08Fi<  Fi+8t tFi@@<@T 08Fi<  Fi+8t tFi@@<@TU Fit`AFiFiFi$h FiFiFiAFiFiFiA.FiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFimD r"FiFiFi (08@HPX`hpxH$TFiFiFihpxN$ FiFiFiK$/FiFiFi (08@HM$,FiFiFiPX`hpxFAFiFiFiCFiFiFiAFiFiFiAFiFiFi!FiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi!FiFiFi4!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi B!FiFiFi B!FiFiFi!FiFiFi"!FiFiFi"!FiFiFi"aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi?\!FiFiFi>\!FiFiFi=\!FiFiFi<\!FiFiFi;\!FiFiFi:\!FiFiFi9\!FiFiFi8\!FiFiFi?\!FiFiFi>\!FiFiFi=\!FiFiFi<\!FiFiFi;\!FiFiFi:\!FiFiFi9\!FiFiFi8\!FiFiFi:\!FiFiFi7\!FiFiFi6\!FiFiFi5\!FiFiFi4\!FiFiFi3\!FiFiFi2\!FiFiFi1\!FiFiFi0\!FiFiFi7\!FiFiFi6\!FiFiFi5\!FiFiFi4\!FiFiFi3\!FiFiFi2\!FiFiFi1\!FiFiFi0\!FiFiFi2\!FiFiFi/\!FiFiFi.\!FiFiFi-\!FiFiFi,\!FiFiFi+\!FiFiFi*\!FiFiFi)\!FiFiFi(\!FiFiFi/\!FiFiFi.\!FiFiFi-\!FiFiFi,\!FiFiFi+\!FiFiFi*\!FiFiFi)\!FiFiFi(\!FiFiFi*\!FiFiFi'\!FiFiFi&\!FiFiFi%\!FiFiFi$\!FiFiFi#\!FiFiFi"\!FiFiFi!\!FiFiFi \!FiFiFi'\!FiFiFi&\!FiFiFi%\!FiFiFi$\!FiFiFi#\!FiFiFi"\!FiFiFi!\!FiFiFi \!FiFiFi"\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi \!FiFiFi\!FiFiFi \!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi\!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi !FiFiFi!FiFiFi !FiFiFi!FiFiFi!FiFiFi$!FiFiFi4!FiFiFi!FiFiFi!FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi !FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFi!FiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFi!FiFiFiaFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFi?\aFiFiFi>\aFiFiFi=\aFiFiFi<\aFiFiFi;\aFiFiFi:\aFiFiFi9\aFiFiFi8\aFiFiFi?\aFiFiFi>\aFiFiFi=\aFiFiFi<\aFiFiFi;\aFiFiFi:\aFiFiFi9\aFiFiFi8\aFiFiFi:\aFiFiFi7\aFiFiFi6\aFiFiFi5\aFiFiFi4\aFiFiFi3\aFiFiFi2\aFiFiFi1\aFiFiFi0\aFiFiFi7\aFiFiFi6\aFiFiFi5\aFiFiFi4\aFiFiFi3\aFiFiFi2\aFiFiFi1\aFiFiFi0\aFiFiFi2\aFiFiFi/\aFiFiFi.\aFiFiFi-\aFiFiFi,\aFiFiFi+\aFiFiFi*\aFiFiFi)\aFiFiFi(\aFiFiFi/\aFiFiFi.\aFiFiFi-\aFiFiFi,\aFiFiFi+\aFiFiFi*\aFiFiFi)\aFiFiFi(\aFiFiFi*\aFiFiFi'\aFiFiFi&\aFiFiFi%\aFiFiFi$\aFiFiFi#\aFiFiFi"\aFiFiFi!\aFiFiFi \aFiFiFi'\aFiFiFi&\aFiFiFi%\aFiFiFi$\aFiFiFi#\aFiFiFi"\aFiFiFi!\aFiFiFi \aFiFiFi"\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi \aFiFiFi\aFiFiFi \aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\aFiFiFi\ !FiFiFii!FiFiFi!FiFiFi!FiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFi!FiFiFi B!FiFiFi B!FiFiFi!FiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFiaFiFiFi!FiFiFi!FiFiFiaFiFiFi aFiFiFiaFiFiFi aFiFiFiaFiFiFiaFiFiFiFiFiFibpf!FiFiFi $ FiFiFi$FiFiFi$>FiFiFi$FiFiFi$sFiFiFi$FiFiFiAFiFiFim FiFiFi$FiFiFi $FiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiAFiFiFiR,<43AU"/ўjX~i2DF`]t-D)zg)~u2!,d3xvmcnsun|iS/6A0lD[w &H2xqS#yE1MþXxw."2Ph :bZG]R\h%J 0Ev? F-]#k<@s=%YJ2 4B]%7tTqٍ$%yR|`8KWq?P^D>`> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4o"4 (0!0!!%%h( LL!%%NetBSDKwGPaX NetBSDearmv5hf3D0D 0p@- 0 0 `ZKp2 p  000Z H 1(#  0P \\3P 4 `+X"J 0R 0p0ZZ3r0S P \Y' x p00R0S ``G0S  0 >(h| P <`V k` 0R?o20S 0  0 0R0P `pP hh `0S L,` P0Rt00!P د& %&&į&&ԯ&&&Я&&̯&&&&0@-MM@ P p  ;0U$C drP TTۍЍ08 2P0 (0P X6 %CN̯&Q@-@ TOP DD,#P $ 0P@ %CZ̯&Q@-@ X0P HH",P $ 0P@ %Ce̯&@-c0 o&0$/'0$/'@-w@-r@-m%@-h;_@-1  0? 0 ЍP'@-1  00 0 Ѝ`'@-1  0! 0 Ѝl'@-1  0 0 Ѝx'@-0  0 0 Ѝ'@-0  000 Ѝ''<00/@-0  00 ЍH''<00/@-0  00 ЍH'' 0@- 00 $0P@IaЍ&,0A-MA!q`!X0 p! R0B=0B  P0H 8 R8B 4!010,!0Ѝ PP =PS0P   0S  0 pPb0P      0 3/R ! 7000<040LaD0'H'4'#=p\'0@0p@-|@PtP00 R 0p800 p0  B0Sqs  '''0 0 0 /'' @-/@- @-/@-80@-M0@@(3/P $ H08 : S( 0h 3/ 0P  0 0Ѝ000  1/qphb0S 00Lm8@@-@FPЍ@ HPЍp@-(`Vp80@ 0 3/PP8003/(PpO@-@P`P 80 (0(3/@'b P!bPЍp'3 PO-MP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 AH 000+ xpt| jF  ЍOT0 P % Hpp 81/qp4 C  ?P p 4 ,a0S4 tp0 0 0 0 "*F0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L00004 8pX  FЍ'X'|LR/ R 0 0/\\CC B 0R0012/P/ A A A A  A A  A A A A A A A A PPA AC-MhB0 0  T~0 0 8 v  ?$ Ÿ ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!d!!4! P ` !4{Z4 C" BXX P!d44hZ4 0" B   !d44UZ4 # B  d44BZ4  /0 Z8p<0@! E` @d4w4%Z4 Ѝ'MbX'U@-@R&C- A `00P4 82#&PP0 (1/qp$ 밀pU Ѝ0S0C080$0( 3/P 0 `V`PED0  Y $ n '<H'&?@-MPA P04 00#!8 0 (1/qp$ wP9 0080 0( 3/PЍ80 $0(3/PP`#U0:0080p0h( p3/p #U0* ,0P`/RP `'<m0@-@L M 0Q pPG0`F [stlV000PXVY4 0[,J00C0Cf 00CS010:0PUP1 ` 00CS00 P U Rt0V00MPYO  00C0S"10 U00CS000 U0P 0@ X' | V 0  00 0 @00S 0S YI''h'm&q''O-M` R0000200010S uܱ@q0`0#0P 00)<T0J?o20ST SRP ŀ0S  RZ  @T  Z     0010S@@  0 10P00CS000 Ѝ S 0P  BR l  @0S Z0 0$'''''h'&'A-P0`!S`P@XY 0/LpP0!S \P W=P 0HH <00S0 $0@&''A-Php@`T0S PW $  %'m&O-`@ ؀0SP ĐĠİp0 T T R R u0p[P Ѝ PP P   P Pp@''''A-p0`!SPP@nW 0ra @ PP0!S P OWP 0HSH\<00S0 GUpGP & $'O-@bP00CS0p0@g W[ " 0 `001 pTpP@0 pW2tQtTP0PP00.PV08 , 00CS010 6 u0P0CS0000 S00 @ X 0000  X0 `0U0$0T p 0 &'p'=&H`'h'mq'''O-pLP0 SPEUP ЍE P C0 0X2b U000PsV xg 00C0S 20  0 0CS0L200 KUZ 0 PPE C P 000S S 1 `V%0 V00`P #Vax t(p 00C00 0CS0@100 0UX 0PFH0P 0 ZPF C V'P尀VP0PP00P U t pl 00C0m0 P0CS0<00jl00`6`''h'm&q'p'ZO-P@`p P`CT  0PS}P 0@^S00\P0S @\[  EP @P+0P00qm$&8&v@-@T 00H0 P 0S( 0C00S 0C0 Ѝ'ht@ &P0 R  QQP0R/@-9 '`G-`PP@ X 0S@ @0S" @T@@DT qpP 0S  0 0 )PЍ'pG-@P tp0SK`HPUP 0 @+PP @`'X0000D@- 40aA R    0/ᜪ&y'40000 01h@- 蜪&'yG-dRdr@`0 0S0"3(< 0?Y+Y# Y{00 R  % T 1@sT0"Sz @`` IQV^Y0^Y-Yj @ 0@^Y-Y00@R(YT0 0ϻ1@s@NT0"SR 0.Y@0 @R /Io@P0 R00R  h@PR 000;Y 00 V@ T0S'&`'`@-0@00 00U0 P000 ,R;R 0S  S   0;SPp'P 0p@-PQS@@R0p`V0C P'p@-P@P S, ($ p 00&Q 0Q\SA@- /`@-0S* 0@ 000S! P|GpP AMPP Q@P 0 S@/R/    /0  '( Q 0@30/@-'00@- R 0C30'A-ppQ1SPS a00S S Q| C200CS00  0a0CSQ0 QF Ee0S `00F0 0\S0pS0 p'&G-0D0!10ZPpЍ0S0  $SPPPPPPX TP00CS00 ! `0Q0CS001Ѓܓ! P 0 S)"Rʠc0U```00ۿP 0b0CS00 O1 Q !@o!S/ %S !`V U 00 0嬿P 0帡0CS000!000\Q00`PR# !RU``0``00}Pd 0a0CS00km0` 1 1S 0S"21a0Sڐ  S`l  PP7 0a0CS00>@10`! S:`Fp00  1S pIa0S ʼ1`0 BRpE`  S`l  P 0a0CS00   '&'( Q 0@30/@-I'`01S @-@0!S @JP /?P /'7@-A0 R!RUUʐ0\00帾P@|O |xp00CS00+ 0 @ R,\ R P Ѝ00!S KP !f0 Sڰ 0R0CS0000 0 Q  vP   '&& ?A-O 0 P,0p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pq PPPೀ0S!S < _90S 1Sm `P0PPPbL ,0100,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S ( 9 d0PP1S PP"G@oG`GoobPVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1Sn P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S 602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1ST1S0!S  G70S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B RL@ `刳@p>L0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P ϻ0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S" P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SN^P0PP RPӮ nQ pQ lQ 0 S:8P0 PPꜪ&'.EX0&,&r'&` -''`' &QP000P0P@u Z`P 00 00 P0 nR, pR% lR& 00 S1S0!S  50S1Sz aWWv 0 =P0S0P0PP1S 2SqXP R! l B R0"0 S07PP0010CSJ bP@p vJ0"S4mPP00 nR pR lR 00 Sy|2 00S <PPPP0  nQ pQ lQ 0 S[0S dPP0S0PPX0 nR pR lR 00 S<P `2SA P0PP P0 -@-0 0 ЍЍ/''-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-`ጁP@0 SS&tPD(!RGdadqU`0``0,0P,I( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a rHP0  0@S  0G`''h'&''!p@-0 P= P@01SE0p0 SS t`P@0P 00S<0PP0 00P h0T 090QP0IX0 ,(`''"'''&O-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00P? 0A0CS0l10G0 P \QH 0 SP 010S mP/ 000S S)00 S [ U 000彷 PH徺 t00CS0L00 0`00 p<P P`''6h''l'p'&O&SA-0P0 0p@ W 0 `@P 0 R00R00 1BQ6H@X @嬯@p+H0"S,"@gR000`''aO-ScpгM@00 0GS TcsT`0``005PG7` \X00C0+0&SK BR D R: Y J@p R PG  00C0S @Ѝh20   K  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WpBp@| \  尶 P rG尹D @w<f00C0 AQ 0 T0 Tpppp  ~Pu p BR   @W0 `0CS0(00oq0  b'h''O&SO-M 0@P0P0s <40S  0 0000 (0 pP ߍ0`CԳ0#2P 00 S pSN(0Y01ڐ Y   $ $PFT PL  BR +430 # W  BR 200S 00 c E 0 0(PP.000YX Y   $ õ$P  BR 200S 0 - pE P0 (0 P'0 p1pG Y;xxZ 創D1PKF剸0 ,P(?00CS0uX   R   MP> 00CS000^`W 004 00S |xP00S 0   E8 EX ''h'O&S'uO-㴡A0QM0Cp` 01 00C S00`NlЍ' 0 P5 P!` 00000`P00CS000  E[  0S00CS0x00` P  P''h''''O-M R B000bsp 0shЍؑ؁0S1  0000 P@  0#੟ɐ Y Fp10S Q0000000p0CS0C01;  \" \    " L\ B   @      0C LN ',&'$'h't'l''A- `P 0 0Cs 0x 0t0 l  C A^  00@pT ޴@ 0$'',&'G-p@P0 `R0  P(S%0  d 1P ڶ0 ,(娴$'&@-fD0 &O-GMeM0PS@p$Q403/P 忪0: SaD00W +g/ P8:TD?0`P0: S 0SHP0: S 0S 0S 0/S&6P7;00poS?P- P #0v PvO+/0P ]H#P]P K/A/PAP ?0P+I [(H Z% U8..0 0PT9..0 0P @DP ^ PT1RP  oR00S$ 0SS 0: SOPN 6  0BG=00 04K BG=00J0SP. Tqb5XGH X00CS0 p Pp  pYW kX0 X p00CS00 W0S P0SGݍЍ0?o25c 00 080'08&&&\\S>0\\O>X X0p@-@P@@DDT ` U H H0Rp@\\9>ppX 0Xp@-@P@@DDT ` U HH Q\p@\>ppX X0p@-0P0@44T ` U 8 80Rp@\\>ppX 0Xp@-0P0@44T ` U 88 Q\p@\=ppX X0p@-PPP@TTT ` U X X0Rp@\\=ppX 0Xp@-PPP@TTT ` U XX Q\p@\=ppX0X @-ppt t0\@ ^0@\\=X 0X@-pptt \@ ^ \@\=5S %R R S R SSh -^L^S R 0/0/0000X'O-QMTh u@ 0 `0 0L0 @@@@@ @@D@H@,@0@<@@@4@8@5 SS$B\ ΋0 !00`V0S9 0 00L0刐St 40D0800$0S00( ,00B?[;$pp;,0S d @?C0000D00H04$0ppl;0$Cppc;$0S00<00@00#ppS;,0S  @?CZ㸰张 0|#pp=; 0`#pp5;0 \ 0C0CQ0B003/040 0S 僱YT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " & P 4 04080080 0Sb Q> 0! XX0$0Q: 0x! dd0(0$:[(: R 0  P 4P0@:0S00P00P00೮PPi\0.S0S 0!{P 0P$0 0P(0 $ ( R P0հP000ЍX'frVUUUwm|pG-@a!80S  'PP )rpW G'<0SB|?(@P @@'@@@0S5!0CS0\D$ 尲  <00L0S \0.S0S b)@0S40S ty)#Y<0?o20S X (040X'fG-`㔱]4DP0L0  HP0S$00D0H07먔pPP00$ᏸp[|4T H0 `F0P 0 \ 4P b]84X0 s0X00 00dt |  P PRPS W( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30VP 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@P> 00@`0S0\0S00S S S0 /0`0St0\0Sh0h0X'ht@4&&'\dP8&&<|ԕP@l80p@-P@T @@\p'80p@-P@T @@\p'L0-SMM\0 + 7p>ڰ 0ލЍ 00 >04@pl0l 0 0  L00S   %&2'''$0\ 0S  '0L0S/0 0 0/0@-M0S   4 @  ;$@CpЍX0T0P@ CH0@ B ?" 0Ѝ@}d'h'|'P'D'P `00CS`0p S00 P0S X0X /X&: S@-  S  S/ I* S  S%|@=1A-`@XPTM !\7@T10S H10S. 004q 00p'p= *@0 0 0) 0@0S00S 0: S@Ѝ0pp 0GRp0x |B?7 0H00S `'sh'|'P'''''''s@- ;@P@P `SU00S @JT FЍp0t  Q \0 \@0U +P@'U''p@-P@Tp0 0C0  $D @C-@4M~$3 30S`sV4Ѝ0 0C0{ 0XPS !$c0S 20Sm 4 㠒;$p|i *GⱭ0( P>D20S 006  220S  *0 : SK( "0 08"$410S10S61!0 0H 10Sx10S : S0: S x`x41萟 0IR 1 B?5 0 'Q ㌐up| , *LN\,|00S ''`'h's|'PQ'x''''''''''1O-@0S$0010S 10S,0001!0 q0P0S ЍOPa0HQ C0P  0[0`SpQPPU% Ѝ  B 1`0    0S[  L0  $R,   V `'h'|'''4&D&'410G-S$0@010S 10S,0000 0 0PG0`VGc렠pPUG s0 0C0 W jp0$S,  `YpP Z``'h'|'''4&0G-P@0T$@0@S 00S,000@0`0娀S㨐@pVG 30 0C0 W ,*p0 00 S !p0$S,  Lp` `'h'|''4&@- M @ p ЍT P 0@  QQ 80 j+T 'P S  8&0p@-P0S``4@P 5PX aA⪨@P8Y lP;p'C-CM@}4 萟P`}9 y9`T *F0 QpPPCߍw ? @P\9w0S ?@P?oP@,&@-j: & 000/'@-Y:0 *&@- MP<1P ᎟0 ˯S , !00  A (! 0  A{{z%p|hȽ00@0 P 8Vp lP 80S IX0;X0XP >P 80-S 1ᑽPXվpPl0S  <+RpY@'/&&%?vOs@-@ `P6P0P UMKЍpU \@?=0 {P4 (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`@$H&3B G-~MAM0SP `E0p 0E~偾PV8d!&0`~܍Ѝ~,P D8 !0 0E~aP68 ~,˼`P-8 ~,¼PE0p 0E~CPYp  Q `/04 0E.P8>( /H&mqQ00CS0 x0 /G-`XDHMp DTD$0@t000000 00 $0S0V"4`0p Q 30Sa3PZ۽PZ70#/e000 0K#DP7h#0n/V 00D30p Q  #'P0 07"0O/V0020"Pk7"0:/2000HЍp(0: S T. S+@ rP00S`0:0 03V-V)Vq 1X  ?0 3 0~\P F ;0L S0 00 0,qp70S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U Z0 XPV P 0H&''&T&Dt(0'I\&c~e&m8@''t&}D00S/@-~M0@0S~, DP~܍'H&@-0p@$0l00S Ѝ00 0X,0Q 6, ].PH&'L0@- R<-P 0 0 -',u('3A-pP@` P@DTP`VA-pP@` ƺP@DTP`Vp@-P@Tڬ` 0Q̺@Pڄ0  Q @;;S p輺@P00T@ 6(0, -( -H&''qs@-R@T` Va0@$00 ?00S 0CS3P350 S9f-00@ЍpPڀ;;S" 00 0+0Q P?ZP00@00" 50S @@50ES TT 0$050S50S 50S 50S $0STڄ00Q Qd-T( L -5(04 W-$H&'u(5k`1 RS@-MLQ R @!  BR0,ЍQ   RR  RQ     oP000S,@  00T0pSp 0L*Qo 0.p T0*Q/'H&&mG-PP`0  ,p@P"ڰAQ"*Q 0P P 0*Q4@ ,ЍP PH&'0@-`xAMPh1P0S2 S VPLDB,00ЍV0Ap0p |*0Q4 , P0S(0S 0f*Q#4 ) Pڐ0V 0? . l0 ` 0᪺P4 0@ N,00H&'`'mO-M 4M S0`RX0E@FP0 0S ̢000 Sr '0S    GC00 0-0  60" #0T~4"#> D2܍4ЍT 2 R - 1[ 0#`#-# ㆸ0S1圁  0}-p 0   0 #T>4!D #>,1$a0 00$0010p(0 C0尐Ի  λ0,0( ,0$ B-$ 0  ỻ 00 0# p尻#]-# %T&&'u(-',u(''q'H&C-PRPb0LBS0000 Ѝ,,0 0 0S 2r0S 1 T% 0S 呹pP (0: S0 0b p10S10S P P 30 0 0S q4x[ 1 %00 0S00p0000 S(00(000 P@0S '000S x0D.P 0+P0p0, 0X$H&''t(Xu(t(u(,u(0'&tu(u( ''C-M M` lP2H#*G `P2#*SC$0`SH 0`E0S2*p-Pu -Pp 0 m S( 1**2r0t0CS G)|)p)5)])\)PL-P0000$2)2 `ލ Ѝ)&0S  R  sS SS YSP )yS)Dq儁)3)P)P@~-P00000S,)( )0S0 e-P +0P)@PP 9P0000)P0Wf) u(9H&'u(,u(W\&T&&=]j t( *}Lk 00@-@DpOp`&O-L|q| \0S(P1`XX@P"@U(,L0 R1V10S :)@DT  A0d#0UPTP#)PV0S t)`@`ꓢ"H 2/L0P ! 咣#, 05&|&'&'Tu(G-@ㄑ0p`FP@cU PppWP<(PЍPT10S (Pp@ 0$03/0 PP" R T  A@KP 80 3/PtPPTT00S\ X(R <003/P 202u('&''9@-AMMP/ /@P+ p`pRP/00P Up0p (AލЍT0_",/0P0 0, 00`('g'{00CS0 P0 /O-0S$M00`Y P$ЍP0,03/P00T30S ,@C@s2PPPP 0030SY PV 20S Q P P x4 CSR qP8 ," PL07"( H0/S6P) ALX m 10S  P0S !S 0l!202;/P K , 81  0S a0S 11004 `]0D0 3/`( 0S 0S 0VP0x0CP0%P!P0403/Ou(u('t(pu( u(u('''8u(u('t('@-<@P/( '])'@-]p @@/ o'@-@p/ 0a'@+p@-MPᑵp@/0S  0C0z/ `{p 0: S@S NS Ѝpf/`C-M~pЍa0H03/P0 03/P㱕tA]pP@ 0AS0 @0a3/PE0 0P)3P/P 9P0/SP( A)00 006@ /t &0(03/\ ㅳg\0 Pu('''8&&@ u(O-MpЍe0H03/P0 03/PsP3D50S 05P .%&50SuJGBP 0(03/ 7 P 0AS0 @0a3/P|4C003cP H4 CP(40S  ⍴P T 0 0  ₴P 0R S = $ `0Sd003p0St00PhP pS`3`0Sd00/S7P', AM S0 0  AP0SW 0S = $ `0Sd002p0St000S "SD p 0 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P |1 H^ X RP$PP ,1P0 P Ez @ ;/0S0S P0S 000[\000*4S 0S 0u(Ht(&Tu(' u('|u('pu(hu(X''H''Pu(Lu(t(u(4u(&t(G- R@p T T 0 $@H03/P0 03/P0SB0 X Pqa0 09p1MP \P: 0 P0(03/P@!!P0 0 @0S 0 00OP@& ፱oP0 0t0 0S T0P \0 CX TPu(ipu(t(Xu('t(u( u(,u('T0@-0S^PP 00H03/P@pu(u(O-M MT崐0$ 0 P`0@@z=0 CzᖨD 0Jލ Ѝ  wr p G@$<pm ?4S(40R(4 \ \0Q0]0S0(4 00P 00H,u(h`u(Hu(l@u(Du(&&/O-Mp@ 0W0DN 00S8 00<0 WPP0C080pG0S `0S * 0R 8 00 x x.  P8 +#@0 X2@ ?@Q*#@0 0嘠P EP` lЍXX Ð  ` `@( u(u(u(u(Rs@-Ѝp@ 0@`PQ"< 0$ KP" 0@t((0@-@MPPv00<00S =  J"Ѝ0u(G-`QM MJP Y@ #p 3P p 00PP=! SR J(ݍ ЍᠨPJw"8 F= $HL0Q\ J(L00 0&QJ["8 PTWl~A-QP 000p@T+`00CS0pT0 0S0T@ 0S@ 0  h P 0S@ @@T S P t(&& t(0 0 S@-0@0R00000S0@000S `小P Pcp 40P`u(du(t(Tu( u(p@-PP 0SEp `ᇏ@P` m@P0/S000000f PR @@@p t(h0 RX R  H R/< R/ $R/Q/ t(tu(\u(u(`0@-0S L0@0T R S( x0@u(t(4a&G-@b- 0(MS 0SzB)(Ѝ0 0p5"0C S70|20S X00 00!P 0 000! " PPp  0!$$! 0!ꓭ  X (4 : S=  S7  S$  S03 0\!  0H! J  ,1,P7 S  S/  S04=! 0400S -Ё ;ЂЃ"040+0 4SP 0d 00  00  Xt(u(e ,u(p@-8M@  ,D 0`P` 0U` @ᖒP8Ѝp|1C-lM0@S` }lЍCPZ`(9="(<p@dWpp P00 0000084X40CSH$0"60"$J 0( E4 CR+p <lЍB>'"3S+0  jt(-3;@-=XM"@r:(ڐ0 ZXЍC7@-@Pp .P Q Ѝ00 $ %H Ѝ0@H0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  ~//lu(LA-@,,PQ U?-QQpW `:WP 0ӧ?`S A蠔A?0:S@0 R   0` -(t(&&/s@- `0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0S-`P⸀p 0P T  @R p00T0p0S ,Y=@P00SPP.0t(s@-@:`P0l C300PЍp@00S S@@PP$0  @D 000t(@-"F됣&0 Rr @-/&@-<@<F0b F FF֣&G-pt 3h@\P*p`4 0Z/00 `O-lM/_oP'b@P= /000?`GPp` PP@t?t/  @p\?X?A0sR  S  R4/4?0, CR 0Kk?zP<N>P ,`>@>0 -R.Q0 000t> l>l. d>`>\>>0SHp/8> 0> > 0S>   .00.0-0==P}===|=-=   H-  g= 0@T pPP\Zy,  0!-1  @L< -=@=<P? <;<,<,<,t<,h<,\<,||_ Y P:4Co S Q  S  FP  ! C 0C0T T0A0 B!"00Ꜫ&A-@QpW :0 01  5  d } (l| <tw @|qp  i=/ 0$  4 =C@2Q! 1Q) ($5Q/^)0)40($84K ARKQ  $ q++   @04(4 :(40/S0004084(49)($ q++@k$u( u(C-Z4$#0CEM@S$030S`` EߍJ(\J(J(J(D ; 00$0$0<0 0 0ݍЍp$ u(p@-@ PP hp@D@-p0-S0S( P@P#{ 0M0` Sh0 BPPP00T Ѝ@`&-@-0@P   UЍ@Ѝ/u(p@-@ATp@0 R PgRP ` `P`pu(-P@-000  x0x 0 0 h@0S \ R00L0L <o ,$ R Ѝ@ Ѝ/u(Xu(t(t(&,u(p@-x@PlthPP \mP pS000S   pu(u( -P7@-000  0 0 @0 P0S | wR00l0l h X忥TFzD 8 0 aR Ѝ0@Ѝ/u(Xu(t(t(8&,u(& @-  &0@-MM@P@Mߍ00/SoLPxjLP ԍp Tύp  0RP 0RP , 0 4 9  000/u(@- 崐㴍P &C-`q$M@T pp奐hAPDx00CS0>@ Pp< @Y@DOoB0S@$Ѝ0P: S P s0S =x pW 7Q0圀 SH@ a 0 G@AT^0 @00CS0,姿0 u(z & x &O-PQAM t2@ l2 00pD4< ^0@ Ѝ/R#RR@ :BQ&@ B&Q@0=S 0 "?R|R& ~RR ^R X!000P00@=S? >S 00@<S =S 00@|S0 0@&S0 0@=S0   +R0'  -R0( )%#$0 v(.v( v(v(   0 @-v(^ 0s@-P0`0X0`0S@ P 0R@P@  P@0S00S 0ST P000 R  Ѝpv((& ~ . @-AL ^`X sr^0 \ 1#P? L 0l0̠?00à cΌ SQŒQQP0R0R0P0QPQP !N    O-p`p됰0%SP@y0V0&S T4m! i000 @ P@P@v( 0@-4M!@p PT` 0 P@4Ѝ0@P S=WP@V P@ 0 F?P@( P@嵊 Uv( p@-@P0)Spv(O-@,,Mp`TP TS T( T) #T! @$TO "T 0#S@P  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0`  HK U! z!P 0 @@! 0 @PV`'T@@`4 @P @ v(    O-M8Pp`t! @p0 X@0DS '00^* PU@  0 c 0DS00Y Ѝ` pUU v(^ C-pᐐ`  0BS0p0@SP&! "000 P@@P@@ Ѝv(G-`d0SP@! p000 PP@v(@-M@`P1PL0P  IR NRpp PpEp@@0SP@ $1Ѝv(= PG-P-PP* @0耟0 `0 0R0Cp0W S `Sp00 0 P>2<2Sp0@81PH0@P 0,"Q@%2Y &x&}((Z @P/- 0/SSS00v(0@-@PMMMߍ00/S` p p  0RP 0RP` p@-`\0@P 0D0p@110"SP Vprzv(b p@-T` RpH0@Q 8 PP 0pp@v(&v G-pWR 0S)P pB000000000CS020S @T  St S\U HbHt0p42@000/Sp=FpPJ0S0/p0CS0pppW00S1000pA0P00 Bp00<0 leSd aS00CS0<10S 00CS00W00 pR0S/S0@D001@*P  R*0000t/S0S P 0/0CS0 pG0S 00CS0000@0@0@v(w(v(z v }(&x& ` A-p`@000@P 00CS000S W00CS0Pd00S H%@ HW 406 R0S 0Ow(v( &v( 2G-M#7r0@TS@P 0.S00.S000/SS?X20PpTePZ( ,`V CPP ` \/ E`<0Eo@o0-S0Sp1@T@hSPo/Pw 0S p%/P  `P =q 0: S W p /PXP pW 0S p.PЍ& (  v(    @-$0Q @ Q@v(v  p@-L@U60P000S LTPP 0Se@@N 101{N00CS00 N 0 M0prp<= (@ v(T &u G-PhR@ @1`0V1 @P ,P  `I\TQp @p0T \0DQjSh00@ p0BP!0 BS@p@00CS00 M 0@0 @T0S 00CS00 M 0 0SZ00CS00 M 0 hM 1 0l1@ @ @ @ @ @pp\@@&    A-@ ` PR 0R 0S S6Mp0S0 R M0S  MU  MTMo xMn Td@00CS00 M 0 AL|&v(@w( &  & 0@-PC- 0|v(40@-@Q GNv(@-x0@T   @@@@ @ʁ@00S 4060S Ѝv(}(&-$0@- R    Hw(-@-  0@-Hw(-@@-00 H@-P@` =-@@-  3@-@--@-00 " ЍЍ/p@-P@ p@-@-   ЍЍ/ L 0P< < @-L,P / w(0/w(p@-@9PPPP Rp` V`P Fp` J`p7@-P240@T t0 6 N S1d0@T PMP0 0 @ 0O@.C Ѝ0(`&w(@(B @-`p@PU'<0P&{ `Fkk&Zg{[[H06S 00S\ M Ѝ @0t0S0T.S N@w(af0    /w(s@-@` PTЍp0P0CS0 M000 P C0 -5@ 00 ;0@-MP @T 0 @@{mp +P   0L@@lmp @0 Ѝ0 @k @w(&j&@-@P 0S0S 4P 000  Ѝ@(0G-`S q0P00#p@T0SP '@D1$@00CS0$10S 1Ѝ00S p U,rm<  R )P00CS00S ULB0S DBUP@I#w(v(w(pG-@P,M^P` U+릐 s)2Q0U2$PP20S vI0S 2$PPPU ;J ^0S|2 0S@~+T ^0S<"$0 0 +^0S2 R$0S0S F@ P0S F0S F^0Sd1 R$ R @T$@0S F 0S F 0S F 0S F  0 $ V $0?o2$0Mx0$ R  0S nF 8J4I Ѝ&`(Dw(h(|&O-M@Pp*0 뤀夠夰`/@P@ *Vx0$`W T ^0S W P  0`S*Ѝ(h&&w(P8PG-P* @0䀟0 `0 0R0Cp0W S `Sp00 0 P!++S p0@*PD0(00$+0 $ 0$/&x&}(w(A-P@耟0p0`0^0S 0S S00CS0 0 0S 00CS00 00$`0C00CS$` $0 R Ss 0$`S Sw(&G- M䑟A^`PV $`*pWT0尡p0p00WZ 0S- |1|a3xIlvI tI00CS00  I 0= XJ00CS00 H 0 H  L^ $`R 0S S00CS0 p  0S pS00CS0 0$`0C0 ) Ѝ&w(((&C-$M@쀟 p) 0 0`W@T+ 0S0 PU@ 000"P x0 0 SP00U$0 @ R^PU $0)$ЍP0(w(&G-@,Pp0ESo᪢' 0S$ 1a13HHY.HUH00CS00 LH 0 .H|aU000 -'PD U@q C 0$0  C DP P00CS000S (A900CS000S U0S0SH0H02THPRH(0GGUp#$&(&(w(w(v(420@-IM000000 20S 00S 1Q1e2HH0@TH1G/PP& |1 1@>0S @T H1 C@G8G1}G0S 1 $ Iߍ0A 0 000 0"AP00CS0 0@ 0 00x0 >00CS0 0S GlGD0GGX00S j@00S dv(&(&(v(w(w(v(0@-$M0000 00`^0oSP4P @'000p\ p&P 00S )5|n>8-|000 p0CS0(00S  ($Ѝ&w(v(?C-@0mM00@H0?_00?0,@0P@ '0o000@@`pPdpTd0lo@0hP 0lP@T 00C0Pl 00$0`0S$?'`0 S 0D0>60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0F7S 'x0R8 @>0S900SE $.00000,(00 0p(0&p  =&0S(7S%00S 0 0S= 8 l= , N|p@ P h=0 LT=8 ,=, R , ,( /%P000<=0S @U0 0P@I/P  @J$ 0 $ R 0Th$0SP007dGQhI 0'000 000|7 t'00l'00(0`7$ 10103/$60 F(7(' 6 ' VDL0S vJ68 6  @ R[ 4 0  V $$Dp&00CS@0 1gP60S P l60S%,0{S5H6$58 h0 /K5,,0( n0000*,( 0#`E0$0(0S,+ $P5 T50S U5,0S p\yt;%0 50S C0 @0 @P$ET= 00<0$0 0C0 000lD000d48 \XP00CS0440S sP( T40S)T0SXOI38 3 3 4\ 30W)ß00:d3 0 0S '|0R#C#0 0 x3 Bph~J00S0TN0"0C0000OqI28 |2 x2 2\  )Ÿ00\20 T0S8"00CS0 2 R   01D0Su$mߍ:10S x0(!SS}1 08 L0H@Is10@0@0SP1  @0S1 01$ @0S 1 @0sD1 R#0S,1   B  @0S @0S7S@<e0 00S ';:T@,0S0 <,0Sh@3 D 0,000 H @((w(((&`(w(ԃ(v(v((& 8&((-&&|&&v(Hw(!(v( B 3E@T(0S p00tw ,0 0v,.sD)lFG0/w(0 /w( 0/w(0/w( 0  /w(P@-@a'P@<0 QP cR   5w( 0S0/w(00@-/0M0@0P xP 0: Sp  Sd PЍ0xP0 : S# PP@(GUhp@-Px@x`M$PN*00S  #0`000``0!`=-#$Ѝpw((@-Pd@$0&0 RP   BQ   w(//C-LM *8ŋ8 p(0@<P@ `D8G `0 MBLЍ`&A-@P`v8pWU La@" 00'#p(@w(O-pWA R``%` P0S:S SEĐ@ @0S(W@  @0T/S/00Cbt00 R00P R:R:RPPP@DO!"x&&Dw(@@-PM/p 먐PK  0 @ T9wp0 @~0!0P 0pWZ0S 0 bT0S 0S 0 Swp @! h`P T T T0}@@T >0DSDw( 1A-@MP`Rk01000  ;p!XZU pfABA Q X=AT;AQDWA 08AS 00CS00 @ 0* 00CS00 @ 0 ЍQ A*AU P000K @00CS0T00S D@@84@(&w(v(p@-P@@Pp 0S%Sp P @5p@-P8@Pp 0RPp@P4L0L-  R0S P P\ 0 &Lw(G-`@嘀0唐0P0|Up00CS0h00SG@0S0 S 0S00`PPpw(Lw( &v(0A-p0@0`P Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S D$P`0W:SP0R@@(' &&A-`P倀000|Vp00CS0T00SA0Sp00K7`@T`w(Lw(v(0A-PSp R+ `a@T"W p000 0 @0 0 ?`00CS0H00S `P `@Dw(w(v(p@-P$@Pp0@P0P4@-L@000@00 _00CS000S@]w(Dw(v(O-PM/`@ 0P @@@k (uP00š0 0S 0S 000V#   P@ 4P @cPM R RA R 0S   0  003 0 03 Z0 R"00в0  *pP7Z { 2 @r 0B?00Ѝ H" R," R8pP B0000S R pbeQ  0X/R0XZp S#P pP tI#P R  R (tP0 * R; R 60@@D P R  P@0000S R   BR 9D R5 M3 P@(. &Dw(&Qw(&7&<v(O-`$MPp `x.&t2@P, 0S*[ P0 00 P0p0Rp`#0`2|P& ZQ=01 P>@$Ѝb@DT@ P  p R  U 01W VYXU' [10 0al 0aS v00@0S v P >W 00SY0 0 S0 P 0< S0XY(Lw(&c@( &p@-P|`0000S S@gI000 00 00000CS0p00Spp@fw(v(0@-Mt@ 0P0000X0>00 I 00CS0$00S Ѝ0@EЍ0w(&v(@-yP 0S$IO-`MpP@d'%P0cS @@ <CpPp vPP VP@ 6 RNcS @ :*0S2UA ̲P0VPF UB:= {P9 3=@Q=T( 00S$ dB00CS00 < 0 U= 0RJPU E=0@ T  Ѝ<@W P` 1000 `@`P1V>0/PW1  ,[ZU<TrPU<U~^<U Ut Uh UX<(!*&:@(@EKavO-M,B,Rp0 @0`V% VV:V  V /V   BR <` F R  Ѝx! R  \a[  m0000S(@@PeqSP@ @Tp ~ [ /R0/SK0MSW 0 BR  R  BR    BR  ' " &w(}(&0A-(A0S 0PS0 0aqP0S00 P000[00CS00S P 0SRh`hp0P RP000[000CS00S Zw(w(v(w(s@-0!S1Ѝp*S@SP``00 R Q0C R R00C S@ `R@|0S00S=STL00 <0 R0AD1U0 S 0St&((A-@Rdp@0`SP  R RQ00PH @w(O-MrR@002 00 0$`42嘀0CA s4`0 SX@00 000CS0E0S00CS0 20S  HoP*0X00*PoP [ P _10S10 DC|0@0CS0d10S zЍ0SHH Z- Z`* V + 0S@0 NP B?`F@ 0S 0 0 0CS00 S00C0~0000C0 0`F0CS0V0Sʫ@@w(w(&v(w(}(02O-p0`Sp0 Ѝ1ܱ @100   Z :[X0S k@ xQQP  PQ XInPD $iQ DoP @800B@P  QE Q@PQ @ T* R RPP 6P Y @ /P@P@ Pw(T(w(&A-XPX@X`P0p00Y0p0CS00S |w(w(v(p@-P{@Z0 @ pw(Q@-pP0` 0S*00E@`PPP `R@ Ѝ `0P@@0`SP0S0O-0R L%85@ @AQ+TK[X H0h0` Y84 0 @0B L    R1 @@9!@@5o\4h$T 0   Y00@@S@$D00[<00 S 00[ 0 @R# R@ @@ #$Q 3 @P @P&8#~@P#K P @P "~00@P"|b'TB P%U 000S PŸ, 0pAQmUx RA00CS0,0 a0 H000P  00B 0C 000PT1 L10A+Y00000U>0 y1 GR<00#S000 B01S0p0 G0 B02T,Ѝp U   p  R00SPhTs.؃(w(&&}((0(1TO-0M Pp0 t5 h500`E` 00B 00~S }P0 0`Z Z$:Z =Z Z6 Z     BR &   P 0 AA Px4 J R Y 0S`Ѝ0S 0S0@S0=S (  #00CS00 w 00w00  #00CS0 0 u l#00000u00D#00CS00 00 00(0S 0  CR  SR0C 0 Y "00CS00 v x00v000PbS000 S 00CS00 ~  BR  Z `TQ00~00K !00010S00 S0 0S0S04 R @R*R R; `#  000  BR !   P  AA   ~R=Z0S 00@  `T(&w(&(}((|1G-Pf0pApS 0000\1\0P0P1p ` (ppptV0 S000`0`0CS0#0 p0pĐpG  G 0   ' 0  R 000p_ 0 &w(&x&}((w( @-0@j&O-PAP`0$M`F8q00CS0@0 PP45 0@G0 P0 0C0S0?P 00P0 R"Y 0C0PEPE0000C0$Ѝ0000w(&}((vO-R`P@p[0  0000PPX P X  3 0 E0CP00S HH /(04 @D,0 0D }w(}(&&{O-Pr0BS,`x@(   R g[0  0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y@F0T: 0PD BU# 2Q0 TQPR D2@Y@FT: P7 DU0#0 2S 0TS0Q00R D2@ PY 0S@@T:@PF0D0 0 C00PE0C`F0T00 0 D0C0CS@0 000000C00000000w(}(&C-M@Pᬐ`B 00000吀0p0p00CS00 p0@ 8@WЍ00pw(&x&}(A-Pp@.A00CS00 4. 0 ` V.00CS00 . 0 ` V(`d.00CS00 . 0`&@-*@-&00S/ R$&T0QH0 0Scq o/P0//w($&0    B /w(A-@P堀0p000` R$ "0 `0T    0 0C@ S000SAw($&w(v(0A-P` @0p0W0 P 0X S S0 000 00 0h0    0 0$PT M00CS0 00SAp$&w(h&w(v(A-bB0 pWcr 0S 3-1-0S@0PP0/?bP2b000r0S\00CS00  0S 0X0#S ,b P  $bPf-0  0p0P0 R R A   BR 0E0CS0000`0\00S <-H0,`8 Q$&w(|&&&&@-L@00CS00  bp00CS0@Yw(@-8P@P 0      00000 0$00$&w(A-P@`000b$ aV |`0Pc$p0PS H0  0000CS0 00SA{w(($&w(v(@-p0aM00P0ba@PbP(0: S$ 0w EaP  +PYal00 0^ Lah#TDaLX00CS0,00S (Ѝw(2Lv(A-Qd@P0`00 PHpP<0`00CS000SAw(w($&v(p@-`P@00P0#P [L 0S00TL0X 0000CS0p$00Spp@+$&w(w(v(0/$&p@-@(`(P0SSSp$&x(dp@-P@0Sp$&x(p@-@Pp P0Pps#0@p$& 0 R/,& @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0D|(5rO,&A-R0S20SPB`T p #@`pp "#JP +1 N PpW`p n` 0P 〖'''^` qP `pcM  SJp,WM  B` P `pHM  9Jp={M "00['X'U'`D|(}(,&2&}(0S/p@-@PP1PL1D8a 000P0R 0S"00D05#0s  0C?o2^0SPpP !M xP0S *00CS0p\00Spp@x  PAoQPD|(#5rOw(cJv(p@-@\P0P00 J@00CS0p00Spp@Iw(v(O-@TMp R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S|22 G! R0+  p  !R-   |" `*  0X" U* 0sT0 yJ   )00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Zc)000u  ) #40  )  )P S#4 L  0 kp@ h   \)Ѐ 00Cs 0`F0j&D|(,&5rO0 @- S  .^\Q    @S0C $00P0R0S O-PPp10 0%SX P 0@S!!Q@ C$0S 0S  R-S %S +S H1@@YZT$W@1 r9 002#00S 0S 0Ѐ?S  P T"@` [ P P ^ `0@00SJ R Q !" R @,&D|(G- a 0S Qq0l0@S @ (А0Sʬ00CS00 I( 0 )0 R  0 S0!(D|((5rO:&A-pP`/P00Stp10P 0S TEjPp pPP gP`W@ P1 1@q(`V Q U` 00S`AJ 0 U(P00CS0 '0 S 0 000S0 S 0 0BF(nD|(5rO&800S /@-P `D|(8 P  /Q 0SZ//D|(`060S/P00S/D0Q<0  40 A!0 S00'&}(&D|(5rOG-`Q0SS@00SjZqP000M:@0 C @ @ R0000CS0L10S U4q000$100S010000<>00V00CS000S 00S @pWZ00萠{ @r0 ZGꙂ! P00 R @D|(w(v(&A-@S`!1pP@! HL%Tp1@WV2 `1N0SN U 0S0Pf]Pw\V 1'Fp+iI L#I#060S$ B#?#<#V?%<%U 0S hPP[`[P L WT 0  V}(v(|(D|(&,&08 N R S  0S  P 㼴&O-`RBM0p0 pP P Ѝ0S0S "0000@00 !P:TR 0S0L 1 0S1060?o22T97 S 500070S а 0 Р㒺* S :^ 0R Q0  r; R-z!  Z B/o" R" \    P 0 00CS000S \  V@z   BZ/o"  "0h(w(D|(}(&&v( G-pPK@P EP1N0St `E@:\T @6\Dp?H 㠠`@0S0S 0S0S.`@Y 0 X 000 8&,&jD|(A-@s PPT0P 0S JplP@ pP@ ZP@=pt06 R0S@@PX` p9 0 P m(&&O-`s$M. PPY30oV &P *P :nU pUV `2`L3 R ZP$Ѝ3P\!ZpP'0?oQ20S P V P  Q6ZP@@=Y pW  42pP QY QuVP  J(160SG\  \@ /o"/ S [ %(\@ Q 00p\#Pu@T R *  W R "0S  RP 0 S0C 0 \ 0 R00YXcX `Z^ R[00V((D|(&p@-PvY`a000@ R 0S 81nCp rF!;0S 0 00E1  S h00P0  D@ RQ D@@@Q00R00S 0S|00CS0000S pw(,&D|(5rOv(<1p@-Q00@S%$P`0SP00CS00 # 0 $0Bp 1F.!P#lP000V00CS0@800S ~pD|(&,&w(v(@-l 0@0(@-@ a @p@-`@00  p 0Qp\ PU#00pD|(O-LRLb@Dr 0F0T$ T 0"  @D@ Ѝ0CS0!)0@T0 R 0S\S0 S0S S S=S7 " CJ 'SH 0  DA-@s布M`TL 0SIPU0S 0S p#"B@ 0 BRS@@0#":P+ )@`!@P@PUV0S  0S xPl\Ѝ@P@P  0S P wPlPcP\Q h`0PPUD A4 <0 S1PD AwP 7P 4P 1P .P +P (yvtD|(L_achmtpw<y}QTWY\Np@-@PTpU0>U 0S 4@ap@-Px`x0PP6 R@N0S@2@@0S@D. 0    p0 pD|(&A-0P@`Tp R@ 0N@T P 0S@@VW\0HU 000000V0@ }(&,&A-P`pᗵp P@ 0 A`C*0 G-PP- 0M00S _o1s q100 00R00 Sڨ @PЍ~0SE  0 Q S/R CW P" Q 000S*  RA ``0S:SV@!00S!@A @00CS00 ~ 0 ( p0SP0@ 00h|((p|((Dw(x&}(&&C-M@$8T4App``P0S 60SP 0P# 0^0x P1U00S^0SP60S .0S } PeP PoЍP ^Y8 0 P0C?o20.h(&&&h&X|(0S/p@-P000T@PV00CS000S TpP@T` `@V00`T0@0MvI0S V00T00p@w(v(&p@-h@P000TP 00CS0 Sp@ 00S w(~v(p@-P@LPU\$p@-=P@-(?Pp@-P@1@pA-P@P0`S~U0p~00 p0 000CS0h00S k0p000000C000CS000S Xx&w(v(P0 @-T{ 00C00/x&00  000   /x&}(p@-@tPt`0000S0000H0 00CS0p,00Spp@00}?w(x&}(v(@-D@ 00040 00CS000S@w(}(v(G-qA0@0000V 0YP0kPSP) 00?0 000E000PS V 00CS0l00SG E  P0) ` 0`00w(x&}(v(T 000@0A00CS0/00S/w(x&v(p@-$@P0 0C0C0px&}(p@-(P(`@0@D00C0px&}(( A00C 00 0C0/x&}(-A-(M@@`DHpPpPVP u vWT(01 0P @ @p@DP`U(ЍAЍ/T (01 p@>0 P ,pL4O- DT 4tQw(v((&&,KkO-PMf`@8pP0S 0S20YJ U0S JSW@ aWP HW@` ;T @Pi Ÿ  00 C RS`   ް P  j& :aRpOG> U0: a:#P¯T@3UQ `UBR 0 U:``qp\/V  d*V P 0SHA01 0pЍ U0㋰ 0aY   `,QP *>y` 0S 0qpl 0Y 0P4(XDk u&|( BR00/00S/@0S/ R /0@-@0000C S  RR R1\ *PЍ000C S0S//p@-PP @P  \P l VP TP<P 000C SPppppQX0 0@-^ @P U@R000/&p@-`@`P6Nr0Spv@Tp@PUP@PO@;P 0 Cp@P&|(G-`PR@]Q6 @pA(0S 0 - `V@A00CS00  0 x1@`CQ 0\!SX @TP<8a0 R 0R- @TP@00CS00 K 0 Q P @1@XT@Q@pQ PGGpW, @-fU&&%4<B<0 \+P@--|9&0S/p@-@PPEPp@r:q:A-@1SV@D`pPU 0@P00` PR(O-PPq00U`0SP  -R  RC -R0SD @0+R7 `;cP[ U00PoP0S P  ``U @-rP  R `DX @U@0PP ЍU0S ЍOy((&A-PRB00і 0`00S 00S0S006X pW޽P ڽP6p60S0S60N0S60N0F0 0CR?o20S  0-S0F01QP00SQ 0S D0P   000S  00^0 PA( R   R0 0&(@w(P0 d@-X@000D00S 00CS000S w((v(000C S/ @-0P 0  (G-0p `R PU4\ 0S -R Q 0L@C10?P@!  ,]PP P@U@b PPiP-U0S 0@T0:SF 0R@1T0:Y " @P+@ P0 T 0:S  @P@?:\00|@Y00 X @0 0CC!08 2A@ Ѝ&P@-H;D0P  Q 000CJ Ѝ(( $0@-S Q*0S-QQ -Q^ R0 P :R0S0 ^ HPP0@:T  ($((G-`R@ 0S P@ -R\@@$0P 0S 0-SM@T@F@D@0S 00?q 0@B00`FA!0S:0P:0`0#1@P0 0V:0 000CS0 10S Y3,3"@0Sp` 0C  0XZO0a`F  R0 0CS0H00S (@0S 7(>Oaw(v(xp@-H@HP080Sp0u`0CS0` 800C80th&}( 0R @-@T c7 0 B   B /@-@0S@p@-@P0S0ڈ800@2B ! ! !!  !!p@-@9    @h& 0S/xQS  00 S/00 0/0S/0/.08 0/=P/P/0/.0 0 0@-h&0 p@-`R`@PIP #t00P pd0 Pp0-S0S0 0pV ($00080@p|(|(E h&O-MRp00gp R XT2T"Tb@P  0SRy RR00CS0`1``@u10`0@Ѝ\Y.R %3 P&  BR 000&p 0 S B R  Y000p[@X@  BR@ Y Y  YR  Q P Pp P  Q  R P000<00 K(&S &x&}(h&0@-@M P0` S @pᙿ0 Pl l "ᐿVT 0U@ Qx0C/  1x0 h&r  *!0 @-M@P(0 00SPcp@`T*vpPT @T4PLP @0 P4Ѝ@x&&(O!]!t000S p@-`P@T T TH p<080@p$0 /ph&0!Qp R00C0@R 1 00C0v000`@F 0`"0 !00C0w001 00C0v0`(PA(P00C0y0@0 0"!0C"  0 P$0`2  !!J00pS 21 0僐0C`0@50 0C0  00S 00C002  B )Pp( "10C8#8S1@00C0x00`00C0p0 e00S210"QQ 21Sx0pW 0 l0 m00CS0< 2pP0@D21S;0 0#<R00S2 0S+0SP@ P1P0U1 UP>Y/UP2>P0 |P!000P$@B0 Ѝ@PC0 ,  s0P*0 &P00 0_<P >P &P 00p0pr0 ((0 @0(0-P   p 00@0Fh&(&&1x&}(/w(w("^"u"";""""|(|(.("&20 0{P B@ 80 <0p }  0D 00 B{[ #PA}P@ 0000@ P5 }P' @ 0  AQ'=0AQ@=0@Y0%[y :[4 #[5pt|0@ 0 p0K P AQNY 0@ Qp 0Ap:7Dr ƭPp@<YA+ Q:p%pp02Q1S 0GS2@0  W z 2W0`2  !n!z@Q r@p[p}[ IoQ 0#p0CS0p pT@'P023Q  w000`"0 !5  $00G-`Ѐ0@T@@0PU 0@S 0 0   B/o"Z`0 0pS 0 x$ 0 0 0h&1@-0P20@-aM0$ 0 1< 001@00~1|0000TPI1| 1@Q  @@00:} dv 0S $Q. 4QG Q 80 1,4  0<  ,0000 0 d0 0 0 S00aߍ0 t0 `0 KH0 D0 H00StTS,0 0v(&v(h&1&v(q!"G- Up0 000 P    x5P$00pN@,&tP 0 R 02`      00S 0 00@> P0, RP 000@ 00 00 R, RP3 00300 0000    BR   0`0 P 0   CR S0  P P`  ``t 00008 @0C 0 `00_`0 Sl奶P X0 R   L000`0S0 R Ӻ000P 0 R000>0  P 0@S P 000| E`@`#00P0`g0 P.    00PU# T 0S "0@P000S0P0S@0S 000@Ѝ$00prh&#,#l&&A-QQ@``p  @0p0 P 0W@ 0q R$@@`HR ( X% R"p0` 4 P (/Ъ`P 08 000C0@04`Ѝ Q  0Sppp0 00 00 @p 0h&(&/#N#A- @0P P/ 000 `P s000p0l@`g`@@P 0`0 U000 TPPe``0SU QPh&&`#p@-PP @0 @hP P 00000Sp Ӽpph&s#  P/0S/80 P/0S Q/0P(A-@Pp`00p` P@-` _?P圼0@ pT@v PP  u> Ѝ C@Pj>A>;8 5 ?$t& 0P/P(RQA-pP`% ?VU``P``V@ 8>`0 R@>P Pr+ 0:#>0 t&$$A-`@|pPT@Q00C0U U d)@P 0P=P(p@-T@T`0P0000F)00CS0p00Spp@ϻw(P(v(P0p@-`@TpV@PU P=PP(|0p@-P @R QP =0 bP `=/+ 庻pt&$p@-@pP0 S0C0 T  D=P 0S=,0O@dA0 T @@p@t&gfffP(p@-P`0 Sڜ S e=@P t0 R@U d=p訸0S 0 S M=@ꚸ0S P(|(t&p@-P @0Pp 0  0pP(@0@-@ P  R (@/=0P( 0 P/ R/P(C-M$P0 U00000p#0C@S0` <@P 2@@Gy  V < <2 R@Ud2T /o"Rm <h`0"0<@P2V0S' `<p@! 1>p P<P1 2 0: S<00``!l`P!` `V'oPP * 0夺 V U0S00! 0 "1P @·* 0s<00CS000S [Ѝ@rT  0P) 8Xw($Hw($t&& \% %v(3%Rp@-@`PP Vp ) xD"<pPV l<pV b) 0P0 pq%%pG-` PppW䀟@  NPA p0S T Y  <G8  x 20@ ,V L &T 0S @V@ P&@&E&S&Y&H&M&p@- P@ ;p R  ;p d0 Rp ;p ;p ;p孹P(t&[&p@-@PpD0 0RPPp03/;PpP(O-0$M@@000`p@A 2 p @尲娒V 0S2" 0S2" $Ѝ@0Sp2 R@00CS 0SP P ( P.;Ps{PP jT (;0SX jPS;딡0000P Sm\1 0R  :pPH0C S A(  Q :PP 20S( :PP0 RPU :0 600CS0p00S T0 00`Y0SP(|(&&&|(&w(&t&v(O-Px#xcxsM0@P P00T#h.p,`U8@D\T(Sh 0Ta000pW` ,@p00S0SqP0SV0SS0sS vS }UPp0+S -S To M@ Q0 R: 寰 P 1   J&PT 0 @0SA0MЍUF p p0      "TR K00H' r   %5S 9p2p' 090pY0 M I0 H -& -&Q&|(|(&&&%&P&&'<'['A-PQT 00CSPDq12SK R@ 0`0CS00 `0120<S R 0q0S 0CS>S RS|l R 00CS0N0 - $'''p@-@ᢴ0T PR R R& 1S#0 却PpR!Q QT " "D0600S0T0S 00S0`(w(v(&@-@P @ %PNP(@-@P NP 0 J<  (l((Qp@-@ 00CS00 P `d 5?U UL?Up!P0P0CS00 `((A-@Pp0`00 T 0000CS0H00SA襶0S 00S $@w(`(v(L P0  /Q Q0 S//`(@-@bM0pS10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: {p3 0S$ UEop' W`RUM@D0>T000 0 u00 7TPx0N R T  DR 60SЍQ Q2 1 @$ `(}(&(TPO-@`PnP phP cP0@DpSppTPA TVP@DP:P5@<LP, (4  >@P@sSa0S 000#T $00CS030S @@T00PpӪTW00 T\W! Hs@P 0E0`P 10STw@ T@@VPT @bP1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `ԡ̱PEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 @`1 R :"T` F00CS0400S (( (((&(`(w(v(#(-((1(<(E(&(J((G-PPp0E` o@㨂 TUG0S 00S 0@0@000CS0 00S }@d(`(w(v(p@-PD@`02S@20CSpNV02p`(40T0P?o20S 0S//`(C-p@`1010r!Q0@S10C1 ЍqXPU X2mP!`P 0S c`(4w( 0?!!R/P/`(p@-8P\2Sp@\Bp`(0-MM01`"R !R X"R   1 1d"1!d2S ,KIPl1, ,BIP L!0,009I@P$1, i@T0dL7`0P, U @T 0S P坶00CS0 ! 66ተ00 0$0(00D>S 00 m575"!031`(4w(v(w(0@- `"dy`(p@-@H'P0PPp0C/U00p(p@-T@TP0 0P0 0 0000CS0p00Spp@Kw(|&v(A-@R`P`p  50PPEUp WD肰0S Q/ @-Q@P BP1Ա01ı 00001p@-s@ 000010100C0p RP000U00 00CS0h00S sDP`000B00C0 Ȃ(w(v(p@-@P@0SH00Spp@00CS00  |&0|&0|&@-@P˲ Ѝ;)-@-  Ѝ Ѝ/-$0@-  ЍЍ/|& -0@-Mh0, @P(0 00SZ0c1 @00DЍ0@Ѝ/G-@'`P$ 0S! p0S00CS0?0 " v00CS000 " 0S xpW PPp 00CS00p ' P'\ 0'X0C S00 XU 00CS00 ' 00SGU S00 00CS00 00CS00W P PU UPP 00CS00 ' f)(|&0Q|&@-0@|&@-0rSϱl))0G-p0 P0R(0帐@0=00"=``F@VPpPER000 S=S B`` R`ĥ`PG@&}(x&0@- 4@ 00C000 06Ѝ؂()0P P PR00/0@-@HP^ ^  R0L00.A-( 㴀 R (p`@pW p0S 0QPU  0S 0S   3/P@P00(0Sfp@-@够PUl 0Sp'SPTP@'pPP,p@H  ED))))))A-P0@S`p    3/@P@PX %W  p0@=S0U 00 00CS00  0 00CS00 z 0 T )&)O-@00pS 00P㜠`V  X0 0@PU* ЍY   [ QʁaP`0p؂((@0 S =SR/=S/A-`P0S=SPERPU@'㩨\0\pV!0@qpT 0S PVpp@؂((1@-`0@S @ PPT 0 `X X `   `P Ѝ@J00ph(n8888@-P0`V) 00  l0 000p@ 0lA A@00T0,A A00 Ѝh(&809@- P@pလ `0P h@h0 AAХ00 ЍV@@T @ 0 AAӥh(Z98@-`0@T/ 0'R"RPP0 Ѝ@ꕢ P᜙ +0BpP d0000 0HA Aᣥ00 Ѝ,pPh(&e9G-`P`@V@P ᆥ@0`0pF ,kp@0P0h(9(O-0hh,M0X0\8P P1@01%oPp PE@ LP Xp (p70PEAU,Ѝ0  000P@`V7 0S 0S\V $`7P00CS00 07 0$ %V0%S@600CS00 y6 0P`·0p*Sp`0.S0@*Sp@Z`P姷`p<ᡷp@0xZ0WZ%Zo A0J R %X0J S00%S00;눅\P  :LP \Q 0p\\ s00vG t 0 D\ \LQ b '\ \\ "\  \ M\^0? \@^0-000fnrtvaet >0P030  C 1 01똓`P &d P`  db  Pd  x㰟 s0v0 t <0 岷p B`0 0@ 0 堷t0  嗷#l cZv t0 O <"0P 00t W 1|j  1v t  j 0et 0^h0P $0'S"S {YX0S$ L v t   0# x8b0$0$  Yt 0c#v t   0Tt 0NVBT0 H> h(&9&9999777&9|Ȅ(99H0C-M`q 0P` Pp f&@P 04 p^&@PC 0p W  ) PuY <YPP0( 0ES _P ژ 00S00H p^YPH0?S0 -S00H0,Ѝ|!::;:;@;H;t;;07@-@0 0 X (TPQ WPF , Ѝ0@'00 ' P3<:e<^<A-p:㾏P008U@P3 0S0 =㬏PP U00 c`cVxᔚP 00 `8iVTቚP 00 <ႚP, b 0$00SЍlVpP 0 0oVfP 00 _P b 0(0 Q 0SMP00CSH b0 0 0Sz<<<<<:<<<<<<0K00M00P0D0 0C0D080;800,0/(<0Q8 00,,<008 ,0/@0D 9K<@0(080$00= 0D00<00,0/+$@0@-d00$ 8 Ѝ@-@4$000@-@4000@-@(0(S00 0$0,0Ѝ`t p@-@<#PP빑둒GP[`8卒<勒@剒D凒U\偒`, 8#`6#V0,0p<@-@4ڻ8 0,0@-@4л8 0,0&&<@-8@&<( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8 @0<<@00,0@-$ W$PT Ѝt<@-J$PTnt <@-?$PTot =0p@-MP`0@-S00(000 0P  PX$P 0( RX  0 0 S40,03/Ѝp&=>->A-@`PpQP-U@QP00  PP0 -U  `0p@-@Px @0P ,pT 80$P< D0TP$ <0<Pp>?h@lAp@-P @0S %00PpЄ(Q+  0 BR @-p% M- 0 S^0@Q 80^  ? 0  / /C؄(Є(Cp@-@dP`V P%p`HV4%0% %0Є(CCCCO-M`pA P U d w%TP L p%XP < j%PW ( d%PU % P p T,0p vR S [ Z YXW0S@0S 0S T00?5S[ZYXP 5T <@†{ RS [ZY XW :S 0S0S Px T0pPS X WU<P:TU $P$bR@ 0*T 0S Tz[TuZTpY  TkX TfW Ta0Sl hT\@0ST PTW 0S< 8TR ( $Nv 0T 0QS TL[ TGZ TBY T=X 9R@ 0T 0AS |ppT9[` \T4ZL HT/Y84T*X$ T%W T :SxT0S pT0ShT aT  ZT SSpKTX`\DTWL H=TU 4PU(2TUP T;S < SA SUS S  T:v`XS&[& Z+Y0X5W:U?0sP0SSUA t<ST[ TZ TY TX TW TUx tThh BPUbЍ0i4"0d @"T   Q ! "0P녡t! P0 " Uᚱ ᘱP p[EEEEEEEDE{ECDCD DDDDDDDD$D%D,D-D4D5D=D>DFDGDQDZDaDbDiDjDqDrD}D~DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDE EEEE EEEEE:E"E+E#E*E1E2E9E:EAEBEJEKERESEEEE@-1 Y#Y F&40@- ,SA0 H#H (F&s@-@`40 00#S@P)0S 8 P00S 0 PЍp?GBG0S/#Sp@-@,P(p0P 00p(F+@-PRP@ p`\p 0R" Ѝ0"S0SO 00SS  00@OꜪ&@-T׍PL0 /p@0"Sd.Brp P !4SE 4`SB2 4`P=2a0C" 20< S :Bt0"SBmx5`|%.BCpj P* x5< B B0qptB Y0x5< 0RDBD 0BQ<0P Bx| RjP 00 00S- pP0`(V& R s S 0|0 0 0`P TލЍcdd&^`dd5ed`eeeFe(8&(e - BR0 R p@-Pa@~ R! hrv0 q0 lᗵX0 |ᑵX0 hድX0 Tᅵ ( <P, 0,aK0 $G8 C4 ?< ;$#7$,3$</$K+P ]'T }#Np 02Q0S*?X`\PQ TV@:p@~xhhi iii$i-i?i|iRigi-j1jO-pᔀ 2MSR R@`aK 8QH ,[E 00    o0d"@`  8 ,   X0"@  0  !R!!' 0S 0C R^!S[0    0A€8QI "P <0P+8孇Q* 8 0A0  @q2<0P+8哇Q *ЍO苴0 0 0 0pN `I8 7 ЍOЍ4j=jxhjhhKjkGkTkZk kk-kA-@T`Pp()T`8SA} 0`\k 0`( "4`#/A-P @4"40 4"40 `p (l(,,004488<$4"44$4"44<D$4"44$4"44$4"44$4"44DPPTTXXQl`pW(4"48(@4"48d0`PV@P ~ {0T0A0T0A T4"40A(@-@l40Pm08f/nWEVT@-@P TP8#!00Q@WEV(80@-@0S B08f/D괆( 0\ P0//@-DD@0 <444_ R. 0 (m|&&;mSmP7@-@ PT>P0 08P8 0+p0 }A Ѝ0[m(vdam0@?o2P0S@- p`P@P P  P P@V@lPH@T@T p0 8@A@@ Ѝhmmmomqmtm(udamP0@-M zdPd@ p H!A 0 400+ +Ѝ0(zd@ymmms@- Pp A0  0 @0`D   _0   0  0  0   Ѝp(td@mmmmmp@-( PM@`P ]p  ( V V h PЍp (.uH( Bp ,@0 r(}d(@nn~d(ooP0@-M @  uP@ q@4P4 p0 l@Ѝ0%o({dЀamA-`!圁0@Pp0M00!Zp0SP\@BT p  <D@eP qP p`(,0Q 0$0S* @P "@QVW V0  x0( e_PR0ct00(0S0Ѝ00* *  `@-&Ro(|dUodootmP@-$M 9@P p t?pRpvpxd |pppp&pq q:qOqaqhq8&PA-M  @?sP\  7sP< >   00S `P0"S U1r0%*V  00S pwx00 "R00S pd>PdPd `尀p p0 <[>0:Ѝkqqqqqr)r(ydamCrC-p@P` Q 7>Pd@ R;  b1p 4)>03/ ЍCX |&]r(qr 0 @->(amP7@- \P@X幂P H0ⳂP400 p Ѝ0tr(wdP7@- :4P@, p Ѝ0(d@{r@-7(0   YY s&O-`,M @PpP0T 0$0X,Ѝ Br V p=$ P  G p $0 S 0T@,0 0$0S $xtkYV c ֝W 0 @DLtWt\ttp@-@P0P& 0P+ 8>0P  N=0P 0PtP0@p@蝝p@ 0tu@`p@U@<冝Pptcidyaratrbmngntstttt0D S/ 3C5C$1 4! 8<0/(0@-,A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@( 213/P/ (A-PT0p(,`Z@V,0T@@DA?@?@@(@-?00@0 (20,200P!P30(> 0R//G-0`p(,BP l E@PPDW ,20CS(20CS G50(tvxvp@-M@`42S%^ $ E 82<"@ 0(2,"Ѝp@儜<"82Ex`p@v,"(20 mX"\Ѝp@ (L&vvvvvv|wws@-P`  0SЍp00S@n0"S1Ds@-$MA@8 ́k00 0]] tv&A-P`0 p @Tʬ; /,s0d  ? zqp  RЍA L` 0S`@D@, ЍL&zz(A-0@`@ @pPph\1ČL0\ D0d^\^( 0zzU({p@-P0@0S( ᔃB01p(O-TM0x 00$04pP ∰ 8 @A e00,< (0,0S9 3,(23`I 0$ 40,~40 D@?"~ 0~ 0p  ~@ D00  #dcP 2: $00<p  (a ` RL` $R0 S 200#1-R0% XLL`P@Lu,0P00S (2 @vP! 2 9vP 1 2vP' (%0L00 SE a}08 g2(0 hE%KU`1IL!\"?C$50}P@1\"R@ x XR@x  X20P@x0 0X20UP@x0 0X20UP@`L` 0U$0000[ 00S  0(0$00 0/ : P @TЍ P @K{(L&Z{`(&{&{-7@-@ 00CS0 <P Pp pt$:0 P00CS08;0 Y@o Ѝ0@Ѝ/&|{O-0` p9Pp/B$0e@O 0 0 S 0(00 ,00(  ,   00+ 0@PT0`  0W0S $8p@00W(0pS,0 @0m 000 W 0S7X\" 0Wvp@@SR 00 RX00 04` p 0S 00 00 0p2P2 S2S/  3@ 0` S 6! R0Y0 @``!R (0 \ !A(0D!H!L@!$(,@l21S  "/0.0010T0 3`2044`5 8<0 T @`@ H2(0L2,00800 S- 1S* ( V000P,  00SV0!14!8!<!14!8!<V(`,)(,00L000D(p0 S( 21S$ / .0,40 81 <V ( S  PV 32 $45(, V\(00,0p@ `00 00 0pS0S00 00 0p ;P  \VU6 0pp ]z0S '0S 0s X2 0 RS 0 ePTo_P$$00D#$0 #(#< 0'4 0'80'< 0 0` p=0 @72S` BT0aPX k0 q 1<A 0G@@p,2 0C00@@T` d(2? 00@@Z0`Fa ?`1<A 0?``+@@D,2 0C00@@`;9(20? 0@@G/`Fa?`?``0S\ L02S@P@V @TTJ041ST(?zH(`A-p@BM42fS,媑P42S,  0PHU42S 0S 哑1P0C0 42RSfvP:僑42S]1!$1(1,ЍA0S` SP`兄d 0 4rW2S `p` 0_P"PR S0SЍA7@D 0ЍASP 0Ѝ(AR (Wӈ{A-@T2 @P_uP ZuP UuP@ `p@T 00S p`V@@uPD00S @@3u@PX[^p(h&A-Pp`"@000 0@@@A-p@`T ssPP8( 0@@@aC-M M04((P@  ThT tP'PLD(t000,4P@(@P 0UL4 4sH` PF @44P4S@@044T0F@@!p0|`P;$P$ $0 1  <30 <(00S#|0 `CP60p0U9 |p@9 PB 4 R 4g\d<(00PS<(0 0@܍ Ѝ0HSʈP0S -Sq@`a=`iP00@@4Pr4 R 4-$+A0!FNP 5t@800  `0 R00S& )@10HQ4A<0C@`PP\; K/TibPP05UP$, 50Ph00h00U U0@IP0U*0RPd0x1STx!0@P %4xQP0%8%\0 P0PEd0U03:T@Rt%P t!dx1PZb" : 00t12P0P0$00`P P014 (40PI 020SP0 S0 $ U 0 0` 0J000 000 00 0(@ D00S8 0(00_800 QP40(R(0 bPI 깭((ҭy((,I&%adxrUǰްG-@p r W pP{\aPP rPp( PK/KhD08QP0Q:" 0PS00  Q pzxPhdP80 "8 R 00 05 !$w((Dhݱa4p@-@5%SQ%5 %SPQ %UUSQQQp  0 0Q0 Q 0((A-`hPp5@ @ 0% Ņs@ŕ\((O-OMPprP b5S5圢@TEOߍt dP@ ET TT 5d 50 ! S$5"R$%P0S4dP  RR @`0d B2" 0t^ JQP d >d0P Eh0K/0h0 Og0@! ,qrd (001 g j  9g  5g,10,1#40L0sK?000/1001001#40>000310 00 000T0 C"^(%,5QP Dd d0Pae((ioX(ŲȲ@-@ P S0 5((0/X(0/X(0/X(-@-    ㄲ-됣&G-P`ph@0S s 0S X|j KU ?T_Y0S 0Sg@ OX(-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-M Mq@` @PxPݍ Ѝ`!r<Pp=0D@@rOP0: S0RP00 0PP P81: S P% S  R  rPPpzPPPU r PP$0@PX(*,;h(Ke@-)0P  44 0; Ѝ   2h(0@-4S 3/ YX(@-!g00 @ 0 $fg@踳X(@-g@Jffg@O-M$M`pP` "NPX1 b: S/d0P  rR f00pPP W UP 0C P"VR V  VaPN P P W\1` 0`PIX1: S<V2"K6rpPUPV9 LPW00``2! 0$ $#PPt P5zf0S.3]`P S R Sp`P-p `P`!\1 S R U;Pk`x!|0#PaY $( PtcpUd( F]PP FXND% ܍$ЍJF F F@ 0`( "4`#/ p@-4"4 04"4 04"4 04"4@0P%G( $0 $(d XXdddhhllppttp p@-4"4 04"4P0@ FFFDDF@@FHHFL`LPPTTX~X\{ \`dp` pd p@dp@-`"Q@Upf@p@-@PFFFFpA-P@M4Q->CF->?n}C@X=X\:\79>tF9>:>CoF:>CFkF 0? AC>bFC>mG]FFZFE~EnFUFGRF 0X J~pXV}m  $$((,S>,-FS>G)FF&FHHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,JzTvT`XrX\n\`k`dhdhehplalp^pt[txXxE0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 PP`,00S 50 0pp(G-P@D[@T@@@@px   0@S*("(@ l`h r紐hX 5p DGT 0 0 0$ 0p (((A-P`% p@5p0S 50S !SRp5p0S 50S!SRP@P@A-P`p@ `$P`P00@AO-MH MQ &80< @02 0B_ `P?Z VP( ,PTr 04P`P (0, 0S/(0, ۍ Ѝ20S*  q Vn8.#4n4#04.40 S㶀4(40^ 0 0" R?"R0`00IDHQ"  P`k F0 0 @4"4003/+ 0 0 0 4"4 0] 00@`0F0 *Fl050S *'0 0~b(D(((((((@-AMMP@p`(% 0 P@4U0:t0 R0*d %@1P 40 C  Pw%AލЍ脴h(7@-0 Ѝ0@-\M`PpX @ ^0H0T0 `'DP!@0QpQ LtP \Ѝ((PO-"M0 M:6 pPP#P3XP3X0P#U` "ݍ ЍW(X @ ^0p0$6,08l06P<Up0p4`UttUx5ȯ 0gD  H?U0 0 P 0 VDU @  0`8p3 5uY` P`d P0 c C0CN1L13 T$00Y 0100 0 8&600 00`400pSǯǔ !{0 10{3 /,)&0" $0P 0$02 B> b"9<Q08u@5ppL0p  0Sls` D^0 0S 8^  000 St:0 02P0 @S$0 `0;9:  \08%@5  L0  0S_h EX,$P20SO Du0 0 0 000(@$? x0t 60 P 0 dCU 01S0 : 00(!( (}zh}{ h(w N  D 0{0P000 R0T 1AN PKHPE8 @2x0 y1( @( 5 P2h5@3hh(((D(x&8((O-M`@ ) P0H: 0 0@40P$? 0 62쒟2Q { B("( pqsἢQ0< ,#42 0JR uXQp 04  0R  @PЍ( 0D1  0 4 Y: 10S<000D0`1 0` (0C 1 010S 10S 0V` `$110010S Zp1p1000 I E8C80]D((x&(&((O-FM MP` X 4\딕p@&: 0 x5 RC@"0Sh L50S00  000S Fލ Ѝ-t00 _1000D0{4 H0T00X0400 4QpQ\t` #  5`Q"0S, D L000 0 HP" $0000S s0  0 3Yl.P3 d.P0! "0K 0 6 @ 8C80  0 0S y  P1 !!2.P РL00 0O0 H f w 0I0 X0 l20G0  000B00S 2jp0!G0 h0G [0 Y0C0#  4 S 0040NpPA!)Ast1p 0p@ 0@0  kh000C0 0 S  ,q  0xs00 p   8C80>0000 0 O!0xs  p0|00S 48((ɴ(x&dK(( 5ah(ƵC-@PM`HXpaY 10S t10S 00 0U P< ЍC(@D`T> 1 RP1H v0A  P PI H0S$00S T  0S ~r0S G O@ ЍCeT-P H0 ЍT@(8(L(ٵ(x&ߵ&( 0`( "4`#/p@-@HP08 200@ 00 .00 @ZpD(00S4  /( 00S/( 00S/q<(P000R0S<2O-@ pRMPhD R0R0aď080S  C/ S ! R 0C00 0@zἰ? 0T\5t!S` 0 000 ?@U (  R8 R  0J0\ P `0/0/0 0 4Ѝ  [ T R  P0"0 0080/p(D(<(8T`xP0O-@P:1 R0* 0w됑吱0 `SxP p* 0 T C:\50 0?00,"1p R 0 0 !Ž p 0>`0 C c00p0S   0 -0xp 0> T0  0>400,00S Ѝh(ֶ(D(T((#0O-p PQM P*T PW0k:8 `\5 0 0> 00O,"2@ R 0 0 !Ž  @x 0w>`0 C c00 d0@C CLA c30B$ 08 Q,040(0PÏP08,10S 1 PpBU809 رPWE 80i,80<01|!0<S0<0<0Ѝ U9  P\E:`EE:f:U : R T` R <(ట/? 0WTFWV  P Q RF 0X:P`0FQ   R(D(T(((((( 1G- 0pP `=   0 0@ 0S 0 0 80PS `P` 8UH0ZP000PS S`4@TQ$,$ (,`(PP8D(((>@-@8P 080(G-ܡP0S100 B?pWR PAP` 0@`8@Pp1 ?O=\10A0I00 00 0 V0 (p"(p p1 p#(,` W Vp`0PQ&d0SnP 1@0  XPP00Ϡ^P0d000 A(D((((((eP0p@-P @?<800P( 02!SRp((p@-X`0SpL0LP0@1CA0STR000pL((( 0 0 /(O-H0MS MP` 003/ ލ Ѝ 40 pP00 +0H000 t /0 @ S 0V 0<0X0|3!0S' l3Q4Qd  0   0励080Z0 02+ 2R2 t R<ʨW;000 Q o ! ZH"$$c+2P$" " Ry{!  {  t R1* Q5 1000S1H Q B/o" RK h!B0 \ +BL~D(P: 10SP, P !n0 10S0Q 10S 03/ 000 0P  0p`V0ZD((((e((0O-SRM0M 00#4@PU( , : SRލЍ|t \`(5R\<R P  RSU 0 0 ,Uq0 B?@`@PE; 00S 03 00 XV8ő @5D0LT 031 a> QPm2 .P U`@@ P80 0<2P0S0` 0ƏP@P2QD 0 0C  0  L10t ?P8#b@TpY:h0S7  !UVUO080}X  0S 0 3/  P,T0H 00R00S 0  G*G X'P6d00SP PTlP0 uxPu(D((((@@-@_80< \PS0 80<  D Tp@-@@PU DPP ;P 0 R0:pph(@0@-P@80\U< S0 80< 00p@- P0@U0p81 R0p8P@00S 0Sp라P0Sp00S t0S 0T0S(p@, h((("&8(/4?@-@M`peWP !0B  P  1p`V( k 00S0H0S 0 0 P0L ,x00Sll, S(00Ѝ@DE&P0S (0`ЍM8(XX((((c(0@-MP `"@ (Q Q0 $0ASЍ000ixh5O-,Mp0@P @P(0S @P,Ѝ` T0): SR 0Ḱ0 9$  !  刡 Q01:` V `3 V `! A P th(0`S @P0!_:0 0S:R 0W30  `J(`!\Ő\  ? 娣 ? |'0匳 S x3R0Z SZ d3 R #R L-<3 R '$3  R0\ 0㵯 80 20 00C 04$0S4L3 2$ 夂 B *92)p20S `90 0 0: S S-  S5000000sS 1 00108'1 1Zp 9 6*K 00 0ˏ /0X0 70T @ 0`; ) $!000<00S 0C600) P( 0ˏ d ⺹ 0T0 C c;  뫴 h(h(D((T(((U (((X((O-lM2@ 0p`7P!\P  ? 堒 ? m&0 Rt"t2 0R S \0 S 3 S D)@X Q(20p`D2QpQ\tQ`Xd   X 1 R, Q&00X0S 0 0 `0\ *L!00ST06 0 S0\ 0㵯 270 20 00 04$04L3 2$ @  *80'h00S P8 Pt& PlЍSq lD((T(((U ܸ(((X(((O-`|2t2PU@Pp00U0 0 Z00 Ѝ0c ?˿R04G 0gC WV@QVg T0U A0 %00100 @ L @T`T0p0T S @`B 0S @ ` T 09  0U2 0 |%P 0 pK0 eK`0@S 0 000T000 Z%[P000miD((O-P,4Mp$DW`W0 Xa P0 c0 C003 X 4(!P  4Ѝh9+a p00p0S 4A 400 0? 083@430000!T  : @ @XT00T S @w0S @ & T 0 m 0t%0`00WCc 1 Pf (pP 20020SV 뉑  400 0? 0б 0 J0 JY@ $0H  10J(Pj 00 400 0? 0 10S4 A0 0000 p0 @0S$0Yd0000o| W z R$p m0 ge00000 <$pWh@(D(9@-P ̹&s@-@P `0S 0S 0 Ѝp>O-MlE M`PR0S 0S @Mp P 0Sލ Ѝ000S  7P I0S 0S s0S nw0SqQ 0Spkf 0S\e<0SH_0S 0S(Vl 08Sd s/2#' 00 " "B 0D@? !? 00? 0I 0Id!! 0{I0 pP\V0SQ "04 0 R0  0"= 0 , R( 圠*,4ï0A8?S% 78P0<P0Q R0" t0S dPUs @0S @ @PUn $0SP@PPDPKH0S  `Cn* l5xl$|0S ll0p00S00$P 0,0UA:000S 0S HD1 H0S 0S$0S 0P  $P   00(0P 0Sm P PP DP8(U_xɺ .Lm̻8M{$@(߼&,tO-PH0pS`M W0R0: P 0"p`7 "0 S 10SQ eЍԱԡ 0@ 0 000CSY?00 1> R. x!PP!0  S  @ eP   . 80< 0 @`80< `P0 P0  #0 S00@ ` R Q\Q\M(Q8(k(|(`((wH(00S4  /(00S0`( "4`#/( 00S/l/(O-M,M \@M"[:$0: S`B[ ` p*P" *P 0 0 00؍,Ѝ`0 (*P L X*P h0S  0  mP J0S, L: z: [   054%00! ?0S S :00/0S 0 S :V00#03*  R00S D:0S7 8  02(:* 0S R #P0P4`Ɵ @U9U)9Q00f0 B?2pQP"x90S  | 0 0l  0$ 0P080S, pL:V  Z9Pp⨸ U0 00(p UxPP0X ZP (0000@PP8HYDP";$0 S7Q9 80S5  V0;R00*h0S- 7('d0 ( #0 [P d70S  0` `O @( 360S 0h0!60(%R/V+: <V3#\Q RnP   hPpQ^q U PE" #p#]:U PpXh RUPp%Q_'qP tPE! p 10S0AU 0  Z; 0S 1000S x50S 0S 0,  t ?E 0S 1000S 40S 0S    10S0ꊡ 0000 04 $0 S 00  000 0R$000$0 #600S440S L4P P u@pt30Q00 0pQSLtQPXd00H00S1 0S \30S? \P  0JP2 #0 \00&&p2 0@S0:000S0840/<0a0#QP8`

hR=\NP 0H0HP0`0Ap`8FP1PU 0\785  @5D0L 0T 32 b< RP1Q 00 V 80&03/ UV 0 H` P00S ,5b0S@ H0S8  0 # P0L #-Pgh(h(( (P(Ӿ(((D((<(پ8((qX(ȿw(((#(pJx(|((()\i5O-pş|M@P,0S%40AHDLdP T0AX  I5 $00 dtP 0@, R<T5@|Ѝ 1o\%呆( R  `  0`oQ0P P0_ S /  !.0P?00 1> (@` 0 _%Ϡ<#\ ğ Q  0  D ?0 I#3 0R< S< 3ȓ0`S0x0@S ?0, dE 0t lg`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S HV0 S\00T0  @T`0VT? @`1 0t20兑A0Y 1XS D 0- ͷ0P0  $  H000Y 0;* 0 0VT0Q@`` @ T\@@R0@3T5Q`1:@Q`$ 0@0չ 00  P k00VT 1PS ۸  P 0R`* A IH(D(T(e`(X((((((x(&8(L(U ((O-`pܐܰ 0M @ 0 0  BRЍ PPU  RQ p @ p R RP Q @p(|(2 0`( "4`#/O-lMX G0X0X10T1 LL1LPp 0,0SlЍ0S 0,`@dC0 `00ట@ 0D RpT0#:J`P 00ASpQ 0 0S\tQ `0S @P |H(D((x(6&(( 0000@/00S4  /(00S0`( "4`#/( 00S/)(T:O-M`@@V MP`0:0S 0P *S *`0080< 0/[ y CP X P ) ( P9`0S 0S `)P P00 <9 #R0p0,0S01000R3(0 0 4"400< 000800$l 0P @ a  \`* @00C0N F0000S{ 5C0PuF0$S 0S '00dP7`} /00S01P,0002H'0 0 4"40'0p 0pp00ppP*0S  .P_ 0 0-`W"PS ` @  - -80< 0 80< @00C0 0 00 0Q.*0SI  IP  0"pWWލ Ѝ0S 80< 080p5 0< S \1^0 00$000 a-^IP 0S 80< 0804 0< S 4^0 00`S $`  B("( p <- ᴠ7-P@080< 0 80< (00C0 80R<.PSR$ .R $PPmP3P`080<4p3 R0* 000ZSP. 0 0p$Z P0SHp0AS0Ss 0p32G0S40000$P 2 @#R0؀R 000 E#R0uQ& d20SX20SL 0 (P    P000 0 0 #R0 R | 0 l~R> +v 410S& 5]#R0 š!ȡ0S  0R z؀0P 00 00lPd0`P00C0Z?#IP8[ ((h(((2(5k yM<(_8(L(#2O-WM M'0ASy0G PPl7 8TG BP 07 00^@  6$-P 60S 60ԆF6 4X \Dp0㨶`0q60Y0:6 R W8`PaVtPVzWލ Ѝ!  R1[ 10SJ0!T  0 S@1`0 ? ;00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0{ {<0 *Pp@D((T(((U (((H(`(00S0`( "4`#/(O-lMX xx@`p200,0SlЍ0S 0,P@d}<0$ P000Pp1 0@1  0D R`T04:1AXpX\tX`Xdh  X  @RF X y%P 10S  0@P7P 00S  0| 0S  Q\ {{00偱 N0X!  X  P  @00D(x(;&((<(cx(O-M式M@PL!n00 ?0t0?0SX0S $5S\0SVPPWX0S $Yk S Y Rd?娀pW\ 0P%T਀X僀 H\?00!` 1B`01$dQd0ڈP0C00h01`l0R!B1d0L.0CW P0=SLq QT00H   0S 0h$5p> *&L>@>0S A0 0ꔭ S0B$5111`R B- 10 0S8 $~0S%  0帐- 00$%BR㩑0`S<B11@%L0 ᣯPP  B PP 0S <P *堐h&<<0S 0 02d0pA?P0;3A?`0 =<0T0.L0>; 0WHQ RX0>F@ @0>8 84<ϠQ bT{ S Q,0 SZ?^@ P< T;0S @ A>+@B@  CMP; @@ >000$:J*%: :0S Z30 0؍ߍ0<00

 X9R0夈z Sz @90S 0(S 3S  0S  ]0 0H80S 8 0S8`0`x800D0Y h88o;\Ş&"\ `  0 0Ϣd h  pBnj `b"36+?H "D H D 08T<\TR\\0H7T `V=S(  H"T VpB$r,00C S=S|~S  +Ϡ\<#Q  0Ćh ?<04S  60S xnP%5u0Pfh $h60S K0 &\Q\u0D06P5D 0ST555o;\Ş&"\ `  0 0Ϣd h  pBnj `b"36D@!9 !>A! "$5S89(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0 =0 $ST0< T=$!0S\0P <V=SL5s35`!~? X00S-["!>R\ /  X B  R\ ?0  020C02`H0T SD0\ 0$3!΍0 h0DH0lE 0#0AS0000 0"0C 00S\0X00!!!`V0: 0phppPp P`lXX㧁 X姁0 8PPK,2!~00<0S. dJ80 ST0Tpp101"P Rh"!>2 ԐXd8p80 0 8#8000$5S `0|63! 03080H ` H D /D VQ 42!.0$00` S`0?00S0\04 0oD(((8(((U 1Iq]((3x(&T((((@(!(8 (E<(b(D(((((L(($5S|2!h `0 ppWS $%S0! !42D0D  ,x  x |0  | ("H Hp L3t !n r! T0eP3 L!T0 R H  20 0000D0 +FP1  "q1*"110S ;0 020S QL $P 0< ST0T STTP hFUPt2 L "0< ST0T STT"l"0 020Sy0 S\0P S\P BF'P 0P S\0 S\0b"TD\#0 08 ppS $S00S`0" S\0?00 S\0?000p` 0Rpd 0W S`0?00 S`0?000p?!D0Y8 0 S\0D000S8!!H &H Xp?!D0Y8 0 S\0D000S8!!H  H X`0A-0P`@0T:Ѝ8+pp%X @{~A-A0 5 P0#R%(r`! 10" q0SR 10ai0 a*!t1h10S 0 00SP03Q0S4 QR@ 5*< 5!000S 0 0@TP)UA$t0UC P`0 0S H P80 0S D(8(&((((0/(0/(0/(-@-    {$됣&G-P`p;@0S j 0S X|a BU 6TVY0S 0S:@ F('--@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-M Mq@` @PxPݍ Ѝ`!r3Pp=0D@@rOP0: S0RP00 0PP yP81: S P% S  R  r PPpqPPPU rPP$0@P(]_n(~@-0P  44 02 Ѝ   )(0@-4S 3/ P(@-:00 @㐾 0 $9 :@(@-:@999@P/00@-@0S Q @ 8( %1Q0@?o2P  R7 P0 P0S 0 0SS 000000/ PP  P R ` -X XQTTT 0  000  /TTT8 (((((T 8t0t 0 0 \5` S\0 X SP0\5L00S/\5, S 0 $ S/0\5/((T8 T 8(0p@-000 0 00@P22=000=000X0X0<0<0@0@0\0\0p `H3H3L3L3P3P3T3T3u/T Ph p@0p@-000 0 00@P22=000=000X0X0<0<000@0@0\0\0p &H3H3L3L3P3P3T3T3u/ EEP  4444K4K4h  5 5d0d00000-P5BP5H5H5=Ch S>S>p@\0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(4O-MX hDhhdhP@quP@D@:0 0 P\cpKЍ ?10p  P\HP0S 30S30S tl3l#0Sd `#SX P L0S @90RS  c*0S @"\5S2 0\"0C ?o20Qh [ŚX2 0s#p0d p4 02 ? M1:010S=,A!Ϡ\<#P  0A ? 0Sd0S 40qh 0S (t!\5S\P h10S(\TA. H!0 00 0p 0<&0|&0P47p0p 60pwt>0 P0p$2S# *1P *1P *.mVXZ hY 4[ 0SV?관X V. 0,5  00 <\;P$V$ Q4C ?/|PeP 2S|3%8 S20#"20$#20PB 2SAt00000' @00aE`02P$V20A\2@02 j02C`0 `Fb^0 0 |9/H ? 0`P,Tt#0\`P`Q=S/0 5P` ( 2RV0 SSc 5*< 5h3 \30S 0 0`20S 0Ƚd3 0 S` V 10S0DS@ 0(y2= C0 ,0"t000 00C`r'? `0(" r0S10Sʸ10S0=S0S PB܁q000F ` 0L%000X30P%,3da * - D10S {T0 0(((((&6(((OtH(( 6]TT<(CdP(8(5^( (tA((((((((6@(D([p((((h(((((((((=S$0S, `0 <<00X3P%0*0 00S 0 00S? 0 >0S a{&PDa 5*N> 0:#: 5]h1 t10S 0 000S$b V1Pa00*<1^ 10S 0 00<cQ6dPXb 0<0*l2> x20S e0 0r0S0L%r0L%r0H00q" T 000cH00STPP$c*43 @30S Z3T#0 0 00L40q#  c400cL00S 'Pc*330S 1 #0 0 0x4 R.0E q\ `PVR d0SPt4d*440S $0 0 0$d0Q,%R0%45 S R! t0040SPTu*^d5p50S %0 0 00u(0S xQ$ ]0S0< x (%0Sv8Pv*16S$60S z8&0 0 08%<5HSR$ / H00850<SNiPv*6%60S sL&0 0 0v@%D5LSR$  L00@50DS%:P|w*770S D'0 0 07 70Sx,w0S0Sp0L5sl0Sd dh(000(80L50P5?T5V> X5-0$0B0^1 `@R$@@B!!@H0 000L 00*|880S  )0 0 0h P^x P8YQڨ0QTڠ r0 0S Pi*I9k90S )0 0 00S/ 2( H0S0QQ&d @0 0S }Ppj*:9:0S `*0 0 0 H0S H0S EFH0S-(Q\KQK RP+00S  E~0 ppVaF !` . R ` H0S72 H0Sb]<Q| H0S H0S {H0SH  8%L < @%DX<0,5S0SO | ,x000p<0,5<0(5H000/85L0<%0/@5D%4*<<0S ,0 0 0(=0S 4=0S(@M*cP=\=0S 0lmh R= PA P<= 0S= @PL Y  /p@TW.  @?00@1>0A@O@@ɣX.Pd7  /,@؟>P* ^ P.0;00 0 S 1> >5 > 巟>p屟?WPppY$?  "008 @DT@H4L0d Lc B b"30`@P Y) ?0S  8 H4L0d @ B b"30D60S  6p00^Pt6|@ 0X6PP 0Z0<& 5000,60S 1S +P6  6@ GQ ?U @ 0`P@@  04 8 <%c#!$c4"x%S X50S `C\P 0 0 o ``0  0 04 8 L H$C0 5L5s0P500ߍTq<(((0 \P/Q/ 0   Lq,PŒPŃ ,TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> kS*}3`30S 0P 0ThSXSfTs`P`UU00Q AP 0S ?@?#@>`P"hR0"00S8 lr003Pb0S* x?0S* 00RE>0X4* 2p610S ]0 00S@YP10S @1 PQ`1*X1` H10S W00 0H10S <@,1 P0*0`00S 50t 000S 0dP` 0Q 0DGA(((((((8(D(((((((h( (("T=(z((<(D(O-PPMLp8 R<@B0S 0(3 ?P00@TaVa` 0 SQɑY\ , \P  ?``  ? v0 (,",2 0Ri Si r0S 3S  '0? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*0`00S B` ` `Ѝ 0_S  $  B$ $ R$  B  D(p((T((((U `(((t0A-P`p`ATR ;@P<M0S @ !'1p0A(<0 0 1S01/ 0S00/(`0 5 /H0P 3S P 3S P///D(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 P(D((Q 0`( "4`#/O-8 0`1 0P0@8Q ЍS@hp8Q Q 00p 0爀ቐpp0` RP/! 0 P  C1  1 @- 0` xRo/ 10#/C!000P/ @-AD0` |R  /  /C! C!/! !/ @-,AT0` |R  /  /C! C!/! !/ @-9A\aO-$5SX @ lPphU0 01X` 0000$p    @R ![ 10<T+EP 1 @C 0ό2 @D R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RMXr@ bPPl  P\` `jP P9 4 ᩬp ~&0S  όߍ<0H(00,0 00004008004004 04$0D0(0P rW[  pUt yp*h \幄 8 `$ <j 00k $,k (k $k 0,0k0 k `$ !p 0`?`a8SPb   00*P*00*  0* d@edAzd@ %1CWjA-@Mp`;@ @p@ݍ P0@0@ሪT00 ## O-M$M`pP`˫"NPX1 b: S/#0P  rR %00pPP W 埫UP 0C P"V⒭R V  V PN 八P P W\1` 0v`PIX1: S<V2"f rpPUါPV9 PW00``2! 0$I $PPt gP5<%0S3]`P S R Sʩp`P-©p `P`!\1 S R UNPk`x!|0#PaY $Pt%pUd( FPP XND% ܍$ЍᠩJF F F@00S0`( "4`#/(G-pX10P0@ʟ 0 R  X 3#15`05aà121 R0` @ 0Ppp!0R00S! };% 0%# 0!ZXl000Z T00!ǁ8P,0D(X((8(0( 9( 00S/(O-,Mp0댡`P@0V000,Ѝ00 ?U0$p$0 0000 P$0S l?00P0  0 T0SpP8P㈦pD(^F8(R/G-P `$ 0p@V` 0@`` V`@&!D`( G-P`0 4J Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-@p0P2#U 1A Qu ` R J` U9# c! SV Q V3  P! I` P09# c SV!Q V3  P 0  P$ ` U 0 ЍJ 0A-1àQ`P x0xo Q(0Sp@@ P` pFQL @$ @PQ0࠱@} p@-@P40S:a80Sh0h 1C0C800S   0900PP80Sp0 C[Ch, 2 ,0S/`0@-@0  L5,0,0080S 0 0 [C0@ \( ,0@-S ,0, C@TP @ O-p-\MPU`@8 U810!@3 @#S41@D2s2@Ds1@DS@D50  00 0P U0#03?`[[U\p@D `0P$0H5Q @O0$0 ᬎD 0 XR @m"<p!8pL0(0$0 0H(0 0 `,0`4  0 4 KB@$HP$0 P\40  (00\ 0P躦,05S00SUSP3S` $ 0 B@`UQ `F000<040@00 38p4` <`00HpL`<0@ RS80 0 ,H0 PpT`k@P ,P`3Ql 0Q 0CQ <tO@ $@$\Ѝ0,03p(0?D00T P  HpL`%VW 40, `S24040S@p( D0Z 0 P  X Z (2( mBV(H ]`ニ400 0Q 800800p?(00T 0`RZ@p(0  0 P 80S$1$f/1C:0C800S   0咍` 0SP THpPL`P@ T@Pl P0)T`V@ !_qP` !T@V00P0T0$0B\(LBAW:\w NBAW3 h G-0,0S 0 BP@`40S*:Ѝ00qW! 0 ^@P   i@PpRF A-0`c,0@St0+ CPpQ H0H CB@ 0$P@DT@Sa C-0`c,0(PS0W Cp@Q |0| 'B@@PEU  0P !  0 P P ЍSq s X0sC-@0Ђ D`P 004 0P 0IЍp\((X0sC-@0Ђ D`P 004 0ڤP 0Ѝp\((0p@-PQ `@0P Rp   T0`! 緤@P 8o4PS3(`(\({Rr@-,@P,0S "A00`(@-,P ,\  E Ѝ`(p@-@Pnp0p 0 SX0d0RX c#!$c4"pD006.8 Q#3SRpp((D(27@-0S S2+, R0 ELh `Q tpSPCaQ* Q( H<FP 4,B 5*< 50d30a3210S G 0 00@ 7.Bp#x3@ Ŝ & 0P xXPA 5*< 50d301$10S 0 0@ d3S+ CQ+aQ# 0AS"P @0a3d3*u|0p00S 0 0@S Ѝ08<(\(D(r(((`(4 @-o,#O-M`p0@  @bcc 0$0$c# ᠓pPc0S@P7# 00" $qp3$AtUhUaU bU X^P4i0E S00p$ @ 80 (P 0 @ 0S ,00#!( ` P P0V ЍVp FpxP`8  pi P`P0V:P0V ZP p0[0T$$0 ! Pp  @w0 00$ 0S Z(0,  $ 8 Ep  @pZ0 00$ 0S Z(0,  $ 8 (|p @0Po |  P0 Pq 0 ! P4,#P\&lOR*G- 0pP@P` V  _ 00000G S`00000O-mM0@` P0@004080 0bW, AW- LW% H84cW iW0 p `$QppH40S 0+mߍ8 4i0H4: S@ @0(00,0000408`0P gP 0 0! Tp ⶟p 0Q=  0! $刡匱@P4 0V$0 0/S S<<Y7`y`"0 <#0P0<0$`P P< ly w <XV<H`p n/B  < n?n/ ŝ0Pp < !$ 2$0 @#0P!S 0pSp`Vxp 0S `0S  R  R 0S( m0H $8HP`$pF0pM $ 0pF >p>  T 0S  (, PQ S RPQv&zd@#FgwO-P-,M@p`$P("p($0S0$020S'$3pO P V 00E 0P0Ne 0O fP AP PP `pP$p,Ѝ`P 0`P , ?o  0x0 00 ` p 0Pqp Lp UQp`&tUG-@pP\!აp`:D10S:  p o09 6X $$ Ap+ P%W00S $$ 1p YPPU `fV rV GT!P$$ k p$&0Li @-%o,#A-@P`pP 4o\ X嗠T DD ᑠ8 7U  A冠A a&0 P/00#01 0"$#O-@PU \  p U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G-8a8q@ @ 0P^ \ ^0᳀ 0S@ 0S@ 0S@@00\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-`$0Pᅄ@P 0z'0 0| Q P dž@ Ѝ CP-0@-  Ѝ Ѝ/4A-0 P $@ᒁ`p'0 0K QP Ѝ  P404A- R0Ѝ耟P@ `P0`p 0S 0SS0S$$7# BS 0S $  ` P eP`$0  ` --@-00@'e 0 Ѝ@ Ѝ/-@-P 4(v W .Ѝ Ѝ/O-MPp`7@PЍ |P yP 4S \ 0T0P$Q$ P 0S 4S $OX 4P S $ υSGڔ!0  p`000  0 0  0 @3P 000 00 0 0 "P 2 T`嘖&P%(0,p 0p$S4pS ڠ 0 p" x0 J0 `0p"P` 00P0S@dO-$MХ@pxPP? 2R 4S  0B$Ѝ0m Q Q0   RSRQ"  "S 0 0c000 00  0 PP4S 0S,  0B0 000 0 Ps0P0 <00SS PẐX  , 00`S4S 0$R V P0 RS  0 0001P\ H0H 0000 0   H;pFUG5cO-P$M`pHLpQ@PPz@P0$4%Cdt(, 0840; pd`M0 S; `p 4044s p +App ?Jp@ H4* R9 : S$$4SB. :p $4Sc(d,T0 B. 'p (d,T0 $$0 r  P0p% 0l?$tW(d,T0|4$t0dT 0S  (d,T  0p"4S    0 0p4 $  | JEp J`mk 0P PFp  0Pp P LP' 0" RpP5:$Ѝ0 S0gp 0$000. f0S*+ohi/ "d@ #d@:Pf: @-@P 4B BRP ]p <4(  Ѝ@ޗЍd@On@-@Pp P Pi4PS 4 A-p P@P0T `{00 Xu4 Fp( @p 6$$ @-#N$ QS40ŲEA8Ѵ#8"( 0 / 0T 00 /$4 0T0 / $4 0T0 /G-`Pp @P1nP>   PP A0` `A0000⃛U:Ѝ 1000H0H `sP10(0 jPUyx&C$$0A@- P@-@ t`RdЍpP eP 4 R 0  -O-p!PR0_otM`@R(0S00S "R0l U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 60[ 2P#  7/p ) 7/p 40 T m0 $8P  P P  2P A-@pP`P 5/p 4 5/p 4 lC-(00pS4P Ѝ$d@ 0    l 0` 0 0 ( 0`WP TO- 0 0pP딐@T`  i P `VP <  0 @ - p@-P `@0 v@Tp<O-`P,M p@FE0     R  0  0 pl PU0 (P p0 SE ,Ѝx O-PQ04p@ 00` ЍP P0S*  E 0`P      04 p p#p p04pp  cTc0s@-S`@ PX0 KRP: pЍp%   iQ000 BR00P0S  -s@-`V@P@ `d`X0 ?o2R0S /0S+00 Ѝp -@- iR sR aR p` p@-P@^P (`Pp Op -p@-@T 40`PϵPpp -iR@-- 0 aR bR LR( sR% tR@#P 0gP0S`00ap`(a0 /9 -'p@-M `@P`ᝯ P00͵000S  㣗ЍpxRZQG-@M` QP  ЍAP $G~pPt 2B0 00  0 p`P _h`O-$MH@`P ,`$ЍPP 0 0 0 $ Y># P0*L Q P0 0?Y S0STP pY0 P pE00 PU 0ppp $ }P 0000 0 pqP ~4  $\ `  0V,S( 0$84 0p| $Ĕ%{!#,[PP  {T P R*L0Sh 0p_ L004 0 000 0 PM 4$$   $ 0$$@p7 0Jo00S 0@-C^M E@$嶖$$E0 0#%P%Ѝ0 @x("(!ᛖ"`#XT 80 ` @卖P8劖ꐜ& 6Th{~0$ 8O-LMP`p4   1D0J00 ᄆp  0S& ! R"!LЍLRR a0BSS0D1 0S 4  P $ @P  8 }@ {䰟P  } T 0 ?0@   T  0@ @ P@ p&i -(&A-p`(P@c|P 0p`P @00! 0$0@-@P$0S }@}O-@`;0S؀@ `@` 0@ `'  0P T0YX@`" R    0R 0 0  0 00 0S 00 000Sp0Ѝ   @ ` 0@T` T'U@ ` Q  R0P MUpP0 0S 00 0 0 RU Q T0Px n P0 @  T 000Sp@ `|+VP/0S//P/0P/C-@ P Pp ` R Q @Y R0Up@-(M@`PiP<(Ѝp, `PP0  4|@- TTP@L0 @P6S8ړ003(@0Tѐ@D& R R R D@-R R///// Rp@-0@P S  \ ppB \"St t@ㅒh0d pppppp, !$0ppd(|O- 0`@P+P Ѝ0!S R `z0P(Pp0\4SP 00$$,0PJK8 S =z R RP304S ڠ0"S1$0 @0  40 3/p 8 H06 0($ P P 0$ 0 0S (0, PpWEVd(O-0,MP`p$0 #Vp@20S$`pP 0 0!  pT AT fT @,ЍsT00$[p0 0 00 0@Oqp 4 `00p x0804S 0 Q1!1 X R- R02U1 0S.d RL!L@[@1R R8 H0  pp0pW$00(p,0` 0S0 00` 0`Z]p ep{ 0oo`@  0Z p@iDe,&2LX8 (v\w)A-@ĔQM PP ကAn`` p pHPP ?ЍEp,   0 "*EaG-@PNp% U4 d$! A~ p $$ 0 P ! `" $`9p L 8 B~` H00 y"Q tO-M@/PpKPDEA =9$R 4SЍ4 R $ RQ 5 S P $ 4RS  0I  U08pP  0S5 P; 0  0T`P , ?o  0J0 00 `gp \ 0&p0PUp@-@M@P`4 t0<000 Xp L00S @ 0p'@Ѝp&  @-,#O-0TMp #$$0@`40#&pP>20SK@0SD00e@ DP 0SD0SA \^<40$ 400#qpp, 804<0QP$ 0I,0, P bU@ qU H04 8P0pPTЍ$$0 $(`Vt0Y`0X0 0000 WX0 0 0S$ (0 [ Pk$00(0 00qpp 0 QP Р 0 Z!p , C$p p ,  |&,#hO-C` ILM$@P0$0d%NpP50S D)LЍqP sP @0p0$  0!qpp PP`0$0$$I0P00P 0 00 00h 0K0P(0  0 0(0 040;P 4P 4  0,0$000' # 4PS,00 VU$0SxP0T ᒃ!088 X : U S   0 <0<0P (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S$ 4pW4 4` P 4\ "$`0 0S 004 b8 $ 0$ R40H Lp 401ST> 0S 0` 0T 00S!Q `S$NP$ a@ P PT{pT T 0$ЍP`d&pO-P$4TM⓲xp哅(@0  @"`B |@݌0P|`TЍ X  0.`ꀠ @ 000 0R010| 0¤P @P0| 0C`l1  00B00 @@0P$ 00S+0"+ /0 YQ Y 0 $ 0ℌ0P|  V# `F0,0( t,0 Z ( 000S$EK%U /0@P0@YT Y C-\MP0  Rx`|p )X% 0CP00͵@ @    0 08@P 04 ᆌ0S ဌ <\Ѝ$@-0@ n 00 0 0:Ѝ*P `00CS`0p S00 P0S X0X /Xx&3S @-xMm0 $8|@Hu @T >uxЍ/-t2C-Mq`PP0HЍC"0 0(p XV pN I !80pp0 0  P  @08 0@XWF QX9T܋ 3S   PPs8m0 $ Pċ 0p UU Ѝ0 0 ppP嬋1S1StЍC蝋2XQ' @ i┋CJTX^*m|9p@-MM@`Px u r4S xl0S hg  . 00CS 0,!80% R܍Ѝp A!0F0 0 D 9P 1 0P t$# BP@P 8r*>M]O-YM MpPm @`  H   hY?H 0C[?H@0剐 000 `00T ݊  ي p n Q Ί   _ g J0.J0 BFFP ^<#0b⫊0Sq3#Fs#F?f❊"袟jF?▊n ⑊$0 0!  <#*Pq |$ĕ 0S,T UV:#@m[ 0000p P _ m0( $8u/J(0 BQ0z/CL#$ f@^  @TYލ ЍP!F?f0@!0F'  [ 000080 P _0 0 P3 RC2A0 A0A003#0# 0S 0CS 0L 800, j j0p(*C-MMPpA@Tt ݍЍ0S@ `  ;$帉 Pp  0$$ Pp 0$$J/H0 Bq/H0 B keP H?@,⍉#.D0 B W D@⃉m0 $8D{y#PD  $<P\O-`((lM0 p@`"`%  {ypPZhPI46( sX%X POJxU`U HU& WU( AU |;lЍaPEUP@@|p o@@@@ @`@LdP V`ҧ#000 0  t0SP Vx0 V0 VP0=0 @ @<30 SEP4O  0S$008 $P 0S0S \^0PU  { 40>S1># r  SP P @(`VL?XP?#?U`1?`#!XY3V`3!V⃈YPWU 0(0  P |n00  P Pc Q: ,Z   P  P X1  P UP1`P00 -   PUMH(&ht@|( &lx}p@-PM@P`4 X  1L0$00 xp T  P 00S  0WiR TR LR a0BST plRs0BHPЍpTRp,#(&85 Q@-0$M\q` 0 0@P!!$K$Z$_$h$s$$$$$$$$$$$% %Y%c%(%$?%E%I%T%8&O-@-ZM`p*sp :0S ЍO}0FS iS:PC>`C$P X PXЍPP X00 PZ0PS 0 tNYP$$0NP+ b Pp5 o  >P 5  >P 5 >P 5  #>P p5  C>P P5  2>P 05q ;>P 5  F}>P q/  {>P r t>P 01S [r/s?p'(Ѳ Ѱ  _>P s/l X>Pu$$}$4P~,:`P (480C$0 |b`P  |b$$0` qp\& p0t< ?P\3C<pP 43< 5C$< ?P <P2 >P 2 >P   >P 2< Sx?P <$ 8 =P# 8 Z* 0NY$ Bp $ c}P$4`  0qp($ M}Y$  800(0 000K(040P08\ p$,` 0$00P00T0  3X/0`$$eqp@y$$}$4P0H00L0p`$4'#`Gqp[$$|$4P`%%&% -%%%&|&&&&&&,#&&&'.' '@'D'I'U'S'''''&+('(G(e(n((0@-M@ P   9/p@ ⯮4 S~p$㧮0Ѝ0('i(@-SM@P, 0H0P0X0`0h0p0x0000 *T  \ $ 6d l 4 pB0`@pt  0 DL`|`p D Sߍi@(i!i@-@    0`( "4`#Ѝ10S/!p@-MPM@P% PA. (01P A!Ax P 0`0?oS c` 06P ``,0 0A. 00P0P A Av0 0A. 00Pl0P AX XpA\000H 0℠4ލЍpw(()) )$)+)8)F)s)s@-1PP  ⼭iP 㵭 @`TЍpUP  00SUV  7@}))0 R !O-M@ Ptpp" `P"w  \UP? XUUPLPUpP XppIUP X T7;P 0"h 0R00 p!P ! R% R/ RZ  '0P)W, #  ;P_ 0S\hQY @ |pNl laXZ T X (t0W 0k0S, @ h|P@ `|pd HQ L 40R !hc01Sp0S 3/p\ |] 8 Xz|p \ [ 6@ `m|p Ѝ))))))@*)*$*V*A-p!T@P@hTPP'TK_`P UT P TP*^@<_T @- |<P Ѝ]*A-MP p:@P00p`ЍpP  š4  |p !0 8<`*i@-@p @A-P`:TpP00WP@?0W  FiA-P`TpP00eWP@:?0hW  FK@- $L:P00 Ѝh*p@-8M@ P;:P1 ESP   V4 PT`O]V8Ѝpp*y**i@-BMM@  p 0S 7  /  (0F(@0S700$0/ (d 08(@0S BލЍ<b}@ Z}@i* ++p@-Mt`ZSPP VP@ T0V" CV  , pPЍp*/+ia+@-M@  y pЍi@-M @q9P0C {x p  1Q0r R08C80 1p`Ѝh,o,iis@-`P p@@@<9P0\ F-@PdU PL ! D.SP, CߪsdЍp,o,,,-7@- P@GpX ɪLR P<0<( CC,0 S@ Ѝ0*-H-R--7@- P@#pl #B⥪0T㘪LR P808 30C) BB@R@ Ѝ0\-k--@-M`prRPP00ЍUP@U a@PmT0 7p7\0 P@ PPNc--i@-$Mp?RP00$ЍU`a@Px0 l0  pP0-DP P`@ p06&c-i@-(B { Ѝ(.-.@-000 0  Pyp `Da@P| ` @ypl 0 PR00bS {zcnyU ~{{Pxi 9.R.x..s@-@`?PP  Bp$ ĩx0Iy.p@-` MP@QP T ЍpX    T  PQ@([D.vi 0@-,M@ P7P0 -  p,Ѝ0 0R0s0S 0 $0NTPP ( Q@ZD.o,f.p@-P?lp@@@;QPL0L. CTQv P8bp.R-,7@- T@Pi7P00 Ѝ0  p ;DX.@-m .@-M\ @I7PH0H+. R04 0o pXЍ/o,i./@-M\ @)7PH0H-. 204 0O pXЍPB 0@p &@-p0(( 0`P/ R/ &O-0 4M@@ !T 20( Dvďp㕧 P(0$`!pSp D@T PoS@ڐAP`@ ) ptpP`[T000 [  v R  P Q R. 0S $P\(P  1/ P `u@0S vp "SR(0 SP$\ 2/P W0((1ɚ;6e11O-M Mp@p U pP< ( I`P  0Y000 r⛙r/x > v[>J0pV / xvp Q hx hx@ p 0 Q (x%_X[ `00@0 0LvPx: 0I 0 48<5vp 8]0Pt0r 0` <04&vpLh <D[x `8H0S 'P01tLxH0S>I0S;X`PU 0 3/P:㸢 "rr000S:0 r0r0S Xx f x ^03/q {I0.uNpI0SQP" E%J` 1 `E PIE @P0 l1 LAp 1 LJA@!1 ,w ``#%J_!1 IA @@ |1 A!1 MA@ dwPPU_ 03/P0 3/ݍ Ѝ12i~i22 &i3i333((1322{3i1444544@4O-@PpP  p ㉥T L@LPT! uL&`P \rPPU @1O0S wVV tW P.Z  P'  N5P! K0S 0 L0S 0M0S 0 N0SO0`S PPV v.J41((s48&@-,MP@pP L`P( > up0S hP 2P00@ 0( ,ЍxAA(8i(AAA@-P@ᮏ0P ͤAG-@LPP0 `@ Y㌀ PpOPP  ppH  H@@@;^@AA2(XBs@-@~L@P00ЍpOPOē@P <`  P^u ]B(hBs@-@TZL@P0{ OPOᛓ@P L` P]u kЍpoBA(hBA-@'-LPP0 |`@OppOkPP ᮏp< BFJN@BA(B@-@d J2PP0P CTD 0 S8800 >00ЍBB(ꐣ&B0@-M@KPKP KPtKP d0P P P P< P6p$㿣Ѝ0BoB]BA(7iB7@-@塎du ÎP HuDPю P! (u Ѝ0zu @E CCCCCA-M`@PK upp"P  (    ґ sp' (( pt"d<@T d8P@u\2PL9u RU TЍ0 P6[@P< $@rp Qu t 0R u k)t tPp `H`t` Q$R@t tmLP:ЍA\P\ 0P R   1 t 0 RS᷍tt $ yt0` R P U 0pD`L PxAD8i(i-D,C7D>DRDAXDlDtDtCCxC|DDDPp@-P`@IP V  J`P 8T`5T 00pITp'TA-@T 00`PpO 0p @-MPP00Ѝ`0 000p@ 0 P GM0P 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 "00"SЍ&<0P 0,  \p 0 @0@-@P S @8O-`,@pP(0V0S 84YP$P$P 40S 04S 0S(0p(`8P0$0S(P^[O-Mq00W $0<00Ѝ`QB QE 00 / PP0PXU =0P ,,2,p4@[T /@P00 D0800X5T (DR( R R["00ZP 000 cPs0"CQn BQj Qf4!<5^ Xpp[XPPX Ჰ  $P jKpZWF  0 Ep? 0STt -PPX!0 8!100#R0S b0m8\@pG 0 YP@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S @00@D@ T030ZK@)ZTl +  HPRU< E゠0 0 0`0FFFFFA-X Pp@`P00!70P 0 p 0 `P0O-$M`@ HpP{X) P W0  P}p` 0p0   0K@)0#30 Sd0 00#00M/H0ppP41S (0Y CM/ZmIi(Ip@-`M@jp l0+SЍpP    5 R #WD xkp M01S I0/S KeI ilI 00S/@-@mw(|IA-P@`TpWP @ 0SP O ꐣ&IA-P@p `PW`}X $PH0 000 0 p`II&:i@- M @ph ]\ )P00 Ѝ0, 1pEII9iI@-(M @p  5 !+P00(Ѝ 00S H [)P02 , pJJI9iI@- pp 0QSЍS   l!J(J/ 04 8 <` S $S HH @S/8 S $, @$/ //PxKPPPjKXKoK 04 8 C0C'S Q:ǟ "!! CR  ##9C0C"!% X'S8ǟ"!2.B$ǟ>C"" ǟ"!/B Q 0*Sz S &S  2S% S`r 0S R )Sx&0C'S000S 0 |Dd|0 g0, 0 B@, R ,vSGg` X>bg 0R 0g`0S g0S e0  g00C!&⩐p`YP0  @rgp lg0S VE 04 8 <$S9tG@Tg0S 0 Lgu Eg 0 G0cGApG00Y#q0p`FT`[! i a`V1ׇ!} gxV-0S]  }X 4=4I 0 g    #P# $P# #ß P f|3Kl#S0S XcF @f0S$  fS sf0S f뭏 `p0VVČ  " 0`f V/A@f0S 0|Hf Hf 0pHt~0H≏HAH00Z0 `F[ p0g&V 1 !^ 44J 0zf    !PT! $PH! D!l P 8bf41KD  @S0 ,Sx0 i-PHP(P $p(KKPhONPLPPQPQO&QQ|OOXKP!QzOP(QNOpQQOPOOOOOOOOOOOP PP$P0@-MX Pp@@CЍ01$@iQQ0 /T&/-@- M,00@(000 P  Ѝ@Ѝ/0@?o21  @@@@0<-@-  OO ЍЍ/@-@OOscHV 0S/@-L(-@-  OO9 ЍЍ/-@-  yOuO ЍЍ/@-\00S 0  0000 0NpЍL(YV@-@aHaap0#c'~pVVVp@-pMPڬ2P0 PS 0P@ 0 0 00 0X]Np HlP@@ ((@,P0P4P8PS00!0310@- Mx 0 M@P \{ ILPP @ , 0@@MP 020Ѝ0X&XT(X@-8P @,d$PA daX&P@-d0 !X !T@0 60\ (0000/[)[>[Ph0@-d`  !TD0 60\ ,00 00/[)[>[P-P040#^4<\$0000/[)[>[PD0 40#\00Q 00/00[)[>[P-H 0:# ^4 0Q$0000/[)[>[P-H 09# ^4 0Q$0000/[)[>[P 4 <# \,4Q00/00[)[>[P@- 0:# ^ 0Q0P@d0 :0# TDH#^<0\ ,00$00[)[Y[m[>[$0@- 00aP Ѝ2`&A-PɈ@p`WЍ P 3M@P p7@-0P@U , 8J Ѝ0[A-@0nS0oS@p pP`\EKPJ0nS0oSKPPKPP'\@->0 dcd`\&O-M M~ PS J I"t1 # t\\\\\\\\\\\\\`(r]\\\\]]]]%]*]&J]P]_]8&]z]O-}MMȐ⨀p@ 0, `R`Oh-EV 2U[ZrC0F!!0`P0S Z`q?P1`Q0SR aZ'|t`0SK \n`&\ %i`&L %d`0S;0!0 P0   P00@P  0S  P@F`ލЍO 0 0S 00S 00h0Zo  .`0 0` PZX T,ލЍO`]]T_]]M_]b_p_`(v___\__]]p@-PQ@@pQ(0opP0p@(PA- 0nS0oS0  o}@P0Dt=P,WpW=EPP`8=Gp@,@P@@(?cFc@-@ h`h]`c&O-@M pP"P0PD0@"` P0,"Op/2 00CS20%|000& 0|0`P0 +0000 0p00*0 &0Z ]pHh ㎍rPdPMP UP4 GP 01e@ P 00 0 00 0< 0~x`|P 00 0 yPVy 00 0< 0ft[,0t0Z00x0V 0;;0|0Ѝ- -&WefePccLe-BMMI^@0 P@M00d  0[pL0 0 0/  0f\neue~e7@-P @=0Lo SϜ 0  Ѝ0kf@-@<0P @}f@-@=0P @f@- @=0S 00S0?  Ѝfp@-@PᙡP0 㻌0/Sp  p@ fff@-  2_2\f&O-`@ Pp(,夐렰0 0000 Np0@DTq oPX0 xP@yx8 O3ꐜ& --hgh@-M@A> 0@0D00 l03[p0S SD  H ,0@ 0[hhihhp@-@PP0 10/Spz p@viii@- ^[i&O-`@ Pp(,夐E렰0 0000 Np0@DTq oPX0 YxP@Jx8 O3ꐜ& -- l jl@-M@A> 0@0D00 l0ZpK0S SD DG ,0㶋 0B[dllhl5llp@-@PᅠP0 㧋0/Sp p@@mUmnm@-N [됣&mG-` $p嬐0@P0 Mp00@DT oPl0 wPTqw  ZA+G -n&mn@-M0A~L` @ 0P 0@%Zp EZnp@-@PP0 80/Sp p@}Vokoo@- ]Zo&O-PM@ P0Ldr`T"Mp)@20 R. +x   &  x `!p0 *00)0 &0_ jZpM uPfPMP- 9P GP p1g@PUP|0 0|00|0|00|00|00pt`x 0wP㝊vPZ,0p0Y00t0V 0;;0x0Uf:gW$00|00|000Ѝ -[q&mqopPq-MMJNP0 @PG00 0C᛭->?n}C@X=X\:\79>ር9>:>Cჭ:>CF 0? AC>vC>mGqFnE~EnFiGf 0X J~pXV}m  $$((,S>,AS>G=F:HHLLPPTTXX\\O-@P`Pp !4"4!14"41  $$((,,00WС\5 S L5sT`0$ $ 0Q`V,zTvT`XrX\n\`k`dhdhehplalp^pt[txXx᪬0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/+0P0 C@ /p@-@R0 M4 @8 P#` 1R  0  ?<#΋ 0 `x 0㟬`0 C c00 d0`c Ca c0b0 0  0x  ၬ\41P0p$Ss $$TGQT`P@UZl 00 ЍO St hhȀ XȐPܨU5P,((U TTt0p@-`0S[\ @RL00S000000B0E0p(@&|0P000/000/B10B1/101/ nP&O-pPUM  dϠ 0@Ì `0 150S  C0 R0S@`Ѝ 0 R` ` 42 b< RV1QV RQQ R  $%R /  l!. 000 0P0C030S30 0C0 0003#0 3#00030SQd  0@ `?4\0 ST0T00  B 0Pu SX0000W0,d00? 0 0@ `4?8 03댠 ,1#  0"! ?0 00C000 rS! 4A8 0 B0 080$ 0C  $$ 0$080Ϧ0C40040 08 ROʌ10S  a dϠ 0@Ì `0 1%ÀQ,  "C^C C!( "^ !>O 080@o0T0@` !  R` _P/  1> ( ((U  @&-&JO-MMO⾟D`, %5_Q0uPSi`50LKx%?D0Shh,/nD ?0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#80Kp0 0` 40S7{ 3 0 000p0  8`  gZ X &0Z``a 0,oF Ϡ\ß ^/F022292?"""0Pa 2@őD L 00 /4;2JKJ 0"d00 0 o 0p,2 0r 0` 0W8 Jp`xSi`10"KJ0/`&22220OD05? 0 04s0hl 0@DE0 L04;d00 0@ `4 <02$2,242( 0 092?  0@ 0@Dő L0 0/4;$0 JVJ 0lh d 0@Ì `01m@&((A&&o((TO--)MM00=0?0,8(0TJD0D`0S> 80pW:,0 0 0 ^J(((((\4 P@P`PO P@ 4 Ep6J3 E8p@ `3T@  6SP@ * 6P (`0S0,5 Sx0<0(5002 0,%S0022Q04PLT 0QHLLtrt" 0 04 0A T:L> 040A 41L5 0 4Q(L, 00 Q*L# 00Q(L 004 Q L1 @00T00D-\3SB1\Cp呈WXpX1X0SHK X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R001K @4pQ0 R\0 a $((D&H&w((я&T(((\T((@&>T(L&((( Q2! dS,QS18$Q<4R:|{K @0\5 ?>C0P4p3x00084$0%<0D0t@000匐XL5P5|G   ?l8`F ? e  ?ه ph8 PEpG0!/0 p!"0 p4%p8$``05<4Rp`K!11 8400$0$ 0<pS_Px8S @C`@0 ?@`0#PP* ?@P`(6#R0:$`@0- 00 0$50SQ 0PӘ&"P0 ?00 1>00S`0 c2#, SZ QZ3 ?00 1>!00   B^B0ȦPp0/2"0$ 0$ ?ᴦWp1Wp#T0p10G 0✻K ?  0PPB@TP`P唦 嘀 00B1  B1 R ` U"B !!0 R0CQE0E ?Pi0 pm똀 0 1 B0S0`0US0  B110S +J/e @P`x1^ 0G<Ĕ84CP0Sp84<Ą-0$5BPSQɑ,pRB@L0 0 000060S|0p ?4HL4P0@0 6@ቧp9' yGK@00 Q<wD7\5?>C0P奁%4tx0]p7(T0#2! a, A3 31  0º@`0 04 p  0H$4  $ ( B, @%LV.  R*h ((E < 4(r X @( \ H( ?.@Xt@+@B@A.@B,-8 Hup凕 @40 pK ,p8d A YZQ  ܅Z0 {X R A/  pW <$?.t{4Ąß  Rï80\@$D04 0H4( 0ĀpP2 R 5#< 5423倂r0S.U{됺 ~z000d0S CQ c6Rc,`P 'z'z {'+SH @<0 z0犸 00z8'(rȊ (+S,H 00 SP0\h!P !0@ 1@f0 pQ0%&0S`@ RH PP0 뀠@t7 -J0jF 0"f`K!00S>(^FؑN(i(&ht@8&ɒ(ĒTU tT0(((D(@&\((8 ( `00S<  0 (#0 (0+ V.|00S  R 0=S,↾0S10$0 1H@(p  EPP04SP0 0R0 S00C0> S< 0,0I0P0lA 0,0S9倱 p开8嘥ȿ+" < Q \%`R 0  ᐡ, @400(0 0 @DU@, 4Ar<2, R40@ `0```0T0?(tb 0 p ` I20 P$5"S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R`# R0C00h0$l`0 R#00B1d0 R*%됃U` p 0 0 0 (0 0C0 (0(0 S 4`R` { $%R l 0! `04 p  R2dᇹ 4RT T  4P%QXԐ R, d0 0   , \  8 @ d`Q 㦃H0+9H, eP+HV 㖃H0q0S ,00C."\ ^  00 0?d 2 B< b10 P&tF$01=S,00CU bd010T0010X0 00&S\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST0C0@ ph`l48 QT* B!44 T: $5Sl0h @0 pp^:S $%S0! !H`$p$p(0W0x0S ,4 H d,04  0,4 $吼 00`  VjҼ0S   0帀0 Xx0#`0y X\H># P 0?d @ `0 <j 9\%R 90SP Q``ƌ` $$S :`R` $%Rl 0! ` p   R2d :RT T  :P%QXԐ R( d0 0z w  q( շ  8 @  p;R` /  `@$  $ ppS $S00S@0P뀐 HFꂑ 00@8p`0x(1呷pYU0I@X!@h@000T: 5@$\ Q 0@08(0 i (0d0O@N 0NC n 0p 10SD=0S0 000S.D08C0S= %>#\Ő\   0d ?0 @> `2<N  $ D0000P4>0S4> 0,00C0S0 \>0S D0S D>0S 0R uD00@P:*0ELP>0SN`E C>`?0S303040404 0#pCVW*HrV.)P`oV.GVغ0S ?0 PS?\5=S,ĺ??^ E?ᇵ0 0S 04 [ dLĒH 0@Ì `04 1,$0S0S 04 C d ,04 0A 04A)ݍЍSmfG-`RMXr@ rPPl 4rP\` `P P9 4 Ap 0S  !ߍ<0H(00,0 00004008004004 04$0D0(0P #W[  ApUt Ap*h q\ 8 `$ <' 0Y $U Q M 0,0G0 C ` JAp 0`?`a8SfPb   00*P*00Sa 8 0* td@edAzd@&ɓۓA-@Mp`;@ @dp@ݍ P0@0@?T00 ## p@-@PCP0 eq0/Sp p@g|R/G-P `$ 0pR@V` 0K@`` V`@&!D`( G-P`0 4J[ Y0000008#8$#48#8Y\dp 0q0! ## ?@Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P0U$PP(,`0p4@*^ :^0 *^*X@O-4MX00\0p0`P`0 ,0, 0S P 0 pmS2aSMS ASB0Cd0b0CX S0SSU0@0T 0DS d9R$ 0 "P T 8 0U$UQUDT P 0 sS@ @ @U00 @@@ X 0x0  P2p0S00 000 040 P4Ѝ/Rs@-|,@ $BA?&@-0 @   ᇸ 0G-@vP| .lPE`0 00000BoH0UB?E ᴀH) )P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@pH)0P  C @-o co`/ᘛs@-PL@` 008&V  @oЍp )H)s@-PX00SL0@`ă5#000<&V @boЍp) )H)ݛh10 PS/C-@PQM@MP`6`@f$a b1 P0p9 0 T:@6S0O@ D6 DۍЍC+ 0P \ 010 S a8!#4a4# 0^ ;0PT& 0+ۍЍ)H) )8)$)G-@B`p 6&PP$"n 0F04( 0 06# R 0 !)n0 80 0 !Rn0006&0?06 0  B 00C0( 6V0:!`p`Vp 0ᬜ0$&? ज0(0 6 C c0&0 $&?፜x0`L0SV&% 0: S t&0 d ЍG(< ((H)X&A-Xa00S FT:p%PP  0 0 A1S0S' P @D A01 S $n0S @2106&0'0& 00C00&101 00C 00H)O-CM`(HPn=?O8fK  ) 0 (@ "*f> 6 !"0H& 00 :PpD YH&㣴0S^9 R0J0XlL  X&' d  zP &X p \ ,p0&s0&$0#0  0vSsx0C 0 0 V0( " B("( 0&`  0r\ BR (0 |x0Sw 0Sv00L8L@ p ;PPYP 0R SIq So  `P0S D@7L R d0 P# 0pDu'oru+UM&0#G 0H&哥*6 B6  د 08넦L 64w0CU 00C0CS : Bг6! S4~0S0  C02#\&0=x`0 00 Z:0ZG:Pu3006   0(01 0勳 0 KU2  060 5&ux(6ZC:0USL0S d0 RP V840SX-P6! !!0!!!0 S$$0 ᓲ" $0 0d$&S: 060& 0{0.<HX0A 05# 000<Y0SNf`F`VJ 30SB <X m<`3PUBL0S \09`0d 3y  PP1j P# 36^:6l0H0p0t0x0908630:Pp` u<j y` *<f j⻲p260:H0p0t0x09f&1 #?1# 0RP*d  v0 lP0哲PPP rbv0!`P V!P 6 \ L!PU:< U+:0U: #0 #0 h℀"L0SVXU:: -$)H) ()5 )`&&8)Z0)S&QN)@)))؞L)g&ht@8& ğ͟Aȟҟ&A&(& )H) )p0S :W$: 0 N6 Pd 00P W:   㓠 p001p1Pu1  !9P  <`U&D1X!6`0U00 h hⴱL0S `0 1 #'$/%169jH0p0t0x0l8&08020lP( f <冱DL<X2 `p2& 0h>Df0?o2U+uᯱ&0#ੱ6` c2H> H0 HD8CߍXAG-`RMXr@ QiPPl hP\` `P P9 4 8p m0S  ߍ<0H(00,0 00004008004004 04$0D0(0P aW[  n8pUt h8p*h h\ 8 ` < 0 $   0,0 0   `ư 8p 0`?`a8S\Pb   00*P*00X  0* ͡d@edAzd@"4H[pA-@Mp`;@ @[p@ݍ P0@0@w6T00 ## @-`pᰱ  c@Pᨱ00S0?0\ 0S 0 hS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 <G@-JHH@P @p:880 , Pg:U@d7`&\A-p`P@LP V 0 g<G-`RMXr@ gPPl gP\` `UP P9 4 C7p 0S  iߍ<0H(00,0 00004008004004 04$0D0(0P W[  7pUt 7p*h fg\S 8 `ᕯ < 0 $   0,00  `q 6p 0`?`a8Sځ[Pb   00*P*00V ⩛ 0* Yd@edApzd@ ԧA-@Mp`;@ @,Zp@ݍ P0@0@"5T00 ## -0<\   RS  0 S䔪&0 / *Q@-$ Q: L^O-@-MMh V/0d00h00\00|00p000 0L0$0l0(0t02000040<080H030<004P04040F00G00H0040P0050<0p 0S00|0000000S00\?00H R00S <t0S ጩPt|0p 0l0- Sd0h 0>0i/e4pD |0@ Sp0@0D 14P pD 0@q/q]@P\#?4pD 5P (Tl0S 1 : S  R 5   㤪`P`0z W`r`Foobr ᐪPV   ᔪP  Ꮺ@DPH (3}pTrd0h 0 0d 0Dh0d0h QP  h0@ F0S@040x0 0T0X0@0`0,000$0 X0R0 X0R@00@00S@0S100{ S0T00RS 00R0 R0S0T0z /a+a`0P00 pR  W 000\SW 0`S`SV Z T @0S X0S2|0p 0/>0D0 p| 萝쀝pcT* ppv @@0S ?X01?0#*@0bph X0S*Yp_ XpZdh 0[J U  U* >05[R[:L0Sd `!0SV 尞PX` VU L0 0` V I`JD瓩P04!$ 8!0 l02.p`P al0&>Ch. 0< S0|0| 0$02#|l0刪 U00l 00 00H0 30R8 00R000L0L0S0 U@ $ 0004Q t R t L0 p 0H0( S P0S (0dHWH00 (0300\0S# U0( R030"S Rd h0`$80 S  +/p P P .( :(0S U0( R00S $4 0$00000,00#40*40`00 01@01X01T00 U0 @  0 <0$00(0x0,040303)00000 0$42?@1c4 04v 08#$0 #(#< 0 0 &2 =Q p0Q\0S0000to00 0 R  P pT ,'? D z.pc P^ ( \`74 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |CQ`000S  0! UQ0R0( lR00S LM(0 00 25 010 0P B24 01(00(0S PP 0`( "4`#/   k B* {S@--Gd A 8 /eAD00@- 44@4P\P 0B""  *-@=B'*@-2 Z2Z/H&G-@P ` !>0ᇾP V0 0  PP G9$pP`0%X 0_0S < _0 V *$-s@-@lP 0  2X X0T0LЍp P `2$ 00 *  *#@- 04$#$04IQ   21 Ѝ+3A- M`  Ƨ P嚿@1 P00 !0 01))11 ( 1X2pQ`:1P2A0F@UWPE: Ѝ07tp@-0M4AP`  ሧ 0 0 010R  4   "!0Ѝp@0R  $   "!R Y0S1$#$ 0("( 18#! 0Ѝp@00Ѝp *  @-,p^ *'P@- 0 R * 0 #  @0*P `00CS`0p S00 P0S X0X /X1&p@-`@8!RP#<10<10 .810CS81V <1S 0<1p0 h彙d廙`0ԧPp <10C<1(0 810S81 *&8&& *0@-@-4MT 0AQ`0d0hQ 1 0`"R d2RK0 /d2SA t= hk0:P{PSH1A k> * +['Hk;[E{7  (+S PPP / 0 @@zj{ k[@  k[+S/4Ѝ00B:tk{{'*k[+S/@@?-C6?Y@ *A *\&Դ *@ * q@-㿦k0d2S1- *@0@-0S0@d2S婦`2"R2& *(@-@ 081 T 0J,tD t4 t$j0#-S<888xS`S)?S DS .  <(8(Ky*0C @+K+ C 0BK+ 00CS00KD*a0CS00 ⡜  PK 0@P< 0@09  90S90 0K +K  {hI  PK 0  PK.  K   `(  ΝPK P 0K. +80  D  ⲝ@Pjkk 80SL8  ,l  ⚝PR_?0<0>080m?040>000>0,0?0(0?0$0?0 0?0?0?0?0?0 0?00?0?-0I?VN+   ^`PK PP H70SD'0 0C!0R3 $70S0Sy K  @PPPh VÛpt0@Pp n p嶛thP@@0X"T  0T\  XpW LpS  0QSL0Qぜ0P@f0D` X\ X0D S@0S( @DU2 PP PP<K 0P@0 K. *K>< 0/ ) @@jpP @v XI 0S$0 0C!0R3 40S0S 0P`0姜P `0zᡜP c=0 ,C0 0 S;.000 j*+ 50  d0d0@3 ὏FS p 1 01 Q 1 \R \>?p@1cDD0X(H`D# R  D/*  Z   OY   \0T0Sp hD00D0, L0 SH00H0H P0S  ⠚A  P0S>$ = ≚   PcݍЍ |  vTa?  PP|A80S  0 P  ^h  ̛P Q8  ⿛Pwy E`B   ⱛPPi@t0SC 000+ ⇋KAh\A`X+H++"+&z+&<"#9+A++gfff\ ?H@0@-0iS03S !x8=PJ&+H+@-@hh` 00 P @4 0   `"+a"+@-`0@Px0 B0PU1 S2P T0p0S 0@ SB830( 0p( Ѝ&++8&C-PD1`0B8! Y!tMR!p@  10S ( tЍ000iS00S 00S  d `P'W @ 0 i P ٚP000 p 0p3 W@000&++8&++&`0@- B@T0@T0@1 S2 0P   0S &+G-lQ0S `` @P 0S 484a4qP0 0@0C!R! 1S1 #Y TpЀؐP` U0(@P 0E!0R30S u | X3(0S2 @TP`00 $ @+8&8++++J`"+O-0B$0 pQ0US P`P PP"% @P0 D  0S= 0S: P05"  UE  (; V S 0S00V0C?o20SP@Yb PP`30S  'x#0ES0000D30S ЍY9 0 X@00020S ?P"0 |'rX0000  000SH 0@\' 0 0@0010S P0 YQA 00 0X@I0000S X0000000S~ @0 0 n RT 0@s0S @ 0 $ @ 0r@WH00S \0 ,}L (&4+VS+n8&&`"+0`1A-0S PP@`D1 T0 :414a PU @T*$PXP@`0S 0D !0R3 Pp U 0S 0S  |&'P0S0S `0S < q&s@+8&n+`"+++0A-0S |P @`pT V @TL$@ 0S$p$00E`@+8&`"+!G- 1RR0堑S W@Pxqx! 0P0:ЍS @LB`P$ 0/C &000j PP@:SR  0%v Q ]y`P0td0 r000 i000+++8&++0@&Wx2O-0S b00 @_1P+p P@ 0P0p0Z: P0-:p R02:70 R S U+:SR00W 030"S P 0000 S' @@   W0:0 SPhn \ X@%000P@ Ѝ+8&+++V@&C-MM$Q@P0S H @p T0:ۍЍ0S 80 CL000@T`PP@p0 - 0 Y %  *000PU +8&+0p@-0S P`t0 U0p(p@TP` 0Q0F00S <@+8&+A-p`P@P $pFpDorPT 00 0CR?o20S $P &6"p@-/0@P 0Pp SRp"+@-8X0S$$ B0A AX$X!K+&A-P0`0pO0000 Sڤ/0>+b P0 P<⒋P@O 0 80O0?"+|B+&0@- @00ې0@0Ѝs@-@P`P @TZXX $?0 00?+"+R  + Ѝp&$0L<S/ @-GP|B+#&2O-@`CMV{ qP@ `0DUCߍ貀TX B/~0 S4((~ jj@0PS  b8"#4 b4#04!40010S 0S 0S0000崐{'{{g W:0000Y&*Ȑ0S 0 0S 0 000R*Q p`v#0S L `X0S  ` +H<+I++8&2D@-p @, P0@0& l3O-p0]MS TThPcPC L H0D#&"00RS  #05 B "ip2"!CP8QRPP "2$#W  0"!00RSZ  x0x"!hip\"d HQPD"L  Hp. @B@@@r0SPY : SVH`P؀/0 N~10L<aS$ @ ( D {`  8<P  8H\  T Ђ X ` {P <"0!00hH/0>+b P< P P <^0?0H @P QP%PD p  u"L P }QPDPt]ߍ+8&Z+++&y|B+#&+ "+ LV<6p6,2+?&'&P@-$@0 00: S+G-@ q `0S+ P 00S VP0 S00P R HRڄ00S t"  Y`-P 0 Y00:$00S ( !++&oG-AM`P@m0pP004 0AލG/00 08/P1 00C 0  R+ d T!0 \ 0 D h|B+&(A-MMp00 0/R @`GPP 0S P@ۍЍ D 8`D @P 0S ]P`|B+p@-0@ @P  P@p@-@@33O-tM0 S K댣00RS|3|  p3p#0 hC4#S\C0TtЍO1Dc !8PL -   + )F0`00Aoܲ@`L<` [ L\0@ #XK= hpWW#X@P OL<0@(e0xSiSPfP 0)0@& 000  L<0@ QĿ A\dⷿXDⴿL OtЍ0 0C0H10S 0Sp&0` S\lXlh0SS  /8/0d0S X00\ `0H0P!xm`p 08? A+8&E++#&+&k&|B++ /++aA-MMp`@PPx 0p=h!h@PX T L; < 0 ۍЍ aD D< PpU U`k tp0P ϖ  x0S =p T0TP 4 붖8 [E&|B+++&0@-2P@-H@4#S 0 7 0#S 0.@&0A-@P` 0 P0:t 0hp ?z0@$a@00S$`V SR+;<6++U 0S 0 0/ R  /0Sd0 `0p@-@ PP0*D` ?z0Pp UTp$/p+<6+0p@-P@ 0 P0: 0Lx` ?z01S 0Hp@< $ P\@P@ p$0+<6+@-MMP@T 0``p/VVP   P @T@ۍЍVP @p@-/PՓ@P@p00/00@P 0S h0A-P@oC/p 0TD@D{ZU pD@DP@:+G-pPB`04PSpM@P`0PP0C0 T`4 $D@<6++G-ᜡ FPTpA$`Pt0&(0C0@V$Q@$0( 600v`PPEPP l @$@@(`//Ҏ` 00 @ `P`F0P p0@0 P $6 <6++1Je@-@᧎00$ D<6+0@-S@ 0S 0S v 0S p0 Pgd T` R 8dD0&$ FЀP 0S00v<6+p@-@`PP50S ? 0P0 @/ᛒP:j崏0P 0 00p2O-p0lMS 嫼|20SHpPP hT PmL0@`000@Q 0*` R 0@*b@0Sg@01 $10 8%1 0`008<嘄0@ 1An p5 ZPP d `\ 8P 4 $( @0@D^`P P r w  1RQ rQS! $0SP P0h_0 P`1 D1L1D10S0" 0 AD@(CD(P@\ (00(( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", t> R" +8&+<6+&9C++e+++ 0`( "4`#//)#~*$x"Y"ꚧꀧ00@-@MT[0Q@X0T L0LP  @  Ѝ0@Q@H<+I+&0P @-+&0@-Q 0@T0 R ||Ӻ0AS@ }ЍH0H P( &+H<+&! '&mKA-p@@P 0 0S( ` `yx `H<+\L0@-  Q4 0P ((^^ ЍH<++v&@-0xP 00S@%*S` RP@` 40P  $ 0 4ЍpH<++&0@-@0S 0$P B5/x00SdPP ҇qpH0`P@B4 0@$ Ѝ+H<+++&p@-hPh@4S 0SPP *GD D0P0$000R0p4 *H<++ +Z@+0s@-@0PS  40B3/p00S\0 4pH0@P`屑4 0`$Ѝp+H<+++i&p@-P,@P@pP @\0p@-XP0SpH`@P EP  岹@p+ '&H<+&1A-Pa0510qS :p唁@P 00P@P)`ဌP!lPG B@ 0I\P7u 0;000@$Av+H<+++&  A+G-la! R` \ 000 D! R 4q4$83(S$1$A?@" 0 Q I!Z/ , R,  000 `2 D R 83S@t00"0Ap !-00@ JBGЍp+G8&2+W+=d&+(++O-pPEM08aSP  ,,(3po0C @ 0T*0 ?o2W03S 20S " T  0S  Eߍ0S3 00"0 u0S 0t"! 0dDsV V V- <  B B B0 0 "p+ 10S S0@  B B B0 0    B B B0 0 X![ HMP 8HP# 0S I V    VB p0S    V     V %l p T D +8&{+ '&"BS^n 0P/00S Lu '&H<+P 6 O-M M)$ PR P  50S@ލ Ѝ90嬕e@T 500RSQ 50SM\5pE9S)0D0e000E0H0D# 8⳷0@$᮷UB I00 (4 S Bˬ@P%嘷D┷B9S; B. 0 W4B [T U@ 40T9 49 dj 8#c3NY0 0-3B 300 00zBw@p`Pg(4 S BSⳈ0305 3 R p 0#p   "00Kb(@62B0 05030Ƞs3303Ƞs0P 20S )Tx0040 S X(L#R Q0cÝ\V I $ oPB hP 1 )a#090)S )0(PU @10S1$10Sh 0 X `y 0W090C/W pC0S 1W 0 cpWJB:B6`FVU 4S 04s&0 ZBJH<++$++&++ D '&++8& ++Dj+@+O-dCd5)SW0pW_R44y`u0SW  0PS9 S00P0S 0S "09 R V?o20SJUMU5D R4 pGW`pVp``\2 RD R: R; 4<820S>,P: %+ s909909 Ѝ0 =+"+R ! R | EUY0+5p`PlP d< T(`e 00S O Po t00 ?(qp V00S |厵0S 906;#;S X%uO\+PsH<++ '&+8&& +$+{+;Tb+E+'0 O-RBM M@xWtPP 'P P Bލ ЍDW0S870S ,,;00 P 70Si ] "4"42hmhm004488<<HHLLmmmxx||m9^EmEm:^EmE"4"42"4"42T%0A 050S  Ѝ50S P 0 L50S @@  00 000%0`,:0S40S  40S  P 0 0 8$!!!   Z00 0`40S T 0 u 30S  30S30S u j? Pj 0> j j Z 0 0 8  P30S` P V0A 0 ,#00 020S  820S620S % P[ 0   Z 0 0 8~ { 20S , 0 m "`e00 0; 10S 403/    !TCZ00  0T10S00S 0 0 8  00S  0 c 4\ 0 3/Z 4   0, + &+U8&++H<+(&;W XdXfd<++LV+h@+`YZ-A-1(   0 !S@ 1 1R 4S8 !4q04n0`@P1 TP0S  R-* SR/ AP/ $!0 010000 QP 0PU0 $N 5P Ѝ0PB0P;C0d0P70S050 0000 @ 0@0 0++TH<++_j@-Mc0S ttpCpS0S YLPΆ 8#804  R0_ 3 r 0500L rP5"0C590C990C9000rtPp ̮0S d2l"h2Q09\09 <0S <20C90S(20tSV2"CbC 2 o P5g  0R0%S P S LX ;#;S h;004Ht0@%S ) 4>0+C? R 0 0B  0S \ZP 00S )X!G0STP=S 000Ѝ+8&uH<+ '&A+&+++++(kTE+I+++D+dw+++-@-  # ЍЍ/ᐣ&x07@-@0PS  P DžH0 < Ѝ0000S 0  Ѝ0@+&+8&|0p@-@PU 0 P D 0<p000SP +.&+V8&p@-@T`P T0:p1P 0S 0@P+p@-@PT0*pP 0S 0@TP@-@ 000 0  xl0 dT0 P<0 <$0@ (  jJ+oxJ+p@-P@P @0 4 0D !0R3 p+&p@-P` v00CS0T=@ T 00CS0J= P yTnTyDop0 @00  p0 0 S+&-@- T z"L00S @P@0P Ѝ@Ѝ/ᐣ&+Rs@-`P@00S#p P 0 ЍpR00Ss P h0 XL00S8T A0 `| { +&;+8&p@- Q@k  e  _ P * W  P  O P  pG $P d P? 0T S0BP ,6  2 %p@Tt&p0@-@MPPPP<  (0P  Ѝ0P 0N+0@- M@ \0 008 ;N}+ ۍ@p@-@0S mt00SPd P 0@00ƃ <p@04 000Sp p@ `+t&+8&A-/`s@P@Dp/Ѝ/SpPP +0 00(P0000S@-@0S  0S 0 000h00S@ Pm <@04p 000S @g +t&+8&@-@0S 0 000d00S@ C P>| 8@00A ,00S @8 +t&+8&@-@0S 0 000bd00S@ PN 8@00 ,00S @ +&+A8&C-0M.S4`DAPp0/SS  0 Q0 V ! ,  4              l   X  00@ 4"9Ѝ+X[T@- 9A-`Axp@P`  P P800 S00ЍU00R+$p@-BMP` 0 @E CR V uSP⷟0FS`0  BލpAS {P0P S00@$Z8⛟9R+@A-P@`{<0 p{W 8AR+@-'AP8 㝁 0S4 P  KPr80'PP `@%rPL 00p1 F0S6 0 00@10<0`V105 S:; S0*P 0P0  0P 0 P 0 Ѝp_S-S pr`00P D0mP0;CR+u|&R++0@-CM@P0, |  0   DCߍ0R+@- @ R800R+@-$M0h ` \ X '@PHpP$ЍPU D0P7R+@-$M``0C/P@  6  z8p   $ЍR+@-XM,@0F/P  XЍQ@-BM4@0    Bߍ/ 0`( "4`#/A-pP[0`V  @  0!Sp h \7 0 `0T  d00 DoR+6p@-@PU U t 0< j  $ p@rz `D8&RP 7P P / //{n-M M? )ƨۍ Ѝ8&4`00CS`0X X0 X /&C-pQDMDЍCRr@p`hP !W200 u0002@0PS0C000@ Rp@T3 W+X( U U    ~  9 0 .0   ~  )\ .06HHp8(yp W8&R+ R+@30@-P<0TMS @Q TЍ0@_0!QyVS0"0CS0"PFFTЍ0@a :!0S SL03  `*X"d0AS!0@  0S(TЍ0@莖    00P1P2P3P4P5P~0hP1 20345PfP# TЍ0@j@P=(<$; :9876 P0P1jS$ $PPQ Q P(  x\TЍ0R+ctK(O-@RT 1!0!sr 00 0-04 0*00 0",_+ISO-`bM0弐SP@ |pTp= ,pnv,0 pYЍ  [ I0SYx  ^qBv0S@0 poLpT 1S!1T p 0  T 1!0 00 0     !00 0d,, 0  000!008 0d, , 0 ,_+r0@-,M8p0P R/ !!fP\,Ѝ@}`@ @t(0`0$$0FpmP)&,_+@_+`+G-XM`_o@PQ% 0rS P @0 D 0,0000x0 0P    RQ  XЍS @0 " 0P@`+`pA-8Q夁X@`!1  0 0AQ!pRS4V0 1SV fAVS 0A eVpTPDP@XU HA D0V,_+)&~8&"I0@-P$M@0000 PPp$Ѝ0 R p s+d0 0 1S4L0000 0C,_+"O-XqM 080@ D @CT Ѝ0ZЍOR`" 1!0 0 @@Kp Y tPP 0 @@ :p R Z dd 0T 0CS0<0( ,_+@_+;g0@-P,M@0 08 0 PPp,Ѝ0 P  *!! 0Q P0P6 08Q( ,_+)&p@-`M@0 0( 0 ``p=Ѝp R  *|P10 01SL0L l1S*HP ڊ!_,_+)&~G-@M`Yp2 0S 0 00 (0 _P (P(0 %"`P(` P@P@Ѝ`(Pv$PP ( $0 PPXp@ЍG(` 0v ( 0C$ S  '*v%Ppv00Y0S Y 0I0t!0,,pH1! < 0( (`(Pv ( 9r( V((0$ 000  00 0 000  00 0P$ 0 0$1SH"<!!!! ,_+@)&"C-M⬀`` (p3rW0P0 000 0L^PPQ ЍP@P/ PP 0  PPp!ЍC 0R $ v)0W400(00 (P 0SQP v 0Pp0!00(lP0Slp1S\*`D0S U 0 $P,_+@)&"]N0@-P,M@0080 PP7p,Ѝ0 R  )0 01SP zZj{e[fk0KZe[KK[K+S,_+"XO-MtrM00`S@ iPTO B0P H(J@ q Y:@0@0E p.oPٍЍ3r  ᘺp  Y  ( "r "QPR0% !*1 21 0T 1S1!T0 0*T 1!0 0*Pk 0 D~ @k  0 Dm,_+txO-JM{ M`P@qk03~<0kk0`400pc?c8000S0P0S@pTlK+!W 0X+ 04@pW8pr4S U08pA/ <0:0 Ur> r.0 014@:@#TRT 1S-  IR:1t Y00 ! d \z@403p0wG, A&\,"\|pG y, \ ,\뀀pG  y, \  ,\pG  y, [| ,[pG  `y,T [ H ,[pG  0y, [ ,[pG  x,[,[pG  x,[,[pG  x,[x,[pG  hx,P[D,[pG 4x,[,[pGX (0 ,[,[ 'HwQ  (  Y\'0Q00S? 0YS; XQ;X PED0Do4H01L001Hp`00 D0ppMpXL010@sXp&4 0#Q0X00Cs 1SPdX0@s5YG4 0BpYPE pW.- 0;N/ 4pSu , [,갠Z 0 R(0 R pP o 0 0 03AP7/%00D0 Jލ ЍY@ 脟 RH 1H0 pH0S# 0 0 @3SJH  ?W8p$W"RZ 0 000@P0@3A4/d4IpY 0 0 @3S$1R 0) 403001rP 0 9p 0400 [*Y o0 S P40Sr 000   $ $ 0 `p8`0㛣#0S P   B ( P R0X0,( 0P$0 ,( Gn$0H0 ppp0p?   H0 ppp0p.;㨀H0 H0ppo0 Sp HpP H0 pW 00H0 pH0 ppHp0pH@P0P pH0 pplp H 0b@_+H)&y@)&,_+"Db+$4DTbetpb+)&O-qM쿟`=P`^@P U#*0T?SD00OZ딟pP0.0809p R  `1`STyP`  2m00 14P+m0 ,@P 0S qߍUmn 8~80U  0Sn0Spl/iPY yL- $iP.U iP iP040 iP040 iP i베P040 <hP}  h PU  m 8 80U40<  0Sm0S h P!U~  m 8 N80Up; 0Sm0S1!R00:qxhP#UW L 080 Rk aBQ@IKKLGJ 2  p  Q)PHFDBpDm 8 8 Wl   R2m R0!P  : <0<00140KS0J  X01S 4PU U0H?o20SU0H?o20SU0H?o20X0S l l 8 ᩶8 W@   Rl R0S*  %00140KS% 0400q~f4PU4KU* ofl 8 8 WX  Rl R `0  0140KS0 }{S01wXu40Sq  Kv 0H0lX7' ZX` 0sXp0;p0087+Xw0@QP900.@D @8Akj 4@P8BiW8 0V80 R@00@0Y-1 ,`040 0@p>l|  @c40$ 0@ 6@V808 p@C1!0  p' y04 @1@S 0 j 0H0c?DpD0H 5pVHPp0 SX Zj-0E1 d! n`0D00 0``qpk 1!0`1 00CS$$1t' = [@P qߍOtor4S 04x4(0 0,0c?0040(00p`000, l4 6Vp8Xu,q RT=00D3` f@P0=S 8 R`  fP 0=Sc 8 R @`  fP 0=S 8 R  `qߍOY( T W04@00, 0@WD@)0S M1S ^Y   pP PU-u ) 0 0(00,00 03A5/00P9T"Yd(,p@\PW0,S(P  T'&j XqpF j0"S j/ 0 SX0T R l00SX S SY FP00CsL " 0P LpT00 T0pWpHXA0 &p000&00' T0,_+ )&U74r=bD +GH)&\e{pb+U@_+0.hpT00zj0SS@@T T TK0P 0h00L @=@0' @00& 00.0000h 0 P:\0 p XN qߍOH0j0S\0 pP000 0000( , 0I0s@-i@ 0 P=  ^p }` P @ 0  C x &t0p@-P@T`e P  p@4"p@i %d+   @-M @  P( 1  Pۍ p@-IMM @` PIލЍp P0 Z0 pThP 0S 0S0 0S  P   d+@-M @ PDۍ00 R  P d+H-3MM pPPYWF@DedP 03_dP@  Pz 04MdP00 S 5P 姭P00 S ) 坭P2  _x 哭`Pa `2P X%dP ,&YPP00 U,00P`\0S孲X QJ0 PJ rP ☲1J @Pp10S h 0c 0dcPPPUX$ PhU  0 V, )PmP`ZZE_oR 0PP`hU  4S J P t@p* \L0sP$  ' * d+4 > B P `     & >O-M Mp`;j/p p P@@p dp p0W1p0Z?:D0S ލ Ѝ00WV@P ?@Pxq(0IT*20Sa00 00D1Z7 0V98 Z RP g1Z.  T@cPZ 0 pV㧉 0Z 3P gZ.  6pZeP gZ. _KZZP g 0Z. _C|dPedAd+Up@-0M` 00RPPj0 P@XRP Ѝp@8P _ 0 0P : VЍp0 S C/p@-@P,aP`(aV pp@bpO-P-Md `\0`HV<,3~Ѝ`JN0PH0 H z0PD0 D0S 4DH UU U U;x0@`|6〴x01tx00Sx|UP@0\ 0S0R0SX0 0P809 H0PDp` 080Xp*0SPx ?|`3S00 P 3S00 P3S0P P|0S|P 0000000% @08|0@P P07‹H0` @T0,4PD00CsD0;\0S 00T0[S40Dt,0僄 b  0`p ,0 ;@p H@l0@x0cC`80J~S01804Pod0S 0` S_ 0@04L0@0p?h0?l0L0?p0X0S8 z@0竸z0相SGx ?_|08 tx?ɏ 0_ {00@0 C0t{'{_L< 0P_t 0P0, 0P0@00,04 h00400 l0@000L0T 0p00T0JnU0 00 pDY@  Tɚ;Fgr? 4 ;$p L<L   p @0x C?4; $p 08 0|0. {0000000 P{'{x,ʟ 05_ 0`/_ 0 P  0ST40T,0[Ⴤ0S00僔( a p 0p`pz $;pr ,00 @S4004$;pd I0 x 0^ 0`^,00 @S40 0P^0 P0S40Tt,0叛{ჴ0S<0O 0 b 0 0`Ap 0 p4$;@ 5p <<0*?ᚃ# 0@'p ,00 S40嘰04$; @p 0n A,40 F0`|0P P A8{ {'{US0x`Ɵ A,4,00 S40 A{ 0 {'{Z^<0 ?ᚃ(<0P 0O^00  0 PF^ 0P ?^ |08%Y@W@-d &A-p@4`S  PT0DPEE$UX  _PV00_P V0-08 P (3MDPE@D(d+ p@-P@Q0 h0 p_P@ R 0S Ly#Pp 8UO4 00, 0p$k#)&+?,7,7,7,"@-2800S ,0,0 p 7밓++*8h+G-MTM0S0 DpW,Q44Q`@`$0 U0A+x<P 0  0ۍЍ0 000nS ?S aS ppS qS|0 | 0h 00L0@0 ԓ++,+:&̮+K&[~A-X`0S L00S @P@@0p0pP00̮++ԓ++T0@-@@X2@00Sy&,0, 0S00q&+++?, $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 坊00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =&&?,?,;,7,+gPA-@@P@T +- @P`p0Sd@`0  @ FP ,04 0 0@A)&+?,7,A-@Pp@0S0P0`x0 Rh O R0T @ 0S 4 P@` 7,H++)&7,"P@-,0 F?,P@-,0 :?,P@-,0 .?,P@- , 0 0 ?,+,7,P@- , 0 0 ?,+P7,P@- , 0 0 o?,+t7,'p@-PAM C0 0@00 0S0! :P7 0S40=PP0 0T00aS` 0`0S 0`T0 0 0@0S0@T@ @0Q0 00S0&.AލpP*,L0 P @0  9PgR?,M?,?,?,\O-1M MP ,t4 1ݍ ЍPX$9P D4@@@/ ,P_ 40S d_P 4pPV /3 sP㞏0S30S 3Y30S7 0a@P0 |300p3 0 #X30S0 %Q03@OoB0B&Q 30S 2 ` 0dP0002`P0 0R " Rd2 T" R E@P L2\"00@2 0H,20S %W 2@OoB0A% Qo10Sk 1pP0001p^, ^0 AP0S0,`V 咟Q 10S 00S2 0@P- 0! 0000 |00S % Q0@OoB0`@v%Qx00S d0 0P00080`?,s̮+ 8h+++Г+?,?,?,ԓ++?,G-JMMPp 70 0@00 0S! p8P+ 0S(0;PP# T0  1 1 R0 0S0QW`5 p1 0Sd1d徇P*L1 @JލЍP @ ! 18PJpW#Pʡ0 c_0S @$00 R000S0 0&'t0P0]4qp P0ST00@K\?,?,?,6,+?,g@, 0 0 0 0Y@, 0 0 0 0 O@,C-KM MP"*2 Kލ ЍP"7P l2@@d200PR0/ZP 82 0S@(2- P0 Qo` 0S 10S1 1 2@P -p1@d10S x4PT1 0pP 818!0001 00S P- 0 0 0.>?0T por [&t@t0Q00S x0p0OP0 00P0pL?,̮+@,6,+ 8h+++2,?,?,?,ԓ++PA-AM b)0 $Pc`P0 0Eꌀp @G BIx @0 0\0@@H;@C0+6P8Aލ0S 0 pP?, +@,P0@/DP@-)0$ 00 0?,H+Pp@-o@P P `hiP XdP (pU ,0Q0  C0 pAD+l0 @- 0t+?,P@-((0 00S/0?,++~0 @- 0X+?,Pp@-0o @PP0B 0S 0 …0S P (0 0pP@tP@P d4P(00 ,n?,D+++?,A0 @-[ 0+?,0 @-Q 0l+?,@-(@(0 F 00S0  +4?,?,0 @-6 0Aԓ+?,P00P0SA- 8(0 !0ЍPAaq0S000+0S 0S1?000PPzP00rP ,G\7`0H 0QD084 ?,+8++YAD@j+̓+R0 @- 0Г+?,0 @- 0+?,P00P0Sp@- '0 0pP`P@ P# 0P 30P xl00?o2`SP@8 8 <00S000?,+ADH+D+P00P0S@- ~'0 ЍP 5P 0Pd00}S`00S T0T倄0HqP80 0 00( 0?, ++$N7,.,.,p@-0PP0000m8@Ppp hrp@/P p@,'1@0@ 0S 000>?,t+V+2,gP00P0S@- 'P0 ЍP8 4P 0 P0 ?,g7,0@-M P&H1 Ѝ0P0! 4P 1@@*P0 /@P*0@0 S 0 00S P |h@Pl0  Q\00S P0 P 0gP000$0P?,̮+ 8h+7,+ԓ+@-P&0 ЍP 0Sx  4P 0S0TP0@P00 ( 4P?,7,G-@pQp`HoobpbVP>10S|1ЍG_T`pE89&T1 Ѝ@5V@ 000 1"T9pX C(`P 0S TPS5|0 @0F `T AVPppTT TV@T %7@P @P 0 ЍG6,+?,#A- MP%$2 ЍPR0S"q3P 0 1CAUP 00|S 6P xP 0|Ut1@p@\) XP#LQ@o`010S 00CS 10S C)0 0 S } !3P0 T.>00R   ]tp!'"Ql00S `0 00P0040@?,\9̮+ 8h+++ԓ+@-PPM M:%@p1@ۍ Ѝ(`B>@PC@@T( Na/@P@FX+PE00S p/00CS0 yU000 0a- 8p0  0 O-AP(t@?,EDH+++a0@-M0P 0$d1 Ѝ0PL! h200CS0,P@/0S0PPP P@?S BXT0S0 @ʴ0n@P @P)S ,XU x0x姁T0S 0H @S X,0 O,?,++p@-0p@P0 p@_$\0\`0XPS 0S#/0S0p@o $=00p?,.,.,+p@-0`@P0 p@9$L`LP0S.0Sp@(M 00p?,2,+ P00P0S@- $0 ЍP 1P 0hPL00}SH00S <0<00P 0 ?,-++4^7,P00P0S@- #0 ЍP w1P 0l@PL00}SH00S <0 ۀ0,P0 ?,d++7,p@-MP`+ C@T` P;+ WC0ES(+ PC@0 ۍp7,@-P|#@0 ЍP( 1P  ?,@-Pa#@0 ЍP( 0P  ?,@-PF#t0 ЍP 0SP 0P 0S0,E 0P?,gPp@-#@0 p4@0PP0 )Pp$?,+0@Sp@-#D0 p8@0PP,0 Pp ?,+Pp@-"D0 p8@0PP,0 Pp?,+QoP@- "(0 00S@&+?,++QoP@- "H0 <@0S }0S ?,+@-0P@-000P0S "P0 ЍP@ 4Z@P@$Q V?,0p@- M Pn"1 ЍpP! 0P 0"p`1`x0S@1D0 0S 1( @P%P0 0S 0@T 0Q%`dH@P P d@ =0@ B0 @ 0@3/H0T 00S00%?,9+AViPp@-(0 p@0P0Pp?,+nA-P0 "0Ѝr0S2|P70S10S 1|a0@ ` ?0封S Cc!!b"  A   c# P0U0C00CS0<\  P?00CS0@8  P7,! ,-PS0 p00 P0 b" R  c&0P UR PE 00P0 0 Sp(0L0 0 S?,++sԓ++++& P00P00@-SM  ,0 0Ѝ0Pl  ,P 0(qpP@ 0 $0$U@00?,g+7P00P00@-SM 0 0Ѝ0P ,P 0(qp L0@0P+p)4 00S 0000?,g+@P@-(0 P?,D@- (0@P0 @+SP00P0SA-쀟 00ЍP <,P 0/`P PPP 0S0PM@M@@- po> H7> 3>00hf?,\P00P0O-SM  U0 ЍP  +P k @P@ 0S0@Lp`z-|0 `@P0)>0Р00000 @0 C?,g?,@,+Pp@- 0 0p`@PjP |@dP _P@)p @ @000 (0@?,\+`++A-p`P@Pd0 `AP 00#-4 RU0 Aꐓ++@- PP   R Ѝ@P   HR  @0S00 Ѝ@`p?,*&+A-0p`P0 APPp@P @AkP s00 a00?,+Pp@-cL0 p@00S40p@,wz(@0P 0fPp?,6,+ +90@Sp@-Ch0 p\00SP0p@HWzD@0PP80CPp >?,6,+>+d @Rp@-p0 pd RX0p@P0zL@ PP0< Pp ?,6,+x+O-MMPPQ 3 ٍЍPʴ#EE*P 3cp@Y 3  L`P@T)<0㓄(p @0S (30@ @c0S0,00&p`J2y2`0S@$S \S00@# 0!|"  0 #" @00B   BR 0 F )bk<0  K`0S@iR0@S 0 F)bW<0J`P1tyh1 0S x10SL1h`10S ,0]y00CS0.  E '<0 03/00S 0S 000CS0 S0  )t<00000h0 rY 0pS7 ?,!+++!+&+!!+!+++@-@P 00P 00P00p0- lM xX00S PH d0 P000p ++!+@k+-lMXT00S mPD d0 P,00p 밓+!+@k+A-@P p0 0C0S13J `UBP@ 0 B RQ@  0 0C0S13p@-@`P:t@P , 0S!PR |,pp@,*`(P %X@P008 ,0S!0R "!"%""p@-@P 00PU I NPp00p@-@0`PP<p0 $.0St  h0 S Ѝ00S 0C @P2P+("P/0S/0@-@Q0%Q#0S P   R   07W0C2007W  BꜪ&G-pP(P SR@ nAPP0   eAPN0 0010S / ?Pe )`@?P 0PS(2  `P):`?P P)P :t?PP000S`UK ᜗0S 00S1 @RđRp0 \ AP0 0 U ))) 0 011 Ҙ.Ѝ @PP) `: 0S000a) 0S S St0 0S 0`S@O)H0PU F),PD"k"s"@+"z""ȓ+C"ē+A" - BR0 R  P R 5O-M M@x PE$@@P0DHLP0($0,8D (00,0DHL` 0p 0S 0S X 0SJ@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;jL@P dۿP XֿP HѿP80 000S V PU@ /CLV@0S ?9P @0U0C?o20S b4pWp 00C00p0Tp pW L9pPpUP 0S 90P00 $ 0R 0900ME+ 8Z0048<03 0 )3 x30S7tZ  A(@=0P0 $3@@6(:=@0P 0 @*(00 @`h `00PPx P00@sPS (P Y0@ 0'T00SPeU 0S} W +X8+XX8+XT8XP+ 8!0 0p4P80L YA+ P0q8E>0000HP1@@DcT@@/=0P  00P+ 0Q8 08 04@ 0R 0S00}Sdu0S @0S 0S@0P/ KP0Y80<0 @s""""""" #B"Г++#+@+ؓ+"7,a$+ԓ+e$l$?,Y#&\#+O-kMMPd|UZύLHD`\X1 !0PX0C|6Q0B? (p8 DA#'XH 'La\'PQV?ⰡT㰡0E?o20SdQ` 0S PVV 0S#UU?0SxH|0s0s0s0s0S0s &X?0S0 /`JP&&?0S 00SU n 0 0 /x=0S !~5P' Uu8MD-6>O00)0SO !N)<P$/>N0 0 (00 AQ 4t=0S2=@ PR( @@-0 Rg@lGP@<0^ 00|SZ >T00S;0JT0"QK\ < < :k,6p;`0S00X  UL k ;/ 0S 00S 0P 0S} &o`а8E pPp 0S :I0PU(EY :Id=pPX ၻp0SU 0S_ d+0 00 P#P %;P i 0x!C_/0t1p1l10[/E? p x10l1S 0S tAT# 0S i[FP h [T  K d0冓d00S 00S P p$%tQ8[Qύ00D!0 H!4 P!0R iPP0000I84010100i/U`P VJ 04 0@嫔PP0S4 0 墔XUU@`PTv  p 0q_0pP7/JPX80S PPq/@|'5t 500S @Pq?/70 S00?o2#P@P0 P60S P 1S$ P 1S$6vF VE@P3 )di5\60T6qP e00@T C HP V00@T C HP G00PP UN`UEP< ('(P<50S2P@T4dL! t&QQ m&R i&Snp `40 WE:e0 0- 4Dpur R&U @05 4@T Q?1/N0 00@ L!1&Vv40SlS`V = PY= 0 &0!&p0S0A &W&1p<00S`a\ST0EP<0S 30S 30 @< %V P30S 3 z@ %T ,BL%O&pa⴯ 20S $3q|R`0P0`0#@ 0DPIP> p9pPP`@PPi 妰0 R8 1000@ #@b>0P`@@`0p|! P0P A@P p `@@0S P@pPP-ࠝZ  0`0rPc ❒h1Q00S @k+!$$+@,T%8&TDl+6,%%%%&0+5&&`&"N&A"ؓ++&++++_ P+&<+&L+$$'''''0&&$(y(()/) ))Z)1z)))+**E*D%) _ `+G*i*|*+*?, +@B@k+*!++H++@,+@,+cP> PG 0*S0 )Q<0-S8 QP00P0,0 /R( *R0  0Q@0000S!0 016gP 0, y\0F\yP 020SyP "` P `P t2ߑm Pnԑ000P }P P  c"qoP80S S WO @80K/CR032 V 0S|"0 0 ڷW5V6ZD Z4 0p#2Sm#83Q0SQ?0!<03$ SQX3P `Hᠷ᝷0SH40A {u00P 00S0xsl4 r|00 P 00S& 50S004 o0st4 @ 0QP `thf0S050o 52S| % R 5 P ;5P P P Eq! 55`0Əs 00@T@ @V  $P|ʐF0 0 n 2 R@ F0"0C?o2? F ""0A04c0 S ;S0 VLBP 0 R RT L0SD0S(0?d'"( ,0< R /$ $ T á @"͡<἗<P r"@RD á 0#PPx#Pp0S0S}H80Si#@P pѬfT(X000 R0HL0$ 0 p wx'xl hhl pt pSFpt P #P U 8 z RP90S H90SL9DyP $80S @DTʨ90S Y~ 0 0S$8 (PZ0S= S E,#J : :`00S0T0S= rpq\J  #Px |Z LAP  W` b:0Sb: Q ]* Q0: R:# 7 ;R/sr  / 0A3/@pl;@X| ; R0 ;Q;:+0 0 S |] YUQ"0S,D< 0R.QVB^E\0S |000S u000S n000S g00kލЍ0S 03/0S U00@-P @)7P  #7P0P : Ѝp ⷉ`P G A7P 0 FUhLP  Ѝ@^ 0S S0S ( 60PPk"z")+%s"0@-M0h 00P P10S 0S00 0 Ѝ0   @T0 S 00S 0s 0 :4P 0B0P R  0 o@T h?P 0|S ᴴ00 0S00 0000|++  @k+@++)A- M@`p /00000@P&>0P/S:S X>@ဴ Pr/D :/p$0 h//@^B@P/:YBpP @^P Z Ѝ@/000p0 @@PWp@00l0@@DcT@@00@0CcS1S@V+B"[+"?,PP00/@-D,0 @  000C@+Pm+@-Cx0 @ d00S X0X0 p Z<0000S C@+++`+Pm+@-C@`00S T0T0 p 68 10 10S C@谓++`+Pm+l0 @- gX00S L0L0 p 00 101000+++`+Pm+̮+`0- lM@ BDd .800 p 8+b++dn+0-@lM@% 00 00 0rS sS phd ].\d %.P00 p 0T(d +̮+Pm+@,++++dn++@-`PP@ 0@s8#80@U 0s8#8000@(B(2b!! P VU 0A0T0Ѝp00CS0 S0 S 0 /{O-TMxp|W0ʿ0? p00p 0B0`P0V0W B@0 @040SD H 8PZ0S= S D0 S00 J@P(B0S B0#S B|0Sp `1 R R 0Ha# q4Btp uTЍ ? 000 $@0 PPqB0S mB0#S@DT|0S ld@"\94$0V 0 `{#M"00 "@B++O-BM MhEPdP$P Q L?0a>0 PPP0p5(`p 5 P<$ P@+40S5V $ 0D  30XD S00H00S+( - 0S 0 S     R  T!$PP$p 0 3@P$p ij0tp9# ap0tSS 00   00Bލ ЍL3@@s 30S VW@@cA y32 0f cW T 20S 5V  R x" R " R W WSh2h <2v02eW @2000 !00D 1#0U10S CdPRPU [ 1000P T)T 00P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V0     0QR\@\0 RZ P :/ 10 YS P 9/0F3Pm+ ?,P+++T+++++d+`+?,6,$,&,+-A-` @T 嘊0 ЍAЍ/p00$  Pixh2l0 h ;oa0S@ P 5/mꄙ+(,?,Pm+ J,d+M,O-FMs M`@ ( @;? 7? 3?0$0h30(0$ 0H,@iK0P Sk@婲0 $43 Fލ Ѝ0K0 @,Q(b+2@@в@aGT  2  "K 0 PD0P2d Y@P h"hd?+\ ;+0S 00S 44 0d ) PP  dk@0S00?o 2P ?06J6D01@ @p  pC<1  D0(66S0d000 d0Aa0PS 0◉P P 00S x0 0|0lP@0H| @0|0`,@v0=`s+0+R,?,6,+,k,+m,,ps+,,+,+O-JMGMsn0p0얟VXv600S00p )9 fP徥X6   t60 9TPL嬥JލЍ860 00$0 97S 60SZ6ug50S# 䵟0S5 Q U 5R "P 0S 500CS\5|Lg00l=0S P97S( 5D 58%8 0SX0$000(00000 PL 40000Z40܀C XSX P4`0(  $   dT CvP 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 408'0P30S@97S00000 F0S  0 <p庤008',PP2 0 0080I 0  < "pd 087"PD匤 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S0,< 00 00,x1 !>P!1 R  D 0 0ZP 0S 0097S|0 0S [[}X  S[00000IQPm+ܓ++l+ps+$-D+++-++$+H++L-?,U-|--+Q-T.ho+_.---4.hs+m....// 2@-`pBWLM LЍ@ @pP=  9p7 0001p1 0S<0 |q?!(c(00 Q 00SZ=9Q ='/@#b?!"/Qp ]=0S Y=0#S 嫣P00+0(60 8pp >=0S :=0#S  pp 90S0 000 0GLЍܓ++P+Mb+/L/Pm+o/A-0H`D0 82V p R R B`R RB`b2 Q  ,'00EoE?AA?R1 $!$! 1 (!(! t1 ,!,! d1 0!0! T1 4!4! D1 8!8! 41  000d4@T X40S@ H40S@@840STPv40S4Ock3 3K c Ѝp30SCP PupPHd+ \3 4LS {P@0W2000 3 )bQ gP@$R000 0R0 0)|IP  AP P"@P  0 2$@0620P S R0S S @T% 1Ao0S3 1o10S x1 P5D10S  ,P01S0  0S PU P 0S 0S T01S\l(0 `+?,7,6,6,7,++?,Pm+j0H @,p0x0dn+ԓ 0+d++r00A-M  0 8 4 |(@P@p(@P@d(d $ \(\ RS D8Q  Ѝ 00-S0S 8 F7 @770SN0<00@0D07 08PPGEGWn@ E5PZx7,047P3DPPL7`@0 0wK-5P [(5P6Qx AQ ,0 p,0000/Qq 7 0S6 @0szD0s{xFP00<0Su40Sy5$ 0 0  n 00|S  0fpD,,0Sx5P5<0f ,,0S    5<0,0Pp,0PX0: S 5 L4 i00, 0D4Q PU>0 00S,  P4 440S!@%`4@0@@Sh4@s `TP@40S 4U040 4 (a 41S $ R 4P <3P P P CrD0s D30SP 30S 30S2P30S&Br,0p` VvU㨂c48 pcU|,00@ 800 04400@ 880030CS,0"p,040q402P001!P X<0S <0,3/0,0@44@f1 R0P80 SB\1#u*0 ? 0!$$P400@0 0 0 48 p 400@0 0 0 o$P0 ^w0#Y寞@(D $,0S <0,3/4]++@,+0+@,++07,7,dn+,d+ L `+&@,1?,+TH0r07,01H+\+?,31+@1@-GM ,$ @_̟_. 0 0+(0,00040E@PL0;@@P@;K00;00 +3oDD0S>;0SV 080< @ t+ RD00S0\ H0PLKNH@41S<$$3P $00|S $SP$/5@70SR 70 SN $ ): 01RS 41S $00-S0S |: xd:$ dD0S $ GߍJ0S : <0s^@0s_JP70080SY00S]9 9 p9T00$0S  T$ T/00Ph90S U70 S$P$K70 S$RP$ 90SD8Q0SPDPP?D0S!0S' S+80S 2(P  8d(880sS<8  01Pw00S  &PlGfQ000SP 7 H7 R0WCT41SWn$2P_x7(074! 6 (0p(0p 0: S &00&071S ' R 6P Ʀ6P P P F60SP $60S 60S5PL60S 0CSWD0S8 46 4 (p(B,Q*$͜$00|S Bg@$((0S$ @54! 85 580$ x((0S5$妜_00\%p00(0q(0P5P001!KPL960 SE480S 80(3/0(00=0L0S04 SDQ  40S 8 4R* qp~ `%$'`0x0)pr3X@$P\  0f EP$?D0S s0 0 @( 0@JP`\ (T000 0=PP sZ,pJ P @`@#'0 ? 0!%%P0 0 040  P@H0S@ (, pU@000@ 540050 SE1(00@N 5,00(00@T!000t 04\p@ TL0Da0L0 TUA @(, rp%P1 G1#BX嘛@PbL Dfn]00S 0 =<@ (0S 80(3/0-+`+@,+@,+++h+dn+d+ L 0/++00?,+//?,\17,017,@,x0r08&H+`+?,1TH0 +1m11ԓ /0]ꐓ+2QoP@-X@ P0  P 0 @ ꈙ+?,%2@-@40 ½Ѝ<3Q p@-P,@P@p$P @*&p@-T@P HPP   0R  p舋+55+p@-T@P HPP  0R  p舋+,5-5+0P |@- P@T Wp`W VL\ P  R/X*&G-@pM`tk/T oTP ЍGFT8,,a,1  CQ Q@*Pw ЍGz 8S 0S vP pP  0  @DTЍPp 0 X0    03/ $ b5+`5X*&5558 $R!R(R3 R (8 0 Q Q QG (-R ( R (8 "^'  ^ ,QQ(88S08 S08 ( ( 0!R/\^^00^ "^0 00Q8/8S08 S08/ላ+0&p@-H@H0 (8@08080$8P  Up$80ꈋ++Ю+@-A(8S [0 S I%0) P p p $8S 80pP\ UP 0S ,8S0N[ (8S 00CS0 㒼~0 `0 08  8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝp\ꈋ+5+&556"6  P/@-@P(6P /9.9@-@@0s,00p 0Co1&+0 0 O-0-KM0/ Ѐ|0 P 0 0SZP=9 =:k{J0`Y0 A8( P@ : Ak QPP@0I000$0.A++ @,@,c9Qa99`99+@,@,99999+40P@0X (p `l 0;{吚 Y`  ,  +0Z C00 0f#`  Z f  0`< <f 0@!  0` U  S  RS!01D0 0;f#;Z0S;#;0 d ,!?;#;0#5 ;0?;#;0@#5;DEѹ0(PS@Y $2@V0TQ@2QML"0 P EP A  Ak{H{7{j"d⟹Z` f" 0ᗹ`< <Lfp  # 0ᇹ0 0S@ P0S S dh#s@p#dn0S 30p ݵKߍ%U[0DEW@-V1X0 R0@D00S 8080 p @1@+++9-?$M0 0 v$Ѝ-4M0 00 0001P4ЍO-p-MM0EU " p4 0 P0 PU0( RPU4d" R 0*Pğ^ $0S 0sd0S $P <0440S` $$1ȸ`$S 06 "{0 A(# A0f{{zdWdp0᪸33Q-A`P N*AQڑh#d#A0 2f ⋸`4ß 0 R#3SPSr01D0000 m/fp0 $` P(0 0SZP=9 =:k{+H2 AP09ڳ A k Q 5 P;!%#3[QP q D d 0@!0f !/1`P0F|1p fR P 1*!3^2?^01/d!P00 P100 p 0S"%+0!gU8 `0Sf ۷`0 0p MMߍY@.A @,+P++0@, :@,:@,:@,Q`9!;6;9+|+C;9@,@~9T;P;0P Pv0  ApL0 A k{I{7{ZU{0P  ᏷pgP<<`~0  {`  u@-q/@Sm/@p@-Bd00` pd00CS00p ,P P00 @R0S"P7Qd`d00CS0*p "P \Pd00CS0p000S8A PA p0 0 `Vxp0 Pc`d00CS0np 0@S P,P \Pd00CS0]p `V0 0 *Pp@H@,1&~;I@,A-@lp`YP@ . PP O@P PE  P@OoB@H@,O-$UmM0S pԷEPd .0S mߍ0.1dPP0͵4P(0P/S SUpF Pd4P PP P4$0CS0p- P P P0 PsdL)P P )P d0p pP 0? lxhxdWp P 0S d0p PP0? wp P 0S0S d(g0 P P d00CS0cp`2`5V P Q82<0 0 dAQ 0D0 p1@S P0S!   Cb"c!   c# 0`S<1Td00CS0 p0 dL\00 p P`, ^0!S^0C0 hHwP\\ 1+;H@,;+;6,z;;;;<+@<_<<&++<<++0@- @0SОP  ?P 0  00@|0  pḞPX0 PᯞP40  0ᦞP0  蜪&9=>=6,C=O=T=00CS0 S0 S0 /1A-0aS0P0-P3U NP 00.S Pl`1h`L T1@P H, P0T0!0!00(1   U 0!ԵA0p000 00000P0 0p0S0000PTl0l0  @U x4 'P$0`TH++Y=^=+++c==+=6,6,7,=7,=6,,+ >| ==p@-@P | 00t 00l lP0h @Q0T0 L0P@D0@ y80@0S, 0p脙++6,6,.,@++$+(+++P0 @- <00S 0000 p Q+++>|+A-@2,Qp0S `0S p 600`Pΰ00000S t`0S p Ӱ0000<0uT $ k+p贓+++?,>O-`"BM |2MR0pB  h" R S4 P 04 SP 4SPP004BލЍ$Rg1+ B>4P/S + +  SP ꔡZpV0刑p00g00000000 0S P1ov@19 ^70@ R 100CcSppW00 0S 0oW0000 00僴 a$RV&uD-uPPeT{ P00̮+Г+@,+4+2>4>B>+?,++.>?,+l>m>A-@Q0qS0`00S Q`Ѝ0TSEP HP t0 R 0000@ Pl00}S0s00T 0S$@,'S H++6,+>>+&?,O-4Ma0AS000qSP Q 1S4ЍPH .P00tP00`c$P$TL %P@1(>+>>+C?[?@-0(@( 2^Pe?D,A-`P㧛dp㢛 f@P  `@P 9Z@㎛?@-@XP2,0 A- 0p0@S0`P08밀P" :P 0S 0"S 0S R00`P"S0"S 000.,H++?,?.,+0@-M M P  @$Pۍ Ѝ0Pl4/Sg# @ $P;0@TP/P@@O-@`pPV1@@P`3:2$`E-$0టP Y/  00#PT@1SZ 0 10S 0Q0 R H#0S*00 0;0 Ѝ@,+@-O)P0P0 @p mpP0 0SP0 0<)@Ѝ萓+ht@@,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C+ +(@++0@-0 00 x0S R 0Sh0000S b0C("( R@ S0 Ѝ Ꜫ&&-=7@-P@0S 00p p0ឮp\X@0S 00D 40Ꭾp( Ѝ0@  Ѝ0\+R@`+o@C-@㌐pA\`\P ^T1:00"\ \ L 9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR0%R0PMU30S2 2"0S0mPE C_o0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^0 B A R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@PL0G RS QK 0TE*0/S@*0< QS8*09S2*+0S-*> @ S'*000GS0P#0!괓+@6,.,@.,.,/A-p`P @WqP0  T  `00T  !0@ R   `FVp`00CS0 X PpTD000`000 T00@@&@G-PȀ` 0帠@ThOp 4 00)a@x0@P 0#D0D 0 P 0 Ѝ+?+@@&++O-M M@ P"<` 00\ @3  P`'P # \ 30S)  PQ PUP ᥬp&0F.@00002&P |"|F&F@lލ Ѝ bpp<0\  Up \020(PS @ წ(0, 0/(0, >pQ&0$S,F␡0I00S f0h$Q000SZ=9Q =*/@#b?!"/E p5]&0S Y&0#S [R&0AS  \0 0 PE0 0Pp 0S 9&06& 0 psP0\ {A|P%&<00Ap+AAJAP+MbAAp@-@P<p@ګꫪp@-@`00CS0dpP0 @ %0S0`00%0#S V %00p0 PA-p@`pP0 @ %0S0`00%0#S V %00A-@XP`p P  P0S A@-@iP A@-lPA@-@%lp  BP@-jP9B_BA-0hMPQ@00 00 T  40S P y00 P p0 0 0 PtCcXY 3c0S @@@ pE    P @pRP@ 0S  @P@  # < P@ #T0S @P@p #0SIHn0S 9 ,00 0P YP12 qCA1 PP 00 @T y |# P ה0 0@T j m#P ȔhЍT巭[8P@Q T#T 11@T0 0P`VPP)000T 00 0P@T{Q DP@+BBx+++BBBBB&B?,BB.,++++BB+++.,.,7@-P[1 Ѝ0Q0S 1 1?Pʔ! 0 CRxA R Sh10R P1P 0S8S,1 0{P 0S 10S 0 0@@P 0 @0@0 @0 $@0 )@0 00S 0 S?,+6,C+/C+̓+8+2Cē++OCiC7,7,7,P7,L7,,7,(7,t7,p7,7,7,ؓ+00S%@-0M@, a"0 +P0S8lmv@0Ѝ0@lГ+C-A-1 AލЍP0 SS  S0 0< ȠLȠ\ ᦦp 0圠0CZ ᶢZ <50 @N,DL,Q,P,eEP,Q,\P,E, kE04&zELM,P,gE0@-EM,P ⤣P=@P4Eߍ0 ,PU  幢 ᤢ괢 x0 <  aTPl垢a 4EEEE 04&E3O-PM 〣@ptH`l`Y`#P3P WUPE!,cP00CS0' p 00R0S kP18C8S9 P%cP22l18C8S  $Ԍ0 PP 1 P8C8S  P < P^S,18C8S / P 0 S 18C8S <18C8S Ქl18C8S 00 l1 ۡ \1/ R L4 U 118C8S WpG(㈃P`9<18C8S0 㑡 ЍS R   RMP0 UA 0QDDP,Q,eE\ \P,P,Q,04&N,gEQ,DL,EP,LM,FzEp@-BMd,@P4P1 HNa^,! 1  ]PP3`1 P* T/%,00!0 ᠡ0  0,P SH1 U hUP 00  000C 6&`@@@P0 T0@0?o2/SPk0SPP54ЍP,P,LO, K,T2&xL&XP,LLP,PP,N,PH L(K,LL8&KKK04&P,L&!IH -KKKKKLL%LYLL @-䶰4K,@-@M h  \0P0 H00@10S  10S0S@Ѝ|P  !00S0@P~0 00S0S 00 P0P@0 S0900 M? 4K,XP,N,N,EM t A-U`V7P@ @Pxp l%0P /Q4 ]yP >{pP@uDN8e0S+ ,5 $5 @5 5 5 R- 5+ 400000@T , P004@Ѝ0400/S@NP w w w ƝTaHa@ 0S{Qt0S Z|p=0#S|sp#;00S: 'y`P`|` R  V \3Q 30Sx l: y$c\3P0S 2Q P o2: @xP2  : xP2 l!: xP2  : xP2  : xPx2 !: xtPX2 ,!: xXP82 NP,ANP,DNGNP,JNP,@-S( @ z0 %uuqN& @-0S ㆜㑜@L,tT@-00CS0p0 00S00&@L,@-@PP- j@L,N LM, xM,0@-M0Q@00 0 v /P 0 @P00CS0ep0  h00S0@oЍ00 0 P 0S*000@L,H N&0Aq P/P//00@-^@\P R NQ | 0\ P0\R@ @ 0$R ^ ?M,NPP<0  dÅe"ÅP^ @?d" ef"/@L,N,p@-tp@pP 0TSp 0T X0h2Sl@՝ T 0T 0* ˝ @N1&04&@L,NN0@-4M@Pl ńф 0<, p"lR < 0 2  8-C8 S  0"!8( 0B(0R><r> 04Ѝ0@L,04&@-`0S@ P0S 0000q20\@e{@L,NN0s@-l000Ph@` R R l  R  R@4N03/ЍpQ P04&@L,|1&NA-` q QAT 0SP ᴺ@P00000P P0 P0 xP hh ᭝\0L@L  "  \ 04&@L,NNOO OO&3&N,00@-18C8S 0P ㅚ04&Q,(0( @-0@ P,Q,P,p@-BM` P@0 S`0018C8ST01y0 l0Pn00x0 ⽘BߍpB/ BR 0И00P Fy0001P,04&PQ,P, 0?o2 0/04&H-AM M0r0$0P0000000@00 ᚘPڶ0 ȑ ፘP0SS WS BS 0 +}P  Tcp0S  1 0S0Y` :18C8S ؠ0S Q     |P Y 0@^S00CS00 S00 P0SP,O N,Q,DL,04&Q,p@-PH@P@pP P P @04& 0/@-遘o/A-@PP p 00CS0 `V sPPT"P0 P00XA * 0S P0000 !0S0R 00 PP'PA-`AP0E!Sq p 0!00CPPSJ0`00CS`0p S X0 X 0P"SP, {0SP`0P0CS`0p SX0 X ! <X!`40 0P0 Py 000P pP 0"S00PA)<0 0P0 Q,&P8&4P7P;PCP@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 EPA-@t P0 =`P`PP2 00pPF 0P /V @P  @0S@0Sؼ )00@[ PP?WP PPP P 0!SPjPPQ,CP04&TP[Pp@-M@PP\1   @P`u00u0ۍp0 P 0@ 0000S X 9  P00 f0 [P04&rP|PHO,~Pp@-`@;PP 0 /Up( P\@pTP7@-@P  彗 R 嶗 㲗@T| Ѝ0(R( d0PP @OP ,KP N,Rf@xt yt RQ,0@-M@@0(@,0 0 t@P Ѝ00,x0  PPP P0S 00@SP@] Q,04&N,@-銙(,W.RQ,@- @B' <;mP 3 傕0P3P xat_ h \ o 堕ЍN,xt yt KRQRTRkRf@Rp@-0M`5PPT 1<18C8S |1xAx 0 9 0@ 74R,P( /0F, R\  $ ;P 71P` 0(0S q=R 00FS0xhP0Ѝp\XTP DԘ04&RN,8&RRRRQ,RRRRRRRR0@- ֔@6N,R-@-yZ-@- y0 R   ЍЍ/R,-@-~Z0 R   ЍЍ/R,A-ARp`P@1T ᛔpP?`@DO-dM @P$}0P 0}0P0 0 880 0(P40P0p`,@@0,@ T R3 U&T ( 0 (d(0tp ` Z0 000,@ @0_oR,@ 0T ZPPU <v 04 JR (0 R 0S0b 0S  dЍT3 ` 0@D(0,@5H00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q p >W : "80(,PP (J- R 8 %Q  R P`(3c8@Ht  G  $P T0`000S(3 0(408 TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@T?SMSbSS}SSR,SSSS+STT)T?TWTxTTTTTO-lM($P|`M|PVPP*8@ 02 | y  0<0hh2 @0`2 @0P 00D@P 8%@P  GPp@0S$("P @ _~]~[ lЍH<`@40S(( В Px  , F, 0P¯4 p0?P00?P<  B,$( ( ,0pRQ @(S<`@ 0`DP%<0%800%4000 0'<0'800'40` 00$ P$@?STX6&SUU!U&U5UGUC-pᔑM00PS@ x$`0` 00qp@  N?sp$_@`0 P 00: pppppW0@ @ Q@Op`6t0` }>?@l@ z00 S @.  C8 xЍC˕0X6&XUUUU8&A-MpP`ЍAh}0@: SPPT@ {`P00S 00 0iQTP1 ˑp P PU0DsLS<(    UUR,UUUO-]M0 M-SPPP50S ]ލ ЍOv/g]ލ Ѝ@pP$ 00S0W0S 0S ` zpP   @px{0* R` D RP [PP0gu j`ҒP bX0v: S+ p K3 P@`P|3| K"P ph ` 0 0P:00 08 0S0S` - P`f`v `0S 0 4P |V P `z{ R 5<MRK ːpP Z HP w!1Z[  0̐ .Y᫐p`l: 0S'HQv00x!0  P: b  0S- ነpP  W ]ލ ЍO{P-Cጐ 0Sᇐp|P P : R S00 R0S YPPhSX}R,X6&U VV-V;VgVbSIV uVVVVVW:W?W&[WdW0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T000@- @P@@ bP 5FP00S D00S 80 -F!UOX^S,P,`,\L&@-HX@-%zPp@-P@{p 000/XS,p@-P@0-S@@p GP0Tpp0p@-@0@MS`P0 @  6P@ЍpPU P$ r00P6&XS,XX@-@P @F(00S@ XS,p@-@PPp00Spp@ XS,A-p `P@P000 P P0 0XX@-@P P0P00S@ XS,p@-``MPU> 0S; OP2 @@?T/  `00 @ C @ @ F00 *S 0 000?0`?-XP10EE>P  `ЍpX 0@-$M8P0S 0@?@$Ѝ06&0 0/XS,0 RXS,A-@0QS`0@S` p098p QP@@qp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@`,ĝ,@-P X00S S9 (,0 @ T `,p0@-@TI0 qp0@ @}01p`,ĝ,p0@-^ 9 @ 0@&)60 P@ ^@T`,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/`,P0001S0 0/6&7@-P R I0 00# Ѝ00R 0@!"0@@qp Ѝ0@R?`,`[0@- 00qp Ѝ80098<@ q|/ 00\ /`,A-`px PP"@ 9 @0@  P09   S 09 r`ALS,`,@@A-p`VY@  @ @ 0 qP0 0y0 VT  00q0@A `,LS,0P /`,\ -P0S0@  / P2:1S0BS /C-@4QM`@|@0S1UA:ЍbS9 .S8 00C S 0  ? OP ~>cS@U:s>0@0CS000 000C/  0?NP @@@`,a,u[[p@-@P 0SP`pPQ /P@dPQVP4>|P0S  p P6&7&[A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o21@0@ 0C^S0SP@u0C?o2`,@-TMrL@DM@M<M8MTr,3,!4!!!8!!ap@-Pl@P XPpH~Ppp@U p@PpbaoaqaO-MMp 0@P! I3P0: SPF`9mV   FP  9@PP1 &ލЍ R R R00 0P @I P  )PP @  "PP 0"SU T 0S0C0 7/  FP 0mS {a}aH&aaI&aP 0j,s@-@P`p 9 00 B0Ѝpp@-@P` R p0S ᭅ`@a@-P`( p@0` G Ѝ0b,@-`@ (8R808Ѝ< 0 CS  8 0C 80b,8j,p@-PQ@`1 0S S 0U P 0U aVpP0S d W$0Sp@ Mp@ p@DRpH&aaa(0 ((((8 0 ( /0b,H&0 ( (( 0 ( /0b,H&C-@`p0S Ѝ @P0S 0S 0 ( ((087P 0 "PP 0a,0b,7@-P@@@@00S Ѝ0 NP0b,@-PP@X9C`8 R8 R8S Ѝ 0p 8 0S087 80 8 00S08{70b,S,@-0@M0 08S0Ѝ0S 0SP8 (0S8p0`00 0C?VRh B(08 80C 8 0 CS 0`0b,S,@-P@`8000 00C?UR 0 R00C8HiЍp l 0P 0e0S 000b,S,s@-@8 R  0S0` (0 RP 08 80 8680S Ѝp0CR80S  20S6080b,S,p@-p@XU P8PE``VH0 (  p8Soppp0b,H&080S/@-@0b,p@-D@0S PX.8 P 0( pp0b,H&p@-`xP@Yl0 R(0p0CR0R:(0 ( mp000b,H&7@-@7@P@P Ѝ0 AP 0P$ /0b,0S/0G-P0`Sp@U @0pP0 @@@ X xP00WjUj @ iP00舏,P R/.,@-4@$P(0,0P $8  0b,H&6O-`0FSMPp(h- (R008(h8! 0S0S Ѝ0S08R00(h8PW08R0x88S08"SPWP Е$(0?o2Q0 P`Pڐ%0@S0eP 048XЍO0480480488080 Szx0488S0S S 8S0S S 048804880S W048|048ЍO048ЍO048n0488S 0S S8Sb0S S_ig8SY0S SU048~Q04880 S80 SGrp80?08<$0X485(pPWxpG(p( VPX  DPP fiH80S 48PS8P i0880 Xt28Q V 0d48 #Dh  00 Q XPP@bc̏,,,cL, c,<,I&cc cd0dS,[dhdwddlcbdȏ,ddLS,ctcddd S,d$I&cdDk,,S,l,,+U@  U !UQ0-UQ00  \@0#0P2 PR 0 a0CS00 0-P  00P= 0Sa0@S @P000S. ,YP& 0e`0,0[0@0S 0! \,P 0Sl-P *a0ES000 *P *0 /E: 0*U @U !U<30S 97R0 <430S07S ;07S 00l##5{.10@S @0007S9 P 0S S30S PP d0S7 40S{i 0#0CSPwd ;P $0FcS000 e`!0 S $0!R0)?040S  /0 S 4%0!R0)?0 ]!R00 !ı50S!R0 !R0 0!ı{ x5 r5 !R00 !ıf(60S!R0!R0 0!ıT !R0)?0H60S 60S >`@0 S 0/70S y0 S 0  6!(gR00 !00Q 0R eSd0C0<0S d 0!0<0<pP0tiP0b(`Q 0!(8 SXPt3IcG\80S0S]=B X8@ 8D 8H  pP- I,9000!R0 0!ıX900d90 00!R0 0!ı 0< `0000!R0 0!ır ` `<0P 0P0 0!ıP *P n P !p R0p;p;0!>P }0P0 0!ıPs ! R0;;0i0P0 0!ı=`P \ PPXZ=qpT 4< bP0P0 0!ı=`Ph A0P0 0!ıP 5 391<`P.)P #!0`0,`LPN(P 00,004 =0=0S:8-T V _@10 |q)PP U U ?Vi!P0 >^PP U U {!@0 NPP U U G!8>0S H%:PP U U.P0!0P. %(P0 0S .00S>0գ?00 ϠR0  B ? 0 S /00S0?0գ?0/0 H 00\? p?x?0S080k>00S/a,@-@0 S!0O-S`MPp``@ pP Z:T8 00"1 0T S@D0X0@D@Ѝ0  0A80 0 @S/o" R 0CS0 Q  S P R 0T@180 0P R* 00P x  80 `P ` [0J0Ca,O-pZ鰐X& RP ` P`Px` [ ``F 0R@ 0R U *0@S0S  Ppdp@-`R P@ ^0P @@@ 0ppM-@Mp @00PC  RT0Ѝ `? `<P ?0? `P<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P#0 ꄏ,xS,Dk,p@-P\dpHPV@^8^LP gP @P%C @@A@@T AT T ep00SCBp00SBCp0!@00CQ#n0 DPp@{T ^gP 0S0^  PA0dP fP pip脏,xS,Dk,@- @ @j, @-p@+j,d @-p@v+j,e2G-pWrPP{ P0`rpЍ\@P 0pqp&^ rr?SZ ^0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*p S,j,Dep@-`l@PP ;O,;0XV@` `;D Op*pj,De 0 j, 0 j,7@-`P@ PyP 0S  P Ѝ0j,Po/@- * ЍeA-`QpP P P@P%U0P 0 P l @>]T @P 6/P-]eee@-~x 0pl l0P X H0 H <0 P0 @0|0t00SЍ0 oPP0 00qpo00@M(@S,ffp6&)gO-M40S 0S j0S@ T y P 4X ЍP @n Pp 00r pPPP`h`P$ P  pPPP(d0S P``40SWPTPQ ((@'#PP3`00FP0`0 P0`0 +P X ' Z 0doP% 20SP `DP  @' YP oY |2 d`2 p KH2p<20WF,b(2P 0S XP ((pP11P %0S (.1 \ 8P 3P l1 PZP10S Z 410 (0 qp 000Sp 0 k.P 5 R0  [ R 0 0P: p X ,LS,HS,>g;@@@=0 `mUU@UT ЍAɄЍ S,i!i-M kkP  @oЍ0@-P@M0SP @UU IkPS @Ѝ0@T@0: S *@{UЏ, L&0L&@-M@GkP͡00 0Ѝ0@-M0P@ kPh0  R\P0  R\ tu p0St00Ѝ0LS, k,k,/bh@-@P P0@/R@-@ (0@0Tb#@`,@-40 R\00S@+@0k,,h00S /pp@-qp :#qpP@ QPpp`,@-P&#P3#0 R/  0k,O-$Mq0S@P`0S\0SOs@HP`@100CS sDP`@ 0S"P`0vu0 @ 0尠00Rᤐ000  00 0h 0 00000000 0000P`HP$Ѝ`,\,S,xS,[,l,O-M<`8@p@PV t30Sh30S`o`V D3``F`V`utV-$0S 300CS QP ""]s"QP ""0S6 N` +20"`Pt0X 0SJY/Y @ Pi"V<"0 40 ut  20S1"0 000 a0 0 10S*P10S q+*qp@PZ "P~"P41Aw"P  "qp ,10S L"P ЍO0G00 ЍO,V utS 00St001 ?Q*)@P9ut`dxS,,,,\L&S,0k,Ԏ,(,6&Ti`,`,0,k,H00S <0P/000S $0@///0k,,,xS,'G-pP(,`@qP"V 410S(1`V``ut 10S100T T00 05*`%*00oᨂY J) qp00S@P W ЍGx!Vq V 'xS,`,0,k,,O-M`iP P @0P! ЍO !qp@PV00SЍO0Az!P00 0@YЍ!pP@PX p 0Z qp0 @P`,xS,ĝ,A-p` qpP@VЍAw   0@2Ѝp@-8P@0SPpUqp @xS,0P  P/`L&0P  P/`L&@-P@p@-@PptP0S T0 0S @ 00C0RRp@R  B 0LS,`L&Hk,0/Hk,G-`$qP@U P9 }Y* QQU&8w@y|0 "0XPP00040000( @0@000S < 0P00QP   0`L&Hk,P/P // / /00//000////0/0/p@-@4PPP zQ4Pp4/O-M cD\ {rPX 0000 0 (HP 0000 0 (XQXQ> 00  0 'P*Ѝ=ЍO" <O-4M(0PX0@ ,0utA @P4Ѝ40SU400 ?QQ('@PP@dp00 0lp P7sc  ` V0,? cp` P P@㴣Pv V}, `?V@P,0S1 h3Z1 @P'L30pW05 0$ `P" R $0 S S`! P P  `VʏZ: P `@T_ @P[ |20S  P0 X (0 S  $PO 20S @0  1 R00 SA> P Pe p 4ЍO V  P0# 0PB R \A0 Pp``@1`@P!Z 0 0@P_ V V@P P P P P@Put 0~ 0@P_|l00S V V0 0 0S j@Pw`0 0,k,`,ĝ,l,,,,,,7@-P@P ,0 R  000 Ѝ0l,O-`Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000Sd  RD = JZ* P+R( PE0P*!H(P3% R R R000#=R00S 0=S#0E0P0 S0PS  P Y PdP  PP 0S 0P iL&Lk,1]&r&tvC<!$0 RP  /hk,0 14/hk,$ 0Q/P/XO&@-w04 ,    00\,\,\,\,G-P匐剀I@IPT`ppP @ORDk,FG-@ $P`P,$bnpP] `l    @yz  0Z Pp@ ;p Tt p@Go }80 } pc<>Dk,C-`Gqp pZqp@@PPR.Y T0 0 Ѝqp 0 p 0a0@S@-TA0@S<0'@ Ѝ'P( #P   ,,p,.Pp@-9 $P" 'P= P !srp p^P 0 &- P& ~?06 pPxd0`d0 T0f&@PAP,@ma006pȪLS,,xS,,G-@tPp`4T#0 5T Ta0'000P0p0 ;?@6T` P'0,@-o0@-MPh@P  $ srxЍ08!P ?00 0 &LS,,@-HP!sr@Z 0!0 &,@-R sr @@@6P0&6 >0606Ѝ,LS,G-6@PP`j>T6k.sq 00P6 >06PU p>P0ЁPP  G P ,LS,ȏ,@-P ,0 0R  LS,ժl0l 0@- ^ @^TSa04S '005S #LS,,,00@- @P QA6R 00,G-X@pP Pj`PL>`I>p6W @,00S/A- M`-W@pqpp6W @ Ѝ 0 PUP89P P 0  W|,,@-  0mS Ѝ 00 Q @@P 0 S# > PP0P`0 S  Q0 R pV`PPp =p00xS,17@-PU0P( P@ Pd0 Ѝ000S@PP =P7=7 Ѝ0@tH00S@ Ѝ0@ 0,0 0 S,\000H ;0Ѝ004@P wꏯ,,P @P/i 0 /᫯ S,P/00Sꄏ,0/@-@0SE耏,0/@-,@0S0 0C00Ѝx,0/@-,@0S0 0100Ѝt,0/400S/(00S/@-qp@h,LS,P@- 00@ ^S00S00 Ѝ0 \&@-P4M & @"`P@@0,S p  h0S  0 ,R 0x 0X0S` 4Ѝ80D@00$0P0 QP`,\,,2Q\P0@-MO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  2@NL,800S ,00S 0P//ď,\,`,$0P/0 0 0C/̏,xS,`,A-PU  @Ѝ`p@y㈀}P`V 00S0\V0S 0S@`W P @`$V00̰,@-0S08 04*P( Ѝ * P؎,@-Q00P 0R C Ѝ@- d0,,P/0S/P 0  //0oP@-/2 0LP/؎, 0@-L   Ѝ؎,̰A-`@Pᢼ0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍfL0 @@@Pp 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P 7⍼79P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PlX   00 p @ =RP    B  Xp00aK[0(!00CpS0 0U ?o200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0 fP.00S ؎,,,TS,pF@-@PM @PU`p0@ uUЍU  j  B U R{  0L"00CS0U0S U3/U@`y 0 LV00SYS_U 0 1  U# U U 0?o20 0?o2P0U U U W0 0S00P0S000 P W 0  0S00S000ESU U U I 0S0mPS000 00SH000V SرİDk,Jnp@-P`@000C S0 ` 0 B ^ ST00p pS 00 000S/P/,,,@-XP@PL0  0S0S  0  03/$@ꉲP&,, 80S/S/ 0CS/$P&O-@DQMp0S [; 0S 00 Ѝ`V$P  I 0P  AAQ-P $YQY0 u0 p@@OoB0 0S `0 0S 0WppP& @-%PP0$\&/@-0M@20S4凋P 2      J2 0S@ 10@@0Ѝ! 0R0< $0"1 S 10S 10S|1 \11S(  I2 P!2 R@ z$10P!@0000 R  RI 0000S@ T0 0S T`0 !PL 1 10S 1㗹 0Ss 0#So @ ,$,ԝ,ĝ,n,,\&`,\&H,@-$,@- Q+ Ѝ@-P'7`ᕾ@ᒾ@@ᕹ 0`pL Ѝ4@-@7P ,;0,G-` @$pP 0H(S%0 = P@@@0^3#@- d 0 Ѝ,7@-2"P@?@ Ѝ0@B@-<0?B3c/ ( 0 0 !IЍMb@B404@-@@T HP0  \&D,Dk,@-@0@\&0$R/ $嬾D,p@-@8P 00R:0 @0 $p\&C,D,p0s@-@@d`D \0 Ѝp坾0U4@5PP<ĝ,D,Dk,@-@@PC- `?@P!M0`p0PƟ0 0ሽ 0 eT-00EPNH4ЍEA-PX 0`p@ @ 0i0 P dU-  D@C,4ЍEO-0M` p! 00@C QaCQW@CACQ7@C@tT?0! `?0 !@P0PX ZЍO-PMpP 00@C QaCQW@CACQ7@C@tT ?0? pM ?0 ?@``PZ UЍO-PM`P 00@C QaCQW@CACQ7@C@tT? 0 0 `?0 0 @ppPY UЍA-0MP@PЍ%P p@0pnP$ cP& dP %PsP xP   Ṽ@`0P`D@0 0 M`0P 0A-P@`p5<[ 0 $D,@- R$00S20 P00S@Po p@-@ 4P0 4孻P}p@ V00S뼼h׼d0`l`P{밼H0@뤻80@0@S(0 p@ D,,\,]&\,S,Dk,@- 00 ЍE7@-@PP Ѝ0@(0  B0~ Ѝ0\&vp@-@PVP %@MP _800S00 QTӶp S,Dk,@-@1P0pSQ 4000 @=U'Qٶ0 0 R 0?o2 `=P '2W Ѝ@IP 2`2,p,S,@-@P 200o/O-|MpP `@< ᏻ1 Y0 \0ACX 00^YP P0@     0 W" !Q0S|Ѝ@0/0S00 0 0L P00CQS XH 0 R 1 @0^AA ,/p p p D00/40@$0@0@T,xS,800@- ,00^ʎ1C0@ @xS,T,@0@ 0 C\1/0@-LAC\@c0xS,T,000@- $0@0P0CQ0 @xS,T,`0 0 P0H0@-0^@P C0/T,xS,<001P/0 R2:/T, 0AxS,0Q@-@ q1!0sr X0L1!0sr $0A Q T,xS,A-pP 0RX@` P0c00yvt 02C!A`ЍxS,T, 0P0PP@/xS,0 :Q Q .Q 0?Q  \QQR/ R//A-`@p0P; R0C @1@C" $00000\,@p@-@XPqp00T00S 00CSp@n@qppxS,@- 0 A Ѝ@- : Ѝp@-@0PS b0C0Spt 23p0PjS BS bSp0mS tSpp0000kDȏ,p@-h彴d0dP0`@S;Eⱴ ⮴4@N⩴b⥴p,,}\,]&C-$MU0`S@p`d$Ѝ:S/ %S .S 0 pU@0S0S ?S \S0S 00@ 0X 00~xX@KXBX] DX. @4LH,X؀PP6qp@40S(4 宺P40S N30S qps P p P{i P3 qp }P' uP02~mM P3Xq 003BH@6Xg Q0R 0 Yqp 0 O|2MP0t2t"0 \ P B B?ᅸ8(qp20 PP01P 1011T1P1Kf. P \1C0  0R0:P0P P[ڹxy 0RQ x0 Ĺ 0R0:0P 극lSA Pb ] PPP$0[P\,`,l,LS,,PS,`,xS,S, 0]&H0@-@@00SOoBҼ(0(01x0  ,,,\,]&PS,0l]& p@-PPp P$R@ @Tp `$@R@p\ @R @T @R \ p @$R \^ 0R0 P00\ 0/ R0 P00\ 0/@-@P -00@p@-P@T `0S` 0 p`ㆲ0@Ⴒ0000`S @@0@A-@QP` @$ @dp0W0 S 0 R 0 0 ]PЍ .P 0`0T X0 @P -0T0 16-`,p,A-p`@V  ` R P ( ^QPR(;P" ^ U!R ( ^ P0 0 Q P$^U $C 0SP` 0 00`Q!PQP "Q P \U!0SP `0 0S0Q  R \  P  RQP0  0 U A U0QPA00  @-oP/p,A-M8@0C0p`pGP4 ϦA XЍ0 H/o"^ R  ? 0Q 0( XϦ@ꈝ,O-$MP`T0pP@0L00SG RD L  R Q R*H)  H00@00000 0 YH  )-  0S0S @ 000 000L000`0C <P$Ѝ@p,0    /p,0A-@0S xPT(`V0(0l00Sdp@ i(`qp &Qt@00CSj8k,p,D`,xS,$1O-`wvB 1!0РS ЍO>00S 9PА@00CSD& ЍOѴU 0qp  L 0ZqpV Q "aP@ Ѝ6&D`,x6&8k,xS,p@-P@T <0@@@ @p `++@p,ꈝ,p@-PH@U p@\Qp@(0?o2(0p,%객,p@-P@ӹ p0$ 0P !U@p谝,O-M,0`70( @40ptD70<0<78 @$ 70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00$0 `000|60(0, rs  T0000S (0S0 00000S0S$Ѝ0H 0C000L0 " 00 000zy+  0Sqpqp0S`000 00S0 @ y40S PIUPe U 0A 2Pm40S 4L HE0|4Px4U 'VPR `400PP40S <400S0R0S P 4L0SPk`kL0PH p3PPU7  T  qp R#T0'L0`     h ` D0ND0P T 0P@TX\PA* ?* P ` @ PUaP 0 0`0hP0p`PL0 $P  000 00 L0`$00CS$0P20S r000 00 L0`p408 CPPI h0S8 Z5  `J!` 0C pQ0_00 p0S0' 0 aP0o 00 0S0<1YPPYPUp1) )0S0$0`P0S 0S < @B X0C  BS pa oZ0Yp0Pp0S,xS,ȏ,T,`,ĝ,,\,p,<,,4,ԏ,,0,l,Dk,p@-P@з < 0 P !U0p P$@객,p@-P@ḷ T 0P 0 Up PS @P@객,p@-@`PV0000S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp p訏,6&x6&,0,p,p@-P`uU 0S0P@T0 P@|0 pP(@~0 00000@pp@(0P00p,Dk,@- 0PPp,O-P34Mأ@0 40`p 0P 0 X0S`p$$P4Ѝ0 $ $X0X8< rq ut00T00S04\0`ut 200@_$0ut  sy00 $0Y0$P @ut00V 0S 0$0(00X00$00 0 P#srJ RD R 0E0P 00@PP; 0  Aqp@PN ` p%ut \0@P$100@_V `p000/V0V`p ` p @ P0X0  8< Z000rq0S Z0 YP 0 *qp`p000 040*p,k,0@-MP @tu 10 }Ѝ0@-0 ( 00S@p,0,h0p@-@mP HP0 pp000S(0SppI&p,0,@-$@$0S000r @p,t,,O-0,M "0Qp 0SGyP pC 00#  `PH Q ,Ѝ,S0S 30S 0S(0S 0(0v0(00P2 X`@PE?qp@P[Y8@PutTXPJ1\R0 0#@p HBHb0 0 0(0m0S 0S >20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@P@P 0S 00SL YJhG qp QP 0S 00S3 p,D%0,,,xS,ȏ,c0@-$ 00000S@\` ĝ, ,0@-$ 00000S@K ĝ, ,ɪ@-鬯8̵0 000O00S@4 ĝ, ,@-@P 㶵x0x0Sd㬵㩵P@㥵㢵㟵㜵㙵 S, ` 1A-@TPP0 ㆵF뿮w~{<:u۫0 @ P`p 0RW 0` ?00b<0 ,00SAEĝ, Dk,S,xS,DS,,G-pl0P` [ @ ɰP 0S 0S Sȝ,A-` pPD@9>%0Up0P */%p@-HP@T<0   p 0 x%v%t% ]&ȝ,O-AM,b Mq>pd%W A0 0 PP Pm0S0000Aލ Ѝ0!S  KPA>004S S S ჩ0PS  00 QP4 p0S  HH P? 0 ^R0 P\ S$R0C 0M00`000 \P0C R  C0 ]&xȝ,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c PU Y< 3T S9PA rPpp>@ ;8 @@; 0 $pmW $l R@ $T<"0S000P ;04P S@ w0 Pp 0S 1T SP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S Z P V? U00`0002ȝ, ]&&ĝ,&x0@-@PP P pP `P Z8Po8 ]&@-@PDP P @|1O-M0S" @`0 ЍOh8Pp00 0 Ppxy@`Ѝ00S 000S  0P @`IN 0 00O0 K# I# 0Sȝ,ĝ,,ԏ,\0@-PP R^0S @T 0 Bȝ, ]&\0@-PP R^0S @T L0 Bȝ, ]&0/ȝ,0/ȝ,00S H/ȝ,@-3LP |7Pw7P@-0ԝ,//@-L@M +0p PFS0PЍԝ,\ QR0* /QS QQ*/0000/@-@P "000000/0S 0C0//0@-  0#3@PP @0@0@-@ 0PSR? P  Q`  M_"` PЍpA-`pP@T@  G-P`"(F$,@p ᬖQP 0$ GdFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-`@pR   ?PP@PT*?P #SP0s@-P00 a0C@`S0 PЍp  000@@0 0 0 0 0 0A-^\^ ^Q[\9[^V ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV0@Q@\\@0[T T nT  \TR  @0\004\p0p@- P0@S S R 4!@D@QV p@30 @ Ꜫ&1C-Qp`p?Vh0@`P0Y 0 ,PA \Y R T R 0 0P@0   [R .0B0S830 00]RT[T@ 0QT 0QST[@[T0Q[S@$0 R Ѝ,h,0@-0M M00P/S $S! +S00! 9S\S @P 0IS@P p00ۍ Ѝ00@00 S00@O-@T0tS bS rS aS @{S000pW G`p 0S0QU 0VrP 0 0 PUP,b`PG ؝,,O-M n >4Mp0 PIW ܍4Ѝ000Q 00  R Q  R  R  R @    0S 00@0p00pS 0S @P#S ;S T00 P00@ 0P TP  0S @,SP0S 00@TP  0S  00@0r0W00 r 0@p0ST @;S }S p j 0R @\R 4 ZPU P @ Q T ,M P <,0 \\^ 0 ^0\ APP00T0I S TP0S 00@ :0S00*3p e 0S 00@0S 00@00P0S 00@X0S  @P0S( X S 1@( RP0U0 P  P\XX $S I0Px $^P I0~0 , 8 SR0 (  S듎700H00 PP R00C0 0C S000SW,, X`0PpL\RC [D Qx␸0S <,00S ,, E 7P00A S 0( [0^ 0   0S 00@MgQ\ R9QI0QcQ Q \[08 9R/RR0C8 &R$ +P 808\R \ 00AR0  S S00( 0  \ Rl  ;QY IQ00pQ wQ$ iQY 00Y Eᮭ0"S YK  0S 00@<,0 [  RR, S 8x mS30S # 2p p  U@P IW[ 0SD @;S> BR0110P\SSpE ND  PP< , @P 0S 00@00 Hpc0 Hp Y20S!000 S90S 0S @;Sa }S0 @)  9099090H 0嬫 ⨫p000 XH 0S p UJc  pYP9 )0     囱!$R1 ! 0⸫0$ (Ⱛ9 09909 00Ꜫ&؟,ݧ,=8]&Nf/', C1FSZ؝,`l,ܟ,'U Ej,&A-D`@@PU@Tp00S QX0T0QD0 0pS0(FaP؝,,T,h,d,p@-P @kQ000P @p^&@-@]Q   0@0^&0p@-PPUph;5@P 00CS0sdp ᥇#dp0 d,A-lBp` R3 RQ R P$0SV0(  R R 5$0 P,ZbP0 P0!3QP$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0c( T0R #R nR   RpG QT000(0V0(00P R R0   $Q T0P $w (0V0(0 00  T0(0V0(0,,@-|@X0  0S 0S00CS0cp Xچ0  ,G-`DMX0pS00S 0S a#3X 00X 90C\ `00d0弃XP 00CS0 scp X奆X %pP0 W0 XPލP3 cp0S $00/P 0/P <p4S 000p0p4S \2PP bP &00\0/P|p0`0d0S0000d00S 0@S0k 00P  +a0   0@ @a00S +婕+q P0  a0+⛕0+J◕UcP0Jd0t!PQHy2 P*v0\ PP b83P\a ( p$ ]/\0p !W/ 0`PS(00q3PX1000*0\`0P l000S SP@  0 l C(00(01,&H,P,P,8&@Xjv--AMM@A> 0$ 020 @0 `,,x--M MA>$001( (  0ۍ ЍЍ/,,x@-@P`PP  0&p O0 & ЍP,@-M Q qM`0S000@03 0@0S  0/` 0 0S S ` 0l2@P *0 "2 Pa0 00ڍЍT,<,@,@-P@  Px_ \0 P`p `P 40P S x _ ЍT, %G-pA嘁0 0`PU , R:(,N00( &U# \U   0 R`Z &R\R`P , R:(,N00(P    "pr P qu PE ,  R:(,aN00(     0T,&A-@P p0R`*ANW0 0  0P P O-0x/xOM00lPЍ080L?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0 P0 R p>0R*ST>0@oP0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0S@=0@oP 0 -=0C>S00L0 R: L M` 0pš00c0800400S<>x<8 00 `\4 00]<0S  V +H0SP80S4PU 0`  EP0800A E4 0T P !0  004 0| 0ll  0L; 8{40 08;0R0 <0p 屛0P 0S P 0( -P2S 0 HE:`0C0 0S0`V: $ 00@ \:@r0S m8 0] H0 $P y0 H$0$ [0`V: $ ` 0 0C 0 P ^0`V:T k `0  Ꮧ[ p X0P `V::0P0`(CE 00 aV :> ` 0 000 SH88 00 0h4 00Q<0S  JP,0800 0 P%80S!g4 00+<0S  $80S04p  GĘ`P <000F pp40<  0 <0S  V 0400<068 00 V4 00<0S  L0 R: L K` 0p]00p[  R  Q 58 H4000  P 04`Z Z Z000 G 0X0 00 V~ Z0 0RP  d0 >0   PQC p0V `XOdH0p0<H<p(0000S \t4 00\<0S  Up P[ 80SX0sFD$D*p@0 ,_\Q0 0  0p V0`0  `=0P  0 RS0 0 p0V R`0 0 PP04 0*4 0P *P"0 000S 00P80S0s"*p 4 0)40P, )P P RH0t0`<pL0p<80S4X ! 0`Rl0004 0V*0000p(pW10 (W0 \90H ! R 0墁 0P pW*0$ ( 1 0X`xpH0`h0<H<h`x0h0E0| 0->,T,,؟,<,,2,8&^&4ht@S<@,?Yl, sv,&,w<0 0R,,0Q 0{Q  ؟,v,p@-@P`Tp0wS {S sS 0p b)P 0 H#[0`@p S)P `sG-`prJPNPU00[01 R  @-PVAGWp8!p!Q <0A\S00 0  Z0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: \pP 000BS Ը,|0p@-P@`T P :P, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@Ը,R-0@- MMPp(@P X JZ C(p8BZ+ X( Pq(ۍЍ0H0  BR R R0- /&&@00CS0 S0 / -&@-(A՗0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@eܹ,0-01S ^00So^ P0\ S0S Q0S R P0S0S0 00Q R  h-ܹ,0@-  `Ğ\ @ T\    %R    ܹ,h-p@-TA0 5S <0S -0,!0<叡aP0U&!0! R8  (P |0  ,P s0  4PP ~p@㨅00\P P D W04 0QP$$Sph- 8,4,&p@-@0`  z(T  r+tGh p<dPPT p ፒP000ST @&&ܸ,@-@P JP;@P @0?SP@ yp Ѝ/-P@MP 0S SH8 0S 00X@-ݡ +(]&0@-@<TQ T0B0 *0001S R0Sd0d@ TPT T@0$D@ ,*T ,  $@*ܹ,&h-@-锡 *'&7@-@Pᩡ  Œ0S 0@T 00 Ѝ0蕡0"S sr@-@ P  p WЍA-<0``@c# ^p "RG ^<0c#N 2 R^&0 0p2#L @ "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L  "L /0 0p2#L "L /0 0p2#L "L /0S00//00//H0H 0p@-@P@!R0 U0 ,㍛0P01p!--01//00/00/00/00/00/ 0  /p- 0  /p-00/00/00/ 00/00/00/+@-@қ -00/@-@ě- 0  /- 0  /- 0  /- /00/00/00/.00/600/>00/G00/T00/^00/h00/z00/00/00/00/00/00/00/00/00/00/sO/gb@-0  0Ѝ@- @+@-0#-r0$%@-R  +@-0#-k @-0-- @--(0(%@-R -  @- @-0- - M@- - @-- (0(%@-R y - < @-p|-< @-gy - < C@-^ -< @-V{-  @-M{-  q@-D- e@-< - e@-4- e@-,- @-$|-  @--  @-z- @- 0=-@- @-|- @-y -  C@- - @->- 0$S00 @-@- @-@DP d 0 0@- 0|1!-p@- -  -y - |-=- [-Z-z-`-0p@-PQ+0%R   p@  x/ @hFP 3S/ @< ,A. p 0#-r T0Q@ @8 84 C, ,( (/- |-  -y - |-\0QH H@0 4 4000S  /-p-z-`-H0Q4 4, C$ $ /- -y - |-`0QL LhD D@ @< C4 40 0/ --{-  -y - |-H0Q4 4B, C$ $ /{-  -y - |-Q Q Q/ &  - |- 0#-iQ Q Q/    --0#-r///00/////////////00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/ 0@-@@,0@-@@,0S00/ C@- - C@- - C@- - @-zy -  @-qy -  @-hy -  @-_|- @-V|- @-M|- @-Dz- @-;z-@-|.0`-@-t.0`- @-"-  @-|-  e@- - q@--+@-0#-rA-T`)qW D61@P |A*0 !-NA-@PP 0S a`W/P .`1S0rOP D/P 0p RB .`@-@PF P y j0 0]~i000A-@`\@*T<0p " RG\<0c#N 2 R^& @-@Q@-@R@-@S@-鑿c됣&bp@-@0S*TDP) ]_.P ] ю#MNk|P s sD@ P < 0@ S< 00ppp@,-^&O-,M@0P0 T; R0AT 011!0 S01  R 0 1AP5_P ~,0S  R3/00S 3/[1P PP Q0P 0 0S^:` p` 00 1`@S0` $0p$0PZ$0P``Pp1U00$0PeUP0S$008C80ᨹ B@S SBڰDP@_@8C80$S@ Sc_ 1  p$P r `0p B BR V` Z `1Z0Z>_ 00000 QQ0 "P P V`y 0CÐ   S CUPPEPE_P 0 wP  _ 0 0 0P@BP Kj1  0 w } Q l7w3XXW`-YPP000;Fᾅ!?@  S0010 S,SQ 1S b !ġ1S 0C" !8C8R11$PUegqphq0 RwP u)}~wlb `P 0PSY 2D p5j0 j ɏD<X P ,500xP0 qP- >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PPt4P P0S 400C`^|k1SR !0C B/?!1TD]1NSAPN0 P ^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0PWvP tpP1aC P vU{1S'ʰ1 C P vF{P 00P1 RE40S 3/f PPP f P,ЍPR0v X] 0SpW 0j 3/pd P 0`C P Av f `{f00x00AJ!0 b02P J00P000azf @,&E-&-S&R 001/@,P0 R0//@,O-PP$p`*@ [ ! % 0P@ Ѝ0噒00 1\$<0P0 000400800<0 <1@000D080H040L0$0<0UP q`, (P1  @@,P/D0 R/0@-A1 P e< @O@,O-0dBp W`H5h0 00p0Z Ѝ0P@P 0S 00@ ['0 0 &oP  ?X0S  9X000 00 `[0S  oP  %X000 [0S nP  X X0 00U P0IS0SPPn0 00n0S nt ?C S WPU  Kk0Y!0C0S( 23PP PEWT,&VUUU @O-$MH0[S0P 0L`Dp? F0Y0 0S 0g }g{뤣`Pnn n 0@@0@0000. 0ESET0D0T00Ө?0S0 CR C0D S0  06hknX 2 g 0  BbU P0{ P>  PN P P!VUA`E Dx@DP`4g g g@`"PD P AP;  KR !   ` D0[x0@0!P1 `V0p00@  d`[y`F`FV0p00@  DPE0x@DU`E¨` Y @ }Ἃ@T`— R   BV00000S 000 0 0|$ЍO0Y S T,&&A-`PlPp `m@m@0T `P@ P P0000T,@-@Pp 00T0* Fp@Ѝp0 00at` 0 0 @wE@t 4ᶌP  du&T,h0p@-P@XP0Ps H` R :ϮP 0S@@Q@pudu&T,@-@@0000T,0 kT,0!kT,-@-@00  Ѝ@ Ѝ/-@-00  Ѝ Ѝ/-@-  ЍЍ/@-@@@-@@-pMP@`,0 0( 00 0`Ѝ@- ЍO-M P`@pl@lUjT0 0`P0 D0SPY 0SV L00SRDwPPL00PT^y@DO@W ;p PSWpV`KЦo`0 S`K0 q@PE0@ ;PT0 0PS00L00D H0T ?Z  tr b5wbbЍD 00R00S 0S L0X3#PpwqP 0 Dr똰8FEdd ?0 EGOq``PFE`ddT,-@-,, ($ *Ѝ@-`$0P@ 0  00 0`Ѝp@- Ѝ@-pMP@`,0 0x( 00 0`Ѝ@- Ѝ-@-00a  >Ѝ Ѝ/p@-Pk@kpT,@-7@- @ƃBA$XPU % 十G00h@PU %T }G00000S$$ɷ Ѝ0t-J K -K x,&*K O-CMP@`0P@0@ R&  @|zVPP :PrGCߍPpW  @ kpPY Z  ` - @ =R@<$8@ኀ p ?zM M M &M DK M 1@-lC-0MM 0p@z`P0 PP* P kP 0S0 0 T   FPP%P 0 Q00#0PgxۍЍ00P 0 40 04M M ,00S/ 0P I@--d-X@-ƂP @P <<y@(!Pq@J M C-@M S@R00y$P,  F0S#{P  d0Sl Y0] #)PeA@PaCR'C=*A^&'ЍP@R=v~P'P'20S @`P'.@p0 $!P]=L~ $ X{$P 0)AT P[P @P pPP 0A+Q !S0p 7'SpT+ApW38pp0W3:X# @PQ  R@4Q p0Q  R@~@P`Vp003/P,00  h0S  R l 410!8jp-!--mR @-MM+@(x+(vxB+(xB+lx(?PލЍB?P `0 @@@@@ @@@@,&B(}>pR wR |R -MM+ qxP+ 9x+ ix+01x k?P  _>ۍЍpR wR 0@-M 1@@@ #P @  P A0$*!PRU)QXb&Ѝ0RL00S 3/P 0$003/0$)*L<@P3P/[P+W@P'.@P# 0P| O,<|  0S 0_ Z'P @P4o0m%(*00-!-bR R --@-M y0@@@>#P* :@  ;P 00*!R00$Q )k@P  }0S 0` <'Pp%]()Ѝ-!-O-`M  0 0X#*0S ` 0 SS 0p0 S00C `@ 0S :xPP @B pQ %S0S iSc %S, dS 0T PsS,200P 0 倠ಠ@ZR  @P %Q0 @0S0 aRT @R$R0PPR@ b T 00S 0 ! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^0  3/PW Ѝ 0 vꜪ&7@- @PU  3 q}C00 Ѝ0lP X! H  Y}u$ 0[%-R R R R R p@-@Q`T80800P0S0S   0p@z6-t-S 7@- @PU  K }SC00 Ѝ0UPP x 5 }`00S "`H EB0[W( $t-S S 3S -GS PS &s@-`4Q@A:jW{ K`dz`dv @`d6d`6zf 0Ak@Pxx 5벀P @f@B_E_ zЍp-uS xS &{S O--}Mp@` ~0 p  V5 0S  P R 0S  뀵P Q|pP L|npPU Pg 4HS0B? 0L+P  KUBPP  BLB00`P[P: @  \: :0S :!P :$4 iE3 %z4$"0}ߍ3r]T33 4嬈0"!03140`040&2ɋ 0ɋ 4T0 T  (0dP,00  ಟ>"!!0@# Y PN  XT $ tⲈl2P tt @0S$@0 U0 @"QS IG1P k{2 U0W$2s1@T u z@>0XC 0@0S@ @  0R0SQ }${0S  2 0 P[^ yt0  PS $2<&-ptbtS f@t--S S S S S z-S S S d-GT T ,T 3T LT 0@-0,M 000000 00P0 00h0 PPP@P DD@0Q ,,Ѝ0@)Lt @&&OT t- -O-iMs?!0ZP 00iߍOЍ/\Ax`PD1P 0 A&`P z[p `P@' [PpT00Z&@U0P 0 "0GSW 010#S 00PpP@ P'mT t--O-0MT@pX   p$p `V   @Q'U` xxPPPp@P >븤H E0PU m0'SP0U*S / "P00 sX/0 0P ề0@ 0 0H0 xPX1Z  |qp`PUQhS( 2S022SP0220C2  S xS`` 5w$00 0( 0 0`,VPMUSSS PPV   0%S @S B B*b 0.S 0 0ĂP1Zp@P] 0A0 D 0S R68gdTw00 (o@0 0 (gP+cq+c0S  \V0A X0E?o20S `o\`$l\aqcewV @ x 60S. c@sU\Qw00CS0000?R0S Y$0S  `_6Tf4wWU `0\`X L*\%wjG0ЍO Ѝ/T T T T ht@-&T T 0@-CMl,-PP 0S .Q"w@P8 qCߍ0 Pq |,{,G-p 堀PB`A@T:00Y W ,/Y 000 vP EQ 0@Ꜫ&T A-`Pp p@ R4 pq  PG @z,A-P7o@3t pq0S DQ0Q.SP @$ $Fq Bq|,T {,p@-M8 8PLP   `q 8PLP  Rq 8 p@ (  Cq W P U 't@tP ` 0q 00 '@PЍp p pP!iz,%i,z,8i(,T O-MNQ >M)||& ێ,Pz`0尪S  W:-8 4e0w=C $ C/&w ]H00w=0pQ>e0 pP400c0 р40P  U Ur0YR?; 0/pp @*<: R0 :P'P P 0X60,0:WP<GI.̟ 0  0/P `h< 0 B0u`````V4Pp0ۮ0tl= -D0+lq0U,ݍ<Ѝ>0a XAp Q`P  KP; `{ 1sS1lS@+2 0P%QPL NZP<;>`Pp},p*0x*0wn&P\8 0\8VW*0yU *0z*0}\8t*0|y\:U :L*P0Q8 8* Q9ʟP \ʟW^9    +9 @H- A) 0p HA0op p=Sr9<)a0hh FP 0H0H0A op , AHY`P( 0Vi OvPSUp`jvF ! JH p0n`0<X(0~Gd@yP T,tP @nP iP }JAcP ^P YPg0:4LP '0\6S '0*0 `P 4|| ph,'[7S0 ';x& P`6 A Ay0\8eP P &6 jP `(b:4S (6 YP 0: APڴ  VF\8&08\8n襟`Pڀ n  s%8P00Pڀ( n  st%8P0040S\80\8Pڀ |n 0S %8Pڀ| mn r dsP000S\80\8)P0S\80\8`:婠4S4Pp 0@?S` @PL 3E00x 0,7P"H pV0S @|WW5S '!#korXvXtX60S`0 <IW41S nP >H%0>`@$&Ԡp+ <ep9     +: $0{Y 4p < 0S 3Sj jdt { {008?` `p䀍0P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`0F'Sn`0pF'S``Vn`0F(P~ 0C QY > 00B,0 c!4 㐀@<#0 p^IZP\TP fOP ,04!k`~ <#``zuL2P  @000@A$"0p0N?P0S J`  Zz VzKR Qz00`K?(081l1$1~0 1\00 @a+K "`P uP% p uP uP uP tP tP V`0C d  d` (wP_ _ _ _ !-h-_ _ i^ _ 00A-p$0p@` P"AP0 >@ p C 01/@P00pЍpP@00003/003/$Am` O-UM M`Mx.0Pex.x QiX@,:FniD#U[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7\4 04@0Pύ✗֯N#` 54, Q~W <S T7h4F>D0C247\41 [ V?h4F>D0C26A\4 040 000000000 00p@ }0 p0< 5 5s 1yt0 00 0000 0 0p@ 0< 5 5s qଔT1 @t00, n.E "c5@0\qW 42XL1`⺀0Nόpjppr຀q ph \ $t00? 000/0,0S00Ӥ?'N?,$"@p0 ,0mS` Ed40S N?,$"h4@PUX4LT0}10  A Sc "Nc Jc,1,1 101$10!4141(8H!L1 1$!0L1H!,@6|$ 1(1)\,, 1010$1441>(8A $$ŸP   ^{Xy! H#0$100$4;P x2P >{\ {$10M0$10GP0 0 0:^0H55S Pf $003/$prPM pQE! >,!  5$H0@;S 1 HPhP> W;<S: $10>C418<100S. @_ 0bWQ!!10'b/v0,1014181>C0(1}1S0}1$1S p E@--& Zi^ &!-h- - -_ t-M` _PP$030/0@o//BO- MPM@AT0*!Rp0)A`T0 $0   P V Pp ,3*'0x$0 `$]?(pP H4\,' ܍Ѝ4p Re0Spp0 P0 4p0SW00l , Ri  000;x8,9/PV0  ,x8;;/0  ,x8;9/T0S8S "0CS0S "S S/ Pp  R <$pWP00P0)|2YP0 T P' 'pP 0s W&P }d0S "8U8 O@d0S !8F\0 @S !>8`0S !48X0St! p!S0 80` DL0@ O@\0S ` R !8A8 ՌD@D~ό@x@ȌD@Dq@D@DjX0S0A@`^pQWppc  ^!-a ^ f&a _ ?a ] a -Pa Va ea la sa ` ` za a a a ` a a ` a O-MuM0*QU$e Uh&&p@5& O Z -&060 T Q ӝލЍ2 )qW nP7 FP' P  @ hP' @H0 pX p40p40 P] P yU Z@D`@ 5 p PkU   c0SIS  : 0S #S 0P00P F0W`P14s10d#5:`#`S /%5%;%0@`S D% % %-fspp`0 0 ,0S T0 S00 P0p0SS40 0  0.xP;85/>P0400S8RT0RP S@" SA00 80o80PP QL ,0@8aa<th\<0 !L! 080$ 0t40 ( ` 3 S/  S" 0 $04@(8 M>0@0P@0T@D0< P t \ 0A00@30! 8@4( A003000S0ؒ; {P  o~e 0@o/b 0!!/,10/*lp@-@4P0 `\1111p,O-P䐟䠟䰟@p`0/ C !  !0  Po00S  0 0S 0P1SR0B 0 0`p@P X 00,0 000`00 Ѝ, P | 0@-MP@/.Vo1, 00 0d000 0X0@@@@@10 00@0 ,Pcߍ0| ,O-P4Mp@` 0SpLP `Ppp 0S00V0#S 4Ѝ0L0 3/`P0 L03/P)  0Q R  I[0 0P  P  H  , R  T  X $ \ ( ` `, 4@8pTd pA- 0R0 DQHa@ 1QRpB   !LAPAP0` A#0Q     TTAU @@,f f O-pLBMXQU<2PX\1S2\U \QUЍ0C`1`1S[`li001PS \1 X5X1! 0`1Vle.X`00 T1^ "X Nn\P6 \ ! Dn000: S.X1 2 \1`0c0X1`^`P 0 S 0.S xZhjp ` XXPX SX1, 2 $ e)Z,h&  f p@-MM`JcPoۍЍpP@P+9Z P*p+Y P*+Y P*P+ ⬶P"f f f p@-&M@(KJ`P6 Li < 00Nh P (M6(M 3io^D m@P D~ލpf af b-g g O-M@P! c0  0봢p`Y  ApP 0 0P0SJߍP W%0]PiP0 a0CS0S p `,Vp08Sڠ0S`p R SX0 0 a00J  p 0X1U0ů0 0s [4+ pY0 ' @0"0t00 00S 0 JP0[h!R@PO O0㏐ 0S*?0 !CV4a0 M g +g d@edAH,9g >g 3g ,@- L@01SP@ 0S 0   , @- @-G- X1L1L1  DADh9'Q   R 0<11L.P+D(T%PPH KgL` GgV !Dpp1 p!?gW !T``1 `!7gVpp1 !p!0g@0 CW P!Px@ЍGFg `g Lg ,og g @-M@ lP @oЍ@-| 0S pP`0 X00T0 LIH0080 8B( Ѝ Ѝ-g - -g x-y --@-Ml@p9t)0 0 0T00.00 0 p $0t !Ѝ,g p@-PP@9@EEFp@f -?@-@P  坃 R4 g#(0@Ѝ0@ Ѝ/g h @-0  0 P L0L PD@D @08H( @0 Ѝx-$ z-g x---3M MX AP0  4gP go3ݍ Ѝf *h 1h -3M M AP3ݍ Ѝf 0@-M0  0f 0S@Ѝ0h0h h@PX0 P00L0LP P@i<00(0 P(a --5h - -g {-x-y --@-0  03 P <0< 0440F000 0$?Ѝ -_h x-{-y --$ 00!S//,$ 00/ P /,, 00S0 10 1/,,11<0@ Q !@-0 " !/,0 10 1/,@-M/.j, 0lh6 0X 00000@0 ,@ߍl&| ,H 0D /Q/QQ Q/,l&@-@0 0 0@VPЍfh @- @0S900-zh 0@-AMl8hP N@ V  P<04Px9/[0Aߍ0h ,h h ,#-P@-@  0P   Ѝ--@-  Ѝ Ѝ/-@-0X0@P @  V#Ѝ@Ѝ/h h h -7@-0\P01u@P B  7#, Ѝ0@Ѝ/h {f 0@-P P @1i :i Di @-@dP@ }GoNi @-@0fP 0 P Ri -y --@-@0fP 0 P Ri x---QA-@@1@#PP1P#T|p|` `P (B(ABbP M .?+?77}ZAzZ--@-@f,P `j(@ 0DЍЀpi &0@-EM@DP U ZP00404 U,0(x:@Eߍ0,#-i ,@-MhdA `Qn `cUd<130 x F ,i<$0 000H0 0 00 0` P0 0P0 0``(PPpR02n#iUx:\ JP (U( (Jߍi ,i ,#- \ h&i h @-@P !0`RxzeP PP pxZ P` 1 >G,01K<0P@T 6Y Ѝ,i h&@-@<#@-0 0 Ѝ@-0 0 Ѝ0@-@M&0"0 000 00vЍp@-P<@0/SpQ dPp@l&@-0 P x -|-C-$M@`pPG0 ( @P) 0 PP0P00Px0 @`PP0L`ySa00ͅ0݅000͕0ͅ$Ѝ j j g i p---z-,j j O-`-,Mb$u@uKY[ pPe $AYePd@T10S@ LbPPEUN TT0 (f$0P0  @@$0VSS00Y00S b P E H $ Y0 0$0   0 $ VRR   P # 2R @D g0@Q`b `P$ X@,ЍTj  G-p`w@PPU  hPP 7/G11PpO-@ M$X`P Ѝp0P 0`0VSS TP$X-@-0 0Ѝ Ѝ/x] -@-0 0Ѝ Ѝ/] C-`PM M@d'P @@ELCp]@ F43V0 V]DADVci & 0So 0CS+PCS0 ) 0 0S8 0S r0S 0S QN@xAP$ `0 P0 @o@2P 0,b0C?o2 7姟00H(0Sލ Ѝ! 7qS bP5S/G B !F? NF@o@1P0  0L o 'x 0S 0S| q0Sx 0Su QN@P 0 i0 @P_F? Q.  QFNn k k oq)k j 0#- --Qk g k ,h&mf ,k g -|-ek k k -MM P  P ۍЍk -MM P  P ۍЍk @-kP( `gP! % ` 0 S0\P @00LP J@T TЍpf k k |0|+R/@- h@|+\0 P0D080",0& 0,k #-4'- #-0'-(#-8'-P@-@ [0@V-p@-@MP H(@`e0H 000,0@@4P,P34hPp0: S HaP  Q Q܍p,7e 83eQ @P@PڤaQ < PT8|1| B3dp80<uDQil #-Fl nl l l `-l ,7@-PQ0@ SS <4 000] Ѝ0 2S<0 l f O-PUM000 W$4Q   c$ğ0/ScP3s䃟C00`/Ve3 P Q1HUc@ A@ tPKWP LDC;@1 U `PP$ 0RP 2P 2`.$o^ 0 10S 0S6 0 1S20S KPpG $1fD1T  00a Y!  R R` 10 1000pZR `01S RB  0 P a0S  /SPR  Uߍ` 1 02UV U@P@T dTg -l #-l&,l 4m \m m f m m --l x-l k p@-Ph`@TUdpUP`P  p$&l G-MM@p`ppT DzD2PCP P1P  /PڍЍ DzP DzP3P `P w3PPP00 u00 oya] ^P 0=Sp  C xPW  lP gP bP`lP X PPh l 3Mn en |n 20p@-4 P@b 0Pp@@-G-@Pp4 b0pS R p2"4p0QSP pP`p 0S!40Sp  %b`/0 R/0@-SLM`p@`aP 0S0 L03/P (0! "!P 3/P 0S00LЍ0  1/p@- @PaP  p@\@-@ (@A-P@p`p0S 0pp RA05#Ph00200#X0S*0Q #"0hPhp P#"4`V000S 3/0Q #"04P4C- 4"p Ѝ`6AP3p⻯ 9 ᬯ# 0y /*s 0ᬦpk W@Z d@^T T g]PMP `P ޯ@n n }Dg n p@-MMP`;  p  @Gp bPbPۍЍpp@-@P ``L P  0Qp2P p|d zd@@-M MPp; P` p  @0PEQPUaPۍ Ѝ edA! 0 02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/@-@p HP`00/00/4\80S0 S001/\80S 0@- ``@0"SR0(SS QU S!0$0S\  0Hp 1Sp@- l@$\ P0"QS:pQQ   P \ Q0\! 0 ,04S8 000803/P,000403/,H0 , 4 T 8 X Hp 40S80S0 S001/S S 8 S S S0/0000, 0R!R@-@ b4 BRp01 408 00803/P,000403/,H0 , 4 T 8 X Hp 000/0O-p4M@ PPp`314ЍO$0 L03/P% Ѐ 0\ p* @D Z["H* 0*P T P , [p _8``pp 0S0P 004Ѝ0l-O-P4`ȁȑȡ@ Q 1SQ " 01 r " 0SQVLLSSDSQ R?!S,0S 0S00 0S  p!"00 0  SPH P00P00 0 K`03/P L Q Q  Q R ST- Y 2 8  . $ <` 0O-Mc(0<00PSp@lp`00 # 80s 3 0WYh0@l0S@3 `R` 0@  "<0P000ЍW0W*8q @ 0L03/P 2PR  "00 0 00@0002Dp0 0 YHL0 48 Y00(,(, 00 0XP23U 40p0P<0SPP0 M T00SI0Sj00q p0 0 0 000000  \0 0 00000PX 00808/X0 PpQXQ Q(00,0 0p4 80D \`\p a X0S l^ 0$0p0 0(00,0  04 804p! 90,-p ,q p /q G-`pFhM0pSP^Xf X0S ]X0SVX0SOxX0SkHqX0SGAjX0SH:cX0SI3\X0SJ,UX0S`%NX0SaGX0S,@X0S000$ R$000 "0& W40SW4 QQ00Q00Q00S 4 ehЍG (  X0SWCL4W@048P Q Q0 =3003 0W0 X hЍ3003 0W0300 0$p3 0W0 0TS(0p`@ 0 ) SH0pP0`@SH0pP0`@SH0\000 SH0`000S#H0rd0S tP`@Q0 # 8D P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 tH0L0  \H0L0@ DH0L0E ,hЍG!耟SH0000 #0PpG0  d :/0 00(00,T- 2 Y <` p @p Wq --`q $  8 PF nq lF / Tq zq q q q q q q q q . C- pQ0EMPE0@ (000S 0CSEߍh0 3/``0d 9/0 00(00 ``0 0pp07/0@-EM0@0P 3/P 08 00 @@003/Eߍ0@-`,MHP G@0 0 0PP@00 RS THP pW WP00H P00P0,Ѝ @T@0/W  /00H GH P00Ꜫ&q p@- MP@D0T x` 0  040PP`FH0Dd Ѝpwq G-%(M=@PV X TP`H<, VV !R "2 Vr PpP`"pVp$UpWb$U  0 Y0 0000 0 0000% 0MppppPP X(Ѝp Hp q  40C-S,MPJ S S S ,!S SB @P? q```X 0TQN eK000  00000 0 00 0 0M`P 80S>,Ѝp  `0  O-P(AM@0pP U !b p<#`0!(<#@ {U`P $P vF00 P P 8F000PZ!@ 0 A@BA  |!@Pt009C  L!00-  (!0 'D`pTP@!@3@T`0 -@DPY @0  -U!ʨ@   P.㨰嬠P00 @p ` D/Aߍ!00PRPV p -r ,,r Tr `5O-p-0M<@$P eP,0 `P%Q 4 0@0D  U 0$ p0pC 0@D @0 0[D 0S , S00 00@ Q`42PP00(4 0 4P00 0A000 00PPPvT0S@8GP (0P40 0H03/0S0P, p p0C @P0D P000ŋ`@0SPuP 1(0p(1fPP ! B B2"PQ% ,02@ ,0R B'@" X, X 0 R80pPn 0 R01(1#0ഁ000>Ѝ<0X ∑0L0 3/ 00X0D!2 B"=1ᴡ0C100C0 V `V`s`V T00 03/P0 0D 2#4`0Z5 P0a 0` 0d0 D p 00C=D!2 B"=10C10 0?o2100C0 !V l-r r T- Hs <&  A-Pp`a!@0P  p0Q p|=p V`P !@ B"f= VT0 01`0(`10q0000ቿx= O-RUMP , X1! 3 #Q1 B2q Bq BQ B B  0U븰0@` X@@p0 0,(00 @@@@@ p@@`P߿LUߍpv', 0 `∀p D s 008*b0A-@0<0SH04 `pPpQV09hQ?V090VP:0 A! 0S/ LP0 05/00P 8p<  @  0P4L p P $ Q:  BS:Aߍ L`0 (06/(0Pf 8< b @_0`4 V  V  R U  U  RE ,A0  ( O( 0P O ( p,$ ( ,0P 0 pP`>p0  O 0P@Op`LP` Pp `P@!0` O-0AM@--s O-`,M0@\0P3/0 X ĀX p ppP(W 0Y3 2Z  "00 "  !" 01 " X "  !"0  0" " "  !" 00CCW 0B o@S0E0 0`20\20X2 0J0000@0 P,<1@11((,Ѝpz'0 8 r P  Pp0PXH D00p 0P P`&0,00J0P9 @ p0 ZY00SYXP P00S`(Y0,(00V,000p 0i3/`x= ,qC <. 6 u s l" 3 r,s @-@P0@PP/SP0S0s O-pMCP TtU`4{ 00 rs> ,b0  * 0 P  1@0 B )R RZ1PR Q0r Q0CFS0TR000US0a0Ѝ@0 pp <1PT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V +N @0P0 /S`Sp`` [XtT00U0,`0s , t ,$t ,p T8 T, 8T,P-s O-0MSأ@pЍ`  W0 @0 P0S% cS2 %MS) CS, GS R 0MP PSS! W+0C?o20S 000 00SmS sS gSR 0R RO-OMM400 00 P00 <0 0PP0@@00P P(0 0H03/000400 0!6 0R 0 ( 03/ 0`` S08 `&PT&a0PUTa`0$080(&00,00$0 $(`ppDWP0`05R0h0d` i `Vp S ` ``U T` XPU` RVU 00L0 LP1j~|zx4@ 0X000PS40\P0O>C<0000D040 40L$pEUL0 R  Hj0 00H0 F0 HL0S ApWNP 0S80Q00`Q0S 0 L0aA3/P 0P0P 0%003/X`\0F0 [8#p@P0?tLUP 0 [0 0 Z0R0 P <0 S@00D00S8 P(' a`0" $0$0,0, 0,0$0%$0匒 Xⱺ 0=L0 p⦺0  0.L` 0ᘺ F0$L 0 Ꮊp0`00d01` 0Dl0hm+Xh=+d= Y*pV 0 LAiU 00x0 L6i0H L0iH0*,0$ Q00Q03S (0A( 2PIop 0 P %B00P3/` 0X`APQ2VP04PLJ(H OލЍ 0 [0A 0 Z0= 0 [05--t 2t ;t -Kt Ft rt 7t At @t [t et @-@! 0$   0 P 0"ġ0S 0$ O-Mp( ,P|@`1/0@T0P5@PZ@TP0 0OK 0pHKpW U T 09003/p 0Xpd0%WQXc.pE0 Z00 Dy+p JpW000 0Cpÿ D0JpWP0W000 000W 000$0=-Ft -t 2t -[t rt 7t 0@-@M@0L0 3/P" ! !WQ 0 0 SS@Ѝp@-MMM`P; `@P N ;; OMލЍp{dЀ@-@P HLKP <GKP ,BKoyu {u u p@-08M@ ! 0`P 0 @@P8ЍpKPUJ0 00  0 tP@o`1C-M MPN @a0P *1SE$A T )1S ݍ Ѝ Q 0 1/PPPp@G 0S0 L03/P ,0X0uP 0  H x;8/P H{@!-,@-0 P u P-@-0 /PR ЍP/R0 R/R  Z0u u ,@-@@@-@@ u @-PP@;O@`P  >Ap0S  AT a㤽 T @L!P 4 % O@ Ѝt-u -u u &@-@ @0u @-@P@@-M@  9  9< ~܍u 0@-MP@~  9x  9 Q0TsP< ]ߍ0u @-@_@A-pP\H`n@P P  M$@0 !=PP ᭾Ѝ0$ Du ,p@-@P4Sp@Tp$ "@Pp咾Dp,u G-px`DTP IPP@8 0 PP$0R04l, v A-TP4SA p`4' 4 @0P9 L9 D,p@-@4S04pTU TU Tp`04<0 60 4., v p@-@P 0p@7v p@-@P @op!v    @- @- @-  0P/,0@-PM 0 xPPi 嗻 0PP @H_D\P0VP0Ѝ0@νXv `v mv -@-@A-aJ?pW;$AT"0 %PPЍ @> C 01/@P  0Q$AHL Q>0 R 0S |P P 0$003/$q!-#0pQ@-sA? #"T R0//s@-(@T@ЍpHʻ0Pƻ0 w003/@P/@-tMa`P 1Q@ p@@(P  90@Tp@tЍT0 @T|0 Ch0h d p `P H 8ʻȵv x-v v -v v P-v v /@-@}@zXv ///@-0@Q s㡻@o?0 \ 0P000@-4M@0  ZKP0PU;G0U 000 0 0 04Ѝ0-//A-pP@`VT0S0S XGPH0P$1U G0U00 0X0`p@v -0SR00/p@-@PE<0<`P" 6D0# A@$!ͺp--A-`8P@mGpP( F7 A-@-ѽw @- p@-M  J0p $0S YZP`L@@PU 0 0  ܍pc-)w ww 1G-`1MP@1!Pt1t10pppl`PBL@KD 0[㐺ߍ ᪕@P axE F@P 0=SlE ?A@0 @T@  TP t0 =P P x=@ UA9:w w w w w w w t-w w w w 1A-@1P`p1!PP0P0P`P`P0 D xM=4 pgt-9:w w x x 0p@-M002 0`0P 0@P @T 1T 1T1O/1 ,}P1O/1 ЍpCx ;R$0 @- P B,@-CMp P@IP 1`0 0p0S1O/1 Cߍ5S t tPd`X 60S  S,1 1 -hx -;(-x x M;崹Jp@-P@l91 1  p,#-1p@-P`CP@?0  p@y p@-P@ᐹP $I11P N/ py V1p@-@Px1(1 1P1 1 p.y V@-e@!y C-aM@.p-ITV PS2P3PG aߍP uP L"080E0"0|tP ",t2X , C 0E, C KX1N?L0 !0,TP P|1|10 tAtaPpU U UP10$0PU@8!88A`,ppP0S S  @H 0 0`P@AP0@9 ED"9   & 0F 0 0 p000  ѵ,@᯲c-5@y ~y y t-z =y 9:&-,#- - -;(---v v KA-`$XQq@P-@T M GP( 0  :P 0 g; P D@ᔹoЍX0bqL {0 P0cz sz t-uz H{ V{ z .{ h//O-c@T Ѝ@T@T) ^' P@ U[Z [Сԑ YZ PUPE P P$P@ P$@0"/<)-O-,0S ! 0S E ,v}.<0P1 0$ 0 0 0 S 0  0S 0$ TЍUQUB"01D)-{p@-@TP0S!R+)r00 S @ 0N DpD)-O--BM MXt\0@P 0P(` ; Pp)Bލ ЍD0 2P Q 0   d00 0 0u0$0!`4X00 pvP0F`F0;S  |PzPV +RQ 0P \Q SC0Rpʨ0S R2 S - S/ S0S00000000`0 P 0S  - 0 R$ ?!y 0$ S0S 0$ P0jedA~ O-DMhPl`PDЍH@P >$p6# S0 ; P`;#S0;p0 d00`0\ h0X" P$`P`t0(0 KH000 00 00p;~ @-`X0S0g'. C?\0@S0h - C`0S0i/ Cd0St0j!. 2Bh0ST0k}/ pP S 0&á ЍM} }} } } } O-MpD001PUЍ䠟䰟`PE 0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0@0R0 0p1/P @L)-~ A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-u"@p`P1S 3/`V@Td0@@ T0P0S@000S4000S(0000AI؀ H)-L)-~ Ȑ x p@-@4`4P0Sp@910S 3/@L)-H)-0 0#0/0@0/p@-@8Pq, 00080sp` ^/ 4R R0 0`40$ Rp `083/<0 0"0`P0000X0S 3/ 0P001S01 0S0P000 ꌴ 00//00/00/00/10/Q@-@@@ 0A0003/@P   @ C-`BEM0SP;0 p 0:0S):0St ":0S :0S@:0S( :0Skݮ:0S00$ R!000 % % F   0 0  qd 00ťp`ԩ@?0t8@,7041 `$0`p4 @4d!0 p 40000 f0,0 2dw0$10 0$10\\0d00h0@ 0l0`p,800S<p0  PÁh ,`3 000000 000 0  0,0pLp` <3d,0$ᑥl0S> S@; SN`p%P H3/P 0p0072|0 00p L03/P x0| 0 00S 00CS`p 0SV $SP2Q 5aЍMP300SZ 3/@@OoBS O00&0 1@0@!Rl!@!x@|@pPpt@屡t0S|0X*@-P PQ 0!n@x 0T:x0S@ 巨t@OoB@|0xT:@!- -- ̤ R 08  H)-( uTB t-3 >O-S`4UM@48 ` [D K0P(0 EpP(w Uߍ:0P,0jk30 40S 0RD 80S:(1SK 1<00J ,HLAP4#0A4  H@L#; $3嬦㩦 0@0P P@T ( (0B2" ,0!P0S 3/P20 SU0%0c@D0`| p2Rv1@<2U?0P00X N eH@`_(HD! @<#P`T@NP ` s1@ p10m1000 0040{ @ a1   0  V10 ᳧K140P1:> a5@0 000000 00000(0 Ⴃp` D^D0S, 5#7QZTX ၧ(},{v ᳣tH)-L)- 8 noG-JMM/0`@0PP+R"P& 0S" h"`03!p/85P T` H 0@T* /R  奼P7@ϼm+"" P:7?0 `HP+0: S pW7>00ꨠ|! ᐻPJ>0@0/SrH!0+ ! SfP`+! P* P 0/S`0oo`bS v0ps00&000 SV|+! P*+! P*dP6@_6@`ZJލЍ藂  @-㟼*@-M @ᑼPЍ(0  "@P  P 1/0S:$c(#"c  8#8S G-`1"PPp X`pC'@PЍ0S @x n1Pd0 MpL喜 P Xp $0 @ԭ Fꦂ A-Mp `PXP HP4+!!@P@ 0᧭@ @P+J zJ.0㊭r+J xkJ.P0{LcP tPP|<Z, kPPso+J KJ.0[PPc_+J ; JB`3 DPPLH+、J h#p0`!0J>⎽P 0.'P UT ލ{P@[+J| JzPPpJ.@0+h  P h J>PT ǂ Ђ ۂ 1 9 E T g t x & +    /00/00/00/00/0@-4M@0#|0$P 0.P`  P0T0670 P劣 P @ 4Ѝ0-h --O-MA Ad2,000PB,0 00000 80s0`0Q, p $  ?(0$0L 0s$00 0$l5l% T`@ @`夝@0S 80< 03/P0p80<P Ѝpv'80s D@0 0 0Q:8`0S0` L0$3/$P & [P T0T2y@X"&(@0@@,0S:0审,"(0P$P@0@00 +0@080s=0 0@( 8Y !W|Ѝ#㈡!@&(00\1 0s,`!00 XT噵@!0(P R P@ _!0 0 h0 @U 0400t0S00XTp00P0 =P@| 0(ᱺ@h3 @8q 3/P- g r  0@-)@Mp0 p\*4 +@,P 0zO*P %H- F 0g. 0 B^Ѝ0!0P80 S+P ,ΠP TDŽ ΄ Є - - A- @"(0M0( x0PQ2d2 5  L! H! D!, 1 0 8!8 @`0$ P$p 0PUp 0S0p\(Pp,P(FA(00FC0Ѝ0`0 PCp0 L03/P 000P 0p0  UPp0 t O-p4@`00Y)Z]p !!PV 0p  0 P 0f0Q 0S  00,0 84p $0T0 0X05p0 P,[.[ P Q  0,0 P8q84p T$00Q[ 0  Q QPPZ 00 00 Ѝl2O-M04p@$P `-PP $0 Sz22@|x 1 0100 0A00000%@llp2x0SS(LPPL p0(P嚡!1PA0PA x 0R`( b ",0 x  B / / 0 8媞Ph lw,0( 040x0?o21000Ѝ0DA!- u` O-pᨑ娱,M@0S0 /00  倠0S,Ѝ/S  /00P`p0U1(ȟ`P p㙑!PP PP%0(` 1`3/ //0400,00`T00 X08`,0100& +p0P _ܞ /P'f`-WO-\M@P4 p`儰.0 SU 0 Q$0S   $ pPd9\ЍO*.P/  P%0#p#K*,9~`00000YF(0S` ` 0 RH03/0p``0[ 80s ȟ0 Q0 0 \0  BR0S0pS 0[p08 r  *   * PU0'0U " [P R 0S  0) PP p00 . P 0$ PU$0[00  [tp0 PU[n0[( -!P$: p00 00$0 0 $0 0pS 0pW (pWZ 0 p 0P Z$0 0 S*0 0S  0( 00#0 P4S 0U PpСZ050@ D Z0)  Z$ R Rp 0S  S0 0Q0000 00000000 \Ѝ,PT P 0Sp  0 ,4P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S P [0 0 0 , R 0R  `xR  )P` )P 0 Q ``T R T  R X `( 0SY0( L03/P <00S D0SS000(( pAL0( 3/P 80<00S (0, S004 Q 0( `M0Q =0G0[^80s[ 0*0 PQ 0N[pq! 0 QQ 80s 0  00UPppy0  R 0S  0T' @p0  0  .l-( !--ȇ ~ O-@-M`,p0 40PVZ ppPU Pp0Z:`PU`J6ERUB 03 D^+00#h R 0  80s0`F`pHU p |,h0S 00  80spHY pPp i,h0l0 0L03/, 00Y:pPpfp0,0P80d5ЍOp0H03/,08$ $( 0RPP$P(0<00WR:< R4*,0, 0$` 0S `0S< p$`Sp $ PR( P`$ (0&PU` P0 Sb@D S [0S 0 8P`p0VT:00S40000040,0(pWr틟8`0[:8`pp'p < p00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0#&`V`P p0l  008,0,p(p<0yS 0| 1/0 0P SR 08到 0;/`0P~0H03/v8P0@00D00Z|*p 0<0 `80s_00\ <0 0RV04@ RD0  0H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,00 03/p 0L0 3/008 000@0 `0[ `0  {% V00 400Pm۶ԇ ]l-! 0 0Q4 0ppP80s00  h0S l Y|* 0L03/Po !0 儐X09/Pe Λ000400$00(0 0$0 0S(0   0H3/P, X$ 0 03/p8  0L03/ pPpP$0( 0S pP(0$ $ W00 40000400$00(0 0$0( 0c<,$ 0 0 0  0H3/P0`r 0R04$( $ R( 0  0H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0S ,0S| P0 P  R0P0t000400$00(0 0$0( 0c<,$ 0 0 0  0H3/PP80s0 00- Q ( 0 S% 0 Rj80X T,3/00T00X0 0\0$0`0(0d0,0 0Sz 3/p^p0`0W:0p Sn:Pp`,0 0Um:8嵚P  0$ $0S p 0p0 Spm`P 80  p0R:pYP Y:PpW 00U0#S p`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,0,0 L03/P 00p开8S  8y\ X W08P@DH0Pd00   8 rp0h p`o!8p 40U 00 0S 0P*` p (_80s0 L0 3/P 0400H0,8 00,0+$0T00X0pPF 00 80sh p (P=p@-@P(M(0S↘(`,`c000P0 F0 0PP` p P(吕P,(埙(P(Ѝp000d,ѕ(哙0,`(P-` R -O-`XM)1$qS W W(!0 "@PЍ00> p C 0 1/pP0$q Q 0 >  1/@P@p 0X: @1XS<1@1\1HL1X\1Pp(, !P#0%@ 0$'8 '0 0 W %&, 劗0冗80000,  0 0x0s80000  0'cΗ0d0H`H0P00T0(0P X0L'W0 000850p0  %  %  P%,  (P 0 %<  5 000000 000 00T0♔pp 85P,0qޔXpW* 0GS0.>( CP$ 00S H @3/4pGWp@ 0 L03/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0UQ  01/ 0S 2 ;C%$Є  0<P 0} Hp0  @D@儀 0X60X< Pl㯖,0S"pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000z!--m p408 H)-< L \ , uTB ` S  @-} 0@Pp`4M#@0S $d0 L03/P 80< 0 ` 80< 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80s#    ` 002%  ؠ`0SQ,  R) 0 0#Q! Q0 2%<{# 8 0 r  1# 000 S   A$ 1 SR8C801/ -0! / -p@-@$P x1SP 003/p@褖x1硖P$ 0SO-KMM~p@㻞G<0`DPI;0S K2 @,0#%,0 0 o=(0< 5#Pⴋ 娫 K@T80 00U 0 00000@0萍0 I@@@@0GpK܍ЍIጒ+R*o=(0<2#8 ;c&@@ u-O-M0M,0t1`l@0pP 0S (0 S> 9 H$00 0 <0.%"P@~40k`0V,p0 0000000U 0 0000000p0 0p`ލЍGŎ2,0S*< !,00+C#X0S000C0C0000S0 0,0B$P - u-@-@u$0  !<$10(10,1P001.@-@a$0 0! 0O-4M\`XThp(0P  啒"\ @,@;/,P R7P _PpK .$p WpF2 $$ "0  00 0(0 0 0Z`8ᥑg(04ЍO/Pㇾ4Ѝ[;0p@-@Q*P当 0  P㶓40 Pp尓<0h p@NPT姓80 P@塓,0 P㛓00 p| ' ) *+p@-PBM `@ቓ 2 V`P|0 Ps Bߍp`h00PSb0`]40Pp`W80S80P8 < X0S4!@$C0  P;\0 `0S ⫬@ `*d0Ph0Sڴ ⛬@l0Sڌ ⑬@p0SL ⇬@T`t0P^ 9 : ;= >? ( A, BCEp@-`M<P@  p 1U%PDPK0 @00S  *  &8PU@ʒ 0 #P’0 a܍p(0Sx  /@h,0SP  %@D00S4  @$^ / / , 12( 3p@-0M01P@Q#ㅒ 0`N   0S (0Sp   ,`VH ܍p4b 0`N   0S (0S    ,`VPC$0 P: 0 P40 Pt.0 P`(0 PL"0 P 0 ꔈ 1 / 4 7    C-`RGM8 G U <0C-P80@ş0C@MS001S|1SƑ" 0ߍCc`0xpW*0pL0 3/x1S 1S 0S~壑8@4ɥ00S` d$F@00 F/'0 000 0/07/P P         > C"\0S0 `F`| Ŋ0p⇞ 0S  L  `,p WV o$ ᭊ`> 㑹00"  `#ߍ@+ 0  0S  ⇊ `PV 1 `SN0  ` 0  0S @0S @ ߍC<0040!00h@0Fo$ 0DL03/00 N0S !0N{D` 0S  ,  8`Y40p x Q0X 8 < RFO     0 /@6@嚐 0  m R0_ 0  ꞈ b s u /  &4 w . @-x @ +0 @0p0rd@ Ɖ꺉 @-@ @ 000(0,0000]d@ 屉ꐯÉ @-`dQKM0@sP!   0媍1!S=0ညKߍ0@ 00 @@0hP(@UTpp (`0 ဩ0  0`0`pO>P>Pk>@!^PP@HP@@P @00P@&u - , O-`D00H0P3@L00P00 0000T0D030S D 00D0p@ 2b"`0""  X2}/ 0 S"0C 1šWߍ s0 p2 0@00 0)1S080.$0X80p$P! 0 SL0X 3/P h W pW 00%$1/pt0S _PWC0A00M  000& 0" $!  8 0X L03/P ht0S 0_Sʚ  0 0" 0 0p@080 0Sh- - 0'-@9- - 8 A #- , D9-#-T `-= K 60S/O-@M MpUPm 00 x R p#`R0]Dad80  @Q D0 hP㔔 \ ㏔PF D%D ,%`V800(0S%Ӥ$B00,0S$Ƥ$B0000Sڠ$⹤$B0+ 0 p0B/MPX`᭠x 00 0; Q <0 Sn0y0!$呤#Bh0#0 0=,0Sn0y0⁤#BX0# 00;80S3 0u0Cp\#BG0x 06#=<0X#Sn0y0_#B6( J 0 R #P"B' 0 R "B"B0x 6#0= 0Sڨ"2d"B x 00 0=$0Sh"! "B0 00=(0S0"!B0x 6#0=00S!!Bx 00 0=40Sڴ!`!B0 00=80S|!$!B0x 6#T0;!  ң B0B/00 i`VxX0 0  @8 PQ+< 0 \x S|0L@T܍ Ѝ0'-@9-wm  j ֊ ݊   ! ( , C-0pP@,M0T㲴 0^ ^ 0S T 0@]`P aV@,Ѝ@h-L C-4M@T2P!`pPP 0TL0 3/P  Q000T0SX0`pS@, XT $0Sb S H H0S004Ѝ0CS@D&7#"9-Q 30S/O-@SMP 0#00t3 `PX3X@ H3P  s 3v B 000 mXjf00,pP0S* XZ'0 FPP Tq 0 x0F/0I1P/S L(-0(0 00 ^0SvU ( 0S `P/01 00!15:%  P p Q 0, ($! `$ ސP^0 0 8a4Q101T4'-|9-h- ` ֌ c U r 0S@0@-S@00 0S/9- 2 O-EM 2@PT P0 |2Pt |1S$ $P| 003/P 02P (  Eߍ$0 R P 01/0P 003/P A10SX aPPE  <0 040000,00800 VpP@3@0S. $P+ 0 x0D 0 #- 9- 4'-\ |9-΍ #-Q 9-C؍ A-0M$^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T @ T6 @pW3dpW0V82# @  R @ RD RV @  @H0p W P^ TXV ,0"0P0 0R,0Ό R8<0 #-9-#-9-0'-@9-\0p@-T00P DPPp0AS@  1SAz -!-h-0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2"P)-p0\ Q0/\P  ^U Q0000@-P)-O-GMMz0l7d2@`(T H2 00V 0 000000P0@@@@ @E0嘁p@a(< F(G܍Ѝ$1SpA08 L03/P `7Z Z ZT7S p$ 0ST7S8 P P PP C 01/P ,00 H$L Q>!-80S  0 @-/ m G-`ᔐ唠@PX0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`8 @ WT P $Q$00S U  0|1 08ЍpP bP P Q  c P N ᖮ P -A-M`}8 PU`ЍGP $A003/0 R   01/pP 003/@P$q0H03/0 pVEL2 `0803/PD@ 0!! p8#  0 3/P"0#"#0 03/p 0` L03/%⏭ p` 0SWp`@`C88 0U 0<0S P L3/00 L03/P @0D t0Rxp`00 L03/P @0D t0R 4 d00`RP  v00`p 0Sv ʿ  0|1 0>P  -G-`RMXr@ TPPl P\` `TP P9 4 ᛖp p0S  vߍ<0H(00,0 00004008004004 04$0D0(0P dxW[  qpUt kp*h \n 8 ` <T 0"U $U U U 0,0U0  U ` p 0`?`a8SٺPb   00*P*00  0* c d@edAz zd@ ʏ ޏ  A-@Mp`;@ @ᄹp@ݍ P0@0@zT00 ##  /O-4MFpT(t,$ X\p&`AT  0 YY 0 0<R. R 0Xpp @P R$ P#2Q4ЍS< 00 Y+Q X( Q   0T pTp 0pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0qpWW  00 R R\p\ ؀0@-4MP!! 0 P P P@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-`@@

 R0 >t!P000㛓#000X    M ,a( [: J|T  ZP ؀!\R 0 0 B@ 0St 0 0@ H0 0S4 4 0X yd|d&œ {dЀ̓   0$\ (00t S S  S00/Q 0P/0S 0S P//!R808 :C@- R )r0@/  80R*@-0M@"P0 0! 0!  P0Ѝ/00S/ 0-hjp@-@(P0S0S0< 4 p0-@-@0S0-A-@lP0ST 0S` @ <0P@`PV@0-Ss@-@P ' dvP E~Ѝp<kP :~a`P (bPP )^P` NP HP(  `?P` D 5PdRPP 0SL` P %`P @00@0; B H N V X o p@-M   P ڔ{ @P"` zЍpfR0S  (0q P{Pzr O-QMM@@P;.,@YpP}0` FȐpw U0p0p$@ @Q&D0S8 CR0 zr0 'P[0D04@T.4@0@T50@`T$00 0G p P P    00wP  p$ pp00#؀\z@0V  00#t #ف000G  `#APQލЍ04 040RP8< 8<0RP`z00 S 00#㩁PDt 0P #㛁P@p Y Y#P厁P@k P #xP0'% D00S00 D  q0Sأ  0 0 0 `[@00t#Q@#000@10 < Dd@ H Ŕ ޔ  7 _ S @-M0 0v 0@S( yP\xX x@08y8 P$0$  B@:Ѝ評 s @-v0SЍ@-M@ vT0  CR$00S ЍwA-@lP0ST 0S` @]`PT\0(Ѝp!0SQP ؁1/T 00< O-DM  0000 00 0 zp 00 4`Ro04`800,00$ (0  fp ,08<\@?! ( _5#Z<P0$P00p/2#*_.08 RP0 \X  PTuU G" ?P1 0HL R0@ p ?  n0 k`/G$'@ T R@`000 00 0  p 0S #"01# 0?04 SQY H0V`00P0pYkXUDЍ!-/C-`@4M0`} p\ X \^ PRPR VS  RQ \R   0   pЍO-( @-1` QPp@-@pP0S0ST 0DSTPS$D  p# @0pD-9-08S^:/I-R-p@- @ 0(  P0R0PS 00Sk ppM-NM`<Р@Pp 8p`0  p `v000 ; PP@ ᐂpNލ l` ydG-xM` ✐堠@pXP" !0 @P 0S PU 0 R=H!H0 bB00S 00" !P@&P0 0S0H L03/P HL 0RPPT $0RP0 0  x@04/@xЍY Y ZD   YZ  l O-pBM M@P`/0;( P傥@0P0P0iP) Y $;$  `i P!14"S5 0Sbto@ ZU01U01Bލ Ѝ ^i0P0  7i?XY$0 0I0,k?X Y 0oS 1 SR 1S  RS1S1S p2?R_0Q   @0 0@QD 0H 0LD0!1F41Q 04 8 <" 0P(@@Q Q' Q0PUTi 0"0S0S0@0iP P `@@=02s 2 02@F @DURX A- 0MHL`Pp l1lR/ fCPi@P( T00  0R`0 !?020 20H02p#04 pj0Ѝ 0S" $0Q00 L03/P Q H 0Q 0 SD S003/] >9-P/@-\ @  0 2BS20D0C@AuOvO0w.#8\0 A- P0\\@@ \ 8\ @T h@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P @jp`T8|BuP08} ^\ 0Sp`82S04@1111111110 8l2~`S@0 P{ P0c>0@SP0 0HL R   ? E ?B/Z[d0P @10`d ἐ 09/0P@\Ѝi !-G-p0@PH8L041\`  S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/!->00@-M 410@810!b0 P00 0Lub0 I0PU ! 5/FЍ0!-l @- Hay@ w@- @ ]  0 /|/y닣 &@-@@0s x,00p !b0Co,& ~--?$M0 0 Gx$Ѝ-4M0 00 000P4ЍO-p-MM⼤E x " `x4 0 Pp0 PU00( 0R0PU00"R0*Pğ p$PD0S 0s 0SMߍ0S @P 0b3堓0S  1z#HS 06{0 A(QD# A0k{ {jodVd`0uz33Q-AP AQڑ""A0  2k BVzŸ 0 R#3SPhS0 10`0 P"k  <P  0 !   sp0 S 09S C1Ѝp0 S   000 00P0 PS d0@ f p@#  Ѝp@ p" R p@-@$`P\Pp0 @ `P0 001 0pSp@-PxM@`  OAj0 0lsp@) Zsp$  Tsp Nsp  Hsp  P H0   p(AxЍpt 6sꅧ 0 0 s@->@P`Dp @t0 p`$AT0 1p 80@  p$AЍp p@-@PqP  r0}1LpP`qpR r0"18pp@-pM0 p @ rpr@pЍO-QMM700ۍЍ   Z ` @V cr@pP` @-`R00 Ѝ0Pp@ST\@PT  Q*R@00 S   0 0S0 S *\P `]]  00000 0` @@0P  @-@@ 꼧 L1p@-S@T1S"d1S,tRU6\RUp`bV7\]\bp1C}]L10CL1SPv]0P11Cp]T10CT1SXi]0X11Cc]d10Cd1Sh\]0h17x2,P0Cx2xbVtN]tb*`2,P0C`27@-@0 PP$ H1 0D1-0@80@ CB Ѝ0@j Ѝ0Q@-@  9 bqP p 00\!Ѝ@ Q @00 Q p-Ѝ@ Ѝӧ Q@-@  0A  ^qP p 00 Ѝ@ 1S70|\qZP| 01 @00 pAЍ@ Ѝ Tt0@-M0@Q0$+p Ѝ  % 7 081/@-@d'P0S P 0800L0S SB@'k a p@-\M@ Q t0 c op\Ѝs 0@-800@@~AfP@-@Qp ?X @3 { Q7@-@  ,Aa _ Bpp L Pp Ѝ0@ P 11P,|1@ R  |'AQP x`00CS`0X su@T0 Y p ,A Ѝ0@ X0 X Ѝ0蓨 8&&p@-PDkpp4p@ @Fqp p@rpꤨ p@- 4P@  0F8 ,p@ ?꼧 p@-P8Q & P X  h080P040 Ѝ 0b"!4b4# 0S %/0p@-8P`J040 :0H@ PpP  Pp%pp@-8a? $0080S  p, AU p p@ @-@@O-`-M@0YR@pPT.Ѝ \P X  R$ R#W 080 C B#0  C0800 @@ (H@X 0 0 '|XUP0|$ 0|x0b  A-`H@a0 CPPj p0 ,Up 0 ڍpЍP. P P0 P6 pP@ PTQ IE@O p(P  08*0 1 P #P @` )@GD!\10B0H1x-h 9@x JPʞ 0P ( @ h | @-@  A@ ,kp wHP<1 u,,k0,1ЍPH0/d<1 P6 A Q/@-@ y 0S@qC-`@ x @P00@ 0S  /0 Sx   0@ Ѝ<1 0 ` pPp @P @00PEV @ x  PP 0S  $0$0> > R **X  0S @0 S   000x1  @  0SP L 00 S   0<V m A-M0 P0 0E0"@0E9lp00`+j`pQuwD07S @0 S X `f0E 0\!`1  `Px1 ,dލ % R Pp3 P0 S   x 0& pP 0 PPUVx}x 6 x |x1p  P  0S 0[$0 P Ѭ  Q@-@  p A@;+p07S@Z0 S 0VS0S@( A-`R@M@p P?P U 70 0"@ЍAP"R 0S 0 r>XU%  *P 0S <0 *#h p  <0 &V>P  *@ЍAm@Ѝ, U | O-@P$M `pP  P 00A $ЍOiuPx pP000 PPPXRP  PE . 0PE 00X  JT) $U 00#3ZpPs 8118100x1`V+  liPx1`G 81181kP NP 6P4PUPpP xP 0: 0 0nP00P 0S 0 0`  P XX p 000 0S 0 0`V81181$Ѝ  P XX  ap0 00V0 0 0 :0F VYx1<1 :<1 0Px R @ [P V @(00 0Ȁ0  YB Y H0Ȁ0YB 7 X V xx@0P 0S PPVPPx0 v꿭 ɭ Э & ը @->@T( 4"4p P`0"@4"4 0W RJL L0 b"!4b4# 0@> *>0@D Ѝ耼p1p@-SMP"!` +%@P T 0p1! V S 0S X.}QP <@tAtЍpp>0S 0x1@T l1S   @>0S@ `l1S   {0 @ "0P 0 @  B00.$pl1S ꨶ ٶ ,  @-PM@0) \.P@ P`pHa 0 # ^  @@@@@P@ A0\0  L00B#`gpЍ\ @P^ @@@@@@P@ A0p@-@Pp0@0D0X0\0PP `S0 0P `S000r0p0P PS00840P PR08<0pp@-`h@dT@@@0St#PPT00pRP dh@pO-@RpD@T@P ЍP@`Vt#``T00@lPP 0 @Q<84`B(` ``0`8g@R/qA- 81`0SP@p{000S= @T@T2 0 S   000S@0 @@00000pp10  0PppW 0 S   00000@@0aq0O@Ppq0@-P@M ,00Ѝ00S @T 00 0  ! 0 0! H0 @  @000`fpR0000C0qp@-`@TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-M@`gp P 0t`p`F\ Ѝ0S *p0 0 0CR00B *S0C00ʚ;G-P $0@`pT 0 S0 R  S 4  0pT@QT 8@T 0 S <  00` pQ 400@4@!O@P0S 0S0 @@@-@^C00 Ѝ ^   ʚ;@-0 Ѝ@-P`p@[,p0 000"#} ЍMb@B00@-\0Q@ PUPUR PU PTP4PP@PPS00@"!030@-@Pi`p 3edP@P@-xRO@P GfpP@0 0  0  004  800< l02fp`pp0@- M0S 0      ЍM-04r@Mp0p0S r 0PRr00q0U0Sl7J 0R Q00 S 4  003/00<00P ЍЍ/-@-  ЍЍ/-@-  ( ЍЍ/0/4& 0p/P4&@-M MP@`@ T 0 0 0 $00` PG 0,0@ 0$00c0S@PPUV0P0\ЍU700@` pR%0 PU B0>00 0<04  ,>  PP> *x @-@T>@Q/!@-@T>@0P/- R 0 R00^ PG-`P MP0(0S @ VP P OP:p`P 0!00 0   0S80 &00 Ѝ080 +00S # P`p  P`0P 0iS.S  P`0S4 040:SꜪ&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`@MPpTЍ 0S P 0S0Qp   I=@P @-000Q/Px1P/$0/@-M@  7  0 bpЍ~iO-YM `F/@H9X0)JpPpYߍ0pgL 0S 0S PP@ Y lP @T0SL0`P 0@S0@S@@T1S X1 PAT1S@\1S`1 ڏP5\1 S S R@L1SP1 ɏP&L1SPC_oRPU@P04S 0s0P?AB@@$P00SLQU JPPdh1 ≏P Pd1UP H@ `   0[$0D  H `0 S 9X001H \0ap X0 PB000S0 15S4 S  CR.T XX @@6S! y R02 > 0*`81 000S p S 0 S D@@0?H0p 0P0H0}>H0 @0000LPPPꞷ i @8 A-p M X`P00 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @``Ȁ- 5S @00 5A 0% 1@ A  + A+": A !9 R50,@-`pᝀ@P@ Ѝ Ὕ0PXJJ pQ,5"P |PP\ c @-`R$MpP 0S0U00$Ѝ/@P 0 00 0  K0S hU 7PP0 T/00DU 7f w O-@`0"Sp0W"SpG` Y PP u.700 ЍTUYP T0000W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  6A0 `P0A\0SP0S  AT PT0PD &P /0 S S /S/P0/S S S/0/O-M \PPЍO=`P ЍOzI@Y@S   pWlI:PP   aP Q0A00Ѝ=v0@S. \P( 0S @PfAI@`@VH0P 0 @ 0 0 @ @ꎹ p@-@ I`P 0SI$`P PP(0S $ I0(0$0p,` P,` PO-@/4M10CXP`pS00pHU- : `Pp$=P@  ؛P7 7  '$ !0P`0@T\0@T U0 @4 0H050U* H0tp>0P H0 F@PA t014ЍJFP 0 2Ap 0S PH01@U  CUH070 0  p P! .R@ \ 0R77@0U   0pP  H RU H0@1S~@H000|U MHP00r ,0 00 0 fL,0S< a J|U ,0!00 0 ,0S L Ux <1F8xb0w4t0000 0 P'PP00 0 P p@ 0  @P 8 UJ <18xb0w4t00p00 0 PP00 0 P0@  H0:0H P 0<0UH# 0S /`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 K,0HST  Ah 0A  ap$  P 4@AK0  U \U ,^`P 0SU0 pH0 50hx0 50,0 % 00 0 ,00,Y`$ U9PePU700 50 $ 5'@ 0 ,  0 p P H0@40U 0S 4S 04S0:006S 06S090PU- ,0 00 0 J,0HS U H0P SPH0;00H090U `  k`,pP .D`P 0%c^ CrFH0Q7;0UlQ }P0l1 xvP0l1 `oP0l1 P pmE0Ptp1tH000UH10 2yLPH0 2q DPH 0 2i <P 7PH [ H000UH020PU @ 0pP$` H0 S;70=H0208H0603H0;0.H080)UV <1$8xb0w4t00 0 P000 0 P0P@0PU2 <18x04gtr000 0 P00 0 PP00 0 Pp@0  @U =PD 8 pPWH0p000S P0<00 sP WH p P  cPWHp  ` VP L PP 8 JP $ DPxWH`  BmzP  ($wp= 00wP 0&  # 1 4 S o ̺  ! ` = K N R W \ ` e m  Ի ܻ  : C R W f s  ؼ  5 R e v ,3p 00ypP0 $ ( H,8   P B( P*WH B $p JpP ((_ (\ H$8X  P  B P  PW ,0 00 0D H,0HS J  rPB /o"B ($P/pH P0(0EP 7$ ! (0'0 ($P/RH  P0(0'P 7$ ! (0 '0aU H0[X UAXUH020PH0 000J2dH000BH000=H0 008H0 003(07600 2R  *$450S00T01=5 =5H00UA <1(0@0P@47x0'tP 0SU( H$CyP$U 81 800  (0 00 0 G(0`S, P5`( "4`4# ,,0tH0800 PP0 0 P 0 0QH010H010H000H050H050H000H,';,UH090AK3O\ 00` U0 YtAKοOAK OAKҿO"U \0@T$(@ p`P  ,00OG,0S \dPPl  Q:`P00pP {  ,0{0{{.G,XLDsP>P/`Pp =Ppp"4DPp&P`Px $&DPzP `P DP vP`P  DPF|P`P CPpQ CPyJ CP9|   @28|?o2= VO 20Sb YP0, ]PP~ZBCPqP`PDCPr CP p0S TP00CPs (CP .CPp 3CPp :CPp ~CP p 0wCP@p 0 pCPx |0iCP(tw Ƚ ѽ  F L @ ( C @@m " , ̾ d ƿ ܿ   . H @0:CPuI \03CPu |B |0#+CPu: 0)$CP|4 CPws 06CPwl 0 CP|  CP| CPvV v@PP00B`Pr Vw`P  R  R 0,PS0P , S%00 0$0(00X `0` 0 P@p@ @ dY`0P ʎIY\0PY YU6HP70P7zH0"800tH080oH07 00iH070dU 6P0X2\X2S$tH000QH070LUy W`P 00^`sHР؀JP  P PVJ) sP P1Ȁ0H040H030H, 4, H020U2 t0 XpH H000H000H0@00U ,0 00 0 D,0HS  qU ,0 00 0 D,0HSp \U ,0 00 0 D,0HS G >O-pPУr8@`P gP `nV<1X ЍOnR('RZ8 07840 ЍO3 Ѝ\ o ` O-SM@5 0P Q  8p`tj⬰<1@0  0 0Ep0@   p   P@ X 8 *  Ѝ萜& -G-@`pPU T =PPPn@P@  źT?0S DD0 !u@D@DYT 0: @/@ l A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90?8g<7S:8?@gD7S;@}?HgL7S<Hw?(u?Ar?q? 1`Pj?h?1`Pa?X  P T0 ST/47,`0C47(<7,`0C<7!D7,`0CD7L7,`0CL7O-MLM`p$ 0=P\IdxP ED3&7 E000 0000 0P70P7 HE000 0:00 3000%0  p S +8 0 EH@ 0`0 E+ ع01 P#Z [0X,=P0047(P @5: ؍LЍD?P PA0 D  D 0 0G<DP078t247x204<',0Rᓸ 38>@D',0Rᓸ -@>H'0\"L'87<7@7D7`"H7L708 0p  +@0S R R P\R @=:0@ R (#P0 00 ?o2 00p0S0020pp@p(0 DDNP 0 0# 00tDP P0( &H 0 P;P5 Z$dh pP#22C((,,0 @0S 0 S S0P\S  @ p:0  ᝁPphqdsPd p(0 P$0S P $1 P 0S P Ppp} 0 0# 0 Pp Xn0D00D000 0 @b 0 S E:$ E000X} H~-@  0Q//Q *///G-p0000@P `P` Y 0 0 R:@CS@D"@3X HGU( IG7A-TpW0 %T`@V0? C.CL0LS @sP X X| |00 S HH0P 0RS T p@-P J@Ppj<@-p@-@Pp PPpT Pp@1@-0@T @00T0S0 eB@@-\ T0A-p `R0080810@:  PP?W0A U t0  t0 <p@\0S d0pQ0S <%p? @U4 J.P P @$T T0Rt0t 0SnPt0 t0 88cPT0$0x x0RX g@OP0S :@# 4 C , R A-`PP c_O@T HT0Spf@Qp@- M z0 zBT0S0e PUx x0 BPc_`U@P >@ 0  R   Ѝp h  G-} G*:SR0M" 4P ((% " JP  0@0A 0(P  0Ѝ lB @T|   T0 R0 0800, P T8p(0SS90SSPT0c |  `P7 R|0   P @T T0R88oPY0Sx x0R ' T 00 HXXNPR P T T0R88=Pk0  >p0VS pc_ ?@TG 70SS`-90SS)P_PT00S8 0 G0*: S R   p 0S 0S @$T 00, @P Q00@-1@LS? @q@dRl@̠ BR001 BS@P@-40; +0S W/00 P@-40QD 0S D/00 P@-L0}O 0S So+/00 P@-H0a 0S Sp/00 P@-L0o 0S S$0@o/00  hp@-@Q0 eCRP0_ C|C0`S0 SQ 0` Pp@p0 p@f`0 p@~ { 0P@-|0| CQh0i CC P R !P BR #@@  p@-PP M0 Z0S@T 0d($"4d4#@c@Ood@T $S t0@0 Ѝpm/0d`Q 0000P 0 CC P~- 'A-0S00@Pd` pW 9/0000Pp 0 CP~- nP@-<0<.Q(0v CB!>000  @-@QkP( X C-TM@` P `ep) 0 e ````e 1 pW0`pV& e 0 0 L@ meT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0ꤶ t -3@- P Vep@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp pp` A-0Pp@`S:0SS 0? C/C  RS* R0 $2`V1S* iP a 0@DpR: Q  f O-MA 0TP` 0 vu6A@PAHh@081 0S  wp 00IЀP CP >P 9P 4P /P *P %pPp 0S l Cp X61T!R H9p 0;1#3K0$0&&*аp L0S% %S  p H p P p $  p ( pw P0S t00$Q0p T pe 0Sz 811K10x1ZsOp M ۽Pw p@ pP0hd p1 | p+ U%P u%P0 x1`@ (p X00SXppW0h 1SPp@Hh7s>P  |p PLF upp%d lp~ 0S P oQ \Z T  Op  r"BNp8P{ (Pv Pq | Pl Pg P P X00S 0Sa Ta FQp\%P `V%RY pTr0S]  pg 0x8!pM^pJ0SL  @ pQ 0$8!p<HPpB 1 R6 0S  P4 Ѝ 0Sp plh   ) 1 9 C U ] f n (   % N     0 @ ` d p@-@Ppp p@KRRA-P`p@@L0s  S$0 U@ p@@@dW0S R H R U p9 1 Q p@-P0U@S 00pH  P@ᐾ@T:延p/q 8&@-`PM1pSAT  p@xЍh ܿPЍ@!R 00  00 p@ a@V 0 !p@{`P lp 0S |00#40 P < SP 6, 0%v t A-PP 0S 1 p@ 0S @@D00 S U   ^ @ .S0.S,0_S-S```&00  @R"0T0 0D0蜪& @- @0P PT00Q    DP `00CS`0p S00 P0S X0X /XUM&p@-h1@SPiPPE @p Ǯ0.SSPP \޾P LپP < ǾP 0  .ѳPP p@-@P'Uh 0 K0 K0 xK0  hK0\/T,L)D& <#@4 , $      K0  K0  K0 K0 K0 K Ip@x  DP     $ ) 1 9 > G P Y d 8& 0(HLǒ -\ \` Q^ ,\ ,@-QMM@pPf[ p 0B  BJQލЍA> 0!>0 0B Jp`0SPE@E* p 0S:0@D0| O--,MlhpP. h}`  @ @P2 0S  㻽 k,P$P@ᱽP@ X_P$0X2200,Ѝ P,P, R ួP,PE0S p R* 0w2_0 6$ R, R |P 6$ R R ,Pp!@P !!! P/ P/Q0@-00@Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-MpP@`UQ:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 0  .0@I0 0IU:D X0 0 `TT  DSPO-`0 2"Pp Y*Q@ U Vn700 Ѝ$@@`FPp  X00U V 00  P     @3 \Do   ' T/T$"\T0 U V@@U V\$0@00@@`FPpU V `F@p~Ꜫ& O-SM MPd`p`p< @(<pF (I p V=7 p (W<4 IpTN    0 Mp PB M^P M/   3Sލ Ѝ   430V003 0M@ p  p@`1P $Ip @T* pP0P 0S4  \`@T*T  4cIp @ pz   G0$#$("( FIpe @  40$#$(B(   '0Tc(#"$ c$" 'IpF @@   1b"!4b$#  I  %  ⳾ FR .0M/P M/Hp 0S @00Sh%DHp׿00   A-p @MTP ЪЍR` R 00P0S 0 -0 0t00#Q0 $ V0B  00 0G O-4MX@p 0S\`d` (0S<0 p4 04ЍO 0  ,   3p0,0 ,0SPFX ,H#Gp 000 ),`/4ЍP V0 0 00U0  a, p04ph0 00X `F,P 0 S(0SVP$ (0S(00 0$ `;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R0, 0 (0S ,  05,P   p@-P`@P 0S $`P(0Sp,` P,` P  0D0@-MMP+ p P0@ۍЍ0;0 CQ@P N,P I@- PΠ Ry00\L  ^@-Qb00P`PV0 V=`V xЍp@@T   L0x@ `DYPЍp`Vx1@P 80>0S *⶚P PU@P PP`/0P@-404 ߻Q 0 9 C/C@   A-` (M00>0@SP  '00x B0epp ᙼ0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0>0S 0xPT A-@`lVPFPPPp2Xp`Eh,P hpl"h20 |V0  )l20l2@-Mp@`P!  ( (hX( 8p{CPU@ TK700@Ѝ Di///0@-M @ 5*PPЍ0 3"QAp 00000)BpO00000@ Bpl A 00  0"Bp<6 p 3* p@-QUp@p A,0h1p@,@-GM>`V ׼P00Gߍ@PF/ ჻9  0է ph0 1`忻0 DF?B> *P಻0 F?B ii@-@MIP4@ $ȷP P@Ѝ0 Q@0@ C@-V0SSP`///P $0 /Lp/Q @-@?t0@0Q00@-,M@P(    gT {Bp 0 00S p,Ѝ08i(p@-MP@  `  >  (PQBPЍp:iO-PQMMD3D CT0S,3 CCpW3 CC@H`"Ẻ0J01801\0t0P0 0K`T0`V3P 0P0T00T0` P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0T0 (@)@@FF@T0e  弱᪺ T0R B   @ Y@ P1F0FᶰF @T0  ጺYI @T0 0F0FᶰF @T0  XP qUPEPPP@ D$("(?p`ݍЍ  ?  UYI @k   C-`Mp"0` 0$` 0 ,pP @T?+Ѝ`Y*PPA 0 ,p0 S &+ `@`T*x0V*00+T00V:0 (P|P@# ( αY 0@P @-DM`@ pP@  ᇹ  ۥ !> U 134  R2$ $@0 DЍUi@il@-QM@  ^00 p l20 h2"m@Ѝ@-]MM`@F#P'?p PP VR 000S0S S SS wR0S HcpbVPS CQRS 0  Vxp@P V$0 Bp 0S$H`  El Y@p 5 $ L 80Su S S00,0S  R000@0S  R00@ H @ 0 H!>50H \0$@p\0S 01S h(Qc0 0 0 00 0 0pURZ1S SN F F]ލЍRIx(@P= >@2 3P0 0- H)@?TY$0S! H⪸M PPN0 0~Qii@ @- 00 000 0 +Ѝ 2S/2S00/@-@@tV002@-S0@0 @@fV0002S  / A-PM`p (PP)(@P. 0LL`0=p00! 9A=Pp00Sp  O?p PU0S ap =.)@! (!( 5?p | P.?p 7/PP #?p &P Ѝ@ qB@ lBpBfB@0O-0@p`M0PU  t=0S2P   Ϸ P崡 00S U 1!Z0  P000嶷P0 PPP0PU:000000x Ѝ@-  > ЍgB0p@-M2S@P`x (⇷VP@0  `(>o00ލp@  8 B@-P`2$MS@p0  0*00J4%40 0 0p`<$Ѝ@-@< I(@F(@-@pp G>p`~B 0`( "4`#/R00@-0@ ^ 0 # R 00P0p@-@^P T00p``0@D^޷"000txœ\p@Tp0,O-QRM@@0÷01`Q V00ЍP0p Q :8Q@SI ᧶넂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 &P 0 0B j 0 S2XZ00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S 6Ѝ@-@ 000YP  R " Ѝ@-@\0S \0\0@-@`q0`;0`00@-8@$@r0p@-800P@ >Q &T0x1 RpR 0S TT0Q  RT0800 >0S p@  A-p`KP%P@00<000S@ (0? ᪵@0K0cScO-@IMА`p< Iߍ0RS*  R? 0 000KC\%PP d R 0FSV (0Q 0S 8Qh00 00> 0200BS* V 0360 RS00 T+ $0K0pC70`$pQ@0 DPV VdP h  Q 2  $\7@ $Q DQV R <0S 0GS60 0 <@V 0GS80 0 @F 2!031 0 k %R  GR0+  %A C۴ %0 @V 00  0GS}20 0 ƴ@8 R  GRn3   ⳴0GS_ 7000  0t2@,0 x" R07 ,0 4'R SH g; F P41(1"<1815%#8107 dSV (1S 0 G0S#=00(  l(100@0S W0 2S 0 GS <0 0 " S 20@V081 0 Z00 GR P0@  k 2S P 0 GSQ0Y0 2 0 0000Y00 @  @V 00  ^00GSt00``@h 6S 0pGS^00 &A  60@{V(9(, "  P V: ART ,0,,S P R:(, "   PV: ART`  ,0  00D0C0W00GSP9000 0C4 < 1ᓳ@ 4S Y 0 GS8M00 $A ″ 40@B?S6; B?S6o 00PD0 KS:KUKe 0 S0P0"1L 0G R 0   T @<0 4 ^$S W0 > cSc5f 7@-P\ R&@P\00S x0xm08  Ѝ0P V<0@ pI,@& A-PR1 ѱ@ `0P pC R0 00 R0 6 30 00 P0 0:000 P00;000 P006000}P00ЍP 00000000 0ap00 0Up0 00 C-P@MT h"P@, 000`0001H0i0P0 0 x0`  (#0(10< P $!P( # @B  ) 0ta!P( ``(1  ( B0(t!p<0+"70 (P  0  )>``` P( `(1" (> *>Qߍ 0*   F  2 @-0p M$M0i0PS` 1 !p 7p@0S i p ۍ$Ѝi@ 0 !Pp  8QQ0500 0hpP P( ⵱P &$ g } @- 0080@P PU@ 0S@ ` `P@Ѝp ᔱ00O-IMPpᵭHLPL `PR +: 0@PIߍO"0,0{"600 0400 0 P` p00,0S2 V30$a2@0 0!,0 T;0 ` P ;X@PIߍOa@;0 ' P V`` ``00T;H0 ` ;(0 P @ G-P@pQtbP,`,x2S#PU`,@ ,xF:PI`?:, Q 0S,9 $1: 5P,`0  RG-00! 1`pP@T:p T  X ⢑00U *"0 pЍ0R0  ⒰ @=;L0 :p  0; @ :p p@-RMMp000PS`B S@ a00 0hpۍЍpt p p `F DE:, G:p V @- 81S Q S0 000 PPЍ R 0# DPD30O-S4M@ h@@ `0 0_0P o0 00 0 "P 3 00 y0 P3 0 0S0@0kٰ00T0{ @P0t 00 0 `Pk 0 $ ( eXcpP  ,⺯$(,8`P@ X0⣡  Q*"00pP 0$00S $⎯ h0n  ,(傯xt$S(P,8M P@0 Sh0` 0h0  `0304Ѝ 00 !0 pPz @ uZt $G ,C,0pS 1P@,0$S  S St 0P !R "Rp( $(,8oP@   " O-PM0@0400``2 ##`pp#`W9 pW6l0S,0S0`tr,0v x2S0`80w,0v 847S0`\r,0v `"Rtr0,p80x2 S0p0g,47S \9| 0 pߍ0$000 `2$Tp$`  `$A9 0 p $`  0 p 00 `2(4p $9 0 p(9| 0 p#0z0P,04l0<40 pl#0k@0"04,040 p]q`]n`dk`k,0 !P !904ǜ R6, `"R`P, 00`1,0,0G0 0 ` uX, 00}R0S 000P 0H` ` 0 ,V,p1S  ,0 !P !`" P ,0 0L00` 0 3p,`F W i {  @ p@-PUp@0L0pp@- MP#p 0` 0 0 `@x4pX3@ Ѝp 0 `j4p ` 0)`b4p  ?0U 0;100N4p@-@pP`Z8!(0.080000'0S  0R  Odp`L Ѝ@@40 pA@ Ѝ@x Ѝ O-`@p 0SP$H` E000 0 0000 ``0 Р0 `  $79 0&0003H081y H. ЍO <0 $7뜳  000H@0Sp3H000s$80407 HS8 0008 R#:kg{{'{z40S' zkg{{'{ z0زS+d0S( $0P$h0!f700 R::kg{{'{*z8 S zLkg{{'{* z$C700 H0S0SU h R 0R<0S 0S11H000s8040 P14 6P18 0Pt10 *804 \[00@0S0i0 N00.0 p ỳh`0 c P0 J.0S00HT{  P 0dh0 ЍO Ѝ??  & A a   K a t   p@-P@8T    (00@x1S0pS|q |10|2p 102022p R Rp0A-p@`0P S pH pph0`00 00p0 pd0h0  0 0 0$003 0 A\A p@-@`MV R 0 iЍp@F0H8P3 \00 R,  0i0P% 0S" <0S 0 $ PP 6  |n` 0 4D0@ Ѝp0 %Ѝp@o O-RpP\M@`$[P X0 #3P 0 RT000 qp` hPP. dL0S0 0@S@0#/L0} ?I00&P X0 "2P 0 Rzgjzzz{T0d0S  $: P $[ <Y y' `20\200(4"<10,00000<00@0,0D00 <$P(P Q48`LPPPTPH040p_ dpX 0 0{PPN  ◪h0&h 0x100(4"<8#8  10 mE00`0{@008d#l `\0 P00\ 0 `zv ]04S 1S0810 5p  [X  @0\Ѝ7S zD  # CDCT | e  @@-`pP@`+0 h0X $7S R h0@0 < ` 4 0 Ѝ@$0   p@- P@$ 0 00L0p@  tp@-PUp00CSp@0D $y4  (000L0p@  A-@`P p_ 800 a B00H 00<0L008 %A  t SA-@P` h 0R 00P5  081HAp` P!08!(0 AP     Pp p 0 ]B@ 0 d0 xP@0 $%AO h00h0 C-@p0 PR  R $ RP508Ȁ `3  Ji]@0S ]PP N P0  lH81 0S; 0 S<$2  cU0 <`,0  @ R 0P ЍG 0PS 0 PD0A 50 00 0SЍGЍ6 B cScP m H0p@-800P@  H*h00h00L0p@$` 5F_iE \/0S/0> d0S  0R/E. / O-M00 0PS000p,`8 0S@TQ 0 ЍO> R**P7S Ǚ Ǚ Y  S@1  H!  Q 0 S:500 0#p00 00 ЍOo Y 0 0Cs0&0S0 S0Lp0 p    0t 0P $0 E0SY0@60@ 600 0p0 0  i`P  =$0 S 081TtiZ<6@P P0S0 0<S<0P0Ѝ0    0 0PY6S700S0 l00 0P Rh532Y@0H%KSK?305.0 $Y0S0   P   [ i0 wt4 @R0S Y0 % 2)  Br  Br 0 3 $ 0 0P   0 Y 1 0 :|3 @S R@00 D$0BY<0<0818 ? < 0 P0aP5 0000  000 0P00S* -P *  p @ 0ЍO2600 0<P04 a0S * P   pߤ`81 000 0 0000H ``0\0S   `!0YP 0 8 R 1@sЍOKY 0 aY 0 20Sg0 00 P0PY0 '0/  tЍO $ ; W g y P ^   @4+ = N k p@-@l PT/ p@0HD N`\P d  p@p`$ O-,M@`P Q0 ,ЍOm`F 8VWP0@SS 0SP0t#tx'xVI:PQUE0VB:  "4"48#8S50V2:1 S/ 0 0P!' 0S 0000<`10a  & ! P .  ,,Ѝ G 0 B c  p@-Q` M\@MP  0000x p 0S T A @ ۍЍp0 V`V \@T( $. G-`j 0Px1@pTT 0S R T0S> R*P$ f 0 @W A- p`=@PAlPU- A0D0S0 A\0S0 Az G-M0MN0 ;p`p D Pd`8ܢ0480EL80H8$0ED80@X@8<8 ` m@TW0|` 0E 0(p$<ݍ0Ѝ`   7@-PX0B @P 0S40>8 Q0'Q'+  A R "'     0  Ѝ0@h}xz  P<gjzz+S$0@ | Ѝ0zD p@-@P0 0Uph0Spp@O-`P@T Q Pd0S r 0 0Gd0  ЍP0AQ 0S 0P -  `08p|0#  81- 8 0 $ 0R0hd`h08 R0, 00C0 0800<0  P`00 400 V0S $0 pWp:#<0 2 0 0 R0H0@S 00ppWX0H0DHt   p00 ,0`( "4`4#S /0 @Rp@-Ƣ00pPQ0`PE `@o@d@ $,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ RoQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScx1G-`@PM T+ 0S pW$ P m 8PP@h0 d0S4 ⚟xVd0 0S PPPЍ|0d 0|00 00d0 00090 P p8VPNP Ꭰ j | ܘPP$0 00 iPP 00EBd8>dX:) ⵘPPp ՘|0x 0|0h0d|00|0X,U H0S P 8 P  MU` jP < 0$Q S "  Q  pPp h  5< 0   `-pP; t0<0t00 00 80dQYx X <P \ ? U: +pP KАY $0% h  5< 0   0<0| ~ * p@-PP1 yCm p`01S 0S 0S 0S  (0 @T 0Q0 PSP 0|U d0S0h0d0p@ - p@-@T PP@0pO G-Pp`Ps@Ѝ0E @P00 4 @P 00000P00 000) 9 0 ($0P pEp)0 "p0S <,0 EP  0@R 0 0000@@s i @-@T PQ0 8 00*:SR h0S dP H` Ѝ$` dp P (0Q,0Q   `P 800000( ,0BP0S 0 h dW $0Q 0h0d`0SH年 0S/0S/   O-MP<`RH0@8 0xPG00ЍXpP P<0 U@ UP R R R0 P 0S8Y0000000Cs z@UЍO4 @PЍO5    p @@0 0(0$  & S 0S/G-P@M T 0p `x$00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000pGY P 00p0000 S0 @00:S 0S @\S000@:S @X~-&0@-P:P@A0 P\:R \:\P@\\ @R0/H& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PP 00pCލ Ѝ@@D;04pW 40p(0= P 0 `R0 :R `d4@0  0(8804 PF0P {0S }" p PP ;000P p 0S#00 0m8`p@Z +85"0P R 0K"0SF @ 늝@ &"0P 0O008`0 SWC @DpW:SY @\Sp S Spp00T:C @DP m 0SQ "Np0@P0 0 Y@ S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0B @D0J`FP  0S !  002 @ ` P D,0  ,0@PE P0S !$ D0A00T* PP 0P:SVrX~-H&. @-0  0 Ѝ@-(@ P T0 0X~-C-MBM000pS 0S`! \0S)  R&    RA^0C R[ x0Pv Ps @ T Q0%P ލЍ x0P P 0@PwT0 PP U Pt%P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R 0 A0SPZ\R    B{:R|R  X~-&1 p@-@PDp@NG-`= @P@ d Pi 00@^S0S:SQ @0 R0FAd P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0 Pd 0:SS0AR0@A P p Pd   A-p= `P@ d8 P`FPd0l 00@0S @Ad Ps Pd0 :RRAS@A P @-@# P 00S 00XS@ 00A ^a0ASW0AA0AS70A\2" @-04@0P 1$Pp~-4 G-A0SRPp`ʏ PU00Ѝ #P00CS0ES Pp0  tY( P j, fP .P00SW  R00S 0σ47,P R   S@T PR   R p~--A x~-@0@-0S |P dPp~--@-@[P08Gp~-p@-P@PPpRPpp~-@-@FP Q 087S@T p~--p@-SP@ P@p p@-@P * 087S@T p~--O-pPW`@P @ ЍZ K P ;PT  RT@ Z //////O-@4r00SRP` 4 PU00 Ѝ  P00CS0*R Pp0 0 sl UZ PD K8 GP P00SX00 S 3P P00S  $P  P | P ` P H P 0 P$ :㙉P갅-D G @-04@0P p"P谅-I X0@-0S H@ ;000D@JP0DЍP갅--@-@`0P0`Sp 0/P PP Ѝ갅-@-@P08D谅-p@-P@PPpQPp谅-A-P @`pPЍ0 (084SPUP @갅-@- 0 00B;P Ѝ-A-P @`pmPЍ0 (084SPUP @갅-@- 0 00B;P Ѝ-@    /A-0@@`P@0 >p00D0& SQ 0@/0PA/A/O-@PDpDpG``b0Y:0z  Z # 0@@D 0DA\0:Z: [=0 S: p `$ Ѝ `p-A-@`Pp ߑ ّ ӑA 00@-A^ 0 n$ P/o b2 0.0AT d$ Pon N$  A000R0@-0TM00`p<` @P}p TT0 pח@ 凉<0@寗40 4/(00S 0TЍL& -A-@` 0s P0X0p0pGWp0POP @P @pT0 @@PP @-p@-?@004@ptpG0SkX<$0S` D0ß0 R 40><L 0 @TC3^ B00@  C31X  02` 3 d ! \C2 h00C0'0hS8 0t 0 00\\刌H`| <.,`ZPPDpAލЍpP P 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0Zh0 :/1, !)kP 0H0-L& ` CB L X-p- 0H0S/-0P /-@-P@ADM|0`S)0S&0S S f0P 0P@ DЍ pW*P 0 0000pp@ Ć`0pX0 7/0S 0SP 0 P0DЍ@-p-L& G-dqP@0L P12C1b05R0 0 0&0S  h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R700嚋0S0PS (&0S,P P,@GJ--!\  0L0#0-t0@-M  L0@31 ^AP 0C! 0Ѝl- @-L 0 0@11D ^Q       -A-@@bM0u L0 @2# p PW%cP_  Bc p\  Zڒ$0 HD@,X#1010 2R01   000 S" V00 S  ЍA X 1(410~X1威42 ᄎSV Q`ЍQ0S ⽊ЍA跊`\c  Z} lS@l=%0S  Zk c00@- A-`QM0S 00S` @P9 0s$@Ѝ pW   @00|0pS0S @Pp00pFV@@ P 00T l@`pW 0S:S* 0嬊 ͊00ppp-p-O-`PqL10PSU$,@T,P@P6 h0d 0B1 `P 1h L0C R P!050%Pd @T: ቊ 0 p[L0CY1T*Q@@-G-qT0So:\0`S&7 2 c@Oo @d(0d$0P0@U1 0S.   B 0PN %Q * RG  r0B408@S 1:X 0@D8C 003 c0< ?o@@D@  PP  PNPP  0 @ S :   b1"0!00000P00,0P-L&A-p0@@ `P PP00`Pl P@=%Q *0S  -$00S:@-@@R-@-P`P U(0SP@P )@T \0@T0 4/ 00'0S 0( ( @Ѝp-L& B O-$MPpPeE00U0SXc )Z@ D3@ё<3 4/W(0Sp0eWD@XU0XW5 0PPW00 # 30+*[@C@dQS: ?L5yP KL ` % J2 10X0D30 2%Q b*0S _Z_1)Z @] 1@s1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P00P K D K0@D   .%Q   0@P0'0S 0L 0p$Ѝ*0S  -L& X-B @-M@p4aPE(0SWTP )@T; 0@0 4/0#880 ᙋP0Ur@P  㤏'0S 0| ( @Ѝr@P %Q|0S0S P͐ 00-L& B O-@QT$Mp(0S@ P xP'0S  p@Ps$ЍW "0T`M\0T*P* 0`0?o 0c  `o `S PP T 1b*ᇏA4 T!P030#P0S X $200301S%T#2Q FZD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp҆<弇`0<0 0 pP PP% 0   D֎  %T#2Q JZ*0T00S  DྎUKP )PU @0@ُ<0 ;4/пPP 004-B L&X- @-@H0'0S 0 00 0T Ѝ@Ѝ-B J////\&/\&000/ᜪ&000/ᜪ&000 /ᜪ&000/ᜪ&000/ᜪ&000/ᜪ&000/ᜪ&000 /ᜪ&000 /ᜪ&000@/ᜪ&000/ᜪ&000 /ᜪ&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/,&; ~0 0CS0 S P0 /p@-P0`@2Pp@ Tp 0A S010// 0P/!R/P/P/Qa/P/0000 /ᜪ&P/ 0S S//0R/0000/ᘪ&000/ᔪ&7@-@P@@P 04PSPE 0  Ѝ0} ~ &PQ 0S///ᔐ&03P 0 /!0 ACP 0AB0P CSoPS//O-M@X @ЍOSQ`pu rTp 04S`\k P0@`S@T~WlЍ_Uᚔ!` 8`PE`0r>T 04SJ:`\H  ٌT  QX Q(    !y  Z P    T0`[T?o20S@ @ @0R @T`0-@0S S @0V @ X 1،@@V X*̍ 00`00P 0! !00S00/g"&) !00S00/ !///@-@HV+D4P (  @qꐣ&T !W !-@-  Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-  ЍЍ/ //////P/ @-P 0A 200ЍQ@P $@ p@-@P0 `P  \*. Q  Rp R  (  p 0 B Ꜫ&-qA-P @p`>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p@-0 00v Ѝ0S/1>3 !/0S 000/ᄊ-0S*p@- @PO P p Pp/0S/p@-P0 @R`*0 PQp0Pp0S/0@-0C@ 0 0  (  ( 0 S/! ^R/0@- @0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!.r0`A-PRp `@{P 0! 000A-@P`p0 SV1 V00W W0Sc0P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & pG`P  B0Z  Bv`FpGPo`FPA` !A-@aP0S0<R&*1 21<0S0 0PPR0 ,S*!!!0 0R0 ,S(!!!,p ([N0P A, (0 ,P,&&&A-P` P0PS\ ]\ xp@BX T 0| 5PᾄPp괐&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00脊-< 08 C800/`Q'Q!//ᜪ&0A-sMp00@P` p0000pSp 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0Wꄊ-p@-P4`@/@P@p Tp !Q 010// !,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0P`,&&&O-@P 0RMp\ ᲄ P&  @᫄ P 000Ѝ 0@  LPP ЍO 0 PS@  0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000〦 0 hSFh ,VKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0 @`F p@ ᢇUh 00C0c-R [RS :R =R} 0S: N .S0,S00``0-S]S0S00``40\ 0 IY0 S:0`S00`0S00``E0 ⋇0I{P  0 (SB(0<R$  KP    t P $0  0$ 峠S0tS00``0-S]S0`S00`=  0 S:0`S00`0S0 -RZ QW]QT -Z00  YI 0S. Y0`S 00`0S0<Y00 Z0S  Z40 KP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P Hp00勰P00 0  EB#ЍORW =RT ]RQR :R ]R001 ! !,&-&&& 0p@- 0(M@! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@Ꜫ&&&0A-``Pp\U@ [U_0V:0dS00`00 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0 D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0SP;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+ꄊ-)>{^ ]&0@-``P?Q@ $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   0p000<20to kmi0V:0aS00`00<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 S`0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 00t !-&^ ]0S G-`M pQpG  ~pL2@P 6W:} Ѝ>PPP P $PPxP @P 0   uPP6   $ ( , 0P4 8 < @ D t| 0000L R:0S005000 S8:  0A 0!GP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RQ00p< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:_00PS, 0E10S*P8I0@0CU00C0 RB  \ U B!U  E 1U, X0C ^ဗ!1L0XRU!U!  R0>P P PS 00 000@0000 0H @ R00d000G 80S@ 0Q10CRZ/TUUp\p-Ee,1p@-@0PS0<Q:1,1 R40S"`$0V):8p1PS58 0#p(00<^ 00^ 0S8opU 0! R R0 0vP`,&&&0p@-P0@SQʡ@P80 p<0S P pH0@0@P(00Ppp@,&&&O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  S]P%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(Ꜫ&(!O-P0Q,@p` V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. `F`FPV00@>N>0> \0C~>!0>#0 R@u @O-4M0\00(0, 0 00$002   0 @X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _V _UQO  X 0FPyu   p$ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  X `M P0#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2Ꜫ&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@YS  D>31># R 0800 0@~Y_  DS S- S* S( @` PS 0 b800 0@YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0, 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  XP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(Ꜫ&(!O-,@pP W`> ^* +^` ^i ^O ^a pP ^o ^Y  GP A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>0 E00  R?o20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!Ꜫ&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-u!Ꜫ&O-pMP`80U:Ѝ0!>3S S8 S6>S1 0 800 0@~YS  D>31># R 0k800 0@bY_  DS S- S* S( @` PS 0 F800 0@=Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0 0VPP   W` 0 PE >#P   0 0T  0Q>SP!>#"RPEP0>#2  F O-P-MLP0@p0H #W # 2RS T| z>#R  Rz R R Rg 0pR0R T` 0PgY Rm & R *Ra &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Rb R 0R  _ R Q R* TQ_RoQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00t 0S*0S0T S00S 00S4 000_\0S 0S00L 0S *0T _0S 0R0S \0 _\oP0S00S* T00000_R0W0 S  _0S 0R0S0p>3p1># R{ 0G  a>#RJ RT RV R ^R Ra R 0>c0D2H0 00 P0 0 A>c pr8 pRd[2 A T0,  QP%0a !0R@pH00 0 P>cp0A0!RH{AH >3 0G  gP 0G>#`0 @ [P01!># R 0 p`>c`1>3"S`F 0 D>c2 H00 0 6P0 0 ( \(Ꜫ&(!O--lM%PQ0t @%Qo ppl        Q 0"RS. 0 YO,Q 4^ 8[ <``F0` 0Z01S` 0s vQBo \R 0C1!S` `0=n0 0Q[ 0000,@4H80<@ = PP  TX0\ L0` s Vd 00 S`FY10`0 0 ,`NP XD0S 00D0 ,>`PD00D0 0R < 0JS : P PZ Z `p3`XD0SZ 4P ,0@P4 pj,0@ 0S%00D ;0$00D0 ,LP5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SPHDhX 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XP4P HP PR [S. 0 Y),Q~ 4^e 8[b <``F0` 0Z"01S` 0s vQBo \R 0C1!S` `0m0eE,& 0Q00000 V,@40H08 <@P0T0X0\0 00S`FY10`0 0 ,`P XD0S7 00D0 ,r`PD00D0 [ ` 0R< 0JS: O PZ`XD0Se 4P,0@P4  p4P HP lЍ,0@ 0S%00D ;0$00D0 ,[P5DQ/*0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SpPHD_X 8 D0`F0C0X?4@` 0 ,0@`\ 2ŁŁ XPpS0 0 Y,Q 4^s 80 0So <``F0`$0Z"01S`$0s vQBo \R 0C1!S` `0k0$0Q000 0,@4H80<@PP T X 0\ L0`pV 00S`FY1*0`0 0 ,`4P XD0Sd 00D0 ,$`PD00D0 0 S` 0P< JP:$0 tN $0PZ`XD0SX 4P,0@P4 ,0@ 0S%00D ;0$00D0 ,4P5DV/0 F0,0D`P% 00 0,P0HP 00000D0 ,H0SUPHuDjX 8 D0`F0C0X?4@` 0 ,0@` V 2 (11( XPppp pnpl-Ѝ///@-c // //p@-08P00@S PpobP p萊-7@-@0P0S TP Ѝ0P ꐊ-@-@P 0S j@P/VaP 00 0/ / 00 0 0 0/////0P  P@- /<!-4!P P/ /$P0/ 2#0/pO-,MP`TpP0`pR0X@$*$0S$00f 0Z0000\0 0 0 R0$ό030#QZ^A2  # T P@PY*0 0 0T 0C2@TPT  # 3S R0 YR00J 0S1\0S# 0, Q 0S 0YSr 0 0C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S 0R #3SQ  PR# 0 B 00Y00S  000CS 000G 0S  AX 00S 00JS 0 0 SDH S0" 0{0 C R9SB0 S H$0 0CR0%2 L U1000S 0!03S 00C 0t0 S 0 0TT @ $ $0PS$0C[ 0SW  00,Ѝ 0R3Z0B\\00S SC @PTP>: 0; $ $ 20f`+*Q@-0M(,4`@0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&-M{ {zЍPQ@-0M(,@0  P#U` `0`/"`o R?#0.o^,AUU-00ĵЍpFW`&O-0M@p`0W PV P'Z P2Y PyX PV P:$  YW Pr  Y  YV1  Y YZ  Y YY;X% h YT 4YЍZY!X3  Y ,Y  {Y <uY~Ѝ kY $eYXVZ  PЍO^|(H((((''''H'0''&&&O-@Q0M0R00P$値 0` p 0P R nRk a BR $  , ni PQ D hiPL Ѝ3 00]iP~Y U000T0003 0$0JiPNY U070T070H 8iPY} U000T000 P&iPY U000T000YW U080T080 oR 0iPT000U000v ~0 XhP 0 4hP 0 `hPjYL U080T080U0 thPz 0 hP 0 |hPTY8 U000T0008T080U080/T000U000&T070U070T000U000 ЍT080U080T000U000t hPYv Y0 hxhP 0 qhP %%%@%$$`$!A- `M0 0 !!0@PH@>SHPPP PPP7"`!P`03 pP0  p+ 0 lp@ lp@  p@@@dl PllPl 0PtlP`Ѝl00@ŸO- 1M MP (@PD`0\ "( pp (-pp^~ @D;h@ 0@k 0Sr pء1 00p 0``00p@, -0)@Dt0p )0 PP I0S Rl001ݍ Ѝl0S 0F\ RK Pp @`0!@DD4 [@ 0 0 0V   0'. 0p,R 8r1ݍ Ѝhp FtH gt0@-M0P  Mp ZPp@ P ` Ѝ00 0Ѝ0@A-@@0s- APP0P 0#p` ``00`kppX`p k``00`k 00T<p@-@PCM0 /\P2 tpP@ ` g@k00t1 @ 0F0 F`0S VS00 SCލpp@@0Sk@X00P0@  P@1:k?00@k00@p@-MQMP4@SZ TF /[PC QP0s, fP!QaP` 0"pO @ 0@"aqpF @ p> ۍЍp00si/00p +IVk@0P0@ / P@1:*k?00@p 04k0#S8p@ k00k@ k@ ؟%@L @-sP`O-$(X,p.S`P@+Wu00Sb [0 0mOP: $" 2Q > !"04x"3S20*rW00Sa [0 0?O P : )" 2Q >@AQ!Ou0 {0Qq w{` "O P : 4#0"Q . ![0 0 OP:t' 00{S' w{Q e 0NP:  4#0"Q .@AQ!O[0 0N P :[y'@w{ 0NPy: 0ᚔ)Z@0S20n2" U%> "Ww{T N P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ P, `S 0 S1h!R 0SLXB ,007H+Q !POT d! +0C 3S00< G {{xP 01C /AGPV P   00%Xp X P$0SP i$gЍ00[pG* 0C!< R Q!h! R@( Qt08$0p|0xpx0(0|0p $0ptG 9p00W1<PSQ_ }Q<) ^( S*P0 09P 01<p@(Q( !hQ0Wt08$0px |0@x ( | pt0@$ pP4  L A!h!R"0( SS:t08$0px |0px0(0|0pt $0p 00WP<\Qp5 LS 0,^0F <P0A  0=R< ;< @%0Dh0(00(0000,00,0  G ,0P S G"x  RQG#0 SG P\0sG `0d   0 Q0*0^*{ r0s{P T80< D000@ h0 0$% 0S 000000(00(0,00,0(00(0$Q0P S %R" :"  R#Ό01"?!x"0x$00$0t 00 0p000l0S <\ ~ X  NR HL\ @0DhT 0Rk{AP{{$hE `&L0P 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#P0L dSH0 G`0G0Gd G 000#( R 0S $0S 2S0 :646 0Ÿ! 0Ϡ!>! 2#1110N 0pP<0d2@#! (1#@ 1110N 0  ΌD !` R<l?, | 0/  "1? A D  D @0<0S H0Q 004 0 2 0< Q00:P0 0<R$0h00c 0<0@]< "0RD01H0<0@ #:6 00" 0Ϡ">! 2#< 1110N 0  ΌD ! R@$?, 4 0/  "1? A D  D <0@ S0H Q0#Q0  0C0h  BQ_ $0 h00$%; 0dR  PM<@ \@@@Q<&<0P0T8<  \00 Q00000S$PT8< G ! G! 0 ! 0 0S(0S `5d0 Q00: c 0<@\%20SD000@0H<L#:@6 00!$Ϡ0!>! 0H!!!0C" . D @" 0D, P<8? D 0/  "1? A    @< P0LD \0#G0000$02p rp t t z  0 RR  0 & G%g G RQz#Z!G RQmG# &K(0<0S$0@00`0<\[=QVH NRL0X\q<0@0@0D0h,0 000 0%0 0" P9#R3 R0  \Q$% 8<& dP(  01) :60 0!$Ϡ0! !>@)0!!!0C 0Phh)! /.P P@<΁!@? < "AL00 h00H%00<0@ C00 00S ^0  $0h0 C0000S ^ 0@D h0 BQ0 D00@ h0  \ps; 0 *R" O-Mp@$a0l`00a0W0 T# 0 2c1  ?<0dPP O 0v> 0`0?d00 0P0?T0 080?0 <00 4@$@$$%"0000  000T ;0h0PJ 0TP dP; P< $`Pf0Sc R`ʰ  R\ʸ  RX 0 0\ 0S0`@dp?O$@T'pET0}Np0`@dp00Xa0@D HPv^D PEJ000000 0H0!00R0SX0 0h080000R4 t PQlpx|POXRSY Y  h6@p| Ux Zt 0Sp0Xl0[h0 Rwt XXڸ8常0:=CP0p00@t0p`VPu x0S `pt00 0800@4p0 h00 0uP |0( x PZv> 00! 0#/!! !./ B 0S!?.P  PɊ 00#1?Lv.C BAQS| \xt PtŒ`00 qp  A 0qp `pV@P 0R?o20Sq`00ߍ 0h`0h00 qp@pS Q#! !pY@2NRp/ h0 P0,P_000 `0  ZR 0`S 00@ (`0 0h@`0S 0V0ZS0 dh`  ?PhT0y ?8h<0q ?@hD0i ?HhL0a$`X\YZP R`_T00_0S@Tp_0S? 0ß園"b^2):##c2S# \TP.j<IPP 0l#0dT0IP30@pD_0h8P000 `0@4p-P ? /( Rß&0Q 0Z/0 #10">/ 0 C!a0C0 0"#0R"P#. X#0,nX10( #ΌQà3\!=30S C! B^ D 0 E2qp> @p(pQ+_#00(_0S @㼀p h 5@p_00@pߍ輀X) XXʕ 0_0 Q  s!P ^T00^0S10(` #ΌQ0"c01 2c1@Tf^T00Hxl)\P(\ ףvɻ %I$@-@T p>;8Tfat X00 R 0 R 0Q/  /  l  DQ p@-0t` SPPH 0@#  T\  Q(p/@l@,H  Q j.0 0#  Q/k00Ɠ\ 0@-o>lP 0@" \ 0 /DkA-@P `p@P0% P @PPA-`X@@P pjNP0& P @PPDjA-`X@@DP pH@P0& eP @PPiO-P M `P; p pn$0P0@P P p % 8P pP0S  Ѝz P0 0V QW C0`0SPiA-PpQ `@Q P 0@DDB(000S  c@- M`ppPP) e]  00S@ Z]0"S# 0p000S0 07/ ЍE]0"S1Ds`0pX000S @ Ѝ1Ds( 8LcH4b@-@5 3@0O-MP@U`  PP2SPS PW Pp B `Xa `L`@ P) 0nS: P= MP0 0Q Q WP P I0 B" S000P Ѝt0 00 S Ѝ0oSP  `O-BMM@p\d `0 0NP:LPP  8vNPn00-V@P C @PP`J$  0PPp +0P0  0PPp t"@P"  t0dQ PkPUPp`  gpu 0 hWP{ @PP0 PpL l⸠P lP1 /\ 00BލЍP/U ` P p8\0SI   GP G0H00 PPp:  F[ X0 0FP@! 0  0 0[ X0 0F[  x 0 00tKY00/[ 0 0FP[l0 P0@  F{[ @0 0FPrx8zd@p@- M 0  PЍ- M> 0  PЍ- M? 0  PЍ8-0M  0eFPЍ--@( 0P    0/ 00ffp@-P1FU@p[,0,0? `0  6/pLfxp@-PEU@p[000? 0`40  6/pe@-@P 000l3/e@-@P 000l3/Lep@-PU?o20S@p 0 0 P5/,dp@-`PVU00P00S@p$$  0P 5/dp@-PU?o20S@p 0 0 P5/Xdp@-`P@Pp}Z,0,0 @p@/cp@-P@P p$$000 B3/pxc-@- M  qp@,,000G3/ Ѝ@ Ѝ/Xc@-pp@  000G3/bG-@- M 00`P O0Sp ЍZ880M0 P@:/l0bG-@- M 00`P N0Sp ЍY880a0 P@:/a@20!P(///|////////////x/l/`/Tt/Hh/<d/0\/$T/L/ D/</8/0/,/(/ /////PXH<, |l\L<, |l\L<@-@$ MP05505#0%A0!0%P$00$0Ѝ R/,0p@-S@p(P$ARp$0S* >$0( 0C\ 0 CR$ *0#$00S 53$07$05 0$0(0, 0 !PpO-DM@X@fP, p@wW Z P a@: Z Z|7$0P$  0@X Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S 5,3407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P [ S 5>37,05  50Q,0R 0 CQ * 0CQ,*0#  ,0 0,0S 537,05 50S 5,07,05 50S,0DR0#0C R700C 1L5$0qS 5<37,058`0,0 ?R0@SKX0 0,0S 5#37,05 50,0 QS 57,05 50S,0 R0#0C R00CP,@DЍQ T` 0pFQ)Q* AR bQY fQ ?R0@SP 8 b@S B;; # C, 0c0#80 S ,0 S 5,3407,05 50,0FQ0 0 ,0R S5 7,05 0,0 5RS 5=37,05 0 ,0 0bw@0`fpF2$0?Qa R^  2! a, A0!p @ `+ 8 Q,Q 5<37,5 5,8Q,  P,  , Q0@5p`0``` VRQQ W  P [P=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R`0W  R `S` 0P`0S 5<37,05 50,0080:Q 5,347,5 5,@p`0%#jo%#jx%ju-M{00{Ѝp@-MP@` 00 4/ЍpO-PRM^  `WpP+a@/FP L0  D pp Ѝ@0S 0  D  ppV0S Ѝ贠 wV0S(D 0@pD 0@ pp\V0SWV00SV008(@- @MЍ輰O-EM MaX@Pp+`E>A ]T0P@(T 0 QT@0PT 0 0EAP @ @UEލ ЍV00Eލ ЍU00D@- @M`p PQP+ /S R rR  P   0@  P@ЍP  rR 0rSX 0 , @0 Ѝ@xU 0 PA-` @>p 0P/S /SP @0 Sp 0 S ; Tp@-IMM@`PP {p 0: S \0 040qp IލЍpbUO00@IލЍpZU004p@-IMM@`PP Op 0: S \0 080Ep IލЍp6UO00@IލЍp.U00- M 0  PЍP 80Q 0 08080//p@-@P PP`  PP u FP  p@*PPp-40- M,0   ЍЍ/DP --M  Ѝ Ѝ// -@-MN<@@P 00  0Ѝ@Ѝ/ꘪD0-@- M@ OP  Ѝ@Ѝ/O-`Pq,Mp;  PR$ Ppp @P$yPX P@ 0 @XP N ,Ѝ000:Q!0P00,ЍTp@-0(MP `& (Ѝp0 0 ꬨDp@-@`PNpp p@808 0p@-(M P` g& (ЍpPDHp@-P@0 0@`  qNpp p@mDp@-(M@PcNp ?&8 ](ЍpX@-@P0 0,M`P KNp '& E,ЍhDC-PP,M/ ``FV` @R p V `@0 @T N ,Ѝ00 0:2 0,ЍTp@-0(MP `% (Ѝp0 0 Dp@-@`PMpp p@808 0p@-(M P` % (Ѝp舥DHp@-P@0 0@`  Mpp p@y8Dp@-(M@PMp %8 i(ЍpX@-@P0 0,M`P Mp u% Q,Ѝ蠤D P $ Q80 8@-M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/@lP/0@- M@0@00S 00000 X | PP  h00B/T00 Ѝ0DFP0h,((D 3O-0MPP 0 @D `p@ P P00U pp00C  Z 2ATT00  RF LD@D T]:[ 2 0000~`K L0 V0 W8 \2ATT 0`Fs 0Ry L  0/ 0 B)0SH L0Ѝ V0  0 L ` 0  0pHX;0S2 0 Lv 0 B@  0 B  BtL`FtY  B 0  BdL 0 z YL 0 0S B 000Ѝ 0 ]ꐢ 0 0 Dp@-@P*Lpp p@0RS00 /D0D0p@- P@ Lpp p@xD808 0 QR00 /$Dp@-`@PKpT T   p@php@-P X @ 00`KpTT  p@p|D"O-P M q 1D`00 SH,0?e@Qpa A10A1[10GPp`u ,  PPDEQ "$(Qp|0Bp7 @[0 S8 0?# R R!R@[u`p ,0 0 00NC11n00P0,0@ Ѝ@ 1 0 00uDD0D 0@-00 @T %AP80@080@-@P AP80@080-M0 Ѝ-M0 ЍO-PؿiM ̑Ёqf Q`P@ P?`K͌U P\?K͌T P?F͌(1S P>F͌(Y nP>C͌ X ]PL>JB͌8W LP>̌1S :P=^B͌`=@ 0S708x H0PP `P, P  P P P P P` P@@ (P PpP (qP PD PxP'( Q780H0x100CS00000C(0h00Lp P 0QP ,0 `0p@ , W @  gpV/!01AQ 0 0 @T @aT, W   @@daXhP 0Y Piߍ P 1 S ,0 0 0 !1S 0D 0| 0?p00,,(00PpL!!\V( @  B  $48p< [$ 00A00@S9 00a1 P Ua PU, [000 P,0匐0Yp$0p1P,@`@P|P ` V ,@0@S 48p<PP 00 0R 0'LpP1L0ṿ0P@X1@ @P0屿0P0$001T0ᪿ0PP1P PX0墿0P0000᛿(,p A8 P40P0@AT 0<O< U, p@PW 0g1pY@10P00 `00V00 `ZV,0W0 P `ܰ少[@`@PP  ` V @pY @ P @T 0 P8 U`T,p40@T`0 (!  A A$@ 4 p,`0[T0, q q000 p`8@<\V 0f1`W10 @ 00 P00U00 PU,0 V0 @ PqZ0P@ 〻P  P U `W 8@<\@7P,0@0 0 ,0pG0H W0A10D|ae>pU( `L( }L( xL( sL (  nL,( JiL8( dLD( ^_LQ,0 1@-( `BU0,p4@A,   ,0@0H T0封"1D|Q>p T Pu[3p,`4 TP2 00RV 0Sf ,00 [D k! 0 SW !L011@ @ T @T,00 0 @(0 pPCT,`4 0 ,01 , 0@ H 0T1D|=p! 0R1B@Pㆺ0P @T  0 P (0 SQ(0 00CP, P0T0 X" 0 0 B00 S3 0 a0T !1 @Tap @嘼T,000 @,0,0Q@ 0@1P`P00P: `V  0PP$0SA ,00 $p1@T d!@W3 !P011D ` V `RV,0 0 0 `Tq[V` ` [  0 0P,p40 0 (0 SW(0 00C,p @0 [# 0 0 B0!0@SB 0a0X !1H P U a PU,000 P,0|!0RP0P1 `@㙹0P `V  0 @ p3 00R80000S p,`4 O-`YM|0cS PAX3? 0K͌00 00S 3?HPK͌0H00S2?p`F͌(0p00S|x2?@F͌(000Sp,2?pC͌ 000 Sd1?耍B͌8 000 SX1?̌  0110SL1?<1NB͌ 0810 @iYߍ 00@0Sk HP90Sv p`20S @+0S p$0 S 耍 0 S  10S N <T0 D@-<@M $( ,Ѝ訂D0 D@-<@M $( ,ЍDD`0` 0 R/DDQ 4Q(00?H/D|$T0P0/ D @  R 0  R$ 00?H/t|$0P08 A-D   R'P?UH0@aaS@T,p10 0D   C(   S@T,  R 00/|$0 0 Dl P  `0H?30\ -@@  D\,00D//|$O-P␲4M  0pS4ЍPD H0 L ! 0 0|!0:|@Pq 0`D0ZP`@P0Z0 T〷0P V@H 0`@:1 0?3Q |QN D pH0L  00|"(0t:B:`P0S R,@P@RP 0 : @RP0`S4ЍP U|00 )0Px ``0T `@004  0`Pd @|`H|$0 0 L|D`0` 0p@- PU 0@S RP7pp||Dp@-@P 0PS ;P lpp0P0& H -? \| 0DR0S  0R0000 0\$( /{|$0 0 zD 0 0 /8O-MpRp2P0@`0Vu T":L"@"4"("2 2 $ 2 T 00 1 X 00 1 \ 1 ` 0 0 1 l  1pmp00pnpp@z20吲唢園 $0TX0\` 0lm0n j1Q0( 0 0  pЍ|0x0t0p0l0h0d0`000X000P0L00 0D0 @000z h<0,$DC-pP␂M@ |`P {h2@0@Z  @03""BBB {6`@"C{@@ÅCC尵PU Cb pP 2pK 0p RZ @B0 @@@(P9 0 @@@(P. p* #$p& p0 @(P  a'f*000S :3S 6ЍP ZB2S@ T嘷ᖷ`h0S,;pPcw4 A-Z`pPp ZB2S@ Tbqig000 R A_ A Z(u@-+ hQhP@EM`_0  S*<10#  !!!- !!!!>  !< !^ v : !' !.{_ !| !o !* !Q>{ R pp1 R 0S8ЍQ L0 0 0dEl00TЍ!f lt  <0l 0 S/t O-`Dt@M[p+s(($ X&0CS0S<3((,P* 40H @08p{8 x%t{ġ`X(ÂPPßHHßP@@ß88ßx00ß $$߂ß@ ßÂ`h"Ÿ! ⼁!: R 0S1810S XけЍQ h2 0 0{DPr'>ppGl`( D(@ T (0Ѝ>㝶@ <㗶 ^㔶v㑶#㎶x:㋶'㈶#ㅶ0# 0偶H#~p-{-x`_u|rooplriyfzc{`@|]h}Z`aD r %+!,!-!.%0%f&i%j%k %l%m<%n#qs%t~$%#up4%#vr,%d"wy{#%e"`"|oxz< 00p@-0'N[( eD(@(0SpO-M4g47`,0 Jҭp7划00 7 `0P `00 S00U0S}\ p @00  4` S  00 4 `0 s 00bR$ 4S4 0((&0 0Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Qt l   P5U0pS  p! @00 4 ` $R{ 4 0 0 ; 0M $Q B q/ 0 ;0 >p4 S S040ST 4 0r0  cR0$0GU  p p P p0np P 440 s 00bR43 $0$ 0fS t30l3#`w pS 83003#`h p3 0 B ` 40q0cR 4S02$0$ r0 0C aR?o$2#n p Si p  0 s 00bR40 ;0 㝴p P `R pa 40 s 00bR4 4$R40 s 00bR40 ;0  { pE `Q q 4 00 0q0cR  0`  Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 04 4 00 40 s 00bR 44 `lX0HAQ(p80p@-P@ 0 P'B TT TpO-@Pd4`DM0 8 p$Qq  :Q#R3Z 300S 8L2P@P@P@p@-@pQP8=P 3=P ;P10S. ,! P:p0@Sp0S0[S0mS S@ 0S 1CQ'0@S ;S 00C S0000@Sp0@S mS 0C;S P 000@S;Co0@O-P0lvSpM`Xf` `JP U0 `r(ʍ"(0%I"R` (0$00 03S5PK T$5P  XRڈ5$50T p5"00`4S03P00S5 p0S2 4S, 4S 0t %W、匑Tp"2 0Pm 4p2Z& LQU# P P P ?<oH5S4S 4S0?o2 )44Ytx2 PuX  3<P3Zx2  *<Px2?;~0x2W  <Px278x23X|2 PW x3|2fЍ0 D $l h $ <% p 0$0(0JXj ;P Y ;P! Z$ ;Pp2?;~0p2|20P?0 r("(0:H"R`p2Z ЍO8 80 0P T0 0//4Op@-P|``p@0@ =0SP0P0:3S 8 80 00 :L#pN0O- Mpp3 0hS0dd*B`pP 'WW p p PS p   r  `R  00/"1 R" @0S S8 SW0B S p20h2#`pw  @U ` Ѝ R j  P  Ѝhp P ` Ѝ0 r  `RR 1   S7K @y ` 0  S q$ lR Q1   ЍOp  q B`R/o"n000 ?c Ѝ 0`0`0 0R9-<  0 @NLQXT(hG-@P4S43P`Y 80$ RF U ʌ3S23pSnW " Rp{ :8<hp@-@0@P:#R| Ó \ "R-- , p #_P`p:p(><p@-0@DPSP @p (0008 <@%8 ppt=DL0L 0@-@0:#R#R"#0: =d0d 0@-@ :Q Q- :<0 0@-@ :QQ σ  #p P{ :P<0 0@-@ :QQ σ  #p PR :;0 0p@-@P :QQ  Ãp #Pp# :ep;0 0@-@ :QQ σ  #p jP` :QL:p@-@0@P:#R   Pp @8 %8 "R--  p #5P`p:pp8 :9<D@-<@<0@00:3S 0 0 8 @-8@80@00:3S00`8 0 0@-@:#R&#R) -̌@́ $p $" "#P`[:#R8p@-@0@P:#R(#R+ -́ " "  $  $ d p  #P`p:#Rp$7hp@-PPP/ 0@` :QQ" “Tƒlp lp  #VP`p :Qpp,6h0 0 H5D0 0 $5D@-@ MZ9)qQp* c0 0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#cP`4<0 0 000:P/3 0 0@-00嶲3X0X 00:3S 0 p @-5+P`/h3\0\ 00 :3S 0- p @-P`/3$0$ 000:#Rs/2$0$ 000:#Ru/`2000 0  :#Rs30/,2(0( 0 :#Ru30/1 0 0 0:/1p@-@P0P`M00 p p 0S|000 SC q R0 :#Ѝp R 40,00 3/Ѝp|1ht@ 0A-MRBP0@Ss Q `P 0S^ 1P 00p S10p Q61 1`p0V0S  h100V0S  034p O* 03, p /#%ЍP  QÁP 0:x   000 0050 0@W500p0Tht@0DT@-,@@0S>5008@-$@@0S/500@-MT@@ 0S Ѝ< 000 00j50 0Ѝ4@-Md@@ 0SЍ W5 0R  (00 Ѝ I5 T@-$MHBH2@PQ :cVW0r3p p)0Scqp 0SQ1p0SB '0  B0*1`00|PN 1@ 300 R 8 D 300 X30&0  :3,p 4 P`$Ѝ0`00|P @ 4 0R` 00 `o400T @8 300 4,tlpC- M` 9S P@/M<0@00:3S W  Ѝp (* 0 000:3S/D)X0X 00:3S 03p @-(P`/)D0D 0@-0 03, p 5P`D)@0@ 0@-0034p (P`(0@-PP MP* 0Q0@00xP 000 2000*C & Ѝ0|P H000 24000*% Ѝ0(l/ 0 0@-P@ M0:R# P P&tP 000 20% Ѝ0`P D000,PP Ѝ0'l0 000:&!0\ S0 0 Q/p@-@Pp80pPU,LQ (0 P0C0S0 U@Tpg#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@pVЍA-PPM Q@`Q00?`FV`V` ,p(L 0@pqVЍP/\ , 0 B0/\//A-M`V,P@p(L 0@pETЍA-M`V,P@p(L 0@p+TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ , B(0 @T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-4 PlMVCT_ ,P@Q@8 =$^8R@ 0000@0pP 0-Pp4S-`0@PP#@  p) ,4,  [ 0 ~+ 0 e lЍB 019lЍOV0*O-0$MP2Ut 0$ R+`V} 0` 0P 嵢 W):0S`H9 0 @P$Ѝ 0SM S7 S0W  '00 04S $ЍO@ 0 @S S" S0V   S0pG0 0@SG0Wᨀ *H0W0 `@G0X0  /pG0Wᧀ*`@0X0 `@ 0S S0W0 @Wᧀ:0X0 \O-PQM0 43pS`.0S+R= @00! 0@ @00@ *TP/  @ ` LP @ PER 0  h`PЍ` D  P 4F " 2 Ѝ@ 0\[P0  0 /ᔼ 404 0  R *P / L0L 0 \ ʌ-P  /404 0  R *P /lL0L 0 \ ʌ-P  /(404 0  R *P /HH0 @-0^ @P 0 @0 0@-0@T J#0R4 B0pQ 7@.P f @0808 0  R *P \/D D0 00SP:P4@//X000 000S :P /L0L 000S :P @-zp @Y/0 0A-0`V* Z3 S$P! #Rp@4Swpp3@Tw AkB0tQ 6A$.h((0 -0 i000 000S :P J/T00O- M X% p `P 0 p @P  0 Pp@ 0 .@ M Ѝ@P  P /p@-JP }3S P`4`.30PV(  03s S 0P 2 $R 0X0S H03 20X #$04p03pp0Hp@-jP 93S @P4P30@Sp@A-`Pf JSU?sW< 3$@PS3 SW*0N, SsH0S0 WP3PSSpP4Sjpp3PUp,0\4000?a000401C0010L10|1spp@-@P X0P:"C0T0XppG- ؀\/P@p  `lP LTL VW PT VW  T000S;0 W0 0 |O-($Z Ap`PP@8P ( ,T2P* T P 0 , @00 ,0\ WXP  RX8 @(  !,@0|d @-?C0 @   @ (( ,  |TA-@PQP% pW# 0 0S0姝,奝000 R   R   R  P 吝᎝4劝`T `TX *P Q Sp QW02op@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S FP00SpX@ '(@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0pLp H0H 0 R P@0?30Q@ 080//D D(0( 0 Q /D(0( 0 Q t/DT0T0p@-PR ` <@78H@?`ppxDl0l 0 Q RQX@078@08Q 0@0//D0 0 D0 0 &lDp@-P`0`0@T X0:20T1S@0?;@0Z<000080S@078@0vp@DP Q@0?30R@080//R^/R/p@-`S 4@HP@?Ipp R P RX @0*"7 8@08 R (0@0//P@/&p@-@Px`P` X0:20T1S@0?;@0B8000080S@078@0pp0 0000TP PR  R ! R! R! R (!R !R 8!R !R  R/L1S/0 0000TP$ PR  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/$p@-P$@0@0p@  Dp@-P@$ p@p0p 0p@-@ QP00S ^ p@c$ p@DL0L0p@-@ P $ppL$ p@8Dp@-P@$pp=$ p@p@-P | @ 00`$ppT0\ ^ @ p@$@Dp@-`@P$ppT\  R @ p@#@Rp@-P@00S ^ p@s# p@lO-`08 P@ ,0H100 0`0  0&U,00pW$ 0 0 00$ 0 (p PEU` 0 wP@p  @p& Ѝ880 -0 M0 00 ЍD- M0 ЍC-@P M(p, P00S 2`0 GR 0 O@0L"Lb ``8 ᵘ (0 0Q 0 GP0D0 Po \0pq1QH``00CQ000 Ѝ0`00SZ00%0   T 0S00% , W10X0PXp2 T0RpG WڠP`PW 0 ` p Ѝ80  080 000 S0CpC#7p@-@`P\!pp 0p@- M Ѝ\p@-PT0 0M`@  =!p 0 Ѝp4Dl l0 00S X  8Q Q @ ,@ /&R//DH H0 00S 4  !R@ ,@ //PD`0P0 T 0008!R !R @0<@0/6S//<0P0 0 0001S@0<@0//l0l 000S X *" (Q Q @ ,@ /&R//8D$0$ 000S @ /DP X0:20(!R !R @0<@0/6S//0P @ /A-@Ppp" 80  P P`o  h D000T $000S0 LL0 - 0?o20QQP T\D,0, 0 RP00T00/DA-@P``$ 80 ! QP~p P eT  800PU  000S00 0 D?o2?PRPT //PP00T00/,0, 0000P/P/,0, 0000P/P/HO-@Pd30Y Q T# PU D#00SH04SPPQP0pGP0HS``HpHW, 0 ^  1  !!*$pGPI@Ye0pS a[0 SqU,0 !0D|000 P0pP`a`0IS`IX`a,1 \  0  !!#pW`YH0pSa>0 S:,0 !0D|000P0qpI PX 00C +0HSP 1TX[00CS``[TY0IS`YPY0 0CPY|0 0 Dp@-@Pp`P0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@00C \.,0 00D\000S  Q R P 0!00//ؓ-(^Q,0 , R1S ^^1S ^@O-MA!1@ 0Q4p, @p P `0S" S#A 00 0C ```P 00(00(00S00C0T0 03/p 0PS@(  ЍԒ0ܑ(0A-S$'p`4@P(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ 0 @ Q@R0訐O-@ M`P VTppD0S  00C(00@00 T0@ 0 S `&, 0 S@p  Rᰁ@`pDg ` | p Ѝ@0 S RR Ѝ,֑P d,0ϑ0P `00V  ppG , B,(pqqA0 ` T` 0Dp4ᤑP ,00 G@p`4 0Tp `0Dt@U   PB   0SQ 0 0PC $ 00\R <@U 0 BQ 0C R G-@Ph 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`0X0P`UPW`V``0 @p 0 $p0PEPUP D0@ PQ0 /$ $\/ P/hA-PQða@`؜1Pp0$ TY 10 0 QTD$ 0R U ESpL @10 0 QTD$ 0R U EAp: u0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0QD0A-PQÈP0P`@0*$ P uT00pW  0T4P- 0S* 0@- \&@T!\8x ƌ8 t ,0A@0@PU 0P0U00 S0/0?o2?=XA-P$@0S00â?4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P 0 BS0@( p`0,,0 0CA1!0 0s`@0S( 8XE?*0@-0B  80 P R00 8  $P R  R0 00S00!R0$R0 R d1S0800800080$O-RQ M40z`pᛍ@Ps 0ሰ(ᓍP,o ᧎PP0^ X4% 0080!0Sa0 ` `8 < X$p@0H0|0L P0T`7 4!8 \0`0d0h0l0p0 ЍwP4, VP& :"R- 0 R80SJ 0  V 0P 0PʬR Ѝ |z xv@ Ѝn A-@P0QM(PD QpAR`    B P2 \/X* P%ʤ,APP  D0HRD0000H p0$`!bP@0SЍPЍ@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED   0  PI jL1D00S*Y p$`(D0@0S0p`0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @|$000@-@PM0 pp  00C  ?o2 0 mPP <Ѝ0PЍ0DH@- @  0M 0LЍ-QPDM00  ( 0@4Ѝ P8 /0@-0CM 00 @0C0 0 0D NЍQP<O-DM@hlp0tx`PP RK TNP@[ B^@D࠳UEpAPpWAA^APU0E pCPpW\[4AAA!p @lp0,00@0@0*l@0 @ V 0 000@ X@* p0Y  DЍ   Q Pp X@* 0Q0 00C0CLO-P 0@000DL0 0  0SO (@@000h0S80@080 L00S$0>, 0(0\ ,0!0 8C8  S^LPQL00 (00SCL00SW ( R), LP S800,0 1G$00Q$0 0\ 0(0AQ 0 , S(0 0 00,1$00 04 S 80pLH0@0D00|00p 0SL01H@804 0,0000t,04 0Y 0Y 000S`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP  YqH @ R  T000P P 00 SPS P*0 R00S 00P ɟ`V0 0CS SjpO 0 AS0 S P0P ` P R  0R  `9,00Se@ Q0C0] 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   `   (`R r  @HDHT,0Q0 L000Sdl8, 0@000h0S(00S80y00S3 80r 7r 8, 0`V 00PU0 0CS<0 HD'D<0NN Œ Č Ȍ N LL\oɟ`V?A8 T0V T@00D R 0 R PPZ| ! YR  sY $Rh  0E0 |0p`   0E  @000$R , l6@  ]@000!R 4x9 8000Vv00C000C05, 00S?0X *1h"0 , 50H 0 8  0 4P, @ (ep$`t00S000 @0p 111qWP40 ~@00 00S~ 0 5# X0:h280V @ l40S 0S84, 0pQ0A0 0C0胟 10 0 SPP 1 11RY@z RRQ] 0    U,Q Q !PB"`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00} XX0ᦙP0P0;^O L00S6(080 { 800  L,10  p`dЍ80GL008 0080@080+ R d1SdЍ( 0 09x \0, p0, Q0A`0Չ8`! ,\'PY @hdhc0 |[\tZYQ8QPODOl@YP P0@, QLJ   8@,@ APX@T `P `pPT` P0 `, @ pPAP(UD EDP  P! Y   @@T` Q0B0CP`P P8p0 CQN @0p 0 0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$0S000 $X0@4< pPLPA\L0(0 0R( ,0, ` pJz5 @Z0,  \F `0x8 0*00@ 0C}(@ 0 080 0 y 0XPx    0Q0000CP4` 0X0H0800D\#  LP 80P0帀L Z J D| p~Pd d1Sa , H5@  pUP:X XP@ V@DT H HHE@H00:  80R0,`0A0000X0C 00@P ` 40 0E00޸ PU U R0 R  X R RR)0SE 0 RAA$ /8,  @00 0@ ` `(0,0 000 0S 0 PC@08 0 0U0P$b pQ_ R$R $Ry X  QCH5S@  9, @` 0  `q@0 0p0 `d00P n 0@` 0 B00b 0P PG00 p 0 P;+ 40U( R X R$R`V_ 0 0 0 " ;, @p@`0 0`oUH%RPR p RO $R $R X  Q R; L5S>  ;, @` H0  `@0 0p;0 `00P  +0@` 0 B00 0P v  Q@ 0`00 0 @000P  T P$ , (=@ 000 @000P" , |=0 0  0 A R! U =, @@p0 0p1S U >, @`@0 0PL5S 0 0RU l>, @@p0 0Lp00 0  :@000E, >@ 0`C00`0 $@000tW , q 0 U@`; 0 0LaP2Pj @00 pRU xʕH%Rl0 @@TI 0$ppP@<@U; <PP$p@`0 0H`%UnH50S0X0S* 0 0 0 0, @p@0 0H` U~00 0  @000jP$pPb@llEp@-@PPMP0 0`0 R    80x t000 0 00P 0  Ѝp80 D000 0 B/ 0C?0Ѝp0 00$DC-@P⨐M 048! \` d0hlp`PpPa80  D000 0 B0C 0/? 0ЍЍ@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT :#| cp @V0 S0( ?3 S 0S1S0 S  0 00D 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $`U0 VP `"Vp`|0P 0@PUpT` @ T @pp ! !@-@P@~T R/0A-p,SP` @T @~T0`SP RQ A0@ ", "Q//@-pQ'`P@0D "! "T "! "U ^ 0N "! "\^`WP@@-@@@0S )$0P0C$0M IO-M:z*0p$P( ,pP `*00\c S@@s  nRXan HR@ @j`40IS0c0@T ^ጰOoB@TP AA  RT0)\ 0  |  bR\ `)` R&P) R! CP'(I@, 4R S[80S $ 0P00B$0X @C, 4R CPg S ^\ p( 00Q P80, H04(0RK0((H 0@0( ~ $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S  B0P$0@P$X70 R(,Ѝ<7 0( X$(00 SB G @ `5 & (00 S5$&P0C (00xP0S $0P0C$0*x&  l&@ 0,@(@ R 50060, 40RofF`@0,0 $P,40 P@0(@Sg 00 CRcڴ%%  pp% x%@ 0p(`Y | `nR`F`V,00P0S  $ 0P00B$0X@@aV  @ Q[Q $ 0(@0C,000 0CS[ pH40,@4!0,01010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# ? l# (@$@ ?#R W( , #\ $6 (@  P 10(@$ R $@ P  @ lP "  20,  , k40 S [ (L2 0$ ,B@0S $ 0P00B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S $ 0P00B$0,@%A@0S $ 0P00B$0 ,@H$HGh(GFHDF4FFFE4EEDDD(DCC0XCTCCAAA\A@@@?? ??>l>O-lsl3phC@00 M S z4000400c`(,P Zn34@3`0T'#0C S402PL좟 >0@DS(00S0 0l0S R "0 0 204@,P0T0hP \RP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00}1 0T0  P,P@ @1(`0 R*T$ !P00 @T 0 R 0 P$ 00 00l P @T00,P0 0( p0  04@SRCPE@D4@P,K 00SL004P괅00=<<h<l0<<;<;P:@:,:9(@- 004 (,9(@- 004 (,L9|1|!0O- p *⨒YX!X P!0P[& Z( 0S!,ppG`P@0   R    P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0ꐁ0 00 08QD0S0l%R h%R /!R!RtP/P// 0 000 0P/\G-MupP/ 5` 80s2 hD  SP̠r HR!1S85@050 50 `\P 400 ~0P 400 s40 0:p@00@00l%R h%R 0ʀl20 h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q j`S`" Q _SP Q kS` Q[PS ڃ0Y[=20  0S R!=@-pBt000 0SD"D2 R8Ÿ8 =01U+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  Y)PUЍY 0   0 0 00R0 0 !R 0ʀl20 0 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf STc$,p6lp33\1P0PP PKPK 8 QD\B @- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //Ly,̹1P0= 00` P7ʀ:l2 S3030 /@ P0000CS000000000000000000/wĸ@-P@M@&\\ Y #3t P P 00 '000 0 iЍvl`P -P\P Y # /u0 0 |  0S h h0 8=0!H00 R/@- pu,,,((1 @-00*l"R !@@ R  ,Ǡ 0:'.tB00 R @R  AR  t,(,+xZ0 000:h/dsp@-P@0@`M0*l"R R &Ѝp`   P H000 40@ 00 @ &Ѝp4slx02C-00$RS MP@ "2` @  "0S 1#{0 Q  l"R R, !`@ '( v@ Ѝ1=00QM0SJ\1`20lL100 C0剑Q:20h1=00Q!0S0`20 000 #0剑Q:20t 000 0`0`U0!Q 00`I0!Q @*lrl0 0 0/0p|0| 0p@- @00CS0 S 0 S P00pፏP0p0p@-0CS@0 S 0 S P00poP0000 0p@-00Pv@p op@-Pv@p 0 00S  @-@J Q P\,Q    @/nD0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp03O-0PP`$MC@ V ivpP 0h#0C S-000$ЍpT0 S80  2 0@  B@DT p`$ЍIɟ,0 AA!R1A0 CQc(^01H1H1PWZ0!! ! :  J T0@ ?Zq $`P@ rP, @ T  @ PW0(@p TDI0WD@0 (0C\00Cb$Ѝ\ X@ @  D0|0_p H0001@D T `V `tV ``  @~Pl0 0 iDp@-@Pppp@@0@0p@- P@ ppp@hDX6O-0lM@P,0 g Q 0pRu`P^ Pq0P0X W  0P <0R0 080ąP 0@SF00800`P0S P0 0 0PEPUS 080 00PS0P<0< ,5 000`Pp0 @R <0T R8 / 0<00800C?80t0P`FtPY`00 t, h480 pP pK 080 `0`p8ppP P8 0E<,Q4pQpP Qձpp( X< R!! B qH" RW`!: pGrUH0< S8 8 `< (P4@p$0,0 1400H0p@0 @0 0D#PU<$0 (Q0 0C0 Ss 0( 0C04 Q00SP{ 80 0B Nt,0"8 P 0PI00 08p0l8 0n800C?80-t0pGP0C00S`FT t0pP0000C0P00 0PS8 0E!q Xi 0 0H000ᰡH XD0|0prlЍ80< p` 0<0T pR0`<0 yPo 0;rlЍ`~r|h`ƨ0 0 Z bDp@-@`Ppp p@L J0 0 BaDp@-@Ppp p@5Hp@-P@0 0@`  pp p@!LaDD0D0p@- P@ pp p@ `D0p@-0P `@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP```O-SؑM D@HP 0T p @` 0Z  A 4/ 0[ 8 $[0<SD100.0S0!10>0P 0@0 0}00 0GP8  #8 S R0 0?P4/ZXЍ0G\8  #8 S R@0p0pP4/pW_|Q# @-@M  R ! R "R pP^ 0 0 @`Ѝ/@-0QM   S S PpP$<R@ @ 6Ѝ]<@- M@0 @!Ѝ,L0L0 @-@ 0 ,M@  Ѝ\ p@-B\\@0N ^\1  @ %  ^ ,\'\{ X"LB!!N0 ("!! L0 }p % !  ; { \PU@ 0 ER7d!@`PP   P0 B! {c\ "0  '  p @ p %X  + {p\\:\ c [QO-$M nPE@PP 0@%pp 0 6S pp; @`\,S 0  @000 S  P~%S+0LGS00 %0i\@0 `f` 00#1.Q0*Q 0 S @0 SPQ0% p  0  @0d\% 00 @ d @ 0 S4p300 00   0  00 < @ 0 0@D0 @00{0 S[o 00P$Ѝ0 SQ0%  p  0   0 @%@  c  t 0 SQ 0% p    0  V0% +c@ @  00@Q0 S0 L0 @0  0" T 0@40  60 @0  0 T0 S\R$ W. 0C00 S $0< n>0 / 0 w0`f S` 0S0\S 0 Sa0 000Xp@-@P0P`M0S SP!  00 0!Pl 0 Q00Q H  < x0  Ѝp#0,S   \ A-M0PSL!00@0@P0S? N0  ` !~r!!`"bNL LL 0 0210B q0P pW$P@WP 0fSPЍЍ 0Ѝ4R0NgA-M0PSL!00@0@p0SE  0 ` !^RRN  L !0 120B QK0P pW$P@TP 0nS8PЍ"0ЍЍPkL>G-M0S!0 0`0@0S[  0p P >T1T I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qP)0< X" pW $@r0sSP @WXV @T mP=PPЍЍDO<-?L*S0 O-TM&l7kPPPR ,$  ! 0: 0 @P> 5e000` 0: @P 0S  R 0Z I #Z =Z =vP  00pdP0 p WZ p 0 0X*SUl0P0 0S, 00    ZP  VmY P mq0,0@ 0s[ p3$ 112cAP3L112c B L00'pr!qpC 0qP  0 p@B `@Hp, @W 0S  m d= @P0P l XWP00TЍ M 0   "$p΀‚ €‚ N G !1 qrpB qPK  @:p! 0pp `1 $ ϊ0K $$N04!b1c$!b1c0N K 00  0ɉ)1i1c1Bp뉑P 0tS0cS0Spp~G@ < pPUY 2l00uD\9gݵN 70kL>|*S-?LA-pP`0\ %\0@pS sS lS P0\UUW 000@1CP0PCV`1E !00O-Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ   Rp| PA0JlRpY PA0Ja0J Ro11OSr00qߍI@[/hP 00040hP, 000#pRp  Pp1l X   QU PEQQQ W! 340`0 R,R*P  0Âp 40P040 P PPp1  \1SB 0C111S? Z! J 02( R 'ZPOQ0S'Sl! 0S'S'SX AT 0DS11a x7@D!&J0qAVZ ຠ `OTb1p@ aAl!AT @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ6 10}RRl1  R}R}RP!R[ 1h BY!u 400 P1`Q,*P  0 pa 40040l10J Rg1lp1OS!!0Pl1XAT @D`1AP OT1a@0A1B0Sl00l0 0St00t060S&   ?R ;R P0S %S0 01S/ 0C11AT, 400 Q,,*P  4 @ , 40,0PPp1DA0JS30J1OS!0l100@1@`hPx 400`,Vp p2hPm 400p,j000S   ?R ;RN eRQf P0S %S0 0AT @D1! AOTA 01!0l1`V 5```&``VP``P``ø`@oobP``V ``@Q AIQ AAT6 @D1!Z!oA媢Vp p22hP 400p,PW0`0`0001 0&J GZ @pp0000x!J0o ᪢000*0 0vV@``pO`V@`pJ@`fpF@opB`@p>@oopb9F~' d V8 t- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/A-PQMp@ 0S XD eY PE _\qp4"P0  ۍЍCD0P L  }P<0 \0P 0S/S ܚpP xeX0 ۍЍC0  PۍЍ  p 0gd XW L0L 0 (04ۍЍ,0, 0 04,h8D\G-p`@P  ^PdU  UP `P@PP @T P  0@010GD-@- M@u00 Ѝ@ Ѝ/> Ѝ@ Ѝ/@-@xdvdtd@rdpd nd0ld@id 0p@-S@M 0J  Ѝp0`P0 0=  005` .0 Ѝp 0p@-PS@:pS QcP!paC- M P@U pᬐ`0fV@@PU   W0 nV sV  PU  @000 Ѝ R@@@O- M PU( `pfSPU   @8C80@P 0nS sS  @PU@@00 Ѝ 0S00PA-P% Ppp R,R    0S,S@B;Ma`P   {`00ppp@С@C-@r Mp`P(P:pW`*nUB sUc fUH0D Y2R4 @ bP( H0D@ pBH0@0 H0:H0nUp@0 H PY sU> fU& L00L0 Ѝ @CP Ѝ@P ` 0S0080Y 80 H0@ HL00L0 80(x400H0@ 400H0@04 H00H04 0H0L00L0 @H0R ,0 0H00H000, R0 0H00H0L0O-M@0`[ ` YZ p Rp(080H0Z`P; P  `00  ἀ0[0   y0 psZ0 0   k0 0  0 @ 0@Ѝ 1 !00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00 A-`P0PUM@p"S& 4aP !P  ᴀ00V0  p  00 0ЍPЍ_ p  O-P@ 04M 0"P a`Y`5   ap`0P  0 a`| @P  G@`0P a4Ѝ  0 a a,0Y (0 0$0,0% \@ ,`u, AR   0S00XPw Y  `Tr  X" faLp W@H @ D L G ,` $fX7  0 @P- pW;  +BHDDnXDH sX  "0 S   ,@ 00 a4Ѝ  B $ a,T=WH8W@PA-P`0`VM@p(S, `P$ A`  㶀0 00P00 0 0 0 0ЍPЍe^0@-P pW M@`R _P 0 `0  00P 00 0 ЍP Ѝ8^O-LM<0 <p*0 0,, 0@P |i|P0`0PP  p00 ZP_V PD9P_P!_PP @ @P W 0V 0,P * 0p100#$0L90400 0IyX 0s 0PQ ,P  0S $ .S  ROS9 = /P# *@PV xhFhv 0n P D\WD00S P P& 0 " 0S v 0# 000 000 0 n0=0TS 0  0 00e 0S(00W8 ( ^8 0S)_9PLЍ J@0@S* Hx00 000 000 f0Pr[N (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0&0HS y  0lP (p70 FQ4E F/R) ` pV@ V,%`  @ ` @ T%,  / P P``P` p(\8 ]@T@@B`  4X Y0 0MPDx0  80g80P p` P P P P P P P 0  80@80P P?U P#v 0 S00Pp`@ 0AP<, ,0  80W80V0@A T@@p`F 0 00000000 s0P (p]@ Hx] hFhv9 @0n DPH 0S00 @P>qPVVp P:p0  0F(p%P00P hFhv0 0@s 0 P0Ph 0  S 0 x[ ^LЍ  0Mt  mG0 0 a;h<  `Z4 p(8lTp<ЊP/U$P00//ᴋ0@-MP^0 @ 0^S!1l!1"b2cNL 00$@B!A@C0PЍ0gݵN@ P0`0K?//̊p@-MP#0 @ 0nPcl b N00PEK 20$AB@C1dPЍp>kL`$0P00?//p@-M`0 @@?MD@D P0ec`E $`L0b!b4!b ER1c1cL 0P0@$D$C!d!bA@C16PЍp蜩-?L*Sp@-0MP0`2D@P 0Ѝp\, 0 0S Q20Ѝp1!0G-@q0PP03 0 4`S 0`02,0PP00|Q``  VPe`EȄQ  V|0`0ȇ`H00 @-@P \\\ \$\,\\,00!R  ! 001/H 001P/ P/0؜@--@P X@X0@00s@ H PJI HH @ pp@- @-C(M3@ @`3P0R kU{F{{*!00 (ЍpPm P 300 U  {Ukk!00 PS ~P 0300 U 2 0"P  0cP0z200{U 0kkP PA  0cP0wʜ200U 0d2ŀ2""P  0cP0P200U 0 0"P  0cP0200U 0 P  0cP0100^U 0 !1""JP{  k0cP0Gd100U 0I B \0cP0f,100U 0V1""dPS  I0cP0a000U 0Q0""QPP  60cP0ʜ000U 0uh0"">P  #??phНx(ܜGDŽ8PH0cP0Y,000U 0 0" P:  0cP0t00I? 0 0Ō0U"f P  0cP000E?{U 0kk] P  0cP0!t30A?{U 0kkt P&  0cP0,300U 03""P  0cP0o20t0U 0_2""P  0cP0ʠ20l0U 02""P  {0cP0iX2000U 0Yd2""Ps  h0cP0:200y{U 0{ qP+  V0cP010h{U 0{  `P  E0cP0Aʌ10W?U 01\1""MP  20cP02D100uU 0 ;P  0cP010S?U 00""(P  0cP0Mʸ00\0U 0=|0""PT  0cP0p00P0U 0`0""P  d̗8`ȕ(GܔD0cP0Z,00@0U 0J@0""P  0cP0p00O? 0U0"g P  0cP0ʸ00M? 0U0"  P  0cP0%10I?{*Rk 0F{U{O P  0cP0D30l0U 0d3""P  p0cP020d0U 03""xP  ]0cP0ʴ20\0U 02""eP  J0cP0xl20S?U 0hX2""RPe  70cP0i(20Q? 0U0" ?P  $0cP010d0 0U0" ,P  0cP0ʘ10E?XkU 0{{ P  0cP0P10t0U 0(1""P}  0cP0 10 00U 0T P  0cP0ʼ00W?U 0s0""P  0cP0t00P0U 0b P  TGp$ؑ<(܏ǐ<܎\$0cP0PP00\0 0U0"& P  0cP0Wʘ00d0U 0G0""P6  l0cP000l0 0U0" tP  YnP  S,100 1,1 U"o"00 Ch100t10K?Q10G?c|1 U"Y"00 -10|01001 U"xG"00 100i1 U"9"00 2080{Ukk+!00 30Y?300|3 U""00 X30T0L30N??@3 U"i!00 30p0Z2 U""00 20U?20R?2 U"!00 20`020=x2 U"J!00 h20h0;\200P20C? 2 U"!00 20p0200:1 U"r!00 10U?c1 U""00 s10H010K?X1 U"!00 ah10`0\10h0;1 U"{"00 O(10Y?z0 U"Tm!00 A00|0E00`000G?*00T0s00(0J`0 U"O!00 #00h0000܍\$܌̌t<,td,ԊĊ|l{Ukk!00 3003 U""00 300{Ukk=!00 P300.D300=L3 "ZI I 3 "UM"00 2009{Ukk!00 200x{Ukk!00 20p04"00 "00 P200D200A  :PI S @ ~"00 y"00 t!00 o!00 jkk!00 c"00 ^"00 Y!00 T{"00 Ov"00 Jq"00 El!00 @kke!00 9`"00 40Sj X!00 ,0SE P!00 $0S H!00 0S @!00 )P  0S 2!00 -DT! @|D4؈h0 0S !00 0S "00 0S !00 0Sm "00 0S5 !00 0S  "00 0S !00 0S9 !00 0S !00 0S !00 0S !00 0SI !00 0S !00 0S !00 0S !00 0S !00 w0S !00 o0S !00 g0S "00 _0S "00 W0S {!00 O0S s!00 G0S k!00 ?0S c"00 70S [!00 /,3 H "}P !H H 3 "0S#A!00 0S 9!00 `300T300%,"00 '"00 ""00 "00 "00 "00 "00 "00 "00 "00 "00 I I \2""T2L0 0H2(0 0u>|20 0z4;T20 0k*,20 0u 20 01t0 0  1P0 01,0 0 d10 0@<100 %!00 T10 0U00 0[0h0 0*?$؀`8p8~~}}}t}L}}|||P||{{{T{0{({0 @@j l 0H00 0p00 0y00 0[o00 0 e00 0k[J1 @@* T 0M\H1 @@  0?10 025\10 0/+1 @@  0T!00 280 0D2\0 0l20 0e)2 @@  02 @@  03 0 0!,3,0 0  @!A*?B0CS Ϡ-S)!R#  S Q0 {+C 7G 03S S 0A.B B03200P1046nT kȠȠ+S 0+C{6F{7 +S0+C}p}/ /P 0S $0S 0S P? @4@P//A-0Pp8`P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00(  @(4/P8,0S0Q 400 @-P0 R 0 `  ) S. p T P $<@ :+˃4?0P R $ R  R S /0?0>$ R&4000  0`h>@0U 0PEd@T$0S`0  0@>`0U 0PEd@T$0S  &$   0   0c 0$ @R`x=`0Ut 0PEd@Tf80070  Q 0SU 0PEd@T 0S 60> 00L70U 0PEd@T:0D 10*D0 6a@Ddh0lZX0 #P$U 0PEd@ 0S\6c@D0l0Z$\6 R] ?0S50>00(60QDZI U01Z!Zh %0 PE C0 p 00D0 0CD00i`l Qv(T%  UI 0PEd@00Rl @Da0^ T 0 $ R40,0000 400U"  PEd@T   !R 840d0U 0PEd@ T: ,H06l0*H0; @D 0;  0$ R# D  $ R# D $ R$# 0+R D U1!Z $Q ^ LQ0Q 0 B0 !0  0D PE B pD R000 R=0W U 0PEd@T20F?o20X$0S 0   l"L2$&$B0#22cR0S 2000d20D10 PN6c@D;D10 Rp 0 B D  0h10)@`Uc 0PEd@T$0D`S`  0 "H@+`kUJ G $0S  $P (D0 S2D57ZU0  0 $ $ ZPEp'0? 00??w?N?P?5?tJ?M?qH?A?L?o(ondmtl:?;?0,( 粠*@D6`%R l!B0$ Q0l0S>0p0P00X0?0X00 p0tP 40> "@z 50>050f8 0p0P0X 0㽯X0tp0 (0$$(0P, 80> 0080 0c&80> SR: 3@ 0@l0%(9@0A@ `d p T  \ \  h }P |90>(w0S90<Hp@-@)PP80S $ (2/$0(3/00pPA-@`PP@p0 QR 408 B4 08@ V000PA-@`PpP 0R| S  P00S  < 90S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /X#X3 C- M0P000@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 2#\p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R*0Q  R*0Q  R:0l00p0C0l0pSp)x 000 0P,04R0p0 p0 0 0 30 Ѝl0Sppl0 @@@ lS???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pW`P 0!(`3/@P] 8X: (0 ( 03/PM 8 8!P S>0Rp*p  BS>00p0(0 #88@oRS B P T X B T p 0Bp8 lp hP S>0Rp*pS. 0A p oR$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-M@ @㬰PwX 0C00$P $`0p sRpW0- p p0 Ѝ0` Q`V00p=J\S30b608#8P0X 00C∀ R"P @X\!\ 0!01 002T 0# T 0SЍ0W0T0S Ѝ 0D?o240%R00S0020 0(0@0 ,000@(,04@ 0 B80 0 0$ 0PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=tPxl0PfPEN N0NxtPAPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPPh`l \0S8 B0=l0\000Sm tP `H0P` R P lp"p  G R lp` h0S:l R1#P0 6SF \0P8 Bl0\00PЍl08  :R&ƃP&ƃP&Ɠ) )hP\0P8 Bl0\0~00SЍ舨O-tdt`,M Pt \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ3@0 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80XpT`tR` l H 07#0H0Xl \0P8 B Kl0\000S,Ѝ806&6!Ɖ909t6l L Qtl \e /t0 S` R S; SY`l r (l `m 00400D @$H0 A   @`@ Pl @!0 PPH0P  `  @P$ll R1#\ Q \P80 B0 l0\0l0P,Ѝ\P80 B0 l0\0Y00S,ЍO-@ ,0K[ 01PQM  o 蔟   PBS0U000u 0 0 0B 0 %B  0B 0 #40B V \0U8`1 m\0 0  PE B    \0UW %6*0Q1A4:\0l` p`F0 S P!P1UP!U:Spp   W  B0  0 PUp` , 8 RKAƋ$,l &\ PUp`l& RƋ5V`(0'

 0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0O00S8#  #800#"0 4(}B0 0 0 0 0 S0 S 00R01 00 q00 R000 0 0&*W6: &R \ R80l0 C 0 B 0=L0DC0C t0S*l0\06y\0l S8  B0 l0\000S10f\ R80l0 C  A-`pPTqP@B Q00V0SI0S: (0sT Q 1@0@!A00000 |0`cp( 0S*t l00\ R$6S S L D0 B Co060@D0 0!1 0Rpp l 0$0;/O-@QM R0p  0S " !,"pDP` p@00 + p % *0 @p'0 @$000Q  B1;`,:)7(463041 R P%BQ` p@!0A " Q"$, !!   R!,  " " Q"$,     R ! P%%   R,!@S4T@ RPR aR,d&P%PN&, QR,T% R%, QR,T% R%, QR,T% ^%,  C @0S |0 " !S," ЍL ""pR1C2PvT"tL< A-PR` @pPp 011   0" C  .P p@1   0" C !& A-PR` @pPp 011   0" C  .P p@1   0" C !& p@-@P |`|`P@P 01ē1   0" C  @pPp p@-@P |`|`P@P 01ē1   0" C  @pPpP @-18@ 0,C    G-Rx 'xh Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#pG7&c20N 1pW|GpG|1^NNPV=F10C=@L   0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq'R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/'U/0S0`0/ /Y&2F56@-S k>@@0 #400k.06S0 k΁ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @O-@ 00 0p0 1Z \Q ⵟ 0100W0 X.0[ A  װ& 0А#"^& 6 2#60 SZ+ ೞ0JYJ Q LG⋰@ 0p@Q0C Y> 0@N0A0 \0000C0/ LQ @00^ P0 00U00S@ T R 000 R0@ T<ЍW@  xyQ / !02@X1Z Gೠ6;#6pQ^p N00=C-@TppR!ಐN0+m^\hT( Y!. Q A^0 pR% \LANpR 9 ^0@ Tp9  \ʰ Q ^0 Rp^0@ Q ^0 pQ^0 p^0@ Tp@@  @O-MⲰ[00Rv!+z   k@T`[0 Y ANP@>d8Y#8WD@ 000 #4060cUS8#8 P >b8Y#8 000#406 B 0cUS8#8@DHR$H&"0("(P P  0#4PP0&0bTC8 B#8V0&7 V0Q PV  ANk`P弦P0ᾐ:`i8Z#8`I 0 00#4 0编0iUS8 #8 R0἖P`U0S P U`0^ `0 V \0ʀP` TH P尐P eY*P0帠PE0#406P0cY ) UV BU@X%Xk>PP@P.V@nR$ N D0Qi PU ` k Pᶐ>i8Z#8I0 00#4 060cUS8#8 ^S B@P.k>@P.V@nR$ N 0Q$ PV(0S `0 _28 #8 P `0^0  U4 `P 0SЍ@@DH$Hk>PV㸐V @DH$H>k.V0v `0 %0S `0 0S `0 ^ U P   @ Mʀ6O-SM 4004`003k^0 0300300 !A 9@b8 T#8@p000@p#406 B 0c^&6S6 @ 编0`$0 pḀ9n8 Z#8 0N 00#4 060cX8#8qX tq@DH$H>phW8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>Y8#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&02Pa8R#8  P`0`00 @#4PP0&A0b^8 #8k0&Ѝ 0&0p0v, 0 0@-&̀+ ; J(0,+8; k> G$ˀ0 0&)0S0 0xS0 0LSI00&&&&`EʀA-Pk@8` R   pp "$ &bS1 B k>&0  8#̠   4##<V0 0 ᚾ000*60@-S S00k@@6 0C60k>@@@!PPƂ00@-k6 # S("(00@P P 0 #4@@06 c\  ( 0C"(k΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@@ @"$PP Ɓ0O-0 QR M@Y, R 0)p&]#P+}(+z0N  q/ ! RF@P j   Q& R \3 "[$k 0("( Z:38#80 00#40缦0jR#8 J#8+ ZB!(:ἦ 8#8kΆ000#4 0缦0jQ8 J#8 ! Z:ἦ8#8kΆ000#4 0缦0jQ38 J#8@! Z:ἦ8#8kΆ000#4 0缦0jQ J!PMk>⼦ / ! Z! ! 缦jR! J!^ἦ 2 / Mx  \ P+R +R ,RE R  Q ,Q3 "[R&k R0i 2 8#8000 #40&0bP8 B#8pk0&N.V G.0 0R0 0xS0  0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOi 8#8#8#8!88#8!28 #88  :Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  0S A-P 0@ Cp`:CVUV `%P 9%/@- M`@p)PP PǶ   8C `p "- @P  Ѝ 0@0 Ѝ0@0@ -T  Ѝp@-P(@P @嗶00p 00p@-@(0P 0凶00Ѽ 00μp@-MP`(@P P @s 00Bp ,PЍp購P,U PЍp0A-S ` 0@ Cp4PBU 0 B%0PP$yara0A-S ` 0@ CpP}BUr 0 %0PPx$tcid0S A- p@0 CP`YBV `M/0S A- `@0 CpP?BU $,0PP.?$/yara0S A- `@0 CpPBU $,0PP $/tcid0@- M@ &Bp  P Ѝ0 Ѝ00 0 Ѝ00@- M@ Bp D  P Ѝ0ٻ Ѝ0ջ0 0 Ѝ0yara0@- M@ Ap D  P Ѝ0辻 Ѝ0躻0 0 Ѝ0tcid- M Ѝ- M Ѝtcidp@-@PR$0PPptcidp@-@PF$$0P p00ploobp@-P`@PP  EP#p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@/ @-@@L @-@@e @-@@~ @-@@ @-@@ @-@@ @-@@ @-@@ @-@@@-@@@-@@3@-@~@J@-@x@a@-@r@yp@-P` @PP  P#pp@-P`p @PP  P"pp@-P`^ @PP  P"pp@-P`L @PP  P"pp@-P`0P8 @PP  qP"pp@-P`& @PP  _P"pp@-P` @PP  MP"pp@-P` @PP  ;P"pp@-P` @PP  )Pq"pp@-P`0P @PP  P]"pp@-P` @PP  PK"pp@-P` @PP  P9"pp@-P` @PP  P'"pp@-P` @PP  P"pp@-P`0P @PP  P"pp@-P` @PP  P!pp@-P`t @PP  P!pp@-P`b @PP  P!pp@-P`P @PP  qP!pp@-P`0P< @PP  ]P!pp@-P@<"(0P p*0P 0pgntsp@-P`@PP  :P!pp@-P`@PP  )Pq!pp@-`P@"<P pP U patadp@-P`@PP  PG!pp@-P`@PP  P5!pA-P@!X0P p&`P  P `)gntsp@-Pn@!(0P p0P 0pgntsp@-P`*@PP  P pp@-P`@PP  P pp@-@RP P pp@-@Pp!$0P p00ploobp@-P`@PP  P pp@-P@PP  P p@-@@ @-@@ @-@@ @-@}@ @-@w@; @-@q@J @-@k@g @-@e@ @-@_@ @-@Y@ @-@S@ @-@M@ @-@G@ @-@A@ @-@;@# @-@5@6 @-@/@N @-@)@e @-@#@| @-@@ p@-P`@PP  3P p0p@-P@PP eP pp@-P`z@PP  Pp0p@-Ph@PP BPpp@-P`W@PP  Pp0p@-PE@PP Ppp@-P`4@PP  Pp0p@-P"@PP Ppp@-P`0P@PP  Ppp@-P0P@PP P~pp@-P`@PP  Plp0p@-P@PP P[pp@-P`@PP  ^PIp0p@-P@PP P8pp@-P`@PP  ;P&p0p@-P@PP mPpp@-P`@PP  Pp0p@-Pp@PP JPpp@-P`0P]@PP  Ppp@-P0PJ@PP $Ppp@-P`Q@PP  Pp p@-P?@PP Ppp@-P`.@PP  Pp p@-P@PP Ppp@-P` @PP  Ptp p@-P@PP Pcpp@-P`@PP  fPQp p@-P@PP P@pp@-P`0P@PP  AP,pp@-P0P@PP rPpp@-P`@PP  Pp p@-P@PP OPpp@-P`|@PP  Pp p@-Pj@PP ,Ppp@-P`Y@PP  Pp p@-PG@PP  Ppp@-P`6@PP  Pp p@-P$@PP Ppp@-P`0P@PP  Pzpp@-P0P@PP Phpp@-PO@(0P p0P 0pgntsp@-P`{@PP  ZPEpp@-Pk@PP P6pp@-P`a@PP  :P%pp@-PQ@PP nPpp@-`P@<P pP U patadp@-P`L@PP  Ppp@-P`[@PP  Ppp@-P (@PP !Ppp@-P 8@PP PpA-P@OX0P 2pX"`P  IP `$gntsp@-P@1(0P p0P 0pgntsp@-P`@PP  Pwpp@-P@PP Phpp@-P`@PP  lPWpp@-P@PP PHpp@-@QP P>pp@-@RP IP4pp@-@0 P )$'$p@PP!0S !p⃫!0@- @@!\(P 0R @-P Q o// P t0, @-H⓱ @-P Q @0ft0 H₱g0 H{ | 0S p@- X@`@@PKPpP p@ A-P`p)" E!@P  ~P` pp9!WP` q0!U @x#'!o#l#$LDp@-P @`Pp;P p@1@- !@P $ 90 0 0 8A-pP @P  &0 0 0 ˬP `P  ` P((0 Hְ@ /@-@P @ k0E/H⿰ }-A-M `V $P0 P:@P pP  0P: EЍAЍ/ЍAЍ/>Q/H␰ U 00 @-@P e@ $0E/Hxp }p@-@P x0 0 0R0 P] 0P Q " p@pp p@-@P `0 0 0R P; 0P Q " p@pLT P/0 0 0R /P/<0 0 0R0/P/// 0P p@-  o QP  QQ x"/TT P/ 0 0 0R/ @-@P \0 0 0R  0P Q O"00  P/00 0 0RP/// ` A-PPM 00 0/o"P R Ѝ R0 0 p`P 0 S  R L  Y/9 P` !  00  l ` A-@PM 0 0 0R ЍQP 0 ? 0pO`P 0S `  Y/P~9 pP` !(00 [?-H;  | ; P H0-0 0/o"^ R  Rv/ P/D0 0 0R /@-P po  P/D0 0 0R /@-P Yo, P P p00 0/o"\ R RP Q ; Q3 /  fP 40 0 0RP !/@ | f(0A-SM`.P@U Ѝ0 PP pP 00 0P+ S(P0S0"Q00+ x@P \ 0 0 0 @Ѝ, gP  @ P 00#0 0 P 0S S R/P/ R0/  @-@4dX.@0p@-S(M/ {@! S   P{ P8` `P -P 3(ЍpX  (ЍpD P { 08$0\ x T 8  $@-@ឧ0 (@-$@@⚦ 00 S 0 P :\03#/S 0 P \0///A-P``h@P (pP  O@P ᙦW@s$$0 xp M 00 S 0 P :\03#/S 0 P \0///0@-M @P  @ Ѝ00@-M @P  @ |Ѝ00@-M @P  @ nЍ00@-M @P  @ `Ѝ0@-@P ,0 0 0R@ /P/0 0 0R / 00 !S R!* R0*/ - ^0 : 0P0*  R*/@@/ / @P $0 0 0R //XP $0 0 0R // P $0 0 0R //P $0 0 0R //P/h0 0 0R / 00 !R0* /  P 5*/xP/h0 0 0R / 00 ! R0* /  P 1*/P/x0 0 0R / 00 !R0* / - ^ :P/x0 0 0R / 00 !R0* / - ^ :P/@0 0 0R / 0 0 S /hP/x0 0 0R / 00 !R0* / - ^ :P/h0 0 0R / 00 !R0* /  P 5*/P/h0 0 0R / 00 ! R0* /  P 1*/ P/x0 0 0R / 00 !R0* / - ^ :P/@0 0 0R / 0 0 S /P/`0 0 0R / 00 ! R0* /  \ 5*/P/`0 0 0R / 00 !R0* / \ 1*/<P/d0 0 0R / 00 !S/ / P %:/P/d0 0 0R / 00 !S/ / P %:/PP/P0 0 0R / 00 R/! /P/d0 0 0R / 00 !S/ / P %:/tP/`0 0 0R / 00 ! R0* /  \ 5*/P/`0 0 0R / 00 !R0* / \ 1*/P/d0 0 0R / 00 !S/ / P %:/P/P0 0 0R / 00 R/! / P H0-0 0/o"^ R  R{/8P/L \ /  JQ\/P/L \ /  JQ\/|P/P \ / Q/S/Q\/P/P \ / Q/S/Q\/C-M0PP0p00 00 pS Ѝ(@Y` +0B( 0R0xSH Ы 0Ps&*0 00 0S  P Ѝ謫 _0Ps:0"Sꛫ0"S bqp 0 00 P  ꀫ0"SH O-MM(@PzH100 p0$`0(0 00[ Q`$ 0 `;/0 `P Mߍ ̇P0 3/P 00 $ 0 :/P 000 dPMߍ 0p@-PP0:A@L7LT#H0a`L8 0L0WL8V @#88#8P0p ^pO-KM3 `0 0R@ @@@$@@@(@0 0C0S5 0fSQ ="SE [Sl2 0 @3/P 0p0 0 ̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 R4P0/S7 0(00>S: SA 0S p03  0B0SR 0 S S5 S3 .S 0 S S+/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 8( S =SB0"SQ0SN   0"R "R RAC$ >R<0 G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Pn \P@ V   WP UP PS00S@Ѝ pR ;R@  uR[R<\ BR  ;R@<{  @d0 8g"R /R  0mP 0 +("( R:Y Y +     SP,0 Rg \Rd  uR` > PZ +  PU6I0     0 # <  P,!*-"-  ƠP  *  (  ""0 . ".  ŸO- M @ 0D0S<^QQ@Q  0>S 0 T @P (0SP  R @ ЍT" T& @P0 S00qP @P T eP0S  0SX L HG-P-Mፈ`"@PL ,+pC v-pF 0F fppSp>C0 MPP +u&  0 p `,-9Ѝ00`0 'p``-$`Ѝ +`Ao/A-PP P`p @@P@@@P p40,p0P4080<0\  @-p@ x@-$@@u E̯ޡڡ@-@@O-4@T ,p` ǡP @D¤@@`T P礀Qㅑ8080 0SPZ PZ P蜺  @-R 0P< P 4Q ,  4)`0 0&0 0 й p@-M@4 00R1SP,0S@R 1`V, P` 0 0:P 40, 0C40P" ;`ЍpS" R3d/ЍpЍphZ<.0ۣPPj?.0ԣ<co?.0ͣ$$N?.0ƣ y l iA-P`,p@P W 0 !,@0`,@0`C-`0SM@PpH  P 00Ѝ! .0P ,0SW ! v/0P ,0S(0S00 0cP 0S?0S0"SZ0:S Q0}S "S000"S vWP  QP \ @@ 0fP m$$w?{/0h 8 @ , ̵ 0p@-S T  Q @PPp`0!.0H 0S ,0 00?%.@-0t 4 @-R , B04 P @ 00'>/0Ԣo?/0͢뤴  80O-M@ Ѝ@Pp4 B`P @ p @%Ѝ娒 y a`P0 004QY  4 ,R\ 牱Q1v   P 0YIV  B B!Ḋ,0 ` 04 p<0 04 <0 aF`,VM<V7V+RY& xx@ ` E `P( ~ =0,S<SS8 uPw @<0 0`p4 <0y<! d,0` 5Y`  |,\0\02.0 LW?/04?/0H$x 2` D p@-@PPg0S D  Q<0  0p@X`0/0ס< p@-@P 0`0VPP h h0 0  0@S<0  0pPp `0/0⬡< 0O-S M@PT p}`40SP p `pP@ ЍSP P 00S 0r  A> 00-PY 10Z/ @0R+ P$ [] P 07P 0S P( Hqp4` ЍO Q P 0  03/P  40R1# P P6>/0q 00C 0 P l`/@yTT?/0@+? 0, `h  \ @ \@-@ᛚ0,S<SS&?/0֠H PG-V pP0`WSW@6 404 S @ 8 6S3 E000,0 100,0$ 100,0, P   @ ?o2\0S0S P@P :  404 SS@  @<<-B> 0o$$-F> 0g ! 7G-PS @- Y`' T 0p 0R   004 00R$ uP 0S 0 GwXXG>I.00'&0,S <2.0 1 GFG-PP' 0 0R"p49`P 4 R @,0儡ᄑ1 / - ,04 儑@ 0T:80804 a`0P 0  Q@-P80080/p@-P@E80080p@>p@-@P 80 0R@ pP04@-pp@-@P \0 0R@ p`P00S@#:p@Hp@-P@@pA-PP 0 0R4p`40S @40@S ,0 P `A-@P 0`0VpP0S P @T <+? 0>@@P A-`P 0P0/o"Q@@T @0R p @P @T @+? 0Tt 0P T@- ^ 400\@+/<2.0 0P @-op@ T\ @\400\@/<2.0Ǟ(p @-PP M 81 0R Ѝ`@/80  Ѝ@( 6P 4 0R S *,\$0 B!p@؆400C40<00<0``K.'> 0⁞HHK.M> 0y00N>K.0 0p\ u< v w0P/4  ?o2\0S/0@ S/00P D- ?o2 ^0S 0 S /P/0 0@0R/P/0 0@0R/d P H0-0@0/o"^ R  Rk /8 0S /A-`@P=pP (0Sp  0P  pAO8``  `DO-0S@9 0@S7  ` P. X6qPp@ P  P  P HXPU0UU !B< #1 0@?,B PO 0s0L d⛝X% X0@#r 1 @:  @Pp D  /P/<  ?o2\0S /0SP/ĺp@-4P4@P@0 0px0S   0,@-@<< T (@@@@ @lmdL@-@P (0 0R蘹P/0 0R/\P/0 0R/40P D- ?o2 ^0S 0 S/ 0S /(0p@-S@ ``P0 _P0 XP dd X@@ @v@p<<<@ @0p -딙 @lĆlA-PP 1 P`p @ @P] @@ @P p<``?`p 0,p0P4080<0谷@-@s @p  @-R 0P< P 4Q  ,  0000L t֙ 0L tϙ8T Q< VPG-? pP0`W<W@ 404 S P . , S -000,0 10,0$ 1P0P :   404 SSP  P00 t}0 tv ؖ p@-M@400 S,RP, R4S 1CaV' P` 0 0P 400C40`ЍpR S   ЍpЍpLkE?M/t94|n?M/t2lR?M/t+ ȕ A-P`,p2 @P W 0 !L,@0`\ ,@0`400 p@-SP8@S 84 <0,04Q<0pPpE?s/t렔 o@- MpW4 0PS`@%  P00 Ѝ  /0P ,0S p @0 @P  Ѝ0]Sw?}/t⥘ L Rp@-@P 0`0V PP d d0 0 0@S<0  0pPp00/tz| w0G-S@PK Up40SG |  ?P@#P P 00S 0=P6 0 03/P/  40R 1#P& >`P 00C 0P  I@t `G sL?).th(?).tt @  40S 0C40/ =/@-t̐ 0p@-S P  Q @P^PYp00/.tח(X ip@-@P |0`0VPA0S R <0  0p@4,0,0/tⴗ00/t⮗밮̏  wG-S p)W@ `V 0P 0R 00 |` V 0S  G883>/tts0,SЎ @?A-PP 0 0R42pP 40S @,0a, 40a@T:8 8 40p@-P80080p@-@P 80 0R@ pP0@pDp@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`Pz00S@#:tp@꤫p@-P@gI@bpp@-P@[80080p@Tp@-P@O8@@@Jpp@-@P x0 0R`P<40S ,0AT 3p@p@n?/t⫖렪 aA-@P 0P 0R@ p`8040S ,0X <0, 0Q<0@@l@44?/tq ?/tjĊ  p@-@P H0 0R@ p`PE@pA-PP0 0R`@4P%80,0!qW# P P ,0P < 0@ 40< A`A4?;.tn?;.t 뜨D ( 0P D- ?o2 ^0S 0 SG/ᄧ0S /p@-`P@P (0S p p@ Ц  괦0 //@-SP0p0 ⻕븋 O-IMP  @T p `0 R 2/0 SX P X @ 8/@0 pPP @TL0P ⊕003/X@ 8/Z RZ Z X" 000 R 2/0 R# P/0S% 03/P& Z :/ RXL0p Jd0P CIߍd0p :h0p 3Z :/[ 0 03/(0p " ܉ X P0/O-MM(p@ ET 000 000R+`P$  T%0 `aP4  0@ 4/@P`P@003/0 @FPMߍT00 0P $ 0R000 Mߍ((0 Ⲕ R00ꘇ # 0/0/@-@@A-pPM`P1 @T. u0@0W  WN 0/RA 0CW /RW  W0 0/Q B H!0C@T@!  ផ@0 0.0 0B 0 S* 1fp@  U ~P4{@wPۍr?00@ۍ S0p PD[p 2p UP @<  p@-R 0@S PR:   Ppq0P  , 0T90( D<:p0( D$;0( Dpą p@-@Q PPpQp0C-S M~@; rbp`PAQ <Q$ >Q &Q ĐQ P ЍP Q Ѝ輐&Q P괐&Q xPPU a/U`U"0E'S0rP\bP ]P PU /U\U fPnPtPbPUt 0 O/  PQQ 8P(0F/DL ܃ `  0S p@-P@ Pp 0@Sp/p@-@QP Q  PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@0Q/DݒT #0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@Q0Y/D⤒p 0p@-SG@`PU Q Q rP<mPp PU Q aP QPU Q TP QpPQ GP Q/?P >p@90-DP  cA-PP` 0Q ppXpW`V5@PR  1PK <V`p p0 8/PqPn`<`nQ P P 0S 0P P PPT T /P P 0 1PX~ } p@-P@PP  9P``p {z011/A-\@`pP \1S 0 €  P 1P1 `p P 0,0A0 4⚑B`0 4ⓑ~ |~ @-@^ P ^%QRS  T00NQRS"  TŒ 00Z0 4Y} G-@R0(M0QP P 0 ` p Pt p `0T0?o20S00(Ѝp`0 } p@- M`P@00K0 0E0 0? 0     SЍp0@- M0P@) $ 000      S Ѝ0 0p@-Pb"!4Mb4# `@0 4 40 4 40 0     SЍp0@- M0P@ۑ l,0p.l Б 4!40ɑ0$!$       P Ѝ0p@-@P(MP`/ 0S, R00W$P (Ѝp0-S 0 0 0 0 0  0 0 0 0 :V P0V00(Ѝp@ R 0S V00|z @- @!T00@-@#p00T0o0p0q@-@T @-@T000 000S/@-蠠t000 000S/@-`t000 000S/@- t000 000S/@-t000 000S/@-ґ蠟t000 000S/@-‘`t000 000S/@-㲑 t000 000S/@-㢑t000 000S/@-㒑蠞t000 000S/@-ゑ`t @- @?^ʎ0 !00@S  \px ? ? lR ! 0^ < 0  0^ \#[L[[001/Z001/Z0 01 /Z0S@-@1/00/T0T0p@-@ P`\ Pp9p긜t/T000 000S-/@--Ht@-)000 000S/@-tAo//p0@-@ MP 0 P# Ѝ00;0 vtht p@-@M H P pЍ 0;0 َwt@Dt p0@-P M@ T T T Ȑ 0 Ѝ00 @ Ѝ00:0 ⴎts p@-@ $@ 080 ⢎^t s p@-@PP (P$Pp070 ⑎s p@-@PP (Pp070 ₎s p@-@PP $Pp070 ss @-@P  Y.<+ < 00;0 Ys @-@P (070 L(s @-@P $070 >$s R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@t P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@P8000 0@0 !0#2 /UUUU3333  cTp@-PQ@t : Sj H Sd a Sp  S?c r0-0!-w- R00E ?Rx  -  d r - w- Q  8 'Qx-1r-@w- T% Tt0 T-x   p Ss  Sw S?lQ s! R0s  S  0TS S?bAa-090 ⯌m O-P,A@:  fpP? P?  ᶃpP% 00h` 0@T% ᪉P0=S AP` AT BX!  *cD<0>0 e a008l `2C-0@TM PD@0H LP@h X`P ㈐@@@@@$pk pp p` n{ P  {j{{p[ X0p 0S00R4@8@<@@00000+0++0+@1@000@0  00"+X  "0S kp@ Ӎ ύ j Ѝ ioЍ @׍0 0 㶍 㰍 㬍l ؐk O-PMp 0GW"S00` 0w@sP-TPh +T@`0? ǿ 0 "r 0 r P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP dP"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`4000S   Ѝ p圀圐 p XR A B0A PR `@P0?0 UWp psW ꙙg 00M 00Ѝ6x3O-PMp 0GW"S00` 0w@ᧅP-TPh +T@`0? ǿ 0 Vq 0 Nq P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP P"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`h000S   Ѝ p圀圐 p XR A B0A PR `@P0?0 $?UWp psW ꙙ e 00M 00Ѝ6H3O-M8@t P T0  `uL P T0  `jЅDb a ` ` D` $` _ _ _ @-M"{ @|d{ @0S H @0 0 |0 30Ѝ  @,0^ -M{(, {Ѝ 0 0 9/,$mNA00/$G-@SP+ pE`JK0Q" F0Q J=OXP0 S0C0 P Y 000 P^ O-QI,M 0@pO Ra 0S 9 009 P0S009`0S |) l)l  `)`   @}PT0+0CP I @p  q 0| 0  0C 0B00 S00Q? 0X00-SQT0}P0-S0 !000 ,Ѝ(8(H(0@00q p7 0  ,Ѝ01 0 B0C0@崧 :Q 5 0+ B Ry0 P( WY :R 0S00087@0| | -Q000 $  6 0R&0 0 `=wyPt A 0Z @P @p` P@T HPт2 PN v `  Q Q 0@RTZ@Phv 0 Z Q! 500S 0:S  0Sp5 00+ C :S:P ? ,Ѝ0JS0 SP0 S,Ѝ@PxTPX `0 ẆW 0S 0 㰆TPX` H0 ᦆ 0S dH0 ✆,400S 0:S ( ^3 0 h0X ⁆q;R0S00%X03 00S 0:S 9h3W 0 0+ C}0{ 0S /0:S  X 010300 0 0S000200S 0:S 20LQ 0N00P200S 0:S hRZ; 01 S0$0001100S 0:S I00C 00!S 00 00+ C H0  0Sth0 ߅|10 م4 h08Ӆ0 ΅88!0 00S 0:S 000+ CR@@q 0  10R|h0 ᡅD@("] ] `"T""@\ !!   Z Y XX _xX HX X W aW V V ,V U 8U T `O-pQ ` V 20 R" P@T6帢 0 R01-[@P-T@PC T"hRPP wPA -@yw0P  :R9 $2 0 0S " 000PP@:T0S! 000100S 0:S 1d 0?@0Sp1 0 0@TQ 0:S  X 4 $1$Q0:RP@P 0S Ɇ0 0P00P0 0 R0 ˄VWST0 „OQl0l 0 pu5X45XT 5x<((S DS xR 3R dR @R R @-@P  @0/0 ⒄$R @-@P @ 0/0 ⃄@ R @-@-Q" Q Q S2r0!# 0Q! SL^" 0r0!#   ^I00<H0  $00 6T000 ~Z7x_0 ~/\! 0W/60/$0S㈀~! 0 -P6 0 0W?.@6 J \&pE^<]C C xC HC C B B B yB z`B {06 000@p6@0P}?`@p, 0 Gp! } Pj~00S# 0=SPX PUPVPU b`@P0#S< v@T< %@00C@0뀀 0000 00 ,5P%00@0 0 00 4P 4 yn9,0$zsj00$zmj40S@00C@0  0D0p@ 8t@`xPp0/Cx x0Y056X`@0X0 0 Pڶ6 J‰ Y400Sg Se @x $@x (@x z PD R3<w"2 0 4 30ݍ Ѝ0@~x""0 < WT G40D@0 @D0 S  WP @`V 40lj< 3 0000D  P~P P P|*el0. |P0. |$0S,0. z||i?. r|80Sl0. h|dg~0S %#80@`x)#WW> > > = ((< ; PS9 9 8 8 8 x8 X8 08 8 7 7 G-`!p1 0PMPPpt@0L00F VM WT X[ 8D#wPPU@!1 0 2 30oߍ 0+S3 -S0S  ,P`P%{0+S$ -Sz0S 0+S& -S P kp0S P S!@#0Si 0S ` r\ 90S P{00 0xx?/ y``?/ y[D1?/ yA!$KJPG- , , O-P#M@3 M P 0080s Ty [ 2 0U&M 0AN.0 ; cPX0SU r` +pef+-f0 0 0aPP` H`JP2P0: SN 19~0v`C3 yz!1 0 8 30cލ Ѝ7PP  0 @$`P% "3X100S`@10v010/ xT?/ x[~?/ xv2|P d0S   S 00v00vP0 x0x 0 ?6  0 @`l E+ ,D* @l* L* (* x) TA-@P0M`p4 V; W( 0 Py  @ 0 ህP @T@T 0 pPP ]0Ѝ @WP``?A. lxH;A. dxV((?A. [x( @( ^ ( ' ]-$M|0!0 0 (0 0 0 30$Ѝ@@-$M|x0!0 ,0 (0 0 0 30$Ѝ8@?G-p PP`  Bx0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00C QaCQ~WCP00C PTaCQWCPACQ7CLS00 D0C?o2R0SW ? R0S*@D T T-@A CRS^ @ A BR0GD?o2Z0SX  Z?0T*Y 00A Pa0ASW0AA0AS70AQ P0 zw00C P 0 T:aCQW0CACQ70CS } h0Zw   DACQ 7C|`0C0 Kw H@dS P_$`@0 :w( ( ' ' t1 0G-@P?  @RP<T !4*4444a4q `???p.0S   Q#2 0*00 P*0U 0 R*Q *0U000?0R*00t?Rp1?p#` w R ? Q*:  T: ' & @-PL@L0@p M`400 0婊@ Ѝ:@-@PM 0d  0\00 08 @Ѝ030 v% % @-@P(M" $0 0 0 0 p0 1<P 04P  8< $0(Ѝ BX0d bvh% T$ p@-`P0M@P! T( U. ,0 0(0 0$00 0 P;P$! 0" 00Ѝpx0 /vTX00 'vU<0 vx 0 $ $$ $ # "2 O-P0TM`0L00s Vj  0 0 A000@080 0 0PPP @ p0 p@P< 0+S+0S((P,00$00(0 P 0$f,$,0S/ 0 0 L0 30%TЍ0 KP ,TP/w00L0Y0 u4X0 u=7H# # x6! ! !1 O-IM0p010)qWX PPO l@ `~0 `L@P; 0+S+0S(P   0 0P   Z0SUS/ 0 0 1 30Iߍ P VrP8/ w00,00.u5 ! ! x4 0/ 0 0@-PP0M@000' T  0MP ""44  0S0 0h \0 0 0 30Ѝ0!@P(040 t3\ (3 ! 1 @-FM0 M@Pp0d40. `\ VPPd@!j+E P v@\v R@` T0 0 d4 30 Fލ Ѝ,NH0X t621 @-P 0 0dMpP`0\00 @ ']P H0 0 \0 30 dЍ(hd0p Ut1,1 88@-M8@8@ Ta0 TЍ ,0`( "4`3Z1S // 0 0@-@P0MP000' U  0 @  ""@@ 0S0(0h \0 0 0 30Ѝ0)PP(0F0 s<0t / G-p!@1M 0砐 040 U$eRwPF0Q W0Cp +d@P1  ZPUo0 ;u0 U@ Q@P  GU0PUo0u@^u@  s 0 0 4 30܍uPJuTP  0LkQ:p xP|`0)(/ .- M0 Ѝ@-P 0 0dMpP`0\00    )P H0 0 \0 30 dЍ(T0` Cs4-,4 /?O- M0@Q000 0S @ T.tTX a! pP.b"? a. *b i!*DPP\@]!  "P dX$%T\dT%``.lČfH&bȌ̌$DLfD$Li.`  i,-a.d`ia` hh(&d@plhphd&%gX'%T\gT%$l͌hx(b!aA"8'tp @|ht'aA$i) `&@(l"<`t`i(aa.%jh*M`&dlQ l jd&Px "lQ%P d  'ix)  l!!'t| it' "(] n(|d!. i)dd!"*hH($Di*LhD$ + e.  '0,k+.-ak.eq! `&p*eq'4͌epiX)b!} %Tl\iT%, ( ,(o&@$O$,`ba,`H@@@ba& g,`hH($D !LhD$,++ ,+0 ,+...$吠bj*. j."$ " (,+, $ , 4P%++H (" m_%_%` ,P gQ PO$O$gQ%f P $@gA , $@..@].apf!O͌@f.e! OfA O@lea,`?ea&e1ꯠP* )!P@,`(o)_(0P(P **P!!! n,*pyM !`nQ 0 P%P =d  ]n,c1d#!.... 4 0 $ ͌e# dq .O,p/$/"p/"  O$O$4 O$leq, @O@p'?p(aA,}e1@$n_@a1. P0#0_% ,, _%_% M_% g.$P_aQ)0_% !/!,_%_%_%(PX=dAg$_P*㝉cQ$魊i P%䗟 ៉gw Pc.p )O$  O$'O$(' wO$],@jA.cq@$@ ?'?#$ 0/# 0''坉?'eQ0jq%?0 p'p?j1i%诊_o%o&Mo&} . dA$`_%i1$0#_%` 0ദ_%PogQ$iaP%Po&,((=o&(no&o&g.o `(]O ca.午gA`&eQcq%`Op'@@ pmc1 /'/"./", ... 0 ' 'M'h%uf! h!f10/  Pd1f1d! 0]?h1 $`d `10f0.,,4..-. $(`e`e d@Ϡ0,`!! ,,4=,be bχM` cbc ePd,pcd b/p"++0/"/"/"`d( `! c?  #`!o!`$`?#?#`͌?#n`0n1 -0dlAnA0lO=`A`bAlAbOnA4`O.O$$@..@.cA pbAca`OlAϠ`,(@))@ ,,aAcA paqpOmbAp`A aA`! O}cA, fA0P`Af10OaA_!-_% 0_%4,P(P!!!$PgAfA0gO`A @O   ,= bgb돉fcbca`ꏉ g`acaqpP菉b /c!0O$0O$㟠?')?# )*0?#*)' m) P?'0`1' Pϋa1` 0P捈fa0忋`!&a "= - 地 h&⿋` !c1h#  l( ⿋ ⿠o+,PL o&o&_ꯂ$`` +o `b1# ,yZnܼb$  0 0#+⯊, +/ < 뿉⟉h⏠ 0()d )O/ | (⟉ abb!! "= `!-!c1` `#P b1#0# 0a=bAb!!`! "! Q @-c1(O`A`# b1# 0# 0a=bpb!!`!!$@ " -`c1`#b1# 0# 0 abb!!( "L@= `!-!菄c1``# ͌8<@plDPbb!# "0L"0P2  0 0 30Ѝ20 n0S_X0 nW8@-@P LL 0DDD   00,d0t nn#EgܺvT2L G-PPp`6 W, 10.!00% "0 ?0%0?S @@h  No  0hS@H"p ` *0V@@p`F  G7o80 ,nd0 $nD $ t!t1 p@-PP0M@0 00@ TG  R00113 R0a `0~? S ` 0~? S U PE "001<3 R0x l0 0 0 30ЍpPP0 mT44d0 mu    0 0@-@P0MP000' U  |0 @  ""DD 0S0(0h \0 0 0 30Ѝ0)PPP(0F0 m1x H G-p!M@1M 0砐 050(U,ePG0R W0DA +@P2  PUo0 ;u0 UB @P  U0PUo06o@2o@  r 0 0 5 30 ܍Ѝ!oPoTP  0dQP/p pP|``D- M0  Ѝ@-P 0 0lMpP`0d00    &P H0 0 d0 30 lЍ(X0d ld {$0 k $0{0k/ܺvT2#EgO-0|M@@ 8m @/LPp8`pPp, p'+phkg| `<뺅Th,`&P !`l[kP@a lK+P%@$P 8@g[h[DHhKh )k!.h \ 隠fl j (nHla$j ,L͠kˌkd . @艠eg g*Pp` a n,+aTddKdi{ꨠfpf p' pl +@Hhkxe{ `e`&lP `K 4XnKn`!+\llˋlj[mikPiP% Pa$+ Pg\h[h) `ɠ`ˌ` d. +d` a at霠jjfn,* (X hgghpꨠddKl{ p'epl@ g}n{+n<@@ffK`k*`&i`pllk+lˎ`@dIeKej['hP% Pt+[`[` Dani+iˌ hd g&+lʠhˌ;h+ )Tkjf+% f+"j P i#M(a, ,$ a+n Hꬠge+   g+e( d dpX+)l hlpfd+ !kK*@ f+kK$nDp@ +` ik n+`&T`dL< eKj{(p Me+j{'ph$lkly`k{h+$ kˌh+"P! P`[*j+d'P%P jd,\i[ L8&a it.ˠhˌ g" n`lhg* %f ꬠDd`)b , db iaLఉ @.eKhg a@$l*@gl!KfK`dp)n{fp8` p'bpj `ze{bkj(MѼ`$ik$e`& `h\l`+!P l[`+" L(j+a[(Pja[%lnk Pनt'd [@`[n,h" `h.X \̠ iˌipab% & ag b+ h ` d M,ќf$d ! d뼠hhXeK.0H @MeK$ь @$ggI\pbKb; l+s "Mx |b-$pf+f{D`n+ ndn*hlj`eek`P nTk(X\芠Pnn[<0!`;0#M08$l;l@p"a{Ìp'MȌp̌ `$y`{`` pdk&`nČiȌkǩkˌj) HP#b[nČP%iȌdP̌ dˌh tZmČƌ͌3a[aˌ\@@ncK$ j @ jf,LKm3bKbt n$g.lɠ(hˌ,  h+i!< m$&-3 cc+X0n4e(8f<  0f;`+" D0舠m46g`=`30g;dk&`<0)n48i+p<p0Ti;l{'ࠔjekp00 en;#@ 0xt`{PP `a[%p PcpmnܼvmzNSaP<@nKi[%Pze\mb[ &cK vg@b.cK$D @lJiK`% hhi ,`!f+  hd "฀ac e$ ce)H+g+gtp0.l;zt0#imx`0v|d! p`{d(lpc@ 4 *8/0녗xB /, :#( /$&:0/--M  ]Ѝ Ѝ/0  0c <cA-@PMb p 0 `P!0 pp pX Y{0,pp{ pL O{0,pp{ p@ E{0,pp{ p' P ?0p  B@RQ 1 ! S%{̠0+{ p`Ѝg0 Ss<0<0 e 0 @-P4!41 M0 Mp@p0809  `p  QP3 * 0 0 8 30)ލ Ѝ"%[p `Pt 8QP* PE0*P:f,0B0 dd HtH$H p@-+,@@PPpf0Pp\C-@PlMP XQP0SG p,P>00P'a`!a 0 ``(a0PPP#Pa`pa 0``(aP P LP @ \``lЍlЍ'wG 0H0 @d@Bp @- M P)Xpqp1p`@PP@@T 0Q P Ѝ A @ XP @ Ѝ` XP"0S, -S?@0 0000 ` u V RP +R@@D!0DS WP0S +S!@?@!@x ` X ?P L0P00 1 R/@P/!R/0@>S 00 00//l@-Mp @e``PW P0D>S 0!3100 0reЍ>SH 0!3100{e00we00 /-p@-MLeP@U@0 ` ` aP|0| 08 R;0Ѝp@Ѝ/0 a0:, ,  B<P, ,  ȷA-@PP`p= =U( X0ES  S0+0E0VP00V&2!0` 0`00+WP -W =W00V-00`00+0+0`00@@00(0]0 b00T p@-PP@F 4a `0RuSpWS6X0CS0p à 0R Q PSPQPQ  0    P0 0+S -Sp0 b40D bN I@ O-TM0wSp @@0 0P004080<0 0(0td @( md@T$@7(`0p00000G@  @ 0a0GS00Md00Jd@^Fd@`TЍ+W = W0 -S0000 0P X B R = GS/o"!!   ( P:0,`d ,d R(""@,`0 @(  ( 0S" (p W:,`cp ,c0S"@(ppG,`p(pW 0[ 0I00X00p(ppW ,WpPxS(P Y0,`cP ,Uc Rp"@(P0PE,`P(P   sP(=W +0GR?o20S# Y,`c P,+c0SF(P"2PE,` @P(PU 0[ 0I00X00P0(P 0 U:,`yc P,qc0S"(P"2PE,` @P(P0X0 0%0() KR;%I?#I0!0 KR<I Ic $0@$00SP=c0"SB  U*(@ T:,`3c @,,c0S(@,0@D@`(@Ty -00+0"00 P0TЍ'pC  001]0 a1]0 `pꔱ1Esb00(0VpJ 0Xp+P-@ +B XR R  0+B -R +R XR 0 -R  X@PPQpP0]0 `~80o0P `` ~ H , 0@-@PMP 0  P@p`Ѝ00:0 s`t P 0 @-$a/o`/00/00/00/ 00// ///00/ // /A-@p`e^R+PZRU PU  0   IP@P PPr`P \000Vp@4000aPaPD 0p@-P@`T @T0rS PpXp@P0+Spp@IGyX0@-0P$M0200n 0Ss 0P 0N 1 00S${W8p@2 P! W0rSB  00PKp!  \1 P @00S5$Ѝ00HP0T X@\4ma@]W0 00S  z^a@P" 00Pp 0P$Ѝ0T 0 >_8@0 6_ttȀ 0 0@-P$M  0d 0Si 0P0@ 1 00S<p@& P 0rS: 1 00PP! <1 P @00S-$Ѝ0`0 00S@ `@P 00Pl0P$Ѝ0P 0d ^4@0d ^0t~ ~} @-PPPA M@I D1p0S+41@T4 `0`S@' 0S0V0, 0S%P`0S  b>p  Ѝ50@T0S h+``00P$D  088l0x M^t$||hT|8| $ G-`PHMP6 0p0 0 p@  zp@ HЍ P 0 p dp@ *HЍ`0S @X@0>0 ^,A0P RC@l O-P4M\p@Pw WmX0S0 `00 S 5/040 00!S5+0$0 00!WaW0] Y[ X00Ud5S`50 0 0 0 0@P0` (0`0r5`0D0$0XTY 0S20`iW A, 0`YVW ,@P(05#[0tQ` 2P X $ 0 4%*&  # #.ğ BPU 3 2#0!/#1##* 0 # N`V4Ѝ3+00 00!n|3/00 00!f`30$0H\.Ld0a#0L0|2pST @ P, ` !X`P 0V ^ ,@Pw ^[X"$:600%$0<"%>4!!!0C$"0TAP%"$A0O#QX00 0 0$00?S%4 P! (`1T101! T$?01>! R01"_0A`(0l10X00`d(0@t0P`d(0 QX  R.AP5Q4 0A` X0A0PE$0 `0P 0  `1`190T dt\t8H0T dl\` GzG8 Q)\(\ p SQl ̤ ` O-PP M@`o Tu V| 8p0T:R P- Ÿ P2 1L PPm@pQ @T*RP P 1L P R 0Q[ SQ Ѝ\ P @ @0<0\; \ @ p R@p\ p W R:\#Yp 00 [T80 [VllD0 [zp,@ \?[*!]-  p@-@PP U p@GHT0` [U((h0` [p@G EG-P@U T\ Pp ppq W00"1aP: P] 0S\ 0 R 0C ` +PP0 X= V  00S0 0 Q 0  ! 00S-*_oRe`VVP" U ! [xxt0 *[T\\0 ![DG0 []00P,   C-P!1 M0 M@P`040$ Q? U5  00S0 0@ $03/!1 0 4 30<ۍ ЍQpp0 ZV U G0 Z0 Ztt0 ZX0 ZD40 ZX@̽ C x EX D O-MMMp\&0X6 PL0 TDe040_ XB 0SI VP 㰰{\U\0U@@ R R 50B?o2 000RU$00S0E0 @f0S0000SgV 40F+0QG 0@ 03/[o 0@ 0000,00G(00 3/ P    0S00 * y 0.S Z~00S Wx:0S 0S , P80: S $ P (0JQ/030J1 1000 @P}000$0 000S  0P)80: S%V 00S 0  000S0 P@T  00S0[4/P/ 0,0" $2 MލЍ  0.S0Sn 0.S}j0S  0@0L  2/0S0>  000.SQ ` %P J0 @P@ @h  2/05G(100+$000  `P0hh0C/KYr0I[ R 0 D0$0 8Y0S0 .YV0 %Y0 Y0$ /QR[0/ 0 0@ 0 3/0{ D D0t* XL /d <   O-Pd#``3 KM0MPؔܤp040; WB VI YP \U /\@ 0@ \/\0 U'"2 0 4 30KލЍRZ/\3/00`/\U\% pD0G/XW$$0G/XV0G/XY0G/~X@`p `hP 0   R  Q 0T/S 0: S+ S 0 0 0 0 `X# +00S0 0@ (03/0S0: ST/03010301:l R/0|`|`0I/ XG 0 XZ/0 0ᲰO8 Ĵ m n| o SO-M$M %5 0P`P0004 UD @0~S<    pH 0S/S;RL 0B0 4ZS 0H*0 ;P4S 00C PR- IR*00S;R# 0X @H p S   lll *S1 0@00S ?S! [S!^H QM00 S@000XS 0H , R @ 0<@Ⲑ 0 0R  R QR Რ@  +Pm@PU 8#$3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0n 0]S 0 00-S]Q 0]S  0@< 0<20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 gGY0 [0!^0  @E  p 4` L0P H *; P 6010Q@@Kp0 VU 0M/V0K/V0M/V 0lV\0M/V@7@5A됿?**[-] !d   O-`QMM@p R W T  D lWI^ @P}\ @\ [\ {\PU PE0]\\ \8(<PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B00S08( B0 SV 0F0C  0V0 0 @ ]RR ]RR xdd0R/UX Wf@FU?R/U\$$0R/UR  p@-@PM`P( V/ 0  0 S /0{S 0\ {\ 0 P# Ѝp0}S0S Ѝp@T0.UV40.UW 0 ꨨ A-MMp`@P00P00 0< 0000000 < 0 ; S \00  ލЍ℀ @R0B \ 0 \\ 0\@9*ލЍ0[/%U\@ p@-`P Pp@0T1@D 0CPP (@T*$000p0]/Uꈦ 0S$ - *S ?0C\S0P0S Q 0S 0 0/, 0 RT 0@-@"RC ^ 0QP BP'  R7 "R- 0 @\R "R  R&   0BS0 R 000 R "R @0 #  0 @ .R0\000/ @-P a `1 QM0 MR050  0 0 5 30,Qލ Ѝp p @, 0 p @EO0 >[P@S0  0P0댄TT ܤ 5O-0$eP`M 0500S E @p#S!" V0 pP$ 0S (%P @ 0SU0SЍt `p  0@S0 04 0  0Sy t匤匔匄p ,p<0fS0fS 00#3R0 4$ 0000@SS 0oS 0oS0nS 00#3R0 # 000 PP  00#3R0000 4PP 00#3R0 (# 000 PP( 00#3R04 " 000 0#S 20@ R@@EP00Ѝ0 S S D_PP 00#3R0 (" 0@00u LHPP  T@PP3 00#3R0* ! 0 00V 00#3R0 ! 000GlPT H0@S0 @  \PP =QE  0P00 dOP=Q 00 @l0厞D  0P0 0H$ d,D @ < ,< ~ ؟ $~L } }p@-PP tOP e@PDPPP 00p I0 uRT | ̝ @-,@@P{ 00p|O-`(@8 0M0008pP00P UVYTy 4 HpJ09, RW M Uz 0 2c1100p0 0p 00S> A0$0 0  0p P2 T<000S[ RU\ T'H7 0 0 30Ѝ `s?0l0` 㰈pp  rPWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S  I BQ #S# H BQ #S" G BQ #S; L BQ #SP M BQ #SF N BQ #S< O BQ #S5 D BQ #S  E BQ #S F BQ #R 0S:U 0p0S8 Rg BD{P 0`000  00  L$   ,40000   $   30000S0 @  # 00   pW p[ pR00@R@W 0[ R000S R 00RY 0 [ R00@R@00h@gp00,(@ (@(00,0uX X0[  tPk0Sy[t+[Q_0 PJR00kR P ppfT pw0`00X0`0 0SCQ DqpLp Y*0p0]0 ^R0SY00P pn0S02 `00C0* L p;pRpOpL[? 6pEkp0pkBبP  @ L  -0 Mˠ0 Ѝp@-@|`M`Q P0ˠ 0P ЍpF)3pP P Ѝp srA-P`@ A@0S(A@Q0,pPpPR 3M@@喿 P jp0 @BA QA  Vp0 Mp0 $0<0 Orrdr`rē p@-p`pP`P^@T T0T0 R@@RpP00GDA\q@qAA-`p@p@P90S x@@K R"@\+_P@P00RQ@@ppp@@- 0 0 p@-`AM@PEEpP 0SA|@@0V ! p @'UpЍ ☸0P  R 0QTG B&R 8A@Ԛ4њP̚RS' Sp@ S'@z@ @S@u@@S 4⭚@q@0@@4⣚q6@4q㛚@0P@@4ⓚq; @ꐒ d H oo P 4   PP5PO-BMH% M08u0  p0$ $$ 000 0000 00 00+0OP 4 @0 4><P (`P,@\ P 0S x400#S \ P 0S @D@4@08@\ P 0S D 4@08@\ P 0S 3 0   \ 0P 0S m30\ 0P 0S ml30d3dSd@F0P + < `+; @P\ h@P 0S IPPU PU 2KP20P0xS~ "x2 0 $4 30Bލ ЍP@\ :P{ 0S `200#SJ \ +P 0S (B(2@0@\ Pa 0S 100xS0xS0S& 10 0sSA0wS>0S;!  A1@0@ \ 0P 0S m\10\ 0P 0S l,10 1P0P!0 $ 0 L0xS}0S y00  00 0000@JP m4mh m ll lHl lkk |;,kpj\ pjPP$Ѝ[S5 \S/ 0S@0?Sc S *S0@V0*SV0 ' *S0  0*S [P$Ѝ[QLpW /W| 0p!S^SV J  Ɵ  P 000@ 0]S2^ -Py 0]S00S /SD .SDB 0S} = 0U/S:w\Qv 0@r/P P]S /S \S$ S] -P8 0QV]P 0XJ q  0@PR ?=P@ P0V@0S 00T+ 0-S T~VP]P0 p P]P \P^ S0S00@00  $ P   R   U/R S /S pT 0-S T@00sQ@0QOS@00]SQ-P ]Go0⨂\ V@T S0TF 0X q R[WP 0X q  0@PV<2{0 J0S<|<0 J4Qo0 @z^d 0-S5 ^06 Q@RSp GpP@0V0  ! @T6 0 Pf/T @00 #0 @@T S0T0b /y<20]Sb /Sf \S광P @0P@-@ P +L 0 Q <Q ?o2c   p@-@l`P`:GP 5GP T00pT 00pK 0 pP O-M! 0 "  Wpc P   10 230Zߍ 匹PT 0 4p H  ~ P7 R @;` 0  0P ߺP& PP 0 pP 0 P0@T*p@ J 0 pP zK - R  ! @O-M! 0 "  pc P   f d10 230Zߍ PT 0 p H  P7 R @;` 0  0P WP& PP 0 pP 0 vP0@T*p@ J 0 tpP J - R  O-M! 0 "  Apc P   ޺ ܺ10 230Zߍ |PT 0 p H  n P7 R @;` 0  0P ϹP& PP 0 pP 0 P0@T*p@ {I 0 pP jJ - R   p@-`T@P@@ [PPpPfP ppx p@-`T@P@@ PPpPLP px p@-`T@P@@ 7PPpP2P pw 0 00 -H- M0 S0 00 0 0 0 00\100M\ 0    RK8 00 0 0 30KH Ѝ/}~-H- M0 S0 00 0 0 0 00\100M\ 0    R '8 00 0 0 30KH Ѝ/A~~ -- M0 0D'--M  --M  A-PPp`p V Q @Q EPD@h0 0000Af@00 NG(80 FG0`}t ht 0P R   0// H'H7 O-@P0(@04!50;:`P6&`p`3x@y66U`1p 010000 /0 @- /,0k{   +C 0/A0C0C00[k {{+C{7 Q/A0C0C J@ @-p A J@ @-p J@ @-p J@ @-pPP `@-D00p@-@PP   p@010 Bte p@-P@` \7Ppp@-P@ P7Ppp@-P@`D E7Ppp@-MPP`V ⊳@T |00CЍp 0 : *p@`$ KK|d 00 R K,@-D00 0S@l J0#/"br1 0!@0lR0cR0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \lp`0LPSa0@E: T@@ X@TS^!:O-p(BP`= @6P PXY  P A-p@  1M00`0S 00S \P#P3.000R`0@ p `0 0 2 30ߍPP @@ @w(@$gtg\gfO-`P 00YP(<Ѝ0 P( 00 0U` 00S! SJ 0 @P$ph08P pC @< P-5P  X R0 0 @P$p0 pC @< P5P X R0 (000@ 000@(Y(P(PzX0  GS(  +S -S0`000 PP䅐ಐ3P:U V P( 2c2c2<,S \0c$00P 0(0v50 ,P(]U0X0,0h000j<0 P4P: _<P 4PP. 0(P 0  R7,0Y0!0 @ /Y- 0( 0 0; 00P(/0 ,0c0,?0S,0111v>C 0C,0P(   /"b!!A0,0 Y0 00 000X: ,0L:,,0 v>C 0CY0P( 00 050 ,P(0PY%S(P 0,, ,0 0C0P( 00 0Y` 0 0 SP(L 0 0 0Y 0< 0 090  0YP(YzY80  0GP(=0 P( Y 0P( l8,, ,0 0CY0P(k 00 0w0 P(] 00 0i 0,{,0!/A!b!b0C 0P( E 0 B0 S_`(`P0Y08P7 00P(? c0,Q0S, P(? 0P0?2c11!, 0  0 0 000Y60 0P(Y;0 mP 00 S 00Y((P10 P(&(P000c0 ,P( 00 000  R 0s @p 0 @00v0 PP `H 0@aa0K1c B  B00  002  /#b!!"A ğK/"bP 3 :bQ # 3,P b4x$ ,  Q0 00 00 0 &0H0?3c112A #K?###cR 3:#cR # 3 00 0010!, 00C0 0 0@QP1 R0PR00A0PY @$p(P  00 00PY @$p(P 00 0P,  /#b!!"A0 K/"bQ:2bS0#03 |"  1 ,0 B00DRd , 0 40N0 S0(0!0`@YPO"  FP@~ 0 40N Q@(P0Pn 0(P0 0(PP @ ACLC  \^JS S  0 0#3P0 z H(/o"PzX (PUSX ZSP @  0 0$0t0P0(050{Df` QP] l'd[ [ n$IX P)\(\ ףV V U pT lQHE10PE0,P` ( P& Pd!/"b!C;R, a2ba12TQ(tP ``@CP(fMP P(P @j @0C2c2c2P$00( (0  @X 0 @R|YP(  00 0SaYP(  00 00@>0S; 00@70S 0@0 Db0`,0 0 0P , P(01(000C.$0r,^2000c^\0M0c P  0P , aP(00(000C.$00 0K<# `  0P d#,   P b((0$ 400M 00ЍR1A-0QPHP P M@S Q(h10d0 P1&PD@@\p ",. R!  vΌ @p `U# Ѝ0 P0  $ Ba @L  p `pUl>T 0 ЍL Hc=_>004N N *TN N M M gfffM hM P2@-0M@ 0P ~00Ѝ@-0M@0P q00Ѝ@-P@e1p@-P4qύˠ@Ѝ,0  (V@P e. P |0 0 5 30ݍ Ѝ\0D0 l:k<00@f<00JJ8IG $$0 M000 ЍH--M  Ѝ Ѝ/ -- M0 0} ЍЍ/O-@PℒM p` X X00?#0-00P @ P 000 00P ! !  D1XPF l.VP WT V[XPVppPpW` B 0`f0` ᮩpP `PED8 0 9W`!00 ! 1 00/ Ѝݫ0XPC0 P P00/ Ѝ 0 9`npPP V gpP `P00?0 9e\H\E tD @-@ M/(0S2 1-0 `(0` 1/qp0Pp)  0 0 PUR <0PUl/ ЍPPTp 0S  0CPW/L;00PpN/@-P M>/(0S: ,0 "p(0p 1/qp0@`/  0 0 @ToR <0@To$/1`V ЍP@T` 0S  0C@o;T00/:00/p@-PPD (A0S5 @Tp1 Rp0P00 P 0S P0 0c0( 0P0 0 Sު,P ڪ4P ֪8P Ҫp@ϪHM@0 80Sp 0K0 8eE(<> @-P`@90 qA-pP℆`@P( T.  0 SSS8 S00 S 00500000050 z7T40 q7%0 0  00`50000  = 70L0 20-V00 ^V00;\ 40000 0K/l R000C000LS0 100C0 0?V`00 0 00000 \ \ 00y ,40000  70L0 0 h", 3010CP;\ cP3`b0D001dP0j R SXc\Qp3 01K00 M \; =\J \7 00C00L S e0 D100C07"00 0 0  T 00L0a" 0W0C0Z2 F0nR \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00L0! 0W0C0 0 #\ 0 0 00Pi00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP>cP%dP:00L000L0 0<00sP00nL>t=  > = < ; ; P9 O-MR@p 8 0S? XPF DP 0 0`0 @F2P?T@D 00X `R%R% V 0@F 0700ЍU 00?7.50S`?7.5 R @T  0E0Ѝ7007 7 6 0  00   4@ A-@ R`P0Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@b"0081003/0P !p0 $@@0V0 00 R (000P3/0P! U  R  SV  0SXP000U />3X$|? t=A-@R`P 0Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@!00810 03/0P !p0 $@宾0V0 00 R (f00 0P3/0P! U   R  SV  0S]P00 0U d4< ,A-@P| P0`Px rpPh  00^c<!"#b!0CaqV8 X pq1PXU $001p00S ?!\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(ģP` p  0000SxͤP0000H0003/P 0/>3ppp=A-@P{ Py/`Pw rp Pg  00^c<!#b!b0CaqV8 X p0PXU $001p00S  \1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(+P` p  000$0S4P0 $000D0003/P 0 Th  hSR: G-P000pS` 3/0Y @IOP 4 T0 0 0 0 Y @IOP ! TT0 0 H H0 0p`P   /,   T SR; G-P000pS` 3/00 Y @IP T0 0 0 0  Y @IP ٤ TT0 0 H H0 0p` P $  /    4x O-PPM M Q \ /\E 8PB.P:p/\ p P/ `K`\o @ /RR.\)  B R/0 D 0r3 I z pd 0: S$  S/ L/o" R/\ @  DQ7 .PQ X0  [K/R 0W0[0娐 !uɸP-U  -   RW  $30/\0#p0@ /R0 X0/ ލ Ѝ@  ލ Ѝ.003 X 0/ ?     㬡PE3003>003003003?00300A-@P Q aP`\Pp@P RP`V 30"S ἣ300@p@- PHaM`=  E-4QP00T P; 0^0% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P j<0 0  L3 0 @%p@-@PP`2 U( 0Pp:P@ P0P \:V \0@Sp\ \@P :VP:Pp<80  1 00 1 p|. \. 00/`p@-@PP" U( 0PER R:Q|Q00Q0SP0@|R  :RRp@0@0D 0U(P0D 0p- `- O-M M ( 0P8$ p00D40w 0S~ 0S 0S t4!S S4h`P PP7  XpP 00S RDP 0PH(DP ` P@U"0 S* Z :S `\S S S 0T:Hᕡ@DP U@p +P `0P SZl[@00#QQ AP6P00@S0 60000040 p(0,P= P 0:R pR0t4@00 0(<P G<4`PD pP? :00`00 [00S   `P  0 ` PㄶPu0S00`Y@D*0 S :S ``[ ` @d `` 0:R& PR0 0E`F00S:S:00` F0H[0 D0   ạ0 @Cx `! pP H @DIpGǠP @ p ,P pU 9 D0AX0$0p#3 0 D4 30ݍ ЍP ហPpw_1 00%@ pP 夡(3@00@S0,P`U9 \`PU03S< ;1@O71@0080` +/0SBh0` !/0Sy``t0` /0Sr@@P0`  /j ĵ 0@0S> 040*0S00S\S00 R|AP 0S7\S5 00S1 :S000 0 S4Sl A 00S :S|S@0@ A@0S'!|1 0 8 30V ލ Ѝ  @P 0 0 CT1 0 Z P @P @@QP P } @1 0   0yP 3~t0 K-0 C-0 0tP_ P @\|``X" 4 hH  d p@-PP@ T `` P (0 0d0 0p@   @0@0 ,T(t0 ,L , A-@P`P V Ux = @P d㥜P 0:SS   4r`pd \S@+  R0 0:SS ^S0S:S 0 R0@AdPb 0:SS`d A0R@A0,`0S:S 0C^BC@2P 0@0@^1 0@P0 0 0 00:00ᮝ`Pሞ! 00 f,~x0x0 _,Vt``80 V,l@ @e@K. 00`    A-@P`PF VL U: = `P\ d@P^ 0:SSpppdG0:SS   \0@@AdPP@ pd@ \D@ATp">Pp@+0 +00 +V80 +xF0 +pP @@@- 000 $ " # p@-PP`@2 V8 T& # vP8 00S 00XS@<,00A  RaPAU70AA AW0AR^p``F?C/+H0H0C/+V0080C/}+p sl qL rO-pd# `3AM M 0@P`0(0 0 0S4 '/4 PP; P0D 8T  0O-00CS02 0x<4 徱 㺱<4 ⵱0:S 84Sq1-0S--00X"D2 0 (0 30 K, p&!P) 0B.K:SS B000$ 8T S#葟 0440<4 0 S BKI ; /04$ (4J+<4 0'$CB>K0CP04 8 0S:SYD H R0 0  Q!0A00@M@04@0+ w0:S , 00UePaE40D P*G0 :SS008$ 0:SS00O4 0L    8    P  0 0@-0  -H-M0 S0 00 0 0 @0  00^100M^ 0@    RL00 @ 00 0 0 30KH Ѝ/| d p@-(@(P@GPOp O-P"2 @`0,M0$00ƚd20 R[ 00@`pR 0 HP Z p P p J  0J0PP0 S": *$ U10 r 1$4S!$@ 0$ PسP0S "<100S (!1 0 $0 307 ,Ѝ U r 1pP Р ,]P 5SX0(, VT00#    &PP P0S9@H  @-;(@M@@00@PЍ  { k{ {G[F { //=A z z k [k'kFKE{{ //=A  { k{ {G[F { //=A A{ k [k'kFKE{{ //=AQ@-@0M 0 0$0(00 0#  ,0T *P0 0# 00Ѝ *0Ѝ-$M0 00 0jP$Ѝ-$M0 00 0ZP$Ѝ-M0 00 0 IЍ t {0s/C-`0!,1 0sMPPp010. V4 @X0^00pAtA^0O⚘0{PP0P >TA{ F$0 0$00 @0| p0 0 1 30sߍT0G0 x(V8H<0 o( pLH ( $$0 M000 Ѝ$O-pM/0? P0030_ We 000!R !X P  #P4%X 00S)00 R 8/0? 0 3 30 ߍ / `0zS 000P0C0 pXP l@0 0 "P P0C S}P @>0 $'W$H0 $'a`0`F p0p0S8@0 "P* 0P0CS00000偼0S0p0@0 0 z"0P 0C P0 S1P 00 pj0p0S$P 0Se0 0b00S 0p000Sp000e  0 P_P\+PV  PR00SVp!p3`0 S`0 ӱP 0P0 0`00050p0S 00hʠ@0^T@pp,(0'TIN 0', 0$0 0$`-QQ ]QP0 ` Q8 @$00!0SVp!p3@0 0:0X0`P0 ֙P$ 0C 0 `'0  務p PTPpG@0SW Კ`P 0@00:0偼0S UP /00S?0p00p0S00 1P 09pG0W[p8pFW mp!@.p( H 0+0AMS00 [m0H000CS0a000pWH R0XS 00 ( 0t 0        0H 0 0(0 B0P0030F SK*N (@m`Vp0t7t'000l7(`0 p>(00S pP V ,$00SGV`@ T@0  R  R=  0 BV0 5 RDP/0pH  R~ @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00s BH H HQI@ `pG00P0W0S`J 0000P4 H      D  8  L T0p080$@0X0@ 0LpP00(  P4 0C 0 (%0 Öp P p/ p ἖0S $0 PS0pS`F V ۖ P0 0@00bP ($@X T 0@0 0d0SrP [($@  ( 0w00 Cej00 >Vk5$   ]R $R@Pp00@0 000Pr$ ( n$ 4X @P0 0P 00,p004@mP P P  P Ph P tt0 $g#000C,00V[ 0$@(k ` @vV @ ^(0R0BH0R 8P-@0 `)V`p ,X@0Tp@H0 H0P`V B   H  0SP H0 p H00CPTX0p050X@LpP0 00 V?o20SX 0p B0V 0c RpP]0 P V0 ᰕ P 0C ?0C #. 0(  bp0 P s ᨕPX P`Fp0S 5P [[ (0 {/(0 SA-@P`p0 .P@-` MHP@pz<0P000 Pw ЍxA-@Q8R`Px v $200S8 X0P1S010r G000P`$ pW@0PD uPP^ 0 8#00P0 0 C `C00000  Q  Q*RQ1 <0@08 00 0B`0P$00P0 㾑P 00+ B #A ?#@ 0#L0`0 ! B0 `$< p@-@P }Pp0@-P$L MT` 0S pW 0 7/@P Ѝ#@ Ѝ0804 H!0p8 0 00M 0Ѝ0A-P$LMT`p 0S $X 0 8/@P Ѝv#@ Ѝ p0 Hj!0$d 00M 00Ѝ(0A-P$LMT`p 0S (X 0 8/@P ЍA#@ Ѝ y0 H5!0( 00M 00ЍT0A-P$LMT`p 0S 4X 0 8/@P Ѝ #@ Ѝ >R/H!04 00M 00ЍO-MD@@`PVpZ T6 0US`$[C 0S@ `V= 0 6/0S) $l @V 0S HZ 0 :/@PЍ"@Ѝ0$lV?%.H 0Hh[y?/^ 0HJ>s/H 0`$}>[/^ D  (@- @MЍ0@-P$L MT` 0S 8pW 0 7/@P ЍZ"@ Ѝ ?/HN 08p 0 00M 0Ѝ@-Pp`"x@x0@p@  :U  ޿0 b$  ''t(0 0㔦O-$M03`0H0  0P 0u 3p000ʿ0P0! B0 b8<B p  UQPE @4B 0L3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  00P- S@0^^?0 0`0  P 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `000C0S\000000 0``0\  a  `0\  b  `0\  t  `y0\  n  `r0~0PU 0 D RQ0\  @`b qA- Q@Pp`" ბP=0D! D?o2]R0S p0$!0< @ 4 140= 0 V V 0 P0 A T A-P@p` P.T T x0! D32 0 A_T D0$!0@<  1x x0% (0D,TSI6 O-`\(pX8SM 0PP0D10880 0t10x1 0 ?o2V0S 0S W w@cP  \0P0 X00 p1# 0@S PT, U T 0 1 # P00? PPm@T`P @  TP 0@T0P 0IC1S@1@!0<0`0P0; p 0S V <0 0C BP0ap1  $6* 0_?  Rp1  5' 0>  Rp1 00p1 00p1 00p1 "00p1@\00p100Np1 p JP@T`zPH> @L$$I?  㨎P1 NzS?   pTPQ{0 0 0SE? h T $P(Pp `@T- 0 P9/P00嗏問 ᓏ呏#3 0 D1 30 Sߍ0 <$pA `uaIꐓ $P(@@j0S`(r 00S  Vu Uz 0 0p04 00 0 `P, $ L l7 ,P`O@@@Q@TAO ,[M* 2,@*$04)Aq  0000 0R$00#(00S(0 00 004P 0 0S0"700 0P  v0S 0Sd ew? (0~sW(@20 0T400IH1 `@0`PgXP 0Y3*  (0@0S(0 0 CQ KP0 S @V< 00P000 ? <$  h @ tLX L@- M@(  @0 @ 80 0P@ 0 30 ЍP @- M@, @0(0 @ 80 0P@ 0 30 Ѝ`p@-@QM`P0 0 `PgЍp0@-@RMP0 0( PQЍ0-M 000 AЍ-M $2Ѝ-M $(#Ѝ@- M @}ό @0 D <0 0P@ 0 30 ЍS P@- M0 0@}ό@0(0000  D <0 0P@ 0 30 Ѝ% 0@-@QMP0 0( }ό PЍ0L 0@-@RMP0 0,} PЍ0 p@-0@QMP0`0 0( }ό `Ѝp <- M}ό00 nЍP <- M}ό \Ѝ <- M}ό $JЍ -$M 0 0勡$ЍO-MMn)`< R 9A P p@0  @p IBTIp`$pT ` P 0 ST U Ō ܍Ѝ R U  fPP 00 @-p@-PP@ D!!!!@ṋ0P0 @p00 s yA-`P@PB T% $0S:0@@T(0  0 E R R( pJ0S$?@04 <$0S%*8( p00S$ 004 " d @-PPM@`q ,0PXPH00PW0: S Sb  SЍP P 9P p`P@0` \0`D`@.S0H08< 0L R$0L R 8< \P@D V^0 0U z:0]0S \040. SЍp $pb Ѝ0:0P  \ A-pP`P% ,0Y@P \0 00X0 0 0P$05%0`?@P0\X0@00\ k @-`QM@ ᆡpp-  8<0RP@D0RP PP00V Ѝpp epP<@8@ЍPPЍO-`P4M(v ,00P0(0r S , @C0SOoB 0 0P0 0 -0 0PP0,0 00C /R 000,00$00 ,PHL0000p00 R 0$0 0500W000p@@ P ,0  0.Sn P  ,@P XG0 0L00, 0 0S5050S 0SK 0S 0E,0\00 0 0$ \0 ~ R0@PS000B 02H00#0Q 000PPS0 0u P 0 0y0P0S , 0$000 0H,0 0\00 05~0S 0.S P00 00/  00$0T,P0Sq,0B 0 S; Y $ 0U0; (0YS7L0S,00 S." t P& ,0 <%,0Pp/W P,0%<,0p4Ѝ0 00P 00$ 00BUYd (0SY 4ЍOP  0[5P0500,0 00C /R} 0P00S  \R   B  0SL0S0z \R   B   R00L Rj0)0h S050$0$0UC L0S,00S (0S05SEP e0$0SW p O-`P MPp U0W@Px PV(p,P X PUP1QP UfP[R PPPP [L PP P[!  PP P\ 2  L,  PWU0 PpP[WX EwP P0 %,0K X  PU @ ЍPUP1X0000x0 `Kx0 e ^ P+P P0 %,0| Zp,00,0 P , 0  $ ( P 0 p@-PP5 0S %#L R3@T@L 0Rᝈ@T @嗈TP 又,0 ኈ@p('0"p@ H0H0 ]@Z`lV R`P A-PP @TP ,0,MQ Q% R ``@T KL0S 5S0T 0  BQR@( @D Q\! 5`V `$V`05,0$ t P ,0<,0@`V   <,0`V`P@,0   lP@ 50 $ 5@T 0   0S00 ,0 C/P0/0 \ @Q20 X@崇L0s ,0 `L0SS 5 ,0(DPv(AI,0:P00\p ,0/P W@ `  ~00 00@kS <P0 05 2PX,0 U<10p(7 505I,0 $0S005@?@p(0S P -,0 00p( 505.```(ț` 0 $ 50 $ 5l  l U T Pp@-@P T UUp 0 p4"0 00 \ < A-PP`F L'p@,0 $5 S9 S@T @ՆT V,0`<,0L0`S00/S , @ |00| =pp@ hJP G 0 0 ;H 1p@-@PPP 0P0S 0`0e0S၆p@ (/(,(*(u0B0 Vꀱt4 1 0A-P (M\`@ @Ppp 00 0@ P% 0 0CS%0 p0 0 0 4 5;1:(Ѝ 0@0<0"0 0(Ѝ0ذ 0 00M 0Ѝꔯp@-@PP P PpPp0*0  p@-@PP U p@D0B0 U(C<0 p@ p@-@PP U p@D0B0 U(C<0 p@<  O-PMp 0GW"S00` 0w@YP-TPh +T@`0? ǿ 0  0  P! @00D Pa0DSW0DA0DS"70DWu X: Q\ SP JP"000T9 W0 0 p 0 U00S 0 |S 0F0 Ѝ0S U 0@ 0`000S   Ѝ p圀圐 p XR A B0A PR `@P0?0 $UWp psW ꙙ 00M 00Ѝ63@-LMp`@$0 P 00bP LЍ`0 SLЍC-P!1 M0M`0p0<0rt @PU h1 0S dP(0 S PP( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nSiP0S  zx`@P\PZP( (kQPp@tnfsuniop@-`P@p@  P@P p7`3`p`@-@P @$F 0 ( @꨿ @-M @<p 0: S  ὘p  KЍ00Ѝ3O-0-,M$@`0@ VP;#;S%1pp{V00Sx00w e0$0P@P`0  U 0 * 0@Px `FP@` 0  {p P@PE0S7 PUS0  Y*0Pp R   U T 0G UATPP @Vi 0`0D00@ @$0,Ѝ0 ጃ000 6 $00S$0p0+P P  0! p Q p @ 00 0o01[ 000 p 0 0 S 0S[ ^P p 0S  [ 7L00 $܀ @PP p̻ p@-P  @T @T0 0pp@-@PP U  p@ 80:0 U;<0 L , /O-pP M0@`& X, @T fP W P5@1 P1 5* P 8/P  00[W@D:P PU Ѝ8080 X @0 ꌺ rl sO-PLMp@< [ TW> <000D $0HP [ <0Sy 0PD0W`p000G< 0 000p `;/Ppp Xd*  0 b @( `P RPp`,004PZ` ;/P  R ,0VB^P5P1@1*`Ip ;/P  R <0 @I 0 @W@ 0Y:W0@  Y:p I0;/0P  <0 0I 00 p' R` P0S <0pP00Z ` P@000CSv 00`  F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ PW  0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p,04P8` 0S"*$Q R0B0C0 00W0|@D 0pS+ 0Pi< 0 w`<0 S<  bLЍ <` UE 0N W00 Y ( 0  S``V 0`S`j @p@pPꊠ W@[` ;/ PP @ pT00 501 *p`p ;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 U0E0C"030 00c   S & @0PCUP00p 0;/0 P0UpJ6 p a%;/ P`pZ0 P00 JU0 U0E0C"030 00c   R 0Q$ @0JS J 0 0Q $0S 0 Q 0AA0 $0`S 0JQ 0 A <0SD < 0`0 P`( <0 0I 0p' 0W dPh `R^t0l  }xxL0\  [aXy@0\  Y<<@0l  a00 ' | &- M0 006 Ѝp@-@ PU 00S  RQ Qpy}0P{ P { 0pD0D 0 Rp@-@(g}P(b}p0tp@-PPM`% @T@T T0 Q 0QP ``?0`P 0 RЍp0i0 $b  p@-MP@\PUP`0S$005000 0  P& p" PQ! 0 00CR 000S 0S$0Ѝp 00`$0L0L 0 Rp@-@(|P(|pt00p@-@ `0S P(|P   (|P   @p(|@ꄓtp@-PPM@  0! @ 0 `Up@ @Ѝp0 S`0<0 h X!X1p@- @0(MT0$00: 0PS` RT= 0TS@ 0 0 $0 303(Ѝp 8 (0!@$R0@0T$0B0S 0S ( !0$ R0 P <0 0 $0 30(Ѝp@,ȑ \0P@- D  R4 I  )谐ԩ h 0P@- XS HH@ ,0( ( @@lvTvX 0P`p  S 0*< ,0 0 L1 30Uߍ 15mmp@-PP`M`@& T, `PЍp cP q_P l_P p0000 P@0G0 $T$HL0 $lTp P O-(p,@Pv_P ` V&S/Z V@0S u000S @Z 9/P V@PV sP< %k0SZ@P Vꈇ G-`R p@P8/PPV @!1 G-@Q0MP`000R U: U30p )P00 S0 0000 ^PP 0 SPP J0SP !1 0 0 307Ѝg.00P0p \Up0T  3POppP P(p 0 P@400 0 P@j\i/ B/0  Q B  / 0R % B   %3 %//Q0 / 0R ,` , `! B  // R  B-0  ` .$`$"  /0S :0Cp@-@0 P 00 0p/0S :p@-0C@0 P 00 0p/0S P@-@b" M0Cb! 0  00 0Ѝ/0S/p@-0C PM @`0 0b"!4Pb4#0 PЍp0 $000  / 00$0YXp@-PP@ T O`P 0S Sp@D`^Ppp@^800 $STH0 $J́ p@-PP@ T `Pp >p@`4Xh0T $/0W0T $(@ p@-PP@" T( Pp _P 0S SI^P p@C^p0p@/80w0t $Tx0t $` @ p@-@PP U  p@_80g0 $Uh0 $  0@-PP M@ T ^P Ѝ0_P 0S\00 `<00 $T 0 $$V$  p@-PP@! T'  0Q  p]P f_P ]P ]P p@]800 $pT0 $g@~ ~ G-PP@F T  R! R `V" V  0 `PqPp$, 0F R R/ 00 0 `V00 0`V 0.&0 F0R"  0 I0,$h 0K/ `  00 00 0000 0 `} %| |  @-/ 0SAS/0-$(0@# A  A A A0/p@-PQ@`1 V' T ^ 0S^  S 0RR00p@@Tp4;@0 0:0 | { C-@!P1 0MpP`030L TB A< WP8 #Y` z0S `!X1 0 3 30Mߍ(#@+ R> R/ ! T K p0S Ep% 0 0 D0 100 *  T $  RP R0꾦]]D{ z z z O-IM4M`p$@PPJ d4 0I ,000 pW W0  $4 I0, 0 30Iݍ4Ѝ0 SJ=00SX30"l @ J- 岰p~ # 4+4J8 #8T  Ṉ gJ- 0S 0UV  SV S RNJ= 0012 00d$00':00H0 40 RP @,VU  W3 0Sa0S  0S0s S0S RJ= 0 J= 00ZWJ O<  sVP^  0SI cge1a! 4a4#Q #< p0<0J8 0J= 00$ 0 X\0Pl J- 0SJ=  01pS SuJ͍ 0 %! 00S`LP P P J= 00W0  VPJ͍ YP ꔥ[0[Hy y xx O-`H$@D4 0MQP@pDH0000$0C S0#3 0 0 30Ѝ#3 0 0 30H0 D@pЍOWXf t4"4 8 #8 ᔇpPT0S RM 4"4$!$("( #8 #8 DzPT8VT00QWX00 R0SY 0Sf S4ZP00SP"0 T NT@@O 00QWX00VT<x!  0T  2 X: 8pZp  0PȐpZ@D 0   T00? ,!0 piT 1i #Z3䐟P p0PȐp  T00?pW@D 0 DֆP^T[pAL  ȆxwVu V`V|t t Ts r r $r q 0@S0h 0&h00a 00  0zP 0 0 1 30!Iߍ Z a0VX 0S P 0 0`RPQA-@ 0P`p0 { 0P p@-MP`TP@@P@T 0S  R0S  P@PЍpPPЍpp@-@P PuX%Xp0@0 n 0S/ AA. 0C.S .R Q P-S Q P_S /@-0S0@SO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJS 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0Sp@-0d M."P0'  @ 0R0 0S  R la  haR 0Sd .P 00 Ѝp 0S S0S,  R R R  R/@-/ 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP 0PE@0S0S 0S  Ѝ00n0 i @-pQM @Q`P Q Ѝ0SSp P*(4"<8#8V R# R!  `0S Ѝ Ѝ00S SD<0 9P 0  @Ohh 0h p@-@PP` U V 0pPp``D0P #UDD`0P V((l0P g g tg O-M J 1 #E 01p $0p8 `<  P0 0 000000 8  P 0\ 00,1040300؍<Ѝ0  R 4"48, #80,000(0PU,(Q Z Z Z[ ``x0 ^c[00[00[00Gf @Ed  @-`0!p,1 AM0M@PP0 402 U P P0 1 P-@  0 0 4 30$AލЍ0SP @0.Sh P 0 @ HHx0 [00ꬠDc 0DTc 0c @-`TT!0 $MS@  : S, V& p,0< S9*@ \ 0S PU S  S0S \Rp`Vl d0 0 0 30$Ѝ ]4 01 KLC\BG-@P`p W"  kiPP   @  @!y<<D0 lW 0 c` ` O-M4M@<($088Q 0$h0,00&<00,`0 $0S 0S P0 <0&<00!S2 &<00S &<00S @'t7 0, 0 306ݍ4ЍS@70 000 S _>`C @80:0 0ᶀYpP0  03/P 0@&<00&, SS 0040R0SY pWp@`$`4(48X#8C 0,P: P00(Tq*0C 0Y`Pg0  03/P_ @NZKZ`HZV `M40S?&<00S !Z?8Zz` 4Z1Z@\50 0}Y0P4   @? P, Pg0P( $D00D0Q d $RzY $Ru 0 00 Z &<00 Si 0J'ZS@00S00(`Z,PH Yw H4H 0 P 8pph@  `iY5 {0 0{%%{ E{000000IP ("P!0P R R 0   `R *iYVw 80LE0S3 Y00Y0020 0&<00S1@~@PX 8(5$%0 5s (0S #0S hlY00@ $0R Z? ZZdZ @~@PX[(0S <0C80D\G Z<0 C,0P@ 0P,0(00(030@@T@%Y@@dp@01z00 kX@P"0  03/P )Y 00 S ~@@p p80@RC@G.@e?&<0D D00/$0%j@@0@Cd0.X W W W |W $$0,0$0SDDC?,&0SddD0,80`RC`G.@@0%/pjX@p0p# GD0XD0Pl0 0 R  Q QY Q 0ꘝO-PSM$04 0@0D10e`P epP $0  08X0`00pS0  PO 000 RPK @@PX 0  APgg@|#t3 0 D1 30SߍY 00X00 Q0 0 .Q0Q RS% d! St*+ 0 !Pg}g @S Rd! Sf*.[ 0  P @00@$0 `` pY:9 i2 I520Y0 0 S   S  R  R Q\z  ^ \Q/o" S R0S 0 PQ 4-0 0S Q0S %w0P 0 #P7  B  0 (J(P?Y 0( P p0`8P<p`P,@4Y 0S@TC 0SV 0S S 00S P(0 0b< R=P R: R70S0S `;0S PUh;35 \ ^ 4; 00U Q  P \ ^  R R  p Y P` 0S   0?S C" 0c6#PY A ^h #\S㔐Q^'@ pTp0S 0` p$p@ T :4 d2 D52H 0SE0 S > S PR  PL @0P0 0`P`&)0 0e?0Y?P/ @s^( 0@S0`P@T $PP@P (0$00PpU 0@Yᠰ @H`}대pPUp`K|0`B l` 0 0( TP`ph !@wP uP20KD  Dp,0wP`K(,>H|,<0[ Sh S \` R` 003 Q  R0R`U`P u+*p$D C C |B l(t? f<> x<= Ii $@0P0 0 a[0"0S0$0`H@P P0U 0P`P0U `0$p(,P` K b_.n> f5 vP1x00x0 `uP@`H`0V00L0``P``O-PTMc Zj  5Q1@0P=>p=^0  `Pp 'PF 0p R R R0 T@0P p R 00 00  BP0 0 V  Y [ 00  [ YV,@TЍTDD?/Z((D0/8 9 7 k l7 l G-XMp@~P `P@ 00   0~P 40S0. XЍ TP _  0~P _8<8 2P 4PPFP 0 6 l6 O-"M2M 0`Q<000 Z 0Sq ppr@ p <  =~A. *J9PPh 0#S( ;P$ 0=30P  @ PRP R R UP P ?uP4 @ R0 @P1uP $K$ (0K$ K:P0(X PPU 00   P  0@PAxP0 x0 0< 0 30ݍЍTTD0/i<<x0/_ꭔ,h5 d5 3 @3  3  A-(M@0 p`pPx .P @PP $00S(Ѝ2 @-@ ]P 0  @0O-p"|2 0M020) `@1Np! P PX PPQ P Q,p!1 0 2 30`ߍ&0@SPX 0@SZ00 0P] X00 0 T P ZY0 Y  0 0P Y:[ 0 0 X  R  XR P 0 zɓlA-pP`P@ 0 I 0P 00 $,5 0A-.L RO-LMP `0 D@00p840 <0T 8 0  0%00#0(<  .  " xb*. ,\Hǂ@# @!p8Ha@@ 0"00#p0H<@@ ,  " p Gb*@ @!@@$$ @ǟG #!(p ǟa 0"00#,p 0ǟ<  $ 0p " b*!){G OpGp,XG4pǂ@@# !84Ga@@ 0"00#V 0:  + C0hS@H"p ` *:0V@@p`F  G4\0P  00P ) ) !1 p@-PP0M@0 00( T/ `  !? 7R8 bx b   x0 0 0 30X Ѝp@Lh0t T,00t l4) ( ( C-8802 M,"0 P00  `p 0R @  0XS @@0 T .. 0N l!\1 0 0 30 ЍT  0A a 00C 80BS.R ^V* 00RP 0FS0 S S^*0X 0n(."4n4#0000@^0 8< 4^*0 8<T@x- McP ЍH!H1p@- @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0DqT% % A-P!1 0rM`Pp010: U@ @X0^00pAtA\W0OW0 1TA Ό 00 LZWP2  0 ixpP# 0@XP 0 0 1 30rߍx0<0 jU\=@0 aP tY00Z 0P0hB$ # $$0 M000 Ѝ -- M0 0 ЍЍ/-4 -M, 0 0 pЍ Ѝ/\p@- MP| |@|0`  @  P` @X@ PU  Ѝp# (LL1 @- 0M`!000np P@   op m@ 0 0 0 30'ЍmPpW @@T PU 0SP@]TX00@Zi 0p@-P0@ 0 p0X(0PX(P,PXt` 0`0PP 0&P 00 0pqP 00 0pp 0@-@ 0 0 0 0 0 t 0 0 00@-P M @0eX 00P 0 .A?o2 c0 Ѝ02 00 0p@-@P 0U0 0pp@-@P;X0PP7X(0P4X(P,PpO-p0Pm `,Pe 0@00 S S0 S S |0PS 00^P U(4"<8#807 ,,P@P! 0P,00S S S@ 0AS AQ@P$ 0 PS0Q0000VP  VPP@~@PP  X 8 O-P Mp@,0(Sx:  (T] 0 T0T 00SP 0 RJ@D@T0`E   RA 0@D@D0`0S* T0T 0 1  @D@T`G 00S#0A S00H ׋A0S000 7 Ƌ00S$ ,p@=W0pp9W(0p6W(p,p@ ЍOVP  (,@(  Ѝ0 00@- M@P   p P  Ѝ0 0$  0$0 P Ѝ08p 0$0$ 2 Ѝ0O-PTMe Ep@,P<@0 ppUXPb,T`P^ 0 ppHXPS,PPU0@ \ \G \Q \A pp 0U00S QTP, p0 0; 0@ ` R  R2 R[ R 0 @U ` 0 yV 0JX0L 0 TЍ @\L@ 0U  0⼰  80 ` ` SPE0h ?4 E0 :0; 0Y= S81P3 P#S41PE2s2PEsSPE0i !0 E0 809 PEPE0i U0 8PPEPE0h U4 :P 080 4:04 @-pMhp) @|jp, `0v0 0 0 @XPhu l00 @P Ѝh200@Ѝ1jh / p@-\ ,@\ \ Q :\ :Ap00p00A-@$MPJ P 0( T 42~|:pB8N87 @8nj;p$`137<Ǡ  B- @0NQ  Q  000<8 A90><à 0 (0 AЍ00 01 0 0 0@-S@ 3/@SO-M@Y Qs 0`  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \᧗" 00\ |3 L0 1 00p0` 0`Ff& G B$"II࢖)0F 0C)6# B B("IA!0C0C1# B B%"AA!0 Ѝ ZTr ` /  P* 0 p$ 0 J 0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧗# 0Z " Z Z 0 00  0 0 p 0`\\ 1L0 10`ZZ- Z) Z+ 0 p 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7 p @-@P  @ J0/0  1p@- 0@P0 00D@1011.T 0@\0 S@ P p0  00C1000L   00LDL ʚ;< C- Mp|P'yulaa`IQaQNH(0\   M@ N Ѝ Q2Ÿ0@-` 0P 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> 0pC0@@.SM 0@00@000@ 0pp@qE0Cp2Spl 2S 000 @ @  @000n l `Ad Dn l lAp00@  0pGqqAp00  0pGq@p0000pG00 @ @@j  O-IMM(`'ĝ<0 $ `!P@@l7R@@T0\0P7 O0P80 (p0 0 x@'7 x P &0 8 @ < P0L060T060D00U0400,0(0 P40Z00S <0`1  L0PU 0P 0U VP0 jV2x0S4,0?pc5@P00P 0U9 W,0?pS50=< 0[9 W00 iV,0? )R DP8p000( pP,0P8 + t0 p_T0P pW t0 p Mpt p0 D0SPP M_PU  0R,4008 0Uh`1S   ;`1SU0P aU0 0 [P[0 0 OPGP P CP30 0 7P0 0 +P 0 0 P0 0 P0 0 P`1S|Y~ 8 < Pp0pW  0R  0gpW 0pW  0R o 0ogpWj 0pWe  0Rh ,0o[gpWIpWF 0 PS 00 oHg`1S   80 ` 0 `@0 `0 `, 000 0O tЍ   YP H2_P0 t0  2p 0 t0 1p 0 t0 1p 0 t0 q1p0t0 RPhO ftЍ tЍ80 k&0 j0 i0 0 g 0f0 e0 D pT  @ | 0 DL  ` (  h  @-`0AM 0M@p 0 40 0 ==PP0S D 80 0 4 30AލЍ.A$0,@- M@ pp P=`PP 0SD 4 Ѝ00S.S 0S Ѝ p@-Px AM p00 ` $ 0 @P 28 ,0 0 4 30Aލp螂p0p@-S@` P0 @S bPV 00pV00p@-@ M`p?PU 0PU  0\W 00 Ѝ80_0Pt0 `jW00 Ѝ p@-@MP`0S 0 @S 0S@V00Ѝp80O@0t0 PAV00ЍpD p@-M@P0@008@@T  0UЍp\``t0 PUrO"*00 P@Ѝp Ծ Qp@-`M |00<@P 0PU  0VЍp<0_P0t0 `Ѝp @@ @- M@P0@0=<@@T  0U Ѝdppt0 PUN"*8```0 P@ Ѝ pL 80@-P Mc U{  U U= 2 E0R8  U@ &@Um U.A@O4U]  U:  Uc  U A@O&U+ UH UpA@'NU\A@O U HA@OU4A@)N (13N0@?( P\ Ѝ0@@O@@&N@@O@@O@@}O@@O@@yO@@O@@wO@@O@@ Mt@@Oh@@O\@@ M t <  t d T D 4 $   @-@( P ( /04c 0@- Mx@Pp0@0B>MO@T  0U Ѝ040O@0t0 P Ѝ0  Mp@-@ML 0 Q0PP@0<00 0 `0+>. T @D J000X L0 0 <0 30 @Ѝp@Ѝ/ `.0 T0ꆀ 0O-@Mp@@ x ` P0 Q ЍSq SR@@ -R 0 0+R0  0h300 00 B10 11 .R 000 @T@0✑)SQ 000R#3@0SQ #3 00R0#03!3 T$ (<0(80(40%<0%4 0)< 0%()4 0)(0 P 0R0P 0T00@0SP 000R#3@0SP #3 00R0#03!3 T  0T00@0 S\ 000Q#3@0S\ #3 00Q0#03 3 T V  00 Q @0N0000D00 0 0 >O-Q dM0 R 8 $ Č(Ȍ , 0̌ 00  8  /`Pc$Ѝ C-`@P@P MpO 0 8/0`Hk= 0PE$P=00∀HPP]d P0 0 ` p , 0%p =000SJ=000S, -0 <= 0 BR" H = 08 @ 0 p  R 0S .S 0S 0S00S.S\P=<<0P=<00Stl``lLd @? P`8@d0  p 0D 0 Sb0H0 <040.8,0000@0,00 0PI 0CS `$0 l;X@ @D0  p^ $0S`80 ZtpQ 0 0`pI 402+0#8 00( 0 0.0 .00R0  A0 Kp( 0 Y0D:0<H+@B0?R0Sh h?/" @h 0ZDY: TQ0  TP@*9 0 0 30 ݍ Ѝ= 00H080@00 0 p@ 000 p,di``2X H = 08 @ 0 p00008 040 BvP0H< @I0? R0S?/=<00S Q3@0d D;|8 0R?cP`0  p 8 040 BP`?P}H8040pP`@C 0P`-Pk0 pb 0 P`PXG0@R_d 0 0!p0  hpE 000d D; 00  Wp4 20d  0  Hp% `VD W zO P0d 0 00  3p 0SD[ =0003SR Pf0` !p DPUD vp0X@H1!0ES 00=<00S| 2P@20`@DKn `ed `f?P 0  p P*=<00C4UPP=<00S h2 e`d 0Y00Y00 D^?v0  p =<00pC 4  @PL TT` pP 0U0 0 Gp} 00e0T0PE9 0 pn`P 0 Pe C0 @D 0{pX =-00< 0 SZ 0  PH=<00P C+@0X 10"38# 01;@0==1;@020!201;@000301;@0<=1;@010 1;@=0;@0  /p 0D 0 SQl20k@`TPd0n U`j  R @ T( 0d  0  p X 0+@0X 10"3! 01;@0==1;@020!201;@000 1;@@ C=0;@+A0X 10"3 ! 01;A0==1;A020 1;A0;+A0X 1 001 ;A>A C0;tx,D T  Ẹ  % 8 l < * ` ==$ ==== \ L  x < t T  x h | ,  X VUUU=000+S =<00S@0@R_d 0 0p`0  Jp'  0 d 0  <p 0PU0D[_* `pzOUD[U 0d 0 0 0  p=<00S5 Q=P<0PJ@ <0 p-=<00S"0 S00=<00S P2d 0RO00 0 `P0  p 0p00d D; 0 0  p  0 d v 0  p 3 0DR P`C0L#@1p0d3Z0DKKt0 opw=<00S S=P<0P8 040 B!P_S0P ypV jDK0`Dk 0d   0  dpA /`Dk 0d  0  Rp/ /` /p /U?d  0  <p Hd8 @P040 B@PP  DU0P%p `DK/ 0@/H/v 6 = 00P@ ( 50`00 06/+8 040 BP0DK 0T*4vPpkYV ` 0$PpVG  R P@0 T% E0d  z 0  p PU0-< 6!?C0 S. 0 op=<00S 6/`WP@0/@@S?2 D C `p0 pg 0  @`P^ P0 D v ppR 0  PJ 0 Dcp@ 0  0P9 |0D;0 Pp- 8 040 B@`Pn"8040`p@C 0  `pP Y0P -p 0  `pP0 p 0DK 0CYU PL8 040 BP0Dk 0PCU*؉Qk@p@T 1 W2 e0d  0  p=<00S#0 H[= @ 0 0#qT` *( :0 p: 0 7/=@D @ 0:P` 0>H[ d b 0  p 0YD3*<{<p]`0p@ DPY V0 [pg `0d  @3 0  |pY `F@P 0Y 0 ZipE=<00S= -DL0@d D; R? `p0  Mp* 8040PC 0  `pP0 8p 0  `pP HW0  XPM0]=P<0PV=@  <<01 =<00Sv |=0 00$ ]? d 0  p `VapD3 1QXP `@ , @@@@͍ Hp 0" }WP *(X> 0@@$0l4/,0pG= 0p0VHD 0 S&@P0 p @P$00>d 0w? Z 0  p 3-@0-@> `P0 pb -< ?B !?C0 SH0 ospO=<00S ,P,@,PP0@@2 D;?0U? `p0 Np+ 8 040 B`pP!Hl=<00SK 0 Cp_ PPn=<00S?8 040 BP0D 0 SG/ C 100 S0 op60 Hk= P 0 0"U@ *( >0 px> 0 7/0-`PE HkDP<0 p0 Hk= P 0 0!rU@ *( =0 p= 0 7/0-`PE HkDP]=P<0P-0 h= R=<00SH]=P<0P0] 0P CP] 0P CPP$p 0 PU0D[:=<0p<  @PTET l``pP 0U0 0 GgpD 00e0T0PE 0 Yp5d ? ` 0  Ip& U `PzUDK 0d 0 00  2pp  Z`PPaVVM @pP 0U0 0 Gp 00e0V0PEj 0 p0 HK= P 0 0!U*:0(d* \P  5/0 p0 HK= P 0 0 wU*:0 0 pY 0P CPZ+0pD 0 `p A?d ` [ 0 ` p  0  `pw B 0 pp ,+0 PpDpc =H{ ` 0PPYV *( t8t0 8 0 8/p=H{ `Fp `` 00 `p: H0 ETp1 * 0 D PHp% =H{ ` 0PPV *( |7|000 0:/p=H{ `Fp `` 00 `Cp X0 p *0 D P p =H{ ` 0PPV *( 6000 0:/p=H{ 0p`F` 0 pp hV0P Kp s*@0 DK`p = 0H{` g@PV *( 5000 08/=p`FU `H{`pP 0 0Np 0 `pz 0 O pfr8e0`  pi  PDK 0 PX0 |pY T0@P ]DK@`0 lpI 8 040 B@`P?0DK 0S`)p @DKj_0d   0 Ep" )@DK{0d  P  0  1p )0d D; R?0  p 8 040 BPPD  0pC 43 <P@P(0 c``pP 0U0 0 Gp 00e0T0PE 0 p y)0d Dx2 0R?0  pvT@0 Np 20b?d  p0  p0 p `@ 0@Y0D:Vڔ0 Npw0 pp @lp  @PNTvT a``pP 0U0 0 GwpT 00e0T0PE[ 0 gpCP`TڐX Կ D Ⱦ ̽  h P ̼ H ̺ < ,  \ h t < Դ ` * h ,  |  p T < , Ȯ `0` +p ` 0PC]0 p `TBڄtmT<ژn`0` p ``=`<0P`>+J X0X! ##0 0 !+J X--!+J XX" !" !+J XX  # !+J X,-!+J XX! " !+J X 01;J 0p PUD @- R MA P  ,@@0(@;@ Ĝ0 Ѝ輭 M-(040 1 2Ѝ/x A-PS`/p@@W0 V:0 $4"48#80@PU V'P\@(00T0T0@DT0S$0l0 (GP@ G-0PU!::0` @4$#4T00 0p4$#40  @T#0 T4Ġ#400S X T0 $( ,0 P @(00QA-Mp$0PS@` 0(010$,0v(`V|0Sx(0S! 0, $P(0, V3100&Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$0Q0 ( ,0Ѝ0F "P5, (` , Q/:04800XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQ 00000  0C Q700C20@?D0 $0>0 `h ̢ A-p`@HWP. T @00V 0Px0PV0 G.`U` P7000 200p0 S700W0 U00gD0T ꠡ /qo/p///r@-DM` @ 0p0 < 2 /0 RP300000C0< 00 0 <0 30DЍiep eO- M`r 0X婒'`r@B( 0 rgqC0ሀB"RP C@$A i!dP @3@CG*TNXWmY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 H|p# W0Y[0S    00000000S 0 WYp@@ 0 DN p XW  0 MAp Y He0$ 4 Ѝ @ꉈ%I$: LdP A-`pPU0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0. 0 @@r( 0 0p@- M0P @0 80p k`d p 2Ho4 (0 0 8 30ލpg00p UPpp@-@PTp (0":k0cSp: A pO-0 -tMP@0 L18up@º(50S @P/00% 0<0-X000X 00H S0 100H < 0H P-\\Ё0HL4010X @X `V @ ER>    0S PtЍ P EXH  tpPpe spPPT  XqL `VH0Sf46S{ ]۟M ^MK۱^4 X+S 4jXQ {ǻ {:S03:VgK{K{+Sk0AH+C{{ {*300SQ {H0$&0{0G;{ǻZ@DrBr@r >r @0@ @{ǻJ{ǻ3 $SQ 0$@ TPR 5 p@qD 0H5&L @  @R[PQk{{+ Up{ L( k`Q Q4QK`7HpLL{@{0S0H000S0S0SJ Xxk@ppp p pU  1j{ *0S  0Q$@l\ 0kP`0\ 46$ sL@V$ (0~ S \H0 H{{7{P*XH0/SL 46S00jS^ *k&0B:H{{{ qP) ;rPU L L00jS5?55??P9H00vL 46Sq000kSm0S0Sg qP\ rPL]ڀ0U0: kS87S@ppp p pVS<H0S \: A H{@{7@{{8HpHm/UH D10jS#knP \ [6C#::L00H0p1Q 006L00H0 \H0  @  0 00M 0ЍK`EHA-@PU `0Sp @ zP 0S U@Dp@-P@PPLP0 S :pSSp 0R:pp,0e0$ @fh0$ @됁 x A-P`"@T*P- P0 pPW 0P P B $$P W 0 P TC0 @ⴸ<D0 @⭸$E0 @⦸脀 h L 00 ?@-@PDQO-^ 4A`@Pp  0S 00CS 0\V0 S  RYWppXpQpW\`\\U0 SP\p Q@-P-r-0w00-0x000S 00N000S wS -S rS  0S /xS /  @-P@20 0! 0 P P//0S/ S S/0S/0S/@-@ᶳ0@0T S R RT/ ?/PP/ ?PQ/?SQ 0p0 0@-驷/\}  ??SS 0p0 0@-陷/} ?S S S`/Q/AQ/Q Q/?0 @0p0 0@-wQ/?S0?/0?/| QP00 / /@-鐹 0  A-N'P 0`0H@p P^x0SrP)nPp@-@P M` P0ES  a Ѝ X p]Q0S   0Z0 @T{ p@-@PpP Q 0S PH)0PSB)p@?)A-@Pp X P@PE@X `FP`008 `tz O- M` V" p@IV P# @P0SV F!`F0 `1 Ѝ Ѝ (` -\ x  010C. *  $    y RA-P(M`p |@ 0 @0@0 P0 0P9` P@ 0 (Ѝy x  X00 5CS  A/0cS#:'3R31 3:0CS!2# 0p@-PP@ T Pp S 0\\0 0p80L0 @TMP0 7w w O-PM`p 0FV"S00 0] P@P-UO +UP0+ 㴲pG"<,@P00E Qa0ESW0EA0ES70EVt \SQ @0U1 V* 4q ` 0T00S0 Sl 0J0 ЍS T 0P 0Ʒ000 S  Ѝr `00XS 0A0C0A PSVr `Pr `0?0 ◵hꙙpu 00M 00ЍW5TO-PMp 0GW"S`@ DP-TPs +T [ ?0 00 00DP p P:Q PS \1 !ʎ\ @00D ^ a0D0SW0DA0D0S)70DS&| [YQ PS \ !ʎ "00"00 0S \0F0 Ѝ[@`J ?0 0s 0l0b 000D000S  Ѝ[@`g0TI W>0 p 000Dm0T00XS<@ 00DA B QR ap `> S0T1 W  0ptt p 0`@> p PPD1?0 ┴0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP ph0p 0> 0W 0@ p p0@ p 4333333q 00M 00Ѝ0 r  Q0?0S @-[-- Mo ЍЍ/G-P`pP WV 00`F! R !V6  P 0PE (`V PUU@@nPP X1 00  @@PE  P00 ص000@00کH0B0 dzW,C40 ⾳ũn n A-P`ᓵH@H0@@@p >U  YS A\.(n p@-@Pᗩ00CS0 S  P 0` P㎩p ?`@-@P u 0`00@t060 cm - M? Ѝ 0 0@-PP0 M@000 T!   J 0 0 0  ?p h0 0 0 30 Ѝ0H0H0 *T00D0 !Z,|,l Ml NA-pP@`( T/ V6 0S 0S0P00 00S0 00000 R` F`Q000`6P0\ T@@p0\ ڲV$$|0\ Ѳk k ak bO-p#@3 0OMx0410PP`1 dh`0 V Vw Z.` P 30 00 [ .Q Q\.Q b :0 忤 0PY [ 00:[.[#4O[0Q.SI Yg0IS00`0 0IZ 00 0W 7 0 P00 ` `0 0C SB: K0   ` 0 #+009/00H!81 0 41 30EOߍ:[ 000$0( @,ѭ0 0 00 ` P MP00 ZW00000 B<4 JPPH U.R|  :!P pY**d("h H' Q Q 0` @V 0`VI:`F0V:\`FX @pꅲ pZ`FG R #0 0 o00@ߍ Q Q0 S S    pP ` Q PG |PC T :  z"@DP  0RP@- #[z0dpp ܬX  '[`F Kq `F  W d Z V P, 䠊0`P `p R R R RS T * ᥞP p RP=("@D PPT @`V0 P& !T<: `P  P T014 @1:o0 ⮰0 0"; 0 @ 0 @0`P`"' 0@ 0@ 0 PP P 0` @Pg e Hd c ^@-@d!d1 0LMpP0D00G DP0`S- @.0 rP( V( QPP0 0 0  ,AP  [" 0  0 0 D0 30LЍ@PlPPP L@ ="T88C?F/ W\!2a 1 ` ` C-`PM@8 pPU* Y @@NO00嬫  0@P " 0  Ѝx@@JO @!T Ѝ@P P$$C?R/ ʯ0<` _ x_ O-UMM( t*0p: 0hz0L50`P|5pxU別0 (0S 0 S00W :0$0(g0P,0 0 @[ S#p`P ,!0)09 0 L5 30VUލЍ50 0 eP0 $03/P @[:0CoᨂS  Ri  P0 `PPP0,4'4Wp8#8X uD PT4R pPHL@8< `\ T]*`P0C 0 `PR0 $03/PJ @ Y%  @ T`0@ 0S4<0S 0 S  R06P0 0S!0S H0S0P太P0X`*\0L 0R *P  H0`0H0LPZ84H0S , 0d0L P0QH RXK p XPHp `BZO[ P0 0 00PT ! R  ȠLȠQo \ V SppQPW  WX0 B@GAq 0SPSPڰP!^P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @bt L0X C0 0CS`:T040$0S?0@0 (@Pe0 t V?@X00`VX@ `0@<``(PM S  C'SRG 0P 0`P 0a`%"3V?Z/ (0SX]?Z/ P(0P04D0,0_?R00 @P0 9 VT D0,1Q;*,`P䍩P P`P冩0 CR00Q 84,`@IPPpp0`P CR00@T@šP`@9$03/P `1,0D(`C 0T00Pv  , D00D0D뒯0 (i5PH0 h@P0 E VH0S0P T D0,1Q=*,0P,0X@LP  0%!}   NT81p6`V `p{ 0  0`!L1 0 <0 30GDЍ(PE P Pp 6P?p P0 0 0 0y 0Ip `pP 000WU  0I 0000+00pQp`H L K K ` p@-M`@P 808 0 0 ɠjЍp@-M@ ((  9Ѝh@-M@`~ pPP0@0 ) <0< 0  0 p @Ѝ0@- MPP@T x 0 P00 000Q T 9 @ Ѝ0@T? 00C-@PaM`P^ Ud !0 `   p0S  H  0C ^0 .SNW 0@ Ѝ0 XR   9S 1 @ pG W 0  RU 8 <04 c#!$c4" 0G\0m0 9U@n<0 0 @S G G O-P#3 0,M@Q`0$00 UN Ph PV`0:V000 0k Vm ß0 0 HP @`0  ,P \ PUW @ZpWP  p$`WH(4"<00S W0G> S0 s fP ̩(rJp<0p ᾨV VS / 0 !1 0 $0 30j,Ѝ!1 0 $0 30_,ЍO`:V@ \p ȚP :Z<U2 0S 0$ S$!, `PqIp0p rU V V0| gTT0| _<0| XE0S@dp$`r `.V0p$`WPdOWpF E d8D HD @-`!1 0,M@PP0$00' U- 0p0H 00000002P* # 0 0 $0 30,Ѝ 0 L0h0 U0i<0 O\C TC 4C O-ptM8%045 Q 0@0l00 W P P* ԩ/ 0 $4 0 l0 30.tЍTIP`<0T ἧTu T 0S0` 㰧p<0` ⩧ 0 4$ ( , 0 4 8  001@ R@0`S U P Q 0S0@S Pu0Su00 Y0S @\T<000j0:0@0T0` 0> Zg 0Sg* 0CR00`:Wt"2 0 l0 30 tЍO@PPUF*0: T00S DP"H 0l  1[P3@T` 0Z00S RZ  @T`0zu YPr S 0 S P0@n Pa0SA: 0 Y Y Y@$!0Q 0 H P x8 @R0PHP`0T ὦW Tt T0` 㲦uC@ O-@P⼥M p`  500SJ }([N W W W s00xЍ0P R $ >0[& + P$p 0;/qp 00P @ P [00 0 00BЍ謠p  Q. P0 Q+ L WZ p  0<.P 00 0 SM  00 0;/qp 00PPßQ <PU;ᡙ0 {0p ;/qp0P r 00 0PUßR <0PUß`X0p\ Rh0僚0cX0P[NS  00Q[ <P800CPU0& Z  "  RNLP0Pe? P ;/qp? 00  P @ P 00 0Z 00 `P(0 S%: PE u ?J 0C0}9PPT 0S  0CPß,1G0 ]APU0 Z 0CJ P%JPP @0P Y0000 00CP0 006*00/480 0 <P9 8 P8 O-P,MPP`p@ T 000S000Z00$0 0`PPW0 00 @P $ 0R00SQR+XP `   0P 0֥0  UPP`њ [XhV,Ѝ CR_o$ R  B0 S $ PRPPU8 0BQ: `PP$ RPPURP%X00S PD00P \[ TP|[  0P \ `PdP^[ ATq [H S ` P$0c z ጖P 0S   00S S0S S ^ S@@T000S00ߟi0\#00% ^@ [ @@ S@ S80h0 00D4 p@-@PP` U 00F G p 00pt060 UX7<0  0@0p٥0TSե00,4 4 - M0 3/Ѝ/0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04P0 ◣00 ␣03 3 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04h0\ `00\ YT2 42 p@-@PP U 0S S S 00p@/p00p@/p40t 200t +1 |1 p@-@PP U 0S S S 00p@/p00p@/p40 00 0 0 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 ͢00 Ƣ0 / 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 ┢00 ⍢$/ &/ %0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ0440 [00 T@. F . E0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044>,"0Y0,\- e<- 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044K?G/0a0G/|, \, 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ04iS?O/ⲡ00O/⫡+ |+ 0@-PP M@ T 00P00 Ѝ08080.⏡T q[?.↡ + * 0@-PP M@ T 00P00 Ѝ08080^/jT [?^/ax* X* 0@-@P MP, U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ044>a/+00a/$) `) 0@-@P MP( U 0S S S Ѝ00 0 3/ Ѝ0003/P 00 Ѝ044j?g/00g/( |( A-PP`@7 T- V: 0ppgS S&0 03/P" W 0  0A/0 03/P W 0t 0A/Co<0<0m/⤠(#[?m/✠' h3`' *D' A-PPMp@`2 W8 T& P R P P P @ЍPX 00@R X ЍA|&w?q/]00q/VW>q/M + P` Y0SP@R$q{H& (& ^& _% p@-@PP U  ;p@8080,U ?,8% % A-PPp`@, X2 V9 T P  R 0 R 0\A/W 0A/|| =/ٟd0d0/ҟXLL?/ɟV0?/8$ $ # # A-0M@PP` 0J U@ 0pS S P R`V V V ЍW D 0SP00Ѝ W` 0SPVll>%.fT0/0%._ = Pp%{l" L" " p@-@PP U D p@<0<0/;U$ >/2(#! ?! 0@-@P MP1 U7 0S S S Ѝ00 03/P 003/P 0  Ѝ00 0  3/P 003/ Ѝ08080/U ?/ Wp 0@-@P MP1 U7 0S S S Ѝ00 03/P 003/P 0  Ѝ00 0  3/P 003/ Ѝ08080/⦞U ?/❞h {H p@-@PP U p@aD00/≞U((?/„p@N  p@-@PP U p@D0D0/iU,,?/`p@xt T p@-@PP U p@ D00/HU((?/?p@   p@-@PP U p@JD0D0/(U,,?/p@7p P @-M@P0.S00Ѝ3@-M@dp  B0?R0S Ѝ 00 00CЍx 0SB .-R10 N R8S) .S .Q* A BR00C S(^ .^0P S.S A B R0N \-^ 00SS 0.0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 /< H0 0 / L0 4# /0 480cpg '!"L 0`00U<00    QL  O-@px$MWP \d`` XY @ppW P\W+ .W E BI XG Q R.Q@ p W 0B0C6 X4S0 XPń- PEU*0S0P(pW [W$ P @Qq  P @Qp P @pW(00$Ѝ] PX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00   0 ]R' @R " XWSQ   Y I b" R A  QC .Q pW@Ld@`@]00Q    Y t " ^  @WX  P0R P?XW(@[p57:dXP …1^R XńY PEUV0SPU WX<  , 0G-`HAQ@I*p0PS$ R@ @R0 0- 0V7 0  Ԡ 000 P00 pS p00@NT00U0Spp$0]/PÚAS 0Sɑ!0 00V@(00 P O-`VP3P# M0 VP3U0p\ @U @RF R R2 (00 ЍW@ Ġ[? A @ GRPR@\ 40S4  0@0[A[V[ a?.PZ  Y*@T*0PP0 A\ Rɑ!" 40S4 00x - M ЍO-pS$MP Y p 0 pS 0S0^@x @^a \sS0  H Y B @`p p@TX @0S @S^ pZN TP @`T00 S 0 Sn*p 0A>Sc B P_^p0Q ^ QC ś(00H0S 0Q* 0F S0S 0 `  0AS"`!0}@T`0\0Yp 00噛(00@$ЍATw0S@A@"@pZ ᇚ@0Ġ?  0^0A>Sp0pSl000^ 0AA^ AN[ ^& SQ0SP5 Zp? 0.$ @C /Q Rv?}/P2,00@G0?Q0Sllv?}/P Vw*p.Y P LP ((m?.PB Jt j( p@-P0 0M0 10 `00Dp !@p < 40 0 1 30ލp@@ ( A- `0 0M P0 10@0 (qp 0 p0 (0 0 1 30ލa@ x Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q 0 ARL ?R@- RQ0A  RL ?RV00CO(00/C/G-`@pTY( V W T)P@TY 0P?S  !00(00 QSp@-`P@ P`VP@  0R p/pA-APUQ?UU@A`pp W ڀ1APٙ(00ԙ00Й?00Q A@-?SSRB 0@S A赙00谙(00/-- Me ЍЍ/@-M@ p TЍR/0-S0 \ R ^000O-P MPp 0EU"S} `@.P-TR +T| Y U?pM^00D`" [*SP# K@00D P a0D0SW0DA0D0S70DS| Y[SP;+0S \0J0 ЍY@0Td UFap P 0A0C0 A RSkUPP]`>pa00D000 S   ЍY @0T+ U#8a Pp00D0T00XS"@ 00DAA PQ0Pp>ck p>cP0?0 ⱖCPp>c00D[00XS UPpb 0O00XS UpbPPp>c 0@U0@PP1@ p>cP433  00M 00Ѝ꘹ A-` !1 0rMPPp010, V2 @X0^00pAtA0OV0 TA0Ό`p 00`L PP+'0x @h0 0 1 30rߍL0F0 6V0G<0 -=`  D $ $$0 M000 Ѝ$  -- M0 0 ЍЍ/-4 -M, 0 0 Ѝ Ѝ/ḷ O-@SM ^ YXb 0pS000!R !3  PP E`#3`9P*Q30A 0#1#2#4#8  P8   ࿖0 A 0U0 pQ>PP 0@pQ 0S  Ѝ蝗T000@0000@0 ⏕ꎗ0000 A-@`Pp0 }Pဋ$0$ 0 M Ѝ\ P\0 0p@-00St@@@pdddPP@P@P 0000 0$ t4`p@-P@7 p@G-Pp` t@t0@l@  - U  40 zU   G @ (x , A-P p@` F  }000 (@P p@-@PPpp@O-MBލЍ &P (%@P  4/P Q Q 0 0W0 00P 0 0  @ P 0S 3/ H000P r;뀰 D t  $]\0@-@P$MP U! 0 P% 0 0   0P $Ѝ0XX<0H X⌓U<<|0H X⃓@DX4 ~ O-@PU  RM `100Xqp0S@ @@@ PⰀ $)A0PS,00a000S 000  000 000 000O D@00044<0 X | x t t ` A-pP8  0S@`$ 0`S @0PP0S `V @P @V000 zT@ 0@ P ((<0B/Xʒ(, O-RlM 0 4 吀0 R X #`000Sa# 0S00 #3 0 4 4 0P Yڀs倳3@0p P0V^ p p @QS  QN XP0S h @p $ 3/0  0PY@@RP00SS" 00C0T@lЍxB@@@0d20\ 0 00SN  R002( 0 @ (,0 @p 0TT|P 0S 0@00D00 0@0lP 0 S PW @@(0XS, @ , 0 R1 1S@X  1( 0 @ (,06&>I/X֑0S XQ?I/Xʑ@lЍE?I/X⿑@^(  (,0ꀪ tlW`4V pVV8UTT\ , b aC-L"`H2 DŸ0M000P/"b1?2cQ 11QAQ@PϠl R QE00å?8@ 0 t0 30|Ѝ x?@O3d11 "@(,p0p P$;.#"0.cR:x.c2Sp>  PP 0 0C@aa0C0C Cr  \\.N2?#c!!"N -  ! bQ@.5:bQ,. 18.#c!!2N0 ] 0@ S 0Yv0 `R 0o S `k 0@ E``0 S0C0t  B1<0Q/,0A!b0\P  @AYF0 `R 0? S 0  B1\<0Q/,0A!b0\P  @ Y%0 `R 0 S0 @`;Q0,0 0\P  @Y0 `R 0 Sh0 @` (;Q0,0 0\P  @Y0 `R 0 S^0Q!/ b !S: 0,00\P  @Y0 `R 0 S>P:Q0,0 0\P  @Y0 `R 0 Y% 0  @h`@0l @`z9 0Q,00 \P  @eYj0 `R 0c S)Q2?0c01Q 009 00\P@0 @EYJ0 `R 0C S8Q0 0\P @0 @,Y10 `R 0* SP8 Q00 \P T0 @Y0 `R 0 SU,P!U(P7Q0 0\P @0 @Y0 `R 0 S~l7Q0,0 0\P  @Y0 `R 0 Se040080 0<00@00D00000 0 P0@ &\P Y0 `R 0 S> 0@?0@ S0ŘY0 `R 0 S'Y@ 0 `R 0 S00&@2?2c  1R11Aãd0Sâ/c1S0c0l5\P00 ZY_0 `R 0X S 0@0   0  +00 S0R05`@4 0\P 0 @.Y30 `R 0, St0 @`0\PS0044 00 @ Y0 `R 0 SY@0 `R 0 S0 @` 0@S0 @ "qp nqp  0@Sj" R-Q RuŸ0c "QY22"0"b0@h0Z YL `Q \P Y0 `R 0 Y0| @_`z0@S !YrI0`Q0i R`eUPy 0@S]@ P  P Y 0 S `Q0+PE0@ p@`<0@ S~ 1hY30 `R 0, Yꀣ \ lP)\(\ ףm d d * < t $ < 0 0 \ h < n t $IQ D 0@S 1Y0 `R 0 Yu 0@P !  P$(,p0 VR\ 0gS 0` ` D ! D $0L! P?A1c$(,p0P?"dN2c 1 11N @1?2c1Q11@  ã/ d0 S  á/c1S0c01\P00 tYy0 `R 0r S042Q0,00\P ]Yb0 `R 0[ S  ` ` o P 3 \;A A-MPp@`40@0 p0000@p T p`0FЍ"00Ѝ(@- @MЍ| O- M`p@P댠 lP0 X X0 00p0 @e ЍǍ@ Ѝ, HO- M`p@P눠 =P0 T000 p0~@7 Ѝ虍@ Ѝp H@-0N \0N@ T \ڀT00\w00p@-@0M-S` +S`P0 P( 02c2c200:S V00c0Ѝp;0 P 0 2c100:S<0 P 0 00Ѝp@-@0JS( MS 00C S!00 [?P 0/S 000 0 0P 0.S  0{P 0.S 0 000n@0 d m@-10#Lc\3j*0Sn SW @Q 5?0cTa0@1L 100\_?L1ceSe aa p@\0 0 @1\00C L``S0B0S0B\D@Ql`LPQ S5 0S``Tàn 000@002c2cPÌ 0;S0C l là0Tc\0#3S l là)\P*Qgfff$I < ף404 @-0,@ @M Ѝ PX0 0A- R`P`0S@P 1Pp@ P ?܈ tp6190@-mΠ0l6@NbG`122d3c@By:E.€Q_uk9"mnףp= ףd Sc$IųQ\(\ Q)\(\ c 00 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0㳄 ):60 0($0(>! 0!‚)a!!!0C00!YoÏ(" ?00 #2>[?G'PE@@Gp1#! +"Q 10,U#1 ?0 25:$20 #4"".<2Q D2 30 #1d0T\`"2? B4sppp0/SX0 is c 0I"):60 0($0"(>)Q!!!0C"0Y_("Z0%R^PVXPo`v c 0!0#&: 600+$0+.P3& 1110Bh#`V:+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 0$):60 0($0!(>@$ 0‚!!!0C0\$)YÏx4(" ?00 #2>0r/D B  1?A1c1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\X%`;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0t&`000  @000TP@DP0S@ @0 @ 0$ Ѝ& vc 0 -'):60 0($0'(>$!!!0C4'0Y)("0,".L<0@0P<0000' 0 P<0@0PxT 0 O-@P`Mp 0S+  U 0&ZP? ނŸ01# 00 0 Q 0  ! P iB00Ѝ0 S! 01P0 U 0UPz? ⧂!01#. 0!U00 R㨡!h&0pP l6m&NS@0HSH0P0 0Z0d 0S00Ӄ!10001[ 0<zhhpPx@2[ OX10\10 01@T% <T>0pS0S >S@p=S*S0S -S0 C R@0H0010H 9 b@N h&lFpFtF0 h 0 @10 0*T@T -T00D S0@0JSl0S,S  ;S  RfH .BL S] ,S;SZd00PS 0,SPx@PJ 0SGH  L t& `h& lp& u&g.l600%( ,0P ş pP$D $cR-:$cR 0#031d002c2c# b?0cXZ  ^  RPp N p$lpLP 0H$,0P 04,004Pğ P0 #cR":#cR 0#031d002c2c3?0  cRp c sP  R PP# x3t3p301c00,^004P0@380@00000 00N  0h⊅@ 0@⃅ @u 0048R'0  Z0S  *` ϠϬq^Z R pSH H D WPE&@@$[j( V.i5:IPI%^ 3#adO0RS@lXEW`` ( p y@F@Fp pX%HpI@@HИ@'Q_Y$AXO@P1:H.BXN T3#dPPS@X0 pTHP@1S\p WPE` 0 ": 600,0!,>00Cࠇ0R?#00 nC1( ၢᡍ H 0R0`(4&^  ((`3`#`a P p WPE  U6 00c\;S9;Q$0(080p P`P@Lp40#XT YV V0Q#`? 00?0S 8@<V 80<8`<  05/P `0Z\ QX QT Q{P QwL Qs p0pS P Q(% Q!S, Rl0S Qh 0 SeJ1Fp Pe,Pxp BrIX 0S@`TJ#M @A 0S7 0N080+0+P0P㧾 0` [*[:[$4[4*[\4@E$*[OoB@#[1 "*[$![[t*[[q *[ [$Č*[[ *[$[*[ *[$ [*[V Z2\S}QQ [ *[$ [$ RH SF WD .`,^6TE 0 FC:  0PS.`Z00æ0@T )9 F0 0 30_Fۍߍ0/S <0BQ 0R/S  8P  PI@@K0 0cIPUV ZSZWQ P ,ppH`3@ $(004U> \0 4 Q"<$1V, ⁡ZF` R@!W0( $,p004`@T@M`^v  \`0\ \0$0\4 \$!?8:[ S_0J08*S RZ RZP 8ZC6PM L| 0Wp@ 0P0@E+C.E 0a S`Nhp@@W {P0W00 @PY a0共`PVP{P  {P0/SS0/SPzP$0/Ss G`Fh QPQP Q Q@Q@QDQ PR: 像AN h 0 H 0Nh    Q)j@P ph` p $0(P0 ^0 4Q"<$1 WZ  Q\  Z`@p0^ ^04 ^$0^$!? L\ Z Am pdj0S PW @0W[ 0 00S -<=0- @0 R s Q t̔<\070 A+- h@0PbTb``0SZ0@?`c0SPⅡQPZP }SPPA@QM0`0 RW@0# C !ps~@p p$0(PPF̉S n 1 R Wo0!q0S 0H0B 0410S01 R  0S !0S RNh 0-~ 0 PW @0 0000F a0`ᅱpk@2 \像B<02i$ p,`  @ 0P]   hhNA-pQ@Y 0Sl ɀ001N  hh6l6}`P`P 0:S  AP `VpFPPU N hiP0T`VNLg@`_ S T 0:S*S+0C013ZS@Sa0CSQ`P t p@- 0P0@P@CPp p@ 0 00P/Q t,0, 000S  /`Q t\ P/ 0 @-\F ! L3/L2S @00P2S T? # 3T #0R00P0P@T@@P20CP2dP2SU PU Ѝ\00P2S `@T 0400P2S$554444443d383 A-`!`\1 0M0100P0Q0S@P1 V7 T=p`0 80xq|q 8OGT8@D@@@΀TA `pP1`LPP0@ 0 0 1 30ލd0P0 ($vVHQL0 (vxT 0 @9 d8 t T 0- 0 M Ѝ7 @ - -M00$  0 0 0 ЍЍ/7 0--M0 qЍЍ/0 0p@-@PXk`00CS`0p S  P X0` X PXkpXH`7 (\ \0 `00CS`0p S P X0 X /X )h6 (-40- M,0  XE ЍЍ/5 (-8 -M0 00 XLЍ Ѝ/5 (G-@SpP\ 0S:X' (S" WH bk0` V V,* Xv0p0J0/PM`IwT000@00 `pp`/P,0`VpC0 00 7k +v0 0SJ 0 00(kQ40 up0=0  uIqPD@0 u0 0Ck Iq萄 p @ --M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-PP aM`@8 .pP& wo@P# l0P S00p@$ 0,0 0 ( 0 0 Ѝiv0000@Ѝ 0lЍ00>0 t2 8H @-@P j 0#C@j0;0 zt꼂 R\@-,p@-@QPI 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00Sp[hP hP `hP 0PW40 )t 00B(0<0 tv 00괁 A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2<ЍPP0ؠP0Pؠ0010 00C0B Q$RpP00 wi0S0[ 1!pP  w0S>0[ 1!pP  w0S<0[ 1!prP  w0S p w0SB0[ 1!pT w0S,0[ 1!pE[O[Mw0S0[ 1!p4 P>   w0S pT 0[ 1!p@@PZ@P"Z P PP 00B S01 00B 0B P$R w0S p% 0[ 1!p0 *R# 0B Q@ 00B SP i  w0S  p q  w0S op  ;  w0SV0[ 1!pw0S Rp 0[ 1!pw]0S0[ 1!pw0S0[ 1!p~wR0S0[ 1!pqw0S pw40S0[ 1!pXw0S0[ 1!pK pu pn pgs R  0 0pZ  [@ 1, pJ pC  w0S p6 0[ 1!p  w0S0[ 1!p I w 0S p J w0S0[ 1!p }pD vpp T 5 jp$ cp \pI Up)_ w0S0[ 1!p] w0S0[ 1!p , wy0S )p 0[ 1!poE w0S p$R_0@' p7 w60S py 0[ 1!p@w0Sj0[ 1!p3w0S pXw`0S pL@ wC0S p? 0[ 1!p  w0S p* 0[ 1!p p P \ pC p pD |p P ; 0B Qc@ 0B 0B P$R= w' R 0Z0p @0[ 1!p P  P  P  P  P  P  P  P q0 S p 0[ 1@!m P $R@00 P  P } Pz x Pu s Pp n Pk i Pf d Pa _ P\ Z PW U PR P PM K PH F PC A P> < P9 }7 P4 x2 P/ s-~ ~  P( l& P# g! P bw0S p 0[ 1!p P J P E P @ P ; P 6O-oMMD @/0P0? PL@0060 D0S 0P00!R !0s060d00 O 0SL   RR l /0 0 D   ܰ00040, h0 \0 0G?@$匰H `00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0P `@r01(0 `0 0EZS00PbP   R00s D0S< P=*X1RRLXOX`>pTQ`C.+; 0 6 30  oލЍUY 0D \nBU`Q pQ@m@PrXT8@ 0P( PR00S<00儐0 BRQP 0G0^0V@DTe L 0 R`p0 /  ( PBU9S<0 0000$@T0S} J`yaU` ( P X0@ 10, S000SL0100 p | L0x00t0u `P x 0BH00?V0XD | r !Se 40S c0P40r ,pt0S-0r0|080s P D`Pa,`  : R 1P0 S0r0<0qV ]00,P0R00S 0 ,P `S-0`r020 @\ sMdpk`pGWdW3  r0WX0PP@T080@0Sy H008 @0 10R0bB+ S- C S!!?/.BcSC0P0`EpB00Q0@N*n0 BPk   B.Q r0^0P Q0` 0 0YJ( BZFZ#匀 0 JZ R Q  \ PJZ$0$ 0  \0 S0u$0 @ R| R4 Hp8 @GT@T ڐ 0 R`@0 n8TJZ^\8 Y`   d R0M  @ 0 pGWpW ڐ 0 R`p0 ]WHXX f$p``@HX 0R`0 S \000P>0Tڤ$ ⌀@DT 0R0 S [000P@DT0 8'0 P @ 0eS0 [000P$0W[000Pg  R dPM@H00Q@`0 S [000P$ 0HLXh0P08 Rڼ匀  K[0Q0S  a[000PK[$0 d0^ 0 rQjQS$0ld0VrT  0WX0#S] .[@@PZ08 ( 0PBU$U4j$p`@PEU 0R`0 S [000P0PEU0*0 PP0 Sp<0 0S$0&P Z000P H0$ 0C`0 A0@P0`08Sq Z@@Ph >00 00$ . 0 R +0    d   d 0 R   0|@T= H  4 pC @s0<0\0 , R MRd  d`0!"0 , 0f 0dppG,Q0 `bSdp`F00dppG`pG,,0B<P-0  P0 St EZ000P oS0 9Z000Pdr0Se 0rQ00$Z0PO$LS Z0PB$P400NS `Urxn`(`0P@p0X@T@8@@0S80Sp0pS@@X%n$p``@HX 0\`0S Y000PHX0 x0P0  -@  RC ,0P 0P0 0  SL0, L0Ϡ 0Sq-0r00SP @-TX  䯟/s@  XP@@P@T 8pUT`ڐU@ PEI@D0Q 0T8 BXX ڐ0Q@0SXpApWWڌ 0p`P@JZ R Q 1Y P\JZ$@0P` pT 0^p0\S0  Y000P8$0S*0$Z`ڸ-$ @⌀JZU 0R@0 S X000P 0 X0P$u 0D \0f% 80D \(fl`0`S0$6R ,0PX SL0,  !00L D, 0 P  00S0 X000P$0"_4`@X0T0@050\Myo\ { P8 @TX@ `""   . B Q/\;2#0/0 0 !.BϠ # *@ Qʯ P  A0F,FP# 8 `P QP Y <N8""P 8@N@8@ @ `N  BP(Q B JQ/P2#΂0/ 00,# $!L Q. ! A0  @8ϠBP!.up p0D \Eex00CH0&S0_$0 ,, s 0< 0 <M,dp\ ,P`pG`, @0ojo ^5 ,  r0R]P @[@  S R ,0PϠC 000SQ<+W;T ^3 ,0r 0SϠP SL000 ,pL0`b, @0Bj? ^ ,  r0RP @0PSL , 0101,0@0pML ,0,    S ,S0;$0+; ^ ,0r 0SϠP `U2ڀf` `0p@P0rXT8\0S 8  B0S0S S0p\8 TX@_4`@@e`,`S0$0S  L000 ,pL000xex`j S |0s8 H00S0$071SH 000S00G00$F@ 00 ER0 nn"!  00Bh00?R0SF 0h Srpw@p_4`X@T@8@TPV0P$80SpH0pS@0H00$0 zV000P qV000P ^~ 0, SrP  l PS,L10L , SL0, @@L0,p0^f 0S r`P @^O 0, Sr^P ^| 0S r`R ,0P1 ddR ,Pu V000P 0U@000P '000 a`$` Q`&  .! FtQ 0#e 0 M 60 c`39![U@000P S  L000 ,pL000U000P L0 RrL0@ L0 R rL0?@ 010h0X@Tdp@pG,uܩ ة K K 3|K $ H xE hD C L@ ,> < L; D: : L8 7 >S 1(0P`Tp x0@ #RppS 00C?@0oS$0qt@d@pp$p⌀@DT4 0Rp0 S  3U000P^0 080_4`@X0T0L000 L0PSY U000PQ =!0  P@0 |@n? PecP 06p@S 0 @00#L 0L ,pL0PL0,,L0 00rRL0g0 PlL0P00L0.qL0 00rRL00 PUP$$0D \bx00CH0XP8p\V`!GL0LEG040d 0 0SL0,L0 00, H 8 BR@ c@`0`yyT 0P$,L0 RrL0L0 RrL0&@``0A/\aSo , ,p1'h > 00$ Ry ,P1^ ,0r`0S @]^m  ,R!r0nM^ ,0r`0S @E^>  ,R!r0?~@@L0PL0 QQL0PL0cSg|@$0a0 \UaL0 RrL0xL0 RrL0L0 R rL0$P @ 0D \*ax B0?V0H  @ S,L0L0 00, 40D 0p 0S*L0 ( L0'L0PL0Ϡ<S 0P|@$4L0 RrL0L0 RrL0L0PL0L0 RrL0L0 RϠrL0 @|L0 RϠrL0o @o 0@00p0X0T0>0S* P,pP`00E SIpqp00A S$Q0!S- 10P`b 0 0]  S,L0L0 00, 0D 0pkS,L01` `0,, L00D 0pU 0SL0  L0 p,P%@-` MHP@pBV<0P000 P?V Ѝ A-@P`p)V0 P*VO--@0pj/ H30P (  O{(0:j0P00JPP+   ! G\,0P00b00P$@ 0k0 ~K ( {{[F8N:N0CB:N@:0000 R0 R Y Y 8ƋF* ,@ 100@QN0S ISj 0,0@10?[k[* Q BT@,(@2Z 000SY 9U& PP00@P X0S0$&R0!**R 0P000$0y0P$@?@0 p0< RTڪ@,(@Z 0G0SQ0 R f Yd Y S` p`Pd  P9U $01P00P00S YE Y 0p[P (@,@@,(@ZM Q QD Su0P[p00C0S0Sh00 S000 p @(@0S0SP 00r0S V00S>0S 0Q0Q Q p 0S0$0G$&R00$0?0!**R8 0P000$02100@0S@(@P+ p0 0[0S0SU #G00S Y Y P  p0P0 4[4 0090 0pG04a^ pl0G040S @(@ 9U Z$01PP000 0009 0 00400@- M@P`e[ p cZUT 0S*P  SZ@N[p Ѝ_ @@EZA[p Ѝ$S 9[T@p5[@P :#46*0/Q /46*0/P@-@00 R@P@Rp@-P`0@0R@*0Pp@  R 0 R Vp@ !0@20O- M@SX@DPa`101 0lUYq`": 06  R0 R0 W *00S 00CX:X@D* R @  P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ`P0-UM0P,@.0L10rY{ {{{0.      ?Z/Z   @-K @- @-p@-`P@ TP 0FP R @P  .Y00pP P 0?0 XP p@-@P S`PP  Yp0:0 X -M Ѝp@-@ P` !LN/U !@Ap- Mm ЍP/L -2M")2b3c1@2`1  0pЍC0@-@PMP 0 00 0 PMp`Ѝ00;0 WX 0p@-@Q r  P p0 S 1P p PP   ! X @0O-M`pDI@0D0Q0P+5X! @0S Sj @   b 0P18 P T@@  0  WT` ЍW Qz@ 0Q AX00@P00  j 0`00QB@`VRTQ`p0 0"!` b  V0 ZT@P@0Q=W 0000! @TQG 0P02@0  000X"000@000, @i 0Se0T0 2aPPlv"! 0#000 0 0 @ 0j`@Pp !R/0S 0C0/ 0RA-@P'`Bp1W@* R0C@C   %WV X@p@p0 `f360@p1W@:b S PPO-p -M0 Q '0l0x0 0 Pt0-P000P00 00@ S0,0r `@ a`0`Ft@00@ STT!Ђ 0 B0SpЍ 0 S0 EP 00Sl 0 $@ < SV ?o240$ 0R0$0jTpg{p TGڬ5j0f1k5ZT 0 S 0SB %0dS{ 0|  pDpW!0Sp ,%W 1  @pPxL |0p0 pLW|0V |0 0p|0  A R8 ( QqpCW px Wpp\ws0p000,0( S|  800S(08000 0$ 00M `۟<0 﫟T˟ﻟ 0H0 0DS?<040 B 0S0$ L0D@_ P  H ! \Vx0T P x   !PVp@|R PD0P 0 X$0<0 ( @pC0D$ pW pGP/ `Tx 800C|0p PxSt@P5P t00Ct0- Pt00t00000x l0 !\ \  XXQ+tP0C0@00a` 0ES00 0wx0000 00P0(^  < 0H`P00p 0P00H `00P`@`t`00`@000 0 `:S4 01c:6||00` %4  0!{5Sl 0'0  H P 00pP0P0吚00cP0相 [ 0 @0 X54 0  d{  A1{'kl00 {'0G GP] `T(A4000 0P000pP0n|0050`0000(P0l0!S!00 `Tl0Y `Ti 0S x0p   ~}\ t(   B!0p| l0Y `T^!0Ul00( P80SPU@Pj PPr0S 0S 0 00x lT Abg `Tx 0000(0|0P0l0}*$&%&x*!z(GH pG'U!08 l000#Z00S5x 00^ Y^ 0l0U0" R   l L Px  pP1XPePPp00p0!0l06 `TQ80( lPS |0x 0Cp|0Kx0! l  R!0S,00,0000|0x 0C|0 0pl0Pxg@-00pO-@ 0Q@P MP `PO p,Q 0@  "($(!(  X"8H XA3pIqW K "8 80W#8S 0Y  0  0 Ѝ@P   ! O#``3ß0O-M 00@Sp 21`C`0 00 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 Y \ 5 Q0R i T0#03\0SWe* G0V*0F@S3 F BS   3O0WQ 06S OW*@DPD@ Q0A Q0Q l l > U00XS Q0Y j00Q )Q 0Ѝ|<^0 n 2>0 00 R)AoᨂX 0v Q>0?0l1 c 0R:j O-M<0p HJH:@`00S 000S 0P0S EA R[ % @E  \  P 0PS8 Z@@@Ѝ @0Q[V R 0 BPS10W ^@0D0CSڣ0SqP [ IT 0 TD\ @N Q T   @T 0CC10B3P0DS0 SE@TS@DTDX`  `R ߰ BP[10@0+S -S0 R: R800BA\ @@!~s 000AS0B[0bZE^ @d\ [ 0 S S80S 000 0 b@0N"00IZ@0E^0[ @T0 QL 0SP00S P3 4^E *@C $`P D21 `2 Q\` V00 00S@0T@DUQVD`b 21 8PE : @0T0 T1 T@00@0PS  Z PEP R, 0 R Q 00PS00= 0@0@E IP 0 C0 RZ@Rh@DU 0S{ S SUUv E Pq C0C01` Ѝ00S/0 R /@-pXaM@`PB D1P5PP3 qpP-0S  Q4 p 0: S-RAP  8#80 @0 $ 0, ( 0 0ЍH00Ѝ<0L0E0 FH00~HO00z 8Hop@-@P l<00CS00 Pj<pP0=0 SF@-@P 00CS00 @0I04 ;F(p@-@PPD 0rS= wS+ aS3`0S  +S" e0C\S00S``p0S0S0S`0`SG 0 p`0>0 E<p@-@P8 0S< ;P00 P! !' 0S 3/PP೼000P @ P ݷ00 00׷00`aa;\0`` 0pȷ^9P,080 EG 0P0d@-@P 00!R !#P 0C 0;0 E@-@P 0 0 S @(90;0 qEp@-@PQPP 100S3 0  RP 4000S8 0"$0 3/0:0P3p00P @ P T00< R 800p?0Pv9Kq8P009\0J08 E 0 @0 0p G 000@00Hu <-Ѝ/@-@^S S S  \0 @b @0 @fF00 0 @m6@000 0 0000/@P@- 0At @F41Sx O-@ MM Q 5/0Q PP $d |@ h|0g'( $g* ph ` 0 Pp$   T`  8 X| lp`0 tP  !p$%d),P 8 $10-` (4 td8 T59ċ<= "< # &'(* (+p. x/`2 |h3P6 lX7: \; >, ȋ? $l` ̌+$a(!`+" 0 b"a +4k+b$! 8 ,` k"!$  Q 0pkP4Q 0pkP*Q 0pkP Q 0p}kPPQ 0prkP YMߍFEOCEp,qMߍ/a$Q@-P @41S  P mP0"EA-4!@r pPP/1S 0L1" @P!GPPPUQMoPP PQp W Dp_oRDpDppp@-@P PpPA-@`㩳P] VapPᜳPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ  V fDPDbDPSSO-P M1 Sz$aVp$q q(SSp A`TR X`D (0Pʀ 0S `(q\ 0{ @P A Ѝ C$oB/갰[" (hr 0^ Q `VH$ [ pVpGp@(VJ ($ AT$$( 0 [ `( A^% \ :0 + @PC@@,A 0 S$1N(!r5 V(* T$$$H0 A( [$9(~( 0Q0 0 $A$!@`$ A(aV 0 $AP(` 0 `aqP_ 0Sp{$V$O-,M R0  1 rp3/,0 (Q0 P{ @`P@P^$$P 0BZB  @PUpWW 0 `PS @R㲀K PUJ[Mp p,Ѝ 0 oPPu6  $`p$`P  0 ]`P) @R㲀 BP  P^ ^4 ^%  gP 0  jPp@ P`@@,Ѝ 0 j@ P@⁠Ằ[ PಐU 0I   gP(A DR 1V(Q0  oP 0@-@ 0! \ @!B,B00,1S@-@0 @  B00,1R@-@1  0@qB,kB ,!O-`᜙0S ]M9 pPw:@P Uq   @{ NB0S 0 p/  ,p  8p4 0 1 D@@ @+ P XP $V  PpW4p^ Z !3[@ @8([[@4<P30Ʉ  D H p $hP00 A G, <0(  Q PVY[ P  0~p pt 0~ V% 0S" A/ 1T*$ <)$p++ *<(),<('4 '<.0<.,4,<0!4<!< 0!4<!$0 #<$!<($0!4<!(,!4<!,0!4<!400#<4!<840!4<!8<0#<<!< <08 8 8 4  4  | pp ̀ 4 (  ( $4 |($  p, p0 ,0p4$( ,, 0484 48 x< @ < +4  8| + ̂0@ >$@%0S 0@00@@Pq@Pn @P @PdR0a@?^a Ta tHt,O-@(P`P5f10pSp(P6 R ؑ㼮P. ( ,0 [ D`D` S`1005,`5Ohꂡ ိP ر % Jh> ůؑ@-@ 13/, (Q0@-@Q /00 2? 0 O-SfM `$ [pW 00!>0S >` ?-P  9-`P pW0!10 ! 0p< - -G=O00000 0000 -0%L00KPdd0 ,;w?q尀U 880b18*@-`@MpPP  -00U' `P$ 0S r?(p0 4" 2 pЍ -Ѝ -pЍ=00p 2/QA-@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   *<0  '  P        P  0  V/0 0 0 0 0   0 0  0  0  00   0ЍR 0B8#8P P0#0BR0``      UЍ40b0 $: 0(0S"( S:8 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 X@00 0UXS 00 I;s0, T:)[' P0K/S  000P0: S /000S0I S/?00 1X0 -QP@PV# 4- Vp!/0SY  \0 RK Y P/00W ᝵p z᜵P /@oo4x G utsR Q0P:Q0Q:q.@-$@-@@1 $ @ ( p@-@P#)P$  p@S d0@-0 M @ 0  @ʠP 0S  Ѝr( O-dM@\0P T 0. \$.\p @p.\0  (0 .\` D`.\ ,.\ 0- \@H@-\ 4- \8-\ <-  \PLP- ( \40 0 ` `0< ,@8p$0P` "  0#0b0 P%a8 p'egH` ,. alngx+b(*`gLb0l$`&0feX)c8(n, e cl fj!쬊̉b,,g|*gbH  ,l*錈e\(l$gx" fe!c<+b(*cig eX(enl*c8+bL i!c fj$ n Yc:0 $7&600 $-&hbL0d p%&L0 $&`0pW\(\xZ\X4XXWC-Mp`@P' PP"  0   Ƞ  ,Ƞ 0 !! 0 04000000 p@PЍЍO-M@ 8pPPO 0 0 رR 00㲱 1 1`0CS㣰H* 8#8V: ر 㓖`PF 00 0000000Q0㲱1 P 0 0<0 00!&V@PЍᖗЍ000100@P,bL0d pi% f$UO-`0\MS0:℀p3< @0‐P(0$  r@T X>*1 #0C8 #  b#Ȅ 0 F 0A 0<S@@ a,^p  800|8 00,0F 1Pd `V 0`h0 &h0CcS00 p㰑1 0CS'*0$ S 00(0pP `VP 00 0 00CS001!R p0p  0  00#0VS00 0 IY㩐* )ቐ 0 0 0 LTPH0PH2/ 00W p0 01p0 pp ,0!0 B(S"8110  p"      0<00@pS- 0S 2  0 w  p la0S @ L3@ 00 ,k 0 S<@p  M I E\Ѝ3<S00 01040封HX㨀*004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H4 (0 岁ᴁqpGpWx'x*W 0 08#8S:00T#(@ IY㩐i* 8#8V * ("( B``F  1`0100[p@   @  Z`V<@p "   p    D$D P 0 0 0}각HX㨀d*(ሀ10406각HX㨀P*(ሀ1040RbL0d p[# 2  0+ W)A@P00,bL0d p@# bL0d p8#0bL0d p0#IbL0d p(#pybL0d p# 0!VbL0d p#hbL0d p #Lq0 $#@pKTSSLL`L@L LKKKKO-M %@ ,p0`Pq0 p WPK 10C0XS%X:*U2 PEpXXP+U px'x p @P 0#0!01p0 P [ pKx'x 0m0p b$" 0 0Ѝ 2 p  @[Q\@10CSP*8#8TQ 00@Ѝ P   ᴡk PP ^뼡 0 W0 8#80CQ K뼡P W 0J 1P 0ZK[0嫰:2b0 $0" 2 p @ P 10CS@d*0D@ 1 PPF 뼡 0 W0 E@ZTj 뼡0 W P0J 1lP ^1b0 $!1@DHPE$H up@! @10p  KP 10CS@: B01b0 $!A  ?0b0 $!0pPEu0) 1 01p01 0P@D1H $H @U0PE10Z!08#80 !L IHdG$GR0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P , ;"@ (! 0"E2O-$M p0P`  (@$\0 0 p 0p pP`@  "l(,"$l$" %  0f  X Ơ d,  .d, 0! \ p p P`@ 0 !b!!    !`.  . "  @X!)!   $Ơ c,c,.    000 00 0 0 00 000000 00$Ѝ4ED 0G-1?p@P` @g(X, q! 0P0 0$0@`F0($0`2#?V@F?p@pp& 0$ <@P U 0$ ?@PP?`V (E! 0$ a0 0$ ?V@F?@(p@ 2! 0$ <@P U 0$ ?`@?V PC-@P MP) $ap6?`V&7 ) `0(0 `!W``Āapa8!#4a4# 0 Y@h  ЍC  08R(@R )@ b (`8  )8 b (`R @-G/ @-@-@P 0  @ (h 0"t?R @-(/r @-@-@P 4@  PH 0$$> O-LM( 6,p0`00( 4^_~?<$P,< @$ 0H@0@8`8@40P`pp  00$(0 P00p`$P`p,0 4F e0%)'&ɠnj)000000%  &') "ˠČ ˠČ "  (0 00#0')  ,  ! 0 0 Ϡ' . (̠Ì  ! $ $ ,  ,  ,0 T(03`0~?008`@P p480   @0  @$ 0p0 01!  Q!声#$ ,኿+* / 3< ( +1牑 0媃(३1p>ဦ*1砹 1ᅶ>%S 0#] P% #$7$ ᇑ90#  ..YW([T0#P P[T(P  P%0P P P%P 0!(pP00,p/!~,! rp', /!!0 (,#p'\ )S  $( "P p P% p PP%4pP8p p0 4PR8 P(,P]<` 000 0 00 0 0 000 000 00000 00 0$0P(0$P0(0,000,0008 400 408 <0 0<0LЍ>8<p@-@@DQPU  0pRPQp bPPo QP0P0H @ p@FR Q bPP;p y@0G-1p@P` gPX? @0D 0 #@0D  H00H0L00L0`FP`P6VFppp@0D ;  SP@0D *H0L 0 H0L UPP`V Pu@0D a0 #@0D H0L 0 H0L VF Pp X@0D ;  SP@0D *H0L 0 H0L U`‐V PR @-t/G-@PM ,PH8 I `p `! U@ Ѝ@-@P 4@  P 0$$4R @-</nG-@PM PH(  `p ` U@ Ѝ 0` a!, a c,/0@-M0<P0 P:7@0;P5zP DP6E@05P(6P &ڼ6P 0P0@$  005 P0H 'p Hߍ000ߍ0?CPq 0P@  @0H p HP ߍ0L0@$EDCB4P0@ PH A序40pH<,+*)(&% @RPA@  0@$  00P\vb^GhFdp0@$L+X0@$<@0@$=951-)3/H㳣P H㩣P h0@$,H0@$|00@$d     d0/00 0H ׎p h0  00 0H Ǝp D ? =@00S,&x0@$d`0@$]708P865544333 i 211{G-8M(`pP {{퐋࣊@W@V@U@T4 0S !Q4 0S3 Q!-VM W0`c U pq P\L 0 020  @b H8Ѝ0S[  Qq {0 0h2{`" P0x ! ("(R  #m:VW$ Upm P`10   0 0UU0  P R& U  Pl\ P0 0VvW0 UpM 1 P0  `  | y00 Rx000 㡍P0SQ 0Sx Ya @`U] PS`0P0  SXz xy y Ty h0x px 8x w w xw .v lv 0 P0  7p@-0@T 03/@TPP 00@T 03/@T\~pH00@T 03/@T$]p4v Dv v u u u @-M@@P Ѝ{ 0 { p P(0A0 z,H-Mo 0ЍO-@Rp M ഁУP  `C80 S" 0SL: f0  0Z 0"80S8  0Q@0 P 00 Ѝ 2  Z  00  00 0 P 00  |P00 2  >P   7P  000 0@-P RM@PQ    s/ r? DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U1!^ 0F BS @\ `fpUpC- MP @`( ``0pV!ؑI@ T`1 `! @D s T@ p PP Ѝ ЍᖉpP p`O-Mq  PpG  0H PU @P U`1`!  E[  0PU0 % ЍЍ@- M` @  P 0 q@pG{ @DP @PPW : Ѝ Ѝ  P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-81, Ġ%̌T$\D#L0P  R*0@ :Ġ01#̌  R* R: B0@-81, Ƞ%ȌX$XH#H0P  R*0@ :Ƞ01#Ȍ  R* R: B0@-81, ̠%Č\$TL#D0P  R*0@ :̠01#Č  R*0@/p@-@Pp00Sp8PUp4002U!*4080`P2U:080pO-@R"2 0|M`P0t00] 00S80S p`"X2 0 t0 30|Ѝ4P  ?P8~ 01 0#\ %$`0P  8 0 0 Xp; P&8Z> !10! ` 04 4^ 08P  R8P84P@P`0XP:A@8H 0801248 Q:%0 S P83P8܅P 8 ` 0塉pP 800P8P8m00phꦽ  @g O-M$ ) 09 @,0@020D2(0S} pWw 0H"4SnSl90Wo 400l0h00~0P . Sd e  S h` I dPP& EX 0 #0h00 00@0S000 R!@Q  :SY 0S c/d Z c/V0 0U X@  0 S  0S$ R0b00H2S708 R400W 4p\ p0r4040p0눐4`0 0 ` ЈpA 0PW:: w` 77's07_U04PP8 W00S  0 \' YPPU PEWY0– 2\8 Q(( Q :PS 0 SR7@T 00$0S  00@8Q 4Y  [` TpJ 0S8 0 5 P 0到SqT2 c/00< SG 0 SR@T \00$0S ,0S !$0(0S (0@Tp 9 0到S c/d g R   P 0 SRPU (00$0S  p?00 0 SR@T 00$ R 00\"00#3 0 2 30ߍc/d &  p 8Qc 0 SR@T 00$0S  /00@Jc/d@0h@ .rX *2 `0 R(S Uᅀ00*PHY`l2 08`0p4pTrp/p0 S ((Wࠓࠃ\^` `0\\440 0 8 8 \R \P0` @ eP 0 SR@TF hk00A@ @ h3`m(0PP ` 8@P@@ ` W x@  0 SR @T 200$0S  @ $ 0 \f d c (_ _ A-P`@M@`@`p$000,00(0 00aPЍ\ 0 ! ƒ<1p@-S@P  0P ! "0 2pp@p@-@P` VP(p0-P@  P 0S RP0/P*0    PP0/0/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/(!(1@- 0MQ020# 0S0* /!PR*  R @ 1@0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@1 ꪹ똨 ԧ /O-p?o2P00#R00,MSP MWC  00$00 R 0   00SW 0SS0嘣#f 0 00@C(S0 #@P!  7/ P7/P_ 0S 0 00P`cPU0? E B R Q @F"`B`FV`!V Y*0SE* Sb:P 0C 0 0000S0  Rᘣ#R0@@ 0 P   P7/ 0P 0@  ` @U* 7/PX X 0 0R0X 00  0 @0# 0P0 0 XP  SX0 00Pd" Q0P0 S*S: X  QX E ^ @F"`B`FV`!V C  B+7/P  7/Pz 0 S 0SS0#! 0 R 0S0壀S0嘣# 0 0 X Bv`S 0P1  0 07/` P 7/P0H 07/` Px7/Pڅ0`DP 7/ P^7/P 7/P^P$0@ " Q0 C  7/P @0@0Sz,Ѝ! ^ @F"`B`FV`!V  B&a`V P 0  %P 0 C07/PL 7/PPD7/P 7/P~7/Pl  7/P d0@S@8 & 7/Pe  7/PN0 0@0哤$ T P@`c⃰ @Z}* @  Tt@ 7/PlU U   0 Y00 #0Q0 4mL0 (0l0 (D$- M0 00 ЍDR Q0P:Q0Q:8@-+ 4A-SMP@  $3/dp0  QP0 0~4P4S  $3/000ЍE00A-pd 4V:@T@T 0P0 S  00 S  0@P0`0dp@A A-`M p&@P0: SxPP ˅P@ P 0 i tdЍ00PЍ( $$4/p@-P$0r0" @`Pp$U04 0B0   0R 1  00 0p 0% 0~@ؚ ( 0@-SN  00AS 0塀4O-S M|@Ap⇁0PS`*0S'  TP [ P0 00! Q    0     Ѝ P@ 0  QP30 0}$R P1)000000S@p 0 q 0p4 S   $3/ Ѝ  00 Ѝ00O000Q 000A/0@-S@  R   0 0Sp@-P@T @T 0 `pp@TzP`p  0S S/P/$(0#   @// / ////@-@ RM`P:Q !S@Ѝ0 0p P G @~ЍpT000@00O-PP X 0SL K 0SH p@ap-[0T B,B R`  0S7*V5* A000P<0@D0CS0 T0@p@pT  T 1 !,03/P00CS@D0(PQQ  :  D R !,0 3/`Pʼ@00 "R(  0 T`1 `!0PVQlRO,0 3/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C 0   BR @pZT `@ 0`V:}0P 00``F0``G  0Y0C00 00dP  ~ 0 0C 0 `t 000NP nX0G0 b X<H<0 Y X00]T 00Yp@-PP& 0 `V @@D00T`0@T` ,0 3/Pʼ0@00pD0Spp@/0Z0  00p@-PP0 @t@ p@ 00, PH| @B|p R0  R/ S/p@-@PQP; 100S" 0  R 0   p-  0R0{0  0 0c 0p00 P @P }0 0 $0 $0<0  p <l@-PP qMp`@* V0 T7 p   ᪓P0 :CoR  S L 0( 0R  ; 0 Ѝ;0d00 ^ VH<0 U T(L0 L "2 A-@PR0hM0d00P= 0 C 00  \"P2 0 d0 30hЍ 0`0S$ pz0PP ! WP00]0pS p 6PP0001|0`  0St$pl @PA L10F L<10/R 0 p6{ 0 0{2{{ 0SP ` 000p p00` ppl0`  xPQ  L 4 p@-@0MPRz00TaR{V( c{0T1S Oz0T1SU{0`={00 UTX!\!R Ѝp@-z\!B{00Ѝp@$z00UX\! X\!0 000S/Ј t0 0p@- PUp@0z00TQ{0`U TQUP ypX1P0X1z0T0`X1꤈ th0h 0 R/@-@0y0 X10CSX1 @yOT1/z0 @y t0 000S/gꈇ t0 0 R/p@-@0PyU00 \AQ\ X! BRX! p@y`z00OT!y00p@y` t\ \0 -4M0 0,008 00 0 ,0 304Ѝd븆  p@-@QP   p@Α090  t,@tO-M8@0 p 000Dm0T00XS<@ 00DA B QR ap `> S0T1 W  0ptt p 0`@> p PPD1?0 $@0p 0>00D.00XS W#0p 0 000XS W pp p 0A0C0B QSWpP ph0p 0> 0W 0@ p p0@ p 433333300M 00ЍX{ @-M0 | @  MP 8 ,0 0 0 30Ѝs8{ Pz H0 S8 0 / 00 @-xz 0 S 0,/00(@-DH0 S8 0 / 004@-y 0 S 0,/00<@-H0 S8 0  / 00H@-o0y L0 S 0, /00P@-[H0 S8 0 / 00\@-Fx 0 S 0,/00d@-2XH0 S8 0 / 00p@-w 0 S 0,/00x@- H0 S8 0 / 00@-Dw `0 S 0,/00@-H0 S8 0 / 00@-v 0 S 0,/00@-lH0 S8 0  / 00@-u 0 S 0, /00@-H0 S8 0 / 00@-yXu t0 S 0, /00@-e$H0 S8 0 @/ 00@-Pt 0 S 0,@/00@-<H0 S8 0 / 00@-'t ,0 S 0,/00@-H0 S8 0  / 00@-ls 0 S 0, /00B@-8D0 S4 0 / 00E@-r 0 S 0,/00G@-D0 S4 0 / 00J@-,r PL0 S 0,/00@- @/ /H-M 0ЍA-p`@P0 8#@T0P@@-/"O R ?#0!PMO$T P!Ѝ  0S RP/0    P/0@-$MP  0  00@PP  8P< ,0 0 0 30$Ѝ0跫D@p  p o A-Q`pP@ S V ("RSR P` 0Ck ?o/o0CS 00cÎ10VpS& /o?o BR Z 0 0b1Î0pϠT\ ^ R0V0 BV  T$ 0d0?o c007/ooAq!  R!0r b<·V Ve0o`100@b>07Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000H8 / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/0///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @P' TS0 C0 ^@DP \T^0L Q^ PPP 00QPS @R S Q0 S00  / 00/U/S 00R0Q0 / 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@0@-Q @P ST Q@DP  ST PUPQ P00S@Q RU // Q#/  //s R PS  00/ 00/U/ 00/SR  Q 0/ 0U0/ 00/0/R  -/p@-@R`P R U  V  R 0 p00 (@QRp@-`P@ 0S0 000 000S0 0pP0l (R S 0Q0 0S00/ 00/0 // Q#/Q- S$ PQ PP0C S00UPP-Q S0S P 0000S00 @-M0| @00000uu00o q4 ,0 0 0 30Ѝ` ` -BMMR d X @  P  P㍆1   @` 0@- @-`x@t"pr M Mp $( PrM TE <" `0b0R @`$@  P0u!1 0 $8 30kލ ЍB~p\ @0p ] 70 xaB^`P.d0a/'tH100: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A @@-00M>R@ 0 000P001 200 :P0ЍM00@`0@@- 0M@>S   "0!,03,0 P0Ѝ)00@-@Z@Z0 00/ X 0(0(0-M 0 0OЍW -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/W t@-@p@-0@ ,ppPm`0Ppp^\^//////h //1O-0p,MWP` y m1 0  0 (05/,Ѝ蕈@PL 0S LLL S0 S0S3*$! 00S S( S000S  0S S * RpC 0QW 00+0 0 0 0 00hT0 0V0H00 0N?@__<_8__^^p^\^T0//O-M, 0< 00000P0Q0S Y [00<,0 0$0 0 00%SS  SN pX  0 HZR X: ,0 `P,@0 S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V*  0BS0C [ ʄ0S*0 H0 H R;  d  \ rSi{- R@0%%%!:0Z0Ņ`% 0C RZ%ȅP  dV0  d/*00  D@D` prpo@pl 0 , 0r *XZ 0 H R 0^0100 H R? T|P @ T S  0Z 0 P  BS0 cP`C 0H p2 $P p xSPS P@ p`0) 0P  Q D Z'* 0[ʅ Q   BR B0 [ʄ R* 0N G   0lX pp|    Sp+pp\{#0S P@`0 0P  Q Z 5 4p,  S@ 0  d0R\ @RC0?T0SPA`B  0PSe     +  n P gpd R  ^{[y,  {UPP xr    S ǣp@! ""d   S   ~    R(0P0000pCP`@00  BR B R' R, Z  048D 0Tn  BR B  [ʄ R* R\ [ R   RR R f       BR B80`P@000 Z0J0(#3 0 0 30Ѝ    @   ,  0  D @A [  z 0 R*6 `  0P`@ RPP   ! 7   @. +  @( "(y   "@ (B(pp-DA@  @ !     Or(0D T$Y|0D T@   0 ? pT0 0@겡pLtT tJ  A-Px@@ p0`pP@PU J0S 8/`PEuX@pW0:0 DG x  0SS S  0R @-@o/ 0R0@o/O-p(!$1 CM0 M@`0440PP  0 0 44 30,Cލ Ѝ 000 0@0`0 @P mx0 0@`wP+ (k 0"k/(F E E (G-`0S+ S'QU$ pW!@0 S00#S0S 0S0S0S& P# YP@ Q@ 0S1S00#S0S S Q O-0BMMHtQ!t3 xؐ'x P`0 pW' 0 ZP@P U{[x[0[P_8PH <0 0 4 30BލЍlC B O-T!P1 AM0 @ MT0406 0Y3:0px0(S`: 0 T#T4"4X8%X#8U!U@T *[ '[ 0 xP PU p 0 YZPL @0 0 4 30Aލ Ѝ0x0(SXB HA O-M Mtp /X0? 00060~ [ !R & R4 ` 0  0 ?x@X@0  p 0t  0 H   R: R20uo @P【 pR >P p ᰐMP R!Rs )P PZ@ 0S 00 0[ puo@PPP0S@ 0Sʰ00 9 S  R-<0 d008,0[g040Xv?D0 0@0\4 ` 0S1S @ 300S S00T01@ 021QU[0H0St0(0p0<0400SyATv @0CPu D0PPPxs 0;b<@( ᅟP m @j0P eP > @0 40@ 040D00D0 0S \ R ) H0S 80S F<00p  R  H RY ꐋ*000ppt`|@0 0 @5/P|<+,; 0 6 30Wݍ Ѝ00S0 Q 4@PD0Px !~D0P0 y  0 : X0x PD0q4000SB0T0C@0`S\0c  Խ`@pV  `G00`P?60 0$` ,90>P090Z?L000 0,000F00009}PP- U;(0 0R0K `1  0 h9L0X0 80Z80   /080>$ 00 0 SKb0!刀?A9c!@00}P a0S ] @Z0P j-0X , 8080PH Q!  (< 0 0 P_R`1  0 7P0X0 800 00   1 01 080<`(0 0|P& 0I PT `1 q 0 60X0^ 80^000 M 00d6T PL0&0@@ 0 X߀@Q1 0U0pI0} M 0 0W`@vQ@  2ˆW0000QP M 0 vp01000P w 0 H5@X0M 080HP 2|P0D s @p0P iR/00  : (0d0080i<K/0d0d@X0 0WʤB 0+S .0CS:9 P60@z1@ +@)0Pi$P AQPRl `1SC 0    R 0H080n |P8R9`!!! Q5   30 @| X0X  0H R. , qW |R*`P|@p t 0@7/P0 80k h`V q0 02@X0~  0`!01 @XUMS0 \01S@ 3`0`00S S``` `P1= m`0 |P0 `08{P101<0@PD .WhP p0< (00 z<00Px00 P 㸠D-@ @ ؾ< ̽CX$عp0dԴ@0Ԯ<Э(h8ج( TP B("(R D zP#0d0 P0@@ d06SDVB `s VXpl0(H0"( D0 P TP B("(R D zP0d0@0P %h| 0d0S_(0 0RV 0`1 u 0 10XP 0)X0   ib g$ 00d@~0 42 X@d0rZ0   F PD pH0Se=00^g0 d0~e0|p x G0("(0R D0 P T B("(R D  R,#zPʅax0A P 2@0 0{P`P "1011S1 9000 4(0X0 %<0d0(d000 X4h@X@" 0c~Z0   0 4 X0l00`d0+S .0CSP@0P 2g$X 0070' (0d00d0@0Ps g 0`0d0``0x  _s05 @X}f&00 d}w P0@n fX&X00X d}a/ /MM  00   ( R1#0e(6,Ѝ0/ɚ;M- 00S  R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@zP$Ѝ0 !zP0͡"c1010$Ѝ00@-$MP@yP$Ѝ0 zP0͡"c1010$Ѝ0MM {2aЍ{/M- $ <{LaЍ{/MbO-<#83 0CMM0,401S03Xd0P@,p 0$P0000 0 )| 0p v P<QP0\400Q PJ0T0= !8 S000 $0<o \40 ;0 P 0000 ; PP_ P0. T l10,430RCލЍS! S 0S0Q7 Q1 Q+ S     `   4.48#804"4 $,$8(#8"(d|{SSSȘ$' pt$@ @X% 0\C-PT AMM 04@`p$ R6 U{!0 @ `z P-8ĝ0  0 0 4 30"AލЍR PP 0@ .Rd @ @L zD {QSe# ԧ # , O-!1 AM⠑0M  0 40PxpPLpA@PF {PPB @ t+0H<P7 0S4 `  0S+ 00@ p0P00@S 0S0S 00@ K@ @ b @d `@ ,0 0 4 30AލЍ," " h O-p#3 0CMM`0,40PX\$@@R0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00000 00P00S !  @D DR0$0 0s< #R80 tP0 1 00S|z0000   Rl@00S}0000 q 0s0S0S QvQT  O-p0\M3@0`PiT V   U @  4 400#à #4:W 0 P 0FSX0 0 F 0PP0x 'xQQ0SUPPⴠm   B RX00 0 BPP QQQ PHQUT7H!0J 0   y0 `F 0S0   iQ eQ fQ0 ]Q0S   <PHUT0XU `$0@ P\Ѝ<P0\ЍPHUT DDC-@0 M(p`P0@D T@B)Q0X Q0 & Q Q @4"40(4"< U @DT R0  Ѝ\xLL$0 P- Ѝ,@؝G- p崒Ḃ@P`. F0S@`>0WV!: P@P,@ 0G`D?o2V0S ?V0*G `DP0?U0S XHH$0 P,,0 P`ꘜA\=(0`( "4`43Z1S//0O- M䑐P 0S2 s샟p @$` S S0  P$  <P- XPC  tP-0V _0  SR 0  SRS Ѝ d1 0P0d1 ,w 0P Hw |P vP060 0P dw `P  ZP090 |w000wt0:0 @P :P090090x *P010{  !P020r  B0P0Yi @A?P1?# ^ 02Z E0P0YQ @)?P1?# ^ 0(3B P< @ KP0102 M P010)개0@-@HMtxth { - |#0 %   { 0 0x8sxHЍp@-MAT ot P00{ ``u00 0nt 0 0gЍp@@d 0@- A0|MT0t00& ?t0p`0# P0G : :@ 80 0 t0 30|Ѝ@@ٓ h A-@Pr1 0!1n0SuOPpp rp0PSp@-@QU x3s|p ^01P ^01000prctVxrP //ပP /W/XA-pP@>WP``UW@0S1 S P  P;O-_M M0+0; 0@P0507N0YU: 0W[`p+,= d!0  d!5. 0`1q1110R\PP  ʟ0ʏ  ~Wό d10 d1 Y]P( `P ]`0SH _DPP p\ S S00 PpP0S SR#3:0 0CQS0 0CQS0000088vP ~?0}o80 0p+06P 1#S;S 0(S$ 0t(Sq 0h(S@ 0\(S 0P(S0 @8R00sS1 S S(0 n/ 7R1 S S0S00 S S SS@@ `0 \_A_t00P@0Q"0A'A+S? P7R1 S S 00R00S 0P0 S S00  e@@ R R| p5 @ @@@@@  @ uO g?8  7*0G jPb4P R^P 0g4P 0R@m^:@J0d!S 0 0 2d1pN Qp @|[1 |erp x0ό`0S W`0`SHPDHp .Sp0SWP`.RpGWV 00TPP /O0$00x4 0 5 30_ލ Ѝ4 Rq W W Zt$t k?$00  (,`k` V V` VV00;V0SJ`V 4 @0p ;V  00@`V  PP 0 0P 8 Q$h!P ``V;V \#0 00@`V;V  0 0P 8 Zl`(,`z 2R1 S S0So00 S S SS@@d `P 0[ _AH P@`0DPS \ S S00 QP0S R:0 SQ 0 SQ0000025}_oP.iP `}[!0x3!|3p\aDP` DQ }o|sQ(z`, UP 8 Qh!- ;pPB-4j`P@8pY2  K Pꘐ8 ( \t domasearnamesortoptioninerPH listch\!p@- 1hP@lHMP ^ T 000HЍpp Qx#r cpV p `0!0x= 0p M9p  u p\TmpP/ 0. S 00KL `Xp plDXlH0~TD}D}\|\|L8 xdH$ @Pz4z41O-0 MX B*1a001Q0,`P0 ^/^_?+~ 0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝ,,0, 0(@- nk (A-@@`V 0 CQPqTP pG XP|TP 00` 4@-@00 R \\  !$00D0 0@ ($ Td@-@PL  0S  T0S@gUeU@bUP/0d 00 0Q,0/01P/0(00$ 0/Dp@-@P&`L  0PS(  1T  0 $000`pp@-`0PR@P  PRP 00p C+} A- 0@S  P p00   ($ 8PP(p`P0+O- ,0ĻS 4Mt 0 +嬫   /+~ ` Px+ @0d{d[pP^/^_ @   Z@ }@Q0 :Q , @T  :R^@Z :0 Z:P00<0` 0 `@ P 00 H4  S   !d$R; PSu00Q0,090( RC 900 RB ) 0S  !R 0 0($ jIk@(p` 0!\90 4 R B<ɟ  B QR 90 `0 PM( ( ( X 0 80P `I UV4Ѝ8 0`P P l8@p0 00  H( 00Du0DS:$8B0`800H@004  P`0 00H 0C 0 1 ,Pp$p($p,(\y*ppQq(pW pA$pW P$G@Y@`A$ppW0@  ^(0 1,P1 @P(@ @(`P, P  ~RP P  BR \`A$Ng0@(`P, 0 P1#S0 0 PPp`@(( 墚( p Pr $0 0@SA  1@`p $P  pW+00^0040$p ^P;  0 @000`P000$4000C?00s( $0Q$0( 0P A ,P$ppT (0$0 1000@`p $P1(P$@ k@` p$0 PW$000\KW 30$1,k, ]0, $@(P020@ (kP N R-JP( 01 (0jPP$ 0 (P1$@;0 (P$@$$)QOSJKF 0ppP10<0S  p|! ^O0}ς00P +.000P4! /(1:Q0@ Q10 `{@ @0`.VP ||x|t| {{H4  D(yP,(vhXrDr0rrqq8q@-@P  0Q ^   00$0000 0@ ($ 4p@-l@@`VpPPp0U1pPE1PSp  (0$ 0pQA-pA@PT`QV0 O@P  0 pPP``p`"@ YanA-p`@NPP T  0 000P    B _>$nn@-@@0/P 00(/$000/004/00/00/ 00(/000/008/008/A-``PU 0AP p\pM0APP<0< 0 ,(0l( iNOP/@@ <0 -b M00a.S ЍPl @-@P 0`00@050 v r@-@Q m00 2 d 0 G-PdsM@p 0 p T 0S00{000 00 000 0$00-{PP 0` 2# "Z &= " 28 )0 000 0qp| X X 00@ۤ dj <R 2"00@ˤZ 2: 2( fP0 0] 2< 21!001 001 0 01001001 00PP 0 R00   0T 0 2 13/p ЍTh00-0,PP ` 02 2y00@Z@P0S~X 2: 2l བPy 2 @0 2@001400 48,nC-`@ MpPP  k000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH nP (0 $( p 2 P7 ЍP Ѝ(00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR n@-`@ MpPP  00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ  Ѝ00P2!O-RPM4: 000 X'*q`I`[ p@ p W  ? 0 PtZ 2< 2ЍЍЍMP 21O-MrX<*0`0A̱PpP W [K @DMP$ @̡100DS 0 Y 2< 2Ѝ10@D @ 0 Pu YЍЍ2!C-R` M.:rBW R * U"R  R00U00SR 0 { PpXB Ѝ 2< 2 ЍMP21 ЍG-Z RbMp* U0U @ RD0 E P XЍ@ 2< 2ЍЍG-@ap0LPP FPx1加Z1X%81ʠa%X @C !QA! @ 0S001Q@10CS㣐3* 8#8 0 BR ("(R B("(  0V8#80R!2 B0C!20pT00 (E<00 (>$bP0h t6eelep@- @ZP ` ~PP "p Pp@-`P@0S  00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-@P4M0`S  00 Vv 2+ RJ 13/p* 0 00" "00  0$04 p`0 9/P 9/P a0  ^ 4Ѝp$  0Tqp 0 P 2: 24Ѝ?(0p0`,0 09/P @PA 0]AQ㡰2* !0  R P  8!#8S!Y Y Y0!00C0 0!00 0b0 $Y`~`0E 1P 0UY0 00C00iQZ`F@@`<_G-p `0@PR!@DH$H`0 8#80T@:@DH$HR8#8p@00T`:P0D0@\0m0 ) @s D0  {X0 $^^]G-@P@ `RHZp> 0ഐS0FI S)0 0 B 0V F B 0D 0\ Ƞ.,Ƞ0P0000 0@ @@T*80`F0C@J`80000 Y ,)Gd0t d\G-`M( yPXPpL P;S<03%R @@~zz0 L l3< 02Hp P4,0SJ 1 R ,  0#, ##$\A A0AW@S00X0;(0H8#80ᴀЍP007LS <0 PF,0S0S !Q #$ 000#$ P0A 0S"S8#8 C( 0"( 00 ! Xp0h @0@{@0@@@0  0O00ZY61Sp@-@M PGaP8 0P,0000P8ЍpIЍp/G-P4"M,2M 0` p0 002Wpx @^ 1 R2Y< *5S0@[ZZ 0/, L. l3.<  0LGpF WP`!P1 0  0 30I؍ЍU9 0`J8  8000S   "4<Ġ"< ̌Q0Z0 "Q Cx-p_@0Y@0OO00~  VO-P  `G@P H1嫲p0q1  J08 10000N`ⴜA40O-Sp M@`0S0040000 PD $ 0B;110C0 X0M ^ Q 0 Q @0 SX!B! 0PR|   R 0S  "  0!2#$ S C$ U@  UX SRRS5X%XpUk 0 Pc 000@@℠0ᄐ000ಀXcH0PIᲀ0@ ЍXD  $ U D ] RP1 PD D00CD0 0 10CRV  B Q" 8#8ᅅ0X%XP!@ 0C 0$ 10C0S  "0e Q 0S 0^JPM Ѝ1 \;000,/ r@0B YPUڤ0S 녅0P!D PD 8#8LPU PHD充ADpR@RQQdQO-M@P`pV 3Q3⼀ X j*^)PP @`V ᆰQ0  V\Q  X 0 PPЍ0S `0@ 00S#@P 0S 00 000S[ 0P00080080ЍO薗 #0008(8s40PЍ0KⱰ Z 0 0/ K0 +ᰰ0  p [4:K0 +尰 e   `` 0 X0:0 H0ಀ00ര dd>I/.0DD>I/$,,I/D0 R0 P  0 0(!S$! 10$1\0 P 0 㼐ᲀ@p 0@p 0 S स10@Rx ἐӗ'xP $10 $1(!w00O- @1T@0 p0CS0 M@DP`!P tB ;AP' 0 0 cP 8#8R0 V Ѝ0 0S0㇗P 0 0P,000@- M@ Pp10 Ѝ0O-@Mp 00 pH`pb ]  PPM0STD0Z 00 @@  0 pWM0 @ pGW 0G*0@p 0@000S  p0C8p#8W㲀Ḱ07*0p00ᴀPP D0ZPPЍ0 P0 ,x0 ,0 pLLp0 ,44p0 ,09ft9D9}$9G-`"2 00M0,00w?0 @Rpq2SP:0JSM P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00CK1!0C8# ∀! #(@: 2 0 24!,1 0 ,0 30B0Ѝ 8P1 ZP崀 Z (0 p哩P202 ᖶp   0  ` $0} 5p $0b0 $v\  @7A-p@MPP`  00 2   Q Y:1Q|0" B^1"0001 0 VA00PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E0 EP VP V$P 2: 2 07ЍX00Ѝ0PU Q:(0 $P0PU`P>P  j?P 21 z?@\6@--0M  Tl lP 0PS @T000S 3/ T0V 8 80 $0Q/$$0S/@I d lX4<<0 0R/( 0S/H  t4A-@T 0S1hp`/XP0P@QD 0 <XP0 A/PꈻD&O-@$Mp-jAT$Hpp4pD0q$4SO 0! 0 05TpC,BP b0@S3S103 633 $$3 $ $3  3 $$3 $|3 ($l3 $,$dIH3 $%D @MX$Ѝ $40$0($0,$0$0 3S000`V" VP  2RC=XPP2&Cm5 p000Sh%P`R0 p0 00CS0z \ p` RF(4S VZ  4S8 0V$0R0S  W6@) 0@ )5000`006@FU0`00 چ 4S ! DW6@ 4S $gp ` V V ,4S ^gp Igp4S VMgp -gp `000 ^gp V@?0`gj1&&ٿ -8&&&&ֿO-@Mph`hTP? @@004#434Dp: RPGP P gf0@ 3 hP>  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y いPPXPPqT! bi`P "  jPP* ᖵP0SQ t]YhqPPSp@`< L%,1 B R 0S ¶V X h 0S X  R 7/P  R 3$ ? |j$ ? \bYS%G -& ?R.ROHO-yMPh>Hx0`00 00( Ep8`K[( 0RJ S| 00 0 `ȃvPePRPGP0if0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0S%RK,0,R4*R q' P M6pP/W  0 1v0S Rp0S &0S0@0@P0P/S R 0: S00! [sRq0: S 00000#/W00S %0S0(00S00JpW   0P0M l50 0"90P @/P05,%0CS0$ `> > : `pPPb0S ݂0Ss 00   B R\ L` V, `Q' /0 L 0P0 P@`h 0P` J/R  S/R/  # C  R:  ` 2 3 0S S/R$ 0hSR& R0sX/ HL!R\0X\!R\ 0X00: S  C C `Q0: S P1: S  : S!  Sp  Sh e Sa S L0S !2gPL,0SJ ! $TE0(尥 0Z tZ80 S800 dQ xQPP1: S 00Z0S 80`!0CS!80 TT0 @ePR X0tP 30S !(g0S !g嶲_Q[ (0S0S 0 0 HQp!㾁&e&v% %8&<C`&6N?b#O-P@e\~<L&Cp@<6gXP\`0O ( G(0, PU`00 XP\`> ;O&'&' L'L'S'\ ` 'kx\O-MMc:rXGw' Ap 0 Q 0  xH0(0h7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S XtPU R8nR oRP0<0,`P  7P8[`P, PPP{ QNRN , 05 PvaPhp4 1SzH0S?80S<@0S9 P0SP vP4PD0S 0$Q, + ⢳ P44X(D`尠pXV 0PU 0040D0S hލЍS ,0SX s P㨠=`0@0S0H0S 0  FkP P 3R㓵(F  SP3m W` J0Z ŤP t3  dI7P \T H0`F40P -NPP jPPT0Sr.0: SjPPP4 01!HP4L  0R p 000P T0SH R 0 T0SP pjP4T0S 0 3YX 8SU # WpVJ  f."  ."  $."  (,." 04   8<   @D   HL  3]P )  gP40SP8`' -Y:_o&&i B@-04e,UO(u@P00000Sr0C?o21 ?p0 1000C00S9 000-S4 0R2)0pP EP SP l h$P$MsP xPqDH84 4"4 "4 "3 !00000C0q'P&~{_@P |S!|TXcQLoPN<32S L#L0O@Zjk3 0S 000S 0wP 0nPPH000!S 0 寱0S XRd000S úP|DN@g#A1S bVqQ"o|᥺P2S 1"rO:Ua`0:EjlQ100S S S|!0`00~01?r@P8w Po @qPj @xqPg 2S 0"r r r2S`A["|QPG2Sl p0"PEP, H0"`(O0 0O`'&<& - Tbl''4L'~8&&@-P@M`/\P@L"@P3 DBDr00 ]>p= 2Q0=q E  -P W RZ R\ R3 0!BSQX KPS0: SO00 .| ->pd10 ER!JpD|wPePLP PP0 FP f0@ S00000 0 0 0 0  Q |tK fK@P0: SpGP Ӏ@0'&O-`M@_6kJqpP!=p 10a1S 00`F00PmP pP Q`P |{`.`P*5[A PDp^40Z 0KP0 0JP 00B+0 * R 0Z /0 0 U:Ip @TJZJP U:Ip!& -%'O-JM M@=_6 R`"+=p1 @DTҸ a,0S T  zJiP fP hP vP00`000 00 0`QDyJpP0: S! x PP zP 0Y/S J>00/ P$C@T 0p/SX/MP0 S:Pp` B p'&A-`@MP D^4 0t *JP  II  JP  ?I JP  5I  JP  +Ilh30d3PPP P$P( <30P+( P3( P7( P;( P?P(  PP( P ^P8$@Ѝ(P (PP"s(0S (~P(0S (tP(0S (jP(0S (`Pq0S HPk|!0S0S p Ti`PLa @1R`PU 0E /R 1P(ĺPU  @00,0/00)0 0CS0@P0$0v00S xy뵕0s00BYꯓt(&AP u(|MI&ik;'<('p@-@P]b4`LP PP `| q;ph00SVP^yP $年 0@H; < &8&&? O-MPR]h+4`F`pX&?;p D6@X/,60S ЍfP WP! PP p `RP dP vP iP00p `rPxP pp0p0p$pxq [,1@ES ᩶V8e  0P0S$0P`S 0S@ ۨpP܄ PP4T0S x @[*0/S /KP0.S0S .S0SZ< 4  0  R @ 50C SN00$S P PQ4  00$ @G4 0|x0S $ ?RR00R0SV1 $ 14  0SX  AP  0!0 0C0~ +GP 0S' %(0S 5S 0S 0SGP0 0] 0 0XX  PQuF0SJfP D0S 0S= 0?S9 0SGS 3 S 00PU G$0P S`0S;H'0: S R 4  S /o" R 0: S!FP0S ) ᤹P SF 0S?G P 50S 10?S -0Sw u( &F  !    * G-P@[4}2`p$!9p 1 R1 0C@pP  GpP vP0p`պHFPE'p0S VP /P 0S 0S *FP4''p0S \ ] &v(` 0@-TM O 70 $ 9EEPE@FU0tF0T0D00 0QETP00ȡC1➴3P XP 30S S S" 30S!  R h#6 R P#!SRL3F,3 ! ,3 003 3 3 20S! (2 20S 0S(002PU%B;@ 0P@pB00CS00  0 4 0S60016 R0S 10S<wh0PT<001 10SQ 10SM(rp1\1PNL10S H10S \1 P1 t0S  160S ([@1 F01 (5  p0S0F0S 00Vp0SE0S 00ItP@@ To9|(&v(4w((Hw(w(v(&&b((&|v(FhC-PM Z0b2@@@0 S cp %W"7pC 0 L1 0嵳Pl7h EPT%Px ~EP<%88 vEP$%T7 0DS 00S8 0xL@"Q0D0@0 0Q%@0SV L PQu!a0@S0@qCP du@@L\ P P O!P 0@0 00 [@L_.Lk.0@0 00 0 PLO$D0S lx DPX%%D/F&&3F9F?FBt @IFht@TFt@_F&FE -0FjFpFgtF@-AY)CDO-Mp8Y00놾@ dP@@@@0o0C?o203#r4p3 X XT 0S9 ZP7 [PP3 tRPGPP )$l3H@ PPhP dP fP00vP00 3@00P00Pk 1 0T0㠢 00B R; :qP" @"$ A0S #S(h# 00 0 㤤PP4 04#pϥ@P/0Sx '. P ᥇ pᝇp# Dp wt0S<0 0@00tmt5h!0C S?00S $ p0p 0 R qX  Pp P    3/P00 S  $$ p/ |}p[p000S z~CVG(&WG&`GF -GG(GGFG?GO-M M`p'btI^^  b50 0 5/b5005a$900 sP # nP ዸP#Q sA0@6S0Y S~(5pQl Q` 04(TȟS SS @s05505 00505057 DP  >Pp# 7#꘷ gp0"S tssP Up 0"S ( Dpּ0"S P 06spP$0z05000001 00 00g0e0c ^D ^  ^ QS00 00055UU ) BY5S50`FV%R" 2) 0%0;%fpPx%5S 0BP80: S055@%0IS00YV05&V)R܄$0P0 H?Dp"P \s`PP  *Ad$iB.%h/9t50000 00@A@P#2 @1A@-ABAFS0 E@PC  0SE   qpPB-0#S n@F="A QT0D?o2? [@ PU D@P!"f/}=&PsU )PPAgBD唭00CS0  tP Pp PNU0 P00CS0<s0 V)0S:00S:0,0V51 )1S'1S X#$PdPh!iB-%l|>/V`DP 8e%P -)P0V0 (Pq0`FVzP@rP  f/8 T  *x#P(WWTVGW:XXXvXX -HHWWXX&&((HXXWM(XWX&8&md2VY0(P@-/0 P `P@@pSC p!3`00CS`0T oD@T ЍX0 X @ 3(r&r8&O-dM@` $t| P 04 $0?30p+$p@DTlUU!Z %rUdU t0B?0p`$ y dUQ 'RU2 SU> QU040, ( qtPcPSP PP(3d @" nP tP0 aPP pU] [1lUT 3  $oh$ @pX dЍ $a8$ u@p3!p 8S8 g@p2/( 8 8BY  H<T@D'PPp` p`TE`8 <@pPP<"X0B!v 10!L "X 0  1 P Q !WpR0P0UpTK 0S@d4B`1B)!p08_08 p0PU 8 g" P P P0ZS  2)`V  x tB0P```Q -t&tu~DtD{Dt|D( uu}Dnuuutuu&yaratcidO-0-O堯堏aM`p22242222322$ `/1pjL?"42`FS 20000b2_S R2SVV10 dbV%L0 ``*p L&pP L0 ``*ppd2S P?PX0: S0d2232d2o``Sn}0 =bPpn0S f  zPRP3P/Pz3S@'Px=1@P A@PT=P00j000]0 ,2",00SP (o<P0d2M042J02G02D02A02>\@ @@Taߍ02.202*02(PX0: S:  PP (/2P ), ( 0Pon]<PP :U<=>p X:{\10  [ *c<[ d !14\)ST l<̲03T8  803M8 8 P 0@B R[ 2SX 2S 0sT] +<pd2SL =plV X!\1 H?\1X! 0 \Q102T7,2P7c|`(q&{Ջu/{1P ⋟팃`0`p0"Z0,00!0`,"P0? 0,! 0 `0("-D0(M/ES1P s$ 0   072S3 bV02@t.@2S61P# Y=넂 0 0 0d?0@H!1P D2!` V!0Tp2<<23Sa 12AS``b2S 98$)0 0PO 33?4I c0 g2 @T' @ET0 @@    RT 0 S`0 {60s r `Vm <T <"20"03P`23PL,  L&Ɍ,! ((O2+JO-M E M-0P 00P`00PPP@ 0$ ,؄p0040pV4$< ލ ЍyPcP PP! TP' \4S T=:H$d0@S0000000  +0 000003Q30S : pPUj00X 9 P90SH8S )R Q$nQoQ 0)#0HPPq "9002"@xǮP' ®P" ὮP  jU.; P1]p@.D F8"89PB(8$RS;00  9ZpWD ` jV/P `P1Z N;Zad@P*d[?o20S@ !d `@T jV`P8j/iP( Q9p. 7Ϭ(>04P`CQښ. . a0C2,S!R. !$RU>"0vip(X&ȺJ&@( -(:h&|ex([^ܞ(zd@@(ΞٞedA,RG-pᬁQ@`!V+p$Vㄑ 0S 0S l`d10pWA OP @J0S (DpW%ZЍyPmPPP fP = n0@ S000000000000000`LJV 0 zKPPY=PU=P )7X -(OX&4qO-MD4D$` r8P! 7DP6p000PPP#*p4W00S 0S 0S Pp3 a X( 0S00P l㷱0S X㱱P㮱WPY430S ЍzPOPBP FPL [a"P0@*S002 &P2  P20꜒"00 0bAa A:00P2` P00 D P00 , 0 c%aPx s000o00l00i!0 m a1 P :1h100000P000L00I`!000D000@1p=0000070003P10Sv]WPvU 0 ᣋPy!`IFv`Z 6`Z<(t8(&X @(v -EHvy&(#3O-@Mp@@K ,[P6WpG102EvPlP+HP1 TPH 7 p0` 0& D D0Z`   Oqp` 0S  mg 5m@ Pက$ j)p R 0S00S!0  4 0040Q 00P0Sd  , X 0HPHFK00-S 00@0`( 0P@.`PЍ@}0 <0k$P@ᘰ000 R0Sk3<0 @ t#  lG B R. 0<0@ 0R T 0 00S00 fR R@uDK0T$0o R" 0:E%KU0<0 iR BR0<0 BR0<00ST  R\" :J%FZ R  :O%A_$U@*DP Q@:IP0.,@㘟p $0S$ @ 0 200S0Q@$0S0S (00(0@`4P@ `$`(`$0S (,$TUT[D$0 1ă00S00g?;;0 4;$#(Ć,40 3/p V p`T n@#>&J^&&0?? -dy3H &@-44,$0$00 Ѝd &($O-@M -P`,@6`F8 01T`p8^ @`p8 4[p (e 6 R 0ᙌ,0P T4p80P\806pH X7tEUh5uuIH吅Bh@%'p0)L5O005SO 15. , 0(0,00(00 0  EP PP$VBAeGzS `SNS7 AS( CSt 0ɼ0pRdaC QWS@4$  㹣$ 4RD +K L J sO 05N 3 W WpM H $0%s0!0 0  ㋣$0S@ LeI 3Wpph zS dkSLS` #m0C S[00rTrRXmGPH0SI0SO005SO L7PK ( =pp (0S 0C !P '@P4 L@p``Ip/<6P 24 P!< 0S!0L BB@3/ 0x@ Pd `P -'4D P414+ C HR # 0 p0U PP 0"0C" B @ 00 p0 y &((h &v4P &4x( &4 &&4 & &8, -4 &4R,8 &44285*X5..R-i5iui m@-^P 9d&@@D(0@-HH@<<,0400# Ѝ(&(p(\@-HH@<<,0400  Ѝ@&(( @-t@t h0(,ݻ (0Hڻ8@ջ@040Ի08ۻЍ@(& G-`M2P\P2P1 np* P2`2@PP2H@R0 0K0P @O⦀ \3 H p HQ t2P k a@1  p00 @ p0| @l ~080<0@0D00 0000P0 0 80$@0P  8\1 HL@P@T@X@\@HP峬 H㯬1}1{1 0400,0( ,00@@0PLpPPUPT0PP 0/`ЍiXXXWXRXXXT&\.,,,,L(O-\FMX6`pP(` 08& %p$6U K V0Sp@`@0VoP 0SЍuPfPFP RPZ 5g@PP0P 0 hb0#S P` $$00S`  $$00S`GP b0#S (uP $$0(0S x $$0(0S|00y0P .P\4q W4q R4 4` @s0KSq01CP1 @Q 0cR pR bRJ IbJK[g0Y`[J0^00I?o20P00 U.Ux U,P 8 8 0,3/8 RPSX F@00S_ w0P| R00C?o20SV\ _ꇫ0 $00,0$00S 0U00S 0 o0S0P000010SW1 0S 0兦0 P 0 0 Q0s  h1000T,0 008B1P0S& SR 0@0@0 #  R S '0P(0s  0pc 10S / 0[0 -2`Z&T(XZZ0ZJZlZoZZZZZ&ZZO-@'M⸆V M`$@@@& \#됦p/6p0PKlU00S0C 0 1U0 U!qNPPy YDpP㬀H= P/p`*0S   eAP* a@P5P00@50S $@Y haXu@000@0000p ឥP ᙥP ᔥP4 P/ P*pᄥP P( `}p qMPXq/`00 000#0 00$000 PPZ`P'ݍ Ѝ( uP(@TPY hu1 PLP(!hEP( ][P`P p8$0 0PP(`p` qJMP 00 00$00 0PPZP ZPZP ZP PdP TP DP!@jP0PZ P( ]Pp` P( +⨔ /➧Pm``?V":r0 0%.p` h!h/P2.0SH0 0 000$00 00P0@(p /p..0Pa0SJ(S'- 29S!S1X/0S (OW`P@\p_\`(_[&|`[ -_\\`p_2``[`p(zd@ (edA p@-P@Cfp@-P@C'p@-P@C@-*p@-P@C p@-P@CXpp@-P@|CpO-nM M0㐎800`4PᾨsP 0d~0 P PPL 0@~S$0Gp000((>$00 000 A!p@9=> 0S=D$R$r R  $}Bt $JX<$.m`|0A: @ x0<$0p(0J-p P" <4 4*88 0.`PEB@D4T@@0 0<@ᡣP< $ᘣP  < p< $$r $xL ၣP8< $0 00 T 0 =}0L0(0 0,;0@m ^; ;$d00 0 0 d;V0|0!0 0 ,; H0D0(0 \ 0*:$:0 0!0 ( 0 :(,00!0 0 :,00(0 0 sL:0h:@8:0S b P00t: 000`  "!00 8 0 N:00!0  0 @:00!0 0 2H940`0c 0 0 $(: 0(0!0 h 0 888Ȩ@0S C.00 OJP]@JᏢP0@4 ሢP@ 0 =]\8Ĩ@yPD40 qPD40D4y  H 0P$0n L800 1 01 8C]7@<P00U7 000  sHH7G: P9P/ 4P s]0S 0T4000-00* PEU UY~ V♥ ╥0. P`S 4S<4Y1 H4L$0 V,pk?HL4P80S $E~G?9GHtLW0.= 0 $?*p5WLHt,4SH$L4R0 & 3+pP # V,p  4S@  IpP = \  PP%;P PPPl%l\V,p (:: S@%D/ $R(*@P% 4cTpP$ e k0HP 0(0pWZc>$R $0@0ip!$Tk = (,0KP,0 r04 OP JP $<03m`Tk 40S0X44S.=0@+$R)SR- (8 # *~%bP0T40SP \#00ST4S`31 P H3 50c (8p""ŸR H$L4P*`4\p0p L4H/0#! 06]p<2 C  #\ 0- ;zp~` z W0P0< "  A!L4HqϠ0#4S 0-?W p0$$4RT SQ  W  0)0px pWS  !S0$Q\ +S0$0 Q$ Qg*c(ʂ"2&ʅ -'*&-lpw˃փ&-?\lyP&܄(/_&݅( DW\(lΆKׇ o@& .-HL$ P,} P+P *+0$PsS0] 4S$iP 44娀S04144 0S @4S 0 $L0@4,4S $4R#1ѣ1,40000 $08Uu a)t ])0S +Ȉp@& PQ' 0 d|,;]P`E}J+ yP9+-XQ :$43041$4+GT4S, * d0|j,)))))\4$8: H4l<$4: x00@ 0+)pO|zP Z +hPoP  <"p  T<  l$+-00 *O-MIi M0p4,( pP_8`4pGs04WZ h⻢  ⷢYaB 4S<44S $$4R0d`((pT  h*p<  4 SP,0S x$0T t$W0 0O $0HpW$ t1SF $$4P?*`*ZZU CU p7DPEUPPbPEUUPP6 ( '8#80( R&0C Rn ("(Y044s04b00 0 0 G6T0HV0(0 p0,90@E L00 0 0 0'500*0 +0 )00*0 +000!0  000c 0 0 D500!0 P 0,00 1 $1 40(40SuY00;h$ L0P0H$jYh )p 4S 'PP$t$P`P#\ T (@PD4(0(00`V Z<000 /p"#7$p = 0םP0 r04 ۝P ֝P$#0Y3}p$p4S804Sp 1S !1B0"L 0S O-GM MP`h ^0t@,$$p40PEPEUq(@@5P3D04030033(3 p00,p0T3000D30804@3@# (3 @ 3 D2 H2"20L02"d2p"Dp2P"{$T2 p00V02 Wi2 p00X1!W1 `Op0x0p0d1 &p㸐%  >qpڠ0 S ֠ D 0Z BW0SĠ0SPT0 eA/P 0$ 0 0 @x(xF@P W dGލ Ѝ΢h& -elxȤԤ.?ZO-` -M@p L`K@m&TUPV b&P4%p`%%pP `:@@4$ pI 0{0@{{SH{{S _%P{{ZW%P<;SP%Pݻ Q[ $<Z<  AG8 ({:S[d(;t X30P2pGS<+10X2#(30S" C@4P 09 0$3 PoP 3P  Q R _V 0;8;08; 00l2H2P[0"2 P R  (x{ l+S6V42 P3P 2 R / < X 0< 0: 0 V@0 010@;F 0@0 00 008;0t1 PP \1 R /@ 1P& 00z 00w 09t1 PP 0 PR` x0 PP 0 R @RD xh?{Gz?eA`RMb@A 7Q*vݷ&>`yҶ*.1* -4, * *-&*|*۸** * ** *r&\ h *K 0; 000  0 0 000 0P} 0 P R  Xp<00 ,Dd IP 0: 0 l>t|1!.8@ Z12@TȌp Ťpp ňppz Pt  .U 0@ 1@  0@TdPf 0C Sc0400000,00(00$00 0000000000 000000 000b 0pRA @@&̂WB &r8;  00L0 3$p8; 00L0 %$pP8; 004L0 $p8; 00lL0 $p pC  |0 x; D0 y;z+&0;0; ; '0cy;0z;(0x;+8@ppL0 #Pl;"0#10@00 0`K`QH D `   `0 #PnK0S ``K0 #P(a 0  00D5 #PTTd r'0d h&``p5x%p#P5%`#=`!2(1kkkk,a0a4aU0 0P````{$W<;SVd#>˟@ QXzL{ k A::۟SP#@ ?XVz{ k A9I:`"2Rgd@' { `30S 0 j' L N@^IN2 X0引!pV00 @+L0@W0 00Dh%@X2 ppW S p,2 "PK,"0:CS0K"`ojL1堋CA{8ZA {'NjGh@8țINT{ X({*!PU7 ۜ0S3 <e0T0xpT00p0p+t^!P Ɯ0S 城"t;<000[ X0 0 |Y& %d2"SS$ 0 ! $@-C6?8~A@@ *<*8&E**O*͹ҹ&۹&0 *< `H1 PS, 2R`2p0C(4"<8#8W`0`d0 0 0 d20 "  |  `V`0l0hd?ph{3{7@{{{{{ {  M 4'4#0à3@0h2 0h22d0@#Xp |%0H $#$<0(0"(0@02 0BS; (SC; = 0;c$p@0S:0#h2!(0H0C8C8S!* 0 0H 8(#8 "(E$ 0 @1币  hךh≚;    0;&$ 0W|i%0H $#$<0(00"(@0+p0V 0 1 J#xP<0[@W |0 0RZW|5%0H $#$<0(00"(@0| 0 0D hH#p0WpD#<#p0 *&{+V*8&|*$4 'He$ 0CS00 P \0Q00p# x|0#!#0ꋟp@0|xt0 FPZ T0 =PQ 03Q0P# C#0 P3 0$#$0(#"(!/#0  P %#0 Pl 0 P Q Q 40r,p0 P  t0 P 0 P 0 P 0 P 0 Pl 0 P H0 P $" 05 10Sl ES` S W|#0H $#$<0(00"(@0p"Hϻ&7Pj|D,μA\tݽ /AVi{T*SIZ0KWI7La"DDD0J0ZD0 I0) 0K J0KO  QJY0KWD01ʸ+Y XvP WD0 -"D0J C 4 ḛ˜WT"pDDD0I0YD0 0J #1 KJ" W!O-M`Pr0@-S@ἔP-3 @ Уp#p*30SP a`F0P[:3PQ9 KJP9  H O8剔P@3 C d0@S L@p20SK@HGG 0 0  X dOY'G`P;fP`8b2 R d  } 0 S X  S U+ 0 i ! !000 W^xurol izp40 ppƘ0S{W3{` ^p0S몘PM 00p@@  0O Vhf{`|+$&/-29FXϾkO-PAM MB@`|6VPv&0P000-S' @&P  0P0Np0@I0\[00[`F00S@DDA@D`u%p ,0S@bLP53 Q  ͑P -00 _`@[-00  D0B5S0 u00S jNPeN0 0꼄F4P ^N0000x44 0S hDN P4  00 8 P   .300S Pm0$0h0(0e0,0b#t0Cp ?o2R0S0$0"PtPXx@Da0@ T03@00`FrS= RS iS1 utS xS}'묢Բ +880p 0@00@00S  0_Y 0S pQlwJ8< Q (0 B b/S CD\Z(0S Q 0`.WB0S (0S |;10 0\{S @,*(0S (" 0`  pP+ 0 pPUU + -8P@+r&& &tG&<"%8&btt3!PO-LM'8N8nP0.p>,# PER a0: #@@0SCLvPcPSP TP LP Sd0@S00D003030800H00 30$30(30,30<00",0@0)@0,0p qW3S()P @ P< P/P LЍO3S 00p,04 8<@ 0RWS[0ZSPQtD! 100gS @L{ EY0`,  aR @L0Z S 2L0-S}0 @ 3R: "00: ` P00 |:00 h:43043{0830<3@30@3ppzzyyx||{U,0 [U ,0 U ,0 U ,0 U ,0 ;0 0U ,0 .L00L0U ,6U S SX0X0(0CS0 P0D#8 D#<#  P Q0P0083 r00b0X0(X0 X 0X@0X0X00,0  ,0 =DPPdH0S7 009@PH0SX'B0-,0 SSX 43Spᮔ0P婔/\aUF cU2 gU0BP㛔03S_0Sa 00gS# H0S |&Z 0  `d0Sa T pWpUpWX 0S00# ,04~8|<z@xDvULЍ0000H3P0P xH30娐POD30& 4 004 SSCP 0C00 ,0  4    0R:400,R0T ,0 R B    0%z< Q $0Q P0 00 R B    0 z< Q $0Q P0 40 R B    0y< Q $0Q P0 80 R B    0y< Q $0Qp P0 @0 R B    0y< Q $0Q^ P0  <0 R B    0y< Q $0QL P<0PESZ $3S0S vD0S]@ p9w07S s >00&c;sr<  R  d  v   |  v Ul P70S 0S 0S  Q 0   7ypqPU q{8 30(#0<  < R+&3):(&xR+R+R+R+R+R+R+pR+QPR+jshR+0S+^#1?P]|G-PXMpd-PHh  FIDP b0@SS0t80 6l(? pX80U 0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R T4&R <&R 06lShFQaHPA87=CP 名WP0S f P 0000P6T&0 T@P_P061 u(VU\vpX}70+SDp(86 000e낯<0 0/015T& P 0p00 :XP00G00XIYpᡋl5 @P 00 B00C2#S0d0P0 00 B00C2#d Pv>C 0C0U U0@0 B "00 00A 1#P10C0 00A00C 1#P 0 00A00C 1#P0 00 B 00C2#004qp 0P 0PQT3HFJZp=V w`2o`F#]P0 0SU030#:U %5$PJ+P p= \P&T6K/r0)43PvTS0 0 S6# G@`t SPEX!EK/r0PQt 0 0<6Sr46Sr 06rS 0GpRP2 016t6S 4P W0`W  0㔊P [t,6S m/X`P b{Q0 Q`"f̧'sDħ<6S46S^E`^E`@6D&SH1 0 00R8!P H&,QR(! $& R! 8&R0&PR  Q @  @ e뱐  @뫐@`X+ -&^+ |Y+pY+ .& & =mXhP^+,/825VVA-PHM`pI!p10PEU hHP h0@ S SHHIIp1彭h1X1 T1 pa@ kP (1`$ @aPP F䀟 L`$@@`(` `C QP FP0S ;PxW IP XF0 0000 f& -)& _+yt Ct G-0HMp`0u*BR"fp 2B1 pGS 1S 0$  !RS@# P+PTP<(@FxP`PAP MP !a0@S0 00 04044041P100101@30@3101101101101ДY 000 0HЍP PP  E0S   y0 G`PoGPW a W  pGW R $Sw ,0< sW p,_+&*)& -u0_+8&C-Mp`VPPEUy%p5U@U`F V/@T |>P l9P %aP tP,5 R $0%  PV 0S A@D D%P`VD  tP@PA@3PzP0S<0S000S00S00S00S00S 000#(pPU 3 `V= V30SU7 0S4000000S@0000000 0 3ܫ 0Sr<0Sm00Sh2呉P0$0:]0S 0SW`V UUQt|P dwP hrPB UB U UR<2PEUNPPUH Q [PA D U2 @U U60000  &- U+>PJo 00000  &P  T$ $$0S >& 2$ p>qp庤*bb@=T ᰤ 0"600"$0-$P @P xPdd+4 &>   -&h  O(8' $ zC-Ma M@Pp!p10S Q༑PE R ލ ЍRP fP74p(0Pd CWOJXP1 JfP/0: S2  S)J (P0 JN@n` 0J4S00``@0S phJ (PJ x(@PJ0@(d+&O-GM8MM o0'=/ <(, 8@(D P0{PLDl("-B HXLXPXTXXX\X`8d8h8p8t8x8x8x88888(8׀`P   wP:? 05Cg[K ⿀P3>0 <[ⷀ@P 'P; T(X倌[@̇0Ph+TX8\ 埀P;P  0S4;8+,(Kh8S <PU PhXJↀP@ ⥇OoB:p *:8(p P Z`T`hYPdhfd:xJ 0pP0 `*p`W,J0 P4* 0 0C 001W0܌ l>  \8T0P`>0 XP0P- S)!_0 ]P\9Tp P89 h(gP9 T(X(]X(P8 h(\40FDS008 (8 X(T(8 ,8 S8P 00S| h8l DB(8, ,, ,o8 ,k7 H(g7l 8*ff^7 L(Zg+v PS:?@ 0|7 P(H7hg fpĆP78=l7 87<(8,7 T( X(2@7 7P 00S% 7$ 6 t(6 6P 00S 6 6p l`E ev68`eF08`0 P 0S46E `V 8g5p oV+C5 ,5 L(5e00Pt5 `(d(`5 e bH5P ? |5?Qt(BVGލЍP5TL +˕D04<<~0P 0S _e L9P1@PD8SQNed4 .ePD Rnpu uS~S> ` V ~  V~ U U~ VU ~  U~W U ~q/rU= ~ UY~ ZU0atSYhPY`MYTJYLGY 0S0SA  E@288S2o@Px |b<S P 0S d dD2 kN @+Yu P:B?l |081<Sa\\+u P*Y0:]zP 0bP )E@P,"X XV!"@PX X0@`6zPP0@P`ىp@+u0(@0000pU@p,`40 U0(P<P8e,(PR00S ,R `0 ,0S Pd,8S= l,8S <3+6-56&8&28&-87 -0&K71+`7g7&i7|77-777C8H8  R8J8|+  8A-P`"$ E[hj幄P03op2S l+ P?Ur}PO p 9P/P00@˜7' sh0vP303L$p840pEWQU 4 000`P C,KtPE0S34# 3 1P㿈㼈㹈㶈pP|?`ph `\}X3P04 wH-t4S 8SsP  $y?g P 4SsRsPn l  PpR6},`p1<01 1> 11bG01/΅01$1rRPN,P# 2R CzClp`d Pa Q18C8S khq́`Hr  lQ00S s P +`P3?o20S R=?o20 P Pl Ts18C8S 0 S MS 0Rr  \r=S` 0 0000l -s18C8S q`/td0@L,FOOIO]OpO&&|OPO,OPH OO8&O$4&N04&OOLM,xM,t 8O&N@-@` PXPt1  lql!pX10SAH81P@ z 1*$q:P 5P0 nPbP 9P0P  c0@ S0VP  00@0T0 D0  40  =yz0S}WR,3SW&WW&WX6&A-`4C00P@0$ 08TsP0 0܂P00{g둚~딏s|屢ɂP000"SBP kU 0+0C0S-P*P -\p8᥂PEP P 0SP10 P10Q rU 0SPߝa%PEh10S \10Ls^DQ)}0S(1(UP#=P ^{r+Pqp 000000S7 ߑꞝPP`0S PPp00S8S,W,, XWXXXX"X+X:XtS,,QXԎ,(]&{X}Xȏ,P,X,,O-pP]!L6DBD``<"Ip(2 0 qQ upBPpGe}fuP`P GP IP EP 0  a0@S0000P @<,&2& -8&؟,O-MplvzP`<@P 8 E001"1xPlZ 0Q plA0 Ѝp-`--M p-h- -DK -- -p-@-M &M -N IO TO jO -t-M -}O --O b f b P-O Le O l--x,O-poM,e@O0  8@0 @$8pPS4 W[Y~  HpP 0  P(0: S) 0T0[0Sf Y ` ST @PH  \P y  y!PPf@Pr 4pUaUbPEUPzU" |!0 p 0 00 0@34 1 , 0y300u@s pT 0!0 02QX 000ḐsX%X <p;P0 0P* Pt%0fPPh!! A hU !0s8tq"07P _8 m oP"  IPɁ0S ؎| 0S ώ\0 0/X0 e$`p0 0  Q   S  R#4p U`Pꎁ0S T 㚎  Vp@}-| &    : ^ h - 8&ht@ Ť v   פ O-0MPp00@|P? ||P ?M / Aߍ(@).:X?X1T?P0/1012 211R"T122pPpIp^A&[0n0d10. 0>Zp90|n0C 0 0R080 h噢0 l10 B1!1pq(0 ZPPg0Z m 0R- = 00+0 80 0YSVPMP 6P@ ?P7 4Pxp=N@PfP j@PD=P0=0X1h=&hVP0V30 [0000z00u XPo꘼lꐼi0 pXP 0PH ?0$Qa8 80 R°0 2PP 0 p38 84'0C00`1Zp @ jᲢ1SᓰP ;897̳3 ᖒ:0P )@@ @0 Tp 0 &pA@8( P0Q819:d!*`1 xjpp lPL 5  m<:< @p, D&`11`V vy)PpYGB Y9 +0d1 ሖmp<)pߠ?pP \X 0S` ( 婠5PQ 0S Zo F0080x8"/0  W  0  2s<8"/0 I  2sc!"# ?p B 0<l KP$*M F 008 @ p 138K72 @P@ z@ wx7  @吜p0S G 0HX0SE~0S ~0  Q 8 0 +zp~0S &BAp~0S t&OBAHP qL S@c8 _,۟0 T 0 Sգp) bp% P =0$A>0 0T1a5T @ptDA֟p$0 T1Qp mbp\ğ$Pp 㓝p,k@T5 @pA X000-k0@00 P  {@ 0 30 ޏpt@ Fd#\ L$# D43pI  ב+Dpe3 @坛pTAZ!R`14`11ᥡP0@!"0P!tI00!R00SRd18(F`1Z  R! Q01Y<(p V`1 !1Y4180; X >< 4900z1PU| 0S 1 PkP 0S  ɓ 0S  ở R080SX  R   P1p@0 S   03`V|a7ܮ 0& n &, î ` -d [ i  L P @L b xt ڳ  ߳ < [ q  ٴ   ' < \ l Į ή ծ t   ) g 8&60@0@ 唜ߞh,8n(0 A  Q/0@-0t h P ^0Ix8f@6 0 0$010K @1O-0bM!Mb  Z !1 b0  0 30_bݍЍn t( Pp  0 #G \ ,j{` ; (0$(00G +x(80G( G 7p x8_S  000 00 0Ԁ @G P 0 wP x8#`@#Z* wP 0l8 40G PU P0l8 40G P"`,J J X+DD+0ƒ S$*0@- R P@ 0\ R^ H00"@<0 0 0^ 00"@0/*))p@-`hAh1M@0``T!0P1 0H 0 0!  0 QPp 0SЍp 0 AP000 0 AP 0 0 0 AP 0 0 | |0 AP` `0 0 Ѝp, (G ``H d P4 @-M   gЍ?h  Q/X-M  0I p 0 S 0 0 Ѝ(B<A /$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/*/_*/\*/;*/b*/*/*/*/c*/2|*/y*/v*/9s*/p*/m*/8j*/g*/d*/a*/^*/ [*/X*/U*/0R*/QO*/L*/)I*/{F*/|C*/#@*/)=*/=:*/7*/4*/"1*/.*/+*/(*/%*/////^*/*/*/<*/*/ */ */*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/ */*/ */*/*/*/K}*/Wz*/+/ju*/Or*/ho*/il*/vi*/f*/c*/ `*/]*/Z*/W*/T*/Q*/pP/< /G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/4T*/@-@y@*/*/ps_strings missing ramdiskbinUsage: %s ..., where is one of: ܽPc= 0popdnedirectory %s encountered when not expected.%s -> %s fts_read%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %s%soverwrite %s? stat: %s%s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeblock sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %sl0 T@@ @@   |@@@%|@@*%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsbscbsconvcountfilesibsififlagiseekmsgfmtobsofoflagoseekprogressseekskipunblock and -DNO_CONV?%s%sdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape device.usage: dd [operand ...]stdinpдyXfiles is not supported for non-tape devicesstdoutcase conv and -DNO_CONVfsync stdoutcloseposixblockblocks %llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) %sskip reached end of inputllll%,l2llllll8lllllllllll l"(/ll5ll;%*s1024-blocks1K-blocks100 0NAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksSizenon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapAvailUsediUsed %*s %*s %%iCapiAvail Mounted onhflag == 0prtstat/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %jd %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s%s is not a mount pointfile systemWarning: %s is not a local %sWarning: %s mounted as a %s %stotal%s cannot seek temp fileout of memorycannot read temp fileinvalid addressline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+%scannot open temp file%s: %s cannot close temp file%s out of memoryp unexpected end-of-file& no previous commandinvalid pattern delimiter%s out of memorycannot read input filenewline inserted newline appended r%s: %s cannot open input filecannot close input file%lu cannot write filewcannot open output filecannot close output filestdin: %s cannot read stdinunexpected end-of-file%ld \  \abfnrtv\TTT(IT@TTTI(1TITTT1vHY|#Gp(f#>|Tiinvalid addressno matchinvalid mark characternumber out of range%s out of memorywed.hupHOME shell access restrictedno previous commandno current filename..invalid filenamefilename too longainvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimitercrypt unavailable%ld !unknown commandcrypt unavailable ? Usage: %s [-] [-ESsx] [-p string] [name] p:sxES ? interrupt? %swarning: file modifiedscript, line %d: %s unexpected end-of-file*unbalanced brackets ([])trailing backslash (\)%s out of memoryinvalid pattern delimiterno previous patternno previous substitution%s out of memorynumber out of rangeinfinite substitution loop no matchnothing to undo%s out of memory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file %s%s/%swarning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s linkFLPfhinsvw.EG9 total %'llu total %llu humanize_numbertotal %s %'*llu %*llu %*s ????????????????????????%s %*lu %-*s %-*s %*lld, %*lld %s: name too long%sout of memory!usage: %s [-p] [-m mode] dirname ... Cannot set file mode `%s'm:p/%susage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rm rename %soverwrite %s? override %s%s%s/%s for %s? %s -> %s rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long3Rg-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)bytesunknown format, %s skipped in %s %s: %sWorking on `%s' (%s) files%lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...done. directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedFailed stat on %sUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itself.Cannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingcpioCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s"5'5-5522Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %scpio%b %e %Y%b %e %H:%M%s %s%2lu %-*s %-*s %4lu,%4lu %9llu %s %s == %s -> %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing 999999999999999999999999999999999999999999999999999f9999np999999p999999999999$9'+-/91AOQSYQ[]_9c @@@@@@@@@@@@@@$'@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @@@@@@@@@"'+0@5:A@lnuz@ Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory /Cannot create directory `%s'tarInvalid block size %sbzip2write_opt=nodirgzipxzcompress+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-I-rUnable to open file '%s' for read-C-C Problem with file '%s'TAPE/dev/nrst0paxInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:abcdfiklnoprstuvwxABDEGHLMPTUVXYZ -%cDestination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2createfiledereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionspreservefast-readappendupdatelistverboseinteractiveconfirmationextractgetgunzipread-full-blocksdirectoryto-stdoutabsolute-pathssparsefiles-fromsummarystatsexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursionchroottimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)Removing leading / from absolute path names in the archiveCPU time limit reached, cleaning up.Signal caught, cleaning up./tmp/LC_TIMEUnable to set up signal handler.Can't open current working directory.TMPDIRCannot allocate memory for temp file name.cannot gzip while appending2 )  AUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory "33"}c}Tcc}c/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sustarBusted tar archive: has both ustar and old tar recordswrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oLinkFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %s00MODEUIDGIDMTIMECHKSUM././@LongLinkpathname too long: %srcannot open %s: %spathname too long, line %d of %s%s: /dev/ttywrFatal error, cannot open %s (%s)usage: %s [-LP] PWD/.//../.LPstdout+LLL<LLusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? %sdfiPRrvWx"." and ".." may not be removedfts_open failed%s: %sfts_read%s: is a directoryusage: %s [-pv] directory ... pv%sAlias count botchalias %s=aalias: '' not found alias: %s not found 5$+iEM=aO]Varithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expression:C5@FP%-V"SKarithmetic expression: %s: "%s"0variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'%lldexpecting ')'incr/decr require var nameexpecting primaryexpecting end of expression%lld .getcwd() failed: %sPWDOLDPWD..Unable to determine new working directory%s PeHOMEHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryLPunexpected argumentUnable to find current directorystdout: %sffffikfXZfffffff\fff^f`fb-n-ewrite error%s: : %s   " ",;OcEtZ# _^F<>?$error %dinterruptedno execute permissionpermission deniedI/O errorfile existsno such filedirectory nonexistentnot foundis a directorytoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long@NI$2Vkks{%.4f0.0PATH=Pipe call failed: %sNode type = %d for using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedPATH=Cannot vfork (%s)too many nested function calls_invalid count: %d%s: not found%s: is a directory%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss G   048%s: %sCommand from PATH[%d]: special builtin %sfunction () { ; }internal error: %s cmdtype %dbuiltin%builtinfunc%s not defined in %s%s: %s bcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V]vVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ...'' is an empty string %s is a shell keyword is an alias (multiline)... for: is : %s is a shell function is a shell builtin is a special shell builtin : not found usjQED[[[[>|>>>&<<&<>; && || ! | &(if then else fiwhile until do donefor in ; do case ) ;& ;; esac() { ... }-<<...???Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profileHOME/.profileENV Can't open %sOut of spacestunalloc ststrcat() over length botch d:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...IFSSu=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error t"'f.3d:3s@'cI3mP3l^er mupn3v b HSatfdscmlrpnvbinternal error (%c)too many argumentsunlimited%s: value overflow%s: bad number%-13s (-%c %-11s) %9lld%cerror getting limit (%s)error setting limit (%s)unlimited %lld ulimit: I/O error (stdout) timesecondsfileblocksdatakbytesstackcoredumpmemorylocked memorythreadthreadsprocessprocessesnofilesdescriptorsvmemorysbsizebytesInvalid number: '%s'Number out of range: %strueyeson#$PSc: , onoffCurrent option settings+-%s%c%c%-19s %s set -o default %co %s %c%cdefaultUnknown option %co %sUnknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option %dOPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that many   allexportcdprintemacserrexitforkignoreeofinteractivelocal_linenologinmonitornoclobbernoexecnoglobnolognoprivnotifynounsetpipefailposixpromptcmdsquietprofilestdintabcompletetrackallverbosevixtrace%7:.[ (8mYSgirktEEEEEEEEEEH66I8%d: Syntax error: %sBad fd numberEOF reading here (<<) documentWord "%.13s" unexpectedWord "%.10s..." unexpected#####$$ $$$$$"$.$3$8$?$F$M$R$Z$b$h$m$t$x$|$$$%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: \###############Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'}-+?=-o promptcmds not set: Bad for loop variableinBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentifthenelseeliffiwhileuntilfordodone{}caseesac!end of filenewline";""&""&&""||""|""("")"";;"";&""`"redirectionword"if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"7c/gkkPipe call failedUnable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %scannot open %s: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s)''@'''''''''@%d: +%s%s-%s, +%#x insufficient file descriptors availablefd %d: %s%d: %sUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '''''''''%d'...'...>>|<<>>>>&<&<<appendasyncsyncnonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecexitEXIT%d%s ---l--p-Ptrap -- - %strap -- ''trap -- %s Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition %s abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d''|&;<>()$`\"' *?[]#~=%%s\''%s''%.*s'%s =%.*s: is read only%.*s: bad variable namePS1=$ PS1=# #$PScNBSH_INVOCATIONT(0W+(1_+(1e+(8o+@(0}+,(0+(0+(0+h}؃(0+PS1np%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1>>0>&*->>>7;W[_cccc $/:EN%% %s: out of range'%s': bad number,-l-n- p-r- t-v-x-z-|-~-- --- -- - --------- -!------!=[]missing ]unsupported expression when built with -DSMALLGLOSbcdefghknprstuwxzefeqgegtleltnentot<=>unknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %s grouppgrppidunknown signal number: %d%s option requires an argument -- s0--bad job id: %sbad process%s id: '%s'%s %s                  breakcontinue.evalexecexitexportreadonlyreturnsetshifttimestrap:unset34 40 4844a4#4,434|74=4HC4H4@J4pcommandaliasbgcdchdirechoexpletfalsefdflagsfg%getoptshashfcinputrcjobidjobskilllocalprintfpwdreadsetvartest[truetypeulimitumaskunaliaswaitwordexp4 4|4d>444P444845R5R 5$55p(5("5?(5J-5h2585?5$C5hH5,O5T5V5@[5`5og5lm5 u5Kz54'#$%dPPIDIFS1OPTINDPSc20220122 BUILD:20260407123622Z SMALL REJECT_NULSNETBSD_SHELLLINENO %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4incomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complexL#-+ 0'0123456789%s: missing format character%s%s: invalid directivewrite errorprint failed;; ;;;;;;;;< << << "< '<,<;;;option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %sbrkflushrprntdiscarddsuspeofeoleol2eraseintrkilllnextminquitreprintstartstatusstopsusptimewerasegfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 option:illegal gfmt1 option -- %s%lxcflagiflagispeed%ldlflagoflagospeed/dev/urandom%d %d %d TIOCSETDTIOCSTARTTIOCSTOPO>&S>(Z>&_>&g>`&n>%r>&}>$'>d'> (>)>,&>)>4(>P)>|)>(>'>`&>\(>p(>)illegal option -- %soption requires an argument -- %sallcbreakcolscolumnscookeddeceverythingextprocinsaneispeednewnloldospeedostartostoprawrowssanesizespeedttyWC[C_CcCgC#nC3vC#|C3C2C3C3C#CCCC C@C@CCCCBBBBC CCC C@&C,C2C7C%d%s: %s %s %s-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscs5cs6cs7cs8cchars%s = %s;%-8s usage: %s [-a|-e|-g] [-f file] [operand ...] %s-aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1illegal option -- %stcsetattrTIOCSWINSZ====0==0=9owner:group|owner|:groupgroupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s%s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.userCannot stat `%s'fts_open%s: %sfts_readreferencexxx#xxxxxxx/"&),FBXi|~DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentlebechanging %s byteorder to %s[[[@Z@[@[@[@[@[@[@\@ \@\@[ @\@\@&\@.\@[[5\:\@\G\O\U\[[\b\h\o\y\\\\\\@\@\\\\\\\[\\\\\] ]]]]"]*]1]8]ZZ@]%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%sattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:or-Y>YNYYYYYYYYZ0ZCZNZnZqZ%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=S?^C^H^P^U^Z^`^f^l^s^]z^~^]^]^]^^^^%s:unknown%u:se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:G]N]S]]]g]p]w]]]]S]]]]]]]]]]]]]]]]]^^^^+^;^t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# typeunknownline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFOZZZZZZZZZZZZZZZZ[ [[[[([.[7[>[G[P[Y[b[m[v[[[[[[[[[[[/tmp//usr/bin/viMACHINEMACHINE_ARCH%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXwforkEDITOR%s %smalloc-c/bin/shrre-edit the label? [y]: unknown disk type: %s[-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)-l(to show all known file system types)aarch64alphaarmearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebarmebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64arccobaltlandiskepoc32hpcarmhpcmipszaurusunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmd %s %s [a-%c] define named partition cylinderssectorsRounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesnoAutomatically adjust partitions [%s]? Invalid answerreallocarr%s: # Current values:`g hhhh#h(h.h4h:hAhgHhLhgRhgggUh[h^hdhDisk type [%s]: ?Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: %uInvalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition> ggg#g-g6g=gLgSgYg`ghgmgugzggggggggggggggggggg hFilesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuAadjust the label size to the max disk sizeCmake partitions contiguousEprint disk label and current partition tableIchange label informationLlist all known file system typesNname the labelPprint current partition tableQquitRrounding (c)ylinders (s)ectorsWwrite the current partition tableunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdDYDYYTYDYYLYYYYD# %s: kllllllllll;lll6ll?lilMllllltype: %s type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u kkkkkkkkkkkllllll&l1l6l;l?lClMlSlWl_lclilmlxllll%10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u) %u partitions: # size offset fstype [fsize bsize cpg/sgs] unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECSCSIESDIST506HP-IBHP-FLtype 9floppyvndATAPIldflashdmrumpdmdUsage: %s device %s device command [arg [...]] Available commands: %s %s force%s: %snonerwrwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: %s %s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd characterssqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes list%s: badsectors list%s: blocks %lld - %lld failed at %sflush%s: badsectors flushretryfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - failedokWedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %s%syesnosuccessfully scanned %s. rrr%s: strategygetcachelistwedgesaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetwedgeinfogetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grew %s truefalse%lld %sArray:Unhandled type %dQRSa:dlnprt/dev/drvctlopen %sDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': /Select neither dict nor array with `%s' unknown command `%c'147:'@*TMP-1  ,%lu/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidextendedprimaryCan't read %s partition table%s partition table invalid, no magic in sector %lldsectordecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbmbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1reallocarrNested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld DIOCWLABELCan't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionunknownPBR is not bootableNot bootable~Ŏ G     )9Pej֐$:Rn !#$&12345Ǒ68ґ9ؑ9ߑ:;<0=H@WAkBCӒDEF%G%H%J;LXMiNpOPQRSѓTړUVW\a9cCd~efgǔhǔiǔpΔqstuvwx+Utؕ4Li˖3C_yؗ!4CVakŘʘݘ&Accc|Ǚߙ)Gb~̚"Xϛ1a˜ל*%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable "OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: EPART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidstartStart sector already allocatedsize%sExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:%d: Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s/%s%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSNetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table ;]`rorwrq,%snoufsffsfsck_%s-o,start %s %swait %svfork%s: file system is mounted read-write on %s; not checking %s/%sexec %s for %sexec %swaitpid%s: %sInvalid option stringonly one -t option may be specified.empty type list[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]usage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s%s%s%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypeԠm٠ߠm )06=EJRW\`ity~ʡ֡vfstype `%s' on partition `%s' is not supported/sbin/usr/sbinv7fsmsdoslfsext2fsunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check S, /etc/fstabCan't open checklist file: %s%spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: %sUnknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%s Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %snoyesFIXED%s? %s %s? [yn] ** %s (NO WRITE) Can't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** MARKING FILE SYSTEM CLEAN ***** FILE SYSTEM WAS MODIFIED ***** Invalid sector size %u Out of memorycould not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo block fixUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors out of rangereservedCluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctfreebadas EOFCluster %u is marked %s with different indicators, fixCluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATinvalidnot freeLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directoryInvalid long filename entry for %s Invalid long filename entry at end of directory %s Invalid long filename entry for volume label Remove%s has entries after end of directory Extendq != NULLreadDosDirSection/usr/src/sbin/fsck_msdos/dir.cTruncatelong filename too long long filename record cluster start != 0 %s has clusters, but size 0 Drop allocated clusters..%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 Correct.`.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersNo space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectLOST.DIRNo %s directory No space for bufferNo space in %s could not read LOST.DIR%ucould not write LOST.DIR%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %.*s/%s%s/XXXXXXXXXX/dev/rfss%duntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dDIRFILE%s NAME=%s %s=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY ..DIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%s DIRFILE%s %s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block go!@GJ]cjsv|usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** /ffs ***** REBOOT NOW ***** belenumberAlternate super block location: %d eano-eaconversion levelUsing maximum conversion level of %dmodebad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sBADEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEDUPEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)CORRECTUNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo DUP%s: phase 1b: cyl group %d of %d (%d%%) XX))_*w_ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORY.BAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s ..BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORTDIRECTORY%s %s: LENGTH %lld NOT MULTIPLE OF %d (ADJUSTED)ADJUSTDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luRECONNECTCOULD NOT FIND NAME IN PARENT DIRECTORY3:ACG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld UNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluEXPANDCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUP%s: ** %s (vmsg) (%s)%s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. /Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%s%12.12s %4.4s %lld returning to single-user after filesystem check %s: BAD SUPER BLOCK: %s  MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x f** F Can't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblockCan't open %s%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION ffsappleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKCLEARUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKFIXINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)CORRECT (CORRECTED)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE%s? no %s? yes %s? [yn] CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld), %lld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool%s (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of range/?..cannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) CG %d: ALLOCBLK: BAD MAGIC NUMBER cannot allocate quota entry   ffs_isblock%s: unknown fs_fragshift %dffs_isfreeblockffs_clrblockffs_setblock        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?unknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%.*s/%s%s/XXXXXXXXXX/dev/rfss%d DUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %d (FIXED)FIXCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK userUSERgroupGROUP%s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %llu (CLEARED)CLEARNO %s QUOTA INODE (CREATED)CREATEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number CONTINUEno user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == lenwapbl_circ_read/usr/src/sys/kern/vfs_wapbl.cwapbl_circ_advancewr->wr_blkhashcnt > 0wapbl_blkhash_clearwr->wr_blkhashcnt == 0wapbl_replay_stop calledwapbl_blkhash_free!((wr)->wr_scratch != 0)wapbl_replay_freewapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_space_usedwapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wapbl_blkhash_initwb->wb_blk == blkwapbl_blkhash_inswapbl_blkhash_remUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records((wr)->wr_scratch != 0)wapbl_replay_writewapbl_replay_can_read(len % fsblklen) == 0wapbl_replay_readwapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSCONTINUEwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d a:i:s:b:l:t:s 5&@index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on device%dPartition %d added: %s %llu %lluadd[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:2:&No valid Protective MBR found/usr/mdec/gptmbr.bin/usr/mdec%s/%sCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]P?&AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBRcreate[-AfP] [-p partitions]A&@@frDevice doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]%s: (%s) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedEFI PARTBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %ju%sGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juPMBR at sector %juSuspicious MBR at sector %juMBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged gptUsage: %s%s %s %s%s %*s%s %s %s%s %s%s %s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x),(1ZdUnrecognized attribute `%s'%s%10.10s %s , [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %ju (%s)primarysecondaryUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tablebiosbootLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OrequiredPartition required for platform to functionXh&Media SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector%d- Media GUID: %s - Number of GPT Entries: %u headerKKKEKKlabel changed-rCan't open `%s'Can't copy stringCan't label from `%s'ab:i:L:s:t:f:l:<i&@label-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirrored bogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after it%juunusedmbrmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbrGG,,,",>,,W,,Pgpt[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: l#t(hP%p|8<# Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %s%s %smedia size too largeCommand %s needs a device parameter*  "Unknown FreeBSD partition (%d)*%u*X_dnx)8DTPartition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %s9hz&@Afp:sNo MBR in disk to convertXa}(     1FKj}3O k!{#{$&{1{23{4{56{899:;<=)@8ALBCDEF G H J L9 MJ NQ Oa Pq Q R S T U V W \ a c$ d_ e f g h i p q{s{t{u v{w x   6 U b w       - J b |       $ @ Z ` y y y        -8{{{{BZl:::Sr9U]/Z{{{8{Y|MBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]unusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOPUSOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486NetBSDOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionCTOSDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBACTOS MemdumpDR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderSpeedStor or Storage DimensionsDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block TablesecondaryprimaryAdding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %s&@Device contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'No room for the PMBRError reading MBRCan't write PMBRRecreated PMBR (you may need to rerun 'gpt biosboot'recoverremoved$T&@ab:i:L:s:t:remove-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] &@a:i:s:b:qEntry at index %u is unusedCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]H &@s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT header; run create or recoverNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizedisk[-s size] [-q] h & a:b:i:lNset-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]-l+%')Hx %%jx%ju %*jx %*juBKMGTPE%s: %llu (%s)%den_GB.UTF-8 (active)UnusedExtended MBR - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part %d%sGPT part %l- %sPMBRUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: GUID: %s %sTypeID: %s Type: %s Long_Type: %s Attributes: %s Label: %s ()start %*ssize index contents%5d unknown%*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s %s%ju%s = %s%*s Label: %s %*s Attributes: None %*s[ %*s ]Could not find index %dDetails for index %d: StartSizeType: %s (%s) Attributes: ĝ &gi:b:luaxAhHpW:wCOLUMNSGPT not found, displaying data from MBR. %*s%ju %ju %u %5d show[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changed [D &@ab:i:L:s:t:T:ltype-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtype-l ( & a:b:i:lunset-a attribute -i index-a attribute -b startsec-lSFH0eC쬧  SFU0eC쬷  Hah!IdontNeedEFI  (s*K>;  |nQn- q+  |nQn- q+!!|nQn- q+!$!|nQn- q+5!@!|nQn- q+N!R!=rGy=iG}V!a!;Mt?l!w!mWC 3KOO!!yD<#*=(!!YbBRuoqr!!3Dh&!!\ M}-!!@Mjy֬""-чH)"-"-чHB"F"ZIчH`"d"IчHw"{"IчH""2IчH""L6 %?a""S'@ )Ѹ""*1@ )Ѹ""1x )Ѹ"#ST.qBHo6֯i#!#%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx-?%s%18.18s %s /dev/urandomCan't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBLk#4 &@UUID changedab:i:L:s:t:U:uuid-a[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]-}%< &o:gpt->secsz <= INT_MAXbackup/usr/src/sbin/gpt/backup.csector_sizecodeindexflagstart_headstart_sectorstart_cylindertypeend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failureMBRmbr_arrayrevision%dguidle32toh(hdr->hdr_entries) <= INT32_MAXstore_gptentriesGPT_HDRi <= INT_MAXstore_tblstartendattributesnamegpt_arrayGPT_TBLwCan't open `%s'backup[-o outfile]-/dev/stdin(0@ &@Fi:Device contains a GPTDevice contains an MBRUnable to read/parse backup filesector_sizeproplib failureSector size does not match backupGPT_HDRrevisionbackup is not revision 1.0entriesguid%s: not able to convert to an UUIDGPT_TBLgpt_arraytypestartendBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endMBRcodembr_arrayindexflagstart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highUnable to seek/write MBRattributesnameEntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTEFI PARTUnable to write primary headerUnable to write secondary headerrestore[-F] [-i infile]in_addr_flags%s: getsockSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s/%d -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %sin_status%s: getifnamegetifaddrsinetcommit_address%s: getsock%s: getifnameaddressdstalias%snetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sififflagsafethercaprcsetethercaps/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)do_setethercapsSIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeo+}++[%+-/EXXXXXXXXifflagrcsetifflags/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlensetifprefixlenprefixlen_to_mask%s: prop_data_create_copynetmask%s: prop_dictionary_setdstsetifdstormask%s: getifflagsdstormaskd != NULLsetifbroadaddrnot a broadcast interfacebroadcastdescrdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRlinkstrmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTRs%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for names%sSIOCGIFFLAGS %sifcapsifcapsetifcapsaddresssetifaddrclonecmdclone_commandNote: trailers are no longer sent, but always receivedmetricsetifmetricSIOCSIFMETRICmtusetifmtuSIOCSIFMTUsetifnetmask, %s byte%s, byte[-m] [-L] usage%s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimegetifaddrstimed outerrorSIOCZIFDATASIOCGIFDATAstatus%s: getsock%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s 555 linkstate: %s input: packetmulticastqueue drop, %llu unknown protocol output: collisionprintall%s: prop_dictionary_copy/createifparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecated%s: not a numbermainexec_matches%s: prop_dictionary_augment%s: getifname%s: lookup_af_bynumafp->af_addr_commit != NULLpreferencedo_setifpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)do_setifcapsSIOCSIFCAPunknowndownupifaceiface-opt-familyopt-familyoptional silent familyopt-clonemisccloningifflagssilent familyaffamilyiface-opt-family-onlycommand-rootoptional commandopt-family-onlybroadcast address (address 3)destination/netmask (address 2)local address (address 1)family-onlyno commandsnonewait DADlist clonerscreatedestroy7zi &7yialiasdeletetrailers-linkstrdescription-descr-description777 &- &777 &/& %s%s SIOCDIFPHYADDRtunneldeletetunnelH & H&bad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xgetsockgetifnameaddress:linkprint_link_addresses%s: getifname%s: getsock%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfacessetvlan%s: getvlanvlantagSIOCSETVLANsetvlanif%s: getsockvlanif vlan: %d parent: %s -vlanifI&JIl&>JJFJVLAN tag(ELly{}NONEWEP40WEP104TKIPAES-CCMP?AES-OCB0x%02x...SIOCG80211POWERpowersavercsetifpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWERssidsetifssid%s: SSID too longSIOCS80211NWIDpowersavesleepsetifpowersavesleepnwkeysetifnwkey%s: nwkey too longpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYbssidsetifbssid%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep)off chan %d bssid %s chan %dchansetifchanSIOCS80211CHANNEL%sSIOCS80211hidessidsethidessidapbridgesetapbridgesocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)fragsetiffragIEEE80211_IOC_FRAGTHRESHOLDrtssetifrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATESB< uc:+8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHANBSSID%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAfGfQfUfZfaf getmntoptsegG:jM:m:o:rU:stat %scd9660%s on %sbnorripbgensbextattbnojolietbnocasetransbrrcaseinsuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedupdategetargsextattgensmaplcasecasetransnrrrripjolietrrcaseinsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node ii%i(i+i0i9i=iBiGiNi Ti[i cihiti@ziiiii@i@iigetmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceext2fs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdatereloadforcegetargsdevmtimeatimerelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-o options] special node ulllllllllll ll lll ll@llmm m@mm$m(m@0m8mgetmntoptso:mount table fullincorrect super blockspecified device does not match mounted deviceffs%s on %s: %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountednfs4aclsposix1eaclsasyncsyncupdatereloadatimedevmtimeforcesoftdeploggetargsextattrdiscardrealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: mount_kernfs [-o options] /kern mount_point nnnoo oooo!o(o .o5o =oBoNo@getmntoptso:kernfskernfs on %suserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsrealpath '%s' failed"%s" is a relative path.using "%s" instead. & 2usage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath %r/r:r=r@rErNrRrWr\rcr irpr xr}rr@rrr@getmntoptsGsl9Uu:g:m:M:o:t:stat %smsdos%s on %sbshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroruid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncsyncupdategetargsunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead. '*? -($25GJM + Conflicting version options[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]Usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]Illegal value `%s' for option -%cstrdupyyyyyyyyyyy yy yyyyz@ z zzz z#z )z@2z9zAzGzLzPzTz w@wwwZzwww w@getmntoptsportrsizewsizerdirsizeleasetermreadaheaddeadthreshtimeoretrans23Aa:bcCdD:g:I:iL:lo:PpqR:r:sTt:w:x:UuXnfs%s on %sbsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacaddr=%s, port=%s, addrlen=%d, getnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d userquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedforceupdategetargsbgconndumbtimerintracnfsv3rdirplusmntudpresportnqnfssofttcpudpnfsv2maxgrpsrealpath '%s' failed"%s" is a relative path.using "%s" instead.Unsupported socket family %drecvrpc%s: reject, astat=%d, errno=%d rpc_getport%s: %srpc_call%s: error = %d sendrecv%s: short write! (%zd < %zu)no : or @ specnfscan't get net id for host "%s": %s $thw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'%/:=@ENRW\c ip x}@getmntoptsram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o updateuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedgetargsatimerelatimeunknown %s id: %sgroupuserinvalid file mode: %srealpath '%s' failed"%s" is a relative path.using "%s" instead.untitled. 2 0 #:NSao}A*LZo%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).BiωANJ>Rr܋+Pp׌Chusage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: %s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsbeleWARNING: -G may create file systems which cause kernel panics 2eaformatsector sizesector size `%s' is not a power of 2.verbosemaximum contiguous blocksblock sizemaximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %saverage file sizeexpected files per directorybytes per inodefree space %number of inodesgetmntoptsspacetimeuse `space' or `time'.unknown optimization preference: %s %susergroupinvalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk label; disk type must be specifiedno default sector size%s partition is unavailableappleufsApple UFS%s partition type is not `%s'ffs4.2BSDUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d/statvfs %swaitpid%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume nameuserquotagroupquotarorwautocoredumpdevexecsuidrdonlyunionhiddensympermrumpautomountedasyncupdategetargsatime rdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s WTWTbSScg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0 illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld  super-block backups (for fsck_ffs -b #) at:%llu Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %srealpath '%s' failed"%s" is a relative path.using "%s" instead./+-$ ")7IKWco|%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file Bad inode size %d (only 128 and 256 supported)formatsector sizesector size `%s' is not a power of 2.verboseblock sizefragment sizebytes per inodefree space %number of inodesfile system sizeVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:can't open file %scan't fstat opened %s%s: open for read%s: open for write%s: getmntinfo/dev/%s is mounted on %s%s: can't read disk labelno default sector size%s partition is unavailableext2fsLinux Ext2%s partition type is not `%s' (or use -I)Unable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageilog2%s: %u is not a power of 2rdfs%s: read error for sector %lldwtfs%s: write error for sector %lldSSSWTWTbiput%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)alloc%s: inconsistent bitmap block size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O bufferPreposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%llu%s%*llu, ...init_resizeino%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize featurefsinit%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s  #'+3;CKSW_goy%s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: @BCĥFХILNO,S7aHbXccewfhЦiܦkmnor%s6uG -%c %s offsetcreate sizevolume IDbytes/sectorsectors/FATblock sizesectors/clusterdirectory entriesdrive headsinfo sectorbackup sectormedia descriptornumber of FATshidden sectorsreserved sectorsfile system sizeCan't parse timestamp `%s'sectors/track@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:/dev/%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyOEM stringBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per trackunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %s%s: no default %s%s: illegal %ss%#x%uCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file size%sgetmntinfo/dev/%s is mounted on %swarning, %s is not a character devicecannot seek to %jd@@@h pp pp ` @  $%s: unknown standard formatCan't get disk size for `%s'bytes/sectorsectors/trackdrive heads"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAMENetBSD%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u1м|^t0 Non-system disk Press any key to reboot %s: can't write sector %u1601803203606407201200123214402880bj #'@PSVgmp>Gey  "$&(*, usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s %02x TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route)RR: RR: NOP unknown option 0x%x     pusage: %s [-dln%sqvxz] [-- ] ???(can't restart init): haltpoweroffdlnpqvxz %sreboothalted by %spowered off by %srebooted by %s: %srebooted by %sshutdown~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()%s%s?<0&),080I0Z]0`usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] /dev/nrst0/tmp/TAPETMPDIRoption requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusiveacan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. .Begin level 0 restore Calculate extraction list. Verify the directory structure       &A]uC+P%command lines cannot be continued missing %c Warning: undefined file type %d ../canonname: not enough buffer space ../%s > %s/%s%s: %s: out of memory no filename match. glob() aborted. unknown error! addcd%s: not a directory delete%s: not on extraction list extracthelp ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from files to be extracted add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory lsls: out of memory %s: directory reopen failed %s/%s%s: name exceeds %d char %*ju pwd/ %s quitxitverboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue5/ f|NIL|ONTAPE|INOFND|NAMEFND|MODECHGleafdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %swcannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXX/no memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/.Warning: `.' missing from directory %s ..Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set rfopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s %s: cannot create file: %s write error extracting inode %ju, name %s read: %s write: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore wfopen: %s cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table .open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table read: %s cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c ũ©)+S QJNChecksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s pVlVhVdV`V\VXVTVPVCannot allocate space for tape buffer -r/dev/ttycannot open %s: %s /dev/nullthe epoch [unknown]Dump date: %sDumped from: %sLevel %d dump of %s on %s:%s Label: %s #Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted%.*s %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)sChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. %s%s%s%s%s towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes: %s%d, Specify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) none Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuecontinuation failed: %s End-of-tape encountered oldnewNote: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s blockchar%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) linkextract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s fileno memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps %s: %s tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. .cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptyusersystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |NIL|REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] abortdump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s NODELEAFbad entry: %s name: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s ,./%s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappnderror writing to mtree fileLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). %s: %sProtocol to remote tape server botched (code "%s"). strduptcpshellshell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C closeR%d readW%d writeL%d %d seekI%d %d ioctladdatalkblackholechangecloningconnecteddeletedstexpireflushgatewaygenmaskgethosthopcountifaceinterfaceifaifpinetinet6linklocklockrestmaskmonitormtunetnetmasknostaticprefixlenproto1proto2recvpiperejectrttrttvarsasendpipeshowssthreshstaticx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxy %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"prefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAG%s %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYrouting message version %d not understood &Px6^%s: #%d: len %d, if# %d, %s, flags: UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTpid %d, metric %d, addrflags: if# %d, what: associatere-associatedisassociatescan completejoinleavemichaelreplay#%d (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: UPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATING locks: MTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVAR inits: route-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s donebotched keyword: %sdfLnqSsTtvUsage: %s [-%s] cmd [[-] args] Internal Errordefaulthostnet/dev/nullSO_RERRORsocketCannot allocate memory0assuming route to ifold usage of trailing 0%s, %sassuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa%s %s %s: gateway %s (%s): %s RTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsGatewayEncapInternetAppleTalk Protocol Family %d: %s: UGHRBD M@dmCLS1@2plb%-6.6s default%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d0123456789abcdef(%d) %saf %d: %s%s%-*s %-*.*s route-sysctl-estimatesysctl of routing tableRouting tables-%6s %8s unspec       " % ( +8/& Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL s/usr/bin/wall%s -nw%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at ph???PFPF0* XXX,,x<<rebootpoweroffhaltshutdown/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already past-Shutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-d-n-p-lCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:/dev/%s%s%stcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip ~W  " "&%07x%02x%07zu bytes %s,%zu%zubitmask_print%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s: %s#%zu: %s: the value is not available (%s) %s: %s , bad size %zu for kern.drivers%s%s%s[%d %d %s]0x%0*x%#x%u%d0x%0*llx%#llx%llu -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%.*sunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)/o||||||4|CM|`e{||||| 0 |) |; C |[ b |  |  |  |  |  | C | ^ | u |  ,, |  |    | |& |+ |regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f bitmask_scan%s,Invalid port: %sPort out of range: %s.???%s%d%s (%s):  CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDENALIAS%x, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! addrsymbolstringstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address typenodeintboolquad%s: '%s' is not a valid type size%s: '%s' is not a valid size n%s: '%s' is not a valid mib number flags%s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long =Aabdef:Mnqrwxmalloc regexrNODEINTSTRINGQUADSTRUCTBOOLtopsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?ps/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendor !&ADGINPSV]bg9?KhKKK2usage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z nonecould not set dump device to %s%s: setting dump device to %s %sWARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=blkOut of memoryempty mountpoint/sbin/mount_nfs%s %s %s%s: mount failed/sbin/umount%s %snoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failedswap/dev/%s%s%s: adding %s as swap device at priority 0 %s%s%chw.disknames swaponat:usage: %s -a [-t blk|noblk] %s ... autoADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab blocksKBytes1K-blocksSizeGBytes1G-blocksMBytes1M-blocksno swap devices configuredmallocSWAP_STATSDevice%-*s %*s %*s %*s %*s %8s %s PriorityCapacityAvailBadUsed%-*s %*ld %*ld %*ld %*ld %5.0f%% %3d humanize_number%-*s %*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node getmntinfo%sfR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %s Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. | %s%s ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. Can't stat `%s'RETRr+awremote-filesmregetSkipping non-relative filename `%s' rCan't open source file %s getonoff20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD %sCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTLISTmoremlsdMLSD is not supported by the remote server. nlist-pageroutput to local-file:mls/bin/shSHELL-cCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %s%scommand line to sendarguments to SITE commandSITE modeSITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:command?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutautoPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueallputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicELanonpassftp_proxyhttp_proxyhttps_proxyno_proxypagerpromptrpromptsslnoverify!$accountappendasciibellbinarybyecasecdcdupchmodcloseconnectcrdebugdeletedirdisconnecteditepsvepsv4epsv6exitfeaturesfgetformftpgategetglobhashhelpidleimagelcdlesslpagelpwdlsmacdefmdeletemdirmgetmkdirmlsmlsdmlstmodemodtimemoremputmregetmsendnewernlistnmapntransopenpagepassivepdirplspmlsdpreserveprogressproxyputpwdquitquoteratercvbufrecvregetremoptsrenameresetrestartrhelprmdirrstatusruniquesendsendportsetsitesizesndbufstatusstructsuniquesystemtenexthrottletracetypeumaskunsetusageuserverbosexferbuf?macro name'%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %s/parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'?URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'cd ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. getmregetmgetPragma: no-cache Cache-Control: no-cache , (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedrCan't open `%s'Can't seek to restart `%s'Copying %s (restarting at %lld)http_proxyftp_proxyretrievedno_proxy ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'init$initCan't connect to `%s:%s'r+Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close %s Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s 20260208NetBSD-ftpUser-Agent: %s/%s %swith authorizationAuthorization: %s %swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:bytesReceived unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:binaryBogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'-wCan't execute `%s'already done Size of `%s' differs from save file `%s'aUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %s://Unsupported URL scheme `%.*s'mputput remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c@2k22421 Service not available, %s. %s:No control connection for command QUITCan't lookup `%s:%s': %s?Trying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Can't determine my address of connection to `%s:%s'rwCan't fdopen socketConnected to %s. Can't create socket for data connectionEPSV%s wrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connection./Can't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR STOUSTORRETRproxy server does not support third party transfers. No primary connection. PORT %s%s %sREST %lldlocal: %s remote: %s Error aborting proxy commandr+sentlocal: %s remote: %s -Can't execute `%s'Can't open `%s'%s: not a plain file. APPECan't seek to restart `%s'%sReading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWriting `%s'WARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connection2?\x "*.;MQag|usage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> promptprompt: no such option `prompt'rpromptrprompt: no such option `rprompt'Proxy cCusage%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' %-*s %s %s Sorry, input line is too long. ?Ambiguous command. ?Invalid command. Not connected. ftpgateftphttpFTPSERVERPORTNETRC$NETRC `%s': %sTMPDIR/tmp/FTPMODEpassiveactivegateautoUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %s%s: %s-Bad quit value: %sBad retry value: %s-TBad throttle value `%s',Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %sHOME//.netrc%s/.netrc: %sanonymous@FTPANONPASSanonpassftp_proxyhttp_proxyhttps_proxyno_proxyPAGERmorepagerFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYsslnoverifyRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s's%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s)`9b;f;j;n;r;v; ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBA]Token in .netrc too longrCan't read `%s'anonymousError: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. defaultloginpasswordpasswdaccountmachinemacdefMDTMMLSTREST STREAMSIZETVFSSYST Remote system type is %.*s. unixlinuxbinaryUsing %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. FEAT lostpeer due to signal %dwa/ftpXXXXXXXXXXUnable to create temporary file `%s'NLSTrCan't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too smallC%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YPWD.Unable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d- EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. ?Can't bind to `%s'saveCan't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Can't connect to `%s:%s'restore10Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyanonymousanonpassName (%s:%s): Name (%s): login@USER %sPassword: PASS %sAccount: Login failedACCT %sinit$initAlready connected to %s, use close first. tomain: gateserver not definedConnecting via pass-through server %s asciinon-printstreamfile8Glob pattern `%s' not found %s: transfer aborted because stalled for %lu sec. EOF receivedError encounteredInput line is too long (specify -b > 16384) disconnecting...interruptunknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedr%s: hayes timeout error (%s) [sh] ! can't execlcan't forkS can't create %s [cd] %s: bad directory ! %s [EOT] -c%s%d %s%c W %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for on[set] Boff/bin/sh~{[*?$`'"\pipeecho %sfork"Echo" failed read"%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo r%s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourshellreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend break9>plEt9VxUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedhardsoftnonebad flow settingevenoddbad parity settingmore than one line specified/dev/%sConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifieddircu%dall ports busylink downunsupported speed %ldConnect failedhelpescapeflowparityphoneportlinespeedhalfduplexnostop%sHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrfsdu%s: missing device spec%s: missing phone numberhdraecbenbsctbvbnvtantrwdchfesfoprrcdlcletatdvcmcuelieoepndiexrepausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number %s n r t fEb%c %2s%-2s %c %s Lost carrier.writenoneoddzerooneeven%s: unknown parity value Connected connected cumust be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dall ports busylink downPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKcan't forka'1HBHHHPaccess denied out of core %s%s=%s=%-5d n r t bf allrecord%s: unknown variable %s/.tiprcrset %sbeautifybebaudratebadialtimeoutdialeofreadeofreofwriteeofweolescapeesexceptionsexforcefoframesizefrhosthophonespromptprraiseraraisecharrcrecordrecremotescriptsctabexpandtabverboseverbSHELLHOMEechocheckecdisconnectditandemtalinedelayldelaychardelaycdelayetimeoutetrawftprawhalfduplexhdxlocalecholeparityparhardwareflowhf AT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234 OKRINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x),:EMT]eit| malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 failedwritereaddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%% %s fstatmalloc(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)%s%scould not create output: %sopen: %s%s is not a regular filegunzipzcatgzcatNetBSD gzip 20260107%s usage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzMORELESSLESSSECUREmore--VISUALEDITORviLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functional-No filenames allowed with -t optionPress RETURN to continue Cannot allocate memory 0000000)<%s>LESS_TERMCAP_%sme$<LINESliLESS_LINESCOLUMNScoLESS_COLUMNSkrklkukdkPkNkh@7kDkbunknown[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGTERMhcamxndadbutNRsgpckske@8MOUSE_STARTMOUSE_ENDtitececdcl cmsesoueusmdmbvbbsbcho|^llcralsr  *" $#!%Z^\`[_]a[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread error%sFinishing logfileseek error to 0.invalid chardefchardef longer than 256invalid charset nameLESSUTFCHARDEFLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMT%cESC^%cANSI_X3.4-1968asciiUS-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437dosEBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bCH @j18RnMHOMEXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE-/dev/nullr.less-history-file:.search.shell.mark"%s %s /LESSSEPARATORInteger is too bigwLESSHISTSIZEkkk=kkkk>ddddddd+1YMX]G;btH'2;z?5 'ug PD]o!by9GJ]/6ePQWDbQPattern not found!done#done|done_-(P)+!Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &//?less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d)::%s@/\less/\help/\file/\@Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailable%sXDG_CONFIG_HOMEHOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYgu gu pclose%sInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\help/\file/\@@/\less/\empty/\file/\@-"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARS\LESSMETAESCAPE%c%s%cSHELLr%s %s %s-c%s%s%s/HOME-lessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x -- %s%s*@/\less/\help/\file/\@@/\less/\empty/\file/\@LESSOPENLESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file2&*.)/35;!#%'+-1%s: line %d:  \x%02xinvalid escape sequence "\k%s".lesskey-r#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completebackspacedeletedownendexpandforw-completehomeinsertinvalidkill-lineabortleftliteralrightupword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-scrollback-searchback-windowclear-markdebugdigitdisplay-flagdisplay-optionend-scrollexaminefilterfirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-scrollforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markhelpindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentpipeprev-fileprev-tagquitremove-filerepaintrepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottomshellpshellstatustoggle-flagtoggle-optionundo-hiliteclear-searchversionvisual]8;;\LESSANSIENDCHARSmLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ ]8; Line numbers turned offCalculating line numbersDetermining length of file! SHELL%s %s %ssh (press RETURN)Cannot seek to start positionwCannot create pipeInvalid mark letter %cCannot seek to end of fileMark not setMark not in current file%s -m %c %d %s %s 2"$&(*, " $ & log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %s#Invalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"/%sless ( regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops ,%d and then every %d spaces-" must be followed by 1 or 2 charsquotes %s-*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sheaderinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %s1!4]WValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %s-%s?Input is not a pipeThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapintrno-vbellmodelinesexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersheaderstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifthelptildequoteswindowmax-forw-scrollno-inittabshilite-unreadversionunderline-specialtag-filetagchop-long-linessqueeze-blank-linesraw-control-charsquietsilentpromptpatternLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenforcequit-at-eofcolordumbclear-screenauto-buffersbufferssearch-skip-screenLESS_DATA_DELAY%s: %sSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIX$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd?--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data-tagfileNo previous regular expressionPlease re-enter search patternNothing to searchrLESSGLOBALTAGSx%s -x%s %sGTAGSGRTAGSGSYMSGPATH-No tags fileNo such tag in tags fileTag not foundsP/dev/tty   vm A\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])whitespace after %sRE error: %sunterminated regular expressionexpected context addressundefined label '%s'unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandw commandfilename expected%sread commandbranchlabelempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsoverflow in the 'N' substitute flagno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s'$*-5?Br setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnrustdout%s"%s" ..."-I or -i may not be used with stdinstdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s: name too long%s/.!%ld!%sw%lu: %s: %s7}}}}}}>}}[g}}}}}L}h}}}}}}}}}}}}}}}}K}}Ubn}}s}0}X}}}r%s: %sfirst RE may not be emptyRE error: %s COLUMNS\ \ \abfrtv\%c\%03o\%u not defined in the RE%s%lu  . 'malloc><@=!:illegal -m option format: %s%swrite to stderr Terminal type? [%s] Terminal type? unknownTERMterminal type %s is hardcopyterminal type %s is unknown &26:usage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] isset to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorresetarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptSHELLcsh%s%s%sUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'/bin/shG:g:u:no such user `%s'too many supplementary groups provided,%s.setgroupssetgidsetuidSHELL-i #&/)  #&- ),/ $     "2( &" msdosffs/bin/sh/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyrandomkeyurandomkeyshell_cmdnonedisklabelmbrgptre-enterAdditional packagesftp.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -qftp_proxyhttp_proxy> %c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. untitledWindow too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitMBRGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)logasyncnoatimenodevnodevmtimenoexecnosuidnoautoZeroconf []: +MSGTXTS%smsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesNoAllSomeNonenoneOKokOnOffunchangedDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"headssectorsmount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalSizeFilesystemMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6StartEndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:newfsmountmount optionsmount pointToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressdeviceEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. file systemI can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Install aborted.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: RunningFinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuExitNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersSectorsInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueContinue?What do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchDeviceFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofconfigurechangepassword setYESNODONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)REMOVERemoveAddautoThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontypestartsizeendblock sizefragment sizeavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: INC, (C)lone(I)nstall, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec activePartition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.on$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.HOMELog ended at: %s # Script ended at: %s sysinst terminated. O O O O !-O O z-P P x- P P -P "P @-3P =P ?-NP VP >-sP ~P -P P y -P P =-P P [-P P Z-P P -P P |-P -P Q - Q P -Q Q -$Q O {-.Q ?Q P-KQ XQ |-]Q XQ x -nQ wQ -Q Q -Q Q -Q Q -Q P -Q P -Q P -R wQ - R Q -R P -(R 6R -HR P -TR P -`R P -r%s # sysinstmsgs./msdosTERMsysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certs1FTPSSLNOVERIFYsysinst: screen too small ./usr/share/sysinst/catalogLC_CTYPErelease11.99.5machineevbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orghttp hostnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5hf/binary/setsftp src prefix/source/setsftp userftpftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fsffslocal dirtargetroot mount/targetrootdist postfix.tgzdist tgz postfixpkg hostftp.NetBSD.orgpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5hf/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy%s/bin/X.old%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7# Script ended at: %s w/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file%s%s%s: %sLog ended at: %s a/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s %s sysinst: failed to allocate output window. fork() failedopenpty() failed /dev/nullexecuting: %s %s cd&&chroot(%s) for %sexecvp %sselect(2) failed but no child died?selectselect failure: %s read Dynamic menu creation failed. rcollect%s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s%.*s:%%.*s%s %%%02X. mediaopt ,ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eulaU ]] T ] %s%s%s=1/nfs/usr/sbin/wpa_supplicanta/etc/wpa_supplicant.confcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst # network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confdefaultmanualnone /sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s/sbin/ifconfig lo0 127.0.0.1w/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5[ R] W] ftp-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s%s/%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s up media %s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s %s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" httphttps/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0pppstriptunFuT?????RE%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%sffs%s -p -q %s%d %s [%llu @ %llu] %s: %s%s [%llu @ %llu] : ...%stmpfsmfsinvalide b e e e e e e e f f f f f "f 'f +f 4f ?f Df If Mf Qf [f af ef mf qf wf {f f f f f a%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-infotype%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)noauto/NAME=/dev/r/dev/-t ,rwrqroswdpxx -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated 2ea21/sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o loglfs-tlfsmsdos-tmsdossysvbfs-tsysvbfsv7fs-tv7fsext2fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s/dev/%s-o async-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs%s %s/mnt# ,dp???,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid#/etcw/etc/fstabcat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 swapNAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shmEOF a ` ` e a /sbin/newfs_%s/dev/%s %s ffs %sc/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entriesmount_disks/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkraidxbdcd*fd*udfunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSunknown%-40s %s/PATH: dd if=/dev/random bs=32 count=1 | openssl base64 > /dev/random/dev/r%s%c/dev/%sCD001%s%c%s (%s)   "#$%      "#$%&'()*+./sbin/mount -rt cd9660 /dev/%s /mnt2/mnt2%s/%s /dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %scd9660udf/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfoa/etc/rc.confcat <>%s/etc/rc.conf EOF /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfssrcpkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) ?%s%s%s%s/usr/share/zoneinfo/%s%sTZ Please consult the install documents./usr/share/zoneinfo/%s%.*s%s>>>aa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == lenstr_arg_subst/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmpentropy-filerandom.tmp-a /tmp/entr.%06x %s ftp/usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %sumount %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random./etc/rc.d/random_seed stopraidctlvndconfigcgdconfiglvmgptdkctlmdm >= 0 && m <= nget_available_cds%s/%s%srm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -%srm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXr+w /dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadevice-parentsdmmc/netbsd/etc/etc/fstab/sbin/init/bin/sh/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffs/sbin/mount_nfskern-GENERICmodulesbasebase32dtbetccompgamesgpufwmanmanhtmlmiscrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebugdebug32xdebug#.yt t t t t t t t t t t t t t t t t t u u u u u u %u )u 1u 5u ;u ?u Ju Yu eu uu   %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%u%*s : async noatime nodev nodevmtime noexec nosuid log noauto -ndx == cntedit_fs_type_ext/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c%s (%s)------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s 2 Y <` $  8 . / PF lF 1LP e u %zu%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packedit_and_check_label/ FATNTFS a-%c %c---%c-%c%c: %llu%s %s %s %s %s%s %s %s%s %s %s %s%s %sunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS//targetroot/altroot%s%s%s/%s/bin/mkdir -p %scd to %s cd %s %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd//boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES dhcpcd=YES /bin/sh -i -E/bin/csh/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %sNOYES/etc/rc.confr%s%s s,^%s$,%s=%s,%s=%s adding %s=%s replacement pattern is %s %sfiles dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confpkgsrcsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s root/usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatemdnsdxdmcgdlvmraidframe/tmp/checkrc.shwCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi /bin/sh %s 2>&1chroot %s /bin/sh %s 2>&1var %s is %s YESdisklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error         " ) 1 6 > C H L U ` e j n r | € Ҁ /dev/%s%c%s%c/dev/r%s%cr%s%carg != NULLdisklabel_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypedisklabel_set_part_info%u%s (%u)parts->l.d_secsize != 0disklabel_write_to_diskparts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousSCSI/tmp/disklabel.%uwcat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:\ EOF disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %sijz} H X Є d 0 t   p ؆ @ | D $  | | l P 8 p disklabel_change_geomunusedswapVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSunknownHPFSISO9660bootADOSHFSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS~ 8Ȑ x %7%s-%*s : %s%*s : %llu %s%*s%13llu %13llu %-4s%llu %s------------- ------------- ----%s(%s) %13s %13s %-4s %*s (op - opts) >= 0 && (size_t)(op - opts) == num_optsouter_fill_part_menu_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %s%s%sparts && parts->pschemeedit_outer_partsUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalselect_part_scheme.%s/%s%s%s/libOut of memorymv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aoutaout.old/usr/aoutmkdir -p %sln -s %s %susr/libusr/lib.oldetc/ld.so.confetc/ld.so.conf.oldmkdir -p %s etc/etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0rD%llu%+%llu%s%s%s/usr/ (%llu)%llu%%%llu %s<%s>%s (%s)%s <%s>%zu %s%-35.35s %c %s%s, %s %-37.37s %s %s----------------------------------- - --------------------/boot@//tmp/usr/var  (target-ui) >= 0 && (size_t)(target-ui) == *numnormalize_clones/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0replace_by_default " %2RAHXblv%/9#AJPV\bhck;258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%%s START array %d %d %d START disks %s START spare START layout %d %d %d %d START queue fifo 100 EOF raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnd-r/mkdir -p %s dd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %scgdpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)aes-xtsaes-cbcblowfish-cbc3des-cbcpkcs5_pbkdf2/sha1disklabelencblkno1/dev/zero/dev/urandom/dev/r%s%cprogress -f %s -b 1m dd bs=1m of=%sumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedgesfalsepm_from_pe/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cpm_whole_diskunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sparts != NULLgpt_free/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %s0gpt_create_new ts}h}~|\|rk0m0s8r|gifmff Xȅ w ig chhhgout of memory          ^       ! -a $ - 4 = H R ,gpt %s %s -b %llu %s        % * 1 6 ; ? H O T ^ b g p v z %s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEgpt_get_part_device/dev/%s/dev/r%sr%sparts->disk_size > 0gpt_get_part_alignmentStart:Size:Type:TypeID:GUID:Label:Attributes:, gpt -r show -b %llu %s 2>/dev/null Details for index -p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %sunsetset-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s-%s (%s)t != NULLgpt_get_uuid_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0gpt_read_from_diskhave_gptgpt -rq header %sgpt -r show -a %s 2>/dev/null Pri GPT tableSec GPT tableSec GPT headerGPT part - unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfswindowsefibioslinux-dataappleraidvmcorevmreseredbiosbootbootmebootoncebootfailednoblockiorequiredSFH0eCe k SFU0eCu  Hah!IdontNeedEFI (s*K>; |nQn- q+ |nQn- q+› ̛ |nQn- q+ٛ |nQn- q+ |nQn- q+  =rGy=iG}  ;Mt?* 5 mWC 3KOO@ K yD<#*=(V ` YbBRuoqrj y 3Dh&Lj \ M}- @Mjy֬Ŝ ֜ -чH -чH  ZIчH " IчH5 9 IчHD I 2IчHd i L6 %?au z S'@ )Ѹ *1@ )Ѹ 1x )Ѹ ĝ ST.qBHo6֯iԝ ߝ %08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhxappleApple HFSapple-ufsApple UFSbiosBIOS BootefiEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfsZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRwindowsWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryccdNetBSD ccd componentcgdNetBSD Cryptographic DiskffsNetBSD FFSv1/FFSv2lfsNetBSD LFSraidNetBSD RAIDFrame componentswapNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsVMware VMFSvmreservedVMware reservedsifive-bblSiFive BBL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/  ¢ Ѣ ٢  A   " 2 B U c %u%s (%u)falsembr_get_generic_part_type/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0mbr_init_default_alignmentsstart == 0mbr_create_new~  t d4(4p`4؞T< x hlLtxL%s_%lli@%lliwedge_dev[0] != 0mbr_get_part_device/dev/%s/dev/r%sr%smbr_read_from_disk/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorwrite_mbrparts->geo_sec != 0mbr_write_to_diskt != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal errorinside_ext_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal erroradjust_ext_partinfo->nat_type != NULLmbr_add_part/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorparts != NULLmbr_free%d%d%d%dNetBSDWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDOpenBSDLinux nativeLinux swapNTFS volume setNTFSPReP BootSolarisDOS FAT12DOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partition!usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] buffer sizeinput sizeb:ef:l:p:z%sgzip -l %srreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcgzipexec()ing gzipmalloc for buffersizeoutput pipefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe %s%3d%% |%.*s%*s|*************************************************************************************************************************************************************************************************************************************** %5lld %-3s  x | %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d: %02d:%02d ETA KiBMiBGiBTiBPiBEiB%.2x/-4-6.unpriv.unpriv./var/run/dhcpcd/%s%s%s%ssockcontrol_recvdata%s: no terminator%s: no arg buffer%s: no argscontrol_handle_readcontrol_handle_data%s: unexpected event 0x%04xcontrol_handle_write%s: write%s: eloop_event_addcontrol_handle1control_start7#&))뙙 dhcpcd_readdumptimeoutdhcpcd_readdump0%s: unexpected event 0x%04x%s: eloop_event_adddhcpcd_readdump1dhcpcd_reportssid%s: connected to Access Point: %sCARRIERNOCARRIERPREINITDUID %spid %lld failed to exitdhcpcd_readdump2/dev/nullopen %sdup2 %d%s: removing interfaceSTOPu x } %s: waiting for an %s addresswaiting for an %s addressexiting due to oneshotdhcpcd_daemonisetimed outSTOPPEDdhcpcd_selectprofile%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lostdhcpcd_handlecarrier%s: carrier unknown, assuming up%s: carrier acquireddhcpcd_prestartinterfaceRECONFIGUREalloc_argsdhcpcd_signal_cb%s: sendstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMrebindingSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with itdhcpcd_fork_cb%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departeddhcpcd_handleinterface%s: interface updated%s: interface addeddhcpcd_linkoverflow%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messagesdhcpcd_handlelinkdhcpcd_handlehwaddr%s: %s%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.3.1--getconfigfile--getinterfaces--listencontrol command: %s146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:ALRMHUPTERMUSR1:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:-4-6[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]Copyright (c) 2006-2025 Roy Marplesdhcpcd 10.3.1 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:%s: /var/run/dhcpcd/%s%s%spid./main%s: chdir: /%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.3.1 startingsocketpairfork%s: setsid%s: eloop_forked[launcher]spawned manager process on PID %d%s: pidfile_lock %d%s: control_start%s%s%s%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPIPv4IPv6/libexec/dhcpcd-run-hooks /var/db/dhcpcd/duidDUID too big (max %u): %s%sduid_get%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duid%s: %s%s%s: hardware address randomised to %sif_discovergetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init SY^}22,^222.4jn22v282=Iy21G6~2Bt!',:?DI^ssplitv, invalid CIDR: %sinvalid IP address: %sadd_environ%s: no assignment: %s%s: per interface scripts are no longer supportedparse_option/dev/null%s: hostnamehostname cannot begin with .vendorclassid-1failed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendorvendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slllltuuidnoneptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=routes=static_routes=classless_static_routes=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthrequestincomplete request typenorequestoptionalincomplete optional typeindexincomplete index typearrayincomplete array typetruncatedincomplete truncated typeipaddressip6addressstringuribytebitflagsuint8int8uint16int16uint32int32flagrawasciidomaindnamebinhexembedencaprfc3361rfc3442optionunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable namereservedtruncated only works for ip6addressbitflag string too long %sno authentication supportcontrolgroup: %s: not foundprivatestableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument b c d e f g h# i j k$ l. m5 nؾ o< pG q rM sT \ t ud i  vo wv x{ z y A B C D E F G H I J K L M N O P Q S! T& U0 V: WD XN Z] 1e 4n 6w | ~ }       + / 5 < E  ¾ M U _ l v         " / = I option requires an argument -- %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:strslen >= len + 1alloc_args/usr/src/external/bsd/dhcpcd/dist/src/if-options.cstrslen == 0default_configread_config%s: embedded config too big %s: %sinterfacessidprofilearpingbackgroundscriptdebugenvconfigreconfigurehostnamelogfilereleaseleasetimemetricrebindpersistentquietinforminform6timeoutvsiovsio6waitipexitallowinterfacesrebootnoarpnobackgroundnohookduidlastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llmanagerrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesoneshotipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbackipv6rsnoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forkipv4noipv4ipv6noipv6noaliasiaidia_naia_taia_pdhostname_shortdevnodevdefinedefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequireddhcpnodhcpdhcp6nodhcp6controlgroupslaacgatewayrejectbootpnodelaynouplastleaseextendinactivelink_rcvbufconfigurenoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULLrt_compare_proto/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULLnnPlPl(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %sctx != NULLrt_disposert_new0rt != NULLrt_setififp != NULLrt_newrt_free&ctx->froutes != rtsrt_headclear0rt->rt_ifp != NULLrt_proto_addaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt_recvrtrt->rt_ifp->ctx != NULLpid %d deleted,m,mrt_build%s: if_initrtif_missfilterif_missfilter_applydeletingrt_delete0l0lsa != NULLsa_addroffset/usr/src/external/bsd/dhcpcd/dist/src/sa.csa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbackbuf != NULLsa_addrtoplen > 0link#%dsa1 != NULLsa_cmpsa2 != NULLsa_toprefixsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixsa_fromprefixsa_in_initaddr != NULL# - 6 = A K T _ g l t - %s %s_%s*(bufp + 1) != '\0'script_buftoenv/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbintruefalsedownunknownupPATHPATH=%spid=%dTESTreason=%sPREINITCARRIERNOCARRIERNOCARRIER_ROAMINGUNKNOWNDEPARTEDSTOPPEDinterface=%s     protocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=%s STOPif_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnewmake_envnew_script_runreasonDUMP%s: executing: %s %sscript_run%s: %s%s: waitpidscript_status%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuelinkdhcpipv4llradhcp6static6interfaceprotocolreasonpidifcarrierifmetricifwirelessifflagsssidprofileinterface_order(none)localhostlocalhost. embed encap index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest truncateddhcpcd%s-%s10.3.1%s-%s:%s-%s:%sdhcp6_nd_, 0123456789abcdef%s_%s1%d%u%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6dhcp_envoption%s: %s %d%s_%s%d%s_%s%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 uint32 dhcp_renewal_time define 59 uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 24 index embed route_information embed byte length embed bitflags=00011 prf embed uint32 lifetime embed optional truncated ip6address prefix definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt dst != NULLif_copysa/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0if_opensockets_os%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK) ifadata != NULLif_carrierrt != NULLif_routert->rt_ifp != NULLrt->rt_ifp->ctx != NULLif_initrtif_ifa%s: SIOCGIFALIAS bridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompile( PT@P HEPT$ @CDHDBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not founddhcp_openbpf%s: %s%s: eloop_event_addbootp != NULLget_lease/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cPREINIT%s: using ClientID %s%s: using hwaddr %sdhcp_initreading standard input%s: reading lease: %sread_lease%s: %s: truncated leasefromviaNAK:log_dhcp%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s , ; D %s %03d %s%s/%d %s%sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%sdhcp_bound%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsTESTRENEWREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %sexiting due to oneshotRELEASE%s: releasing lease of %sP Y _ g o    s BOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAILDHCP%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULLdhcp_inform%s: DAD detected %sEXPIRE%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last leasedhcp_start1%s: dhcp_init%s: discarding expired lease%s: waiting for carrier%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sNAKIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressoffereddhcp_handledhcpignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %sdhcp_packet%s: %s: short frame header %zu%s: checksum failure from %sdhcp_readbpf%s: unexpected event 0x%04x%s: redirecting DHCP message to %sdhcp_recvmsg%s: truncated packet (%zu) from %sdhcp_readudp%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVEROFFERREQUESTDECLINEACKFORCERENEWstate->addrinet_dhcproutes/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host routeaddr != NULLipv4_deladdr%s: deleting IP address %s%s: %sipv4_getstatedestinationbroadcastipv4_addaddr%s/%d%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedipv4_handleifa tcrer/etc/group: : :r/etc/master.passwdOOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJ0123456789 : (malloc) Error in munmap(): AaJjHhPUPuVvXxZ z ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: ) (2^--- End malloc statistics --- ????: (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS' : (malloc) Unsupported character in malloc options: 'malloc??VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B: (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory .4 b: b@ cF 0cL PcR pcX c^ cd cj cp dv 0dalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigit: %s%s%s 646towlowertowupperalnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ & ! !         @ t"lr"hp"ASCIIcs_path !X ! bc_base_max( ! bc_dim_max( ! bc_scale_max( ! bc_string_max( ! coll_weights_max( ! expr_nest_max ( ! line_max( !  re_dup_max( !  posix2_version ( !  posix2_c_bind( !  posix2_c_dev( !  posix2_char_term( ! posix2_fort_dev( ! posix2_fort_run( ! posix2_localedef( ! posix2_sw_dev( ! posix2_upe( ! stream_max( ! tzname_max( ! atexit_max( !/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m (%s)aaaaae%JaaaaaaT[ !~ ! !@ ! ! !, !Ђ !t !$ !* !`0 ![:<:]][:>:]]alnumalphablankcntrldigitgraphlowerprintpunctspaceupperxdigitNULSOHSTXETXEOTENQACKBELalertBSbackspaceHTtabLFnewlineVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopslashsoliduszeroonetwothreefourfivesixseveneightninecolonsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d %juI7$uappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/XtyXX/dev/ptmtty/var/run/%s%s.pid%d oh  SL} 8" s$$ januarygmtmidnightyearama.m.pmp.m.dst !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: mnnoonmiddayabcdefghiklmnopqrstuvwxyzututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirstonetwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekdayhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurthfridayfrsaturdaysa,full-duplexfdxhalf-duplexhdxflowcontrolflowflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTPUTP10UTP10BASE-T10base210base2/BNCBNC10BNC10BASE210base510base5/AUIAUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s',ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed %s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]{wsokgc_[WSOKG ?;73/+'C#unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfsr%s/dev/%s%s%s%s%s%s%c%s%c//dev/zvol/%sdsk/dev/zvol/%.*s/%s%s%s%srTERMinitscrTERMUTF-8d3Inkey wstate screwed - exiting!!!8-xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymap sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey state screwed - exiting!!!HeNKcsp != &blankmakech/usr/src/lib/libcurses/refresh.cunknown   '++ 9L.DDϲ;15MS7) |;p%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9usebel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^J,1nny:mWnC!n75VPLHD?;9/-11)15-1$1TERMTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansiansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbdumbP  R vt100vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220vt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25wsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxtermxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>cb'''''''''''''''''''''''''''hn''bk'''''Y'Y'''etq,v3use%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangebwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %K6Dzg Tr_I" 6A.o\vI16Dzg Tr_I" 6A.o\vI1" acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C025J.0tcr>q Tunknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatch`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @invalid block typeinvalid stored block lengthstoo many length or distance symbols     invalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat@@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler invalid distance too far backinvalid distance codeinvalid literal/length code deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N61.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cps->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_key/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)_prop_string_rb_compare_nodesps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)prop_string_create_cstringprop_string_create_nocopyfmt != ((void *)0)prop_string_create_format%s%s%ssrc != ((void *)0)prop_string_append_cstringstring"%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON_prop_number_externalize/usr/src/common/lib/libprop/prop_number.c%llirpn == pn_prop_number_allocinteger0963array!((*cp) == '\0')_prop_xml_intern_find_tag/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON_prop_intern_decode_string?xml !DOCTYPE plist