 @#04/PP30C3000 Z nS P SP  8,1 1 R!Z @Վ0 d0 000 0lh0 0\00`00 00!)h0SS  Q  R0Q @>h0!#4# 11 | p+h003/PPp@ᴽpP |,0 0P+X00X0 ,0 P+X0@0 X0Ry0X008 0@@0@@0@0$4'f0 R 0R @T @k +Q 0#$# AT  S Q Q @ P 11 0R!ŃVP|+0@o+X0@0X0H7300+ pRW Y MU0@,0@`S 0 0C 0000PD+X0@ ~+P@0X06300x0S  q+l+ ++ Pb+ 0\00`0; P~P|3Sp< 5310 0P3S7 H@X p0s0( yPӀ h↟0`0xP*00@017[@(+s@ 0S 03# @04/3pC(0PpA 8@P @0!S3S XHPt@ #T@0p00h t0 p00*s耍0 ** @hTX0x# @00 00S R 8o *0SZ 8**j 0Q 00 0h0T8Q3S *{X0 X "0X0@00C@0 *|00X* (0*O*X0 0Z!0X0@0 0C@0h0 0S\ 0 @0 0X0O @ X 8" 0@0#X00 @00C@0[*  ** 0S@ 8J* H* 0#03 @04/@ ))0耍000 0pW00T0SH 'R 00'@ 8 * * 3/  $!0X0@00C@0 !00 00X0 0 0@@@0r| )000h0 0S 0040)h P 5/P40)U ) )6FeXA@c@-,0 00000 00Ѝ䀸Ap@-P@Tp`QP @G-`p3aMp)1 PUG)P ^)@cp@-P@``U) 0@I @p@)p@-@PPH) 09 0p@)00/A-@P@pET|`6)h0000h0m)@ꤸA00/0S00  0S00o/p@-@PP)X0d`)PG)RiX00X0F=)p@:)0 GR@-@L厛5PP@<@-@X0 0dX0jh$`03$! $H@  pP tP @@cFe 0' }Fe 0}FeO-p`@嘰  HQ:/PDPWe \   0WP ?P Ѝ0S 40A3/0`@00@`WeO-dMZ@$ ` +0T L0P $0(`T ^`P8p$p* dЍ P`P$0p$pK 1 00ݓ`V /~P Y0Sy@!PPt!(PPn00i( 0;0!CPP_P1 00 0000 0 PPN0$ 0C0:P0 1 T01 R !' ` !l  2/`PH0T S *P S:00S18 ,0 0Rn pP ptP tX0Z `x\P P`RPucFeG-M@` 8pYP+0~P@@0/S WЍV0 0 S?@# ,* b.0 C /  C1$@ QN00<`00 n` NV@ k`F 0W@C0`F`O-`4Md@q̔ 0L0 ?0NX) 됙̙4LP0 0/0 0,0p p00 000FP ,0/pt0Q0*#P,00 0`PP埙,0L \0P0UP000 PhP|P0儛0(0L0 C5<0X0pPtPlPxPu$M >^PP FX0H(``QcX0S X0,X0X` 0,020(0PP`1, dQ0`1\0S p20` \(0,PPTd,0d(0l H000C0`1\1 $  BX! 0D 0TRm:D04Ѝ(PH! E'b$ |$ R!0 R $0_$0P(P`10`1Q\`X00X0 P\`X00X0yX0 0dX0$j!$}$h HM P pP qtP mdaM<]M`0 0R0U0S \{ FeaAcAc44Wexc00S/ P 3/DcA-P0 `p00l 0 0010 (@0cPP Ѝ [PP'0TP 0@00 0 0CS 0CPP`V pZ9PPp 4PP'0`TP 00@0G-PM" @@L a0 @@9 >yQ1q0; 0 @0pu0 yPpH(@T `X-W0AU2@P 000` S'Ѝ 00S S S  00@0P0p 01@ 01p@ 00P!0 R cEcDcFeTucmAPucAC-@PM> (0S; $ X7 `V6 h0Ԑp03/ @0^P00^P 00` 0 ᓉ`P j003/Ѝ  D(r0 (0p`003/DcA@ycP/(0S/P/ R  00/G-Q @DK08( Q!P( U Kp PU PU ^Kp R(0  @` jpP PU *\K(0P(@S0`(`(@0S   0 cPucxucG-PQ pOK@(`T `(䀟VKi$t! 0S$@0S LPPt$dKv"(@T 0Q S   0 U`@cPuccAA-@`PpU 0S {A w 0S SP@-@bP ] _$hP lP 0U@QA-@\`庵00Sʬ#Ѝ0 0 0PPᵉ0 0,0pp00 00 0P ,0/pt0Q0!*ᛉcEcO- `0  0 RRv  ˅00 q$1|pqL0 48<0L0 1 111k#  g#>Jp ehb#p0 <0<0$,0S7F,p,[ppPpulP`0<1xp8paN4B#P P0$(, 0P0Zt#T0T0( H(x`0pQ h1d0l1=0c?0h0040083pp0 `0T40qw40puW 4p40qit40qhs40!0R "40pM+#0, h001"10 0S [0[00[0x0Sp p0t 0x@t00H05`0`Sl 505`0@1d0Sd d0h 0d@h01 R @0@d 1\D03/"(Jr40004Z0b"@"1S' A"{II(0 T 5@ "5`0`S "<ЍE'4040pWev $lk"  S @yITI "BY 4t#@@극AAùAxl3ccc0O-,MpQ #0A`P#@t@T ,0〠X2 PK@PP yT P` X !P P`k@#0SKu&V 0\U> :$@M$ HK@PB C`0V):= `V 050 ` 0K@P0 00# $ 00`00 @PQ  $3L@0@,Ѝ 0S S+$0:P@P X x$$ 咪`PEccdD3|0S/@-@h3/0|0h0O-a4M00PS@!Q!0S 0081S }X0T P3᫇,00000>0#6040080>0#60D0>0#6000<00@00A&t80S NG!0/1000L09L0{!5@ 0 0  0PpW(pWL0<L00P . .`1Sp [pP0  t0  t`p_W pVaqVa!0R  p=!r:T0   ![0 h 000[  [ 0D6p30pGor  *GqP  $$01 0Y:pƽ$!$$WpWpA /vz wD2  DD0ĐN I1 0`1H!<1d1D1l0 p 07/pP\T!@0AX0  81 0<1$0@1(0D1,0 JpPG l0 0,03/l00S 3/Ul0 0$K(0Sq [o Yl 00Lp @07/ 0 03/3 0000  0 0嗄pP 01K 0 03/7GZp3GX T#共`HD JpP )tP %0S  OpNW   /o"    2/pP#pHd1S t l0q 00S p0St$@F$0p  $@F0tp0P  1S 8 R l Q 2/l0 000S 3/l0 0 1l !D03/<10S XFZ0FuX 0"#  "pl PfP0. pl 000p[ p p $p L0 0Z000C0X0 A ^ 0S xKAp4ЍqWec@ccAcFec0@-_MP P@P0 _ߍ0@-(000000 0ЍdD3@- $0000000ЍdD3O-dlQX (XA0Ph >10SG`10$0?P x`5ҹAp@-Pa|@T 0Sp 0P T  P06P0 0S P0 P08P0a]A0C0 y l0S/Z B\R R  B 000T00S0H0`0<1p0St t ' x0Sp p0t 0xt0l/8DeH-wA0`SM P0P:P00Sړ00P0*  sI8P|0l 0\000Z 00C0   0 a[0 1111CI0Z0 0S H81S 뒏NCx~6$=0$04G僟` 180S 3/x>EnT0  oWQ[0 00[ 0 [ 0"10S2 [ ` 80`Z0|`` 0m 0S  LHd *8! `0 000 0 V &s[ D  +(r|*5 x `V 1S!! !1 0S   l3 R @@00l`Z0000x0S p0St t ' x0Sp p0t 0x@t0L0 `Z`H0S( x lP%0@ ( H R( S0,02 P   , @0`080(0< 0 D0(00H0K0(0 <|1S |'  01501 0Z0C000000Bl NlV G=q 0 a+Z4$9F1 P 0PL 0S 0S5p@ <5 =5vl0Q Q*00p9N `* x0S `J8De۹Acce@cAcAp@-a@PP0  A !O-M00S`؀  zX t80S0r 6Z3qYY10$0 Px0 HS,0 0 0 0`, p P [;,02 H0S5P0,0,@Ti U5  Y5y -&P0 Z0S 0W| 0 `0Ps $0 R00SDh PP f%@H0SPT,0Z R R ,0 RP  !P  00C0X 0000PB ,0Z R R%@   B X /  5@00PPUPP0,0 ,0p0bZ0S000lP030dP0Z0 P0 0Ѝ0W 0 `0SP sZ0S000W 0 @0AP aP5l`@? 0V< 5 =5"`V2`H0S& x 0a%0@ @ H R@ S0D02 P   D X0`0P0 T(0 0\0(000`0 J {Ձ|p(;(X;((X;0S X (僢X (0}0020Z00S   00C0p0St t ' `m%D咃% a" PC,Q<(S>P D ZV US(@T%; B/o"S R0 400P%`0 _0Z 0RP B+ 40 0? nc@cc@c8Dec0@-q@M QaT0P0` ,0 TP X Ѝ00@-P0dM 0 0@S0 0S0 Q  YC?o 2Q0S X OCdЍ00@-@0P SMS0R  0 0 0000?o2Q0S  /C?o2Q0S %C?o2Q0S CSߍ0p@-5lP@0U5Pp@0`P * P5<50 Spp@@-X0C50S[0  3JL 00S @Q@cWeO-`$10|0L048<0L0 !80 !!L0?! 0  > 0 0? O001P DP  =D+ |<0<0, n,0S(:0[00,00[` P055 l`0<10x080B4P P0$(, 0P0T0T0(U< (  it4[$ =0c?0h00400h0 0`00,00? 40!! 140S  3/N10 0S [0[00[0x0*Sp p0t (0x@tH05AAQ  RB0BS  R ly505`0@1d0Sd d0h 0d@h03 R @0@DY 1\D03/2022! Z! ! ! ! !20C22S V`20S PP1211S T0   p(Jg?4p,P04B 0 0Z 0000 *l0S `0l 0005AAQ  RB0BS  R 5A0AS l0k G@ "@ < V~$ 90pZ0Vs0S5D0DSXPfl0 GcEcucGeA$@0 @0 @PZ<Ѝ0@cJAp33cDc3@-p p@p@0@@SC 1X01Rq@ Hq@@Y<<V80@[@c@vcwccT4WAwc_A(wc@ycA- 0b@SPpb=zb|0@X4100S ]0 !!04L0H0@000, !  !@cddd@-@Q't T 03100|P0P4Ѝx- 00SEP 00S t T0 #!R `0S@cc@-P 00Sp@-P@1PpTUpp@-@P`yPpp@-@P`yPp@p@-@P$Pp0U p00/p@-P@0Tp@P 0 P QOp@-@Q 0S p@0Z0P01P00Sl 00C00Sp@O?0S P00 0000@-2 @0 0R  R@\ 0CS00S$@0 . P5:Ap R/00/0 0/p0?Sl ?R0|S/ 0S/@-0@3Sy@8@cp@-PP@W t PpP0 l t BR 8P08P0P0 6O8P0MPBAp@-@`Q6 P08P0Z0S P0S 0 000C0.p@ O41041/41!0CS41/p@-@Qp@p@-01Q@101`41Sp PP/@P/|0S/@-P1SO-頓MsQ[0`J`V  00 0C0`>8AT㩰@ L0`` 0N81S-8AFZ. /Qh`0 !0L @0;/2 00  00r`P R^ЍZi8APU 0RJ `0SNPXRPܡ  2/0@ ! * 0 0nr`P 'X8  2/ `0*gl`P  0*sX! 0000@ :0<`0L0S0P0 PP0 0Q!R 0b0?o0c#"! 2 B P !  10 2020 20C22S* DM'@c#Dc#1[  00/p@-@8aP 0PEu 0Q"000P50001S 00S  R0 0 0S0@0 @@0p@ A- 2Q@Up` 0S 妽s  00C0   0 iI &  0 000P00P0 O-pA000,P0   P  j W& zPP_ 01^0USS [G  t`W dP (1 S0(100C00,1)|PW !Q, Q0 U! 0ae 0W( Q( Q0,1(10Z0C010qr  Q 0P 0R `P ` ```A- Pp`3@2::P@1@!<`JPP   t~0@D@P0Q @@p@-@PPp@U``FUPP@p ᨒ  B PR / t0Q   0RL     / Q xcGep@-P00@Tp0 #P @xcp@- P0Sp8 P`@ū0 QV Ἣ Pp!!0p@-P@㰫@0$P0VpGe@-@000VP ᜫ@@㘫GeC-MP00`0p0 0` @0 P 00 000 0@0O?o2P0S R0 Ѝ7@-D 0ثP0PP0@EU Ѝ05&ꀼA0/Ge-@-0@00U](PЍ@Ѝ/ြAO-P`С,M @TpPP VPp vP @W0 hP,ЍQH 0 P @3/ PPP9  )! 0S ,S0PU,UPP K R #_0S 0 PP 0x P ت0 000!R00! 0V0C0@xcAGeAAO-0@!T0TX qᱪP `1 !R  !t1 `V` ` 10 VP `P `V@&0Q@D0 ˏP `Y0 `  S      X@] Ѝ`0   0P (  :`VXAxcGelA7@-P p 0⯪@P X Ѝ0Q000 $!@ ꧽAAA4A-@-<00S 0,0& ЍЍ/cpAAG-`"Q0B  @PpX  p$0S00SpQp @W 003/pP  P 03/p80S 8T$0S R0 0C0!R 00! 0S% P $`X!P ឩ Y0000000@0@@000000!00C0ꅾAAϾAAGeAxcALwG_AAAAAAA*AyAAPAAGeA0AA[AA@-pM0Pp0勶a @T 0S$ 0S/ЍU 0S@00 !R00! 0p0@@@  PU  R000@  P 000xcA-P`p<@P l T@BЍ۳ @@@@ 0z@P@0 h@@AA-P1ap3Az?0 ` 00S8 /ĈP r@ Ѝ@᷈P.ᲈ@P㛳 @@ 0;@P tV0 %@ I@cAcA 0 Ge0Ge 0 0*Ge0 0>Gep@-`PB` P@᮵00@0  @@0000PUp6/0Gexcp@-@ᕵL0PU  R8 00 嚵p@ 03/PxcGe@-@0 00cp@-@@`P00 ֿ ޤp@cp@-@`0P@ p c@-$@ ~~뫿 cjAO-M0S0 P0 Y`p/Pp 0#  )pW @@T /ӇPpD3D#PPл y  pW ፣2Y C0.fЍ00S00$0Yr  t+W ỆPPo@t嵈Pcddž gsP @L P D<(00,0 PPP@P9(0⽧@P+0!R00P@# <1, 30100 0000( 妫0 @PP,0S( @P(圵(0 04 ss T  T&}0U@ ^V _~ PP@Y d|P P |@ GڢpS$0S0yA|AHeAxAAAA@cAAA0  ycX3HeBA$0 0!0 00 /@cddd-  0  /XA/20C22S/?@- $0 C0@ⲣ ЍycA'@-<0DT 0 !0  !@cp@-P @tU00p00000P0p-0000/G-`@#202P X4 CX$S\U  1PiU P0Sa p1i U a 0aG{@cAp@-0P \X40SX4p0 !J 0 !p\0@`V iPpaPPiPp@ai`0 p@Ib@ccP/0 00@o/@c/@-D@ JX4 CX$S\#/1@jio@cA-P`@pZ@0 B0000]ȣZA-P`@pG@P 0 .0000]ȣZ@-@:iP5i2@`/ 0  pQd `QT}r}}r4 R? ?  /`He@Bx 0/`He 0 pHe@-0000(0( (0$10c00ЍPA3ApHeG-P `0$T@HTH0 00 psPV < 80$+40 Sp|Q0 000000``F`00C$0䇵YGp_O-4M$0h4, 3\`1`p@00S 8ϤXX0600۠0 P ! ` v$00t $夌0P0D0V l0 N_p 000S00(000 0S0@f0僡000S00 H@T 0R@0T {V@[@000 0TP(0$0,00H000000070|2 00 4;80 0$< Sg0;;00S8#$0000\03/$0" 000 0 (00O0P  S0PH 00 00O0 000SY " 0S0 0S  00S 00TT ^X dz0V 0`5000700 0喴4Ѝ 害m0S1೛0 00 00,03/0 0C00 000  000  0C0?0@ 决@c yct3ATd\3$0S8$0/$0 0!0 00 /@cddd0@-M uP@T  uU T康Ѝ0SsP U,寷#媷P 5u@AAAC-`pl0lPB<@C0S 0SU Ѝ0 \ 傷'AxHet3O-Pp`BLMa0 (`0`D00,p$P PP P<DPGe0`a0D0 <,(p$P PP P G 0 0 0'!Dk0 00<,(p$P PF0 0 0D!q0 00<,(p$P PF 0D!y0 `00<,(p$P PF 0 0 0D!0 00<,(p$P PF 0`@!0<,(p$ `P P@D FLЍAxHep@-PT0@Tp@@匭 0R0P 0S 03/@,ycHe 1S/00v]xHeEc@-<0DT 0 !0  !@cs@-@P0@`Q Q10S8 0 R    ᖶ,T Q S`0 S#0@0S 0 Rt    X00S  0S800 00i@Ѝp RxHeA AAA0@- !| 0 !p@-r@`3P @0303/P PU t03/poAp@-r@cP03/pp@-r@Q@0Q  !1PS\p@ xHeIes@-@P@`0S S 0SRTP00S ^0@ \($@ܵ00ЍpxHe A!Ap@-0P.@@Pp0(.Pp0 p@TAZAaAp@-PM彷 s`@T s岷ЍpDqP .P0P 8垷q@P 嗷` s@eAAAwA00S/7@-P冷Ss@0(00T Ѝ0pw qP\0 ?qP@j,)s@qP (keAIeAAAp@-8`@0PS vP0p p@b,yc@-00P Ѝ bP ,yc@-@ q+q@-@qq@qA-`4p@v?0PᏀ 0/?0P0AA-pa@0PS }TpPPqP p0.BP P#q0S _0./P 0 (P 0SHϴbqP 0S;d´apP 0S.4嵴pPxHeATA?AZAaAAA.Ap@-M`PPPЍpP00S 00S叴ކP卶 rP@ rl僶P Hy_P0r q@P !qЍpp@-M`P qP@@ t~V pP@ qЍpP7@-@P 0 000 Ѝ07@-@PP Ѝ0P 0 0000@- 0 0o Ѝ33p@-`@P㾧P 0S Tt ~ `売p XP@D0SpT  ~ 厲xHeAA,A,0 0S @-倲@xHeGAA-Pp`@e00$0p ` P@ ,yc0@-l@P0^P UPU  PU0^00 0@=,yc7@-4P0o@P $000 n Ѝ033@-` !@gtPp1S`00X1S0@<0 AA0,000 n ЍxHeEcIe`3@-0@p`PM  000@xa|q0t t@p``0PP P02W@P =ó0jX ( Ѝ@XbAHe 3Ie4IeIe4@-`0@0 0@0 0000 0@00C@0Dcc|0H S/P  \\1`A |000S \/0!`0 SQ/PQ//Dc@-PZ00C0 -@-kF\2O-0S0PrPRM 0@0\* 0 Q00S  0 0Ѝ 0@`g`@  )0V    0倐 00 00000 0\00  0#00 00000V00 @`F B`0@@D0` @T0@0@h @0`0 `媴 P` P@~@yccDcc0uIe .9G-MP 0`` @p> 0P 0  00 0 0 p@M<?o2P0S 0000 0IP0S0 0Ѝ@-@TZ0S[00[0f&c&d@@-p0 0  ^8 0@0000@00C@0Dcc 0@-81M@T,  Q 7 0  P@@   t!00P  0e0 x0@@ 00@@`@Q 3@q HЍ0@货AcIeDc0uc@ycAEc 4Ax#40O- 000p(P$@ @?0谟,00 000p(P$@ @ @P?/0,00 000p(P$@ @ @P\o?00,0T0` 00`0p(P$@ @ @]?<Ѝ{c`A4Ie84044000/p@-00CSP0@@$P,eU tTpp@(nc A-0 0 2#PU 0`S@T AlEpd0S R@D:$ 0R @TA?DcceA-`p4|P@^ @0@00T0S@1S C@? 0S 1S DcA-pP@`^ @0@00T0S@ 0S@1S1S Dcp@-P`  0 0@0T 0R0S 0S @P4Pp@Q} 0ScDc7YWD 0  !"P/ R0S//DcQp@-@ @PXSTd0P1@0P !0@@T@~pcp@-P(80@p`opcp@-`P&^\' T `@00  RAP @pQpcDc `0S  0  /Dc 0 冪Iep@-@Td0QDSh h h0d 01&0Sp@p@ecA-l0P1@Q`p 0SR 0 0 0[00[0xPU1T  R Z BRQV [  [  pP0CS 0  BR wO-SP ` (`p"0 0*@T 0 SV`0S f0P @,`Q l UVC! R=T R8L  P @[ 10S, P(1 QSV00@#boYQVT T R S+@0`00@p@S V `0P @$00@01 00001|[00[0@`@`p `p * &d0Sh h h0d 1 RA0Sd d0h Ph@*x @V (4W /cDce@-1PM?@?@`pL0P?oP20S`ߍL 0RP S@0@6/P0S   0cp@-L0@3P1S P0 00SښS000pp@cp@-P0PSA,00S aPpݢp@@c}cG-0PPpa|@P @T P03P0NATAU ḢYL0<L0WTG@c 0 Ie0%Ie0@8Ies@-xR +  '@ !8 | (2(BRG !"|0 ! " 0QQP1 #"10"RR"Chh0 1d D03/᭤  0 R0d1`0S00#0H1``0S/00 /0 \i/6& *P 1:Qi@ 0f0`0/0? ?,0l`00000C`t0*|`S4  Ѝp@Y@ycAA@vcIeycDccc{c@|cEcEcDc}cJe|>XMe0@刱Ie@-H0 ٧0@Z077pp@Ie 0 @吱Ie0 @失Ies@-@Pἡ`ṡVᵡ`ᶡVᴡ`ᵡV 00嫡 ṡP0SЍpBp@-P- R@ *B B0 0CS0 B " p~`{Vw@xTp\02S SMp8000CPp0 0O0$@ 0;00 V@ T VJ8@y 0 4  x@P DATy @44Ѝ>rV@y 0X01 \/@P0X@0 Z 01O/@P0Z@4hx P% r[00 @@00たP@ VJ0700Z0 CSRL0 @꒟ @T@ 0J0 G@P Z$0,0 00.0@0 V00 0p`J@c4C-M p"@P0S !PU  AW` 0 p@P`P LЍ@@-@`0 000 0@0oЍO-LM00|0 P80;@3p` Up0s 80 `|000xtpLЍO\50S0000(00S40SU YPEU U00=03 P 1L0:`@40@A0C?o2<00$0000,0T0So l:ATk 00L0SZ0S u0 00080@ 0儞P  @U 00?09Yb 00`PP110$[0x0/S 10 R 0S0SL 0S0`0`@ 0(0Z$<0 R0S ; 40SW; 0000  _W000 n8 _ _W& 0 000000000 0 0$0$0(0(0,0,0000040408080<0 <0@q_H0WH0L0L0P0P055[0[0T0T0Z0Z0\0\0`0`0' d0d0h0h0l0l0p0p0t0t0x0x0|0|0000W0000000000000& 0000000W0000000& 00000--....////1W1 1111 1 111111111 1 1$1$1JυJ?W81810N/N7<1W<1@1@1D1D10Q/Q7 RREs1 1=sW  11222/W22!2? !. (2W(2,2,20/70 ec0Z 01$ 8,[ 0S%?S 10 Rx ?RQ eX_d_2,/@ = 2OP00 >70  870 370 .70  )70$ $$70( (70, ,700 0704 4708 8 70d d70l l70p p60x x60| |60 60 60 60 60 60 60A/A60B/B60C/C60.60E/@6@0F/F1060G/G60.60/62@0@ 0 Dp6060 00C0$0 0$0(0 0C(0,0 0,0 0S @T00 YQ0S $0 C00,0Y * B,@,00 U=0J G1 LЍ R@ccLAc1`00/1`<10/1<10/p@-@Q100pcp@-PP`@V11 FP@ 10$00@pcp@-PL`@V11 -P@ 100@pc@-@p@-P@p@-@@-@p@-P@ؘ٘p@-@јp@-@`P PpR0p@pp@-@Q0` `00p R0Q`R /O-MPp8`u@w5xGuYw ᅘPWx   uP @ qP  0 P  ЍXP  QP  MPDP    =P   9P0P+P ᔚu "P MM널IiM Mx w  PzO-MpP`8Bw@u6vHwZu PXvl   ۗP @ חP  0 yP  ЍὗP  ᶗP  ᲗPᩗP    ᢗP   ភPᕗPᐗP w ᒗv ᑗu ኗ zP@- 0  Ѝ"0@-00  Ѝ@-0t`qR@uOPJ$0P 000 Ѝ7@- 0  < Ѝ"0@-00 2 Ѝ@-0t`q)@u&P!$0P 000 Ѝ71M000/s@-@`U00 0P;@PЍp@賙*Ѝp@-@PT@#a81  lo Ѝpc0A-a(M 000` 0Pᅙ@P p0 @P ?T@(ЍZ1P0 ` $0R  _P 0p0z/`00 e0 00d;vcA(0310S/00S/@cJd@-d03" " R @" B"2S %@T*P @cp@-P@Tp P000000@p@-\03Q0S m@T 00@ 5Tp@cG-@`T; T[ T[VY h1*ERU:0CVQ p81`3  1 0S`} P U* W0@ @03A } @T@0U00CS  @00J ͇@@@c|cA-@ `50 0S\ PZ0S=Ɍ ͌pWX 0 S RQ   ЍS@-@M `P}50 0S ^ p0S PQ S 00U0Us00Ѝ@-pP`#@P 0 |0| 0 00 0 P#3S<0 R00Q I@chWec4DecA(keDZe0@-M 0000 0@0P     WP ЍBA-@ `$P B  p"PUV#3PU V VX031S ( ,02 0P03#5P @cA-q`pQ TPP<@ ovB Pc@-QM`@͔P0T  R 0@ 00 0@`pPP P᳔P ᱔p宔W ᨔp委WP Ѝ?LO-QM@p帰Q @PH0P @@0P 08@P:00CS@5 aL0` 000 0l0 00P 00 0 0 p*0@?o2P0S` 00 0@P  P0R00P0  ЍAO-QM⨠崀:p0PS5` =@P0 @@0 0ٖ@P⒟ Ѝ 0` l0"00  P 0 0 )?oZ20S@ @@O-(DM  ⠕ 0!% Ppa B, 0  0p ,`(P$  -0 000@!<.  -  0 04p,`(P$ @\}-+0$ !H.  6 / 00  4p,`(P d- 0! @vT`dPT哏`0PU L0S$减0P@ @`UTPO@@`cc@-` V@Q,  g7 ^ Ѝp@-@PV80< 00 #3  0 0 0 004 00  23 48<0@S- .HHL 0 P030 0 0S 0 @0 D R0 0``#`0  00000 0 Ѝp@ O-`ᑿ0|0@0C0000   0 S p@vcEcG-@6`Pᰐ1qS21 0! 28* h R R R # |aX0@00P0#*1S0Ap@0 0@00002S0000SPGB000@)AJd@-@0( R (   B "R  B  \!RA 4. R!R b /o" Q AG-0@Sp00SW G SP0` 00Q2@C` T`W p l W 3U  GP 0SJd|c@cp@-@Ps p@//// 0\ CSR0d 00P0Q#7Ó7P00d0\0FAp@-TPC噍%0C0\0(@T@ 0S 0AA눍Xp@c@- 0!0@@@c0  /TA0/000S/@- 0@| Ѝ(keA|cb00/00//O-H`Q@S 0p0202  [0 C3" B"2S1 ЍOp `00S; ; 0  [ ;0 40 ;V 00S 0 Ѝ@cAG-P@0 pspB EY  UP:`P WVV `XêB 0G^;B0 XB0 @cQA-Ppp `D0@c`  E TB@@cA-PuB`@ 0 @V`:pX# ! @:0 "S  V@0 A;r:p@-P @H0c   0S@6Bp0 S p@cP/0S#/P/ 00@o/@cP/P/ /p@-@Pz@0000p]Ӆp@-@Py@P 0000p]Ӆi@-@AiPA@z/O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @O-1p {P{W%N@ \[`R03/@ Ѝ @PR  03/@0 @/00/0@-003/ ЍC-0`M00pP@TЍ 0R@ 0` @`0 P 00 000 0PQ?o2P0SP00S 0@ 00哑03/P p |We|cAA@-g0A@-P P d`wPL)r Ѝ $;hcWeHA@-]ZA@-@| Rp4Qڀ  !L D<, !  +6A@cdddA-P@Mp1 p`@T,0@400000 ,00(00!0$@ @ @00 000'>0<0 @P<0W0 00PSPDT`@Ѝ4^Pp@@|c|We4WeC- LM0|0 0<P`pA0D0a0,(P$  @ 0P  ĐLЍD  I    '. a 0,(P$00 0l P X⨐PH0H@0<0pP ,<囐PU@WeA|cA|cAs@-`P- 0@T T0@T  S  0D 0 0 !P, n Mo`Ѝp|We|cAWeh0#(1< /@ ρP PQ00@0!!#/@c 0S(0, 0 (0, (0, 0/ B@- @ ̆P 0S,031!10P@cp@-P`|@Tp 0SP0 `00C0A@- -Jp@-Q@Z0S P0S00C00 00 p@M \/Wep@-@dPvFKp@p@-@803Q 0dP 0 0eF6p@c0P/ |We0S co `/P0`o@`/p@-@00C"0!300 P p !A\  Q` ^000PUR0(00@@@#pp@-@P0M  0@0@@@P|̉0t` 000@0@ @@x㽉85 0(86 $Ѝp@A4cc44p@-4` Q[ fpT05@  0P8+]`cp@-@[>fPp>0p@ ?cp@-4`8SpP0P @  +]084@p@c0O-4`@ q@0D0H0L000000000111 1P    @@D   Sတ 8  S%  0 Q31?Y$ ( , 0 4 P00P00!!!! !$1|0(!,!0!4!p!!!!!!!!08 0@ cAp@-@T 0 R X0 vPP T x \0000@pt H0c0 0S/0 凊cO-pPP`@U#`V0[00 U00 t  \` @T 0S V x SH00p@-@0PQp R00  @c0@-@PPM RS   PP P 0   >PP  E2 1"  P0E"0A 30Ѝ0Qp@-!0 P`00SpQ LBA L ^@P00000 00 0 0 00 00 0 0p@-@`P|@Tpg AG-@M04`pP,0 000"!       P0?S$P(P,P0P4 PЍ L0QQ 8QQL02 SR|0p!!!!!!!!&0S ЍA@-Pa@<i?,10!(1T00!41  1 00000110010 0 ]@Ѝp0D"! 0#@0A-q01P0c?@0010!(" !0 & 0`0(0 A10101A-0P`q ( @jT  0@P 010 10010-A!  !!! 1P $P &A-@ 0S Pp`P0 8P0@0D"0!!#  0SW00S@ p0>S? 0 0CS#0T P@G r 0 S 0 0000@`S P@@ 9@@AO-Z0M0C01@S FHP3 1,<00Jp"@03 qp[`) `P iP p #@k!QP @Ѝ! 1 0S P 1PS01ąpp`$ 0 0    0S @1S Z RP Rp Q.  0P pQ   BV *V .`P [3  ~@P gPC; 0@; B "Vx1Sp` 0Z 0p!x!ZR|||!xtZ0SP RU ;0|POoBU  0Q?o22P L Z  R Jo ⪢ᢢ S0Sl00C00Z0P0U1P0R /1P0jWAccG-P葐lp@U" PP1@T' L0S` ZR` 0  ``ǃPX P@T ,P @TUЍ`0SL`` 0  ``囃PX Z0S 0CSPd@ccp@-xM@?x ` PD0U0000`0 0彀(0$(P lP, 000LP0 fBxЍp@-P0@1P00Z00l 0000l@ A-p`)@T$ L0S!P0S[@]0SP`PLU ,HUVA1PcccG-1`pAZ0S'P\W lP'0SP0SP90S|PP0S G'0 QU 0@ccc0@-|M@t P;D00P |Ѝ0p@-PRQ0@2  0$1\ P P P$p@A-P`p@TW [0  d@p@-xM@`Pt C0 0 0`xЍp01 10/O-`P1Mpp0ALHFP0  (~~Sv54c@㇒) l 0R[0"? R (`pap0` 1RX PX 1 ` ^0% ЍO/0G" 0# ?o\20S +d20 d2"ЍO]YP k` 0 0  2ЍOЍcAO-p1|MSA僿P0  hXN -T%@4|ЍO R (alSt  C0! Rp 40堀尐1!` p$XW0  kWld`0STP 1`@T 0c/ 4/|ЍK@ccAp@-@HP`A?50S xp@u@!p@}cO-p`PA$MZ0S P R U 0 gSZ [Pi?!0000!0!00000!00 00000P0Pg8J?X~ 2         0000  000 00000 000qPP,P04P03ptq$ЍPPp  㸅0E⣒@0 !!W QA p R!` V !!  Rv UX [  l Q W   0 0?P}vPPP p402S SU 000 000 000 000S0X 1A HQL!`0S7ڠ01,0 [ Q , lP( $0 ?PP01 P072Pqo cAA-P@q` 4Rk`A2! !! ! ! !! !0  E2 1 U"! ( !, ! !02A0Ap@-@P8`0`  V` ݆p@ &A@-APP0  =P08P0庽B    P!p!,' :P0|`V0S 0 00劃 姂00C0 VP08P0a7P0倽ዽ/000X A0XHqL1' 䀟P&  03/`00S P |z?V` 0 t`切aVP02P0P0 :P0{u`$tPAZAAcP}cdAAC-@1|MPCT!atR 40T!md2cX0d201S" H1Sx  @` RU1嬁p0P [ 1 ` X 0 8/Y/ gP  0 Kx |Ѝ@cp@-@ 314020SS \ASp@-<@P`7Pp 03/p@<@cAcp@-@P@`$PN@  03/@(pcp@-@P@`PN@  03/@pcp@-@P@`PN@  03/@pcp@-@P@`PN@  03/@p@c0A-PpZ0P01P0?`0Sl 00C0|@Tͻ 0SP0 ѻ R AV   ` p000G-`1SxMpA 1 0t ?001Wpp00 0 0$00(00,0@ 0?0( S :P0  UᢿU0 R (! CxЍ%@ S]`40` 㠐p0`1RS P 1 `@T 0c/ 4/Z@cAA-Pp@ ᰻0`V S R @0៻Xڰ0`00@@@0`0S 0 @p00/ 0RS/ S0 0 0!< 04 0 (   !/@cdddA-D`DpP@O0S h00U@`00cWe00/p@-0@00S00P00R -  P 0Q 0 p@$刺b 0 d~&0C0d02P / q20 0`p@tAp@-P@ჺU cOp@-TC\  P 0 P  &(~`@L2@cp@-@P R` Q00l=#0`PP0 % p@P0=P0/G-1`S0Sp YP@F DP@@D P @P0Y0>00@cA-l0,q@0 PR `  0*  @X @R X A$@c Q ,1f@cP ,1! / x/ / /@-<@cA////@-@ 3'Nc///N/-////@-    Vo Ѝ@-  Uo Ѝ@-@P@?C-PQM@Ѝp`۱@P E0a0CQ R p O0P@E@P _LP(eL QPP͂{LpPt TL0y0 cRY0 0PÑIL뉙! &ခ"** 002LP 0 3LP0L6#::00AA-QM`@p0PMP 0 `P囀 >P@ >}U 厀匀ЍQMPLP Kp pxUKPKHm =KPKbAAAAA AA@-2@M` T} 0  20S& MP B0 rs |#PPP  a:0T"0 !& @0! 0"N @PPKPc'>P@% KPVKPQ WPPM p|z0 px`l wgV9|3MP4>T _K P`PVKPSK1 40 0000PoQ0BK\KP ?aЍF=0l`0`%K@"K7:!#: $ : 000@04De@cWeHc,A1A8Azd@;A@AMAPAPcO-@0pSM700770S :PP7 730:PQP>@IPP 7LP0ST G\70S ~?CSdJP20 000000000T0 0 ` 4T J-JP a&$"(q 0P00S J (*(PJQڧ0 0R`A*S 00B(0 0LPP0 0(0CPP 5  J 0P"~Z WJ~~(+`PZ D%0 +l5 006 #:: 0 $0 `#4 1hV(KP>   0(`P " 4$00[.Ȥ ~(P0 KPX4$ I@PXJp峁JP 3$?a⧁<4PC`D R  KP hP(KPP(KP (H0P D RQ~x3[ K~PX(KPD0S T<~h 2 043~30S ЍPU:T) I NPP"IlbP40Lb I w bRWPI˱Q PV0%Zအ Z PP  PoIPlIV0%ZZ-I  0PPa " MI@PPRIlIP 81d?a|1Pm 1 NP0 `}81PU 0P0000{(!0 Pt (70*6 0 (1000 0}(uPP( }}007XcWePcX}cZA@c]AaA8c@e4DeeAqAMA~AAAA,A@ccRAAAAt]eAAAAAAAEc7A1AA/ p@- @RP` x0tPS|0|Pp@Qx0Q0R h R t|0 p@tP|0p@-GDAp@- 0@SP`pPkp@)S h0S p p@pPpP00SD0P 800S,01@o/c40\ 0S؃0$! 0Pz/ 22  y40T000T0+0S P0  0S 0CS 0!Q500 ( NEd 0500pA0S,0 P: ^:pzO@&0` y 0`Nx @娾T  @ `00S L5uP$ЍO蒾`` 0Pc5U50Ded\}cEcccAAAA(AdAD?eDP000@-0ll@lP R P00Q# R" 0RR 00|uc4t4P00G- @`p PP㬀PPU1U@  `R0s#0"s#R Q0Vs# |uc4t4cc/0$ R @- /We 00S/Wes@-80`SP 000 89+U`㥳@P  Ѝp 㞳@P ,%2P`  20`0P40P0 R8@0`y A@-0 <DJdWe@-I0#202We@cs@-@PP  <0`0S 0 }ЍpЍp@WeRSA-Ѝ@P0p P`U`dV0 P`s@-@\P  <0`0S 0 BЍpЍp@We@-Q @  0R_ST`00`0P O-M@0P0 4S'Q Ѝ0s0S0 P0S0  0 P0S0p 880p 0 R  )w0 000 00 0oP0pU 000 0(]PX400?8000C S 70S@R 0`8PtUpa  4 [=X R 0P0S(0R (0R0S x0S60S60p ; Sy 0+0 p05   B 1  RlSPQh AA0C \Q-S_S_ R[0 S0 8CP0 0 00(0 0"E S`P  BPR7  `[ ` ,` R)hX&d 0+0!0`PS0P  P `Qn 00Sx0S0SI80Si6Pc X  S0Sx0SH`P wAP`0S  бpP( `P*,0KP ?[  ` Z8ER*ױ"`0PE,0PϱUx0S `0 00 0P S0Sx0S  Ā0 pP ᨱ80z4p02` 0S c:00Ss0P0 `08$ UD$ 0/`0 p0p0QS8z080`04  Rp B0B`0 /`0P@4 YG 4 8 4$ X@P0 4 G 4;00x0H00800P@T( 0 SQ0 00(0 0#  R0 08P@Q ` 8,P 0 Q:8 R `8  P0R: 00S 0S S`000 S`000&#`0dkd00`( P0 Ap}cGAbAO-M Qp0a4S  uЍQ0sVz@0P@T0p 20p} X 00 1$FP` (/84匐0尰 ThZ `0  ]Q4QB P 0P 0  XP X `  (NC4 BQ  B8` B A4080CSE+`  .P4@@DT4@8d0@8@0PPU(00ZAp00$0( {0 000 00 0=mPo0pujYS 0AP0[ [ @`00S @8! P08004Q (0P~Ap}cO-$MXp0 H$RLPT  Bt@$ЍUQ RQX`Y`X00S0p``V @  0 0 0l@P 00 00000 0l@P  00`0`S@>?0SY @0Z 01 ]@P 0H!@00CS0 U0  @P00 U0 0@ = UfpP @~ 0 @P xt0@S@T@ U@T mhU  2B0  U* J-YAAs@-@PP 0 <0`0S 0 GЍpЍp@=WeO-M00$0p0尀`$R is Ѝ0SQ0s PP  0X8@00m (00 0$P 0Sa V `40, [ S0 0 0kP ^ `0K$P0S ( S2   0P0S0p p 0 V X0S 㤮Pl 00 ;bP\ ᵮ(00 XP 0( X00'000V0040$ S4r  ,0RX0 H+,XPP0 00W0(00 000C0 0 0  S "Pw 0 B   B p$0s) o$0sQ0` ^  9PS V A(07(0倠H0 00000 03kP`@?. 0 6P +,0Ap}cp@-D+<0<@! a v``` P 0?P8F. !  q!X  PPP Р   ( X# X X 0000P`1PP0@p400 80<8@PP  ,oYߍР010804 P00F0p<0,MP`B<P H1R0!sR g |oPP1 00 400 80@8@UpP` `84p40SR40 8✦$@TR4`Sko` `0Y8 @T2@P @P0S1S X@T01X0| ~:pݪ@Pt  =X@070l@ \)00 0@0QP P0S p0 0R  O 0$0S !0(0, 嫪0P$0 , 1)$0 ! =弪$0Y 0(0 0 0S W[  B % 0 0C 0!  1@0CP(  P0SQ 0 P0S@nvP 0p 0kAAAAA-C-M00( 00P00q0PE 000 0g@P aT@ЍCЍ/ S?@X X` p (4X001 ``\    p @`$0$@JBPP804 \@\CRQ f%PU Q@R0 0P @@`  R XP L0@9$ߩ@P 0$ X< 0 X@' A-`1V`04S  nAPp`8@T 00S8@P Щ4p0p8pPPUV  0P ©0p0 XP Xp`@4 802#T*0 R0 R P8@Wep}c6AA-P0 m0 p RAm sA S s `Cm@Hm@,m@0pmT[AAA{AAO-`PM PU (` ' S\Z00cЍ    p @$G 1( P,00 00J P 0 10P0 00`0 0@$0$ C 00 0WeC-` $MPS@p@ ppY 00H0 0D0@00@?oV20S @T @@U00$ЍA-pXP@(`-m00 T @00$R01 @00-AQ|O-//0 R/ 06S/`Xp}cD4@- 0 5] ЍWe@-@0 00 #3  0 0 0 0 00   0/Zep@-P@03/0@0pp@-hP@0S03/03/@p Q \ :$0@؁cA-@0pPP`A@0=V P0S؁cO- `0ptADM! <0 0,p(`$  @`P<<0 SG 40p0 ,00!1 0 0 0 0(`$ "<040p0 ,0@0$00'!0 00 0 0(` <040p0 ,0T0@  00!0 0 0(`$ @DЍA%5!5 ZeO-lQM @p@ `06`0` :@000 000 `0@堰0poᨂPX o*pP V 0S啱`Vp00  0dpP Ѝ 9pP$`03/03/`0S 就؁ccZeO-в$MpT@P0P0`P J:0PS 03/0 0 0 %(,0 00#0( , 0$ 0 0$ 0S 3/ 0 00PPEUPa0 0UЁ%1!80 SH4 0000 l?;#;0 #5;B%!!O%  ˱ QP 0Q 0 0 000PEP0PY304`0P`D0 $V0Y@ 0D00@倠D`儐@P00SP00P0$Ѝ؁cd@Bʚ;ZeO-M0 SQ墰@0pP?oU20SѰ@ ЍWp@! ! 0 0000pk [`0P0嶰 0p0S,p@I$PZeZe؁cAAAp@-8PD@t|R@`PD0Tpdp@-8P@tj@`>0Tpdp@-@PTp0/dO-0夐@crW 02PP 0С*0  00#0  0 0 0 X P0Sr@c؁c@-@  00Ѝʚ;@-@  00Ѝ@BA-@0pPP` 0V P0S؁cA-P< O!$" (@,$[`3# 0SP@S  "! ,  I `F \@   R   4 0 !Yi0ЍZe KdZeʚ;A1P; @- 1CP2 1 @@P+0P@ 000P 17P$0Hp0 | 00  |0-/11(@1(|0:0 0|0/p@-H0@PP0P0a0 0 0P0 R00p؁cO-@Pp`.0$(0,0 0#   \$0 $ $@ \ 3 Q\ P0 00"0(00(,40$P \ P \ P 0  L P0@ rPpQ0 j؁cdʚ;ɚ;0 ,p@-d@ 0$ 0S 0pP P0S $000Stnp@Ze؁cZep@- xɬp0p@Q0}/’\ \#3$0Pp3 8@#4gi03/p@0/ZeEcMbZe@B؁cA0S0/0G-P@M@(p(0< 0800,p$@ @@ @`P0 P000'>0,(p$@ @ @P<08 @ЍAl65C-Mp 0@P`` 堐X5t0 00  00P 0 0f?oY20S 0S0ńЍ者c80< 0S 800< /!cp@-@@@0`0@0c,PU 80< 0 p,bp@(cP#b@-@PP@mN@-P@`0S 44q4a 0S@0 Y( 0R0000 8a0 bXa 0SƂ 00"#! "#1aPB3 $103$!F0 3/˫0 00000@000@ccMbdEc@-gA0p@-`Q@P0 N10`, 4fupE10` p@*f9A=A0H-@`,M0嗫P0S? T$PU? ,XO80< 0 80< ë aP@ saH  @R ppD ̱00P1D H[pbW  a !0 YNa@0IGap00 0P00000pbp<v50S0 0R 0(0 0 ,P0$  R 0(00$P 0Y<PaQ| Q 0   Pa=ddAAIA75EcC-@,MP` 0 $0(  ,0p@0000 HPD` @`@U  t000000 T0 彗PP `Ὢ,ЍἪ00a_AhA95p@-@`PPL PpPL00p@-@X0M 0@0@ @@@ U_  00@@Ѝ@}sAd0Zed0SA-@p`w@T屪`L Ps@P `LH0V P@]@0T@SP P0PT TPX0\ P0 X0\ 刪U `L@@H V P@0Zed@-@d4X0\ 0S X00\ @P0ST T % bT@`nLd0SA-"<p8`@T JYL0P!` T S0S SFL Ѝ0V @@0T@S 0 |0P 0P0 T0 0 U zSL@ V @0Zed75=5554Ze@-@h庩0 0S 00 @0S   $TOS@Kdp@-@+SP;Spp@-@PS@p0-@- p@ 0P` 0c0`00s_PЍ@Ѝ/p@-P@n`V ᧩`b_ 0  0p@Z_\95|Ap@-@8P弙 3 $!™';(`00p@c0S/p@-P@;<,0S  (0 0@0(0 `p@k0 0R0000 000 @0S  Sp@-0P@0 0R 0(0 0 H:P_pp/p@-@PPp0Sp^@-X0@SHi@ ip0S/ R/h l00h8Zed @-(è 0   =0d8ZeE5d0 ,P100S//媨ddA-xM⢨p`@TبxЍ&Rl00& 匀p0S p Rt00CJQ0S \0s0\0x t0000x0(0\0\P0 c8Ze0@-P0 4MQ003#:@ 0 0S$0 ( @P0S00  00U  0@T4Ѝ0Y0 0000 0@0?[P H0L 0P0S 0003/(@ʚ;8Ze0@-@,Mf0003/80< 0 @0S P00$,Ѝ0@WX0S&P 08kH \0AQ00\0`0S;,Ѝ06p@-P-J 0@   S%0S@#p J@@- 2PdT@-@ iP Ѝ \Q?/ɚ;0@-@MP P0 Ѝ0P@-@ P P0 T0S000305: 0$Pʚ;ʚ;@-@ PQ  ЍG-p`@M00  0`@;iP <PT 0 00 @Ѝ R  T@0@C09#PPPU 00Sg  xhP $ 0 S (0@P0R0P100Q:UGiP !S R(QQ\( 0 BR0 \00 \0 0 Q R^ 0 R R 0u{Aʚ;0@-@,MP P0S00 0MPQ 0  P,Ѝ0p@-@(MP` 0P 0S000, PQ 00 00(Ѝp 0P @- R R S12S1`01 0 Ѝ@-0@SM 0Q  00   P Ѝ0@-R@P$M 1` l[aT U  ~P  @04 S#*/00$Ѝ0A@B@-0 ЍA-@QP  0!Y`Ap0 RR pW=) -` p`-UP0 S00 10\00 1 p 00 00\ @@S0P S0."? AhHeZe@BZ{c /8Ze?B0p@-0M 00000` 0PX@PP  0P@0S!Q Q  @0ЍppC-P `0EQ@P XP\ ` f HUp0Sp0 0@S((0,0,0p0 pG58Ze@Ze0`0X00CS/@-@8~X0S000S(0S, , " d@-@X00CS@<0@-@00S &R, l00& 00@wG8ZeA-X0@0CS8CPH0L 0P0S  0S'H0L 0P0S 0S H LHPL`PR3PPpX2\C  R  @p S@0 00TTS  SH L HLP H LPPP QP H LP0Up RH LPPPL\P RH LP0 R  @HH LL RH LPPAQP R H LP0dʚ;ɚ;6ep@-P0S H LA  R5k9 SxEUt $\RnhE#P0SRX Wp W xt 0xt00  0xt00W W @ a 0 00⌠A: JPA@-0 Ѝ䘍 A-1`PU 0FS0!RX00CS 0S 0SxxS 0oHHL@LpH@L@PPp^P@HL@P0ɚ;6eO-4MX0YP4Ѝ0@S`p1eP-ePP`ATPW 8H0L 0P0S# X 0BQ%SR  HeP H0 L0 H0P L RP 0 H0LP p YS ~ HeP H0 L0S H0P L BRP T0SH0LP0P0S0 $0P0Pɚ;6eʚ;p@-@HM` HP P1U(P0 0WPU (LHЍpp@-`V 0@S@@P(P'p}"p@-@ M P & Ѝp@-1@`V 0DS@P1Sp0 S 00pQ)p@-` MP@0S PP  0!  Ѝp 5!!04 ?A3c00?A3c0/Mb0@-@Q$M   P $Ѝ0Q/ЍO-MP`cPcP@p0 0PW 01S 100[%T ~C@W DpU0 @ U 0  0t pxP 40匐P@@Ϡ0H0L0P #0 RQ @ U U% p FT#>HcP H L d0H PL QP H LPC6eAɚ;C-P`U@p,M0S U P ,Ѝ p01P  ?10S/p@-@`1PU V @T h00P 0003/@T ,00P 0003/p@Ecp@-@`Pg0SpG-1C0(qZ@@XP`X R00G荠 00 CQ'Q QC400 0C?ƒ10Q0 0 QC400 0C?ƒ1 QC80# pPR @> 3T`@ A@0@K~0 @H0@B~Ѝp舅c`ZeWA`5@-d@0P ~0P H K0P ~0P  K@}3`ZebAp@-P<0@Tp0 RP @ꈅcA-Pp@P`  0RP `VX00PW@ G0S PP00舅c0@-M@PPP, +0QPaUP 0S   p00S  QR000 !R  R 0PЍ0舅c @-@x0P@tp@-0QX0P@ @0Ppp@+'Pp@Tp舅cO-,MP`PC MpP> P 2Pf2 0@00尴00a00h0l0@P0<043\0 0PpST U0Wp00 01S PU 01S PuG@,ЍpW1 00S00C00 00] l2 0S 0R dM ^2P !  G!00S  0 Sp /0p%0%0 UC0PPC&P PE0S L 00"0CQ 0 Ï\E$0  X0480080<00<00S 0 P1D0 D 010 D! 0H u"H^X HPap ] 1L200SM PPJ 00 X1 `P. P0S 0P0g pP  : R 4 ( 0Z lY  LH 0A Pꈅc@c@JdAAAAAAAAAAp@-@P`}0Pp p@0/A-`0@Pp t Q A 0P1 P P O-`p0004PUX Ѝ@0SP  R@ 0S 0CSP  0\gP tP [ 0 ;/P ꈅcZe0@-M@P Ѝ0O-@P`p||0S Ѝ+ P @pU 05/T O[Bc@-@ r0d000KE@婎`ZeA-X`P>X A/p0@,Z,0p P0@,@A菎ꈅc`Ze@-@<JP0 SP T0 0D X @T@D@@z`Zecp@-40SXvJP`0@4)00(0P `L  @L@p@\4A`Zecp@-h0P0Sp@/`_0@4 00(0` PT  @T@p@.hA4P 0(0S 3/4Y.0S  ~H0`0A"50U0C0   S(0S%_-P  GP  0R YP 0S0 4S "+00`Ze@c@JdZecA_Ap@-@Pp@A@-@P 7@-@/Ѝs@- P`@P 0 0@ЍpGA@-@P @-@=P@@-000 Ѝ䐔5@-000{ Ѝ5@-000 ЍF=@-000 Ѝ0G= 0Q/P /@-00 0XP Ѝ䐔5@-00 0NP Ѝ5@-00 0`P ЍF=@-00 0VP Ѝ0G=0 Q/S/< /< /0@-S@p0S 3/P <00<0/<   /0@-S@t0S 3/P <00<0/x0S //x0<0pt 0<0/0p@-@Pp0t0ᴉ<0`0<00Sʸ0Sp@@?@-@t0P|0S@/|/A-`@ᏉpȀ<0P 0S#Q003P0 000u?00C0K@ᮉ@cp@-@Pg00CS00:@p@蜉//<0 0S /0@-S@0S 3/P <0 0<0/<  0@-S@<0 0<00S 3/P/0S //00 000/0S/@-@3/00000/< 0@-S@ <00<00S 3/P/<  0 /0@-S@0S 3/P <00<0/)00/0S/@-@3/00000h0S p@-@`Ph0Spl01S 3/P/G-lP 0hpS A*0`S0Y030#@D 0Shl`}W * P0!!0A-P@l`hpT1S S@ R Tjh@l@NA*1GQ @p@-P @PL0P  $     PU $  U p@ppQ P  80R 0 Q }P 80R 0 @Jdcp@-P0 0S S, S@t@@pm@P`F`i`V80S@[@P``W` 0V80S@@Jdp@-P`@P P p@@-0@Sl00@s@-A_P 00` `@t000TЍp} L DP00PD@CH[eAA@-@8@x@-@0切,0@T   B B  @軇@Jdcp@-M` P@P U 4 DЍp R 0 R G0 QS8  )PPPP ꈅcAp@-MP` P@ Ѝp U @P C-Mp `@T ЍTP8 h1 S(0Z?00ЍAAAA@-@'P = #t@#A@-<0DT 0 !0  !@c0@- ! 0 !@-PDMp@`+ 7I*0 000007 'P =7 0`DЍAp@-P`#0@`  J+p55O-#A-@pPu*C H0`S  0 X0 ^'P  0 I0 P'P < /[*Ѝ6AC-@_M`p`  xP R, 00 X01 0101HP0100@,_ߍDJdC-@`pM ` e pP0 0 000000PP00o@ ЍDJd@- 0h ЍDJd@- 0 ] ЍDJd H0H0 0 0 0R  @ -@  R /@cJd 0!< 04 0 (   !/@cddd@-8@ 0U R  @JdJd-@- 00o: ЍЍ/p[e/p[e03 /@cL03"248<00 /@-$P@c-000 0Jd 000/JdG-RB0S T n@0T =@00?Td"0P 101S@0T<@0 @0<* 2 @  P101 R@ @@00ST S@  R@   R S0S 0S,9T 0S@0@0@0T @0 0  0RЍ; T  R 1CR,C ;`P 0||;p6Zl;@X q 0WL`~;V (4Z/ЍGu;Jd@cXAAAccAAAA-PÑx|0x|120C22S䩾@c@-02aM0S-aߍbpTUʀ 0! $!0!!   !2W@ 1rTaߍ@- D|!202VE 0^/B` ` ``  $`$ ($,(,`0(04`,4088<`4<80P<@ @0<`- N_B0zJdc[e@cdddp[e0c@-$008 @MM ЍJd@-0( 0 08 <NyM ЍJd@-(0  08 @MjMЍJd @-~t 0JdJd@- ~0 @P~JdJdO-t2,M@T@ `P\~50S D<~%@,Ѝ050404080 80<0$p<0@0H@0_`0S^~@H R 'BL\0$ R*0Pn#TH H L L $ p0Nc#H00H000W:0H[ }P WQ*HM&0 0S 0  BR %0Sk) ,0 0{ 0h?B3cPÿZ 0$ 0 p,}(@RqcJdJdMbA-\P@`Tc}50SA<}$0  B2#Hp PDPJdJdp@-<0@P4G}50S DQp@}}JdJdp@-80P@03}5@Tm}p@JdJdp@-PP0P` }5@@$U@T ,W}p  O}pJdJdA-@`Pp}500#T0S l;}$ R$ .H0,} HU 0JdJdA-`x0pPp|5@$V@@T L}0S0}$ W%H |JdJdp@-80@`0P|50Sp@|sJdJdp@-00@P(|50Sp@|EJdJd0000/@ycP/0S/-0\0000C00S P 1 !L0 @0C000P0 p@- R 0@ Rʠ8PQ BP P0 h00R Pp00000C00 0C000 0 pAA|> S$ @-0@(M0T (Ѝ@轧l03100P (Ѝ@m0 00!4 Ѝ0 0  (Ѝ/|>@c@yc S& @-0@(M0T (Ѝ@菧t03100P (Ѝ@X0  < 0 Ѝ  0j(Ѝ/|>@c@ycG-p@ࠟW `PU0``0C00S 0WP1R 0S0 P0pG0000C00 0C000 0  c|> 0S\* A //O-0SQ0+ P@p`V `p 0T 1!Q  0R  ^P 0 @T   0S  R `F P0 Ѝ  |>@-P`pឈ@P0  @ Ѝ@-P`pወ@P0 &@ ЍA-@`p!{᫆PPdZ{@Ѝ{h@N{,L{T0 @c\ J\ [G-`p0S0 0w@P202W@P0 Sp@20C22S ㆺ1 0f@c/ (/0/8?/F/M0P PЍ/  /M0PЍ/@- P P R:H0R 0R  0RЍTVRPA-` pP@Tl@lpT: X@0 8/P ЍPP PxB|B00/@- 0  00 Ѝ//// /$/4/Q Q Q  <0@o/<9@o/</0S= /<!@o/D0/P@/@/H/P/P/@-oP/P/@-oM0 Ѝ/   /@-PMp`0 X@PV 04/Ѝ@-0`S@ 0S0000000HyPP000 @0100Ѝp1  0S !S_.B"B(BPP OPT10L1P) =3;0P? 6;0P`V) 0P T0P`V 0P0S P P n 00@T Aatadrbmngnts@-P @$Mp`TU80pP@ 0$Ѝ WP0P@-`Pp$M@  p PAP $ЍPUPF 10S>S 900T00p@-(MP`@ b` Ѝ P(0 0CS"00 "` UV000! R 0 1   0RS "(ЍprbmnAp@-(MP`@ !@` ЍP 0R  "30%(Ѝprbmnp@-(MP`@ ` ЍP0 0CS00 "` UV00 (Ѝp1  0RS "rbmnA@-0 0 0  00 ЍdЍ,A0@-@P$M  PhP$Ѝ0@-0@-@P$M  PRP$Ѝ00@-@P$M  PAP$Ѝ0@- Ѝatad0atad@- Ѝgnts0gnts0@-,M@P m40P 0PO@o,Ѝ0loob@-o@-@ P@Ѝ@-!o@-@ P@Ѝ@-0o7@-P @(PP@ Ѝ0p@-P M@`&$`P o Ѝprbmn@-,MP`p @0p ЍPP@,ЍrbmnHZHBHH#H9H!H7HHA-`PpP P1 10RQ0P W4 @0 00RQ0@ GV ` 0 o 0 0  0!W\P0 ]0y0 o 0!V@`cdcccx]e@- w@0-x]ePAO-M @ 8PRP@P t`v0ZV 0S $4$0S?0 SJ31 @*Q nP 000V 0S000S00 0R0SRV SR !R @vЍ# !RVO!RR 0 S  X 0S P  0 0R P 3 !^o2l<0䲟 01S  0 Y a0S "2"0S 0 Sh0 @!RR 0 S  0S ~P &ܱ 0R rP 1 !1<0儱 0Y@ [ 9 010 0 0!0 S @K P%  S! "+0 07P}  K㌰0 P  00 JP 0 0 0 0  @꘏ccx]e`cZBdcVAccZBAcp@-@Pu@p@ux]eqp (0 $00P00//`cdcqp (0 $00P00//ccp@-80@Ps(00Pp!Rp`cdcp@-80@P`(00Pp!Rpꘟcc@-@QuT00Sڰ001S 000 \^  R @Pru@ 0DP8AT @_ux]e`cdccccc@-@P@PuL0H0 0P@\@Bu 0x]ecc@-@P@PtL0H0 0P@\@%u 0x]eccO-PP' `@pt0S000Z. e P% 0 R 0 B RPUltPh00S\001S V  0@0Dt Ѝpx]ecc`cdcO-PP' `@pt0S000Z.  GP% 0 R 0 B RPUltPh00S\001S V  0@0Dt Ѝpx]eccccp@-P@ TBt00S001S 00 0P\ 0S @P@ldtPp 0\ RP !R P< J4L @Ktx]ecccc`cdcp@-P@ Ts00S001S 00 0P\ 0S @P@ltPp 0\ RP !R P< J4L @tx]e`cdcccccqpO-p Ѝ A Dp110T00aV` 2V @T! 4/ppU 0`Tx0 PU QU $@P 000 0;/ 0pS ZBdcx]e`cA-pP`P ^ 0pA/A-pP`P p0A/@- @P00$0 0000/cA-pP`P p0A/A-pP`yP p0A/@-kP(@-eP(@-@_0P 0S @/A-aPPP a0A/p@-PB@Pp 0Sp3/pp$Ppp@[qpO-p Ѝ A Dp110T00aV` *1V 0@T! 4/ppU 0`Tx0PU QU 4@P 000 0;/00pS $ZBcx]ecA-pP`P ^ 0pA/A-pP`P p0A/p@-P`P 0p@/pp@-P`P 0p@/pA-pP`P p0A/@- @ P@0/@-@0P 0S @/p@-P`~P 0p@/pA-pP`oP p$0A/p@-Pa0P p@(0/pA-aPTP a,0A/@-GP8@-AP8p@-P;@Pp00Sp3/pp4Ppp@B/ 0 6/O-@P(0!夡M#&0 1 09 ⃡p@Dtqa` h,dq0`P@0 0 007/$08`P@oUp0p@/@cp@-P(0@00C0`Up0p@/Jdp@-P@`TVp`v`FVT@0@-@PH0MD0@ @A`40A眞뉠 Ѝ0@s`4^e@Kdp@-@P@|0T00  0pdLd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd G-0 M P   @ p X@`lP X 0000 ЍG@1  @PdLdPc^eA-X`PpW0S8 Aq P@m@Pc^e9Ap@-@P0 p@zdLdp@-@0PD@TpdLd@Qp@-@PyDUPptUp@00@p00S:/dLd00S:ˉ/dLd00 R !AdLd0 dLd0 dLd0 3dLd"111/"111/ 211/ -L0!0\Q S0dLd,0 0R/Q0 /dLd@-0 BodLdD0 0R/- 0RdLd <0Q/1S co `/ dLd -@0^1 0 co ` dLd40@0\/- 0\ dLd40@0\/- 0\  dLd40@0\/- 0\ dLdA-@`P$0pW纴@PdLd 2 2A-P`@$p0SQ @dLdA-P`@$p0SQ u@dLdA-P`@(p0SQ }@dLdO-` Rp;:Pа$M0@T$Ѝ0S:?T@Q; P 0 ?0@4'V`1  L      T: 0I37c@-@0@T t0Ѝ@W\P0 1 8*b0 崲PЍNdLd =ep@-P@P  ap-0t  B^\  PŠP0 !.0 . ƲNdLd =e@-0+00Z,@  0*QLdANd/-@- p$P0 P@~`0 P Ѝ@Ѝ/A-pP`@j0P U @U0p@-@`PW@P  E00p@-@P@{PA /R/qN/@-~AN/@-|~A@-x~A@-t~AN/ 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-`P@0 0/0 p@p@-@`\pPP 0 000 sp@ ]0@-@01s@-@0 PЀ `\0 <?,+\0 000Ѝpt6Np@-@`P0S \0 0S 00 j\p@ٜ/D^eG-`MpP@ᰐ:P!0 3 0000X0P3/H3 00P00 Ѝ^e@cAA6AAp@-T@dC\\00 P@ B?"@U$r\p 00C0/(0, _e@-@ %\0@ @@^\_ep@-T@`\ PUP 0 001`00 0RPPE\p_ea0@-$0P 0 0 Ѝ_e@-@[0vW@)\_ep@-A@ <`P[0 0RGW@\p_ep@-@0R, 1R >0R( >C 0CR$ p0R >0R >C 0CR0p 0S00 \P[0L$PBU 0P[Pp p@ 0 p@|f~f_e_eA- pM`P[| 0R( p@T1 00S 0E0C@S@1T( T@# ^00S0 Sph[ @La[T W 0[#@Ѝa@P [_e@_ep@-@T P,0,h0C[ V}[ppA_e_eG-頁@0MS㠠$ Ppx1 R0S! 5S-@Z@W 00@ C[ ` P@U`1L[V @+0@0Ѝ 0`` 0  00  00P 0 0@PEUP!U @ I0@S 0 T0p`FP@_ea0WeQ/p@-P0 @AlP Q PP 8 @ 00H0p_ea0O-P@p@-QU@`PpV 01p`U 1S 0 HY>A-P0QppU@`P `U1S0 V HY>G-pMS`f@Q03/ЍG@Q 00000 ` 0PЍ1 5G@\ 1Q  013/ Pq181@c6-1R001@ 1S ; @ 1S/ 4@-(0@tQ 0 @@cHY>1 2/ O-P@~80 S2Ԁ<0t`̠Wʀ ! , !8!<  S@@T`臁 13/ pPhe`geG-p0 @0 0 P  (`,(0, 0/X(0, 0Q h000C00Ѝ 0$ 0 0$ P@  13/P pV 0 P,A|>A-@Px`PM@pPEPE804P"8%< 40R:AyMpp@-@Px`0MH0,PU< 40R*p@bMp@-@Px`M0Pp@XMA-`@xPpM? 00+0`@`PPPEP0pE8A8M//\00S /@-X <!t  L  R0S Xc@-L@M`_eO-PP@4M?4ЍO/lR5 pR5 cR sR` SR0 RS 0S! X4/X0V0l $ $00 0000000L0 0H00<0 0 4/4Ѝp0`pttb(4/X E4/<0Y0804 ,4/P00@$4/4/00-4/Z 0S E4/ 0S 4/ 0S 4/0SJ4/Wx4/X Pp 0FNP `` `0``` ``p$`0P Z`\P,4/, 01p4/U4/Yy r4/Q`Us  4/p0X:P\4/ r 0D4/p4/[AzAAAAAAA!AAAAp@-P` 0@Tp @XcA-@xp`KPU  PUPU  bPP ZP PKP MPP@-M8PQP1 ! !1@11/ qQaP1P0  $00 $0 Ѝ P0RP Q  (0, 0(000/, 000P`_e,Ap@-0@0S00S)5  P`01!000C00aP0A!400C40p@0 JdJdOd@Od@c6A-d0@S h3/P x`JPЍ00PpQ <04S J0S   0— E R :@H B, R:0CP Xcp@-@`P J0 ;SR 0@0<Q ;T0T0T0LJ`8JT040CT0@JU@pT`_eXcd_e@-A-@I1S0/R 0,2/ "JxP9I00JpFoNPU Q 00Q 00=U 0VA`_eXc,A0je@-@@@iedh /pM//A-Pp@`ᘀ010 R BT1P000 0 0 Ѝ P   0P P@cA-t0@@Pp X0 0 `ሀ010 \ *! Pp0 0 0 A \ 1:0 UP@cG-1@PZ`00S 0 5 0pW V`P 0V00  3TPY z T T00T00S Y oTrpW 0003/ZGi pc(kedmdc @-H 0 ,kec00S/Hꌈc,ke00S/Iꌈc,kep@-P<H[@@ 1 @T S1@Ipc@-@P H@Sc@- 0@ (keO-`0A?oR20LMS$00$00 00pP?o2 00 000%PPppP  0@p 9RFR< RE$0S0`803/LЍ0[00 V 0 V03S000  +p X6R @( g 00P 0 0p@l  BR  D B6R P0 GW p@ R b @ *Q  !0@ P K  0 B  0 @ Rz@@@ lR @   @LLP0000 p00@" 00PQ0-ppZ[S S G000 0h0SQ000HBN  P  P @AP@  00PZp0P P P0@ P5 0x0@0Zp0p RZ  KGG00CZ W0P|4XZE ϱP @Zʟ p0 R0 00 40(00 0C W [V 0 V03Sp(0 S0 pC 0p0JZ0Z0 @ C Y[V 0 V03S@I@  00PpZ0G5P|P  00PP0@ "P P P0@  00  I P0I*0IWG 0 0!0h0L[ V V 3R  0CSi   ,09,0  3ig [Vc 0 V03S] 00  Q R`0`0FP 0   [ V 0 V03S000pGW> 0 [ V 0 V03SpJ0 0 [ V 0 V03S00"    +ꌈcAWA6APAhA-0@-M PQ0$@ @ @800S @ @vFЍ0@Ѝ/ _e-@-T031[  1 0S 00 00 ZЍЍ/@c-@-T031[  1 0S 00 00 @ЍЍ/@c-@-0 0001Ѝ Ѝ/s@-P@`0 `"Ѝp@-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/ -@-  ЍЍ/ @-00S@+(ke@-@P`00 `TU 0P0F%07Ѝp -@- 00 ЍЍ/G-PP`M <&!1 @P >`Ѝ 00 U00S`C 0S. z,@T@p T @@b 0R# T d  R  /A!b CQ00 0@!@ x @T 0 0 `ЍG?@1c  p U 0 yAcgfff|A@-< 0 0 0,0; }@ (kePA t@-@@-?@-@P0 @ @ @800S @ @_Ѝ0@ Ѝ/ _e0Q   AA@-`@P 0 P000S   5Ѝp _e-?@-@P@P 0  000Ѝ0@ Ѝ/ 0S LP P@@-0`Mp@  P0 Ѝ0-@-0 000 ЍЍ/-@-@Md0 4 0 000 [Ѝ@ Ѝ/A@-P`S}10S A3S  luPT #T212@00@00A0S<$10SA0 00S 0 0Q000 Z#p0 Pb 0 pp0 0S `0` 0Q01^P/0 `@vc@c8ke(kec_e_ea0ADkeAAA-@-`00/s@-@P`T 0 ,@J0 `Ѝp@4DeA-@-  ЍЍ/-@-00^ Ѝ Ѝ/-@-   Ѝ Ѝ/@-@x0P0`ppT 0 H@ 0 `$00S Ѝ@ Ѝ4DeA(ke-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/d008S/s@-@P`BT 0 ,@0 `kЍp@94DeA-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/A-0@0`p ppP0T00 0 \@~0 Hy0  0SЍAgЍ4De(keAA-@-  ЍЍ/-@-00 Ѝ Ѝ/-@-   Ѝ Ѝ/@-0@0Pp` ``T 0 H@/0 p$00S Ѝ@ Ѝ4DeA(ke-@-  ЍЍ/-@-00; Ѝ Ѝ/-@-   Ѝ Ѝ/ 0SA-aS_KBB@(pAB01 010101/A-a(P!R Ap@1!#880Ro_B$1 q0$12020kAB@-`R( q@_ BT0  (0!R@D!!!R Ѝ@6BA@2B @kP A&B Ѝ0 00HlP AOd%$p00S/@-`0`@0S@0D 0 @0D A@0D 0 @0D @A(keJdOd|0P-  !T LD.!      /@cdddl 0CS@-T0 !< 04 ,   !/@cAddd@-P 0P@cp@-5 0P@5OoBPp@c$0 0!0 00 /@cddd@-<0DT 0 !0  !@c0@- ! 0 !p@-@P` 0S@ p R0@@-@P00/p@-P`L@b @Pp@-@@ @/00/A-@Pp` _00$0@p#0 hA@cA-P@`wp H0S00  0S00 Nx0SAA-@PpY` *00@000#0 2A[@c0@-P@`xpM00Q ` 0 T 0S0Ѝp@ @[Jd$6?/0 0 1PS/ /@- @G@00@-NAG-@Rᜐ@@ PU``1S `V PQ pq  w0 P00\@`6p@-@P@0S` p@M@0U* `V 0a@-@@ ?p@-`P?@Tp00?`0S   0S@p@- s`p@-@`P?@T 0S@A @@pP/0S /O-p`P?0S R 1 ЍO???@X:? 10@?@T R A??  ЍO R !^  R   ??T  ЍzA@- M@ ᩏ 0 R0 00CS0 R=9 = 0 Ѝ@- M@ ᇏ0 0S 0  AQ0S00  00 Ѝʚ;@- M@ <0 0S 0  AQ0S00  00u Ѝʚ;p@-P@P@p@-PM@ 0 `\0` p^Z\k` 0 R S Q 0 Ѝ\ 0S AQ0 0S00  00,ʚ;A-qP M3 B>T t13AT \>@ Ѝ%J@>000 _>>0 000@0 0@P! /00B! 0㨀!!3Bak>T .P>p@i_>! @ 00P P@KΎc@cʚ;@-P@ 0 00   `pP10e 6 0S0  @P0S0 0  00Ѝpɚ;ʚ;C-@` 0M0RPЍ0 QPP pYP  R0 AQ@XPP0 00SuPE!mPp<A-pP0@D` `mV R@-0o/0@-PM S@0"Ѝ00    < p@- 0@ ` S R0 P0pA-p 0A0@@`P@ 0\ 0@0@000O-pP0 0 @P ca `僥a`@@ Ѝ001S s`@-P`$Mp ᥔ0 0 =%?0000000 0 P 00A @@ 0 JP$ЍO-p@$X0S 0 0X 0T00T0/ R0d0 /0@-@PN T!^! ^: Cb CT A, bCC^:N^:00 00O-P`2TP Ѝ000 @ 00@- X( b0A*(P Ѝ䨈c@- X b0*P Ѝ-:$M: 00A 000   0$Ѝ7@-@P&5 X0P4 R0 40 Q Ѝ0@f0U -,^ :!!<  12X0 0(ꨈcX 0 p@-@P4`Qp@$51S3A-@pP`40 00@ 5ЍO-s,M@0`PVP`$ 0+t3B 4 4  4404#C8("<pXw/ 0C0CVp40 2p8<000Td0a@PY `h x4d0H0> T`X` 00J1 Pp@W U P!T0L0X0$ P0\0 \0q``a a,Q1011410Q&3*`5WpF&8!U. P0`Pd PR0 ˨ 0 PSD d0 $SP= K@,Ѝ`QH  B(`z`1QES 0 @AP h00<  W0O< @@ QF? P q`F pఃd0 qL3( @,0,@SI$1((0(14ꨈcle(teA7|7AmeԈcA-@p0 M`00P 00 0p0@N0 00  0|0p0@0 \0\ &P(X00@0 p0P0 } Ѝ le 7AP7<1;1cEc-$M<840 ,(0 $Ѝ-$M<8ƌ40 ,(0 $ЍQ Q Q /1 !C//@-A00@-M00|0|@| 0x00c00PP X + 8傔40 0 Ѝ0@@PAle 7AA7Ec,,00 C#' ,00/JdEc00 Q0000$  B',#  /@cEcA-@PM` p20 0 0! 0?P W 0  \ \0P  PP 2Ѝ$ 0  0 P*A70Ap@-P@2 P2$ A-@P2t0 3R 0SP` p!VU A2S0@cG-0P3x0@ 4 2p `V 00 02`03/Vu20 0 0 Kg@c@-@G@Q@cs@-0PQ0 7 0@S K20 `0ЂЄ! 0S }2827 @Ѝp@-@c07O-0Pp,s0 `0@ `F`! P A(0P@0 0 PP PUP@Ec@cp@-P@1000PPp@(2/A-1P@0S 00 `26/1 0$ 0 0$  $0RP@Pd@cDPdHc@-L@L03/@1`0d 0 RS`0d D@1@PdPdA-`pP1@"^\Up `0 0 P0 @0 00XAT1Ds0 000  0@Pd@cDPd 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd0@S@-i0 /3AA-@q`@T;0 (夥  11Q0 @▥ @0D wh rh  mh hh  0EP00 0E00\0 0L0000040Ѝ$c@PdCAZAIA\!7lArA 7\00S/QA-H@H@`PQ0p"R0:A0JdPd@Pd 0h 1ii@PdG-pP0|@X\`&V\U0 X0LL0PTp/P 0`XPh0\`0xPd@PdJdC-`0@0PSX 4/X  Ѝ|0#2q12`03"p'qrX Ġ 0 0  ЍCJd@c0@- @r 7G-P ` @R 0Y 4/Y p0#2q12T03"p'qrY Ġ   Gc GYJd@cp@-@P/000CS0000p@Gp@+0p@-`xMV 0@S x P k000(`(0/ 0`0xЍpcC-M 0`p` @學P0 P 00 00 0 0@u?o2P0S RR! %*Ѝ(cC-M 0`p` @}P0 P  00 00 0 0@u?o2P0S RR Ѝ(cP  0R://O-0 ,p`@\ PU3 \\0\ PU0 0 0 @\ \0 PU00 R \\ PU  0 00@-@R 0Sb0S] 0S_0 R @0 R  R 0 \0000 R PU \ PU 0 \ \R  \0\  ^  0 0 0S 0 R  R 0 \000 R00 00 R @0  R  R 0 \0000 R \\ \ R R R   \0\  ^  0 0 0S 0 R  R 0 \00A-S`@1 \. P\P\ p^ 0S0S0SP RPP0P0SP^ 00SW \ p^ 0Sp@-@P$`,@},(p@,p@-`P@0U S0PP @ p@@]pp  P 0P@-@Qp Pp@-@PQpp0 P0@ 0R  R/P R/0P/ R / 0R  R/P  R/0P/ R /0S/Q 00O-p$ 4M+ 0SPX *,`%ꔰ[Y( o@`@P  ()@`$ +0 0`P ( ,4Ѝ@A$@(`&Rl00& 0T0C 0Q `+h 0l0P$0hP P0$0+ @+00 +o PU T`h0Ss`P@$`(Pp@-@ $t+P0P@ P00P0@PpO-pP`$c+@T @+T Y+ +00,0pI F+,Vp=+ ЍG-@Q8@T80S <`1+P@0U:j+@8z080D0@0++GLk80兑P p W 80 0   [Pp@-PLQ@y K0D0<8@0 <*08 8  0 S  **80S +p8@+A-@`P$p*h`0l0@h00 00 00Q0*p@-@$P`* @T*p(0S H0S*p$P *$0S*@H R*h07@-P @P@P 80S*@ Ѝ0<00*18P /p@-0P@ PP00b p@Z*A@-@ZW*@ @- @F*0 000A-`@p@* 0S P 00 00p*A**QU q(*00CS0`*`[*@-@*XS*@ *@-@TP 0T0 @ee0@-p0 0mPP@`TV @P Ѝ80S #*V 2P@00TP TP0 <0@ 80*V  ۓee18P /O-pp3TM`3@ RP00?STЍ,0S 0S 0SV$0S S8 S `8P3 $0@ 8PH0SP @@ \   Hp p`)X L尵T`P@c `P80S I)00 000)T` @p`~D0<5)80!0S0 80R1``80a8000`))$ 1 P 0R,:R) 0 ^ @#T 0T0W W  5)T0T0BTC0%) (0Y00000)1@cee(c0SS  S/@- @P1@8@- @P1@8p@-P`( 0SS 0 000p@(0AT (0S 00 0_00CS0(`(@-@u(0TP0s0XT0(L$@z@- @   0 03/@P0W0>   N@ X3V0 0,Q *Q :@  0  \@001 1 000    8   ;@w#000 S 0# 00C 2 0 0 00 3/@PY 0  "  00 0 0 3/@P 00 3/B0@ 0@00 0| 03/@P 0 0 0 0@ 0 3/ 010 0 0 0 03/ 0@0 0 0 03/@  (0`S10 0P@0+R@ 0 03/0 0 0 0 00 @AEc~f}f3{f@|f@-@qP p p@-@Pd0P @ 003/@8p@-@M P MЍp@-`@E0P @ 040S-@  3/@p@-$M0@P @, 00`V-@% 0 10 !0S! S S@ 1 000 00p q# 0 006/@$Ѝ0A-@PP @ 08Q-@ b00 0`01/@Ѝ@-0@0! Ѝ@-@  nP0000Ѝ7@-@P mP MP Ѝ0@-"0`p SB@ pP P`0 @  O-@oopb W T0!03SP (0S0P Yp(0SY @ 1!H  @@J PU @fP-dM"h0 (00@#0 00 ,8pdЍ_7A-0P`p@0 TЍ@- #0@-G-pP1SA@>( `R111U @ T 1P Ѝ@-00S0;0 ЍO-`0#MPܰ" 0$0P @Ѝ(0SppW @P (0S0pWpWpW @pGorV X_ @T    A0 0p$ %?\0?4H0PX``Pd0pA 0 00! "?,0?P (`0P40p@P  0 00!P pMATX X  @P 0 00000 00 -P@x  @q0  @P @g0  @P>P ([1 01  010b 0PPQ`U0 @ @K HT_7Ep@-0PS@`M  6JP0 Ѝp0000 O-14M`@PX0`0CS: 4ЍqP  (0S[X\00X0 00 ` X  0     0 [ AO-0p IR@4M, [P  I@P!@T  I@P @  @0` @P "J@ 4Ѝ?@-@O p0t 0 0x0% #@ p@-d0d@P: &r"0@3@#Vo pp@-d0d@P& h0l (00, @@VZ pp0p@-Q@ 1CQ 1CQ pP h0l 00010? p00f@p@-d0@P0S S p80`h0pPm# p0@`AAp@-@d0P@]p@ p@-@d0PQp@ p@-P@P  @pp@-@P` 7&'00F= 00'`P000@0 pp@-P@A` h0l 0H0` &r0`3:0@p@cG-0SP'@  pᄣPP srF Th0l Y^:0 h0l o$AyЍX#x0S `nP000p0t 0 p0t /p0t `0Sp0x0 t S PP #`PA-0SP-@ `phl 0 y0S 0Q h0lDo $@u'  PX!x0S PЍp0t 0 p0t p0t P0Sp0x0 t S PP #PO-50S`5 P`P-00p嬰 0 0(0 @ @H @00y0hl`n%+  @ 0300 ЍA@c0 0R0,00 0 0/ኈp@-P`@t  PPppp@-P@L`SU<<tP@P PPP@ @pQdQdQdp@-@`P EOPpQ@-@ *@ 㶒O-`pP(@T 0(  Y $Z Q @ GIPW(@ X $[ 4 @T 0( q p,0H0@0,0PPp@-@P@oЍ0P :0Q:///0/P$ Qp@-$PP $@*p@0/P$ Qp@-$Pp@P $@*A-@`PUD,_P@ }0S 0Ss00T0`n8P40S$pe(PU _8PQJH8GA@㖿? ENPQdQdQdA-P0\!Qp# `!0  sPP  PP0S Ѝ@b@P P0 0$pP 0804P(Pt,00S``\T0`0 }PP`( U0S K@c`AQdQdQdO-STM@xp|N `PP#@E W 0S @P;0  00 0  R0 0200p f@P(P ,H4@L@$  P  #@P ,}zTЍy,048@<0P80,0 @`jH@TK 4@TH VWm `P0  RS> QQ< <`4@0pG40S@  @004PD0|0$L0w64om,@0SD  D 040S8^@WT0@P0S 0AQ 0S 0 wP r ,'#P`,`ɚ;6ehAʚ;0@-@M0@d QP#!0   P@   r@ T@Ѝ0@cA-PR  p@P `VP $0 pP(0PЍ@P/@-MP@`۠P V0 ! 000Ѝ"RS+ P `V $psⷠP2U0!㢠0P  RR   .◠P2U0!゠P!SSp@- (1 0 @PS p@OQd`A'QdO-,MpP  S T 4P   X`\P% Y P00\XT  ,ЍO10P ,ЍO;0P 0 $07JY )P@/ [, $ @P&$P "Y 0 0 0` ,$`P > P :,Ѝ`P#@@`P0\0XT  00J/&>2  L+& &bR0@P} 0S4#,S  @P @P 0QS P @Pa0+ S0&%&b"x1Y, 0 $0⢟@PM$ 0RXP 0 00,P[2 *"*kA 0 BQ    "0C?o2S0S0S000  P S00S00S wPP IPN@H@AVA[AA0@- 0@SP$M  SCP 0 P     $Ѝ0 0 R  //p@-`Q0@0 Q Pp00p 0@-@ 0P  -DP 'DЍC-@$MP CP 1` z?0 0?$ЍP`p崀P`0S X *1` z?0 0x?V ǞPPPYX V  A@BA@-P04Mp3     1U`00@ P P$ (0"L 0 @ 0H4/@P U tT00#T0S@D0PE0S 0 @\RP0P(4Ѝ@cWe@-P@`?P 0 Ѝp0 ` O-R@|M %PP 0 @|ЍY 0,Q@! 0000 1/@P0qlX X@8` 2B@P V , 8 `0P!,0#(0!0 0 X/(0S8(0 0 0 @ 04/@P( 0S tT00#T0S@0X0C 0 R   @Q (( R LP0QP Һ h@@cWe0@-0 0Y ЍC-4MP 000 0 P$03Up1@00(03`T 0 @ 0P4/@P 0U tT00#T0S@  T  0h<3 HPu 0PED00S 0 @OQX0P4Ѝ@ccWe@-P@`1P 0 Ѝp0 ` O-R|M@ PP 0 @|ЍY 0,Q@ 0000 1/@P0qlX X@*`  $A@P V 8 `0㔱,03100000(0X>d0SG(0 0 0 @ 04/@P (0 R tT00#T0S@  T  03 G (0X0B 0 R  @P̹ (( R LP0PP ᵹ K@@cWec0@-0 0I ЍO-1PMp0`P P @@ P @f  0 03/PZ  *Q@f [ $/ S  P 5/PP [ $/  A P R 0 O  Ԁ0 S @㴀 0 0@ƀub xz/  A$4` 0 , $(    TIf rdAedAedAWe}f~fg~ AG-pM7 P 㷸0` S)P 0 i y@, 㜸Ѝ>    7@P  07 000L{P8'7 y(P0S6  S1#U S1 #0 L⧼P  7Z@P0@7 Ls@P H 7 M0 @L≼Pd @PU @6VP0 CP @HJdcA@c~AA00@-@0,MP 0 00!00T0@3Q100 0 0S N0@DT@,Ѝ0@c/p@-P@fZ pG- P @`$pX X X@(0WPP@ 0 0@`020@`A-P S@`@TQ U20 Q@ Q  E 0 *^@#eRЍlpp~Np@W02< 0 @  01/@A-@`Pp5 0@mG-pP@`# S!@"0R  2  00@ 0@V0"(0  ,0`$0 ?@A-@`pP ~TW 2`p0#΅"^0@@A-QPp Q! Q`+i`@2` R`   Q`02@20C-Pp`2  Ѝ S @ R0P0@A`0 00\(0 #d 0R P A-`PpV S@"@Q  0" R0Q@H0 00\ 0@ "dsЍG-`VP:Pp u @ WЙ 0 BPP$!dd2 02mPP 0 ( h @  &a* / )00ЍX ;AAG-` R P0S0R@9@ &0+SB@P)V  U @$P0p BB@PvP`@ P0 ,Z@ ;pW O-0TMp$00S00 0<`P#`TЍ0 0B`P0  0<`P003 ``3 1P00C&p$`W[3pWb ᫵᧵0`op@⫲W[<3pW4@T0,0 T 1 #0p$, =,0 @Tp00P00S Z 1 !, =,0` T00P00S U 1, =` ebVP P 04Pp={0`$`P PPp0`$`P PPp  `i R<  <` EWi`` P  R , (╵( $ , 0 0@@00 0$0000pu  4i R<  <` E+i`` P  R , (i( $ , 0 0@@00 0$00pOxP@t:P 0 03/`NV`K`N``gA@cxcxccA B @-00S/A-@P`p _00P0000 0n?@r?v_` A-P@p;A` $0SH0( ` $ 0R`0P c@cp@-P80@T ,PpAQd0O-T"DM`!p <4B 00 0,p(`$  @P<\ 0! 00< 0 <00,p(`$  `[<0 Sc 0'a!<0 ` 0 0,(p$ [0 00<!0 0  0,(p$ [0 00<!)0 0  0,(p$ [ 0 00<!80 0  0,(p$ [ 0`F@!  0,(p$ ` @< [DЍ A0c Q 0 Rdp@-@PBoPPUP 㬳( P PNKp@z㞳 R00 A-\0P3`q900CS@@0$B@nT <A{@cA-@` q0p ?PP hЍ@P` 0 PP 0`P > `;PHP1S!!1! PU020( j P f Rdp@-@PM TP0RPP+0@@@T& RP`@@ @@@`0  vxP0 @@oR PT`L0Ѝp800@0lAQddAEcRdt7ep@-@P`0P ( R t pU  @u@p@-pPPM @P @  9@P0S00C>S@0`S@ 0S@ x3107Ѝ0@-@M P  P m! :Ѝ0@-PM p9@P  p@P @p0`S  0W000DQ  g:@ЍO-@$M 0Hp?0` l>PP 6CPP<@ឡ3 Py@P   (  , ^ R !W$  RR R0R Pz@ @80j/ 0R( P 0W`0" w1 00 0 100嬡@zVpP= @  P $D1 00? 0@0 4<00000 P  Py0 00 pyL0 T# $Ѝ0S@rP^vo_`rτn0X@Sk/1!p]@@PFV00cAA%Ao QdRd0p@-P @`M P  O8PAЍp/G- p0`^PP PK@n8_ 0 Sj$0SD `V10 c /o 0b4 baQ  S  !R!0C31$00C$0 PC  U 40  9?oW20SP   9P)ЍV   0yP P` `0 200"20 #P<#(P@- 0000@uP 00Ѝ0@-@PP$M  7P 0 _P 00$Ѝ0O- 3P MⰰR`)0S: S: Y`  ሰ@ 7`P 2  P `P  `Ѝ rh^U(`; p 0S:$ 0REXc00 40h!  @ 1@1181$0 SfPU `x0S P x s|0 00$0080匰$00$0 A(`  VU   #>[ 0 P `P   P0 #R< # 0S000@@ P0 0  @@P(`(`l0cRdc0@-00 Ѝ@-@PM  6PЍp@-`0SA 1X03/5H0HSp<_ 5H0HS p@ V !p@>@ccC-$M@`p_PP @ \0 0@0 0h00<0p `0000@0p@P  _$ЍHA7A-`AMpr 1PT l6@P*0@& (?@P! 0  0c? 0  0@P Bb7@TЍ|>@-v10/10/]G-Qp `P @3W0S P0 5 @@P P @ P P0P@@G R H@p@-PA PP p pp@-@Q @P @pP0$P R @ @@s@-@PaZ 0 @ TQ  6@Ѝp@-p|M?WP$x AP` ƀ00`0p 0嗼0$Xp0- + pXPP W @:P\ Z |Ѝcp@-@aP 1S !@T 0S 0QU00001501 0S p. PPO-03pP1@`ᄠTO P 0 S iA @ 0S9PP02P03@cTAC-p`$MRP0P P0CP0 4P0%@ RP0 0  0@P $Ѝ0( zA0 ` Ap@ #P U<@  @U  .@cTA@-`@V  4PP  ` 0S  PQ Ѝp jP P0 5\C-@MT;0 p0I S@#* aV PჭP ~4@P U yЍ 5@A-p@Wqg0P 9@P ?T0003a 2@P = N@I[$q$Qc, W@9@c@-0P@3UQa PP Ѝp7$Q  >a:  0R # Z9@c@-0S@?P 5ЍG-pW@ PP F0`0Sk "]@P0S WQo@/p@-@1P 0ch id$ Q$180p_p@-`R" 0P1S 0@S _ P pP0   00p p////// B 0@Ps //Q 0S P 40 P0@1S///eA-@ t03@`P C |0S 0 R0`h d0P0U TpH1 0AD@0Q00C0 R0 QJd@ccceO-0@pPDM(0( <00,p$@ @@ @`<@S<0S% 0 00< 00000'>0,0(p$@ @ST0P0000,(p$@ @ @P< SDЍAe77A-@pQ ޫ0 P `㨀0 V: T` V 13@`QЍ0`1S 0 + _AJdeAC-M 0@p` P6$a0 P 00 000 0PDO?o2P0S@.0S@*XQPU@$ w@" pU*0!R0X H@PN _@$G  X@%QЍeJd@-808@ P 3F  @Ecel7A0@-M 000 00 0p@P@,P 0R #`0 S |  @ R \@0`80 @3@P ЍeJd@-0 000 0 000@᯻PЍ@Ѝ0C-Mp0 000p0 0ᗻPQa}V  0RI@P0P X@ЍwP w3pU W @0U@UPU0pPpU#Q  2@0S P P doTm@ Q0S 2. Q@cJdcc@0G-M 00 00 0`P@ hpP L9@Ѝx4143P@刀0S S@ u`q tp jP@TQ  92@u`L@@@|PUY W 1S 0ሀ0.VQJd@cc0"!S/ 00/P /A-L0C@1S`H1P@ATAp|q`@@c00@-0BRUbPEQᆢBDU$XQW]YiP @PaYX i R/0Pg  Z  0J0ЍXWYPELD  6/0P;P 0  )/0P.P  /0P"P   /0PTP   /0PTP   .0PTP  $zW < .0PY 7  .0P0 01 0100/oX" R0  /0/oW" R  /0/oY" R]  ᕰ /0V y  y0U@cAp@-P@U`0M  .PPP  .P P 000Ѝp@-@PP4M  q.P0D S# *a/b(0 0 004Ѝ@BO-p0EM31, 0 ? S @3%:a V P@P ;.@P81 00H@P C/@ U &Eߍ@cA@-0s0 H ϠNl/ / ( 0C00 ЍMb@Bp@-P@U`(M  -PP P  -P0(ЍpE/08!PR/p@-SP@HanP@10D1@A `0p 0 pJLO-0`SP 0S 0@dQ @280SP81^0S 9@0@ 0 a0p $ 000!   #88 !#4< !#2> !#1?  B pBw 0b8s!$%00   0 :UT: Ѝ^U  0 L0Z  P2pp1   \ 0R 081<10<1     P    ЍO @ PRdAA-`唀p?`@T|@0C0 P@PEPKK9 0 F0 f021@& 0@@ARdEc@-@( *x@Wp@-@V0Sp 0P R @1S0@1  0S0000p@@-0M?SU1p`0@SPT:4l`P Z@@D@ V@@ S @Ѝ$`帳V00SJ @@0` 00[@P@T Y1@uTst T T 0 d0 Ѝ@S20@cp@-@xMP` x w` b,P0 xЍpp@-P@xM`x w001`0 0]0$ uxЍpp@-@PaM. tw ;0. F-ލp0p@-MaP. ",@P 0@  K0@T@ލpO-A$M>ZL`0R00pPA 0V4U 0S31@0b 'w " }h H0 00     WP   P L  `Q((L Q`Q''L  "!    apR Rdb 00000 0 0 00 .W`1 0110 0T0S|[l[1S L0  1 [" [#H0S 1Sep10Sa[˵LH1H0S ,1 [0(0[09˵H0SP2 |v2 020ъ00008`1 01 1R 0  0.P 7P0 4P0 <P0S -$ЍP[H0 Ace Acc0@-P@PP A0@-PMP @ )P0S Ѝ0A-`q@PaV 0! ! ! U 0  1 @ 0 S @3:0 ! !01@}0@-P@PM )P0S  R PQ *Ѝ0O-`V@p MF 03/PPO PPK `P0 0`0S``"PV 8/PP5h2X!@0 X!\! \!`! `! d10d1` ht 0#, P Qo@00Tt 0g,PV#PЍp1ZS^/x1|! 0A|1 ޵p1S 0p1x1PS|!|!|1x! V7 xX4 O 0 $0S 0( $ BR( %0Sk) , 0$( 0Q0 @R 0S0h000Q 03/PPPX` 0@3/P Pcʚ;@-00Ѝ s@-@`P⋟ ϟ@T 㶟Ѝp Bp@-P@ B B p!oP h0T @DT p0PpO-M0s 0Spe0@SbP@  PPh2 ЍH*L0 %(13Q00|@0T 0S 1 S26wh0Y00S 6Zx` h0Yp` S` p`Y`F 0 `P±P hvAc@c@- @ 'P0~ЍC-`0PCMJpn@PP 0 0001 00㏱PP 1Ѝph10IS HWV@-@ 0 P  (PQ  (Ѝ0G-M p 0@PM؁6XP P 00S@00S # `P x\@$P▞PDOL0 J@a0` 000 0@P|p 53U nP \ЍZ 1 SI 0S PqWYP NU HPsP6@cJdcA-0MS90PS5 f@P`P@p @@@1 00㹰P 1@ЍQ @1 @*@p@-P@`u 0SP S00C00 xP|PU x0sP 0C0Pp?U p0PS ʀ000h0S x0UP@-<M-0`P |D!DA@M!0 00`,P($  @pp@-P@P ;Pp:p@-@P 2q9000,03/@pp@- 2PQ@1 #2=C 0CQ 0CQ 1!0S01Q0#30I <i S01 01(p@03/1Q 0CQ% >+1Q>C/1C  Pp@UP1QB 1CQ [?0Q Pp@Q 1R::1Ppu!0Q 0 0!0000c0S: R :SP0C BS000KKPK s@XAs@Dc@c~f s@-@SS0 0 0h0ֲ@LSp@-d0T@`BS0\,0(@P@U0 0 00`,(P$  Pp<(0 0 0!?0 0 04`0P,(P$ <1 0 00!? 0 0 04`0,(P$ |<000X1 00 00!*>0 0 04`,(P$ e<1 80 00!?0 00 04`,(P$ O< 0!?0 0 800`,(P$  Pp: 0 ,`($ @<08 $;0p0<0i|Q hj$p@p@-@P @# 嬯|c/0000`0001S 0V (g0p^edmdc eA-P`Vp0| @@ @@1B  lAT 4/0 y#P@xP ep@-@0P#PP@ %m _pEce@- @$^PeG-DaP@ 88$ 0 4 0 T 4 T ( ,8q U( ,1:00%<$ P - 8 < 8 $ < $  R P @o l iU <0SPT_H\ P @14 0 LS 0000?Y$0!D1  L0S81  UP h4P000@1 t1S 3/P0000  P , 9\0+4 V1SSQ   ^kh090@W1SSQ D15 0L s xD15D1;T9 P1SSQQ1SSQ ViP1 S S  b0 3  1T!U1R*,R1SSQ VG   U1SSQ 0<0}T1ST1SSQ D15D10<0 U  P < SK1SSQ 0S H. U@ PM1SSQ# _ 0 R P I  DQ 000S0>;6RH L1 S S RP N1SSQ1 e P P p\ p0U P P  l p0D P P V  "@ Z1 S S R ,L 00 S   | 1R"Cy  PX^ U_ H1S I1S J1S* ( U& 0 08C0  :/0H1 S S R  P PEUP#U PE0 S = ePA@1  p@-P@$p/e@-D1 M2D10@9000 00 P090 Ѝ@-D1@ D1L 0X1SY1SA-`PpA@@ | 1R@ 0@1B @ TPT Q X @ep@-T@p`<`?P,00(@@UpeO-0DM S @0 Pp#48@3@(009D h1 Q/[ , S) d4P[01 0S4Y`DЍS K 3`BVp<0Ya00VX0FS[`0#4 0=0 0PS!RRQ   R V`0# 0 # ?0cR81  TP hp P000@1 t1S 3/P000"Q8 SQY0=@0T0R@2 @A0.@!B +@) `qQ =!008  R(00C?2cO 0@CdB$@FSzYL0S800q0)T0S 0  8#`?0 `X1S#V V#VH /S0`Ph~C0CU 8<U ,<U50 A<Q ]k0CQ$0CQ;0S л3!1PS |;U;U0CU;+0S00p;U %40cS KS V0CS@{< P 0 :/zCz P 0  9//:Q ::0S[  S 1 0S [0 P Q@  ( I :P ? Ѝ90AU? 9UPu 1 0R0[0- sPP 9U908 0;bl9U 0CU 0Ui, 10S 0RS 9U 80SQ8U" 0CU I0CUC000 8U <8U 0U0508U 7U-@ 0Pt eD8U >0Uu >C0CUy 0R000U'U L7Un70 S' S00p7U  d7UY_W zP4  8t I+70SL70S  P;07U7q0p p1S 3/P  4p Y|000| 0C 0;PUPPK@8vZ + RT 0H0HS G]PP  0D 80< 0PS@bP #]!$2$]ZT@TЍO, Ns+0S ! S [0 0S00c01 0R[0 0S00\1 0S[  $0|00@1$0\1(0S`1 i{,4U D1 "    2D10D!810 R<1 0;; 0D!"0D1 Fs 8P D12D100FTx Ptt/0D!  %<D!0* Q}[z   Q0(03/z 0<0wP @>uP= 100100@[00[0x/CP0S ! S-[0* UUpehPP 1 0RPWPQ0 :E P 0S ЍOvSL"[ЍO" Petrtht@t0^t et,@Bt @ut@cf@*At@cBc BCt gtcEcvtt nt ot st@jt@wt@HtH~ft:At,$edmd Bp@-@Pe0U R  @  @1B  T0pR00PeH/H!/81 - p@-U1@ C/oS" R 0\ <0 sP 03/pT1 S S R 0<0l1S (l13/K#/#pe/p@-P,0@TppP @`c/@-@PD0@PP  80P  R 00 0edcp@-PPL0@T 0S 408 CTT 00 0p@e`cc@-@P($08 CTT 00C 0@ecA-@FnP/pPP` 8pPa00|0p @R 0PQ 00400S  R  0?e`B`c@-$PP 娤dcBcB@-@X]T08 CTT 0S 00S   ec/dc 8080 1l1S 0 0//ԉc 8080 1l1S 040//ԉc 0 601/ԉcp@-PT T0 601@0003/(0lQ007pԉceA-pt`P@@@ @L0 @ S@P0/@(0,   AR SD1 W P00Ce0 /@-P0 @"6 0<  $0000P0:@芞ԉcp@-@Q@ x0`"6 0h Q0000X00X0 0$0mp$p@dԉcG-0hMS~ 1P!0 & q`r됀@@,   XY 0X0 j@P@  ,Q,#NkhЍ YY 0DY0 hЍGj|0S  @ Z;H@P u p j@+T0@@ @hpdRd #A@PxX =k@\T0@@ 0R0T0S3@#@@ԉceO-p@`x2Pt"0tM & 000L @  I L Rh00 4 Xr 0W#000  ` @P R8m X✝LPTdRd #AQ@!@1l  jPOL @000(CT GT p RdR@1d@#  jP. @ `D!L"$ L\ "P R (Md ( 2/He@D8n(Zr 000 tЍԉceG-PH!D1 60q0`EA@ 0@ # | R    X0S  Y0S@ 0@  L0  S  0@ T@  BQSD1  @T Q sY 0n@=ԉcep@-@p p0 601 R R p@ Ph p04g p 0PԉcBeBp@-@pP0Up@ep@-@pPIp@eA-p`tP @@" |0S  @ X R@ Y@T /(0,  XP YQ 0 (0, @,@Wep@-d0PQ0A TyT 0SlA@OoBU $p@T@ԉcHeA-q`0S3@Th✠0VT@ PQᝇ,H0TS@ ᐇ R P!n0@@l |01S`t@0Pzxh01S PPrp`[}0A?ԉc(BHeA-P0` VP@P@ x0x0qPl1S X$@H0@`l1̀0003/D1;D1@Eԉce8I8Qp@-4Pp@$0S@@pԉcHe@-@ $T@ 0Heԉc,sr/p@-Pl0@"6 0\ \ a $o 0$0gp@ԉceA-`A0` F@PpPP84t0101@0@$lj 1810<10D1K<@1=`1\1Il1S000( 0 03/P @ 0块P \}PЍ00   h0PP0C0 heԉc+p@-PP0 601P003/@@dpԉcO-쑟p3`!1 ر 60P@ @` 1 Q$ L0S1 8pL0SP@T:L`p#V#51 0S [ X@P  [  S oP @< #@ X@T @|8g@dT L0S8@l1S 0 03/@@cԉcEceG-`,$(4 6 0Q4(,V@!0S 0 X0@0X0D1;D1pЍD1  0 X0@0X0D1;mP h3R `3Vl 9>C1CV %@3Vm 0 $p 07/pp{ 0 *ppr0o 2 Rk0S Y`v2V, 1\0CVh|P|2V" 0CV 0TR 0 00I0;,2V0CV20S0S00 0R 0 py00u 0R 0 0P0E>SxD1S0 008|00D1  0 1V )1V 0CV X0@0X000S81< U1ST100C?o2 @ S) X0@ 0 0X0 p0V T00SSX0@ 00X0ԉc`t`T8ft_t u wt@ept tttut 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cdddp@-`@P}U VBtP0P0 0`p@-@P cP 0SBZ000p@-@0SP \P 00AS  !0R30T000 0S00000CS000tpG-p@`V0SS00aI"U P PEVP j0 `F0C000S000p@-P`^Q@ V0@@DT @@D8p L@ CA\@ ^@\ A\ R\Π p@-@P%0S0000p@ S0C0LU0 Q BPE0 0U RR  p@-@`0 SpSP 0S埛  0000`P  BR1 " 0010 0000S000pBO-`QI@p0 S> S 0S4d 000 0R*PP P%PEUP i R A00N \ᡡ:50C010 `F000p0S000Vc Ѝ@ ࡡ0030c00 [ B0PQP/@P - Q^00@S0\3Le X0P/-0^  0CS0\3 Lep@-@# RP 0 BS 0 \0C0P 0CS0Q30TR  pp@-@PKpp4031[  10 P /@c-[  \ [@- @ [0  P p Q  Q\1P!  S[ @ [ @G@@@at cp@-`d0@31[  10 PU 8 0 ᭒@ᷔp@@cp@-`d0@31[  10 PU 80 y@ᘔp@@cp@-0@1[  10 PU 0͆ ϑ@|p@O-DMp0P0<0p`<@ @00<0,(p$P PP P`)*<@0 0 0<4,(p$P PP P@`)DЍPehBp@-@Pe0Upp@&@-@H.$0S 40 S   0 uPeA-Pᔀ M@T fP$q\_TPP` d  5 p0S Ѝ@cPerBxc0S/Oci8A-tp@hP`V U0PD 0 p@)fP `cPe h000@-@AM,P oSLA dQ d, Aߍ0/01 p@-L1@SP(0:0p,18`S 0,Q0Q:01 01"PLaPU 0S 3/P  0$L1H/@-PAM@zU 0S"Aߍ@, `P Aߍ ``3pP ` À0PS 0S 㸀 d0 L1S0Sp0LQ:03/PU`P 㗀 㔀$WHO-MRQB 0,P|ߍO'Q 0S 0 S 0 00L\0$00(0D&뺞`P7& pߍ00 3@00T 00PS, (0S)pW& 0( S"0$ 00S0 000,0p 01P0 S030#[0Sw 00S@000 08S 0 0`023 - PER0 P 0T000X0@0\00XK 8P0p01 `00' 'QJ  f0S QE b yf ) 0X 8p> "2 2" 2" 2" -8p͛TrPU000 W >0 =00 =C00Ks 0 0  *0 0 H*00P0001P0100 *00 *0*00 0*00 +0*p,gӝ0S 02B% pc@c@c@-8>0>0$ >@0  >Xeet8@t8p@-` P00P0T0@Tp@D0D>P0SX@$0S 3/,PXecEcep@-h T00T0\0@Tp@L0L 0?0c=P0SX@ 0S 3/,PXecEcgfff0p@-X00@ X  $Rx01X0S 3/P0S P 0S00@ 08 04 0c0p0S 3/,PcXeeee eO-LMD@pl 0R!  0 00,@(p$  `& 0! 0  D 40@,@(p$  @`& 0! 0   40,@(p$  @`m&0 000! 0   4,@(p$  @`X& 0!\1P 0@ 0<840@,@(p$ PB& 0!1 0@ 0840,@(p$ P.& 0!00 0  0@84,@(p$ P&D0 S @dPd`dpU:T +LЍOP 0"S !@LЍxBDeXo8B0BHe$P00 !XP/ P/ R/XXec@-P R0CoS \,0P @-@P0^ R\ T \RP \,0/@-@P @0S @/@-@P <0S @/@-PL@-P@@P 00%ӕ/xBQp@-@!@3PVPP@p0S @-⌗ 1dBp@-P@eP`  H0S p@/p@G-P0P @NP D0S G/p`W 1 !P @TNjPF舐Y B BR !  AjP @W1!V``@- @0P @p@-PP@p@ ]10`S% S S  p@aS SG10\ FS! S S |xS S p@V0P L\ 1 p@& p@ p@QBBBB0BBB B-BA-`p@0@TP0SX@0S 3/,PcA-PQpT0@T0 R X@`0S0S  3/,`c,0(0 0#1P! P #/Dcl?e0@ S /@-$0 @%PЍ|>G-MⰠ P`p ` @c0P00SS00-ЍS0 000000@" ?o2P0SQ $0S S S h 0QQP<0H S80(0J$00Ec؍e@BEcEcC-釟M|@P` pgNp0p $  ̃0` b2 020202HX00ߍ؍e~8p@-1@SHPL0S0L0 CHLkP UpH@0100p@ (CUH  L00L0H0P @0` T^ p@X0\ /B؍e 0!< 04 0 (   !/@cddd\ P/0 !8 00 (  , !/@cddd@-M`0@THPp#2Q120@T ~ODT3"P%QR| 00 0ЍP0SX@(0S 3/,P0S 3/Ac@c@e؍e 0O-DM`'p!< CS P00 0,p(`$  `#3 ?0080 040`,p(`$  "83 ?0 0<0 040,p(`$  "000 0 'Ȣ!0 0 04,p(`$ "0 000'tŸ! 0  0 04,p(`$ " 0'!2Ÿ 0(0 0 040,p(`$ "0 000!1 0100 0 4,p(`$ v"0 000!T1 0700 0 4,p(`$ _" 1 0I0 08 0NP 0 P@<  w s0|P &R+3'! P<0l g v<0$^,0DЍOX؍eBAAEcL8EcEc88D8l?e@BA-@`(pP$|!$劁Aj؍eP 0 0S/p@-X0PP L.@P 0 H@Q000 0p؍e@-PH00000 0$0(0,0004080<0@0D0@-d0Q@\` PP0L00H@40 400;\00T0X0؍eG-0MZǓ0\ 0pWЍ@L\ T 0E0 0 尓P@T 0H0 0E0 0 D p坓` `FV`!  <`pG@0BB1BP/Q@- 0ࠣ @a0 RS000(00\ 0C L000RS ( 0A0B(00 ( 0R 0S PA0@-@P 048900H0000000H0\000 0C000/A-@PpPU0S@@``FV`! 7/P@PEQ0/0\/ APQ /p@-@TPPP@pp$00$/$0S0$0/ 0S00/@-@p@-$PUp@Qp@@-@0 ( 00@Jp@-@q0 0P0 p!R 喒100 ڌB؍e RA-@P;bS`:pc@P PU0P SA-@P;bS`:p_@P PUl0(PPp@-P GP@ V0@pp@-@PPlTp00 00FS0^ 000l@3S @pHL0SP0\ 00CG-P0@0,0S *`V 0Sp@ATpP 0 `0 夐0J,R0TPUP! U P!0 v^0@DJ0000CS0000`VTT`p؍eO-pPU' `V':S`F' 0$ @P 2V2(0 0C(000(( 0 ` 6P(@PHV@` [@P 0 0l 000 000HLfH0H0`0000+ ]0O-rMP`@0 ``(`0 0`S`F 80000U Vn0  ( R(|pPEWY80 fXp000<)0" 3SH L0SP0\ 0fX, <Pp 0% 3SH0L RP \0  <  0CSS10U 1 !)I0PI00<,00 BX 1U  1Ip@Pp@ppWm 0j 3SH0L0ScU 0< pP7Ѝ<pP U)0& X븀V0008000T   #RH L R!X B/o" RX0@0C0pfV0 X 1S  0  00HAQ00@0Wp!S  \000P`V PU @P@-P   Ѝ@-0000P7 ЍP/@-rPQp@-t `P@Pp0 0` U PhB@-@P@Ѝ@-  0S  Ѝ0bSG-@9p`PP2 0 0 0  I,b0W`!V`! V `!0 `\0pGI0000CS0000@TWW@xP؍eO-PR``Ap0PPPM 0@P 2 (`200V [ ^@P P Ѝ00pJWp!fW{  W 1+#  \ @PZP`F R[ 000R000 p؍eA-0@S" `;(0 S8ʸS C< 0CPHPZP (00 AQ(0000PP 0 ?0W@ [OpP `(P0PEU0 U + (0A0PEUpP `$P/0S/p@- @PP d[pA-@pP$`V@PW0$000@$@p`0@-P@ 048900H000$00@O-M@0r000?` `0 sQPp000, vVQ@&U #Y0SPpGW0pUv  :  0 $ P@ 0ЍS v(0(`0C(0 v B R ! 0> 0S000 0 00HLcH0H00v p`F0Sp0P 0 3SH L0SP0\ 00<0Cv S0!0  BR ! ZBB@-R Ѝ@-L ЍO-0P0tǍ RP@ Ѝ0S@PETUT 0S  #RH L R  YUP`C "XP 00 YP@ X0 P 0 0SP]pH^\\S Z QHLQP\ $ QHL0S0P0  A"Q \  0 o0000H 0CS00C R0 0000 Y00C0P0PX 0 YDPB ` Y00C0 00 &000b00rBG-0P p@P: ;  0 0  000HLXbH0H0`堀VgYPP P  0  0 00HL7bH0H0`JYy@B/-/-/-//-/-/-/@-@b`-v@-A-PUp1p!0@W`DS W c cc_PW(0G-`P00 00@pP) X01 0!00000P XI Y 0 000P Y J0S@FЍ-/-/-/-/-/-/-/-//A-@$`P Pą@ p00  GDXP  XWPp  X`G-4pPPP8 `=@P 00 00 `P@ЍC-P0S`pM 2Q@0S @Ѝ@50T U @ 00040"(P 0  0SBT D@DT@(P ḍ1V< 1CV VM `@4TC@@ @T 5@H@t0` @Tፍ`1@00C?o270 T:0 z`T `V4 `V1 pT``P @ X( @0@T@#C  T4@@iiip@-@PPPU@` W`Pp Bp@- P`8@<0P p @0PppPp@- p0Pd00S PR0pDP<@巀80 @8gOu%0(B@SdeTdp@-P`0` 0@ 0AT 0S`a0S@ 00 0pTd@SdA-@PpM B, 80R) 0 R *)`00<00@0 0$0t`|`p00S0x0 00P0:0`P@@aA-P@p0`,PUVU  A6RG-41p!,10RC*Q`= S PP<*P00 /R0S /oTPP8p@ Y$`D1p@ |҃0PP 0,`8$0 Pa2~<5~@<3$_@P?@SdcB@-@P p00@-@<3l7 0S \u0LS   ,P 0o⌃@Do@SdSdp@- 0@0CS`P 040,PP_oRU vpp@dp@-@Pj 0S 80 31R00 p@cp@-P40@AT ,TPIp@@Sd@-0 00 0PP Ѝ0A-0SPp` x@dSTP8P (0S @ 00 0@PSd0@- @P ,0S@uT p ЍЍ@@-@ P$0 0[  KЍs@-` @P)P,0S(0S@ 00S |0 31R@؋4T <00S 嫋Ѝp@Ѝp@9@@c07@- k@P@P$0sT@ 0$0(0S r Ѝ0O-@PDM TP^DЍOtQ w@A@AKP1  d @88~4q@0 a H(00<0,$@ @@ @t0 00!00'>< 00,($@@ @^ 0\! 0 P0< 0 ,($@@ @LuF PP DЍ@SdTd8BeBcp@-@P8in0 @P `np0@-`PP @BT6P ЍPPp *h( P0XS   @00C@0 `V40040V"Td@SdA-p MaP 3/@P"@P 0 (00 0<1R 0@ Ѝ0 @P  0 PQ"03̀1 0f&t@BP 0 @0@ 0QPQX   803/@P   P坋BDRSP@cSdTd@Sd@-00 0 Ѝ G-p`0 M 0*@P⨋@P  Ѝ0 (00 01R 0 {@ D H03/@P% Pha!P cUZ0U@@000 P @F  A@ FT  CP G`P 00 0*V @x0!0R:@@1PPS0P1@01@Q00  PB@SdcTd@- 0000 00gЍ A-Mp yP@$`'X``P$P @@$(0V0(0  0⃌@P  ŀ@(0T0C(0  ЍW` #@0 0@-@MP P 0S 40 R 0#P<Ѝ0ɚ;0 <08 SD @R C0BP// 800C80@0pP 00 0S 0080( 3/$0    P A1Tpp$0p@SmT]W qq 0SVqT|0S 0| 0090#0@cA-pPX`@0 0S@0d00T T0T H0'&@P9$F{P @ec3eDc$e@-@ 0w@DcO-ؐؠ`PUV {{00L뜰0H0P\@P `N@@ p @@D $` 0 ,0{{Uec$e|>܍eO-TMP4L0p0L 00RZ(Y`|    "200 \20\2x0S@|0x@3080|00(05<0X008 P z4S @|  $+ +LxTЍ00 ?o2Y0S 9@40SN " <0R0 YFTD0S0ST00à R0S  6|0 3  8 Pa0@0H0Z|0 L 000L0,0?L0S 0c~ 0`(0 000D4 R8000S3# RQ. $ 0  0 R& S 0!Spx 00 N@H0P$0  H0 `0 @P(6@00 $H@ 0S@@ [fYD0 T 3 0{b W p00K H@C0`H01`;0 D7$06D0@0S00$ 0H`\p:XP#:0 P000L L"4040T 00 0C0000 00C00 R0000C0 0SK ,0p`L(00(08p_TY,`C|00001`P LR   Y;( 10R04 D0x 3/0@S000Y1;ò10PL02Y[xY Y p{p [ 0 0 RppR@@TKd V`0[00S  @@4 x04/'@(@#@ @0x0c|>e|8I0O-@`'~0;s@! !@-@.s,s@)s P4:A-`TȀ@Upʀ 0! $ 0  , !|0 ,0w0d0 0!T!0    !/@cddd,cDe@-@Q Ѝ0l  R:` <P#!, i` @!P 00@H 0TD@D0<0RH0De@c,cG-RpP`0=  ( 08`x  0R<8 P/D @R+ @ BPS@P P㹱PP  0H@L 40B300\00T0X00 6W00 DX0ST0S@L@T@P BG-`Rp 0 PV T0SPLPT0XP0w@P  DDUP`(0 0(0@Q`Q@PU7 BA-@R0 vwp0 S00 S<8`^D@P\N0L^0R0ST0S@L@T@P& BA-`@PpTXUZ 0000 0RX 0SUG 01QT0S0T0q@U8  R0#&  3SHL0SP0\00<0CR1Q 0C 00080 080@P@0P00@pL@At6 B@-@P L0T0p@-@QpT0PS@0L@T@0Q 0 00000 p@rQ/T RT 0 0Sbp@-@QL0LPpS00S0T@@0Q 0 00000 p@D!R R0P00p@-PL@Q``U`QV 80mv0S0C0000800C80Q 0S L`L0SP0  RpT0pPEL`N B@-@@0S87@-@P1 < @0D0 Ѝ0A-0Xp@P` U[<S !P  P71 S010S0PR 5 cA-4$P 4p0?RL1S(@8P ,1S 0,1010:01 01`A@P 00000111010044P0P041418181@1@1D1D1H1H1800 P <00111100!1.01 0.000003/P&f``& 1R 101%p@-L@Q0L00P0T0PL0SO-(ppP U [  s@`(@@P U U PP  H@L BÌ\PTX0(O 000P z- Gu-d B@-P `@P   AЍpp@-P@0Tp @˸p@-X0,`0 ( P@,  n0@U pn@- P0P@-P/ R/@- @@V@薸VT `0O0X` `@V@@ BWeA-PM`pyt@P 400000 0>@sЍ7@-Pbt@P w@s Ѝ0p@-`PV M  V00 R0S@"  +t@P0kV Q0@0    @P ds Ѝp@-%50S@,M]32121P0 a p 0@PF0 000$000@P& (00(0(00(01:11:1#010 S;305<0@T Y$ tS t $ t t 00$00,Ѝs@-`Ps@P19@ 00003/@'sЍps@-`Ps@P 00403/@sЍp@-pP' c@0P0  \P ЍT@ 0 S 1H05 bPV00  X B0p@-M00000P0` H@P #0@P PrP Yrލp@-p PP`IM  @P0 0000 0@P # 0@P PrP .rIߍ@-pP* c@0P0  P Ѝ RT@ 0PR 0% PV00   Bp@-0M@P` ' 000 00 00 0 0`4,00002PP #0PP 0Ѝp@-P4M`p @P&043,0$0 S0 0 @P$0S 0@ P T @ |@4Ѝ @P BO-PPlM%  (L@PnB00S@i8F(8uP- ( 80,00< (0 @, Q00(0H2 , 000 7r@PG0DT@0` S;# p0 @ts0S@( 10@" H@P 0冲*S`  ? @X0 S$0 00  H0P #0@?oV20S@ P &TV0`D@ qlЍX0S- 0HL@P H0 Hd0@P`0`0S 8(,08< SP00@ S00S p $ HA@P P000ɚ;6eĪ B@-@0M 0P 0# ܍@-@0M 0P 0#܍G- pW`P_R/R-?U@PP 0L00 H@$ B# \PT0X0Y PK`P :W@ W ` 0 R $R ÕP`0311  U`pV 0 0F0ER8m000  R` R B@c BO-MP 0S 4qM Q6 Q(@AS` R. 4  0$0 8^4 Q Z R7Q=@20SF WP? S PU:8@` @P @0V SvtЍ@`00\J 00 0@P  RM[00 0 @P P0 Q00 04A004/0@P0 0* [ tT00#T0S  T 0 0$; | NhBU T00S 0@ 0FS0K@@ BWecA-`MpP ,p@P 0 0 Ѝ000! @o0-4M$0(0,00000 000 00 00  0 04Ѝp@-@(MP` P3`$00 (ЍpO-DM`  o@P0P S;# p0 ts0S 0 P0no0U@DЍ 0Pⅲ! 8p0P ,0 <00PP B-/-/-/p@-^. ` 00S0S0000 0 0 0h 0@@0 PP00@@0P !@100D1 0ppPeO-P0㄰U`!R `VP R@ R R ppG'qZY08/0*p@-@P0Upp@0R0 0S  0Q 8 B @- @-p@-@0`PVp@0 `wḯ`p@Pep@-@P0S 1`0D0 `H `@0L0@0pp@-@P P O@PQ@-@-p@-@TpP0P R  RpPp@  R   R4k Q  101pn B@-C-@MP_` 0` P 1 p`00___ __0S GPЍ_`sC-0`S' 0S$0S P@1,  B0001,0 (00C  @0(00M  X Ѝp4k B~ Bp@-P@e Pp00Fp@-@ 000S0S P A-@pP`V ®pPp0S 0`VJ`x` 0S  0S 0SD埮@weA0ٮ6P APecde@-@5p@-0@SP 0S%Q 0S 0S PPP0@Pp0S@`00k jhP p0cPe B@-@P,E80 S 08  @< @ycPep@-@PpP2 0  p@k(0 S 0009Pep@-@P400C40U ,p@jl\ep@-@`PɮǮ 0 ` ΅p@1M/  \@-  0S 0S00; j)/ BA-@`pPP 00S0p&$O-gn@Pj忭S0S 0S4 3t| c`V/d```V8Z@0SX`(V p嗭(0S 00S 8 R4 S 00S ĭ `~c<08p80席WtuQpG p&(W`p`      B 0 Rᑭ 0 R  4R 8 R Y( R`V  1Q   R  @ 0  0 f4d7 @  , qkZ   e(pW0pW  8p  8p0S 0 0@000000-P+p,Ţ ¢00 0>P0` |@TX 0#0L0R    X@X 00 000$0l0 PSp  p p0l U $庢Tdxe@c4eep@-40P (aX@P ;UP00pxe@-@]X`@ZXp@-@000l0Y05000  L00;00)000 Q :0`P =>09#900S? 0 0R9ڜ  I S `P 40083/0` =V0 $|$BX 0S 1pp@|Q t  | x x |000900000 0S"ʽXx0p@ eXxS0000 |  @|    , 0C1p@XꔐeTd0UdxeUdp@-@P尡Op@Tdp@-@奡0  ]<00 0F PU 0 0͡0p@/0 ġp@]Xp@軡R Bp@-[  P8 l0Sp p p0l X  @P  0,P Hx E4 PllpA d0ic1p0吞 ʞP00Tdxe@-pM(ppP,`@P" 0 "0V060000lS0#T20T20S qP V 0 0 0 ЍV 0 0 0 @c@- (pP @ P@P $0 R;`P Ѝ`q0@0O-@0@Dp8<P @ P4` TK@P@0 $;`P Ѝ {P L510 k,@``10@0TdA-P`pܝ 0Y@P 0 p 0 0(90AcATd0/xe202/@o/ 0R:****,//p@-@|Pᛝ0 dS(0 1D 0 D00@0D0(0(01@  B@ P00P0p@輝UdA-P`pAT 0S *,P A030#A(0S A- P$`@ZV Z Q+ a$ 0R010 q` ="?0 S(0 1D 0 (00a@00C@0lU *Az? 0R010 0A SUdDVd@-@2Sn D!1,,N0 N 40N48 N8< $N $<@(,N(,@D04N04DH8<N8<HL @DN@DL$PHLNLHPT(PTNPTTT X 0%, ,0,0@Ϝ@Vd@c8eEcDVdep@-]@YL X!Pp@ PT0QP3Q/0@-@P|@0S0(@\DLP00L0P00CP0T00T00Q0UdEcDVd20C22S/0@-PR@X0\M0 0S\Ѝ0Z N0 XSX0# t0 0 P4/0O-p048 X001 0A S *LD!000@ Ѝ  0 0Y "!Wm0 0jP'D!00000  xD!000$YX)0W0WPPU D!@000t XD!@000g >PU D! 00 0D!@000Q80DVd@c@-900pЍO-p0M0  $2` 0S *"D!000-ЍP G@0MY P D0s: 1sT @@N 1R" I  .  @ : #:0 1!Dc  0DN P T V mD!(00(0 0PP T BZD!000$`VPD!000Y -T@0@`@D!000DVd@cO-T2P 0MS ao@p@0S; 1s @1IL@]N 1R" I  .  :D #: 0 1!b 0TN P D! @(00(0cЍA,1T !D!$00$0R/ @ *0.SY Y+0.S (0S X 0 0CX:00"@ *_# i=@T X0 0000$ D! 00 0DVd@cO-p00 0 0S:tRP0lbT 0 @S@`0cV`V``V:HZS pWq P` $@ 0 80)0  *# V |t P0(  0P0D00`0D0<<T a_W 0 W7 .R4 .R1  ! `1 ЍO 0=0CP0 Q L  L 00 L0 cᾙ* <!R 01a@ ЍDVdUdEcG-`0 S@Paps pZPp` Qq aG0 S00 ///0S/9@- 00 Ѝd B@-0)  0SЍd B@- 0  Ѝd B@-@a0@@D00H@L0P 3X% X| 0X `<0000,00 (00!X0 000<0$@0 @ @`2<Ѝd BEcUdDVd8es9Ec\w9@-0@00CW0T;DEc@-@ ̿aʿ( 0 !1011 1 B@-@ ⼿a@蹿O-@`p a ᯿!R  EV< P᛿0 DP ^ ЍO P  0P  N ׿P0; Ͽ u ʿ; U0  g Ѝ B@- ,@P :Ѝ|q9@- D!000@,@c@- D!000@!@cp@-:@@0t031$P@`,P :P :P :r 0 000p@cp@-@031$P*$Pp@cp@-@. *PpP(@_:P Y:P U:p@n:$00S/p@-@P$$Pp@-@$0P@<:,0 R P/20O-@QaDM00 P @@E0 0 0 @@@EX1Xq 0z3S4#S630˗J0A@ (00!000 08040,@$@ @@ @ 0 !80 0<0,($@@ @ 0!'>`0,($@ p@ @`<08 DЍe Bl?etcp@-@Pp0SpP`0S  ! HQPUQ 0L 0000 0C0p0S  ! bH긙etcp@-@TpP`PzK 04R00 0 倗HH00peeȘep@-`4@PT F@ 0 S0S 0R00 0 0 ,000R 0P0@M@p訚ee@-@0 0C0@>ꨚeO-`40@SPp0E  0S>Q  0RP?S 0 ! G 0 0S 1zі100P+1Fp `000000 00 00 00 A 000S 0 @ Ѝ R RQ 0 0 9CR:0S 0긙etceeA-@p`PUddE0Pp `P00S 0 000$ 000 00PetcA-@ `PX00pQR0S0 R\S  ! 0< 0C0 00C 00 0C0 0pA Btcp@-@0PS`"00\ p0S0S 0S0 0S0/P: P/O-CM81 `Q1P$ 81100 0$0`V4`;898X00$0V@$0S  C$ /  C@ UJ0@TJ@0 S$0 0P 7U 77Cߍ870 <P@@p@@0$ p@W`<0S lJ@T P$<  G@Pp81X10  hG@P LJ0 0 :800<024 @00D04VG@8J T Xf p0 W|00 07 m<@P 7 0 H%,,H0pLXp\ (0 H(I0@?oT20S 0@P'X0 0GS@%(Q  RRPD P> @T ^7 $00CX"#* $ I M7 @T($0S C$ /  C%701 P0CVS @@01ڀp41p@H X;T(  2G@P" I0CW IԚe B@-0 ,0  oЍ$0 1P$0o/Q /O-P$M U U@"@(Z@6`F F !p$@ _0TC0@0 |@ ᩻T0 F ߾@6$ЍC-P`M0F000Fp00 0h@P t@Ѝ0 C /  C07s0 0pB@y6T8 1 !S X p  P000`F 00 갚e@-@,(0 R @0@S谚e|c@-@T P00S@ S @R 00:0갚e|cp@-P840@Tp@)0S 3/@갚e|cA-@`TpړH0PU4 0S  3/@PP갚e|c B@-  Q &Q  FP-/p@-@@P0S0 0S!0Sp00Q!5` 00`00Q \R H  M<O C0\S&B=B B!Bp@-P@@0Sp0500P 0S!!//O-QG@@3A-$0`V0 Pp 0  0`P$ @0FP( 0 ЍA 0RP0 0 0  p(0(0Ѝ(` 0`0 (`0S 0(0 0BO-PQ$MQ`š P/Q`QA`p0 - R!W0S QA 0S S S \P PP n$ЍWV0`pW 00 P P P000{z0S /P@ 卐0S 0S 01/a$1`00(`,`00000 0 0S STtTPP`p p0!Py P4@(PzS P0 #P@刐T @ 0@ `H0  `V00`0(P400080@4000,4F(0PS 48 Q8 0 804 0(0U | x0S R | 0xA 0(0 @ `31V P [0S(0[V0@0(0P0S0S|00 0R  0RP0@(P? %b0S$0S!Y0V( @0( (  0_`>48 Q8 0 8 4(@40 8 04000,0S((@0 0S 0 (00+V0 0 0 :"P 0a1!sr0  R 0`0` 00@0 0`00Vdc@cB KVdp@- 1@ 1PP 1p0P00p@-P@ `APp0 S 2 A0/S$0/S  A 0 0C0070 R99 R999 0R .Q  .R:0p07:?p0/@-0@ P $10P@1O-PMU@  DPC R& R#     TP 0T R@0P@**P W *pW`/oU" R 5 0Ѝ `P  0h*V O-p2`M0 @U Q Q 20S@0000-   R  {5P Q P``>z_P0 PmI|0 00000P @0 Ѝ 0    0 0z0`0 0@000 0S 0 25 ?PP) MU $5P BP@U 0 0  P?00Pu0 7SP PUPPT  000 B 00 @cԚe<B H0R  R/R20R/20@-@0@ 0@-@ / @  p@-PP@P 0+P 0#pp@-P`?@P P 0+PP@ pQ@-@@P 0@-0@S /000p@-PPEUPp@/PpO-MH00@,00D8 <000 ,0(P0SP00000000PP  0$PH0S! x?0S 00P0q/0 n/00000 0 0S 0S H/0 00H> c0 P 8/0P 3/0001$p@ɳ`0V  x.`C0 /RI 0S  0 0 ` 0 0S $/0 P /0P /0000S =P  `pR0"  ! P !PS J0 0 ToP 0 S !" 00 `Sv r 0 T0000 00 R000 0: 000 00 0 /RL R 0T  X00090 000 0STP S0S ~.0S00T0.0 X.0T0S P X  Q   P S0S ^.Xp.0 0000000S 0CSg| lH 0 00 00C08+  Q~  00x0d0 p0Pm pP\0 00 c03Sa d# +.0T0p0-XX0S00TX0T ]XX0S R0S 00 S0X TP TP S0S -0 00000,00SQ 0N <0< (000000,00f,0(H0(0b0S .P 0p0p00S 0  0UG U- .d帲[/ -TP0S p00Sp吰[ r.P 0 pP0  b.P0 Pp0p0 P00S0b 0P 0pP -0p0  P-XdPU tS|-zX0 0T00 0S 0S0'0-00 0S S0S L- ^-0 00000[S009   R S R S0.- 0T00US0S 0S0?0 00 0 0 0C 0D0S0bSf 0 00 40p6 0$0 S$ d 1 000 40@ 2=P ?-B -\0 p00['`0\pp0`Pt`P#40p  /? ?X -ꀀx,80Sh50S 1@0,80/P$0 `@R0 r {R`" /U  0X QP@0凯  0 S o*000/U  ` `Z0/P$000N0}P 0X0S 0/U00S 0S*0S 0 P0 SC*/U 0  L00/P ,00`$0L0 /UZ Z2* 0S/ P) 0 S*/U  `0 00 /P$ X$ R  $0$0_, 0 0 S:W,?//U  X X 0S P 0 S */U 000 ` s/U X X 0S `P @0 1 l 0 S */U 00/U [ [* 0S PQ 0 S *000/U   `6/U [ [* 0S xhPh1 0 S*0/UP v<1 `00g/U[ [* 0S HP  0 S L0g*/U00 000#/U4[V 0P1:90 dC 0 S 00J*/U deԚe@cWexBB@c}BBBBYeYeBBBBKBBWeXeBBBBBBB[ * 0S /U X @P:90\  dC 0 S */U00[* 0S /U X X 0S Pm:f9@ }U0 { /P 0R00Ǘ 0  0   3+ 04 0 00/S + 00S0 00 .R  .R0/S0 0 00+40 0 /R" 0 T0*0 00S* 0 00`pd0  P0p0gP 0  }  { -4 0 0 0 00C0S *wT00 0X  900S00@TP *T@T0 0X00(0S ,0Ѝ*6*Q** R 0CSP S0S p*X*0 00000x*00 RX R =0S0 X R F/a>P: X 0S /U[ tP9{8:@-(0M00    0 00  @ Ѝ0@-M0(0000 000000000  @ ЍC-04MP@l P?Pq/J`PPkP(_ ,00,00`4`p 0,0:4`8 @(`p$09PPK804 Q0C00 0,0ɀ,.Q .R: :9,0)0 0PS U<00U0S R 0S ,0  0 PP )U`V ,0 z.``4ЍA- 00S : C0pP`4900@   0S P n)@00WP@J.@P ^)B B 0@-@DMP\, 0\ 0\ 0\P  RC 00 0x8T4@P00DЍ0@ (BA-P`pO@P P 0 P10 A-P`pF@P0 @Ѝ0 G-P`ሀ#p@0T00/ 0P0T将(P @  ,PV  6/P 00S0P00P0Ά)P07@- 0P @P  V@ Ѝ0tBp@-P`@`` TP@g @cF  ] Y 0!p踚eVd*@-@S/PN<0(TF0 P b@!긚ep@-P "@@ "@pp@-P"P@@@ "@p@-@!@A-P`P 00p@TH00 0S0PPP@ 0S@@3V P@Vdep@-@QP \00SpPT ` @ Vpl꬛ep@-P`+'@彅0 R000@00P0@pp@-@&P 0P᥅/R 00/ 0P0مp@A'0A-`@VP pጅ/R 00/ …UP p}0000@@@峅VAO-`M@n'$P̡̱$009P9@!OCAd@ 0P p- 0 S   v'4 pW U,PÚ 8pP# !(7p 9W T'W' kPUPW00S XPrX R0 R 'P &P ڔ  BR*'*'PW ЍEc@cgfff@-@D?0 !!|0x0t0l000, !  ! 40 r@P?B@cddd嵂PU D0SK d00d0D03/@奂d0T0Cd0<%@ڂU|嗂0S2hтVd `t M8M( 0& 00001 0! 0 000 |0PW  9p [* 00M(  A +%R0Dt[0dV 0 oP VM.040w    R Vj 0 RPb tV0.00|00 0$PO-dB0BhBew]lBB@- 0 0 0000 yЍA-`PMp @P0@00<@@0%D@T PЍ(P+Y(0 @@0P 0&@P 0 0@ @T(P[s0S Ises@-`@PЍp0BsP @00!-0@P000rs@-P@pM0 0 `P Q! T@z-0 /!bR 0QPU @@0 iPЍQBEcB`:@-@-T3\M` @P04#P0 S0, `h@P,   \Ѝ PX @P +@$ PG @P$ ( P: @P  @P(  p@P( @P  ڛ@P@ ` @P@ @ ě@Pp@ `帛@P @P@ 0000p@ `埛@Pv @Pp  ⬜`@ ⍛@Pd @p+`}@P zP @Z@DdB B@-@M bP ЍG-@!S$`p!M WP0O80-PP%W$! 4P?@0Sp 0官<P0@0 P U Ѝ _P@ Ȑ  P00/S S 80SP +4@+  ԚeB@-PX0M`p @P 0 0 0}@ ЍdBp@-@`L 0P@P ٛ@p @-PM p`0@P  04 00#0I@F0Ѝ@cp@-@`L 0P@P 奛@p O-1MP`@0Dz`@ p0 0P[0$0P 00 00P*U!@UT@H0@0 UT*0 0 0P@0 3/0P` P P@@0 3/0P 0]+0Ѝ B@-0 000Ѝ G-p`/@P.0  0S@ ! #PPY |%$@@x0S&   P  PP @/Ѝ I@ T  k@ \TG-0Pq$@#@`;P  PPPဗ}!#$" G}@c0@-Mp 00000` 0N#@Pj/@P0`PK0S@@!"@$Tl/Ѝp@-@MP `@PU?000,@@0v!4@T E@Ѝp00?0S@@!M"@P$ 0s@- Q@P $P@`ᰖ00Ѝp0 0p@-M 00000P 0`"@P0 @PBЍpO-5,MpT @P= a$$0@P 0 00000 0P  000 0{@P$0  /,Ѝ R  /$0  1@P$00P@P@$$  /@ C-p0MR`P0'mP 0 3/@mNT T+ du40000 000@S +.T@ @P0/S ].@P0  dЍc@-p0@ @`jPP @ (0 T@J Ѝ@c@- 000@0 cP 00Ѝ@- 00 0@0P 00Ѝs@-@ PR000BS` F00S03P R30ЍpQ! ! C- pሐ)P@``V`31P01 0@PP  ЍT0p@-0P@-0P 000S 0 p@Fp-p0ASG-Pp@ `ŗPP00S!3 T` TS @P0p@-`M 0000 0Pb!@P@PT0P00L@$@(0T$0@T }`Ѝp8`xp@NT  w@P`0 0S030儘@P 0S@3:z@O-P0!M0#q` 0000 0 !@PcUPd  bQ.@PX  a@PF@T0SG  /@P  @P  .P 0S-@+" o 0$  - @P  0m0X  X m 0 P@Pl" 0  -Ѝ-@@@c@- x Ѝ@-M pP 0` @P @P`@!T&@Ѝ@-M@ 0P 幗ЍA-M P` 0pS @P @Pp@T 00 00@DЍs@-P@Pk 0`00@P v@ [Ѝp C-P0M 0000p0 ` @P  k@PxpP0, @Ѝ @ @0 -: S'  S"  S0 0@ S+0  S0P00TS-sr@,<*!,P5V% "00 P-0T+S S ,P0< (@P ( ,<!@P ,< ,,P0< (i@-@# Ѝ@@YЍ@- c Ѝ@-!  Ѝ0 cD cp@-HMP\0  1 1 0-@P+X@P$0`800 @4`0 <H@P 0$S@0S 0R@4 @$ $DR@HЍp@4 $ 0P5 PdBlB@-; 000c0 Ѝ@- 0;0 00Ѝ0 c" 0c000@-DM 6@P$P0@,P000024@P 0S00,5 0P  P @DЍ0  , @P ,  0c I0F0 cA@-0S@`@P*0P @ 0,Q@ 0P000 1/@a*ЍpC-pM`y*PP 0P* @Ѝ 0,Q !!1/@P Q@@3*00@-MA0 0@RЍ0C-pM`A*PP 0* @Ѝ 0,Q !!1/@P R@@)00@-MA0 0@RЍ0C-SDM@`p.  E_U_`S@P#00P,@@0Q|Q4 P<G=H 4P@T W\DЍV@ `c  @P @0@-0 c Ѝ@- 00 Ѝp@-@M` P@P0P,@@00P4@P @ЍpP?@ @-0 c Ѝ0@-MPP @@0cP ȔЍ00@-MPP @0cP 巔Ѝ00@- 0MP00P0#@3P 壔Ѝ0@00@- 00 c\ Ѝ@- 00T Ѝs@-P@0` F@P w@/ ЍpdB@-P`9)@P 0 pb@( Ѝs@-P@0` @P L@ ЍplBs@-P0` D0D0 0@P D@ ЍplBdB0@-0 c Ѝs@-P`(@P0 '@(Ѝp@- 00 Ѝs@-P@0` @P  @ ЍplB@-P$0` L0L0 0v@P@0 +@ ЍplBdB0@-000 c Ѝ@-PH0` @P00 0 @ ЍpdB@-P` (@P @0@4(Ѝp@-00 00 Ѝ@-P` c(@P 0 00@(Ѝp@-PD0` F@P@0 @ B ЍplB@-PH0` 0@P00 0@ + ЍplBG-M0`@S11\p @Td0s_\ 0s0Sp 0PPp?X!(/PP 0 SP? P0UPP(d0 s` 0 s pUZ0!(00PfW  0S  בPP Ѝ 0sP0PPdBlBp@-PM`'@P @0 @0c0 f@J'Ѝp@-  00 0000#30 SЍ@-0 cHЍC-LM@hPP$ l0S (zP(0 !R x S:LЍ/``0 1S<0Q*!!? 0  0@B@- 00 @0 Ѝ@-P` &'@P @0  00@&Ѝp0@-0  Ѝp@- 0MS@$P0` @Px0S@ @P!@Pk #!*@ ЍpdBp@-P@&0P @ 0<Q-@ 1/@&pp@-PM&@P0L` 0 0 @Lk&ЍpG-PM&@P2 0 @+ 000  0- @`@0! 0 J R@@`pXbP0  @ ,&Ѝ@p@-PM^&@P0L`? 0 0 @&Ѝp0@-c 000 Ѝ0@-00 Ѝ@-0c 0 Ѝ@- c 0 Ѝ0c00 c0+c@-`MPp&@P 0 @ 0 @@P0 0@0@0S 0 ٟ00%ЍWe@-,0@31!$ @cp@-P`Mt  @dT0@&0S00P0!@PЍp07@-<P @P@ Ѝ0dBO- ` 0M&J0 S1 0C 0 p %@P 0  @ PTe 0S@  0 9@.%@Ѝ@G- `@ 0p%J0!S B   X%@P 0  @ PP5 0S@  0@ $Ѝ@@-@(e$0S( ( (0$ @4fWd@-@, {0e,0$ @R$$ ((0!fWde0S ( #P QS//@cp@-@pe 0S0\P 0 #0Sp Q R$0Wdeee0@-@ 0 #@eeWd00CS0/@-@P $ 600C0@ e0M, 0S*00Ѝ/ep@-Pp0 0AT 0S P 0SP@p0S00   @eA-p䀟3AT Ie`Pe0S @000vePU PPh.eX0 $3`U3@103 P000 @@cWdeL031S  R R0SQ 0/@cA-`@P 0S00p;#P P 00 U#R#V DdP 0$0 eWde0@-0@M@P d d"0h 0 \ \0  00  ,g $0 Ѝ0WdeBDP:P:Ec1S/p@-P`tdAT`d\@Q p0S `` ```@` $WdeA-p` P0@PP0PpPP$Yd 0 0! AdWdep@-P@`Hd0P 0 1S 01  0S 0 0000p@odWde . + (G-PP0S0C04q0S c"0SB "d00GFd`d3}?@T ;dV @ $` R   R  R R R A 0S  B 00 0003``}?00G?"eWde@c@-P0S003@oѠ@c@-P003@o@cG-`P@# PpW@ Ѐc `!@TW% V@ @00@P Wt]`c0U 0S  3R  P $@030eWd@cee@-K0@-E@cWdp@-00S-@ `P4@P V\ cP#@3`P !0SP C`0S h`R`0t p 1S01  0S00`0U 9`p0 0000m`0DP00#`TЍ@cXdHB,eeeO-@`Pxxxp 0R0S TP1 U ,V ;`_|PP 1`=`P ! P⧑ [P01 X0S "r0S$U V `_`PP1S  EP⁑UQU \0R|Sz ЍL 3S00SV 1P _s_V P VV `P0xH0 0 U P_Mv_PbH0   . b?fH0P"0t p0p! A[0 0000iL[[ !,[[@z[ [Xd,eO-M ` p~D@  `vPȐ`İ@l[[ P LЍ@0 t p0 P! A`Āp[ Xd,eG-M K8<p C`-[ @ P#[`[Wp0ĠȐ t p!R !  R t  At `!R ! 0 R ЍGXd,e7@-@PZ0t p 1S01  0S00P00000[P hr P p qB^0ZL000000ZY Ѝ0Xd,eeBe0S/T  BRT  @-5/@wB@-@P@oC-PZPZ Ѝ@Zx0S 0`oZ0Px00ptp`t0qW P UHZ 01it010qEcXd,eXdp@-P@`[00p@[00/0S S\/ //G-S `@H@ VBQA<`IQpQY/ `P Z,HZ`V `$GJpQ`n` N@PT0À0 (00 `$GQ B @-@P` pG 0  Ѝ0S0S@-l0  C0 $ , 0 P *0YY/@cc H /p@-@0 0P0:0P0<4P`0@ P P  p@ ppOpppH0 /@-@FoYH0  .?bH0 L0 H00 0 O-,@ 0!@L ( MKJP`Pp Y]0FoSVY4V 0S [ YgV 0`Y@ 0 F00 0  O-@2M0L 2Pc0聖,000 m00UP48<40=  , L06   03 00vpP * P RP[P2 PV UG@0@01[D00, 00@0P ^y[y] " Ѝ4 ,0D0PK0S? 00S=  !  ) P UX  X U, 0P0[P0L P P@+ 0&@ P -OY 1PZ- 1y 000 20 @cp@-PP@`e CUX00CX0}U oPYp O-,M\@`ကP`dpP>0 0%!X0ЍS`!y =P@V 0 0W@0/oS" R@X ,Ѝh0100 0SO-P@1H# 娡@-TV@GߍhB@-PGM`p0 ?~@P\0 @P 000 @-TV@GߍpB@-PGM`p0 ~@P@P0@] 000 @t-TV@GߍA-`0 Mp @P'`00 0@PppU0PV0 `F000pP P@p!00~-TV@ ЍhBA-`0 Mp h@P'`00 0@PppU0PV0 `F000pP P@p!00F-TV@ ЍpBG-P M8@P)0 000 @PV0`W0 pG00 0xP P@!00 -TV@ Ѝp@-PBM`0 N}@PP0 @P 0  @-TV@BߍphBp@-PBM`0 ,}@PP0 @P p0 @-TV@BߍppBp@-PBM`0  }@P @P 0@N0 @h -TV@Bߍpp@-P`!0CS@V2Pp0Pp&-00p@-@PJN0 $p@Np@-@P^0PSP 0PU,0%V Z1 S\0<b0P0 A!┸00(0S#0(0C`5DX 408  (0(\*40X803/P  0R \2$0S40S  j"R 0$0S  0R \} 0 V,0"&0:808 01<0D0 000<0000 0 0P $0Se <j<< l0& $0ST P<` 0P0 0l0S8 00l08 Poo 0bp @4\  0P$0S* 00, PYV`` 0U`V <\ ۷00D0 0000000,00P $0S _j0`@00@PS 000 $0 P0<731|0L0S  0PX0 @00`V,0P0U`PY0 `@0$`6d0d 0` X 00 L R  PhI0   %6p1g 0@ X0 kI P YP,T0Vl 0 U,0"&0:H00H 1 0@P 0 0c5qs0 RZrQZ3h0000000 h0PJ  [L0S4 00S ;@X吾T0X00S 40S 0| d0  d / ,01/PVi@0SiC$0S T < V?T001:#H P `VH h 00  B b320S V0# . R HH @ P! @;*"*X S0t00x0*sr0X0 C ᮶40St 3^P0x >0 PS 0%VZh0H 40U 1i0T0tPx`F)0 0, RS00V00S000 q 00 E 00)0 C ch00172P pPpUP0 b7pr QSqQpP S10 8p<00P 00 0坼00X 0##@0 080UDWY 0@ ջ 0  P0ShPع˹Ꮉ 0D0 0p0 cP a 0<!^$0SL3 L00 ;hX hw$0S0`0~ WP)B@c1O-EMD081@ @$0<1(000@10008308L00@1 0H000P0000L00p,0Ĵ0`S P00 0 $AH0  d0SyYAW ,0S 408 03/9hPEߍW5@12 0 SpPP) %h"h`눀X `,0 0g 0p,08P @1 40/0\3/PP 0 0h$0( 0` @1]V` @1 0S 00<0 @0@`D800 0 0ၻPP "$R( 0XP 0@X H0  0S0000 0S 3/H0  P d0SgL0+ gH`@i&gfkWe ,0S 408 03/5$01(00 S0 0<0H0S00@S  @T0jX0ꋀP (`,sgҺg 0`! 0  D1 SD1P P0  S 00(`,S XjṺjt$(0 T0,0X0嬺040 X `X 80` 0S4`080֏8`!P @ x 0(`,0 00p 0 h  01/9v0 )V. h0lS00V#6:`0d030 000x0*V0d000 d[ `x0 A !^d` B[x0x0   5> !tPp k`  R  R"&*QNƠ  ` 0 x1*0`000d `0 0`0`0 \0`0S"X# d (`,0C6`ïf0` x0P 05/P5fU 0xP`0dx0X @0PD0  $0P(0 R \0S  R ᆷ Q ᒷ`40S    <0 0 S l J ᆷ0 S\ 101T0S@` T0S e@c4eP)Bu)B3e@-0 000! Ѝ 0  /A-@0MPb k,0F00 00hЍ1A-@0MPb R,0F00 00OЍ1O-$@ @` pLM 00 0 00 0 0 0AOoBBLЍ06 ?\0e@@e|13100 000 ` 0`pe 0S@]=eQ(T I1 0@  @& (  6, ?(#<@$8 0(@P8 R  ˲T 0@ 0 0{Jᇶ`@cG-@0(MP3 聓0bᦹFa@Ѝ @v 0>T0 0T0A> ቛ0000 0$@ b62< RW1Q00Wrp @0׺(Ѝ@cO-0TMPS@$0 8Q"'  "$ $ # Q $ R0,00S$0S 04 8 TЍO/4 8`#6/P TЍ0S0000C0H#Hc S``V 0 0 00 000000"R 0 0;;020S(00  p a 0Q2! QP#Q0q0Xp a8 QWQS1WqRk+p:d0 @20>00 0  .p0 P(0 S00 ,40ގP1~pp p,00 00pG<010801 1!&ᜑWK8|1 0(0` 000 :#: 000 80 d ,寎XE00000C00 000 0C02DH8 40P)qp% D8 40 ?y#p{00H <e 04 HE|>P)B@cDc3e\:p@-@P<0 9p@_  ? Ra0 ? /0S S S00 /$0@-h0p0)B)B)B___a_`A-`p@ PP @A=: <900   P1 @0<3@0<O-@`MP0S@ Ѝ  @P@A-P` $p@P 0PV @ЍW P  @P@OoBp@- @P`Pp  P ppp@-P`@P@T@Pppp@-`@PP Pppq@- S S 0 00 0 0 XЍ Ѝ@-0@0PQ Ѝ0S S S+ 0 / 0 ///0@-P M 0@P@ 00Ѝ0P/00@-DM000,00(0H0 00@0P<0A$  <0< DЍ0*B/p@-0P@T `&@pp@-P`Ꭿ@P 巻@᥯pA-pP@{`P$ 姻`ᒯV000000 0 0!!!!""""####$$$$|0|0兺 /@-p@ pP`0]X3 0000 0CS 0 Up` 0@Pp 0` ЍC-MPp`04@P  0 $ 01/@!T 00Ѝ   @P  M@P aA-`pP@P  0 劻@T 00Ѝ @P +#@P 70p-/G 0T0/ 0X0/O-`DM@ 00 0 刀匠00 ` =P p  01s$ 0 0p0 13/P 00s0?o`2v0S  PP 0 0 DЍ U! R P PU˰p  P 0 p Wʠ*BG- P0` 00 00CS @0 00 013/ 0p@p Y 00 00S@X0`W  3@P  |q qq 8<q|HLq|q (,0sq 0S S 00 000/0CS///p@-P@0003/Pp 0! p0  0SS00/S0 /p@-0` P 00CS0@003/@P 0 3X00X0 4pp@-0@` 0P3X00CX030p@00/ 0@-0@00CS0@000/9P /0 0000/p@-@P0003/@P 000pp@-@PT` 0R@0003/TP P 000pp@-@P0003/@P 000pp@-@`0P0003/@zpA-@P0圀p` 0S0033X X00CX0l3P|P\ 0  01/@-0 s*BA-$0@@@P0`00Zp.ZY0S 04 0 13/@Z@XB0     0 1/@-ZtB R0R0#3/ 0 / 0 /0S  0S 0@-@@0S  00S  /O-`2 @PpW  z{ Pu  TdPp2@@@-X7@- 0 R R A@ Ѝ0A@ x+Bp@-P0S0@0 0S p@0\03/-Ppp@-@04400 # #$0Ѝ%+B0P 0C S0 04 /, 0 0 0*B0 00'@-@(20S@Q2 x]eep@-P`@T @2P,p@:2 DcTpx]ee00@-MP 09@P "0 ើ0S T $0@0lЍ0P @@-`P @P 0S-@ ǿ@0Ѝp0@-PM@ P@ 0S 00 3叿0@Ѝ0m@cO-`PDM0S S|@] P 0 50n DЍ0S^ 0S1|!3000 02PK4@ TLTHĔi?0?00 ᠄0偋ᦥ0DpQ1! T 0 00 0@O0 0D X !ZZ v000 0 0@ܒP pW 0Z0SX P@chd 5+BO-P|M0S @0S S X TFP 0嘾T   |Ѝ 0S2"3000X0⦽PKl@ TLTH4$0崞D2p@Wp11401(80 `40c 0?<00 0 0S 4;0$D0?H0?,@0 4;00<0 40@0V0 DID0 SH0 $ ?W1!V0T0000,0  0(0@L0!TL`ZT 00 0D S1[!00 T嬎Z[X4(8,k$!.C( ,0A`T000 0@!`FQ@chd E+BO-PTM3吀 00S 0Q Q @P.0Q, Q8@T 00 0000tt@P `B0T0S )P000 A@P   TЍ 0S 0S 0S00 0P@0S2'40[ 20 0 00 :P@ \/ 1@D/T8 @0/Z\ T @ /Z T0S \ȽaP30 !006/PP@ 8<(1#,0"#fP !-L1 0S41  :  宻P@f/ ù@/T`P ,0 0ST00 0SZ0C 000C00S005``PL30 D (06/PB@?@cx]eeT+Bxcd6hd 6d@@- l@P0Ѝp@-`MP  Z@P t0R R3000 0 徼 0@Ѝp3000 0 幻+@cr+BO-P.될؀`BPp/0Su S.0Sk 2311P 0Sc.0 0QQ 0 0.9Z.00C0 J 0S00Z<1.ZPLoD 3R 0 0C*P0S l 3R0 0 4-0PS \w.00Q.Z.00Sd.X.000D0 3啯PPZ  Ѝ,лc@cex]ee}+B+BD D0 4S 40 60CpS//WB0S@-0/@-@ ( @+B;eG-p\`XP."? !@T0@@0 @@@AP0p00 0` l &.TG40 R\ \ @0@0   x]eeG-`Pp -"? !@T-0S0 SR-P Z|--0@V 000S -00@--P$0@踛ex]ep@-`P-0 @T 0@STQTh-pP@T P @^--fP@px]ee00/0@-M@ P PT0@ D0D 30000 P+(⪃%Ѝ0@czd@p@-P@`(-  Q 00C0 0 [- Mx-0Sd0 2?0!0S 4 0 p@?-0 0x]eep@-0@HP,0`0@,0D0'-T6p@2x]e P  800P////p@-d 0@P .0  p/pO-P1S0l*`@PP @T@@}>w0;*}.0d 0P"<[%@ 08P<000@P WY0* [@_ [@_ZYp㠐~@_p W0: 00C@_2 <0# , ! 0Q:;,O-Qkp0H"ᅠ@ ` 0P{2 S n2@`{? n!2@T`0!d!:#@T`0!X!ƒ1# @T.`1 2d Z%0 PP[?T   P ?T )@.0 @(0< ! ЍT`@PT@`P[?T `T`0I 0@:QO::P/G-(p$`P@7Q<0S00$00V (`嘀?`aV $'0#$+4᝺P W8P< * %!  (Ⲻ$0 ᫟ V (00100 @ D@-0@00$00ЉPp@-@P`R/㷟PP` ᗁPp@-@ +0!( :@ <@-0@0!80@*A-P?@ `!tpR* W\00\0  WX00X0%0S`00S 3/050+A-@`PP p*0 +p@-0@pP*'@*Tp@-0PS@p }0x 0000\`*0 $A&ɹ*0@Y Ѝ@&|-B-B0/G-P`t@*U 1P0姹ݧ0SG*0S0p SڬP嬐U˧PP ፹*03/W* Z#Z P &}w00C0Z $00*<*@cp@-@PPpp@p@-@P+*00P 00$00幈卧p@[*O-M00pQ  (@`TB  0 ^ : 0W 3㰰t 0U0Ѝ0 @00D0 0(? 0S<0#T $&B! BT#? `kߍ#T# BT'B2+B B R!t  Ӹp`83T| +16T !7Tz 26T `"T "T " "T !Be'BT%B 'B B T"T BT T d2Tt 7C0CT 0R550`H T @2Tf/ȜE/"p20S.(0 700ٹ`P1 TT *600 0!00 ?5`070E(f 0R88@9S}E/۰@'P` r Y~`(0$0> 0S`: 0٤`P3`'@T W00(T{ ;xT @ Y{dЀwd~d(udd@d@gdmdyd|drdAgdedg~hd G-@P`tp -/!%6000!0 03pP Pt` l}(0S00 3/v0%  (ЍG0 (p(P  Wpt UPT<$',P * 8SЍR 0030#  P0l 0$0 "ǃ Q0* 0 (a -B-B-B-B$.BO-@ᄠ?t`pP Q4'0SU`V` L' Ѝ`0S 0U%0 Y\ 50\0  YX 0X0%0``0$Q 00 001/`P 50 010 8Sr0SU//A-@PMkMG-`pᾬ@ኬ0P ᬵ`PO00k+&01&aɇ#30  ᴨ 0 ᮨ`  0 t& x00Cx00S  . t&ᅵT哵AM 0!400M_&5M~.B.B.BĜeA-@|`8 Pܚ X0 0 1@01?::0 5:1<,Q@p``  0㆚Wp0Gج0A RA-P@᠀0 E+P\`tp&lLdP5MF&٫ Ѵ%9&00/BĜe 0LcG-(pP`,@렐X Ll0P0PP*>:2<.`DpP0 p0PpЍP@-p@-`Pp0S0X0S C\ c0RC <PTP1#p%/Bp@-PeL@DP0Sp@0L0Q 0S @Ĝe*/BO-M`8/BB/BA-(`@,p* P0 p`^p<X1V 7C 0CV 70V2 .$1V 1C37CV0W p01(00ЍA` _{ Э000 T{** K{Ѝ0W p01L00P`0  0S0Cj}d(@zd@d@G-kP$t@P# aV  $00$006$$0p@$T 1S0aᖅG$`P$Fᦳ$0000000 0H0H0$#0p00 "$0T`$00`0[$T00T0$UW;EcA-@[$0S* P0p`Xw0X B 0b03"kP H8 h1728 <x 0ko$($Q凡`$Ag$00A豂ap@-T@P"`0S00k_0Ԅ$0 $&A0>$ᕂp@Cs@-P `ʧ@P@T !Ѝp  @P  U # XX$00C-`p@PP Y#h#@YDl0S/ 0PP Ph## Ѝ 0PU0 p  崑l00l0 W<181P0081<1<18!0@1t#| R T @1S 광t#1` @-@`P 0 0`0 $Ѝp[;W;@-@`Pm(0 060`0 $Ѝp[;W;@-@[b."0d0S 0S 3/bЀ%@-R@` ! UpP! ͨ0 ` 0 B ^\ P 10 6#::00Ѝp~##G-P`ahpt##|@T<#G9#P V>1#/# 啗@1S @p@-`@P& Y_"h" V<1810081<1<18!0S@1  l00CSl0 pp0 1th""pp0O-p, HtH, R 0SS  !ᛪ HZ Y uH PZ)8ἐ0(, /P, P@嘁HU !x0P0Cx00S  . ! p!$DHٕPP$  $4H 0 4QHW!x0 P0Cx00S  . ! E!$Hb@`oت0 SX0000D wɕPt/BW;LcĜe/B/B/BA-@`@GPp吀0T*0QU P ܦᦨP0堨P F(&HU A蜕@ĜeA-0MP00p 00!t0  00 |@T`x00 !Ѝ0SP*  (4w 8⥩000 )w*,  w  (ʤ` @V 00 0@G-PpeG@᠐0U:GT (0aV X P T GD 0P᱓@Ĝe/BG-@pP0G@ T:tG@aV X 0P᎓,nG@T@@۔ĜeA-AQG GᯋP ~PP f F`PPpU :DG ! A  Q  R 00 00 0P S 8+ĜeLc0B=0BB|BМeR;f;0B M;0BԜe`0B<1L0S/0@-@(QM F P   ᰣ P P FЍ0  P R wPU 03/P F P (PLcĜe0B0B0BМe,1BS1BO-M 0P4hpxl`V7 `l`@`p0 0T*  |60008000<0@@$0 00(,800<0 T {@ KVl00Cl0  Ѝ  0=@O-@p04PF܀0U:RFT œ Ѝ0aV! R  ᱦP 0WS;ZY T ԤѤ  WP@>Ĝe{1Bp@-@lqPd偩`0$4SS @pDD$@(P ܤP 0@v.B.BLc 0`( "4`#/O-M h90000 02PPs00  4+40#400$4"4 8#x#<00p4 8 40 80 < 0 0`$4"40#4 0 0$4"4 0#4 0 04 8 4 0 8 00 $4"48#8=S1=#*408#8 S&:3[ W0!<30C(r* 00r!0CR0C Z V @lP0@[' |ЍA 0P4 8 c 40 8 00 $4"40#4 00$4"40#400000$PP 4!404"4074 1 P.PT+TX(X\%\`"`ddhhllppt1tQ00 0rP1 M0rPl1HP1 \P峦!4"4!14"4!14"41 $0$Q 0RP (10 t t  8  t(PP0T8  p?P 0 ,00P6ER1BPM1B1B2B[2BO-Xp@wuM~ X0p`#00 0?PP+0P X听0P P" R R0>uX8΃&  ⅃3, T 00S 3mPu{uߍPX X3 :] ,4L HZ\RPGS W{3 0巣PE}`X P L0 l:0 ,qPP  .0#t Pp 0⇓ n PpX a& 0& X  U0 P70!*" /s +s(0, 0 0S 1!3S$ 6~?.0S S*Q #?0000. [ A00 Z Xr P 6XP.  Q#?0000Q 00 r Xr PhX0 qR 000X0008fPd 2B2B 3B/3Bc3B3B3B4B+5B]5BT0Tp@- 60@q@P P&0S@@D^p̷cA-@Pf/p័<(00`S3 #01 1@ ##:!#0<,8  'q00 !q0 H0<0 0008|0X``00``@k8 l(0 0<0`0,0$0@000(040,0A̷c5BWEVG-1( @"6 0PP 0S00GMz꤀ $0 BR0 08 pRvW00 BR`!`1Pê0W  z'*Ẫ00C0̷cA-` P &0)`幎@P@ |pm UT00T0  UP00P0%0SX0 @DW!P寐@P៽̷ceG-`<1 0cn`V ` 0S 0 =n`P堐̷cr @Dc@-0@ ($.P@̷ceČcB6BtR h0R \0R> 0/D0R-/40R>0/P-/}ft,@{f@|f~fp@-@D P & 0 pRP$ p,0 60S0!L0p@-l` d0 Wm@H0P*0d,Pf  0@FmpDcYd|>Yd0 60S#3//0 R@#0 Q /R0h0//DA0( #&0  R /E/00S/კG-`0 00000P@P< 0 @@@@p кP@TT ,ºY ЍG: T1# ዜ@PW01H ,XP0 rEP @Ѝ@ce4!  \ / : a7Be$0 0!0 00 /@cddd0S  0 00/p@-|0pPd3@1`00 0/(0, 6Q 0/(0, S @@V7p@c@-@0 00R 0(0,000@#p@-P`0@P @ `T`0S $0CS@ R(08 8@@p耝ep@-PU @`00p`h0P;pp7Bp@-@pPP.p@p@-@P`0S$0C @P R8@ (@T( $0DS R @TP/oT" R  R 8 R 8  0 R $Uẹp0ꀝep@-40@SP 43\0,0S S 00 008@Tp`0 6/@ꀝep@-@P` 2ǡ 0P6 #::0t $00000@0`0y|: 0Kp7BA-Pp@3A`1`00 0S60S50S 0S E`'%L#PL Q 50S0 xw050@ceL;@-@BD0S OP$@L@-@50S0500S @A- pPPF9@0(0@P<1``00fx~wP NPPPPPPPPlPlBqt 00 0`S 0 h, ` 0@PЍ茗;e7B7B@-(@,0SS0 DP 0S @ O-\M0Q0 0S 3/\Ѝ G-`1@p31`00vf 0RP[50Sx=w0550INo 멒B R  00 0S#P< 0 0 0 6 P0 0000&6Q  R  R   0 0  pPP #P 0SPU  P P @c 0O-DM!0p`hA0 <0 0,p(`$  @P<_<0 SE 40p0 ,01  00!0 0D0000'>0(` 0$ _<040p0 ,00!0 0O0 0 0(`$ _<040p0 ,00!H0U@ 0  0(`$ @v_DЍ7BcЕ;;;O-QdM@0 | PdЍdЍO^Q0 00000`0 PPPV0/op"/8A " @T@DHX01H0#0TV0Z 3 #W R+   6 4 8 < $ ( ( <0 , 8 0 D@  RH  H ck X ( O?P `J@ GrpT @DPꀝeO-造Mx@P` pU0` ᯝ00l ),1 0(10$10 1H00XZ 1?o2P0SЍ耝e;C-M 0P`` @|p0 P 00 00 0 0@Z?o2P0S  BP Ѝcp@-@Pl@T $@DT\TpP 60S(@0 (0 0KP뀝eK8Bp;A-0pP@TU,`T`1 !@DP08BD0S/0@-0 H) ЍA-@dp`P0S$0C(@@Z R (0S $0CS `PAGꀝe8Bp@-@P T-p\P "@<0@ @Y$ } p耝e7B Ydc(e@-<0DT 0 !0  !@cO-@Mp,@T P0b0@DT/ЍD <0RTSM (₥?0 0 0 J @0\P: U!d000PPPEf#0 0 0 .W  0R H/  0 S" 0S,A0 0 0  P@T @DS00 6P5Hoᨂ0 pQLa :/0X0 gtꀝeMbA-@p `PBM 2SJ@ @(@0 0@S  ⣇02 100 0 0P`9Bߍ(;0@- ! 0 !A-@`XpPU 00`0S 0U0  03/>(ep@-@P0 0 0 0 00 0 00  p@O-Tp4M31`00#212@T  0"0#!"4Ѝ00 030 b`P0S @D R 2x# P1  PT  C\0 : :0 @0S ( <X0000< 3SH0L RP\0307 sR k "Px"P`"PL"P4PPE_o("RQ }:07>>?00A0Q01 0=P00 R 3: _:  P( U 0S40S ޚ81  00000C0( @D0P0*=(  2 š80S 40S 0 @PU 0 0@PP220:00lp\ 7/U P @p03/@c Yd`7BeeeA-P4,a @T @DT@T $@DTA0S 0S@0S&$S008P0(00S pP ZI<᮳080婳00o=(@ꀝe Yd@-0  Q:0 0(0 0QS Q  ] Ѝ >(;00@-AM@0 0 0 0P00! ! 0@ ,=Aߍ0A-P@ `%0H   CR'0C0 0000S  (  ( 0Sp pҙ A9#RH L0S0P  <-CM       rCߍG-P<p@|` PPl00P(P$P,P0$008P$PS( (0 z 0P pGꀝe Ydp@-@,00,0PS0z0,P@8PUp`0 6/PA-80P4@`pnzT  0A/c080/c@-@P 宲P @ 㦲A-PlO@`qTH1x`31`00?50Saq050t30S kVe00000P oP j P eP 00P 0000qPe GBHꀝe@cO-鼪@,M3p1P`0050Sxq050`V `:W 42CW >0W >C 0CW H,ЍO48(0 S008(0 Sz007W 0Wp0S 00`7W:> W`0S  `d7W  ;CW0CW5C 7C0C07WC H,ЍO6W^ 97W >C0CW1`ܖ W 6W)`VfX# "0 W0@P0P|&0`W`ppxPVV N$6W! 17W 6W000 RV 5pW $pGW`5W 000S0Sp%0 R01 5:S 000` XX  Ḱ `7P ᰰP `~00mNVfG0S4 R6`P0400 R0S 0 S `00  0J  8`i 0 R(pW $pG`Ps0S R0P :WS R (PU $PEU`4p000PW l P040 2 0 B R`-0 E0 0A0CS…R'X1 ]`P,0(S(0SP P`` 7`, 0S S 4000(pY1X*,1`i{@?P 01 1_{ P 0S 0 00( , 0 !(00,00|060y000u8000S080n<00S<0g0@0d@0C 0D0@cwt@HpB@~B f@pBEcEczBe YdoB@|B@oB@l7B7BfB@{B@}f|fvtgBBfBwBc8B@B/P/@- 0`( "4`# Ѝ0M0000# Ѝ/QP/Q02 //00@-0^PN^000@A\" \ @@T00 ^< ^  800000 00 000\ @-L\ 0 AS/P 0000S000/AP/G-Q@1 P`@A0pS S0P@S S S @S S 0SYS 0SQ$0PUp(0S 3/XPc@-5p@-@PPp0S00P00C04@-@("b p@-Ph@U1 01  hp@^C-M 0`p` @嚑P 0Q 00  00P 0@ 0 NoP@@T0SЍ060iG-p 0P`M !` @aP0 Xi0 000000@PmN?o2P0SЍ;@-@z0(㥪@ @-@Kn0@t0/0(P/0S -  0/(e@-<0DT 0 !0  !@c//0@- !q 0 !p@-P@p@p@-A`50S 6PU 4 R040`0,p@/2S 0C8C8_o2RU0hYdEcA-P `G_|<0@TA00S p3/qX@cp@-@P`03/,`D 0S 08 000 0S0(Dhp@9BEcG-@d`@0  +PP0 0" P00@Jp@{1@DUT@o0S  000j@G@SUQXl =$X 80S  3/XX 80S  3/XYdcA-@P(p`0*R'7PG30 0 0 aUh宰004 0  004  @0D 0 @0D h屰3 000SP0PP0P0A-P`p倰@T  R    B 冰Tp03/@-K ݸ0 4;9BDc ;C-`M @0 @0p 5P;00߀h ?0l 0q@0GD i 80 v ЍC\0e@Yd9BYdPA;P;dc0-DM000,00(0P0 0H0000<0$ <0< PDЍh;:B㳨㲨@-0   Ѝ:BO-|0DM S4|00^@S40p0d(00,p$  `<0MPP` 8440S I<0S/ 8n` pg Xg0@a 0pc(00,p$  `<0PP TMx0L#LLcSSD3x00000@000S ~_S #S1!~_O@oPDЍO  0!<0$   ,(pOP 0!.00<0$   ,(pOP|0 00!<30 $ 0,(p80OPg0 00!700'>< $ 0,(p80OPQ0 00!0>`0,(p$ `80< OP? ; 0!<0$   ,(pyOPg 0!p00<0 ,(p$  gO0PU    '.y` ,(p$0 @ 0`< QOPB >P1S ~?S?11~oS1O@oaN4;;$:B/:Bc4;h:B;@Yd0eh;@ed;O-LM@c ^`d` P@|< j t~ 0@Da<00,(@$  `D0NP <:LЍ 0!<0$ 0D0   ,(NP 0!00D0$    ,(NP 0!L0>`0P,($ P @0D NP l;;$:B/:B<;@-@PU< 匮 ;@ ߦ;p@-@PR` Q    0p@P   RP PP  )=0 <0x 8RR00R0S 0S/ 2=h;;A-`pS 㕦PTP@ p ;0V`` B; ;p@-@Pap0p@/A-M`n0P@Txp~ODЍA 4-WP AAT ~ODT0eYd@-@X0l0T0p0P0t0L0x0H0|0D00@000S40000000@h;p;t;;x;;;;;l 0@o/h;A-@`pBTD@D A70HP0UDPES/7/@T@-@400( R @@0000@0edc@-@00$S   00C0@0e@-`pP@MPVP@ЍT@UP\0pWU  X0S   -@PpPE`?@0edc0L ~YdO-0M05p  t3PP,G 0 X`0@"40f300  \3 w$0(0`0`Ѝ;0@-@m0Pm@5,/0p@- 0 `   H0D0R@U DPU ?D02DPSH H0 lR0p@ĔPH0S D0SH0D0H0D`SH H0 lH`0 Q  ! H0SD  D0H 0D00H0Qp@-@ P 00`VpP000p@7@-0@S MPP0r00 Ѝ0p@-@`P5 0 503Upp@0[0 L Yd0S/ L YdA-M@`P>p0?P00GPBT D@DT>ЍA -PH@@-3M@03XRp`RU DPEU1PPj70PUЍ'i`HP0S00P00C0(.,0S 3/XPcG-VM@V/ vpN }?8c +$3"02Q  ! R! 0S Q050 b,Q b8䁄刀 2S i9  0 2ZdRU DPEU RU& DU# 0ZHP %0 RS ܻ R H0 3/0,P0 8P-&U$1PU"   "8_)P Q 01x!Vߍ40S 01Q 403/0SXP0S    H03/,Yd@Yddc0e:B;c0L YdA-00S P`~CW l0SB 1S @0 R H@T D@DT%P 3 P 0S %P~C0eh;p@-@`)P@P HEpA-0PU `p~_EU l0SQU@3B T D@DT 0 0R H@Q u%P~_E0eh;p@-@`P@P  pG-pW0S !S* 1S l QP0PU ~oEPVl0 SB aV ~oF ,  H@T D@DT 0SP 0 S:UP8.Pdch;0ep@-@`፾P@P ᩾p@-@P\P@p@-@`rP@P ᎾpP/D@P/00S/HA-@p`VP@P tqA-`P$V00l P0S/PD@@T0S0S $P Q $P  0S*p0  H@TD@Dh;A-@p`P@P $!P/@-(0pMPL0`  @P $(0, SS  3/Ѝ;p@-@P}  R80S U U U00 p@00R  0000h0Yd A-`p!P40@TA.80S 3/X@cA-pP@H卽W` 40 p0H0(0B A袽#P H@T D@DT02S D0CS   QH0L0S V$0e@-@@A@-@@8|0/0/0/0S/  )Yd0 R0/dc@-Pl 0Rh;C-0`M `00Q@S 0`8`0}?`>CaaUq h&aab н@bT!0 * 40!` 0$10V!0 $0 p䐟00S0 SW 强pP0Q:0PSep`W !Hz`2$AЍ0dcYd:B@Yd0e:B@-@n1@0A- P @0L ^U 0S |0`@Tpp~OD᛼ 0S0@A;l0S ⸅P AT ~ODT0eh;p@-@`XP#@P 0 &qpYd@-Q@MP@`YpPP@ \ V  @LЍ0<S %0! @@0A- P` @0L ^U 0S 0p@T㈀~OD& 0S0@AAT ~ODT l0S <P0 ⼼0eh;YdO-`0M#0|8@QX 6^0Qpu TXP  03/NZeXP   03/NZUWP  03/0S  P7 `2@P@pWP  0# 3/00880R 3/`Q`31H0@0< !N D!0/H0L 2m0/QP @0D P @%qP 0?S@ Ѝ@/$S``iui vi iiiO-hq@Q`PEM L1Q-YU40 00 0`0P Eߍ7X P  0R >ҷBT1 2BPV14  41D@DT 0Q H@i iQ;BC-qM@`P)  03/PNU# 0S  * &Pp@0S   m  0SЍD2PpP  @cx0/p@-`Q@P R 0 0 0 %47p000SP0PP00p*R 7P%0 0 0 U `0SP0PP0P0p@-^ 0p@/RP@  p@ PpiXi3 4 RA0ACo//1S /p@-3tP@ !P`M 0# R3  $mR  PU3P%SЍpRip@-Q@$P U0$0 p0ES$0ʰP$Ppp@-@PjPp0@-@0M0S0坴@P  WЍ0ϖo{;Bp@-Ph@ס1 01  hp@@-p0$M03`A0AS P R R R1  %/@ <$MRY R @ 000 S( )04 0 #RH L0S0P  $ 0 001   01^000000000 0 00000 005@P #T@$Ѝ3  '0P0C@0@ 001 0 S#0 ☀< 04"48#80CS=10 001   \110000000081000 00@P @j0 ~ 0H   C Rw0C0000P( 0 (00(00   J0T0 0 ?0 @P| Qx 4@u2@7@;B33@-3A0@S AS S ;<2@S 3/4P@.O-Q,M0 #21 2@P0 40S 000 " !",Ѝ0S22 20F`H2Y H+<YRpUHp0 0pW0\90PPY00 00  pP0@cp@-P`@Tp P څP @A-0PXMP- 00 0XЍA/`@p p1#`1014"410 0CH00UL 800(080@`, 0 0 0 03/XЍ(e@-@MpPx`|0 00`~|P 0 M~PЍ0 "C~@o;B\00@-:PL@0 R 00 C0.APAAꫪWA Xep@-PQ@M 0 O040060000 $0T l00p0 200P000 %U 0 000#Q0PR,R02}p0LRlP0HP` (06/0  _ DЍp耖;B\<< <(e 0 0a,( P @< ;DЍ|FBXe;B QP PPx00Cx0x0PS L0S 3/H03/p0Cx0A-`pP 03/@T3@ @x0 8/@T x00x0A-@pa@TAl0S @ 0QU`0S꬀IgP`xeheG-\@P`p6@TG00S0 $9/@xehep@-PLJ@PE0  R 80<000@0,0$0(080$0H0p 0%<%,@@c 00S 0 0C0 0/@c@-@ \ 0 `0 0@- Ѝp@- 0@SP 0SP 3/P 0S pA-P`p@0 p`000@@AA-pP`@V@D`A-@`P lpPP+` `ѥ `PPp㸍Pc PP` 00PPP ApP(叧 pUA㖍=B=BRPG-@  Q R"pS`F #B'BS 0PS ' P  0S 4PU0 S` 1 VP  0S P< P7 0PP `S + 0S 0S?  0S000000000S 3/p0S, 0S,  PU UP  X 0S $?o W20SP P p p0p UQ 08i(p@-@P` xPps@-`@P`Ѝz0S u  "U R `Q  `  000P @0T00  夌Ѝp@-@ 0S 0 00l0 S@- T2S@# @ T00^02 =B=BG-HbHHBTDrUʀ 0 ! $ 0  .!0Sa $ $  (0,0 (0, 0040 004 80<0 80< $@0D0 @0D (,H0L0 H0L 04P0T0 P0T 8o\࠳ࠣSp^ 0(0Xp\`8P|p @0X@\`80T`!C`@400o @$ @`ypeEBEc(EUP0S00p@r!P~#dP A0P !8HPo# ! !@cTFB@-H@0S <F0 @T@, P@Yd|S4  0 :  <08 ,p$` `4,40AP 0@00 ,p($` `P<08 #,DЍ4FBU<@^"0000( $ #0 0G-@P`p-  0 0 R:00Y' 0A P! 0` `0S: 0  000 @ ``0 A@G-r@`0T@PR{ T @(@ЍU Eg Dg0Y`* sR `FU T`T BT` 0 ` @  @oP@0@P  0 0T g0  `0pS`P  @U *PQ pI Q`FBo B10P0 00 00TPÏʁecFBFBp@-@Q`P 0 g0P @pnPTp0SpPO-P0M`Q@0  HpP ` @Ѝp0 0@S 0/ Q V Q P  P P [ T7@   P QPP0 0000@ 0V `0 0 000 00pS/PUP 0S$0S# RP0S000  P0SP0S 0 SQPPUV~ 0S{ p0S00R0SpPUff0 S0 0 TVV 00 0PO P4PpPFBA-P@k`P p   BmP TO  mP@ 0@@T  RQ 0S  : T4 R1 R; 0P\d T0WP0S#0 `P0 Q``(0`,0` 00 0#00#0@写Q 候  BR  \R\Qi 0 Sl!0 SDT 0S0S0 0 S0Q00 R Q RSR 00Q `U P0P0 RPPQ AQ  0 %GBIGBeGBrGB0A-`pP0S k@PT 0 P 0 @6/P A-`p@0S KP@U 0 @ 0 P6/P <00S/p@-P@ 0P@  pecA-@`pp  R( `0PX 0 0`0d0(0 0 0P0000 0ei0UpW01X㾁V 000 W"010 <(0SK`JAUpXp㾁@cJBcIBe\ P/0 !8 0 0 (  , !/@cdddO-QM`p @tЍO\h^e崕t00px0\00`00d00ch0 0l0\PUU27[x@6T6tP6 ot0xt@p0 ER 5034 | 0?A43!"4@00T1 ~OD0T+ U `0S   0S \rP@0S T @\ [P\`PP&U`0S "Se2Sb DS` 4G ي0 0 |0,00\0Pl0吰S8 x[5 h0S2U U UD XPE D ,0| \;/ [ N[20S 2 030,H|0 0 lPl0 0l0j0Z DJZᆊ0000\4ATd ~OD`HbP8 R  Q^ H$0d$0`0U00000>000 \0|tP%l0S" x0S h R " ,  4  |  R㸰 R԰0 lx$ %Pl0$ 0l0H$ ,[$0 4P  0| \3/ HxT pmd h00 R l  BR 3 Ѝ , ?A1c0cIB@c@eKpO-`9@PA pP: p( 0  pU Em?p1GS ! R``B``00Q  FL0Pp W(0S0P0 Ѝ@JB@-P@`pM4 3?  /?2 0!0 qЍA-@PP`@pD0W H0L P0 H0L A0 `0<0SP@0P8P0\03@P8 1@P`0PpH0x0AP 0 T Ѝ蠍c@c000S/0@-@PM4 > 8>2 43H@0=08 1SS0SЍ 0C#^10SY0CS!23 U !5% !D!C a P  03/`0 D`0@00800L01H0>2040 0,00131`000S0 S000 0 ,zP 0, V W 0`x 8000`400`=d03` ,1`0p02640h00x0x0FcFcc!@NJB@c@c0@- 0G Ѝ@-A Ѝ0@-  : Ѝ@000S/-0 00 TP H0SL0S 0 R00G0S  $4 $0<Ѝ0` 4TdKBp@-`@Pf@THp@0U@w$ U%Hfp@. eep@- PS`@(M 0S0 @^T!>0000!>0000P @ 0$0e(ЍpTd@-@0S00 e@-0  @0X0S x( 0 1ЍꔎcKB 0 0 C-0PM Z 0!S1000Ѝ蠁\ R00ЍC 03 HeTq@`VT4 + 0!S10<000U`T HЍCe  $P\0`` 0 0``0`@X0 @S p ` D `0pe~ l806J 0( $ЍCLBKBc eeEcp<@-@MsPU 0   0"S2000~`# R   0LS@20 0rA0Q 2X0S  0 0:a~W`vV 2$H]e Ѝ R% 03aA0AS   00  0Rk`I0$! $ R&000X0S p ` W`0 pf ~000 0S0 0 00RT0X0S p ` 1(`0 p}eLBKBLBcEcp00 @ @$1 03/@4ЍpO-`0Mأp P@P 6 6S 5 J@Ѝ3 T V@1T2$1 0@4/@X T060@Qk0 0 0 \k@^'P0!  |@꬀]P  t$1 03/@T,@ 0 8ЍO eMBMBMBO-M0( P0`pW08 ⶀ0#PP8 Lxj`0d 0 `0d k}0N@P 3!  ~;$ x G P @P(Z Y! 50R% {j@0D 0 @0D j `m5 0 ` $|U Lv pQ Q Up L pP4pP LR OW ,ZfjX0\ 0 X0\ qj5 PPYTjh0l 0 h0l _j ``0 {P4(4ᘙ8က#80 0Sld4jP0T 0 P0T ?j$Z ,9&jH L9 H L0j\0US 0S SZ00 ) 0& PP U OP40" P` P ( U`  0 0]`0C  `(0m{ 000 0Sip0t 0 p0t i\0S `00 +h0` A{$0S1 Sb Wi(0, 0 (0, iVȠ̐ 0   `(0!{G PZ6 \0`S(0ʤZ5 0S ZS!.(000 0 PP$1 0P5/PY U06 00 5 NP 00 ⹵6ဥ儵 7ix0| 0 x0| BiP0S  ` L`0z0  jPPl@00S i0 0 0 iT0S `` @0 000`0zh0 0 0 iL0S  ` 0T` xz5 8H&0060[6 [㸶US Y !>00 0@0 iPYD !>T00删匠0PTTSMh ?  0hh 0 0)h 0Y0SZ06oᩒ0S&2 0S6`Rsh 0$ 0 0$ ~h$QP0!P  G0 0GL@ G $G<0004 Q0P<<00000(00,018/h0 0 00 00 4h 0F8╿Ѝ[!>0刀匀P$1 03/X 6ᬠ  Y  QG MG <00000Z7LĻP0 e(dMBMBc[NB(NBNBNBNBNB-OB`OBG-aqQ6@PGn0mzg0 0 0 g0Sa@PA e|0P 40 ᐐIoᩒ S)||Y g80< 0 80< o|gX0\ 0 X0\ g 00S+@P  4"4X ;C ROdg@0D @0 @0D ng4308P倢@0 0@P0yL <\P< \`P8`VMyU 0bh@Su Yr  $09/ zЍ 0 X/ R 000h  $bz0S<L0 y $09/zyY  $bzY U hZz $tz @P 0S 0 X/ Rh  $,zwy $0:/JyZ  $2z`Z U h)z $Cz @P  z (eZdO-$M pp@P0 `nP 0倐hS [  $0;/@ y$Ѝ y @ @ZdO- qdV Q ʀ !  , !p0\@p  /00  0唀0 0$ hy R h$@ !d1000  ! Ѝ@cdddZdG-P`U U9 $0pp\@ \0Ud0 P  C C$0h(P 0(0$0 00T0?y 0< ~T`00`00<p(eZd0SjO-0S,M"PPP@1 P t10S T, 0 0S0U0S5xp4`VSx &,Ѝ`` 0 vP 0h yL0S" 0 S S Rh0  0x 0S  0R x 0 p$07/wp hx`/#@ZdA-d0Pxq@M0D 0S S2T1pH1p(@< $U`F00< <0@PPĀwhx[p[@Ѝ`0< 0C`00(~<0S `U0P@S  0 h@ewxZd(ep@-H,DP@`L@T403L0$.o@P [p[dZd@c[d@- @@0DL0o@@JZd0L03@o/Zd@c0 0 0 /@-@ C[O-p 0M !P``  @AP0宇 0\ Dc0 000000@P?o2P0SЍP=O-,`tWʀ 0! $!0     !3b@ȐPU0 P 00 0 0 p@g?o2P0S 0 S$  Q0ЍPe8De 0O-DM(0 0Pp b!0 ,p0800P$  @G80 <00!00<0 (p,P$  3 0'!|1"< (p0 0 ,P$  0!80 (p,P$   .0 0 0!08N` (p`0 0,P$ `(pp'㌠ 0 8 a,P$   0',0 0 a0P($  DЍRBh=@- R0R0 *0R \ \ 00S `\ \ \00SL00S0 80Q L\00SRBPe R0 Rp@-0@P*0 R :P@D T00SpT H0P \0P0 SpSp(00S0 00SRBPe 0 /Pep@-|P xS?fp@ lk9f \4f L /f <*f (%fpRB=Pe=,==x==@-0@=f;f 9f7f5f@2fPeP@- P0@ P@ dd 0 \ 0F@P DCnЍ0"G@P 6nPe = SBSBTB@- B 0RS d00S Q PQ @dP4 0,GPЍpelTB@-B B  \03< x00S @dPX 0GPЍ$00S ~do@pelTB 0O-RDM(0"0p`008 000p ,`$  @x80<<0)000 00,p(`$  d 0!'>P ZK$Zn ZJP & ZDP Z` ZZZ ZZ >P Z($ZK Z'P ZC ZC x>P Z$Z3 ZZ- Z PZ% Z% >P Z#Z ZPx & ZPr  ZPlZ Z >P` Z#Z ZPU & ZPO Z ZPG Z Z ^>P; Z#Z Z N>P+ Z#Z ZlZ Zd 9>P Z#Z ZP & ZP  Z >P Zk#Z ZZ Z  >P ZV#Zy ZyZs Z!Zm Zm @=P DjBTjBdjBtjBjBjBjBjBjBjBjBjBkB P0C /-P, 0C A-Q`@PHM 0 6/|0 p10 0䀟2pC0DPTQ 0#HЍ0H  #QHBFpBGBH  CHpN_R.0#HQ 0@ T6/  00\H0 00A00A 6/kBWA(kBP/Q //  00  00  00  00$  (00,  0004  80<0/@-@ P@P @ "G-@MPXp @p P` 0@DS @Ѝ@`P@ WpO-0Pp@<4U 0 i I3il8` Q`+ ZU0D0 ЍIP\80S   ZU@DDAD@P U@IyU@DDAD@C-\MpT@T @DT00\Ѝ``KPP@OP000//o/00//p@-@M P@ `@]O@T@@O@T*@Ѝp@-@M@@`PpeP(00 0 Ѝ@-S 000ЍG-@XMp@@pPB`@@@DT00TXЍ P@ AOPPU @D@-PЍC-\MPP@gကTQ  X01H0 RX \Ѝ !W Q A  0CC10S 0 Y 1 R  Q*10X @-p\M`pp`Px@TQT0# X01H0 RT \Ѝp !t R Q A  0CC10S1 01:qW 1 R  Q* 1<0T O-P\M`P`pሐT@T   X01H0PP PQ Q\ЍYT D PP0CC10S @ 0 P 1PP T*10@Y O-`\Mp`pP=T@TU@ 0)   X01H0`P `a Q\ЍUT D ``0CC10S @1 01:P 1`P T*`1<0@U @-@@PЍp@-@XM``hP0SXЍp  0Cp@-XM@@Ph`00P@XЍp?#? 00 0gPEU/QO-R@M2 `ᡰ@[N00<0唆+00 0<  BS 0 KSP`F0V6*0PS㔃'!F<0pG   RVKЍ蓄% 8 09/P0P0'8 09/P0 Up0V* p꓄' 8 09/P 0p0% PEWP8 <9/PpG0 Q /@-0s Ѝ9= 0 R/R 0+kB0R/@-0CA @R A@BT R LP^- @A0@S0 AC^ 0 S LPR/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ P//8@-@P//8R0* \ A/Q :@/Q* @-0@-Q K @\@ ,0CS @PUT S @CP U\0^ PL_UQ@A,à0@ 0@ 0@ 0CSQ S`0\\QPAQ00@0000 0@0 ! 0#2 /UUUU3333 @-Y// 0SAS/0-$(0@# A  A A A0/p@-@P` VPpR00!/ B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/\ S?/\S?- ^ S@-d0o @-@oQPO-(p@@@, P`T @E.`VPW:/@P WRQp@-@@P@T@ P`Q@".PPPpQPp@-``` P@.@T`PpQPA-`` p@P.W PU`@@@-0 0(0000 0P 0@Ѝ8E=@-0 0(0000 0P 0@ЍLE=@-$0000 0vP Ѝ8E=O-`pP-  pJ@P W  1 0W aJ@Q @-HR @P,30 B 0#01,#  PE la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., la Ƞ . ` ̌ . , ,la,,Ġ .`̌  ., Ƞ ľ a . `.. .. .l. a  ,U @k0@P`TF  00 0S !,! @D ...|.q!!,/LkB0A-@R0@P0`?S + S# *S, R& M[S0^\PP^4 ]^F S -^>pQ[W; 0]S8 S030#W0PR'&R' `0Sp0 R0 P P P p`0SW pЍ0B?o2^Lo  Sp@-@ "P P 0#<# "PQ Q Q &" p`04`@N8<#<# "^@E00("0$"00#[@-@!  i/Ѝ@-@P $a/@ ( 0"PBO-@0$M(`00p 00P0$00D2 0@00  =/ $b8"#4b4# 0  0%e#","0    "0 '0&f!"f+"! 0YR  @Pl.  .ɠ,),  ! b..  & Ơc, .c,   00000 00 00 000000000 00$ЍppP`wpP` 0pBBA-`P@. $QY ?PU(p8 0 8S($)8 c8 `.7XPP0Q`pDa(!"$a$"  .0Uh ЍA@S )@ c8 7 )0(0G-PR2 p@q?p` @g(U: P. 0$ 0 @PE 0$ (P`p(,?XG? %3PUF  (1. 0$ Q0 0$  0$ @H< 0$ @ .  0$ @H< 0$ ?XG @-Z@-@P $.@ ( 0"pB@- @-@@-@P @ (- P 0$$萌B0O-P \M@000 0Pv00 8`$000 : }#R?0V FAo#E@P7@-@P * !? 7R8 bx b8   X  Ѝ0@ꔏB0`( a!"$,a c"/G-P`8 p#T0.@``T%0  Z0DD 6ੑ  cZ&1000DDD0DpW@@@%Te-M Ѝp@-@ P` !LNC! !@ApA-PP@#*p `P @  S@P 0@PWP )P )P UP@@-MP@@@`@pT:Ѝ Pp0P00 GꈛBB`c00yara0tcid 0 c 0 cyara 0 ctcid\ 0/\ 0/yara\ 0/tcid0S 0 }/ c0S 0 r/ cyara0S 0 f/ ctcid@-0p3A1+`P @ 0*.P 0 @PP @P0(v Ѝ@c /p@-@P0)0PPptcidp@-@ P$) 0Ppploob@-@@ @-@@ @-@@ @-@@1 @-@@H @-@@T @-@@O @-@@J @-@@E @-@@@ @-@@; @-@@L @-@@] @-@@k @-@@y @-@@ @-@@ @-@@~ @-@@y @-@@t p@-@P((0P pP pgntsp@-@`pP(@0P pP TpatadA-pXPq(X0P `@P  P @ᑎgntsp@-@RP aP'pp@-@P p@p@-@P  p@???p@-@P  p@000p@-@P p@p@-@P p@p@-@P  p@p@-@P p@0!P/ԏB@-ZZ@@P\DTPP= P! P; P\ÀP0 P P\(:%P0P0 P0P 0 P@\0 0 P@ :\0:`0` SP $0 S 57$00$0/@-@$ P *  LRP$00$0Ѝ  00@-S@ @$0,,0<000p@-PQp, @Rp$0( 0CQp>$ (0$  BR00C#$0$0,0(0!PpG-@P8MeY@ , `0a0000P ST ST S40 0 YP^`P@pWY FWl g:W =W *W # n@Q ( $00CQ*A$ #_ \$0,0(0W $0SR00#  C R00  R00  CT$@8ЍL3H3 S R 0C# M0   Q S@0S00S > @ @@0 SbW' fW ?R0@SfWQ ` b6b` B@S8a8  C# c,1 c0 0 FW'Pf0?Sp Rm  P  c5S CP2QPU 0  PU H  0  Y=  0 fP0U08  0R4 XS+=W 0  Q  @U 0S Y 0 P  @0  0S @ s $0S,R$00#  C%#jo%ju%#jx00@-MB0@Ѝ0/p@-@P` Pp-@-@`P P@ Ѝ/p@-@P EPp-@-@`P P@ Ѝ/A-@`Pp P-@-@`P wP@ Ѝ/00/c0-P@  P 0S RP0/P*0    PP0/0/0R/ \/S/O-0KM0 0000000 00$0 0(0$0,0(000,040008040<080@0<0D0@0H0D0L0H0P0L0T0P0X0T0\0X0`0\0d0`0h0d0l0h0p0l0t0p0x0t0|0x00|00000000000000000000000000000000000000;0 800" <`!40" @0," Dp" HP"$ L@"( P"T,  "X`&\0#`+d*h(lp'pP%t@$x)| "`&0#+*(p'P%@$) "`&0#0+0*劰᣿(p'P%@$) "+ .0. 1 0+ό$10,000! 00 !όበ,ࢯ0 / "p0?0#`@P%p`$ @ (@$p@Op@X@`.\@q@+~AN\@@@Xp`,D@s@!$}C&M@``@pdp`$ @@$u${E&K@@p`,@w@!xGH@@p`(@z@"uJED@ @@p`($@~@"$rN&Bd@0@`p`.4@&~@+r$NB@`@p`$ @p@$yvIF@H@p`(L@t@"{DK@`@pp`$ @@$q$A&OA@`q@%`#w&yg$i(@%,@剭@#ढMB@@尠.@婫@+KD@@Ƞ(@)@"$D L@@%@ @#$D)Lဠ@p@(t@刜 "h@墓,#,l@娪@!JE A@,@(@!$AOA@@.+.$x@%|@媼@#LCA@,@嬡!P8@ P%T 0##:%6,

0BP/0 SP0//BC-@P ЍPo0 RQY0 p 0p]`P 0H S00Q J p`PeBBC-@P Ѝ0Y0 p 0`.PP 0S00, pJ `PP:B'B0P -?o42 ^0S0 SE /BP/0, S@-P0o/BP ?oH 2\0S 0SP00Q|/BBfP 0 SP0m/Bf@-(0pSM c`@V `0P ⱅPP 00 0P S ῅Ѝ`0S 0 "R00   6P,BP 0 0#/-0 S RS R RP/$0S @-5@Yceԫ=哏긦e@- 0@a(M 0l`S A  I H! P(ЍЀ`, P < QB`BXBp@- @P!,@p踦e @-06踦epB 00 S  \: P03#/S  \ P0///p@-P0S 5ݎ@P g:>@P tVTƎLPP P40?@p$@cԫ=eeЦeB@-0 0 0Ѝ@-00 00 0Ѝ@-@P 0R@耒B /P/ 0R" 0 !SR* R0*/-0  ^: P*0  S */@/ //@ 䀒BP 0R//ဒBP 0R//ဒB0P L P ! R0* /0 \0://ဒB0P L P !  R0* /ɒ0\0://ဒB0P \ P  !R0 * /-!0 ^0# %/ဒB0P \ P  !R0 * /-!0 ^0# %/ဒBP/ 00R!  S //ဒB0P D P  !  R0* / R0://ဒB0P D P  ! R0* /R0://ဒB0P 8 P  !\0/1 //ဒB0P 8 P  !\0/1 //ဒB0P < P   ! /!S //ဒB0P -?o42 ^0S0 Sp/ဒBP/@\   JQ\//ဒBP/D\  Q/S/Q\//ဒB@-@pMPW ` `0S$(0S!0+ C 00 0S0xSW  000000SЍ  pPꠒB0BR"SO- HP`0@ pD TWpp-T@p` +T@`00T 00XS0 A B0C QR@`9U70T PPſ 0  000D ^aD\WDAD\7D U0S0:0QP00\00S 0!0@P0 pY ЍY S FB0BR"SO-@ ` {H0P pE UWpp-UPp` +UP`00U 00XS0 A B0C QRP`>T<0U @@gĿ! 0GbW R B b 00E Xa0ESW0EA0ES.70ET+W PP/Q PPPSPPU&P!U P@\PQ PPPSPPUP! 0S ZF0 Ѝ0SݒBH-M 0ЍH-M 0ЍA-`p@P0 8#@T0P@7@-_/"Ϡ R# O,!0 P W P! Ѝ00  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/A-Q@Pp`S0V @P0RDWPV @ G @g@OoV @d 5Do/oAQV@@a P4B<@ XP^\0O RV0P@W(0B V00 X 0h0?o c0B0C5R?oo@pP!  R b42<P0@b4P^><?o/o0CS 0P 0b0<SÀ0 0S/-S0-S0>S/@-0\S0uS0:A@LT#87La@LTWL0L@ T 08P#80 (0 0C0S/13/p@-M@-P PPP$PPP(P0fSa "S6 [S0 +0C0S=!239 1tS2 {S1S.  P3/P0 0 P0 `PO PU# 0S P@1000"S0(010rS ``0 PP ލp0uS0eS0 00(0 00aS0lS0sS0eS0  0P`5/0 0`0 6/Po 00T==@=,=,=Q@- o/@-IM@pP`V P0P P Iߍ 0P  PP 0P5/0 p3/P0 0 p0 sP ` 0 0P0 5/P 00BA-`Q@Pp pEoᨂ0<S 0S !S0-S -R00S00P/S=PEU0SP ,P 0B0S^300/R>R '0HV0 S @P0/S0(0U0(00>S0>S000 0$0PR0S 0S   0A0S0^30=Q00SB0"S0S 0 ~ "Q  @$ 0>SuQpQmO-0pS` 0@P0S "S \S0@0 uP mP bP /P \P "P }H3n@PfP 0000@ 0V WPU  0 0 0 P ;8#8 S:0Z Z 0͕l S P 8#8 S6J 5# ## < ,!  0  S*-"-0 #S * 0 ##:.10> #> 00 YPX@ Ѝ0S <S8 &S@ aQmQ!pQl;Qi@V Wd0 lQ"0tS\0;SY<0@0tSS0;SP>0@pQK0oSH0sSE0;SB'0@Y gQ qQ80uS50oS20tS/0;S,"0@BA-`[pWR SSS P PPP|}y}P(0SP 0p P V` P PP   PjByBdB~BB{ RC/A 0\R#R! R/Ao/0 P R   //p@-`P  }PP@pPHj6@P <ʭ0 P`000U  }eB(갨e$0S @--@݆$ce=@- @ ̆  eؓBieG-@pP`VU@ 0@焑QPU@ `F¦`@-@ϭ@̭p@-P@@nwPpp@-@P X0R@|PP@p,00$00 0@00 0긓B== B0 0C0s@-@P 0U S ~|1ld7Ѝp1PP`P 0 0<PP0 0C0PPeA-p `P8|@P V  !V @pF|C-P0pS`@M>0}S "S -|00Ѝ000"S 00  0KP 00S80"S0:S@@0 P  P 0 (P ,0S{0h P ,0S(0S  ,bP \P=BBp@-@P `\0 R@VPp PPPV @p⺬긓BO-0bPS00@0T0S᦬ ЍO SP@ᘬ Ѝ<P pP 0IF0 03008P  00C 0P W@U R\ Q ` V t` P 0SP 0 03/P  0R#P P BBB0,S<S6Ȩeee@-@ 质ep@-P@P㼫 0 0 0p@ G-@P 0R@ pᥫPP`@ 0冡ᆁ!O M 0冁 0` 00V:000긓B0P 00R@-0P   0/ḓBp@-@Pl000p@輫p@-@P ,0R@PY@孫p踓Bp@-@P L0R@P`F0S@#*+@ᓫp踓Bp@-@P3@ᅫpA-@P x0R|Pp0S `nVP 09`P p긓Bp@-@P @0R@ P` v@Jp踓B P /o00"\ R\0\`/ḓBO-@Pi pl2 R0ͪ  .PP @p~@L0S !* PP l0Q=P8a/ h P,U<UU p'3P` `B k 8P屃 ,PP ;P߃U@Ǫ Ѝ&` V P 0p000000 # P [K !! 0P F@ B!  0 P 0 0@긓B$c=eeȨeeeBG- pPW` tyW 00@ >P 0S0,S  0 G0P -?o<2 ^0S0\ S/ḓB@-@P+ 0R'P`0 @P 0 0 B! 00C0000 Ѝ@ Ѝ踓B0P/?o( 2\0S/0\ S/긓B0P -?o42 ^0S0 S/ḓBP/ 0R/B0P -?o42 ^0S0 S/BPG-@6 @`TPp P* e b0 S @ⲩⰩ V S 000 01 0 01 $0 0P@ @0SA-pP`y@P (Q@Rx0P@ A /Bp@-P(1@P 0P0 0p蘫eBP 0RR @-^o//0Sb G- 0PSGt@ h@PR  pPWW(G0  0"!00 Pa#?<`P%c?P6 05P0 `0/P* P0)P$ pGP唀W%10``P R0P&RP0P Wa<`=0 P =P/ᴔBB@-@0P w2蘫eO-`P@豟衟pQ( A R<QV\ Z"  P V @$ V/ V U T *`=Q0S V' V5 U  X @`U  X @`U T*  `@p<S S CR=SQ"0T 0<S@(0Y@SS 0CSR30ĔBA-p`PV@PwPP  P `PQp@-@@ P`v@P0p  0P@ PTwPQPp@-@PP@PP @p@-@P D0R@00S [ @P000ꔔBP/ 0R /ᔔBP/ 0R/ᔔB\ ?o@-H 2^0S0 RQR 0 /ᔔBp@-@P D0R@ P@ vPP@p f ꔔB0P -?o42 ^0S0 S/ᔔBP/@-@@T ?o 2^0So蔔BA-0S6 (P@U2`P& 0$!P( $0S%  N$ 00 Rp)vPP 00  0{P :v 0pPЍ 0X PP X!vP@PP U v@B B/P/?o4 2\0S0SP//$Bp@-P00S $& @U 0D@`p,c$=e@-((R0@ 0L$Be0 SBTB@-@P 0R@;$BP/ 0R/$B0P -?o42 ^0S0 S/$B0S(0S @-0@ /dB00C0/0 P R   //A-`P ZuPP@PP.@P Dpp0 P`000U \u꠬epB@-@b@_PG-@" @`TPp P*  0 SS 000 0! 0 0!@$0  ݥ @.,@p@-P@@˥Ppp@-@P X0R@tPP@p,00$00i0@00 0pB\==G-`0DQS@0SG P@ޥP PP 00 0 1pP  00C 0`P l@WP0 03/P  0R 1#SPꐕBBs@-P@ T R t@`s/ЍpADAP`@ 0 0KP@00C0@@꠬eA-p `PJt@P V  !,V @pXt@-0`SP@p0]S @0 @P  Ѝ P 000$ `P ,0S=B0 /p@-P0@Q  0 Q000pPpp@-P@P㰤 0 0 0p@qpA-@P x0R@ ᙤbPP` @ 0qF 0q`0V:000pB@-P000p@-@P ,0R@Pm@ppBp@-@P ,0R@P[@寤ppBp@-@P L0R@P`H0S@#*@ᕤppBp@-@P5n@ᇤpp@-@P(000p@xp@-@P@@@mpp@-@P @0R@ P`0S 0@AWppBA-@P `0 R@pP0@0S@9 0 0a000 @pBp@-@P <0R@ P`ţ@ppBA-`PV p@Pk i 00d 0Sx0,S00 AA-@P 0RPpጣ0 0a Aڣ 0!1 0S0C0000ˣA. pB0P -?o42 ^0S0 S /pB 0Sp@-P`@P (0S p@:p/ꔕB-0!!00!1Q100 000000 0#0, 0#000!R0Q000! 00000p@-@P1S 0p`%T 00S 00S 0P0!  T# 0 P   R   R  00000p000Sp@PP@1S 0}!000p@t000 0/A-p`PU@@ @E 8/P QG-`pPUV@@@F@ @E 9/P `QG-`pPUV@@@F@ @E 9/P `QG- P`pX@0Q0000R0000@ @SA@@ @H :/P  1P@0R000000@@pP!R 0 000000T 0S001 S@o 000Q0P 0@/-" P  0P CR000S AA- P`@T0 \ R ^  0 TT 0^00AR"/o"!T0#00#000!00000\00!0000000T   0Sp  T`"P P- 3 T!, ,  1000 T R`T  0S RP/0    P/-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/0BR"SG- 6`P0@ pD TWpp-T@pP +T@P00T 00XS0 A B0C QR@P(V&0T ``f[ 00D \a0DSW0DA0DS70DV P   S  R 0 @`  X`EXRȕB  0S S/P/$(0#   @// / ////-M tЍQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / Qs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/G  0RR! R/P/0@ 0A0S=*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R* R.0 \ Bє BÔ4 B24r- B R5:@P`p@@P``p@@P``p@@P``p@@P``p@@P` R@* / R:@P`p@@P` R@* /@@t@P B@@P B@@P R@/ R$$/ 2R $х $Å/-\{F ,DP`pL%T\&dl't |@P`p B R*R:,DP`pL%T\&dl't |@P`p R/ RA2n:,D R L@*Af,HP`pH%XX&hh'x x@P`p B R*R:,HP`pH%XX&hh'x x@P`p R/ RA2::,H R H@*A2,LP`pD%\T&ld'| t@P`p B R*R:,LP`pD%\T&ld'| t@P`p R/ RA2:,L R D@*A /R $х $Å// 0 R/ ! 0O /0 #4<0/0 80/0 #<40/ "4"0/ 0 0/ 0 "$$#4 0/ 0 0/ "80/ 0"",$ / 0 0/0 #4"<0/ "4"0/ 0 0/ 0 "$$ #40/ 0 0/ ! 0O 0 0/ 0"$,#4 0/0 #( / 0",$# /0 #0#<4"$0 / 0 0/  !<0!40"440/ 0 0/ 0(#(0 /0 #$#, / 0 0/0 4"0/  "$,! / 0 0/  "$$! / 0 0/ ! 0O 0 0/0 #4<"$0 / 0(#88 0/0 4",$0 /0 0"##<40/ 0 0/ 0 !Ġ"ĠČ#4<0/0 0,8( / 0" (#8 0/ 0""#< 40/ 0 0/0 #<"4$0 /0 # #"$, /0 0,80 ( / 0 "ĠČ!$ #/ 0 0/ ! 0O 0 0/ 0,,$ ,#$! / 0( #8 8,0/ 0 $ #< 4,0/ 0" "$# ,̠  / 0  0 / 0 "$$ #$ <,$,!0 / 0  0#8 8,ȠȌ!0 /0 ,#88"(0 / 0"Ġ ",$#< 4, 0/ 0 0/ 0"Ġ,#$<,4  0/  "4 <0,4<0!! / 0 #( 8,8 Ƞ!Ȍ!0/ 0 "$$#< 4,̠Č! 0 / 0 0 /R4 R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/0 P0/S0/ P0/S0/ P0/C/00//1A-M Tp @00S 3/P0`7P V 6/0p `Pލ0 03/V@ 6/T T T 00P00S 3/`0@ P T 4/003/003/P T 4/P0/A-PJM U0`0p 0`` 0R,0 @0 4/@P T p0  P$ 0 0 0PU00@0@  PJߍ0 000 003/ 0/0/@-@J@ep@-P0@Q ePp0< 0 Ppp@-P@AQpPp@-0@APS`0q< Q< <Q< >Q@ &Q@ 8 TT0DS0f@\P /T \T "T T0 ) P  Ѝr@t@b@n@@T(PBBBBBp@-@P 0Sp wPpPQ@-@@ kPp@-0`SQ p@tp<@PWPpfP U>H DP VPp@-0PSQ p@Ip<@-Pp/%P 7P >p@-0PS`Q@p$@P QQ p@P<P@ P /P >A-`PPQPP0p 0SPUd@P  dPd<WP0 Pp 0 03/P P 0S PP|P{dPxdX 6P P(VP PBBBp@-@P` Ppp@-@P Ppp@-@P`E ܟPp@-W*–B011/A-@pP`P dPp` P102 P @-@\& P QRS  T00cLQ R S "  T  00 A-% M222v\l!Z 9 $=+낥띵4[?McD &glj{9\w\,G{W{]_}< >pdX,&|C g4 :<  3Q% 30S#* :3#Q% 53#Q% 5Q *c++h?{Mnz݄Mfn맪sjduoje0  a08S$~'tC:;b7Tr\! 2R @00@0 됒룪U py2pm Qf붬9 @:fsxfh +nw뇕0X"  000T@P4;0l}x/mjYgsAqWP'Wt끬1܁k-l1@T(m@⟼U l; 1Q @ |1PdY P. (`'0 000rs/zl!( A0( ?A3c01|pWl@\ 0]q0AD 0 {YP!:Xl0x0Y#@l릾@vcd@cDcEcl?eEc N'0DeAcJdb2Act]ePceMbcPA/A1A0:dmd%d: internal %s image area dkmatch_bootdisk: can't get label for dev %s (%d) mainbusno mainbus foundsdwdldWARNING: double match for boot device (%s, %s) boot device: %s iicziicnonei2c-indirect-probe-strategyThe operating system has halted. Please press any key to reboot. rebooting... REBOOT FAILED!!! ffuartbtuartstuartglasscpu not recognized!@ 0A @ 0H @ P `@ p @ p@ @ initarm: out of memoryinitarm: Failed to align the kernel page directorydos partition I/O errormbr partition exceeds disk sizeCD001BEA01NSR0disk label read faileddisk label corrupteddisk label write failedbad sector table I/O errorbad sector table corruptediso partition: I2C controller unable to attach PXA I2C controller i2cbuspxaiic: PCMCIA/GPIO controller couldn't map registers scoop%s: invalid CF slot %d%s: failed to map memory %x for scoopscoop_pcic_read: bogus registerscoop_pcic_write: bogus registerscoop_pcic_set_power: bogus power statepxapcic_scoopunable to acquire bus. error=%d output write failed. error=%d : GPIO controller ioexpzssp_init%s: not configured. can't map bus space couldn't establish power handler zssp_ic_startzssp_ic_stopzssp_read_max1111zssp_read_ads7846%s: not configured zssp: zssp_ic_send: invalid IC %d zsspSharp Zaurus frame bufferdefaultSharp Zaurus LCDC(.}Tccouldn't establish power handler zlcdstdSharp Zaurus frame bufferdefaultSharp Zaurus LCDccouldn't establish power handler w100lcdstd: ATI Imageon100 LCD controller failed to map config (errorno=%d) failed to map register (errorno=%d) failed to vram register (errorno=%d) console F F F G $G ?@ABCDEFGHIJKLM/57<?BCEGHIJLMNOPQRSUVWXYZ[\^_ couldn't establish power handler zkbdA>B> m1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & '(7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FKT]  1! 2" q wW^ a z '3#&4$eE=sdD`x5%rR+tT[fF\c--@  6&!yY]"gG;#v$bB_% & (7')8(*uU{+hH:,n-,/<.09)1iI}2jJ*3m4.?>680~9o:k;lL|=>@ApD FPQSTXY] F !#%'), <d b _ ] Z X U S P N K I F D A ? < : 7 5 2 0 - + ( & # !    : pseudo power management module zapm: USB Mode detection couldn't map memory space zusbunable to establish nSD_DETECT interrupt unable to attach MMC controller couldn't establish power handler %s: zmci_set_power(): unsupported OCR (%#x) zmcivfp fpscr trapscnopen: no console devicecnopen: cn_tab->cn_dev == devcnopen: unable to get vnode reference  %cconsLwGl G>@h @i j k dk 4sI^ 3!!!!!!!6>0x%08xr%d, rrxlsllsrasrror, %s r%d, %s #%dsplrpc U>U>U>lS>U>lS>U>lS>@U>U>PU>U>`U>lS>_MU>U>P U>U>U>V>@ V> V>P V> V>V>V> V>V>V>V> $V>V>(V>-V>0V>-V>4V>9V>9V>@V>9V>EV>9V>pPIV>NV>SV>WV>p[V>_V>pPdV>NV>iV>U>iV>U>p mV>rV>p 0vV>rV>p `{V>rV>p pV>rV>P V>rV>P V>rV>P @V>rV>P PV>rV>- V>U>V>U> V>V>V>V>V>V>V>V> U>U> V>U>V>U>V>U>V>U>0 V>V>00V>V>00V>V>00V>V>V>V>V>V>V>V>V>V>V>V>V>V> W>lS>  W>lS> W>lS> W>lS> W>lS> W>W>"W>&W>"W>U> )W>-W> )W>1W>/5W>8W>o:W>>W>0/U>8W>p AW>FW>HW>MW>@PW>MW>UW>YW>@]W>YW>bW>hW>kW>hW>rW>hW>yW>hW>W>W>W>W>W>W>W>W> W>W> W>W> @W>W> `W>W> W>W> W>W> W>W> W>W> W>W> 0W>W> PW>W> pW>W> W>W> W>W> W>W> W>W>W>W> W>W>W>X> X>X>X>X>X>X>X>!X>'X>!X> +X>!X>0/X>!X>@3X>!X>P7X>!X>`;X>!X>p?X>!X>CX>!X>GX>!X>KX>!X>OX>!X>SX>!X>WX>!X>]X>aX>fX>aX> jX>aX>0nX>aX>@rX>aX>PvX>aX>`zX>aX>p~X>aX>X>aX>X>aX>X>aX>X>aX>X>aX>X>aX>X>aX> X>X> X>X>X>X>X>X> X>X>0X>X>@X>X>PX>X>X>X>X>X>X>X>X>X>X>X>X>X> X>X>0X>X>Y>X>Y>X> Y>X>0Y>X>Y>Y> Y>Y>&Y>Y>,Y>Y>3Y>8Y>>Y>8Y>CY>8Y>]-thumb insn eqnecsccmiplvsvchilsgeltgtlenvund%s %08x %s%s%s aif, #%dlS>lS>U>U>lS>lS>U>U>lS>lS>U>U>lS>lS>U>U>, #%d#%d ; #0x%x%c%dp[r%d][r%d%s, #0x%03x#%s0x%02x%sr%d!{r%d-r%d}^f%d0.01.02.03.04.05.00.510.0#%s.%c%ddaiadbibedeafdfafafdeaed, #0x%04x0x%04xspsrcpsridie_cxsblsdeppmzp%df%d, c%d, %d, c%d, c%d, c%d, %dr%d, c%d, c%d, %d%d, r%d, r%d, c%d[%c - unknown] Tv \v 6oshstoshnshstnshishstishstsycpsC!csetend lesetend beclrexdsb!ldmbisbsrsXnW!mrfeXnWblxtmcrr#&mrrcstc2L#vstcldc2ldccdp2#ycdpmcr2#zmcrmrc2mrcsbfxdmirbfcdijbfidmijubfxundstrtdaWldrtstrbtldrbtstrldrstrbldrbpushpopstmYnWlldmXnWlblimbimbrangeswistrhtdeldrhtldrsbtldrshtstrhldrhldrdldrsbstrdldrshnopyieldwfewfisevdbg!dmrsdpmsrpFmpF2bxmclzdmbkptkmovwdZmovtswpdmoswpbldrexdaldrexdldrexbldrexhstrexdmastrexdstrexbstrexhandSdn2eorsubrsbaddadcsbcrsctstDn2teqcmpcmnorrmovSd2bicmvnmulSnmsmlaSnmsdumullSdnmssmullumlalsmlaladfPRfghmufsufrsfdvfrdfpowrpwrmffmlfdvfrdpolfpbopmvfPRfhmnfabsrndsqtloglgnexpsincostanasnacsatnfpuopstfQLvldffltPRgdfixPRdhwfsdrfswfcrfccmfPRghcnfcmfecnfevandNuqwvbicvorrvornveorvbslvbitvbifvshlSINuqwvqshlvrshlvqrshlvaddINuqwvtstvsub  "No support for this CPU type (%08x) in kernelcpu.branchpredictcpu.cachecpu.nocachexscale.branchpredictxscale.cachexscale.icachexscale.dcacheundefined instruction %#x in kernel at %#lxmachdepdebugbooted_devicebooted_kernelconsole_devicecpu_archpowersavecpu_idfpu_presenthwdiv_presentneon_presentid_isarid_mmfrid_pfrid_mvfrsimd_presentsimdex_presentsynchprim_presentprintfataltrapsunaligned_sigbusWarning IRQ's disabled during boot() -1single-skdb-k-dask-auserconf-chalt-b-2-3-4quiet-qverbose-v-xsilent-zw!N_bus_dma_busaddr_to_paddr%s: curaddr %#lx not in range_bus_dmamap_sync%s: _BUS_DMA_BUFTYPE_INVALID%s: map %p: unknown buffer type %d _bus_dmamem_map: size botch\i>ji>ji>ui>i>i>i>i>i>i>i>i>ji>j> j>5j>L%u %dKB/%dB %d-way (%u set) %s %cI%cT Unified cache L%u %dKB/%dB %d-way (%u set) %cI%cT Instruction cache L%u %dKB/%dB %d-way (%u set) %s %cI%cT Data cache sctlr: %#x actlr: %#x revidr: %#x isar: [0]=%#x [1]=%#x [2]=%#x [3]=%#x, [4]=%#x, [5]=%#x mmfr: [0]=%#x [1]=%#x [2]=%#x [3]=%#x pfr: [0]=%#x [1]=%#x VARj>\s>2PVAfk>\s>2VArj>\s>2AVAmk>\s>3VAtk>\s>3 VA{k>\s>3pAk>\s>3qAk>\s>3qAk>\s>3qAk>\s>3qAk>\s>3Ak>\s>4D k>r>4D k>8r>4i k>q>4`Rfk>\s>4 i k>pq>4qAk>\s>4TrAk>\s>4TtAk>\s>4TtAk>\s>4TAl>\s>4T Al>\s>4TA l>\s>4TPT(l>\s>4T`A 3l>\s>5TE`A =l>\s>5TE`A =l>\s>5TE%V Gl>\s>5TEWV Vl>\s>5TE ihl>p>5TE $iol>hp>5TE0$i}l>hp>5TE ,iol>hp>5TE0,i}l>hp>5TE .il>(p>5TE0.il>(p>5TEAil>To>5TE!il>o>5TE !il>o>5TE)il>o>5TE )il>o>5TE-il>o>5TE -il>o>5TEAil>n>5TEAil>n>5TEAil>n>5TEA l>\s>5TE A l>\s>5TE`A m>\s>5TEJ`A m>s>5TEJ`Am>s>6J`A-m>s>6J`A;m>s>6ZK AJm>\s>6KPAWm>s>7ApAdm>s>7AAqm>s>7A/A~m>s>7A?Am>s>7AAm>s>7A/Am>s>7A?Am>s>7AOAm>s>7AAm>s>7A/Am>s>7A?Am>s>7AOAm>s>7AA n>s>7A@An>s>8A0A%n>s>8ApA3n>s>8ApAAn>s>8AAOn>s>8AXV]n>\s>`A]n>\s>XV]n>\s>?A]n>\s>@XVmn>\s> Amn>\s>@X/Vmn>\s>Processor failed probe - no CPU ID %s%s%s (%s V%s core)Jj>Rj>Wj>`j>gj>rj>wj>j>j>j>j>j>j>j>j>j>j>j>j>j>j>j>j>j>j>k> k>k>"k>)k>3k>9k>Ck>Jk>Uk>]k>unknown CPU (ID = 0x%x)%sHz: %s %s : %s midr: %#x %s: IDC disabled IDC enabled DC disabled DC enabled IC disabled IC enabled WB disabled WB enabled LABT EABT branch prediction enabled %s does not fully support this CPU. This kernel does not fully support this CPU. Recompile with "options %s" to correct this. arm700swibugvector abortterminal abortexternal linefetch abort (S)external linefetch abort (P)external non-linefetch abort (S)external non-linefetch abort (P)external translation abort (L1)external translation abort (L2)alignment abort (0)alignment abort (1)translation abort (S)translation abort (P)domain abort (S)domain abort (P)permission abort (S)permission abort (P)undefined insn trapsundefined cp15 insn traps: disabled : disabled (uniprocessor kernel) write-throughwrite-back**unknown 3****unknown 4**write-back-lockingwrite-back-locking-Awrite-back-locking-B**unknown 8****unknown 9****unknown 10****unknown 11**write-back-locking-linewrite-back-locking-Cwrite-back-locking-DunknownARM2CPU_ARM2ARM2asCPU_ARM250ARM3CPU_ARM3ARM6CPU_ARM6ARM7CPU_ARM7ARM7TDMICPU_ARM7TDMIARM8CPU_ARM8ARM9TDMIARM9E-SCPU_ARM9EARM9EJ-SARM10ECPU_ARM10ARM10EJSA-1CPU_SA110XScaleCPU_XSCALE_...ARM11JCPU_ARM11ARMv4CPU_ARMV4CortexCPU_CORTEXMarvellCPU_PJ4BARM250ARM600ARM610ARM620ARM700ARM710ARM7500ARM710aARM7500FEARM810SA-110SA-1100SA-1110FA526IXP1200ARM710TARM720TARM740T (8 KB cache)ARM740T (4 KB cache)ARM920TARM922TARM940TTI ARM925TARM946E-SARM966E-SSheeva 88SV131Sheeva 88FR571-vdi80200i80321 400MHzi80321 600MHzi80219 400MHzi80219 600MHzPXA27xPXA250PXA210PXA255/26xIXP425 533MHzIXP425 400MHzIXP425 266MHzARM1020EARM1022E-SARM1026EJ-SARM926EJ-S r0ARM1136J-S r0ARM1136J-S r1ARM1176JZ-S r0ARM11 MPCoreCortex-A5 r0Cortex-A7 r0Cortex-A8 r1Cortex-A8 r2Cortex-A8 r3Cortex-A9 r1Cortex-A9 r2Cortex-A9 r3Cortex-A9 r4Cortex-A17(A12) r0Cortex-A15 r2Cortex-A15 r3Cortex-A15 r4Cortex-A17 r1Cortex-A35 r0Cortex-A53 r0Cortex-A57 r0Cortex-A57 r1Cortex-A72 r0Sheeva 88SV581xSheeva 88SV584xstep 0rev 1rev 2rev 3rev 4rev 5rev 6rev 7rev 8rev 9rev 10rev 11rev 12rev 13rev 14rev 15}n>n>n>n>n>n>n>n>n>n>n>n>n>n>n>n>step A-0step A-1step B-0step B-1step C-0$o>-o>6o>?o>Ho>n>n>n>n>n>n>n>n>n>n>n>rev 0o>n>n>$o>n>6o>$o>n>n>n>n>n>n>n>n>n>step B-2$o>-o>6o>?o>o>Ho>n>n>n>n>n>n>n>n>n>n>$o>n>n>n>n>n>n>n>n>n>n>n>n>n>n>n>$o>6o>n>n>n>n>n>n>n>n>n>n>n>n>n>n>step D-0$o>-o>6o>Ho>p>n>n>n>n>n>n>n>n>n>n>n>(IXP1200 step A)(IXP1200 step B)(IXP1200 step C)(IXP1200 step D)(IXP1240/1250 step A)(IXP1240 step B)(IXP1250 step B)p>q>n>q>'q>8q>Nq>_q>n>n>n>n>n>n>n>n>step B-3step B-4step B-5$o>n>n>n>6o>?o>o>q>q>q>n>n>n>n>n>n>step Bstep Cstep Dstep Erev 10step Go> r>r>n>n>n>n>n>r>!r>(r>n>n>n>n>step Jstep Kstep Sstep To>xr>r>r>r>n>n>n>n>n>n>n>n>n>n>n>*p0*p1*p2*p3*p4*p5*p6*p7*p8*p9*p10*p11*p12*p13*p14*p15r>r>r>r>r>r>r>r>r>r>r>s>s> s>s>s>o>n>n>n>n>n>n>n>n>n>n>n>n>n>n>n>userkernel Cw>$ Tw> fw>$ yw> w>w> w>w> w>x> #x>Dx> Ux>ux> x>x>Fatal %s mode data abort: '%s' trapframe: %p FSR=%08x, FAR=%08x, Invalid, spsr=%08x Fatal %s mode prefetch abort at 0x%08x trapframe: %p, spsr=%08x r0 =%08x, r1 =%08x, r2 =%08x, r3 =%08x r4 =%08x, r5 =%08x, r6 =%08x, r7 =%08x r8 =%08x, r9 =%08x, r10=%08x, r11=%08x r12=%08x, usp=%08x, ulr=%08xssp=%08x, slr=%08x, pc =%08x Fatal abort Kernel mode double abort! %d.%d(%s): trap: signo=%d code=%d addr=%p trap=%#x r0=%08x r1=%08x r2=%08x r3=%08x r4=%08x r5=%08x r6=%08x r7=%08x r8=%08x r9=%08x rA=%08x rB=%08x ip=%08x sp=%08x lr=%08x pc=%08x spsr=%08x data_abort_handler %s: Misaligned Kernel-mode Program Counter Non-emulated page fault with intr_depth > 0 uvm_fault(%p, %lx, %x) -> %x UVM: pid %d (%s), uid %d killed: out of swap badaddr_read%s: invalid size (%zu)Vector ExceptionAlignment Fault 1Terminal ExceptionAlignment Fault 3External Linefetch Abort (S)Translation Fault (S)External Linefetch Abort (P)Translation Fault (P)External Non-Linefetch Abort (S)Domain Fault (S)External Non-Linefetch Abort (P)Domain Fault (P)External Translation Abort (L1)Permission Fault (S)External Translation Abort (L2)Permission Fault (P)  machdepkmpages@````` ```pmap_bootstrap: No PTP for va %#lx pmap_enter: failed to allocate L2 bucketpmap_enter: no pv entriespmap_init_l1: can't get PA of L1 at %pfixup: pm %p, va 0x%lx, ftype %d - nothing to do! fixup: l2 %p, l2b %p, ptep %p, pte %#x fixup: pdep %p, pde %#x, fsr %#x pmap_pv_protect: page not pv-tracked: 0x%lxpmap_bootstrap: No L2 for va 0x%x, pa 0x%lxpmap_bootstrap: out of static L2spmap_bootstrap: WARNING! wrong cache mode for L2 pte @ %p pmap_bootstrap: WARNING! wrong cache mode for primary L1 @ 0x%lx pmap_alloc_specials: no l2b for 0x%lxpmapplpvepll2dtblpll2ptpplCannot allocate L1 KVMCannot allocate L1 physical pagespmap_map_entry: no L2 table for VA 0x%08lxpmap_map_entry: can't find L2 table for VA 0x%08lxpmap_map_chunk: no L1 table providedpmap_map_chunk%s: no L2 table for VA %#lx%s: can't find L2 table for VA %#lxxscale_setup_minidata: can't find L2 table for VA 0x%08lx,c  dump to dev %u,%u not possible dumping to dev %u,%u offset %ld dump area unavailable %d device bad device not ready area improper i/o error aborted from console error %d succeeded vmapbufvunmapbuf address 0x%08lx not a valid page pmap_pv_untrack: pv-tracking at 0x%lx: 0x%lx bytes, not 0x%lx bytespmap_pv_untrack: pages not pv-tracked at 0x%lx (0x%lx bytes)# !!!!!!!!!!!!!!scsiverboseperiphdisktapeprinterprocessorwormcdromscanneropticalchangercommunicationgraphic arts pre-pressstorage arrayenclosure servicessimplified directoptical card r/wobject-based storageunknownscsipi_dtype: impossible device type22@wuQa~>uuw>\bb\\\NbbR-pp },scxspl%sunable to create completion thread for channel %d scsipi_channel_initURGENT unable to allocate %sscsipi_xfer 0x%02x   %02x DEFERRED ERROR, key = 0x%x >&>0>=>X>h>w>>>>>>փ>>>, requested size: %d (decimal), retrying, cmd 0x%x, info 0x%x, info = %d (decimal) , data =Sense Error Code 0x%x at block no. %d (decimal)ES-6600 request sense for a request sense ? we read %d bytes of sense anyway: request sense failed with error %d adapter resource shortage QUEUE FULL resulted in 0 openings xsbusygeneric HBA error invalid return code from adapter: %d q  polling command but no adapter resourcesWARNING: tag %d greater than available openings %d invalid tag mask 0x%08x scsipi_execute_xsnot polling, but enqueue failed with %d should have flushed queue? polling command not done scsizzzsoft error (corrected)not readymedium errornon-media hardware failureillegal requestunit attentionreadonly deviceno data foundvendor uniquecopy abortedcommand abortedsearch returned equalvolume overflowverify miscompareunknown error key"/++-scsistrategy: No matching ioctl request found in queue physio split the request.. cannot proceed cmdlen too big passthrough: adapter inconsistency unknown error category %d from adapter probe%s(%s:%d:%d:%d): killed probe(%s:%d:%d:%d): sync (%d.%02dns offset %d)async, 32-bit, 16-bit, 8-bit (%d.%03dMB/s) (%dKB/s) transfers, tagged queueing tagged queueing N(8V]]]Fsoft error (corrected)ATA illegal length indicationATA volume overflowATA command abortednon-media hardware failurereadonly devicemedium errornot readycommand abortedillegal requestunit attention%s unknown error code %d probe%s(%s:%d:%d): \gg\gggg?wdc_atapi_done %s:%d:%d: flags 0x%x wdc_atapi_done: scsipi_done atastart from wdc_atapi_done, flags 0x%x %s:%d:%d: reset failed wdc_atapi_phase_complete(%s:%d:%d) polldsc %d wdc_atapi_phase_complete: cold%s:%d:%d: wait_for_dsc failed wdc_atapi_intr: bcount value is %d after io wdc_atapi_phase_complete: wdc_atapi_done(), error 0x%x sense 0x%x wdc_atapi_intr %s:%d:%d %s:%d:%d: bad state %d in wdc_atapi_intr wdc_atapi_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip=%d wdc_atapi_intr: c_bcount %d len %d st 0x%x err 0x%x ire 0x%x :PHASE_CMDOUT PHASE_DATAOUT wdc_atapi_intr: warning: write only %d of %d requested bytes PHASE_DATAIN wdc_atapi_intr: warning: reading only %d of %d bytes PHASE_COMPLETED wdc_atapi_intr: unknown phase 0x%x wdc_atapi_intr: wdc_atapi_done() (end), error 0x%x sense 0x%x wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwdc_atapi_scsipi_request %s:%d:%d !!!!4!wdc_atapi_probe_device: drive %d not present wdc_atapi_get_params: no xfer wdc_atapi_get_params: ATAPI_SOFT_RESET failed for drive %s:%d:%d: error 0x%x wdc_atapi_get_params: ATAPI_IDENTIFY_DEVICE failed for drive %s:%d:%d unbusypiomodewdc_atapi_start %s:%d:%d, scsi flags 0x%x %s:%d:%d: %s error (0x%x) wdc_atapi_start: not ready, st = %02x %s:%d:%d: %s timed out ~!{!T~!~!atapiscsibusdetscsinitqscouldn't establish power handler : SCSI bus : %d target%s, %d lun%s per target scshutsccompxscmdfailed to init channel %s-dunable to create discovery thread for channel %d removablefixed timeout-info%s target %d lun %d: <%s, %s, %s> %s %s%sۙ>> >@>> >>> > >)> >>:> >K>T> >e>n>>>> >>> >>>Ϛ>Ԛ>ݚ>>>> > >>'>+>4> >+>E> >+>V> >+>g> >+>x> >>>>>>›>Ǜ>Л>›>>> >>> >> > >>> >>,> >>=> >N>W>h>N>m>~>>W>h>>>>>>>>> >>ʜ>ۜ>>>>>> > >> >+>> >->6> >->G> >X>a>r>w>>>@w>> >aK>> >>>ĝ>!ȝ>ϝ>>>> >>> >>> >>> >>> >>> >>> >>!> > >&> >.> > >7>@> >Q>Z> >k>t> >k>> >k>> >k>> >k>> >k>> >k>Ҟ> >k>> >>> >@ȝ>> >>> >+>(>9>>>G> >X>a> >X>r> >X>> >X>> >X>> >X>>ş> ʟ>ӟ> >>> >>> >>> >> > >>1> >>B> >>S> >>d> >>u> >>> >>> >@>> >>> >@>> >>à>Ԡ>->٠> >ޠ>> >ޠ>> >>> >> > >>> >'>.>6>;>B> >I>R>c>>h> >y>> >>> >>> >>>ϡ>>ԡ>>>>>>> >>> >>->>>>C> >T>]> >T>i> >T>u> >}>>>}>>>}>>â>N>Ȣ> >٢>>>>>>>> >>(>9>>>>O>T>]> >n>v> >> > >>> >>> > >> >>У> > not configured LUN %016llx ignored waiting %d seconds for devices to settle... scsidlyApple iPod CHINON CD-ROM CDS-431 CD-ROM CDS-435 Chinon CD-ROM CDS-525 CD-ROM CDS-535 DEC RRD42 (C) DEC DENON DRD-25X VGENERIC CRD-BP2 HP C4324/C4325 IMS CDD521/10 2.06MATSHITACD-ROM CR-5XX 1.0bMEDAVIS RENO CD-ROMX2A MEDIAVISCDR-H93MV 1.3NEC CD-ROM DRIVE:502CD-ROM DRIVE:55 CD-ROM DRIVE:83 CD-ROM DRIVE:84 CD-ROM DRIVE:841OLYMPUS CDS620E 1.1dPIONEER CD-ROM DR-124X 1.01PLEXTOR CD-ROM PX-4XCS SONY CD-ROM CDU-541 CD-ROM CDU-55S CD-ROM CDU-561 CD-ROM CDU-76SCD-ROM CDU-8003ACD-ROM CDU-8012 TEAC CD-ROM 1.06CD-ROM CD-56S 1.0BTEXEL CD-ROM DM-XX24 K1.091.10TOSHIBA XM-4101TASUNSLCDIBM CDRM00201 !F0724ShinaKenCD-ROM DM-3x1S1.04JVC R2626YAMAHACRW8424SCD-ROM DRIVE:222MICROP 1588-15MBSUN06692217-15MQ1091501EPSON OMD-5010 3.08ADAPTEC AEC-4412BD1.2AACB-4000RZ55 (C) DECEMULEX MD21/S2 ESDIA00MICROP1548-15MZ1077801HZ2PC372IBMRAID 0662S0663HIBM0664DXHS36DDXHS18YH3171-S2KZ-CDFRSS2FInitio JMicron Generic MPL MC-DISK- MAXTOR XT-3280 XT-4380S MXT-1240S XT-4170S XT-8760SLXT-213S LXT-213S SUN0207LXT-200S MEGADRV EV10001991-27MZMST SnapLink D3847 0307PiSCSI SCSI CD-ROM QUANTUM ELS85S LPS525S P105S 910-10-94xPD1225S PD210S SUN0207ATLAS IV 9 WLS0A0ARODIME RO3000S SEAGATE ST125N ST157N ST296 ST296N ST318404LC ST336753LC ST336753LW ST336754LC ST39236LC ST15150N ST19171ST32430NST34501FC SX910800NMK538FB 60271924FUJITSU M2266M2624S-512 SX336704LCSX173404LCORACLEBlockVolumeIOMEGAZIP 100J.03INSITEI325VM MT-02 QIC CALIPER CP150 EXABYTE EXB-8200 GY-10C SDT-2000 2.09SDT-5000 3.SDT-5200 TANDBERG TDC 3600 ARCHIVE VIPER 150 21247VIPER 1500 212472.2GPython 28454-XXXWANGTEK 5099ES SCSI5150ES SCSISCSI-36WangDAT Model 1300 02.4Model 2600 01.7Model 3200 02.2MT-2ST/N50 RICOH IS60 1R08UMAX Astra 1200S V2.9Astra 1220S UMAX S-6E V2.0UMAX S-12 V2.1ULTIMA A6000C ESG-SHVSCA HSBP M15SYMBIOSLITRONICPCMCIA CDL1100 SUN SENA Virtual CDROM !P!44h!47l!6534scsibusscsibus at %s channel %dscsi_subrLwG !B>Xx!PT!x!x!Xx!PT!x!x!l{!Xx!PT!x!x!l{!Xx!PT!x!x!4y!removablefixed%s drive %d: <%s, %s, %s> %s %s : %d targets scshutsccompxscmdcouldn't establish power handler atapibus at %s>ߦ>>>ߦ>>@>ߦ>>@ >ߦ>>@>ߦ> >%>ߦ>6>@<>ߦ>L><>ߦ>Q>V>ߦ>g>@l>ߦ>>>ߦ>L>>ߦ>L>>ߦ>ç>ȧ>ߦ>ק>ܧ>ߦ>> not configured ALPS ELECTRIC CO.,LTD. DC544CSW03DCR-2801TE1.07CREATIVECD3630EAC101FX320Sq01GCD-R580B1.00HITACHI CDR-77300008aMATSHITA CR-5741.021.06Memorex CRW-26421.0gNEC CD-ROM DRIVE:2734.21SANYO CRD-256PSANYO CRD-254PSANYO CRD-S54P1.08CD-ROM CDR-S11.70CD-ROM CDR-N161.25atapibus"&) J-88c&&&&&&&&&&&&&&&&%15:9&?&&CHN&R&&&&&&&&W''''''''''''''' &,065':''/>/>/>/>/>0>/>/>optical mediaread_cd_capacity: extra large block size %u found - limiting to 2kByte cd_setblksize: trying to change bsize, but no blk_desc cd_setblksize: trying to change bsize, but blk_desc is correct MMC close/finalise passed wrong device type! (%d) mmc_do_op: unhandled operation %d NEC CD-ROM DRIVE:260cdm!!!!X!!!.6 c!!H!!!47l!653!.6 ccache synchronization failed preposterousunsupported%s sector size: 0x%x. Defaulting to %d bytes. no door lock %s: waiting for pack to spin up... %s: pack is stopped, restarting... unable to restart pack >>>>>>>>>>>>>>>>>>RBC size: mode sense=%llu, get cap=%llu %s: fabricating a geometry !!!! !T!\!!! "!!!! %s, %ld cyl, %ld head, %ld sec, %ld bytes/sect x %llu sectors (%lu bytes/physsect; first aligned sector %u)drive offlineunformatted mediacouldn't establish power handler sd _CK.A\M%s: not supported ERROR TIMEOU DF%s: status=%s wd_flushcachewd_trimk>>> >$>1>?>>Գ>>> >$>1>?>X>, %s: (error not notified%s%s) wddump: device timed outwddump: drive faultwddump: DMA errorwddump: wddump: unknown error type %x 4"""("+"('"&".6cwdioctlstrategy: No matching ioctl request found in queue physio split wd ioctl request... cannot proceed DMA errordevice faultdevice timeouterrorrequeuechannel resetwd, xfer %lx, retry %dsoft error (corrected) xfer %lx ST506wd_get_params: bad return code from ata_get_paramswd_setcacheIDENTIFY failed >ƴ>Ѵ>%s<%s> SPLIT_MOD15_WRITEquirks %s drive corrupts write transfers with certain controllers, consider replacing drive supports %d-sector PIO transfers, LBA48 addressing LBA addressing chs addressing %s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector: %jd)WARNING: block size %u might not actually work ""4""`"d"" " "`"couldn't establish power handler hwcould not create %s.%s sysctl node use_ncqcould not create %s.%s.use_ncq sysctl - error %d use_ncq_priocould not create %s.%s.use_ncq_prio sysctl - error %d standby immediate wd_standby4""'"'"("47l!653&".6caddress mark not foundtrack 0 not foundaborted commandmedia change requestedid not foundmedia changeduncorrectable data errorbad block detectedobsolete (address mark not found)no media/write protectedinterface CRC errorST3120023ASST380023ASST360015AS1"<"0"T:"0"wdc_ata_bio_kill_xfer: unknown reason %d wdc_ata_bio_kill_xferwaitrecalpiomodegeometrysetmulti%s:%d:%d: not ready, st=0x%02x, err=0x%02x %s:%d:%d: timeout waiting for DRQ, st=0x%02x, err=0x%02x %s:%d:%d: %s timed out %s:%d:%d: %s drive fault error (%x) %s:%d:%d: bad state %d in wdc_ata_bio_intr wdc_ata_bio_intr: bad state%s:%d:%d: device timeout, c_bcount=%d, c_skip%d %s:%d:%d: read intr before drq /"%%$%hW"/"/"J"atabus at %s channel %dwd at %s drive %d%s: unknown child %patasplatainitqataatastart%s: channel %d busy, xfer not possiblexfer %lx freed while invoking timeout xfer %lx deactivated while invoking timeout ata_thread_run%s: unknown type: %x %sunable to create kernel thread: error %d couldn't establish power handler %scnfunable to create config thread: error %d atabus_thread%s: ata_xfer_start() unexpected rv %d%s: queue_freeze%s(%s:%d:%d): using PIO mode %d,32-bit data port drive supports PIO mode %d%s DMA mode %d%s Ultra-DMA mode %d (Ultra/33) (Ultra/66) (Ultra/100) (Ultra/133)SATA port multiplier not supported ata_hlatabusP"DU"44M"47l!6534atdrnqidlataactatafinatathinvalid checksum %x for READ LOG EXT page %x READ LOG EXT page %x failed to report error: slot %d err %x status %x couldn't create dma map. (error=%d) mmctaskqxferxfer 512xfer 1024xfer 2048xfer 4096xfer 8192xfer 16384xfer 32768xfer 65536xfer unalignedxfer errorcouldn't establish power handler , " "%s%s%s(manufacturer 0x%x%sproduct 0x%x%sstandard function interface code 0x%x)%sat %s function %d%scouldn't create task thread couldn't alloc memory (sdmmc function) sdmmcdelaysdmmc_set_relative_addr: SMC_CAPS_SPI_MODE set sdmmc_select_card: SMC_CAPS_SPI_MODE set sdmmc_select_card: error %d couldn't supply bus power couldn't supply clock couldn't enable card: %d couldn't identify card no functions i/o init failed mem init failed init failed sdmmcbad CIS ptr %#x CIS parse error at %d, tuple code %#x, length %d CISTPL_FUNCE(common) found in function CISTPL_FUNCE(common) too short #(-27<FP d'CISTPL_FUNCE(lan_nid) too short CISTPL_FUNCE(lan_nid) invalid CISTPL_FUNCE(function) found in common CISTPL_FUNCE(function) too short (v1.00) CISTPL_FUNCE(function) too short bad CISTPL_FUNCID length bad CISTPL_MANFID length CISTPL_VERS_1 too short SDIO function unknown tuple code %#x, length %d %s: CIS version %u.%u %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: SpectecSDIO WLAN CardSDW-820writereadextended I/O error %d, r=%d p=%p l=%d %s direct I/O error %d, r=%d p=%p %s couldn't supply voltage requested by card couldn't send I/O OCR couldn't set I/O RCA couldn't select I/O RCA %d can't change bus width couldn't read CIS can't change bus clock %u-bit width, %u.%03u MHz %u KHz pauseerror waiting for data ready after ext write : %d switch error error waiting for data ready after switch command: %d can't change bus clock can't read EXT_CSD (error=%d) unrecognised future version (%d) unknown CARD_TYPE: 0x%x card failed to switch to timing mode %d, using %d e @ can't re-read EXT_CSD HS_TIMING set failed can't switch signaling voltage DDR52HS200can't execute MMC tuning can't enable cache: %d HostCardHost/CardSD_SEND_SCR send failed. can't change bus width (%d bit) switch func mode 0 failed failed to recover UHS card switch func mode 1 failed: group 1 function %d(0x%2x) ~>a>P>> ,>@Pcan't get SD status: %d  SD card status: %d-bit unknown bus width, C%d, U%d, V%d, A%d, Cache, %s self-maintenance can't execute SD tuning setting cache enable failed: %d cache enabled can't enable cache: %dunknown SD CSD structure version 0x%x d' #(-27<FPunknown MMC CSD structure version 0x%x unknown MMC version %d couldn't set mem RCA mid=0x%02x oid=0x%04x pnm="%s" rev=0x%02x psn=0x%08x mdt=%03x write-protected cache flush failed Default/SDR12High-Speed/SDR25SDR50SDR104DDR50SD cardMMC: <0x%02x:0x%04x:%s:0x%02x:0x%08x:0x%03x> %s 0x%02x:0x%04x:%ssdmmc discard countsdmmc discard errorssdmmc discard busyldsdmmc%sattachcouldn't create thread (disabled)%d-bit width, %s, %s cache%s, Cache%s, %u.%03u MHz %u KHz blkno 0x%llu exceeds capacity %d error, retrying ld_sdmmcldLwG">>config_hook: invalid hook typeconfig_hook: incompatible mode on type=%d/id=%ld != %dconfig_hook: type=%d/id=%ld is replacedconfig_hook: type=%d/id=%ld is already hooked(%p)config_connect: can't connect with shared hook, type=%d id=%ldUNKNOWNCASIOCompaqHPHP Jornada addr 0x%lx-0x%lx intr %dPXA270PXA250: Onchip Peripheral Bus pxaip_attach: failed to map CLKMANpxaip_attach: failed to map MEMCTLpxaip_measure_cpuclock: can't map RTC%s: CPU clock = %d.%03d MHz %s: kernel is configured for PXA250 and PXA270, cpu type is %s pxaintcpxaip_attach_critical: failed to attach INTC!pxagpiopxaip_attach_critical: failed to attach GPIO!pxa2x0_memctl_read: not bootstrappedpxa2x0_memctl_write: not bootstrappedpxa2x0_clkman_config: not bootstrappedpxaippxa2x0_io_bs_alloc(): not implemented pxa2x0_io_bs_free(): not implemented : Interrupt Controller stray interrupt %d intr_establish: bogus irq number %dintr_disestablish: bogus irq number %dpxaintc pxagpio_reg_read: not bootstrappedpxagpio_reg_write: not bootstrapped: GPIO Controller Can't map registers! failed to hook main GPIO interrupt no GPIO configured in kernel unhandled GPIO interrupt. GPIO#%d pxa2x0_gpio_intr_disestablish: can't unhook GPIO#0pxa2x0_gpio_intr_disestablish: can't unhook GPIO#1pxa2x0_gpio_intr_establish: bad pin number: %dpxa2x0_gpio_intr_establish: Pin %d not GPIO_INpxa2x0_gpio_intr_establish: bad level: %dpxa2x0_gpio_intr_establish: illegal shared interruptpxa2x0_gpio_set_intr_level: bad level: %dpxagpio: can't map registers pxauart %s: Cannot map registersSA-11x0 OS Timer clock: hz=%d stathz=%d saost_countsaostC CCCC !Not supported depth (%d) Unknown depth (%d) : PXA2x0 LCD controller failed to map registers (errno=%d) unable to establish interrupt at irq %d unable to create new screen (errno=%d)console lcd_free on active screen h########: DMA Controller Can't map registers! dmac_pxaip_attach: bus_dmamem_alloc faileddmac_pxaip_attach: bus_dmamem_map faileddmac_pxaip_attach: bus_dmamap_create faileddmac_pxaip_attach: bus_dmamap_load failedStray DMAC interrupt for unallocated channel %d pxa2x0_dmac_abort_xfer: channel %d failed to abortpxadmac couldn't map memory space unable to establish interrupt init failed, error=%d pxaohcipxapcic_mem_map: bogus kindpcic_attach_card: already attached%s,%dunable to create event thread for %d pxapcicevpxapcicsss: %d slot%s can't attach failed to map MEMCTL pcmciaunable to map register pxa2x0_i2c_intr_sub%s: Bus Error Detected Interrupt not handled 0x%x : Real-time Clock %s: couldn't map registers %s: using wristwatch register pxartcpxamci_dmac_ointr: non-zero completion status %d pxamci_dmac_iintr: non-zero completion status %d mmclkclock stop timeout unsupported bus frequency of %d KHz data not a multiple of %u bytes too much data couldn't start dma xfer. (error=%d) mmcmd: MMC/SD Controller couldn't map registers couldn't establish MMC interrupt using DMA transfer couldn't alloc rx dma xfer couldn't alloc tx dma xfer sdmmccouldn't attach bus   CW[jM_a8]o \#Y#apmsuspendpower management disabledunknown error codeinterface not connected16-bit interface already connected16-bit interface not supported32-bit interface already connected32-bit interface not supportedunrecognized device IDparameter out of rangeinterface not engagedunable to enter requested stateno pending eventsno APM presentreal mode interface already connectedAPM : %s reserved> >>APM: %s event code %x get eventapmstandbyapmevioctl get power statusapm at %s : Power Management spec V%d.%dget power status%sunable to create thread, kernel APM support disabled reserved systemreserved deviceOEM definedZ#Z#44c#4D[#l!6[#4apmdev couldn't establish power handler pcmcia_childdetached: %s not found %s: error %d detaching %s (function %d) , %s%s (manufacturer 0x%04x, product 0x%04x)%s function %d: %s pcmcia_function_init: function is enabled%s: card appears to have bogus CIS pcmcia_function_enable: function not initialized%s: couldn't map the CCR pcmcia_io_map: function is enabled! pcmcia_io_unmap: function is enabled! pcmcia_intr_establish: function is enabled! pcmcia_intr_establish: already done interrupt establish failed pcmcia_intr_disestablish: function is enabled! pcmcia_intr_distestablish: already done Drats! I need a skew! pcmciaJXjj[  "$CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: %s: Manufacturer code 0x%x, product 0x%x , %s%s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed disk(ata)video adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx-%lx; memspace@%lx; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS 5>>5>>=>>=>>V>>V4>(>>>>>>>>L>@>P>>>>d>X>>>%s: using CIS quirks for , %sSVECFD605 PCMCIA EtherNet CardNDCEthernetAPCMCIA MBH1030201%  8  @!!@! ! #/ ''w0 g'' c0c >>$>HT&>2>z;>H>zg>n> g>n> >u>|>>|>>>>@>>@>>>>>>>>l>>'>H;>>$>D>I>>Y>n>@IeIIu>z>I0I0E|>>>>@&II  I>>|>>@"I0>>>-/>>>>>>>>>+>>@>>V>n>u>>>>>>>>")>>uE o@o @o @>>>>>>>$>@& 3BI@>!> @(#0can't alloc mem for enet addr can't map mem for enet addr configure failed, error=%d can't get subregion for asic can't match ethernet vendor code cannot set power mgmt handler unable to establish power handler PCMCIAEthernetAAmbiCom IncAMB8002TAmbiCom,Inc.Fast Ethernet PC Card(AMB8110)PMX PE-200UE2212D-LinkDE-660DE-660+RPTI LTD.EP400RPTIEP401 Ethernet NE2000 CompatibleACCTONEN2212EN2216-PCMCIA-ETHERNETAdapterSVECFD605 PCMCIA EtherNet CardSeiko Epson Corp.P/N: EEN10B Rev. 00TAMARACKCNetCN40BC EthernetPCMCIA-ETHERNET-CARDUE2216ASIXAX88190DFE-670TXDMELCOLPC2-TXLINKSYSE-CARDDE-650I-O DATAPCLAETHERNETcorega K.K.corega Ether CF-TD LAN Cardcorega Ether PCC-Tcorega Ether PCC-TDcorega Ether PCC-TLcorega EtherII PCC-Tcorega EtherII PCC-TDcorega FastEther PCC-TXcoregaFEther PCC-TXFcorega FEther PCC-TXDcorega FEtherII PCC-TXD(CG-LAPCCTXD)(HardwareFirmwareVer.)SMC8041TX-10/100-PC-Card-V2LNT-10TNCF10Base-Ethernet1.0NDCDYNALINKL10Cne_pcmcia>>TBcouldn't establish interrupt configure failed, error=%d %scouldn't establish power handler MEGAHERTZMODEM XJ2288com_pcmcia >->>>2'E >'>.>1>I>b>j>u>|>>>>>u>'>u>> configure failed, error=%d can't subregion I/O space memory mapped mode i/o mapped mode wdcattachunable to establish power handler Digital Mobile Media CD-ROMPCMCIA Portable CD-ROM Drive NinjaATA-EXP PnPIDEF1SHUTTLE TECHNOLOGY LTD.PCCARD-IDE/ATAPI AdapterFREECOMPCCARD-IDEPCMCIACD-ROMIO DATACBIDE2 LOOKMEETIDE CARDwdc_pcmcia????????VVwh3???3?S?h?t?????????P8soo P q q sMklt??tt3?? hC?? h&wiinitcouldn't load firmware configure failed, error=%d %s:failed to attach controller couldn't establish power handler SMCSMC2632WNANOSPEEDHFA384x/IEEENECWireless Card CMZ-RT-WPNTT-ME11Mbps Wireless LAN PC Cardcorega K.K.Wireless LAN PCC-11Wireless LAN PCCA-11corega_K.K.Wireless_LAN_PCCB-11coregaWL PCCL-11WLCFL-11INTERSILIntersilPRISM 2_5 PCMCIA ADAPTERPLANEXGW-NS11H Wireless LAN PC CardD-Link CorporationD-Link DWL-650H 11Mbps WLAN Adapterwi_pcmciaFILE: ESECSYM,T3.10-04,F3.10-04,01/17/2002 SECONDARY 22 240 12 54 ~ `c܀ `d`~d`d `#x`d$Ega#Xd@Pa"*2:BJRZbhpz``` `(!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`s`xih^d@@d@A@B@T@U@^@Z@[`b`4dЀ `bU`dЀ`Pb`.d`RbƂ `Pbd`Rcd a`c`>a`f`dXY`c`~a`f`dXYJ`c`adYc`*c `@a`~dXY`a˃YYӤ`c`eEK`a`e`deFX+FY`c`Na`deFX+FY`c`a`deFX+FYi`d `"b`eԀ ̄eDeD̄|c`F܄Ѐ`F `F܄ЀdcD܄P3D`|a`XOxFE`XOx`bfDed@*``vc d`e`cd`4b`~beD`0`P`y````EĄ$`0d%`E)``d-1`d&*`d.2`d'+`d/3`d(,`d04$Ą57d@Pcd@T@U@A@B@^d@R`:e`@* &`b`zbdD>`\e`@ &`bdDL`bdDFd@A@F@G`c`d`fcdY`Av`_xu``*b`d``0`x0Dbcdefl@AC@I`x0DdrD`Rd@@܀d@@H`@: g`ed@:dpmd@Kd@M@G"d@L&D@Fe`@&:hhddV`Tl@`DdFGg`\bdۜ d@&D@F'D"@Gd! d!=D@]D|@^=D@]`>D@^FG`d0Dd@@@D@C@B@A`d@N<`jd@M`Vx0D` d@@ d@K`edd@\` x0D``O`O`6C`@C`D`RD`4E`}E`XG`G`H`GH`I`I`J`J`4K`K`XL`L`M`M`N`N`@`@`A`$A`B` B` :\+t@:\+ t@:\+t@t@:\+1``:\'1``g`d:\0`g`d:\:\@'```0`g`d;\;\@'g`d:\٘`d>@g`Lbd d@H`d@Kg`Jb`dd@Li`qd@@`x0D(`eddd@FX(`XOx(`XOx)`XOx(`XO;x'`XOx'`XOx'`XOx=`/xN`aAM@`XOx-A`XOxOfD`Av`|`dٮ0`x,E?A0D 4C)D"&:*Dt )D@I$A`eŔ A@d>D&Ad>D*b dg`Vb܄g`bdd@IrR2{MD)D@Ie*`xd@;`_x`tDt@^E^@^|`"bXOXOXOXO|XOXO =D@]@]-`xe`Gc=D$@]4@]`G`Ac=D$@]4@]`G`Ac=D$@]4@]d@&Dt@^|`FbƂXO`d`T2D+D@^=D@]>D@^=D@]d̄>Dw@^D4E^&D@F d@LLN%dKt`xaFG`x>D@^F`}`>D@^FG&C*PCF*D# Dd@@rE܄`UeR$܄'܄(*D܀X2@*]`x-D & &D@F6]'D* @G-DX67d!&*$@Gd!*D܀X'D*@G'D*@Gd!'D*@Gd!`x&D* pDЀddP`xd"F)`ddd!`xdFG d@L) :`d`E`dĄ܄?k>D@^=D@]>D@^=D@]d̄>Dw@^"c*c(D& %D`Fa^+!F (D6 cD|@^=D@]`}>D@^FG`xd`fFB`|E5[`d܄ڂ܄`xA^d@F!FFELd@L&D@F.D `zbd@*fihD`E|ihD`Ge|ihDЀdD`G% 6676n6&|"5dW.DlC!~iÔg`^b܄d'D@G`xd@6`x|@En6576&6 6Z`d܄ڂ܄!c'D@G`t`xLH LHLHDžǃDžメLHǃ'σHCCLN|МӀ DZ`d܄'D@G`t`xRJpRc(DlE.D+ eDP*&D @FЀlDąЀa(D*@'alDąЀ2D*'(D6:d8d`x@LlDlD a(D+a`@@'ANlD(D666`xa@"1lD(D:Ha6(D:MaIaAMFNd@Le-D* -DI6H:e'@@&0e`x50elDlD`x5EN#D`C`xlDlDlD&A &-D"2@*P@Md`d܄'D"@Gd!H'D@G .D$@AFp@MlD a(D+a`@@+ `eC(D@H)d"#DAN &(@@'@C8lD#D+d@C8#G?eEL!pEԀd`PlD.D"&#AlD4TlD.@ *lDlD.@&#AlD7?lD72D*bFEڂlDڂlD#Ax|eaCрFE7dCс||;H#DЀ`C `xlDlD]>#A>||e%DՀaCE56`xbрFEa@&a\adCсDZ#ՀaC7bрFEDa@&a\adCDсDz lD|FEdlDZڷdA(D@+2D&lDD}@^d̄=D@]`k=D@]>D@^(D@+>:D+`:\+t@:\+ t@:\+t@t@:\+1``:\'1``dg`d:\0``}`>D@^FG/Xd?;D@'@`@*`xA`@'d@*g`cew+d@* g`c0en@+ d@*g`cee ``xd@*g`cUT`*e0/`AdCDaGD냓`eD`Ncǃe`@+\aнPYЀYЀЀeDT`Nc~e`@+\aнPYЀYЀЀeD =`LdăgD e""dD@[dG@[dD@[`G`AE7cBcd@: cZ݁`Ea_@[eG݁a_@[Z݁a_@[``d@:``3`d?8(d@IFJd0D@Q`x@*F`@&e)C'D`A;@+`Ww_Ɂ`Ww_% &c@J`F;=F8*F`@*c@&c`F+FJ`Ww_`G c@&c@JCIAGd0D@Q>|>=FDG`@& `x=F`edC`x`x`xL/~ =F>`xd0D@Q`0` `d>>@:D;D=F`c`|`xwD`W@J*1$D$F ,@D`F`\` ddD:D&u;D@[ -EԀZ`pd܄ڂ܄*D*#D<`@d@GXOSFCfC`\`"ddD:D&u;D@[*D"K"D`FFd@B@<`Fd@GXO+FB7"fC@*`$d:D&u$;D@[ *`$d:D&u;D@['B`F /X*D*!D`F<`pd@GXOFAfC`d:D&u;D@[4@&;*D :D* ;D`Ud@Z@[=d@J5@*$A@U, GXO(FDf\` d:D&u;D@[5@*#A@U`}x5@*"A@U`x5@&4@*!A@U@T?`ha'BLAN@E`F @K`^x+D N.X%F'CսFEcEdC`Ad۾eC%DaD aF%D %D'C`F fD.X(AXO.X(A@XO(AXO&XOV.X|c@EeeD܅`F@E3DT3D`|ddЀ/XfC%FaDg<~dd# acY/XL|aXOc,F%F,F%FdЀ dFgXO.X'C%F%D `F%D ܄/XLXO( GXO.XLXO GXO^.XLXO G'D %C cF'C fCdDX`F%D .X%F @G dC'Bڂ$ʂ`F cF( %Fd 'B̄/X%F#`F xgg%Fd%DXOXO'.X'C%F %D`F%D %Fd %D/X%D%F|d/Xa%D`FfC݁3EE3D/X%FЀdC`FgddFFEXO.XfFE)CfD%Ddae<`cCÍ`Vx&Ԁ`EѽDGDHDE`dD3A@E`F`|dM3DdЀ/X  Xee 0DP@Q0D}@Q?*F\g`Xbd`.d@D0DA@Q?0D@Qg`XbdBe`A #`E`A6aDd@&d8989܄8dD$܄`\aD9da\Ad@&`@*g`c0d@*`@* g`c'd@*`@*g`cF\"d`x`@*eG6`EąŅ=`NdăagDg`c``8d^@ZdG@Z9@Za\Ѐ0`E@ZeG@Z`E@ZeG@Z`EE@Zd@:aeG@Z`E@ZeG@Z`E@ZeG@Z`E@ZeG@Z@Z `g`b*=d`:\+t@:\+ t@:\+t@t@:\+1``:\' 1``:\+dg`d:\0`:@@'g`\bdE`d@Z3`??`2xd8~`GSQ`\PQRSdT) :SdDcc cUF\"`@&@!`EELĄ!,D)dd@:O'Vc))`Gd@*. "bcL4L)`@:v`@6n!̄`Ad́SUdA6dEbá$Ƃ(ւ́(*Ƃ`C`eddÁĄcEĄ@H`Eh`b`dh`beD(DpEą`XdĄ`AsEԀ dD68aEĄsEԀ.h`b` d d@\"d` x&(E`@:`dĄpEԀ`P`Eh`b`0dh`beDd (Dh`Eh`b`dh`beDg`Nbdg`Zb`b*`dѕdA) `@:q݁݁݁%`G`Ca@"#`XOJx`dݸ#`XOIx`d)`Eh`b``dh`beD"`dڎF\fD `xdhh`b`adF\`@*g`Xbd`id@D0DA@Q?0D@Qg`Xbdۙ:D+P' g`\bdE`d@Z3``xL?~)`@:Z`Zd܄`e"d`xdD`A`G`EaD脤`AeGaE.XdD`A`G`EaD`AeGaE.X`G`E@M`G`A-D́`EaG.X"`kx0D*G!XG?2D&WdEGS 2D&N'`T `:d@B0D@Q?2D&6dEG2 2D&-O:c>D@^@^ `dd@B0DD]@Q?2D& dEG 2D&!`;x `d@@ `d@A0D@Q?(``bg`bd"dڙ0DY@Q` d@@`xg`bd"dڙ0DY@Q` d@@`x!`d@@ `d@B0DD]@Q2D&dEG 2D&`e >D@^@^?2D&dEG) 2D&$g`bd"dڙ0DY@Q` d@@`x`ē'% `x `ux(``bg`bd"dڙ0DY@Q` d@@`x `xg`bd"dڙ0DY@Q` d@@`x)`@@+%>`@& :\d@@' d@+3` `x:\d@+&t@t@d!Ĵ!!`d@@d"0D@Y@Qh`b`pdd@&dh?d(``bd!* !dN`e"``@&`@*;D+@'`x&g`bd`@*`x<`db`Fd@:pdg`bbd@>>=Fd@)@+g`XdF~`CEeDF`@*#`xdek>Dp@^=D@]e`>c`"edHdG`A`J׀h@g`b|`@* @eD@^$`x D @@d&dG?dD+ `HeD`J eIdh^`\` ddie@Qd D *666 Dش@@ D@*$@@<`bڃaۂZڃaۂZڃaۂZڃa ۂZڃa`x@DbC Dԅ5$E`2dDCE D @@dCӽ+ dIhD%CCE D @@dCӽ@D+`HdD`Jh@dIhEԀ%C<`acY1YcY,YcY'YcY"YcYYcYYcYYcYYcY `x'`x'`xI`@666(:ZӜ۸`q̄eD`usD`b `b'`xf`b̄:D@Z;n`G#̄`G"dnhsAIՀ'pEą`XdĄ@M`AsEԀ dD60aEĄsEԀ g`|bddh-DpEԀ `P`Eh`b`1dh`beDdf`d̄v`EwԀԀ(``bdd=`b ̄ =`c`dЄ2D*0h`b;h`ā3 @@*d-dd`A D@@@$`daDde * `bЀ @@*g`|b̄1/dA"D 1@* ^DB!DL!EԀXO?<`4b`F@FH`bFg`rbd@7d@7ga#X(`cd۽۽d##d"%D#$%&'ga#X"(`c $%۽۽d#ga#X8d8`G?(`G q9+:,;-./0<1=2>3)RP<.Ѐ=/Ѐ>0Ѐ`AaDB=JCd@*(d@* d@&8`\dD`G@`G)9!9+:,;-1231:2;3+,-/Xd`eQd@*Dc)s`d+c)d@@'CK!Vad@'ba8DM`@&"ÁрcE dCׅELӀeec-D,E`AԄ߃aD)d`G),C-D -D+Eāрd.X+L`@&9+`AZ`AZ`AL:`XNx N D@^ cXOv~F=D@] cXO>>Dw@^ cXO4D`夅@^k`>D``\`d٘g#X<`bʂ"d;`x<`bd;`x<`bʂd;`x<`bd;`xee`Fce@*d;`xg#Xg`Pbg#Xg#XCDw@^ cXOlm>D@^`k cXO_=D@]=D@]`\`dMdG`MdD`M`G`MdD`M`G`MdD`M`G`M`CdD`LcFCO?`G`\e/FdCbڂɁ`Lb`M/Xj` x`bр`d+t` ``b` ddtudu`b`d ?Wg`b& eEHN`aAM@`XOx-A`XOxOd"`dZ(DZe<`b<`pdfDZ dZ+ET;7Xa`FN`.aAM@`XOx-A`XOxO!adX`.cd"`d#Hedѽۥ́څ<`b<`pdfDZ dZ+eET;6E`dDd1D@Q`b` d=`/x>`x`cӽѽѰ 1D@Q |` d>`x`Gā>`x1D@Q &`|b`@:ec `@:ecce`@6e`lb`|b`@:ec `@:ecce`@6eg`rb`Nb`A&e^a@&c^Zde`Dbd>`XNx&`c`xa`dXY`rc`@a`dXY`c`adY`d<`bʂd- `d2@&`bӥ`A6́`bNB`XO`xO=`/xfDWd@FNFE<`bdfDZ dZ+`XOxO7X*4`Db`E`b`E`Hc`a݁ԀaD`DbaEԀ`Ef`beD`:dD`b>`zb>.X<`Lb`Fb`G7:66 `bF`d<`bdfDZ dZ+NFE<`bdfDZ dZ+`XOxOY`d܄ڂ܄ۻ<`b<`FdfDZ dZ+Y`d܄ڂ܄ۢ :=`/x`b `d`e aXOdXcZڅ́`b`e?`cdZրZZZ`edZրZ/X`d@A`cdЀ áۣ`cdЀ adD́@BCDACXO`X"D#A$C!C`e׀ѽCA?`ddX@O)`@&@`.x`@6 `DdXOdD`"12Ѐ Ѐ3ЀA`vx`eԀdЀdЀ&F" g Ѐ&F"@g&F)`@ *\c`@+bcҽЀ\Ѐ҃XЀUd`XOZxA`Lx&F) &GcӀ`@:Z`d܄#:Z`d܄0:Z`d܄:Z`d܄:Z`d܄ `HdXO-`@: h`XNx&FA`XNxA`vxP: Z`d܄ `PdXO @:Z`d܄ `JdXOA`rx:A`XN}x `RdXOZ`d܄:n @@&2)12ЀЀ3Ѐp܄pdq `dnd@6PZ`d܄ `LdXO `NdXO= `PdXOA`rx`Bb)1Ѐ2Ѐ3 Ѐp܄pdq `dnY` d`@" h`XNxN&Fg`XOxO&FV)=`e dd@+h`b`0dA`XN}x^`EsDd@*Ԅ砖Z`d܄ `LdXO `NdXOf`b#A`XNx&Ff`bdۺ<`b<`jd&DZ dZ+d@FfD>`XNxVv`XNxdd`Xb젢(`~d<`b(`zddJ`b`dD`dZ/X`\(`~d<`b(`zddJ`b`dD`dZ/X`bdf`b܄dd e=`XN2x`cd|̄g`ve`@"3* `cf`e`EĄЀ% g`ve`E D@@Y`d܄NR`XOxO`b`dE`dZ/X`bdD`IxdGdDJ`bd `b@`dE`-dZ/X<`b*Dʂd-`b `dE`SdZ/X`bd۾`b@`ddde=`XN2x/X `Pbg`d `Hbg`dY`tb(`dwd"8d(` dd)f`b`4erDf`cd۽ۣqpG`dӆf`cdds9`bd^h`b`df`cd(`c9`|edGӀG`Dd[NR`XOxO`b`dE`dZ/X`bdY`d܄9`b K`XN+xF`xY` bc`@:n af`b@` ec$́d(`~b<`b(`zddJ`b`dF`#dZ/X`bddn9`b`Egf`b̄ۼY` bf`bs.dD:*eD&`bd@&`C(`~b<`b(`zddJ`b`dF`mdZ/X`bdE`xf`cӁ܄ۃssd^h`b`df`d܄G`x9`cсурѽY` ebEdA݁遽ѥڂ́bE:`&ca`E66 66eD̄`EaDa`E:`(ce@*d݁e@*d݁e@* d݁e@*d݁:`&caD`eaDڂbEӽ`Gڅ́́:`2c`b`EӆeDe`@&e`@&e`@&eY`hbeD`c`cنd`dbvf`XN:x`b*d *d*ddw./0123f`cddDJ`bd `b@`dG`bdZ/X<`b*Dʂd-`b `dG`dZ/X`bd۾`b@`dddh`b`pd D&e=`XN2x D@@`b`d`b`dG`dZ/X`bd=`bac`EeD&߃́cD =`b2db`@6`bd=`b̄=` b`bedjkmod@&J`x`b`df`e"l^d`b`d`b`dH`0dZ/XI`x`b`dی`b`aZJۡZn`@&2vd)c8"d!d`bd<`b<`.dfDZ dZ+`b`dH`rdZ/X`b`aZJۡZۆ/<`(b`F%@Hd@L<`*b(EԀ`F#+* @M<`b<`(dfDZdZ+d@L-D`F I`xdmI`x,D*(F+* <`b<`(dfDZdZ+<`(b`F+*1K`XNx`bd<`b<`.dfDZ dZ+`b`dH`dZ/X`b`aZJۡZw"&dmdo<`(b`F@H`FI`xlЀ+w`Ck*ci`XNxji`XNxefDiK`XN x`bd<`b<`.dfDZ dZ+`b`dI`RdZ/X`b`aZJۡZw"iFHi`XNxd!i`XNx#f`b܄ @H<`b<`LdfDZ dZ+(Ddo i`XNxi`XNx(F lЄ#`@"d`C(`~b<`b(`zddJ`b`dI`dZ/X`bdmmdjdf`b< E@@f`d܄یd*`b`d`b`dI`dZ/X`b`dی`b`aZJۡZE`xg`ve`@"=* `cf`e`EĄЀ& g`ve`E D@@Y`d܄ `PbV`SdNR`XOxO`b`dJ`JdZ/X`bd `Pbg`dqpddqf`bvDd*`b`d`b`dJ`dZ/X`b`dی`b`aZJۡZh`b`qdf`d ddpe=`XN2xf`e`ddC߃ЀHf`bd@| e=`XN2x `PbV`Sd`cd|̄E`x"f`bdpf`bdf`ddddh`b`pde=`XN2xi`XNXxG`xw`d+,- w+,`CdF,+(F-dF-d)Gc8"d!dd.X:`bC`A脐 aD dD *dG.XL`?xxQ`XN(xQ`XNxg)Q`XNxc8d":`XNxfEa}dd@&dcYdYڧ(`~b<`b<`.d~eDZ dZ+d]<`b(`zddJ`b` dK`dZ/X`b`d.<`b(`zddJd]`bdZ&F8`AL`0x}L`xe8ՀL`0xC&FQ`XN(x~d(g@g)+..+,//,-00-d":`XNxfEadcYK`qx.&F>`XNx DL`xO`x`dd]`bdZQ`XNx DL`xO`xK`x&F>`XNx DL`YxN`x(`~byQ`XNx`c'`da`cӽa`b`c`eӥЀ@GR`XNx `bdZf`edD`x'C`XNx `Fb`EՄ`E e>`XNxg`bd`bd `b@`dL`wdZ/X'<`bʂd-`b `dL`dZ/X`bd۾`b@`d D@@K`JxyQ`XN(xd)Q`XNxGb`dcaYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dM`$dZ/X`b`d!<`b(`zddJc]`bdZ&F=&F>`XNxL`Yx`d<`b(`zddJ&F>`XNxd]`bdZL`x`dd]`bdZQ`XNxL`Yx`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx'CaeǃY`d́X&F>`XNxddgde=`XN2xR`XNtx`b`d`b`d d]`b`dM`dZ/X`b`da`bd`@da`bd `dIa`b d^`b`d`b`dN`dZ/X`bdZd]`ba`b`ba`bN`XN]xde=`XN2xf`ed`XbdۥD`x` d c]`bdZM`x/X<`b(`zddJd]`bdZd.XdGF`e`cӣۧ(`~bٌeԀ `b`dN`dZ/X`bdZ`c'`dd`Zbda`cӽa`b`c`edAЀI@GXՀ`Ea`beD:d@*7Հ4a`bf`b'D>`AЀŅdDԀR`XNx'D`AсЀYhЀYdЀaN`x`bd `b@`dO`dZ/XFG`c<`bʂd-`b `dO`/dZ/X`bd۾`b@`dd`Zb<`(b`F `b`dc`b`dM`x'C<ЀN`x'C@`A>`XNx `Fb`EՄ`E e>`XNx`bd `b@`dO`odZ/X'<`bʂd-`b `dO`dZ/X`bd۾`b@`dyQ`XN(x` d)Q`XNxQ`XNxaGddYځY؂YYP`XNxy-D8d":`XNx<`b<`.dfDZ dZ+d]<`b(`zddJ`b`dP` dZ/X`b`dd]`bdZQ`XNxd`ZbdN`x`d<`b(`zddJd]`bdZP`x`d"<`b(`zddJd]`bdZ&F &F>`XNxN`x`b`dQ`XN=xQ`XNTxZ`XNxR`XNHxQ`XNx&F>`XNxe=`XN2xR`XNtxc`b`d`b`dM`x D@@K`Jx])dA`@: 1`b`d': "`b`d:e:e0:e `b`df/X'CdGYdA݁bD́XX`c-DȄdEdAAĹX--C`G~'D˃D,A `G~`É.Xg`Hb*d *d*dd.X`ef`c'B>|Ԁaae\f`baDf`b.X'B2ac$:: `@+e׀c: `@+ e׀c,:`@'cY`hbY`jc`@*cd *cd*cdcdPQa`bQ.X'C+1,2-3.X./0` dd(.Xg`fb܄(``bd(``bd.X'CeDž`GZeDž`GY eDžӀ(`b<`e?`d`A脥<`ed́a`c&F123.X'D`AC腔&& *`@* a\Ga`bP'Aa`cӽYЀYЀЀdd.Xf`cddۣg`cddۣ'D'DЁaf`caDۣf`bсaf`baD.XY`bf`*cd۽۽۽g`bd.Xd]<`c!Dd`bdZ`*c `@a`~dXY/X`b`d/Xz./0`bg`cӣe~g`bd|d (|`E-d`dxd`bd D&d'`d @*`bӱ=`LbdeDq @@&n`ez@~)`d[`Ce @&|dGdA݁bD́XX`c-DȄdEdAAĹX--C`G~[ڤ˃ @&dD,A `G~`Éz-D8f`bf`b`Zcq\`G`VbeA`EaDԀԄ`E`TbĄ@J`Xbd `ddT`xdR`~x`Xb`Zb*D܄d*D̄d@J`c @@&dD6 :`6c*DG`bd `b@`dS`dZ/X<`b*Dʂd-`b `dS`dZ/X`b@`d dW D@* `b`d D@"T`rxz{d":`XNx<`b<`.dfDZ dZ+`bdۯ(`fb<`b(`bddJ`b`dT`%dZ/X`b`d <`b(`bddJg`b(``bddS`|x`bd۱(`fb<`b(`bddJ`b`dT`fdZ/X`bdW.S`|x`bd۱(`fb<`b(`bddJ`b`dT`dZ/X`bdS`|xR`x(`fbٲ(`rb<`b(`bddJ<`b(`nddJ`b` dT`dZ/X`b`d<`b(`nddJS`|x`dW d <`b(`bddJS`|xW<`b(`nddJ`bg`cӣЅg`bԀeDg`bAd`bf`c Y`d܄`bd `b@`dU`$dZ/X~<`bʂd-`b `dU`JdZ/X`b@`d D"e=`XN2xV`x``cÅEM'`eEL@HY`b(DԄ脢-E׀eGeG eЁGaaD,BZZD(BJJBHD(D'`cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB`Cf`beeELDH(E׀6Z>`Edԅ,DdGcBeF(EրbF`AZ>`Edԅ,DaGЀfB`AZѣdEۣfBZeDa\fB D<@@`b`d`bdZ/X<`b(`bddJ`bdZ/X`b`d/X`b`d/X @&``c`d#=`Lc`EDžc\d1PY2ЀY3ЀYЀvD׀=`Nc=`Lb`dЀhÃ%dDdG123`|8 D `Bb`@:d@*;W`XNYx`dЀ2-6f`d`C X`XNx`deDЀ`>`CaD`dЀf`bdۇeăddG`E;F܄dX́؃d@Mae@*dD-ZdG-́Z2cÃae@&Y ȲdYYYЀ2eăa`@"*`@: $::6`XNx`Va`c`TbaēdD|̄eD`Bb| `Pbg`d e=`XN2x`|X`exEMX`XNx`dԀ9cD"`GeԀ*X`XNxe\X`XNxgAX`XNx-DEMX`XNxeAX`XNxf`beDX`XNxf`beD-E`|dAef`b@N.Xf`b.Df`bZZ`C6ZdE`AcD"`G`\cD"`G`EdDɁՁaDǃ߃X`XNx`dԀX`XNxef`b@N.XcD"`G`EcD"`G`G.X/X`b`d/X(`b<`b(`ddJ`b` dX`dZ/X`b`d Gg`Bbo`dXO)O`b`aZJۡZ`zb*Gg`Bbf`dXO g`Bbi`dXOOHNdAAM@`XOx-A`XOxOZ`xg`Bd`Gf:YP[`8d[`:dل[`Bd[`Ddٽ[`Fd[`Ld[`Nd[`/Xg`EԀH`zc&Ag(Fdd .+/,0-./0Cd@*`G@`G)c(":`XNx~<`b<`(dfDZ dZ+d@FHo`_x+gDЀ8{ܠx`e Ԁ`dpЀg`clg` d܄Ѐ`Ѐ]\`d ca&eҡСdDՀف&FC`Gd@&@`G)~(d8d"(+,-./0`E&F3dD2eD1:`XNx<`b<`(dfDZ dZ+g` d܄o`x&Fk`x`dfE FKFI0eF0/Ѐ)F/.ЀeF.Ѐ)F.Xdh`b)`@64:dDeԀ/+dD DdD6&6'6(6)@6*6+6,6- 6(06)P6'6(6 6$6"h`bh`cdۣj`Bxr`xq`Zxq`xq`xq`xq`xq`xq`7xr`xr`Rxh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOxh`bdp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ+Ѐ,Ѐ-Ѐ.Ѐ/Ѐ0ЀVes`XOxh`bdp`xh`eh`cdaѥрp`xh`eh`cdaѣрp`xh`bh`cdۣFJ+Ѐ, Ѐ-Ѐh`bd +`dЀ,3Ѐ-0Ѐ-8(`DbdGЀ`Ac `Fd`EХЀeD́d@'HРdD`EdDԀ*Fp`xh`bh`cdۣ.Ѐ/Ѐ0Ѐ\es`XOxp`xh`bh`cdۣ+Ѐ,Ѐ-ЀVes`XOx.Ѐ/Ѐ0Ѐ\es`XOxh`bdp`xh`bh`cdۣ)+:+Ѐ,Ѐ-Ѐ@h`bBh`b@GVeh`aeCPҡЀҡЀҡЀ'D̄@G)'.Ѐ/Ѐ0Ѐ\es`XOx +&h`bdp`xh`bh`cdۣ8FJ`Ah`b6h`b6aDs`xs`x.Ѐ/Ѐ0Ѐh`bh`bh`b@G"\eh`aeCPҡЀҡЀҡЀ'D̄@G h`b:s`x8s`xh`b6`DbdG<9c`A`FdР́d@+*Р'`DbdGЀl`Ac `Fd`EХЀeD_́d@+ РdD`EdDԀMe~`GāaE&~`Gā&`GЀ-h`bh`b`AŅh`dā*F\cҡ۽ۣh`bd*F./0*Fp`xh`bh`b@Gh`aeCPҡЀҡЀҡЀ'D̄@GH/X`*b`d``c`f `{d̄`*b`d` `x! Secondary F's~ 8   $  F@p 4 ''dd'/  d #+ `xA`x`x`xCD`xD`xF`x`x`xLN`xL`xC`x`xF`xGB`VxC`VxD`VxE`x|`d)G` x@$XA!X"X `x"`vxE!X`x ` x`x@`xA`x%`-xC`x$`xE%`ux`x=`%x?`Gxy=`.x$=`.x=`xD=`.x=`.xG=`.x0`7x1`x(0`xD0`xE0`xF0`x|`d)G0`xoo?PgdN-SV8hXoooooooooooo h0313DD031303132323x==3F44645"4546"454545"45 4~7 45 45  45 45^45p4545:45D45F4540744f45j4545vg45499 4545 45a!45a$57%57&57'57#45(77*45+44x,48f-48.45f:45g)5<5^X45454540747Y45|45z45445454-8~47t4r74545/4504K814844J64L 64ZA6444844$44`44\44v44r44>$44 %44 &64t '648E44G44NH64lI64nJ44K44M64\P44YO64X64`446464b44 h64:!h64B "h64 #h640 @44A44 Y"B45C64D64F44 L44444444f64d64f*55596^mY0$\$Y$z#\$\$b$b$b$$%{#w$HH  \ "t$& (*,.0 246z8 :$<>@BD F&H[JL)NP R TVXZ\^`b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.eg\2e~Z~n*>Rfz"6Jz;;;;;;;;;;;0;;;c;q;;;;;;;;;;;;;;;;;;$ZBZFZJZNZZ>g>g>g>g>g>g>g>g>g\^Z>>bZfZ>gpZtZxZ|ZZZZZZZZZZZZ>g>Z[> [>> $[([,[0[46ێYYٞ>يٌ٦٨٪ٴٶپ٠٢٤lnFJLNP>8>PZ\>^pr>xz|~ـقلن:Z "$&Z*Z.Z2Z6ZZڪڬڮڰڲZZZZZZZٮ>gBD8>H٠>>`j>:d"bflZ>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>g>gٺΘ\`TVYY ZZRZVZZZZZZZZZhYjY,28DJhn̘aa`$ P[<_xbda*g8Yg4UYYYYZZZBZZZpZtZxZ|ZZZZZZYY>gYYYYYYYYYYlYFY>g8YY ZZZZZZf~@    $L~  F@PX~Z~&~   8 č~!ZFILE: EPRIMSYM,T3.10-04,F3.10-04,01/17/2002 PRIMARY 3 72 36 40 ~~d d d d d d d d0D`x DAdd@+d@Qd@Pd@@`*b`d``(b(`d(`1@&`U`"*2:BJRZbhpz!`}h`}`}}`}`}}6`}m`}`}9`}?`}B`} `}`}}`}}6`}`}`}}7`}B`}`}`}`0D `dȁ>cdY`Av`>c`a`f `dXY`c`a`f `dXYXO.XO0DdceXOA`x`|c`da`F܄́d`eD@^ c`XNpx>D@^ c`XNpx/X.X0Dd@@C`exDĘ0D ``@`q`>exDĘ `cexDĘ`d`Av?`d`ddD+P`d`dЀ`d`#dЀ`dѺ`EdЀcG`C`d`vA<wD`W@J*D D@@/@@ D`A`daD@@@@dD? dDd`d`d`d?uD&& & & @&`e`d$g`\`d`d@E+@E`XOxXOJfPeRaQ @g&E@F`dP R~q&\`dٶ`e`d$g`\`d`d@E+@EXO<XOfPeRaQ @g&E@F`dP R~q&\`d%F&ADcՁc`FBaDŁcEŁ`EdԄeD/X%DЀЀЀЀH%Fg/X`q̃eD`u?ga#X@DDEDFDG? $Dg$D? `dDXCaC`E$D?'` d`du?`(b`4d$E'=`dga@ D ߴ@@`f`d`AcXY`&d`AcXYd@Pced@Pg`f`c`dЀۃ D@@d@Pced@P `x`dȁ>cdY`Av#X~`d$Ega#%E+ `pca$D'ӣԀ́$dXad"%DZg ӾԀ́$dXga#XbCdC`A܄"ZbDɁXga#X"bC̄ dAՀdCeAFdXɁga#X`d@KK`A؄"%D#fEHcȄ+FXeFɁga#Xd@E`d@Fw` /`b`XN{x%D`G~`XNx%D`XNxaa\ZdG`XNx,dD`XNx&́`XNx`z-$`XN{x~`XNx`XNx`XNx&E%DԀ@E(`dU`ga#Xw``XNx`XN{x~`XNx~`XNx`XN{x~`XNx/`b`aa\`XNx`G`E`XNx́Z`XNx`XNxU`ga#X``.X``.X c?@&σ.Xc`@*```?@&dd.Xc?@&܄``.Xt c7~@AAŁ@ Aρ@ ʁ@  AAہ@ށ@Aԁ@AAс@01A3@26@754A<@=?>A:;A9@8(@)+*A./A-@,$%A'@&"@#! A`aAc@bf@gedAl@monAjkAi@hx@y{zA~A}@|tuAw@vr@sqpAP@QSRAVWAU@T\]A_@^Z@[YXAHIAK@JN@OMLAD@EGFABCAA@@c        < t 8  \ "T$&j(*,.0 246z8:$<>@BDFHJL NP R TVX Z\^&`[b, .,.,.,.,., .,$.,(.,.. ,4. ,8. ,<. ,?. ,C.,F.,H.,K.,P.,U.,Z.,c.,m.,v.,.,.,.,.,.,.,.,.,.`_d`,dE`dG`d@ABCDE ~ G` d N`@99SA01000000Primary F's F3.10-0401/17/2002~~ &~~ ~ ~~~usbevtusbrhxfer g@o@w@{@@@@: USB revision %s, not supported %s: can't register softintr usbreausbtskusbtask-hc%susbtask-drunable to create task thread: %s usb_create_event_thread task<#P#usb_doattach%s: root device is not a hub %s: unable to create event thread for usb_create_event_thread%s: root hub problem, error=%s couldn't establish power handler usbusb at %sunknownpre 1.01.01.12.03.03.1p#l##4 #4#l!6D#4usbd_transfer: not doneusbxferWARNING: pipe closed with active xfers on addr %d usbdetusb_detach_waitold: didn't detach usb_desc_iter_peek%s: bad descriptor %s: descriptor length too small %s: descriptor length too large addresshub-addresshub-portclasssubclassreleaseprotovendor-idproduct-idvendor-stringproduct-stringserialnumberusbverbose port %d configuration %d interface %dusbififusbdevifvendor %4.4xproduct %4.4x@@@@@@@&@2@9@A@Q@Z@c@k@z@@@@@%d%x.%02x%s (0x%04x) %s (0x%04x), class %d/%d, rev , addr %d%s, %susbdlyusbd_fill_iface_data%s: bad descriptor: too short %s: bad descriptor: too long %s: bad descriptor: iface desc %s: no desc found usbd_set_config_index: illegal index %s: device addr %d (config %d) exceeds power budget, %d mA > %d mA usbpipecbusbroothubif%s: port %d, set config at addr %d failed usbd_new_device: cannot find HS port%s: No free USB addresses, new device ignored. %s: at %s (addr %d) disconnected NORMAL_COMPLETIONIN_PROGRESSPENDING_REQUESTSNOT_STARTEDINVALNOMEMCANCELLEDBAD_ADDRESSIN_USENO_ADDRSET_ADDR_FAILEDNO_POWERTOO_DEEPIOERRORNOT_CONFIGUREDTIMEOUTSHORT_XFERSTALLEDINTERRUPTEDXXX@@d@d@d@q @c@c@2@3@ @ @?@ "@D@Q2@e@eaQ@XBBp@LT@LU@q@m@m@m f(pt""(4I4b '  <         )3      @@@@@@@@@@o7@O@R@T@a@c@q@}@@(@v@&@A@N@j@o7@gO@%@+@4@>@0@`1l703% cU cU c9 : %mZmw`%  2 @@watchdog timeout usb error on tx: %s usb errors on rx: %s rxeof: too large transfer (%u > %u) usb error on intr: %s open rx/tx pipes failed: %s tx list init failed rx list init failed Ethernet address %s couldn't establish power handler usbnetLwG$@hub not fully initialised, but child deleted?illegal enable change, port %d port error, restarting port %d port error, giving up port %d port %d reset failed strange, connected port %d has no power device problem, disabling port %d singlemultiplesselfbus : %s %s transaction translator%s hub depth (%d) exceeded, hub ignored %d port%s with %d removable, %s powered no ports, hub ignored setting hub depth %u can't set depth no interface handle can't enable multiple TTs no endpoint descriptor bad interrupt endpoint uhubexcannot open interrupt pipe port %d power on failed, %s couldn't establish power handler uroothubuhubuhid at %s reportid %d   )%uu 0 1 8%u   3 D D%uu < 8 2u 0&'u 1&u 0&u     u ;u )%u&5Fu 3 4u&6F  0 1  2 5  :uu ; u%5E u%5E ) uu&5F )u&5F 2 5u&6F  0 1  3 4 :uu ;uu&5F uu&5F  uhidev%s, iclass %d/%d couldn't establish power handler could not read endpoint descriptor endpoint %d: ignored no input interrupt endpoint no report descriptor %d report ids uhidev_intr: bad repid %d unexpected normal completion of async xfer under lockuhid_usb%s: was console keyboard too many Variable keysbad modifier sizemultiple key code arrayskey codes not on byte boundarykey code size != 8 couldn't establish power handler attach failed, %s PPP@U$PU$L$K$@L$ This port is broken, it does not call cnpollc() before calling cngetc(). This should be fixed, but it will work anyway (for now). 5dd512 ] YZ[b^U\ ]*L(I$_%`&a'T-g3V7c8W:;< =>?@ABCDEOMPJQNRK ukbdPNNLN#9_@_'T~unknownf$\e$g$m$l$n$ %s T*@^*@b*@9*@>*@D*@H*@L*@using %s over %s quirk init failed could not read endpoint descriptor endpoint not found %u/%u/%u %s: Get Max Lun failed: %s unable to get Max Lun: %s cannot open %u-out pipe (bulk) could not open %u-in pipe (bulk) couldn't open %u-in (intr) failed to create xfers command protocol=%#x not supported bus attach failed couldn't establish power handler inoutINOUT%s: BBB bulk-%s stall clear failed, %s %s: Invalid CSW: sig 0x%08x should be 0x%08x %s: Invalid CSW: tag %d should be %d %s: Invalid CSW: status %d > %d %s: Phase Error, residue = %d %s: transferred %s %d bytes instead of %d bytes%s: BBB reset failed, %s %s: BBB bulk-in clear stall failed, %s %s: BBB bulk-out clear stall failed, %s %s: Unknown state %d%s: CBI bulk-%s stall clear failed, %s %s: CBI intr-in stall clear failed, %s %s: CBI reset failed, %s %s: CBI bulk-in stall clear failed, %s %s: CBI bulk-out stall clear failed, %s SCSIATAPIUFIRBCISD-ATABulk-OnlyCBICBI with CCIumass r$ tr$  % L Pr$Lm L    o4! o! o ! qj! A! A A A @ 0U 3t Q % Q B Q $ Q , 0 De 3 @ fc 46umass_cmd: large datalen, %d %s: Unknown status %d in umass_scsipi_cbscsi~!{!T~!x!atapiF  @@@ @ @AA@:F:FP 43 !      @ @ @ @ A n n@n @nn@0f @  * Q k k"k"k"k"k @ ^zF |%s: reset failed %s $ԃ$Ȃ$@|$|$}$,z$y$y$failed to set configuration, err=%s getting interface handle failed couldn't get endpoint descriptor %d missing endpoint %s: EEPROM read timed out if_aueusbnetLwG4y$0@0@aue %s $ȉ$2VZP~" `"'`{%1no union descriptor no data interface setting alternate interface failed could not read endpoint descriptor unexpected endpoint could not find data bulk in could not find data bulk out faking address if_cdceusbnetLwGX$2@2@cdce# # %s: reset failed %s failed to set configuration, err=%s ď$$$$Ќ$$getting interface handle failed couldn't get ep %d %s: read MAC address failed if_cueusbnetLwG$ 3@3@cue@ h'W W@ @EEE }WQ  k"BFFeeeZZ Z 0 %s $t$P$|$failed to set configuration, err=%s %s: warm boot, no firmware download %s: cold boot, downloading firmware dϼWg($g"  Yg$ϒWW WVp  W@Y@ b WRVWV `YYW Wx,VH 7hW b' pDP g H ' H7 `!7>#W?g0L0 H Qϟhϟ7 pPgpߟWWz nb'4' 6W W w W w w /B w zBz'P4w y'P4w y`0PP0zBzW. \'^ϟLiW3'ز'Ҵg`' 'ߗ rbdd$'r'd$ WbpWd d02 dbWdp r'xb'r@ 0d QWj j'j'Rljl`ϟh b r'rϗ ',wW" '' Ag0 0  @YIJg P |wwLdwww w~dPTp\p\`0    Sxd Ȃ ςd‰0`xω Sy‰0zߗ f h f h d02  b7Wh=$ dgw*f0 w f'w f  'wfD'F`'bhW  h lPgl dbWbpߗ  $ dg zfwW P'RW W wX'Zwp'rw' wd'fw@\'^w76'W WP'RT'V 4wW''.W ߗ nb'n'Rpnph?3WR      X T  D'''tD' | LH'Vr W IC `J |gQ Ibuߧ$"  ,  f$("` 4 >   ( ( ' W* 7* Ҳ < W* '  ''\'AgP gZ' ^ `ZAQϟ  Y' |Y  IZ` HAPYYW&~\AgZ' ^\ `ZAQ W~ @'' ' "AgZ^'\\ `ZPY`X I JX@D' }D@A7PW'vA@D't vA؟D'(g$Wz "g>. > T'R  @ x ''|  ~) } 'jjl'nnp'x'b'd t vr @zQ  v zQWR W 2g&  W#@@W @ @ ߟϟ w w  "g"w g"g"w " W Wz w   f  gw dWșgL  7 AHdwA`qWC!C!C!%s: failed to load code segment: %s d$.,>DHP\`flpvtz~ $"*06<NRX\ &l *.4:DNZ^jr08<@HFT^dtx,0JVZ &.4HRd $*2808<DBH    $ ( 2 F J P T Z ` |       $ , 2 < F L P T Z ^ f l r x ~ |  $ @ D H N L R h l p v $ ( 0 6 < @ J P X V \ ` d     " 0 ~ ,>LP^%s: failed to load fixup segment: %s d%s: failed to load trigger segment: %s %s: reset failed loading firmware failed getting interface handle failed couldn't get ep %d missing endpoint could not read Ethernet descriptor if_kueusbnetLwGܑ$BG@IG@kue P@9WPurl_uno_mii_read_reg%s: %s: bad register %04x %s l$ $$$`$̚$p$ $failed to set configuration, err=%s failed to get interface, err=%s couldn't get endpoint %d missing endpoint read MAC address failed url_uno_mii_write_regif_urlusbnetLwG($H@H@url( B  w *w +w +~ W UP  << 1b0 0rk {&"79n= wF@W wa-  Vn media change failed read PHY failed can't read rxmode %s @$0$P$$p$l$أ$$failed to set configuration, err=%s getting interface handle failed couldn't get ep %d failed to read phyaddrs failed to read eeprom failed to read ethernet address failed to read ipg if_axeusbnetLwG$ K@K@axe$u$u$x$x$Pxmue_csr_read%s: reg = %#x: %s mue_uno_rx_loop%s: packet length %u too short %s: rx_cmd_a: %#x %s: invalid packet length %d mue_uno_tx_prepare%s: packet length %d too longmue_csr_writemue_read_otp_raw%s: not ready %s: timed out mue_eeprom_getbyteLAN7500LAN7800 %s $$h$$T$H$@$$$failed to set configuration: %s failed to get interface handle: %s failed to get ep %hhd failed to find endpoints mue_chip_init%s: PHY not ready failed to initialize chip %s id %#x rev %#x failed to read MAC address mue_uno_mii_read_regmue_uno_mii_write_regmue_dataport_writeif_mueusbnetLwG$M@M@mueF hF  %s $8$P$`$$$$ $failed to set configuration, err=%s failed to get interface, err=%s couldn't get endpoint %d missing endpoint read MAC address failed if_udavusbnetLwG$N@N@udav42-# s%s: %d silo overflow%s, %d ibuf flood%s  !)com: unsupported I/O width %d$$$0$$0$$$l!684device enable failed timeout while waiting for BUSY interrupt acknowledge timeout while waiting for HALT update acknowledge 0x%x 0x%x 'ns16550ast16650, broken fifost16650ans16550, broken fifons8250 or ns16450, no fifotl16c750ns16750Au1X00 UARTns16650, no ERSOMAP UARTIngenic UARTTegra UARTBCM AUX UARTDesignWare APB UARTNXP UARTDesignWare APB UART, no fifo is_consoleforce_consoleskip_attach_delaycan't re-init serial console @%lx fifolen: %s, %d-byte FIFO : %s txfifo disabled console Could not create workqueue: %d unable to flush cache timeout draining buffers failed to flush cache i/o blocked while suspended lddrain(%%%l% %%<%(%8 %%s, %d cyl, %d head, %d sec, %d bytes/sect x %llu sectors (%d bytes/physsect; first aligned sector %u) couldn't establish power handler %s: not drained %l%(%l%%t% %%l%%P%l%47l!653 %lddk_subrLwG%S@S@   +-/, ,Lucent/Prism/Symbol 802.11 controlswisysctl_wi%s: sysctl_createv failed (rc = %d) timeout in wi_seek to %x/%x %s: failed in wi_seek to %x/%x detect auto increment bug, try again command timed out, cmd=0x%x, arg=0x%x command failed, cmd=0x%x, arg=0x%x wi_cmd: busy bit won't clear. xmit failed wi_push_packet%s: %d tx cmds pending!!! %s: cleaning outstanding rssadapt descriptor for %s record read mismatch, rid=%x, got=%x record buffer is too small, rid=%x, size=%d, len=%d %s: invalid channel %d wi_write_txrate%s: tx rate %d -> %d (%d) wi_start%s write fid %x failed init failed failed to allocate %d bytes on NIC timeout in alloc tx buffer allocation failed %s: interface not running %s: device timeout wi_rx_intr%s read fid %x failed wi_rssadapt_input%s: null nodewi_tx_intr%s bad idx %02x %s null node, rssdesc %02x %s txpending[%i] wraparoundwi_tx_ex_intrtx failed, retry limit exceeded, max transmit lifetime exceeded, port disconnected, invalid format (data len %u src %s), status=0x%x wi_scan_result: unknown firmware type %u Z@Z@Z@[@[@F[@o[@[@[@[@ [@ [@ \@ \@ \@1\@1\@1\@T\@T\@T\@y\@y\@!\@"\@LucentSymbolIntersil could not establish softint could not get mac address, attach failed 802.11 address %s %s: using %sUnknown PRISM2 chipUnknown Lucent chip %s: %s Firmware: Primary (%u.%u.%u), Station (%u.%u.%u) using default channel list no available channel no supported rate list Lucent Technologies, WaveLAN/IEEESony WaveLAN/IEEELucent Embedded WaveLAN/IEEERF:PRISM2 MAC:HFA3841RF:PRISM2 MAC:HFA3841 CARD:HWB3763 rev.BRF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.ARF:PRISM2 MAC:HFA3841 CARD:HWB3163 rev.BRF:PRISM2 MAC:HFA3842 CARD:HFA3842 EVALRF:PRISM1 MAC:HFA3841 CARD:HWB1153RF:PRISM2 MAC:HFA3841 CARD:HWB3163-SST-flashRF:PRISM2.5 MAC:ISL3873B(PCMCIA)RF:PRISM2.5 MAC:ISL3874A(Mini-PCI)RF:PRISM2.5 MAC:ISL3874A(PCI-bridge)RF:PRISM3 MAC:ISL3871(PCMCIA)RF:PRISM3 MAC:ISL3871(Mini-PCI): failed to clear NIC buffer at offset %x - check configuration Ethernet address %s %s: device timeout %s: NIC memory corrupt - invalid packet length %d device enable failed yyyyyne2000_write_mbuf: negative len%s: remote transmit DMA failed to complete THIS is A memory TEST patternwhere did the card go? setup failed 10base2, 10baseT, 10baseT-FDX, auto, default [0x%02x 0x%02x] auto 10base2 10baseT-FDX 10baseT ##$atarst%s:%d: %s %s:%d:%d: %s __wdccommand_kill_xfer: unknown reason %d __wdccommand_kill_xfer%s channel %d: reset failed for drive 0 drive 1 atapiatatimeout not expected without pending irqlost interrupt type: %s tc_bcount: %d tc_skip: %d atapollatadrdyatacnfX%%0%%%atardl4%\%@ 4%\%@%\%44   @ @ @  0        @* Root hub ) 2%%%%H%D%+CP]j 9999:OHCI root hub%s: %u scheduling overruns %s: resume detect %s: unrecoverable error, controller halted %%%(%P%%&%<%t%X%%P%%%@%%l%X%%`%X%ohci_setintr: 0 interval %%&%%P%\%X%H%h%\%T%%`%,%ohci_device_isoc_abort: early return ohciabt2WARNING: addr 0x%08lx not found , legacy supportohciabtohcixferOHCI version %llu.%llu%s unsupported OHCI revision      SMM does not respond, resetting %\% %%%%|%%%reset timeout %s: dir offset too large on fs %s (mounted from %s) %s: dir offset too large for emulated program /usr/libexec/ld.elf_so/libexec/ld.elf_so%s-%s%scompat_utilLwG&d@invalid AES nrounds: %uBearSSL aes_ctAES-CCM overflowh@vh@~h@,&>h@h@vh@~h@n@ &h@h@vh@~h@Jڧo h@h@ vh@h@ag@h@ vh@h@Q?}-g@h@ vh@h@@ZC˔g@h@I;0hey\L*JͬQJ}k-(*q8dڅWr65)\9:;Xacfm_kaÄn7Tm]4`Y ms  ׂ%b6ߓk @6cryptoaesselected pi@k@ j@l@ j@`m@ AES is bustedaes: self-test failed: %s AES self-tests failedaes: %s  ֪tүrڦx֫v d=h0tNɿlY iAG5>l2<詟PW"^9}U= kp_D MN&GC5ezT2Wh휾,NJM+0 XF\CTJXGHV\C@IMHCBXQU~AbE *K:b]fA rD~ʇ><aQi4|Q7*S |Cw~~/h`BT_#zZ=)R:`x',#خ2 3x q] sŸvĘΓrQD]@ޮhgmHoOuSsQVɧo)LlY=:uRGu'T9 ܐ_{ HRE/E`Ӈ0 M3d |Ta)yץdJ@%Aq%Zr NZfO~W+$y̿ y7xr _xx.'c&iX J?2ިM ~ig@2G0mc "`$aV]ZY  3x q]־ IMs>sh9؝ƌr}nB?TSx1WDGeGf;΍ g?}\JB:.ްy#d_V|\Iėx1<֖U`)$b/ KNMMWRIIGBII $y̿ y7}#$z4Ny1P&vkvP_>|-Fei7%7HQXM|%Ix)v:BN%s AES-%u-CBC enc: self-test failed %s AES-%u-CBC dec: self-test failed %s AES-%u-CBC enc inc %u: self-test failed %s AES-%u-CBC dec inc %u: self-test failed %s AES-CBC overrun preceding: self-test failed %s AES-CBC overrun following: self-test failed    !"#$%&'()*+,-./%s AES-128 CCM encrypt auth/ctr (16): self-test failed %s AES-128 CCM encrypt auth/ctr (48): self-test failed %s AES-128 CCM ciphertext: self-test failed %s AES-128 CCM decrypt auth/ctr (16): self-test failed %s AES-128 CCM decrypt auth/ctr (48): self-test failed %s AES-128 CCM plaintext: self-test failed 1AY&SX#bd3'A7Q tE'((EE#S`(tq5&bIwW$piYWIfv''GvH0ϦnK2%(}ӁnjCD_3V'ص@6ݴT2c*S 3%ߔz\Q,f`ΓfI"aF ΄kܛJvz ae^-RQ1tQ;:/wlpϛ?^H#W;]1vJfh?Dh 53EKWvlI ^pi*}!ԧAM_)a:uq#)*>z}}U\m }%s AES-%u-XTS enc: self-test failed %s AES-%u-XTS dec: self-test failed %s AES-%u-XTS enc incremental: self-test failed %s AES-%u-XTS dec incremental: self-test failed %s AES-XTS overrun preceding: self-test failed %s AES-XTS overrun following: self-test failed   !"#$%&'()*+,-./%s AES-128 CBC-MAC (16): self-test failed %s AES-128 CBC-MAC (48): self-test failed cryptochachaselectedchacha: self-test failed: %s chacha: %s LwG]&w@expand 32-byte kPortable C ChaChaLx@^&4k&@h&o&(_&Dw&4o&@ABCDEFGHIJKLMNOPQRSTUVXThe dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.The dhole (pronounced "dole") is also known as the Asiatic wild dog, red dog, and whistling dog. It is about the size of a German shepherd but looks more like a long-legged fox. This highly elusive and skilled jumper is classified with wolves, coyotes, jackals, and foxes in the taxonomic family Canidae.EYNHa,P/ ~Y*S鍍d@7[& #1< HW]M ,g;fosa'w :kXBH㩴ٍ ~z0{f31d$ l?OhD0V:D+HϦFKtB@|Cv`[hFnEu#aR ktjtFA^{*)*IWx R ?*j~h|y` HCHlˇ_ E瘚 H'QJm\bאc1]BIt8-d5!w.s+o &mZn9 t1=._Ÿ0^ASm0pxZip"˘jQƧ=v䓚!:oW o!q5W:NRDu{=-oqV8c^U(R=ؖ *w}؋If6U3mUؕ22UXoÌR )'5»;D!UhF/|,Əͳy2qٯMB#8VoD:Hm3Oj3mv[xchacha_streamexpectedxchacha_stream_xorjUS_&)ûIt~._dyz,(4y:b,ia /A&chacha core 1"3DUfw̻wfUD3"-chacha core 2  J1AY'A;B'{BP}sՊtS.&hchacha@`@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& Nuy6Urwk=veKpm5?R/XS?pFRD+}!БwG"lF4v!/wZ}NJؓM^,|0E'w;>5tv0eF9pJ4)N~_I<@;ruf8) ^(P  <`*KO4=I|`U{V;Q@؊@]Aa4]1Y_"7]fϪܐYye5ꅙN7A7 u] F/"lJ}d qո=Hጟ\̤~|f!& ;0yfe}Xq@߾ށM"m5?R/XS?pFR|Z-*f:+KOyQ$:顂psq$c(N~czt;6DɆ'@ZzF|3@ 0bS:FȲc\Tn~.3h8}ȉ0Ͳt6ѽHh@`@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)]رlbM*i֦n6۪;(;q{3n[.nZH/vy,c*ڌ}8HHq f@ZsyTHh@`@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪlE˳#bk'ȆEœpÄEw'iR_ A0qYHuhhOިXr^>34 z3Ӑ3`X7^s50uRXȠ^(Q3X؛r%ߞ;6]6: {AD^q_eNNL4ʧ= 1@dO*T%SRQt@h@؊@DtxnuUQ]lRϰqbiǓ4'g_Bj ȝ|na vlУN9&id89יbeDmcT2-qVKEo6B*Z5)ʪ6̼W:6|5:)zflQLGK5uM} uwMai[#xv%43|G- O0dz,pgR'CY,Og2[6@Pq9+4;4t?GuW{Nl>2FLQiq{ŵ_rieee80211_crypto_newkey%s: invalid cipher %u <@E@O@\@f@%s: unregistered cipher %u, load module %s %s: unable to load cipher %u, module %s %s: no h/w support for cipher %s, falling back to s/w %s: no h/w support for TKIP MIC, falling back to s/w %s: unable to attach cipher %s %s: no h/w resources for cipher %s, falling back to s/w %s: unable to setup cipher %s ieee80211_crypto_setkey%s: %s keyix %u flags 0x%x mac %s rsc %ju tsc %ju len %u %s: cipher %s rejected key index %u len %u flags 0x%x %s: no key index; should not happen! ieee80211_crypto_encap[%s] no default transmit key (%s) deftxkey %u ieee80211_hdrsize%s: control frameieee80211_crypto_decap%s: WEP data frame too short, len %u wlan_wepwlan_tkipwlan_aes_ocbwlan_ccmpwlan_ckipieee80211_hdrsize%s: control frameccmp_setkey%s: Invalid key length %u, expecting %u N@ &&&H&L&&D&[%s] Missing ExtIV for AES-CCM cipher [%s] AES-CCM decrypt failed; MIC mismatch AES-CCM[%s] key id %u is not set (decap) [%s] key id %u is not set (encap) NONE@(&,&0&&h&8&P&Ƅ ֱTP`}VbME@Ɏ Ag_E#S[u=jLZlA~O\hQ4sSb?* ReF^(07 / 6$=&iNtX.4-6[Mva}{R>q^h,`@yFgKrޔԘJk*OņךUfϊDx%K]?!HpcwucB0 mL5&/ᾢ5̈9.WUGz+2ўfD~T; ʌ)k<(yv;VdNtے lH]nCĨ917Ӌ2CYnڌdҜI%ϯʎGooJr\$8WsQ#|!>ݖa B|qؐ_jiX':'8+3"p3-"< IxPzY e1ƄÂ)wZ{m:,ieee80211_hdrsize%s: control frame0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-out of buffers with data_len %zu tkip_encap[%s] Discard frame due to countermeasures (%s) tkip_setkey%s: Invalid key length %u, expecting %u [%s] missing ExtIV for TKIP cipher tkip_decap[%s] discard frame due to countermeasures (%s) [%s] TKIP ICV mismatch on decrypt <@0&$&T&&&&l&TKIP0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-[%s] out of data for WEP (data_len %zu) [%s] WEP ICV mismatch on decrypt ieee80211_hdrsize%s: control frame@&&L&&&`&&WEP333,*,**F$(Kc & = ieee80211_hdrsize%s: control frame[%s:%s] discard %s frame, frame, %s information element, too short, len %uWME[%s] discard %s frame, ssid mismatch: %s[%s] extended rate set too large; only using %u of %u rates [%s] shared key challenge alloc failed null nodetoo short (1): len %uwrong version %xnode %s, %snot to bssnot to cur sta: lladdr=%6D, addr1=%6D:too short (2): len %ubss %s, broadcast %s, %sseqno <%u,%u> fragno <%u,%u> tid %uduplicateunknown dir 0x%xdatamulticast echounknown srcunassoc src[%s] power save mode on, %u sta's in ps mode [%s] power save mode off, %u sta's in ps mode [%s] flush ps queue, %u packets queued WEPPRIVACY offmulticast fragm?demic errordecap errorunauthorized port: ether type 0x%x len %utoo short: len %umgtreceived %s from %s rssi %d WEP set but not permittedWEP set but PRIVACY offps-pollunassociated stationaid mismatch: sta aid 0x%x poll aid 0x%x[%s] recv ps-poll, but queue empty [%s] recv ps-poll, send packet, %u still queued [%s] recv ps-poll, send packet, queue empty bad frame type 0x%xrereassocassocWPARSNshortlong, protection, QoSie too shortbad len %uERPid %u, len %uunhandledno scan.sp_ratesbad scan.sp_rates len %dno scan.sp_ssidbad scan.sp_ssid len %dinvalid channel %ufor off-channel %ubogus beacon interval[%s] erp change: was 0x%x, now 0x%x [%s] capabilities change: before 0x%x, now 0x%x no ratesbad rates len %dno ssidbad ssid len %dno ssid with ssid suppression enabled[%s] recv probe req recv'd rate set invalid[%s] recv auth frame with algorithm %d seq %d authdisallowed by ACLTKIP countermeasures enabledshared key auth PRIVACY is disabledbad sta auth mode %uie %d/%d too longno challengebad challenge len %dbad operating mode %ubad state %u[%s] shared key %sauth request shared key responseunknown stationno challenge recordedchallenge mismatch[%s] station authenticated (shared key) bad seq %d[%s] shared key auth failed (reason %d) open auth[%s] station authenticated (open) [%s] open auth failed (reason %d) unsupported alg %dwrong bssid[%s] deny %s request, sta not authenticated [%s] no WPA/RSN IE in association request not WPA, flags 0x%xbad version %umcast cipher mismatch; got %u, expected %uucast cipher data too short; len %u, n %uucast cipher set emptykey mgmt alg data too short; len %u, n %uno acceptable key mgmt algnot RSN, flags 0x%x[%s] %s ie: mc %u/%u uc %u/%u key %u caps 0x%x [%s] deny %s request, capability mismatch 0x%x [%s] deny %s request, rate set mismatch [%s] %sassoc failed (reason %d) [%s] %sassoc failed (rate set mismatch) [%s] %sassoc success: %s preamble, %s slot time%s%s [%s] recv deauthenticate (reason %d) [%s] recv disassociate (reason %d) subtype 0x%x not handled[%s] %s  JLPsgS5A\_b-/V13#%:]]]]]] kվmmMxxPUhv버***Nj*YV8CKPSw (4:@".4 maccompat_20link-layer statistics and controlslinkIEEE 802.11 WLAN statistics and controlsieee80211ieee80211_sysctl_treetop%s: sysctl_createv failed, rc = %d client/peer stationsnodesdebugieee80211_sysctl_setup%s: sysctl_createv failed (rc = %d) vap%uparentinact_runinact_probeinact_authinact_initdriver_capsbmiss_maxieee80211_sysctl_attach%s: 802.11 mgt frame too large: %ubad beacon boundarybss %snode %s join %snode %s leave notify scan done %s[%s] %s replay detected [%s] michael MIC verification failed ieee80211_load_module%s: load the %s module by hand for now. operating mode %ubogus aid %u, max %u_ieee80211_free_node%s %p<%s> in %s table node_reclaim%s: IEEE80211_LOCK not held%s: remove %p<%s> from %s table, refcnt %d %s: %p<%s> clear key map entry [%s] scan candidate purged from cache (refcnt %u) %p: mac %s refcnt %d scangen %u authmode %u flags 0x%x associd 0x%x txpower %u vlan %u txseq %u rxseq %u fragno %u rxfragstamp %u rstamp %u rssi %u intval %u capinfo 0x%x bssid %s essid "%.*s" channel %u:0x%x fails %u inact %u txrate %u ieee80211_free_allnodes_locked%s: free all nodes in %s table ieee80211_node_table_cleanup%s %s table %s: %s[%u] still active , ieee80211_reset_scan%s: scan set:%s%u start chan %u ieee80211_next_scan1%s: chan %d->%d ????essibsswepno! %c %s %s%c %3d%c %+4d %2dM%c %4s%c %3s%c %s _ieee80211_find_nodeieee80211_setup_nodeactivepassiveieee80211_cancel_scan%s: end %s scan ni != NULLrefcnt(ni) == %dic != NULLieee80211_get_rate%s: fixed rate %d (%d.%d Mb/s) not in rate setieee80211_tmp_node%s %p<%s> ieee80211_find_rxnode_withkey%s: add key map entry %p<%s> refcnt %d ieee80211_find_txnode[%s] no node, discard frame (%s) ieee80211_find_node_with_channel%s %p<%s> refcnt %d ieee80211_find_node_with_ssidieee80211_free_node%s: %p<%s> clear key map entryneighborieee80211_create_ibss%s: creating ibss stationshortlong, protectionieee80211_ibss_merge%s: merge failed, capabilities mismatch %s: new bssid %s: %s preamble, %s slot time%s ieee80211_end_scan%s: no scan candidate macaddr bssid chan rssi rate flag wep essid %s begin %s scan in %s mode, scangen %u new [%s] %s%s on chan %u (bss chan %u) [%s] caps 0x%x bintval %u erp 0x%x country info %02xkey map out of sync, ni %p nikey %pieee80211_node_delucastkey%s: delete key map entry %p<%s> refcnt %d [%s] power save mode off, %u sta's in ps mode ieee80211_iterate_nodes%s: scan aborted %u [%s] station with aid %d leaves unexpected operating mode %ubogus long slot station count %d[%s] long slot time station leaves, count now %d ieee80211_node_leave_11g%s: re-enable use of short slot time bogus non-ERP station count %d[%s] non-ERP station leaves, count now %d %s: disable use of protection %s: re-enable use of short preamble ieee80211_timeout_stations%s: %s scangen %u [%s] discard frame, age %u [%s] discard %u frames for age probe station due to inactivity%sstation timed out due to inactivity (refcnt %u)re, QoS[%s] station needs long slot time, count %d [%s] station is !ERP, %d non-ERP stations associated ieee80211_node_join_11g%s: enable use of protection [%s] station needs long preamble [%s] station %sassociated at aid %d: %s preamble, %s slot time%s%s ieee80211_node_table_resetunable to setup initial BSS nodeieee80211_node_table_init%s %s table, inact %u scan$$hhu Penadis[%s] send null data frame on channel %u, pwr mgt %s no ethernet header!ieee80211_encap[%s] no default transmit key (%s) deftxkey %u not enough room, need %u got %lu [%s] enmic failed, discard frame mbuf already chained?pktlen %u mtu %ufragment size %u too big!ieee80211_compute_duration%s: paylen < 0%s: npkt %d firstlen %d lastlen0 %d lastlen %d fraglen %d overlen %d len %d rate %d icflags %08x no WPA/RSN!RSN IE too big, %u > %zuPPPPPPPPPWPA IE too big, %u > %zuPieee80211_send_probereqieee80211_ref_node (%s:%u) %p<%s> refcnt %d [%s] send probe req on channel %u null nodeieee80211_send_mgmt[%s] request encrypt frame (%s) [%s] send station deauthenticate (reason %d) [%s] send station disassociate (reason %d) [%s] invalid mgmt frame type %u ieee80211_mgmt_output[%s] encrypting frame (%s) [%s] send %s on channel %u ieee80211_beacon_alloc%s: cannot get buf; size %u no space for 802.11 header?ieee80211_beacon_update%s: traffic %u, disable aggressive mode %s: traffic %u, enable aggressive mode tim bitmap empty!%s: TIM updated, pending %u, off %u, len %u [%s] pwr save q overflow, drops %llu (size %d) [%s] save frame with age %d, %u now queued >{4%$$ @@@@@@@wlan: %s acl policy registered wlan: %s acl policy unregistered wlan_acl"%c0x%02xieee80211_newstate%s: %s -> %s no recent beacons from %s; rescanning %s: invalid transition %s: bogus xmit rate %u setup ostate %x nstate %x associated synchronized with %s ssid channel %d start %uMb NODS %s->%s(%s)TODS %sFRDS %sDSDS %s(%s->%s) data %s type#%d WEP [IV %.02x KID %u] %dM +%d   0 0   0 @ @ @ @ @ @ @ieee80211_wme_updateparams_locked%s: %s [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s log2(cwmin) %u %s: WME params updated, cap_info 0x%x        ^^^^^^^^^^//f/f////f/f//       ieee80211_wme_initparams%s: %s chan [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] %s: %s bss [acm %u aifsn %u log2(cwmin) %u log2(cwmax) %u txpoLimit %u] beacon miss%s wlan_internalwlan_xauthWME_AC_BEWME_AC_BKWME_AC_VIWME_AC_VOWME_UPSDINITSCANAUTHASSOCRUNreserved#0reserved#1reserved#2reserved#3reserved#5reserved#6reserved#7reserved#8reserved#9ps_pollrtsctsackcf_endcf_end_ackassoc_reqassoc_respreassoc_reqreassoc_respprobe_reqprobe_respbeaconatimdisassocauthdeauthreserved#13reserved#14reserved#15linkieee80211rssadaptdebugexpavgctlieee80211_rssadapt_sysctl_setup%s: sysctl_createv failed (rc = %d) %s: dst %s threshold[%d, %d.%d] %d < %d %s: src %s rssi %d avg %d -> %d ieee80211_rssadapt_lower_rate: %s rate #%d > #%d out of bounds %s: dst %s rssi %d threshold[%d, %d.%d] %d -> %d %s: threshold[%d, %d.%d] decay %d -> %d %s: dst %s thresholds %d-byte, T[%d.%d] = %d @external%hu.%hhu%s:%hhuigmpplinetigmpstats.7}>]J)JJJJUJJJJ ??lla_lookup: new lle malloc failed inmltplinetmulticastipsubnetsarelocalhostzerobroadcastinvalid argument to in_lifaddr_ioctlin_controlin4pcbplin6pcbpl%d.%d.%d.%d%s:%huinternetL!cv(((((L!cC,O(F(F(X@\J(L!c()F(F(@)L!c(F(F(@)/).)L!cԴ(F(F(X@L!cC$t_lastm == NULLtcp_output%s: no template%s: %d < %dsackholeplS tcp_inittcpcbpltcp_new_iss: unreachablesyn_cache_respond%s: impossible (1)%s: impossible (2)synpl @@@@@@@T)hW)X)4Z) 1DW]e_ace!!rfc1323sendspacerecvspacemssdfltminmssmslsyn_cache_limitsyn_bucket_limitinit_winmss_ifmtusackcongctlavailableselectedwin_scaletimestampscwmcwm_burstsizeack_on_pushkeepidlekeepintvlkeepcntslowhzlog_refusedrstppslimitdelack_ticksinit_win_localidentdo_loopback_cksumpcblistkeepinitrecvbuf_autorecvbuf_increcvbuf_maxsendbuf_autosendbuf_incsendbuf_maxecnenablemaxretriesmaxholesglobalmaxholesglobalholesstatslocal_by_rttdropiss_hashabcaggressivemsltloopbacklocalremoteremote_thresholdvtwentriestcpinettcp6inet6d))))\)))`)̒))k)\))))؉)))) ))))4)renơ)),))4)newreno )М),)))cubic""""3333DDDDUUUUffffwwww!!!!4444CCCCVVVVeeeexxxx""""D3D33D3DfUfUUfUfwwww""""DD3333DDffUUUUffwwwwudp_abortudp_acceptinetudpchecksumsendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunction)D)))T)H))h)@))@)\)))d)l)) ))2@@)6@p)C@)O@x)T@H)_@) bsdrandom_startrandom_pickhashdoublehashrandincm_pulldown malfunctionm_pulldown malfunction8BZ $>FN2:BJRZbjr/7Um%Ybx[<<(src=%s dst=%s tgt=%s)m_pulldown malfunctionicmp6_redirect_input%s: ICMP6 redirect sent from %s rejected; must be from linklocal %s: ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) %s: ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s %s: ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s %s: ICMP6 redirect rejected; no route found for redirect dst: %s %s: ICMP6 redirect rejected; redirect dst must be unicast: %s %s: ICMP6 redirect rejected; neither router case nor onlink case: %s %s: invalid ND option, rejected: %s %s: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_reflect%s: sanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/netinet6/icmp6.c%s: source can't be determined: dst=%s, error=%d _icmp6_input%s: ICMP6 checksum error(%d|%x) %s %s: unknown type %d(src=%s, dst=%s, ifid=%d) inet6icmp6statsrediracceptredirtimeoutnd6_prunend6_delaynd6_mmaxtriesnd6_umaxtriesnd6_maxnudhintmaxqueuelennd6_useloopbacknd6_gctimernodeinfoerrppslimitmtudisc_hiwatmtudisc_lowatnd6_debugreflect_pmtudynamic_rt_msgicmp6_error%s: ENOBUFS in icmp6_error %d NYIPv6 address: "%s" is not on the network lla_lookup: new lle malloc failed in6_update_ifa1%s: a destination can be specified for a p2p or a loopback IF only %s: prefixlen should be 128 when dstaddr is specified %s: valid lifetime is 0 for %s in6_get_llsol_addr%s: in6_setscope failed in6_join_mcastgroups%s: addmulti failed for %s on %s (errno=%d) in6_prefixlen2mask: invalid prefix length(%d) invalid argument to in6_lifaddr_ioctlin6_if_link_up%s: %s marked tentative in6_if_link_down%s: %s marked detached in6_cksum: offset too short for IPv6 headerin6_cksum: mbuf too short for IPv6 headerin6_ifattach%s: %s has too small MTU, IPv6 not enabled %s: %s is not multicast capable, IPv6 not enabled in6_ifattach_loopback%s: failed to configure the loopback address on %s (errno=%d) get_ifid%s: %s: got interface identifier from itself %s: %s: got interface identifier from %s %s: %s: borrow interface identifier from %s %s: %s: interface identifier generated by random number %s: %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x in6_ifattach_linklocal%s: failed to configure a link-local address on %s (errno=%d) %s: cannot assign link-local address ::ffff:%s[%s]:%huinternet6d&c)*X)))d&c:C|1*** @#*d&c+**P@\+d&c(**@l*/).)d&c+*h* @d&c<)d&c++d&c,x)d&cC%s ip6_get_prevhdr%s: off < sizeof(struct ip6_hdr)ip6_nexthdr%s: m == NULL(@AAA==(A*/1inet6pim6statsregister_mifmultiple kernel entriesadd_m6fc: %s o %s g %s p %x dbx %p ?cannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctioncW\E[OT  D6 0$*<Y2DP %WWWWWW3WWWW-)!WWWWWW`WW9Aassumption failed: hdr not splitip6_output%s: refusing to send from invalid address %s (pid %d) m_pulldown malfunctioninet6multicastmulticast_kludge ))))))))%s: Cannot enable an interface with a link-local address marked duplicate. nd6_timernd6_init%s: workqueue_create failed (%d) nd6_options%s: duplicated ND6 option found (type=%d) %s: nd6_options: unsupported option %d - option ignored %s: too many loop in nd opt nd6_resolve%s: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_rtrequest%s: failed to set scope %s (errno=%d) %s.%d: sockaddr_dl_init(, %zu, ) failed on %s %s: rt_setgate failed on %s nd6_rtrequest: bad gateway value: %s %s: %s: failed to join %s (errno=%d) %s: detected a looped back NS message for %s %s: DAD duplicate address %s from %s %s: possible hardware address duplication detected, disable IPv6 nd6_na_input%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: invalid target address %s %s: a solicited adv is multicasted %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_input: duplicate IP6 address %s %s: ND packet from non-neighbor %s on %s nd6_ns_output%s: source can't be determined: dst=%s, error=%d nd6_dad_timer: called with duplicate address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) nd6_dad_timer%s: %s: could not run DAD, driver problem? %s: %s: DAD complete for %s - no duplicates found nd6_na_outputnd6_ns_input%s: bad DAD packet (wrong ip6 dst) %s: NS packet from non-neighbor %s on %s %s: bad NS target (multicast) %s: bad DAD packet (link-layer address option) %s: lladdrlen mismatch for %s (if %d, NS packet %d) %s: duplicate IP6 address %s %s: src=%s %s: dst=%s %s: tgt=%s nd6_dad_start: called with non-tentative address %s(%s) nd6_dad_start: memory allocation failed for %s(%s) nd6_dad_start%s: %s: starting DAD for %s RSRAnd6_rtr_cache%s: invalid hlim (%d) from %s to %s on %s m_pulldown malfunction%s: src %s is not link-local %s: invalid ND option, ignored %s: lladdrlen mismatch for %s (if %d, %s packet %d) &.3;CKS[cksinet6raw6pcbliststats+++܆+p+h++++L++++p++++\++m_pulldown malfunction  sa6_recoverscope%s: assumption failure (non 0 ID): %s%%%d in6_setscope%s: no scope id for %s %s: can't set scope for not loopback interface %s and loopback address %s d@n@s@s@{@s@s@@s@s@s@s@s@@interfacelinkunknownsiteorganizationglobalinet6udp6sendspacerecvspacedo_loopback_cksumpcbliststatsm_pulldown malfunctionudp6_output%s: control but no lwpudp6_output: IPV6_V6ONLY option was set for a connected socket +x++(+H++++̣+++++++++l++*&Rik  $ "BAD LENGTH %d Main bTag=%d Global bTag=%d Local bTag=%d default bType=%d A AOA A A A7>A AO A AZA A!hAAAvAAFt Ad Au@@JRAPA A 2 A " A "AA  A A A NAHAXA A A A[@@U(@oJ@ 9@  A AaAcCeElLBAnNDCoOsS[ZuUxXzyzZ|{"5% mMoOpP1!2"@ 3/!4$"5%#6?$7&%8*&9('0), --_.=+/[0']1<>}2<>}3;:~4{5#|\6,'7..8d qQ@1!|2"@ 3##6&$7/%8(&9)'0=-'?\.'(/ 0+*~1}]2}]3~4{[5|6,;7.:8-_d<> 4^eEmMqQ@1!2" 3#!4$"5%#6&$7/{%8([&9)]'0=}-\.-_'(/ 0'?~1+*`2+*`3^ 456,;7.:8d<>| /1,;`2,;`3' IqQ@2' 3^#!4+$"5%#6&$7/{%8([&9)]'0=}-*?\.-_/0~1,;2,;34i5"678.:d<>| #6/'`4~^cCeEmMqQ//rRwW??1!2@ 3#!4$"5%#6.=+(/`0[{1]}2]}3 4~^5'"8;:d\|/? bB{cC& fF[ gG]nN}qQ\vV@wW|xX#zyY>1'~2"  3+^!4!"5% #6/($7=`%8(&9)' -.'/QP01qp2<3$4506,?;7.:8-_* /[34{-'?.^`~0!]1+|2"@ 3*#!4#6&$7/%8(&9)'0=-'?.eEz/[0!]34{5 2$}y6,;7.:8-_d<>\ 2"@ 3##6&$7/{%8([&9)]'0=}-'?.+*/+*01<>2345\|6,;7.:8-_d<> 1!|2"@ 3#!4$~#6&$7/%8(&9)'0=-'?./[0+*]1}2}34{5\6,;7.:8-_d<> 1!2" 3!4$"5%#6^$7&%8*&9('0)--_.=+1#~2#~4'@5``d\|2" 3!4$"5%#6&$7/%8(&9)'0=-'?.^/{[0+*}]13@4#5\|6,;7.:8-_d<> &1|2@!'4"(5#6^$7%!8&9{'0}-).-_/[0$*]2`4%58=+~d<>\5$#"12< 3>!(4[")5]#@6^$+7%-8&/9'*0-=.%`bB|_pP&oO`!vV  dDlLjJ/zZ0wWaAuUiI eE ,;' cC' tTsSrR3nN4mM2\yY{xX}.:kK~'?qQ 6gG7hH8fF(, _d/^ q,?azw&12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@-)].=+}/0$2*3m4%56;.7:/8!d<> .\`0^~.\02,*345|d<>5^~sSa`zZ~}/ 02'*4^ 5 .'`|0^~-+?\02'*345d<>| .'`|0^~2"@ 3#!4$#6&$7/{%8([&9)]'0=}-+?.|/02'*3456,;7.:8-_d<>\ 5 12 3l#!4>"5<#6$$7%8"" &9""/'0""*----.' xX.vV_lL[cC]wW^kK!hH<7 gG>8fF=9qQ&+/f-0uU\iI/aA{ eE} oO* sS? nN(4rR)5tT-63dD:,4yY@.#$ |pP~ zZ`bB+:mM%16,-"27..'38jJ;;2 9 d .'`0+*~5^mMqQ@zy2" 3#6&$7/{%8([&9)]'0=}-?\./0+*2#'345 6,;7.:8-_d<>|  9aAbB~~cCsS~fF tT~ dD~ hH~~ uU nNeEiImM~~kK~~yY;:qQpPrR~gG~~lL~~vV~~wWxX~jJ~~zZ1!2@ 3#!4$"5%~#6^~~$7&%8*&9(~~'0)~~, --_~~.=+/[{~0]}~1\|~~2\|~~3oO4'"5`~~6,<'~7.>~~8/?~9d-_~~ axje.> u i d c htnmbrl'"poygk,<qf;:-[{.]}//?0=+3s4-_6w7v8z2"#6&$7'%8(&9)'0--=.^~/@`0[{1]}2]}3;+4:*5\_\|abcde f g h i jklmnopqrstuvwxyz1!2@ 3#!4$"5%#6^$7&%8*&9('0)( ) *+ , --_.=+/[{0]}1\|2\|3;:4'"5`~6,<7.>8/?9:;<=>?@ABC D E FG HIJK,LMN-OPQRS T/U*V-W+X Y1Z2[-3\4]5^6_7`8a,9b0c.d\|eh i jkmm ,++ : input=%d, output=%d, feature=%d uhidreacouldn't establish power handler +D+x++D++4\+l!6D+4t!6c addr 0x%02x(unknown) ()%s%s%s%s at %s addr 0x%02xi2c-indirect-device-permitlisti2c-indirect-probe-strategyinvalid property type (%d) for '%s'; must be array (%d) smbus-quick-writesmbus-receive-bytenoneunknown probe strategy '%s'; defaulting to '%s' WARNING: ignoring bad device address @ 0x%x : I2C bus i2cdevstcouldn't establish power handler i2c-child-devicesi2c-no-indirect-configi2c-enumerate-devicesaddrnamecompatibledevhandleWARNING: ignoring bad child device entry for address 0x%x iici2cexec,i2c_bitbang,i2c_subrLwGx+uAyA(++44+47l!6534i2cexecLwG+Aiic at %s bus %di2c_subrLwG+Ai2c_bitbangLwGL+4A     mii_attach: phyloc and offloc specifiedmii_attachmiimiiautomii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %dmiiverboseoui %6.6xmodel %4.4x OUI 0x%06x model 0x%04xmiiaut!A  !@@@@mii_phy_setmedia: MASTER on wrong media, no media present HomePNA1%s%s10baseT10baseT-FDX100baseTX100baseTX-FDX100baseT41000baseSX1000baseSX-FDX1000baseT1000baseT-FDXauto couldn't establish power handler RRTRRRRRRVAAA9A\AA A A A A;6A.YA|AAAAA4.ASAvA5A6A A A (A <EA ?bA ,A -A A A A =4 A :Q A n A A" A6 A$ A!!A E!A8k!AP!A##   1 @,`, ,,, ,,, ,,, ,: Media interface : %s, rev. %d bgebnxphyflagsfailed to get phyflags chipidfailed to get chipid shared_hwcfgfailed to get shared_hwcfg port_hwcfgfailed to get port_hwcfg 2500baseSX-FDX  22     * #hhu hhhBCM5400 1000BASE-T media interfaceBCM5401 1000BASE-T media interfaceBCM5402 1000BASE-T media interfaceBCM5404 1000BASE-T media interfaceBCM5411 1000BASE-T media interfaceBCM5421 1000BASE-T media interfaceBCM5424/BCM5234 1000BASE-T media interfaceBCM5461 1000BASE-T media interfaceBCM5462 1000BASE-T media interfaceBCM5464 1000BASE-T media interfaceBCM5466 1000BASE-T media interfaceBCM54K2 1000BASE-T media interfaceBCM5701 1000BASE-T media interfaceBCM5703 1000BASE-T media interfaceBCM5704 1000BASE-T media interfaceBCM5705 1000BASE-T media interfaceBCM5706 1000BASE-T/SX media interfaceBCM5714 1000BASE-T/X media interfaceBCM5750 1000BASE-T media interfaceBCM5752 1000BASE-T media interfaceBCM5780 1000BASE-T/X media interfaceBCM5708C 1000BASE-T media interfaceBCM5481 1000BASE-T media interfaceBCM5482 1000BASE-T media interfaceBCM5708S 1000/2500baseSX PHYBCM5709 10/100/1000baseT PHYBCM5709S 1000/2500baseSX PHYBCM5709CAX 10/100/1000baseT PHYBCM5722 1000BASE-T media interfaceBCM5754/5787 1000BASE-T media interfaceBCM5755 1000BASE-T media interfaceBCM5756 1000BASE-T media interface XXXBCM5761 10/100/1000baseT PHYBCM5784 10/100/1000baseT PHYBCM5785 1000BASE-T media interfaceBCM5717C 1000BASE-T media interfaceBCM5719C 1000BASE-T media interfaceBCM5720C 1000BASE-T media interfaceBCM57765 1000BASE-T media interfaceBCM57780 1000BASE-T media interfaceBCM54213PE 1000BASE-T media interfaceBCM5725C 1000BASE-T media interfaceBCM5906 10/100baseTX media interfacebrgphyA L"A: Media interface : %s, rev. %d $,X!, $,DP83840 10/100 media interfacensphy) 2"A"A "A"A: Media interface : %s, rev. %d h),(,P',DP83843 10/100 media interfaceDP83847 10/100 media interfaceDP83849 10/100 media interfaceDP83815/DP83846A 10/100 media interfacensphyter) 2|#A: Media interface : %s, rev. %d 4-,*,-,QS6612 10/100 media interfaceqsphy) 2U$AU:$AU2U$AU3u$AU1$A: Media interface : %s, rev. %d 0,`/,\+i82555 10/100 media interfacei82562EH HomePNA interfacei82562EM 10/100 media interfacei82562ET 10/100 media interfacei82562G 10/100 media interfaceinphy) 2%AU5%A: Media interface : %s, rev. %d 4,1,\+i82553 10/100 media interfaceiophy: Media interface : 3Com internal media interface (6,,5,ignoring this PHY, non-zero instance exphy_service: can't isolate 3Com PHYexexphyM V xL&A{ j&AD:,,9,D:,X7,9,: Media interface : %s, rev. %d 100baseFX, 100baseFX-FDX LXT970 10/100 media interfaceLXT971/2 10/100 media interfacelxtphy) 2'A/'AN'Am'A'A: Media interface : %s, rev. %d h>,;,=,ICS1889 10/100 media interfaceICS1890 10/100 media interfaceICS1892 10/100 media interfaceICS1893 10/100 media interfaceICS1893C 10/100 media interfaceicsphy) 2}L(A}n(A}(A: Media interface : %s, rev. %d A,?,B,using Seeq 84220 isolate/reset hack A,?,\+Seeq 80220 10/100 media interfaceSeeq 80225 10/100 media interfaceSeeq 84220 10/100 media interfacesqphy) 2vL)Avy)Av)Av )Av )Av )An`L)A: Media interface : %s, rev. %d E,`D,\+DM9101 (AMD Am79C873) 10/100 media interfaceDM9102 10/100 media interfaceDM9161 10/100 media interfaceDM9161A 10/100 media interfaceDM9161[BC] 10/100 media interfaceDM9601 internal 10/100 media interfacedmphy) 2X9p*A: Media interface : %s, rev. %d H,G,\+Am79C901 HomePNA 1.0 interfacepnaphy) 2: %s (OUI 0x%06x, model 0x%04x), rev. %d : OUI 0x%06x, model 0x%04x, rev. %d : Media interface `K,,\+ukphydmover_backend_unregisterdmoverdmreqdmsesdmover_session_destroyxor8xor7xor6xor5xor4xor3xor2iscsi-crc32ccopyfill8zeropY,\y,[,PX,r,d,\,[,X,P\,4%s: emergency X server detach screen %d-%d added (%s, %s emulation) wsdisplaytty() on status devicewsdisplaytty() on ctl devicewsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up screen %d deleted dmux kbdmux %d: console (%s, %s emulation), using %s wsswcouldn't establish power handler wsdisplay at %sloadedwsdisplay: event queue overflow wswaitwsdisplay_noemulwsdisplay_emulEDID =( dumb.A},~,`~,X,4,, !!!c        BBB257#A^bgejzuxwsemul_vt100_output_c0c1%s: ESC in kernel output ignored ,І,,, ,,@,؂,8,܅,,d,vt100,0A,,,D,,D,,W\))GhntLAu  "$&((((((((+=????????B`/[>24;20;0cP2$u%s%d\P0!u%5\[?62;6c[8;%d;%dt[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_#@[\]^_`{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%% $ $ $ $ $%% %%<%##%##%$%4%,%%d"e"`"  " %" #!#%# # # # ""*#d"`"e"+"4"""""<"C"!!a"""")"*"'"(""!!!! ,$0("" 6A&6A,6A26A86A>6AD6AJ6AP6AV6A\6Ab6Ah6An6A5A5At6Az6A6A6A6A6A6A6A5A5A5A5A5A5A6A6A6A 6AOIOMOjOkOlOmOnOo[28~[29~[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCOpOqOrOsOtOuOvOwOxOyOPOQOROS[11~[12~[13~[14~[15~[17~[18~[19~[20~[21~[23~[24~[25~[26~[31~[32~[33~[34~wseventdefault_versionwsevent_copyout_events%s: unknown version %dwsevent_read0,\,  mux %dcannot load keymap: console keyboard, using %s attach error=%d couldn't establish power handler couldn't register as input device connecting to %s disconnecting from %s wskdetwskbd_detach: %s didn't detach ,̻,,4ع,40,l!6,4wskbd at %s%s: event queue overflow wskbd ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry%s%dwsmuxconnecting to %s %s: disconnecting from %s T,,,4$,4D,l!6,4wsbell at %swsbellrasops_reconfig%s: fontwidth assumptions botched%s: font stride assumptions botched%s: depth not supported rasops_init%s: font table is empty %s: couldn't lock font %s: bits not aligned on 32-bit boundary %s: stride not aligned on 32-bit boundary @`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? ????cwccwwsfont: font '%s' bito %d byteo %d copied to bito %d byteo %d @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not locked0c&1c&1c&|RAtRAo|TATA                                                   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~VAVAaVA)0WA2YWAWAWAͳɿپ̴ް  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ᅠBoldfacecd9660nopl.0679 &..RRIP with incorrect NM flags? RRIP without PX field? RRIP with incorrect flags?IEEE_1282IEEE_P1282RRIP_1991APXT2-5-TF3-3-PN1-RR<1-CE1-STt1-NMh4-8-CL2-0PL2-0RE$1-@RR<1-CE1-STt1-SL8-RR<1-CE1-STt1-SPER:-CE1-STt1-cd9660utf8_jolietfhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] ;CD001%/C%/@%/Eroot_device@_A]A@\ALwG$F-ZA cd9660_strategy: spectag VT_ISOFS, isofs vnode .. eH\A&B9B;Bx:Bx:<Bx:Bx:0Bx:Bx:,Bx:HBx:Bx:Bx:Bx:Bx: Bx:(Bx:DBx:`Bx:|Bx:Bx:Bx:Bx:Bx:Bx:Bx:Bx: Bx:XB;tBx:LBx:hBZ-Bp;BV-BQ-Bx:Bx:dB;Bx:$B4,-@B`,-\B;xB;Bx:BlY-B(;B?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~!#$%&'()+-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥmsdosnoplmsdosfhplm-m-loadvnode(): pcbmap returned %d ;Pm-:Xm-:deextend: file too largedetrunc(): can't truncate root directory, clust %ld, offset %ld updatefats%s: copy FAT %d (error=%d) %s: write FAT (error=%d) . .. .. msdosfs_rename: updating .. in root directory?X------p---p-msdosfsmsdosfs_sync: rofs modRRaArrAaUmsdosroot_device\fALwG`-ReA   msdosfs_write(): bad file typemsdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %llu, %llu .... ..  edfA&B9Bt;B-B-B ;0B;LB-hB\-Bp;B@-B-B-B|-B ;,B ;dB;HB;B;B;B;B`;B- B;(B0-DB ;`BȦ-|B-B-B ;BP-B;B;$BPw-@Bu-\B;xB;Bؼ-BH-Bl-B(;B- B-B?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~sSTVWY[`cihoru      "#$%&'()*+,-./0123:e,;<=>f,ABCDEFGHIJKLMNOE{|}PQRSTUVWX Y Z [ \ ]^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~     1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV--------- - - - - ------------------- -!-"-#-$-%-      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~a     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}&!*!k+!2!N!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!!!!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$,0,,1,,2,,3,,4,,5,,6,,7,,8, ,9, ,:, ,;, ,<, ,=,,>,,?,,@,,A,,B,,C,,D,,E,,F,,G,,H,,I,,J,,K,,L,,M,,N,,O, ,P,!,Q,",R,#,S,$,T,%,U,&,V,',W,(,X,),Y,*,Z,+,[,,,\,-,],.,^,`,a,b,kc,}d,}g,h,i,j,k,l,u,v,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:Zbind failed nfsvinvalnfs_doio: type %x unexpected nfsbioread: type %x unexpected ifupdown: socreate, error=%d ifupdown: GIFFLAGS, error=%d ifupdown: SIFFLAGS, error=%d nfsbifsetaddress: socreate, error=%d setaddress, error=%d nfsbtdnfs_boot: '%s' not found setmtu: socreate, error=%d setmtu: GIFMTU, error=%d setmtu: SIFMTU, error=%d deladdress: socreate, error=%d deladdress, error=%d nfs_boot: timeout... nfs_boot: sosend: %d BDZ\^`bdfhju_acknfs sndunlockshort receive (%lu/%lu) from nfs server %s impossible packet length%s (%d) from nfs server %s short receive (%lu/%d) from nfs server %s Egad!! receive error %d from nfs server %s nfsreply nilis alive againnfstrylatermtimectime%s: inaccurate wcc data (%s) detected, disabling wcc (ctime %u.%09u %u.%09u, mtime %u.%09u %u.%09u) %s: re-enabling wcc nfsiodnfsionfsiormnfsauth1nfsauth2nfskqpw4. 4.4.3.nfskqpollnfskqdetnfs_sillyworker%s: vp=%p error=%d nfsnodeplnfsvaplnfssillynfs_node_init7.7.8.:13/nfs send error %d for %s nfsd send error %d nfstimertimer starttimer stopnfscon sotypenfscn2nfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s  @not respondingnfsrvdescpl A~A~A~A~A~A~A~Ah~AL~A0~A~A}A}A}A}A}Aj}A^}AT}AJ}A>}A ?BEF   build > MLENF''FF''FF''F'' F''''' F'''' ?EF''' ?BEF''' ?BF''' ?F'' ?EF'''' ?EF''' ?EF''' ?EF''' EF''' F''' F'''F'' ?F'' EF'''F''  nfsumntnfsnfsstatsiothreadsbuild > MLENnfs_vfsops: nfs_statvfs would lose buffers nfs_args: retrying connect nfscn3nfsrcvnfssndnfsaionfsdisnfs%u/nfs_mountroot: mget soname for %snfs_mountroot: mount %s failed: %d root on %s nfs_mountroot: getattr for rootA8AALwG$.A build > MLENnfs_readdir: lost in spacenfs physio/asynctag VT_NFS, fileid %lld fsid 0x%llx writerpc readonly vp %pnfsmblknfs: sillyrename dir.nfsAxxxx4.4nfs_remove: bad vrefcnt(vp)`.eA&B9B;Bx:Bx:<Bx:Bx:0Bx:Bx:,Bx:HBx:Bx:Bx:Bx:Bx: Bx:(Bx:DBx:`Bx:|Bx:Bx:Bx:Bx:Bx:Bx:Bx:Bx: Bx:XB;tBx:LB$.hB.Bp;B.B.B.BP.dB;BD/$B;.@B;.\B;xB.Bx:B\.B(;B;d.e@A&B9B;B;B;<B;B;0Bx';B ;,BH;HB,;B!;B(!;B;B+; B;(B;DB;`B;|B;B;B;B;B;B;B<;B ;B`; B;XBd:tBX:LBl.hB.Bp;B.B.Bl.B.dB;B;$B;.@B;.\B;xB.B\.B(;B*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?%s: ACLs requested but not supported by this fs WARNING: %s: POSIX.1e ACLs flag on fs but no ACLs support WARNING: %s: NFSv4 ACLs flag on fs but no ACLs support %s: "posix1eacls" and "nfsv4acls" options are mutually exclusive org.netbsd.kauth.systemffs_modcmd: can't listen on system scope. ffsdoclusterreaddoclusterwritedoreallocblkslog_changeopt {00:0:ffs_newvnode%s: dup alloc ino=%lld on %s: mode %o/%o gen %x/%x size %llx blocks %llx%s: ino=%lld on %s: gen %x/%x has non zero blocks %llx or size %llx %s: dirty filesystem?ffsinoffsdino1ffsdino2appleufs, not mountingffs_reload%s: dirty1%s: unknown ufs flags: 0x%08x%s %s: dirty2t00D 0/#0tq0u0 %s: options QUOTA2 not enabled%s root_device%s: file system not clean (fs_clean=%#x); please fsck(8) %s: `-o softdep' is no longer supported, consider `-o log' ffs_sync%s: rofs mod, fs=%sHAAAufsLwGx:0AA|.eA&B9B;Bx:Bx:<Bx:Bx:0Bx:Bx:,Bx:HBx:Bx:Bx:Bx:Bx: Bx:(Bx:DBx:`Bx:|Bx:Bx:Bx:Bx:Bx:Bx:Bx:Bx: Bx:XB;tBx:LB0hBh;B(0B`0Bx0Bt0B0dB;Bx0$BP0@Bp0\B;xB;B 0Bt/B0B(;BD0B %#jx (fixed) uao_putuao_put%s: impossibleuao_detubchashubc object hashubc_allocubc_fault01ubc_init: failed to allocate ubc_mapubc_init: failed to map ubc_object udv_detachudv_attach1111flt_noram5flt_pmfail2flt_pmfail1anonget1anonget2flt_noram1fltamapcopyfltagain1flt_noram2pgo_faultfltagain2flt_noram4uvm_fault_unwire_locked: address not in mapuareauvmuvm_init: page size not setuvmfaultuvm_km_bootstrap: could not reserve space for kerneluvm_km_bootstrap: could not reserve kernel kmemkmemkvauvm_km_suballoc%s: unable to allocate space in parent mapuvm_km_suballoc: submap allocation failedkm_pgrmkm_getwait2plpglivelockloanagainfltagain2loanzeroloanuopgx?1Mprocuser_va0_disablevmmpeplJ1(K1vm_mapuvm_unmap_remove%s: kernel object %p %p uvm_voaddr_release: bad typevmmapbsyvmmeterloadavguvmexpuvmexp2maxslpuspaceminaddressmaxaddressguard_sizethread_guard_sizeuobjwirepguvm_page_numa_lookup: failed, first pg=%p pa=%#lx uvm_setpagesize: page size %u (%#x) not a power of twouvm_page_physget: called _after_ bootstrapuvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: pmap_growkernel() faileduvm_pageboot_alloc: out of memoryuvm_page_bootstrap: no memory pre-allocatedUVM: using package allocation scheme, %d package(s) per bucket UVM: using NUMA allocation scheme uvm_pagealloc_strat: bad strat %dLAAĩAAemergvapager_mapuvmpdlmtout of memory before the pagedaemon thread existspagedaemon: deadlock detected! pooldrainfork pooldrainpgdaemonanonminfileminexecminanonmaxfilemaxexecmaxinactivepctpdpolicyreactanonreactfilereactexecpglac2pglallocTried to add RAM after uvm_page_inituvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX Boot time slabHotplug slabuvm_page_physload%s: unload attempted after uvm_page_init() uvm_page_physload: bad free list %duvm_page_physload: start[%lx] >= end[%lx]uvm_physseg_plug() failed at boot.uvm_physseg_unplug%s: Tried to unplug from unknown offset %s: Tried to unplug oversized span %s: can't unplug() from the middle of a segment without UVM_HOTPLUG  U]rr:r$swap_off%s: swapdev not in listswap_encryptswstrategy%s: vnode type 0x%xuvm_swap_init%s: can't get vnode for swap device%s: can't lock swap device%s: can't open swap deviceswapmap%s: vmem_create failedminirootswapctl: miniroot copy faileddisksortswapctl: copystrswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap swapdrum_addswapiodswap_on%s: workqueue_create failedturning off swap...stopping swap on %s failed with error %d done 442T2447l!653424,2444uvnfp1uvnfp2/2/2.2.2.2copy-cred-on-forkbufq_disksortLwG82Adisksortbufq_fcfsLwG:2,AfcfsNetBSD-CORE%s@%dELFNetBSDexec_elf32LwGI2rA#!exec_scriptLwGZ2Avmcmdkillsextendscallsinit/dev/consolewarning: no /dev/console warning: lookup /dev/console: error %d init: couldn't allocate argument spaceinit pathAAAA (default %s): haltrebootuse absolute path, "halt", or "reboot" /sbin/initinit: trying %s exec %s: error %d copyout %dDetecting hardware...fork initcannot mount root, error = %d pgdaemonfork pagedaemonioflushfork syncer%s %s (%s)%s %s %s%stotal memory = %s avail memory = %s /sbin/oinit/sbin/init.bak/rescue/init  maxvnodesmaxprocmaxfilesargmaxhostidvnodeprofilingposix1versionngroupsjob_controlsaved_idsboothowtoboottimemaxpartitionstimexrtc_offsetroot_devicefsyncipcsysvmsgsysvsemsysvshmsynchronized_ioiov_maxmapped_filesmemlockmemlock_rangememory_protectionlogin_name_maxdefcorenamelogsigexitfscaleccpucp_timeconsdevmaxptysmaxphysmonotonic_clocklabelsectorlabeloffsetlabelusesmbrlwpforkfsleepposix_threadsposix_semaphoresposix_barriersposix_timersposix_spin_locksposix_reader_writer_locksdump_on_panicroot_partitiondriverscp_idcoredumpsetiddumppathownergroupmodeno_sa_supportconfignamebuildinfomessagesusermemcnmagicusermem64ostypeosreleaseosrevisionversionhostnamedomainnamerawpartitionmodelmachinemachine_archncpubyteorderphysmempagesizealignbytesphysmem64ncpuonlinekernvmvfsnetdebughwmachdepuserddbprocvendoremulsecurityA,@A#7$wx@g`8@O@Accounting resumed Accounting suspended Accounting started Accounting terminated actwatacctwatchAccounting: write failed %d kcredplorg.netbsd.kauth.credorg.netbsd.kauth.genericorg.netbsd.kauth.systemorg.netbsd.kauth.processorg.netbsd.kauth.networkorg.netbsd.kauth.machdeporg.netbsd.kauth.deviceorg.netbsd.kauth.vnodehardscheddivclockratehardclock_tickshardclockstatclockclockinterruptcv@42P4`4P4deadcv" """usersystempid %d (%s): %s write of %zu@%p at %lld failed: %d %s%d%.*s%lldcoredumpLwG2ȲAToo many CPUs. Increase MAXCPUS?cpu%d44444247l!6534fdcloseincrease kern.maxfiles or MAXFILESfilefiledescfile2dup2T2444447l!6534entropy: ready entropy: best effort <cpu0entropy softintentropy intrdropentropy intrtrunc<WARNING: consolidating less than full entropy entropyentropy: pid %d (%s) waiting for entropy(7) <WARNING: system needs entropy for security; see entropy(7) 22seed3entropy: invalid seed length: %zu, expected sizeof(rndsave_t) = %zu entropy: invalid seed checksum entropy: double-seeded by bootloader entropy: entering seed from bootloader with %u bits of entropy entropy pool crypto self-test failedcollectiondepletionconsolidategatherneededpendingsamplesneededsamplespendingepochentsrclockentropy: no seed from bootloader unable to establish entropy softintentbutlerunable to create entropy housekeeping thread: %dnotifydepleterequestextract failpartialimmediatediscretionaryfilt_usertouch() - invalid type (%ld)filt_timertouch%s: invalid type (%ld) A448-3T3d,3+3.3H)3l#3L3kqueue)3 3org.netbsd.kauth.process/383t343H3P3/3$330"3 ,3,3/33/33EVFILT_READEVFILT_WRITEEVFILT_AIOEVFILT_VNODEEVFILT_PROCEVFILT_SIGNALEVFILT_TIMEREVFILT_FSEVFILT_USEREVFILT_EMPTY 3$3C33:AIO/*fexecve*execargsshould not happenexec_init%ssigcode kernel mapping failed %d pspawnwaitlwpwaitnetbsd`pp\dphrinit died (signal %d, exit %d)orphaned traced processexit1increase kern.maxproc or NPROCprocforkmxforkulimwaitlwpwaitidle/%ucreate_idle_lwp: error %d%s: WARNING: powerhook_establish is deprecated ???AAAAA'Adopowerhooks %s: %s (%p) dopowerhooks: %s done resumesuspendstandbysoftresumesoftsuspendsoftstandbykthrwaitunnamedWARNING: kthread `%s' (%d) exits with status %d kthread_exitcurcpu holds : %18d wanted by: %#018lx %s[%d %s]: hogging kernel lock idleinterruptsoftintpserializeassert_sleepable%s: %s caller=%p%s[%d %s]: kernel lock spinout Kernel lock lwpplmaxlwpsigwaitvfork(zombie)lwp_exitswapperlink_set_evcntsWARNING: module error: Built-in module `%s' can't find built-in dependency `%s'Built-in module `%s' prerequisite `%s' failed, error %dBuilt-in module `%s' failed its MODULE_CMD_INIT, error %dmodule_builtin_add%s: builtin module "%s" init failed: %dlink_set_modules`link_set_modules' section not present, error %d`link_set_modules' section wrong size (%zu different MODULE declarations?)`link_set_modules' section wrong size (got %zu, wanted %zu)DEBUG: module: TRUEFALSEUnload requested for `%s' (requires_force %s)Module `%s' not foundModule `%s' busy (%d refs)Cannot unload built-in secmodel module `%s'Could not unload module `%s' error=%dUnloaded module `%s'Requesting autounload for`%s'Module `%s' declined to be auto-unloaded error=%dmod_unld/stand/%s/%s/modulesorg.netbsd.kauth.systemBuilt-in `%s' failed: %d moduleautoloadautounload_unsafeverbosepathautotimeLwGcAmodunloadmodule_start_unload_thread%s: %dModule `%s' pushed by boot loader already existsDuplicate bootlist entry for module `%s'Unable to load `%s' pushed by boot loader, error %dUnable to fetch_info for `%s' pushed by boot loader, error %dDependentRequestedUse -f to reinstate builtin module `%s'module_do_builtin() returned %d%s module `%s' already loadedOut of memory for `%s'module_load_vfs_vec() failed for `%s', error %dCannot fetch info for `%s', error %dModule name `%s' longer than %dModule `%s' has invalid class %dModule `%s' built for `%d', system `%d'Forced load, system may be unstableIncompatible module class %d for `%s' (wanted %d)Dependency name mismatch (`%s' != `%s')Module with name `%s' already loadedCircular dependency detected for `%s'Required module name `%s' longer than %dSelf-dependency detected for `%s'Recursive load failed for `%s' (`%s' required), error %dUnable to affix module `%s', error %dModule properties failed for %slink_set_sysctl_funcsmodcmd(CMD_INIT) failed for `%s', error %dRecursive load causes duplicate module `%s'Module `%s' loaded successfullyLoad failed, error %dAutoload for `%s' requested by pid %d (%s)Autoload disabled for `%s' Autoload illegal path for `%s' Autoload not authorized for `%s' Autoload for `%s' status %dnetbsdmod_hookauto%sLoading module from %s%s/%s/%s.kmodCannot %sload kernel object `%s' error=%d.kmod.plistLoading plist from %splist load returned error %d for `%s'noautoloadautoloading is disallowed for `%s'kern.module.path=%s owner field : %#018lx wait/spin: %16d/%d mutex_vector_enterlocking against myselfmutex@Pt5dt5`4,3MutexphysiodphysioDevices without power management support: %s %s: %s is suspended by %s (delegator %s) pmfdebugeventsuspendsuspensoridletransition%s: %s-suspended by %s (delegator %s) already %s: %s assumes %s-suspension by %s (delegator %s) %s: newly %s-suspended by %s (delegator %s) resume failed %s: %s suspension %s (delegator %s) removed by %s classdriverbusPowering devices:(failed)Shutting down devices: shutting down %s, skipped.failed.success.self%s-self%s: suspend enter %s: class suspend %s: driver suspend %s: bus suspend %s: suspend exit Flushing disk caches: giving up done Suspending devices:. %s: resume enter %s: bus resume %s: driver resume %s: class resume %s: resume exit Resuming devices:%s: PMF event %d dropped (no memory) %s: PMF event %d injected Input idle handler called pewplpmfeventcouldn't create pmfevent workqueuepmfsuspendcouldn't create pmfsuspend workqueueAAAAAAAAAsystemdrvctl**** RVY\c@cfailed to reserve PID 1 for init(8)procplorg.netbsd.kauth.processexpose_addressprocproc2proc_argswaitlwpwait@@ @@ %s (pid %d) changing logname from %.*s to %s reboot KKK]UKKkorg.netbsd.kauth.processcurprocpaxflagscorenamerlimitcputimesofthardfilesizedatasizestacksizecoredumpsizememoryusememorylockedmaxprocdescriptorssbsizevmemoryusemaxlwpstopforkstopexecstopexitcoreschedcacheht_timeskim_intervalmin_catchtimesoftintskpreempt_prisched_enqueue: LWP %p has class %d owner/count : %#018lx flags : %#018x rw_vector_enterlocking against myselfrwlock`Pt5dt5`444Reader / writer lockcrashme_sysctl_forwarder%s:%d: invoking "%s" (%s) crashme on %s failed! crashme plain old paniccrashme_mutex_recursion%s: locked once %s: locked twice %s: initialized crashme_kpreempt_spinout%s: disabled kpreemption crashme_spl_spinout%s: raising ipl to %d %s: raised ipl to %d, s=%d crashmeselfdebug_crashme%s: failed to create sysctl debug.crashme: %d crashme_enable%s: failed to create sysctl debug.crashme_enable: %d %s: failed to create sysctl debug.crashme.%s crashme_remove%s: unable to remove %s from sysctl panicplain old panicnull_derefnull dereferencenull_jumpjump to nullmutex_recursionenter the same mutex twicespl_spinoutinfinite loop at raised splkpreempt_spinoutinfinite loop with kpreempt disabled!!sigactsksiginfoorg.netbsd.kauth.processAD 0  trapsignaleventswitchpid %d was killed: %s sorry, pid %d was killed: %s sigexit 1sigexit 2pid %d (%s), uid %d: exited on signal %d (core not dumped, err = %d) pid %d (%s), uid %d: exited on signal %d (core dumped) sendsig: bad version %d proc_stoptrace4d44WARNING: softint_establish: table full, increase softint_bytes soft%s/%usoftint_init_isr: error %d%s/%usoftint%s block/%usoftint_init_cpu: cannot allocate memorynetbioclksersoftint_picklwpparsediskhaltrebootuse one of: %s[a-%c] %s none halt reboot none%s%lludkswap dumps on %s%c genericmdmd0nfsroot device (default %s): dump device (default %sb)file system (default %s): ?use one of: genericroot on %scan't determine root device unknown device major 0x%llx device %s (0x%llx) not configured root  sched_unsleeplboltkpreemptdefer: critical sectiondefer: kernel_lockimmediatesleep@$4P4`4P4kpause@$4P4`4P4 %pWARNING: lwp %ld (%s%s%s) flags 0x%x: timecounter went backwards from (%jd + 0x%016llx/2^64) sec to (%jd + 0x%016llx/2^64) sec in %s setrunnable: lwp %p state was %dWARNING: lwp %ld (%s%s%s): negative runtime: (%jd + 0x%016llx/2^64) sec WARNING: pid %ld (%s): negative runtime; monotonic clock has gone backwards pid %d, command %s, is killed: %s exceeded RLIMIT_CPU\sched44`4P4A  ( *$/usr/src/sys/kern/kern_sysctl.cp->sysctl_child == NULLkernel %sassertion "%s" failed: file "%s", line %d sysctl_create: rnode %p wrong version sysctl_create: attempt to add node to aliased node %p sysctl_destroy: rnode %p wrong version sysctl_lookup%s: rnode %p wrong version sysctl_query: rnode %p wrong version sysctl_locate: pnode %p wrong version sysctl_dispatch: rnode %p wrong version sysctl_mmap: rnode %p wrong version sysctl_createv: rnode NULL sysctl_createv: sysctl_locate(%s) returned %d sysctl: log %p root mismatch (%p) sysctl_create succeeded but node not found?! sysctl_createv: sysctl_create(%s) returned %d sysctl_free: rnode %p wrong version root %p left %d size %d content version %d type %d len %d: %d end !!SYSCTL_NEEDFUNC!! timecounterchoicehardwaretimestepwarnings %s%s(q=%d, f=%lld Hz)timecounter: Timecounter "%s" frequency %ju Hz -- Insufficient hz, needs at least %u timecounter: Timecounter "%s" frequency %ju Hz quality %d tcdetachTime stepped from %lld.%09ld to %lld.%09ld timecounter: Timecounters tick every %d.%03u msec dummythreadpoolidle_msthreadpool job %p ran after destruction/%d@%dpooljobpoolthread%sthrdplcrpooldisppooldisp%sthplthrddeadjobnanoslppid %d attempted to set the (obsolete) kernel time zone D5callout@$4P4`4P4calloutcallout_init_cpu (2)late/%uwait/%uturnstile_unsleepdevice-is-system-todrdisabled (not system TODR) todr_attach: TOD already configured WARNING: preposterous time in file system todr_gettime%s: cannot enable TODR writes %s: WARNING: cannot disable TODR writes WARNING: preposterous TOD clock time WARNING: no TOD clock present WARNING: clock lost %lld days WARNING: clock gained %lld days WARNING: using default initial time WARNING: using filesystem time WARNING: CHECK AND RESET THE DATE! todr_settimeCannot set TOD clock time WARNING: Cannot set TOD clock time (busy) uihashuser info (uid->used proc) hashuidinfoproccntlwpcntlockcntsemcntsbsizeAA AAA%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%ssched4.4BSDnamertts acl_posix1e_mode_to_perm%s: invalid tag (%u) acl_posix1e_mode_to_entry: invalid tag (%d) acl_posix1e_acl_to_mode: bad ae_tagacl_posix1e_acl_to_mode: missing base ae_tagsconfigure: `%s' driver %s failed: %d configure: attachment `%s' of `%s' driver %s failed: %dconfig_devdelete%s with registered handlerscfargs_canonicalize: unknown version %lu cfargs_canonicalize: submatch and search are mutually-exclusivedevice-attachdevice-detachrootlocationev: %s %s at %s in [%s] deviceparentcfgmiscbootstrapautoconfdetachallconfigintrconfigrootconfig_finalize_mountroot%s: thread %x joined with error %d config_devalloc: device name too longpmfsuspdevice-driverdevice-unitdevice-parentattribute-nameloc-namedefaultlocatorsinterface-attributesconfig_defer: can't defer config of a root deviceWARNING: power management not supported swaiting for devices: %s done. WARNING: %d error%s while detecting hardware; check system log. config_attach: allocation of device softc failedFound %s (root)%s at %sdevice-registerAA*A%sconfig_detach: forced detach of %s failed (%d)detached root device %s not configured detaching %s, success.failed.unable to detach instance initinit rollbackfinifini rollback not configured unsupported blist_meta_alloc: allocation too largeblist_meta_fill: allocation too largeblst_meta_fill: filling unexpected rangeblst_radix_free: freeing free blockblst_meta_free: freeing already free blocks (%llu) %llu/%llublst_meta_free: freeing unexpected range NULLbufqstrategiesbufq_alloc: sort out of rangebufq_bufq_alloc: no strategycallbackcpu0%s/%unist_hash_drbg_instantiatecprng_strong reseednist_hash_drbg_destroynist_hash_drbg_reseedNIST Hash_DRBG failed self-testkernuserurandomarandomnist_hash_drbg_generateslowfastcpu_topology_init: asymmetric & SMT?? corepkg1st%s %s has %d %s siblings: %s GAVE UP %s first in package: %s ureadc: non-positive residureadc: non-positive iovcnt   device-get-propertydevice-enumerate-childrendevswbdevsw_attach%s: block majors exhausted cdevsw_attach%s: character majors exhausted readwrit%s%d%c: %s %sing fsbn %lld%lld of %lld-%lld (%s%d bn %lld; cn %lld tn %lld sn %lld)no raw partition and disk reports bad geometryno raw partition and partition table is fullsectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorgeometrytypedisk-infodkopendisk%s: can't alloc vnode for %s%s: can't open dev %s (%d) %s%d%c%s%devcnt,%d/dev/nullset{u,g}id pid %d (%s) was invoked by uid %d ppid %d (%s) with fd %s closed extentextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags = 0x%x 0x%lx - 0x%lx extent_free: start 0x%lx, end 0x%lx extent_free: region not found hashdone: invalid table typehashstat KMGTPE kMGTPE %qu%s%c%sB Bintrlistaffinitynointrdisknamesiostatnamesiostatsiostat_free: iostat_count == 0ipifullWARNING: ipi_register: table full, increase IPI_MAXREG kcpuset(9): all early-use entries exhausted; increase KC_SAVE_NITEMS AAA A(A0A8A@APA`ApAAAA&A1A@= %upr_item_bitmap_put%s: [%s] %p already freedMust specify a pool to print. POOLCACHEPOOL %s:%p:%u:%u:%u:%u:%u:%u:%u:%u:%u:%u:%zu %s: itemsize %u, totalmem %zu align %u, ioff %u, roflags 0x%08x pool %p, alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu empty page list: full page list: partial-page list: no current page curpage %p cpu layer hits %llu misses %llu cache layer hits %llu misses %llu cache layer full groups %u full cache groups: group %p: avail %d %p, 0x%llx %p pBjfqTqVX`bCd ݻ*,,,,,,,,,(null)0123456789abcdef0123456789ABCDEF%d[% 4jd.%.*ld] |/-\%s: table is full - %s %s: table is full %s: Skipping crash dump on recursive panic panic: %s autoconfiguration error: mismatching pserialize_read_exit()pserializeexclusive accessspecificdata_domain_delete: not implementedspecificdata_setspecific66btallocvmem%s-%zuvmem-vavmem-metavmembtvmem_sizevmem_rehashvmem_rehash_start%s: workqueue_create %d static_bt_inusestatic_bt_count%s/%u%sInvalid IPL: %dxclowxchighcrosscallunicastbroadcastxcallxcall/%uposix_aioaio_listio_maxaio_maxaioserviceaio_%d_%zuaio_jobs_poolaio_lio_poolK7d>7E7 MHLENm_copy_internal%s: off %d, len %d%s: m == NULL, off %d%s: m == NULL, len %d [!COPYALL]m_pulldown%s: m == NULLm_copypacket%s: no header (m = %p)linkcPB8P8L888̨88Ĩ888808 8Ԩ8ܨ888$8,88unixc<=9 Bc=9 Bc==9 Bغ8<8(888L8о88Դ8\8psemorg.netbsd.kauth.systemposixsemmaxsemcntBЯ822228822semksemLwG8B9;=?)'RAAsomaxkvasofixedbufsbmaxsooptionssokvasopendfrbad initial sb_max value: %luorg.netbsd.kauth.networksopendfreesoinit1 %d888888T888socketnetioAsbappendaddrsbappendaddrchainsbappendcontrolsemi-panic: sbcompress sbdrop(%p,%d): cc=%lusbcreatecontrol1%s: message too large %d mbsonameacceptmbcontrolmsghdrmbfreembdatambheadermbsoptsmbftablemboobdata B B B B B B B Bunp_disconnect1uipc 1uipc 2unp_attachunp_connect1unp_threadsendspacerecvspaceinflightdeferredunpgcuipc_init %duipc_usrrequipc 4D.9-959790959)9*9,9 .9'9 '9()9)9+9'9@9 *9buf mem pool index %dbufhashbuffer hashforcing bufcache %d -> 5forcing bufcache %d -> 95needbufbufinit: cannot allocate submapbufplbioplbuf%ukbuf%ubbufbufcachebufmembufmem_lowaterbufmem_hiwaterbufinit2: can't establish soft interruptbiolockbiowaitbiodone2 alreadynamecachenamecache_statsq9q9ncpurgedirhpldirhepldirhashmemusedmaxmemdirhash_remove couldn't find entry in hash table ..vfs_op_descsoperation %s not listed in %s. vfs_opv_init: bad operationvfs_opv_init: operation vector without vop_defaultgenericfstypesmagiclinkstimestamp_precisionp&B'B+Borg.netbsd.kauth.systemfailed to attach file system '%s' because it shares the same fstype (%ld) with %s #lf_findoverlap: defaultchrooted pid %d uid %d (%s) detected outside of its chroot /../machine_archmachinezaurushostnameosreleaseemulkernel_identdomainnameostypeuid%uruidgidrgidInvalid nameiop relookup: null namerelookup: lookup on dot-dotnamei_simple_convert_flags: bogus sflags 4B0B,B(B%s: failed to start extattr: error = %d syncing disks... giving up done vfs_mountroot: root device unknownvfs_mountroot: rootdev set for DV_IFNET (0x%llx -> %llu,%llu)vfs_mountroot: rootdev not set for DV_DISKvfs_mountroot: can't get vnode for rootdevvfs_mountroot: can't open root device %s: inappropriate for root file system ?root file system type: %s WARNING: No file system modules have been loaded. Supported file systems: %s no file system for %s (dev 0x%llx)cannot find root vnode, error=%dmount: lost mountUnmounting fresh file system faileddanglingunmount: dangling vnodeforcefully %sunmounted %s on %s type %s unmount of %s failed with error %d unmounting done WARNING: some file systems would not unmount unmounting file systems... syncdelayfiledelaydirdelaymetadelayinvalid specnode type: %dILLEGALBB"B*B1B9BDBUNKNOWN}BBBBBBBBBBBBBBBBB BBB+B3B:BEBNBWB`BgBrB{BBBBBBBBNBSBXB]BbBgBlBrBxBROOTSYSTEMISTTYMAPPEDMPSAFE TEXT EXECMAP WRMAP PAGESONWORKLSTDEADCHECKDIROPvnode %p flags %s %stag %s(%d) type %s(%d) mount %p typedata %p %susecount %d writecount %d holdcount %d %ssize %llx writesize %llx numoutput %d %sdata %p lock %p %sstate %s key(%p %zd) %02x %slrulisthd %p %s: vflushbuf: not dirty, bp %pvflushbuf: dirty syncerACTIVEMARKERLOADINGLOADEDBLOCKEDRECLAIMINGRECLAIMEDVNONVREGVDIRVBLKVCHRVLNKVSOCKVFIFOVBADVT_NONVT_UFSVT_NFSVT_MFSVT_MSDOSFSVT_LFSVT_LOFSVT_FDESCVT_PORTALVT_NULLVT_UMAPVT_KERNFSVT_PROCFSVT_AFSVT_ISOFSVT_UNIONVT_ADOSFSVT_EXT2FSVT_CODAVT_FILECOREVT_NTFSVT_VFSVT_OVERLAYVT_SMBFSVT_PTYFSVT_TMPFSVT_UDFVT_SYSVBFSVT_PUFFSVT_HFSVT_EFSVT_ZFSVT_RUMPVT_NILFSVT_V7FSVT_CHFSVT_AUTOFS@` !.AS]issymlink-targetBBBBBBB Bufs%s: failed to start extattr, error = %d%s: failed to stop extattr, error = %d%d syncwait/::|: ffsnfsmfsmsdoscd9660fdesckernfsafsfstchgfstcntfstlwpvnfullvnodevcachevnode cache hashvcache_reclaim%s: cannot reclaimdead but not cleanvrelel%s: bad ref countvcacheplvdrainvreleholdrelel%s: holdcnt vp %pvcache_make_anon%s: cannot lockvwakeup%s: neg numoutput, vp %p  *,.024vnB::t:؀:Ѐ:8:::2:L:Ѕ::::xattr-listsystem.user.security.trusted.xattr-namexattr-val%B&B%B%B%B%B %B%B %B%B %B%B %B%B l%Bx%B X%Bd%B D%BP%B 0%B<%B %B(%B %B%B$B%B$B$B$B$B$B$B$B$B$B$Bp$B|$B\$Bh$B H$BT$B4$B@$B$B($B $B$B #B #B #B#B #B#B #B#B #B#B x#B#B d#Bp#B!L#B\#B"8#BD#B#$#B0#B$#B#B%"B#B&"B"B'"B"B("B"B)"B"B*"B"B+t"B"B,\"Bl"B-D"BT"B.0"B<"B/"B("B0"B"B1!B!B 2!B!B3!B!B4!B!B5!B!B6l!B|!B&BBBBBB0BLBhBBBBBBB,BHBdBBBBBB B(BDB`B|BBBBBB$B@B\BxBBBBBB B<BXBtBBBBB B B8 BT Bp Bvop_setextattrvop_deleteextattrvop_openextattrvop_listextattrvop_getextattrvop_closeextattrvop_aclcheckvop_setaclvop_getaclvop_putpagesvop_getpagesvop_whiteoutvop_advlockvop_pathconfvop_islockedvop_printvop_strategyvop_bmapvop_unlockvop_lockvop_reclaimvop_inactivevop_abortopvop_readlinkvop_readdirvop_symlinkvop_rmdirvop_mkdirvop_renamevop_linkvop_removevop_seekvop_fsyncvop_mmapvop_revokevop_kqfiltervop_pollvop_fcntlvop_ioctlvop_fdiscardvop_fallocatevop_writevop_readvop_setattrvop_getattrvop_accessxvop_accessvop_closevop_openvop_mknodvop_createvop_lookupvop_parsepathvop_bwritedefault&Bdead fs operation useddeadp&Btag VT_NON, dead vnode ex&B&B:B p_size (%llu) fcfs%s%u: unable to attach pseudo-device %s at %s: "%s", %llu blocks at %lld, type: %s WARNING: double match for wedge name %s (%s, %s) dkwedge: unable to attach cfdriverdkwedge: unable to attach cfattachdk-method-%s: method "%s" already exists at priority %d wedge:NAME=%s: unable to compute pdev, error = %d %s: unable to find vnode for pdev, error = %d %s: unable to lock vnode for pdev, error = %d %s: unable to open device, error = %d %s: unable to close device, error = %d WARNING: double match for boot wedge (%s, %s) dkswap%s: WARNING: clamping number of blocks to 512 (was %u) APPLE_UNIX_SVR2APPLE_HFS1B2B1B2B%s: wedge named '%s' already exists, manual intervention required %s: error %d adding partition %s type %s APPLEsysvhfsEFI PART%s: GPT GUID: %s %s: bogus GPT entry size: %u %s: WARNING: clamping number of GPT entries to 512 (was %u) %s: GPT block numbers out of range %s: unable to read GPT partition array, error = %d %s: bad GPT partition array CRC (s*K>;5B2IчH5B|nQn- q+5BZIчH5B|nQn- q+5BSFU0eC쬘5BIчH5BIчH5B-чH5B-чH5BSFH0eC쬲5BS'@ )Ѹ5B*1@ )Ѹ5B1x )Ѹ5B3Dh&5B=rGy=iG}5B|nQn- q+5B%s: wedge named '%s' already exists, manual intervention required %s: wedge named '%s' already existed, using '%s' %s: error %d adding entry %u (%s), type %s GPTmsdosswapffslfsraidframeccdcgdhfsvmkcorevmfsvmwresvntfsext2fszfsfictitiousmdidlefcfs(y;P3couldn't establish power handler %s: cfattach_attach failed md<{;Hz;~;};;47l!6534<{;Hz;(y;;4w;42KaaaaaaaaSV;4<;<;;47;534/dev/random;;,;;ą;4;l!6$;4J3/////91?%wwwwwwww;;;444447l!6534bpf7B;X;;20;`;;H;2maxbufsizestatspeers_bpf_mtap_softint_init%s: softint_establish() failed%s: no bpf_if found for %sbpf_mcpybpf_change_type%s: bpf_setdlt: ifpromisc failed (%d) bpf_filterLwG8;7B8BsuŇ! Ȗ" % ˊ 6 C Α Q ՚ ] j w{ MO 7\bpf_filterLwGԳ;9Bbpfops%.*s/%hhu#link#%hu]:%huif_%s: watchdog triggered org.netbsd.kauth.networkifnetifaiflnkstifwdogsdl%s%dinterfaces%s: could not attach sysctl nodes sndqlenmaxlendrops%s: could not attach sysctl watchdog nodes watchdogtriggerrcvqif_detach: WARNING: AF %d not purged %s-lshktoo many interfaces%s: recursively called too many times(%d) %s: m_tag_get() failed, recursion calls are not prevented. ifaddrpref_ioctlinvalid argument to %sinvalid ifnet multicast command: 0x%lxether_outputether-get-mac-addressmac-addresslocal-mac-addressThe multicast bit is set in the MAC address. It's wrong. %s-ether_ifdetachhooksd n;0&AvQkkXaM* ʚ;! *" T# T$ T% T& T' T( T) T* . + , - / 0 1 2 3 4 5 6 /P 7 /P 8 /P 9 /P : /P ; /P < /P = /P > /P ? t; @t; !@t; "@t; #@t; $@t; %@t; &@t; '@t; )@t; *@t; +@0 &`vH'`vH,@vH-@vH.@vH/@vH0@vH(`vH1@vH2@vH3@vH)`vH4@vH5@vH6@vH7@vH8@.9@.:@.*`.;@.<@.=@.>@.?@. `!]!`!]+`!],`!]"`!]#`!]-`!]$`!].`!]/`!]%`!]C =D$E =F$cde@B`Sا@BO[@T6nQ%l7Jc-7ezyund_set_timer%s: invalid timer type pfilFB(Sjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfag jgrn<:ORQhك[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHG`BgBlBoBrBwB|BBBBBBBBBBBBBB̐BАBՐBސBBBBBBBBBBBunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs  gnts== =t=d=,B3B3B%s%s%sstring"propstnge 5B%llu0x%llx%lliB==rbmn==8===integerpropnmbrЦe(Bstrtoull%s: invalid base %dstrtoll%s: invalid base %dB@=B,=B,=B=B=BT=B,=?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunneliTbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlaniflZVLAN tagNONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersaveSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchanSIOCS80211CHANNEL%sSIOCS80211hidessidapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragIEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ specnfscan't get net id for host "%s": %s%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableffs4.2BSD%s partition type is not `%s'Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imagebecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount pointW/,@`>^ 1userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatimerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead.%s: %susage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%xpusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%susage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s .M2M7MCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood H[[[t[[[[ \4\T\t\\\\]B]b]]]%s: #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: %-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s UGHRBD M@dmCLS1@2plbunspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%cl421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)  ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETA***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiBToken in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.2failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEY?Cpclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGS    %s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'r setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %sr%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu Usage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-imsdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgzFTPSSLNOVERIFY1/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/zaurus 11.99.6 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.6 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.6 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.6 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.6 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.6 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVDFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackSendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?The clock seems to be off!Set date and timeSave date and time as selected$0 Please enter the date and time. Current selection: $1 YearMonth (1-12)Day (1-31)Hour (0-23)Minute (0-59)The disk size is larger than the GPT shows, fix this? Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (GENERIC)Kernel (C700)KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.6machinezaurusxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/zaurus/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/zaurus/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy׉߉H#s# ؅#}#!*#;E#V^#{u#t##Ê#̊#֊"#ߊq#N#0# ###׉r#->q#JW܆#\Wu#mvw#x#y#ŋЋv#z#{#|#v$# ##"#%3$~#E!#Q?#]>#%sFTPSSLNOVERIFY/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7FTPSSLNOVERIFY# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed/dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eulazՙv%s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5ʙϙftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalida%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/zaurus/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 %s /tmp mfs rw,-s=%llu swap /tmp mfs rw,-s=%llu /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF ؜̜/sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSɞ (/>EKRZ_glqu~šСߡunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%   "#$%    "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'rndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmd%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICkern-C700modulesbaseetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugxdebug  %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s Ia K=W71Lecs%zu%llu - %llu %s, %s/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS!(-7AJQ`gmt|ǮͮѮٮݮ //targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi C700/dev/r%saNetBSD11/bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/etc/resolv.confpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-30s %40s%-50s %-10s%a, %d %b %Y %X%Y%m%d%H%M%-30s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/zaurus/../../disklabel.c:547: internal error/dev/%s%c%s%c/dev/r%s%cr%s%c%u%s (%u)fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sghxm 1Mm& Q%7"$%uunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSƷзٷ "&/:?DHLV\`hlrvȶ%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s %s. %s%s%sUser answered no to destroy other data, aborting. %s [%s %s]%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------   "#$%@//tmp/usr/var%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%d : %s%s: %u%s %s %s %-56s (%s) %-56s %s%-43.42s %25.24s-%s (%s) %s ()raid%d%uvnd%dcgd%d (%s-%d)VG '%s'%lli/%lli'%s'lvol%.2dvg%.2d%llu%s/%s !"%*s %s%llupartman%s/%s##<##rrwlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -p %s -Z %c -n %s -l %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s%s%draid/tmp/raid.%d.confwCould not open %s for writing cat <%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sgpt destroy %sout of memory-a 09@IT^ ,gpt %s %s -b %llu %s%s_%lli@%lliNAME=%s/dev/%s/dev/r%sr%sStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1134: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../gpt.c:1181: internal errorgpt -rq header %sgpt -r show -a %s 2>/dev/nullUnused Pri GPT tableSec GPT tableSec GPT headerGPT part - gpt resizedisk %sunusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsy   (-5I!E ŲߤMQyEi& 1Ϧ 5}windowsefibioslinux-dataappleraidvmcorevmresered  ( 5!biosbootbootmebootoncebootfailednoblockiorequired%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBLSFH0eCSFU0eCHah!IdontNeedEFI(s*K>;|nQn- q+|nQn- q+.8|nQn- q+EN|nQn- q+_j|nQn- q+x|=rGy=iG};Mt?mWC 3KOOyD<#*=(YbBRuoqr3Dh&\ M}- @Mjy֬1B-чHSW-чHlpZIчHIчHIчH2IчHL6 %?aS'@ )Ѹ*1@ )Ѹ1x )Ѹ%0ST.qBHo6֯i@K/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2101: internal error/%u%s (%u)%s_%lli@%lli/dev/%s/dev/r%sr%s/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2068: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:1774: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2194: internal error/usr/src/usr.sbin/sysinst/arch/zaurus/../../mbr.c:2199: internal error%d%d%d%dȶ%Y]I&?mmQA-NetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition !)6AQAV`hr usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s| %5lld %-3s @DHLPT %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA ***************************************************************************************************************************************************************************************************************************************KiBMiBGiBTiBPiBEiB-%u %uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host sendmsgping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x ?%s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) ...nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu %c\%03o. --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms pollrecvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%x%d bytes from %s: unknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmap??? truncated no address %s(TTL=infty)(TTL=%u)%s%s (refusedunknown qtypeTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Host UnreachableDestination Port UnreachableDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededFrag reassembly time exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information Query, NOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(%s)(invalid), invalidNode Information Reply, %sBad ICMP type: %d HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid maxwait time: %sBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -s%sgetaddrinfo failedsocketbindgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> SuccessRefusedUnknownIPv6 addressIPv4 address%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOP%s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initsplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogbcdefgh?ijkl mnop$qr*s19tuAFvLwSxXzhyoAuBCDEFGHIJKLMNOPQSTU VW!X+Z:1B4K6T^|o~{} "*2<ISbgnt|* &[t [t r r (null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt_new0addingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)pid %d deletedms ms rt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_deleter r link#%dCMV]akt - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s!&+25;protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt lo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)HOUY^biif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s.)9)E)T)]) %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %si)r)x)))&"G! )BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEW%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %sipv4_deladdr%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifatcrer/etc/group: : :r/etc/master.passwd0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- e e u u : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc] ] : (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B./M /e /} / / / / / / /- /E /] alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~/B/H4P</H8X</0 0000"0(0.0 40@:0@0ASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiescs_path=XX= bc_base_max= bc_dim_max= bc_scale_max= bc_string_max= coll_weights_max= expr_nest_max = line_max=  re_dup_max=  posix2_version =  posix2_c_bind=  posix2_c_dev=  posix2_char_term= posix2_fort_dev= posix2_fort_run= posix2_localedef= posix2_sw_dev= posix2_upe= stream_max= tzname_max= atexit_max=Unknown error numberUnknown signal number%m (%s)2F08F>FxDFJFPFdVF\FbFPhFnFtF< [:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%ld ,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'Cannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nn|:pZnF$n31RLHD@;75+)++#+/'++TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K-}Sjr_LvcI 36 TA@.f-}Sjr_LvcI 36 TA@.f acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C059N13xfr?tZunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`K #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @ inflate 1.3.2 Copyright 1995-2026 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.2 Copyright 1995-2026 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.2need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist