08PBi'&<  'Bi6nP''`'&. &.Bi'&P@@<@T 08PBi'&<  'Bi6nP''`'&. &.Bi'&P@@<@TU Bi`'&.yABiBiBiQ$f BiBiBiRABiBiBieABiBiBifABiBiBigABiBiBiABiBiBiABiBiBiABiBiBiABiBiBimKZ%BiBiBiX`hpx$BiBiBi (08@HPX`S$=BiBiBihpxP${BiBiBicQ$BiBiBi (08@HdIABiBiBiCBiBiBiABiBiBiABiBiBim<BiBiBiPX`hpx\$BiBiBi$BiBiBi$>BiBiBi$BiBiBi$sBiBiBi$BiBiBiABiBiBim BiBiBi$BiBiBi $BiBiBiABiBiBiABiBiBiABiBiBiABiBiBi$QBiBiBi (08@HP$BiBiBi $BiBiBi$BiBiBi$BiBiBi$BiBiBi$BiBiBi$BiBiBiABiBiBiABiBiBiABiBiBiABiBiBiABiBiBiABiBiBiΰa|8g40TӪ0y9mh̩%Ps{9G!s9[0od`@)(M3fw{^~ K4.*EsF)zY?@]Z@E'5 gu8\|&. . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.7 2020/01/09 19:17:43 martin Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF@4V%4 (@@::""z]z]n$n-n-T ,,n$n-n-NetBSDKwGPaXUYSRHffffffffffffUVS( o-9s 9r[^]UWVSuZ(]P PL1uQtuYuf9s|1u+z 9suփ 9r}tMtH~t=111t8uqt4#t*v$u}yAK[^_]ËUQȋAE 29scUMM\ E9s<uhv.&tED u|E9rċUM9tu 09bZt*th]9nUWVS(E@@9s{*3;9r[^_]UWVSrW(E u S.M <(9ME @E -t/tuEUEt E$BWl$4W o-9s 9r0"$ WED$E D$E @$膃$@Qn-9h9rX-4D$ D$ D$$1ɉL$W$MB$SW(5u1ƃ5$tЃt^$k_[SWÉ(4uYƃ4t|$^<$^kt(?t<$AktЃ_[UWVSh"h"hJ.K] A&1t:PYxOvhJ.j DCXZ3h%hJ. ] hJ.j CjOUEU MsMU HE]陁UVS1ۋC&tVPlZYu C&C܍e[^]US脨Ph"hJ.x\hJ.h"ܪD& CtsPhב"hJ.D\jNUWVSE tuhޑ">URhc@5 T.諈¡$T. t Ph"j˫ud#~#]]ܻd#}~#Ud#~#WVSuQRPh"WE td#~#RPh/"W u5$T.h="W1e[^_]U5 T.`PXUjhc 5 T.؇ t5$T.hV"j1USRj EPS" xU:t Shd"j蜪]UPEU Ph}" JtPh"&=EEEPhc5 T.= t5$T.h"j_1UWVSSuE H1ۃv>PW ZYtCݠC&uދݤC&Eh"WZY1tFEEPhc5 T.諆 t5$T.h"jͩ1e[^_]USu ShΒ"j|]UVS1D&tSP\ZYtFSh"jFD&e[^]UWVS ]u} Sh}" } ~Sh";}1{EFE} t!v"R1UWVS`] u~ uh"Uȹ1Rhc@5 T.E 5$T.h"j R.DPEU ЋU Шu>M9Mt65EE1EEEK>tt,uh"#81}}}}}E뺉t9Wuh"j5U9Uu[}t }uEEEqEeEEVEEċ]9]}}t#}t}uE}uEEEԅu.u9u9E4ŀD&5$T.hē"-Q }t*}uuuuM9~VQuhؓ"jQ1ۉ]Ek]lS]EYu h"j+1}E1҉Uuĉu܋uu}}UUMMPh c5 T.ۀ u EX@1}Wue5$T.h"jEuPE4ŀD&h#"DPCE rh+"X^ElU9U|S.<ES.]"rt9U}I}s}u,@)1ɉMMf>hS.h$OXZCtCPhq$O_Xj N^CtCPCPh@"pO CtC"PSha"WO Cts؋C4ŀD&h"7O C$Ph"OZYuadXEw1e[^_]UEDU.]UEU.]Uh"j/Uh-"j UhD"jUhZ"jUE E EE]Uhjjjuho"oXT.\T.Uhjjjuh"go U.U.Uhjjjuh"WXuWh"j=SaY_u Sh"jxxuSh("]hjjhD&EPCuu뺋hT.#H t uhB" PhT.WPZ_hT.t(#=t hT.t hr"2XhT.ƒtuh"<t?%t4!t$t hT. hT.h"j&xT.e[^_]UVSPT.uX$U.T.(U.,U.T.T.;T.T.rgjT.$U.T.T.(U.,U.X=50U.u4U.E $U.)EU}t 13A}uke[^]Ë(U.,U.ut T.T.UhE&h$jUUhE&h$jݝUUSË@4URs(PZYts$h$jҝS4K(E%= u(HPhm8@QRƒ t C !jjjQR Bu@u8uK ]USQ09s SVZSPEPPWƒ 1uE]UWVSx(w-Ë@4jjWP ƃ y h"jC4WPs(Xe[^_]UWVS]uVh@T.j@C4uu s(P(98jVj?$%8؍e[^_]UWVST.}t T.T. T.T.EUEUEU}uHjT. t?11ҋ}9׋M} ytEU`U.dU.E`U.dU.ut(jRP5U.U.P Bu@u 5U.h"MuShT.Ɖ 19|8uu5U.h3"/8t5U.h$j臛11`U.dU.utTU܉EE܋UT.T.5T.5T.RP2T.T.T.T.1ɉ `U. dU.5T.=T.9}u;9uu6E9T.u E9T.tT.T.|T.T.lT.T.9}u9utTU.t%=XU.uXU.5U.hE"-XZU.t5U.hi"jB)u}T.T.+EUEUT.T.5T. T.9uEr uM}u}tURT.)P5T.4 T.T.T. XT.\T.ut5T.5T.hT. ;T.C;T.7벍e[^_]UVSˋ |U.yQj hd#RPVuV8VSh^$?(e[^]UWVSljӃ=U.t%tPhЙ"h V7>h PVʟ =U.wwVPhؙ"F?w$w wwwwh"*?0wxw(wlwhw\wXh">ރ } tU.@tU.HU.pU.=ta=t=t+e=@u^lU."FlU.ݚ"hU. {ƙ"=U.t"lU.P~ZhU.UlU."hU. ?=U.t lU.R$hU.4-hpU.hhU.plU.Y[pU.~4-?4-hU.94-}4-=U.t.t h"j5lU.h)"=XZd=U.u[4-h"Ph"P5lU.Ph["VVhf"I=(=U.th"j h"j h"%=h"DXGWO_)Ӊ+G(W,ȉ=U.!=U.th"hF&hC=pU.hț"hF&hDh":uDžF&t1jj@PEwpU.tM9މDžs,11RP,L1󋍤tM9މDžs,11RP+L1󋍜t;9މDžs11RPww2+1ƋG_RPPh֛":(=U.=U.t w>1V.V.tPϴ5V.*E1҉V.YX1V.V.V.1UV.t*PNV.ZtP胴5V.D1V.ZYu%UjhhY.h@J.i2 tjV.V.V.V.U.@=uUSUE V.U.V.MU.Ћ] Ӊ)~U.@[]Ã06$G&1ølbXND: 0 &    t øUWVSӃu]1W.2W.W.@ujjhW.hW.thɞ"h$<Y^W.W.W.W.`W.)W. W.1W.2W.W.@ujjhW.hW.thɞ"h$1<XZSjjhW.Ce[^_]UWVSƉ׀:0BtjDW.u DY.C1 mCE @W.98Y.؁}ULQM5DW.5ZYMUuXs0?Ph$hJ.x&hk"&18Y.H8Y.t $Y./t1 @W.DW. 8Y.u$Y. u DW. KF @t.\s0?Ph$hJ.%h"1ttDW. !uhF_$FPY_Vu P"ƒ u$n0:PVh<&hJ.!h6"RuSRUǃ Uyl>!u7RZy4n0e:PVh<&hJ..!hN"P,R;ǃ=,Y.uWh"hJ.  tE)؍X؍e[^_]UWVSW11 DJ.yh@J.*=^u@J.P@J.s=TY.9 XY.8Y.؁}U|WQ.ZYUu[m09Ph$hJ.K hk"&m+8Y.H8Y.$Y.tjJ j! =TY.XY. 8Y.u $Y.uΨu١XY.uDY.1ۉ߉ uW.XY.0XY.PY.uLJ.@t?m08Phg"hJ.hr"*f%LJ.1PY.-fLJ.9t{t XY.XY.PY.މe[^_]UWVSWPY.C{ u)ÃEPY.<TRP Y^tELW.9HW.8Y.ށ}VR%-_ZuZl07Ph$hJ.hk"&)8Y.H8Y.t1$Y.tjtjk 5LW.HW. 8Y.u $Y.uҨu١HW.5PY.ljD s} us*ExtXY.M| thr")[oELW.9~VHW.8Y.߁}WR#,ZY=LW.HW. 8Y.u$Y."%HW.25XY.NjM}t1s2PRd¡HW._YtD } )s!LW.9|X HW.8Y.؁}tVQt+ZYK5LW.HW. 8Y.u$Y.svHW.Me[^_]UWVSQ]utuh"XZ} 9EueF95<-}hJ.hv%j^XP^w<\u7\>t.ˆUPh"-ZYUtF-"" /B000CL 1e[^_]UEH!$Y.EPhht@jSH x$Efv@-Efv<-U=W.uEW.E W.W.W.~9 1;X.~h%]&XUWVSX.}t~} t 9X.~[C ~KX.tIS P>ZYtF=DY.tj jvPjjjWu莇u19X.uh"%X؍e[^_]UWVSP]U u h%%XU19X.~BPSYX%KMX.uSwPux?]9tWsZu̸1e[^_]UE R.DBuh"%XPt[jX.t P&FXPPj/ƃ t9u =@Y.u5!5W. Z PY.뛃=@Y.u 5W.5W.WZYu5X.릡X.PP_XuPY.Hnt*ptlt PY.8 tK PY.̃=@Y.uu 5W.5W.Y[9X.;X.@X.=X.PRPY[1PY.Hnt*ptlt PY.8 t PY.̃=@Y.uW.W.9 RP>_ZBPY.Z=W.1Hnt@pt)lt1 PY.8 YWiSP+ h PY.뻃X.PP[^CPY. Znt1ptlt"PY.: PY.ăX.PP6ZYW.U=W.Uƅ=W.Uu h"W.;X.W.=W.9|9}h"pu PY.PY.Hnult PY.8 tσʃ=@Y.uPS?X.PP]^_PY. Znt-ptltPY.: t\PY.ȃX.PPY[PY. Znt>pt)lt/PY.: ^P5W.5W.1 PY.뷃1=W.\Pnt,ptltPY.8 tPY.σ1=W.u7uD-W.=W.H0V PY.wr 8 t ك=S<[t<\t.RfZÅu!h $ { uh"*[1C뵉) [.9=[.8Y.Ё}UtVW%ZYUu[ A0 Ph$hJ.hk"&8Y.H8Y.t$Y.tj\jg5 [.[. 8Y.u $Y.uΨu١[.5PY.ljPY.=DY.tj jRP9e[^_]USPY.< u h" XH< u=[.u$h3"XJ PY.R8tڀ u ӡ[.PKXu1[.t=W.u PX9j[.Yu(?0y Ph$hJ.Chk"&eK1҉W.50Y.S5[.C(¡[. t+h'hY.PRp25[.1[.R]UWVSVPY.PPY.M1ۀx%u8HuzPY.=$[.h¡"[s9}ePY.PPY.$[.PY. \PPY.$[.2<  [.PY.M8 u$[.8Y.ف}|WRpZY= [.$[. 8Y.T$Y.tj8Y.H8Y.j$Y.U5 [.$[. 8Y.u$Y.[.$[.$[.e[^_]UVSVu] 1PY. u 1ۉ[.UPY. Uu 1q8u@PY.JπwE<1ɉj hPY.5PY.J[ vm<8"uh"'1Zgu@PY.됸e[^]UWVS 5$[.][.=[.}+$[.;[._&M 9}y;M)9 ڋEE8Y.}RUuZYUu];0bPh$hJ.,hk"&N8Y.H8Y.t %$Y.tj%tj[.[. 8Y.U$Y.uΨDϋ [.M9}}EMELE B19}})É<\GVrω0;UU Mr3)9 ڋEEW8Y.}RUuZYU[.[. 8Y.u$Y.t [.M9u}EMELE B19uu)d9|T8Y.ځ}tVuZY65[.[. 8Y.u$Y.ad[.Cw9|T8Y.ځ}tVuZY5[.[. 8Y.u$Y.[.؍e[^_]UWVS] SZ=DY.tj jsPӸCjPjuOXt 1E1 [.}t9U3 98Y.ށ}V5[.5Y_u[80Ph$hJ.hk"&8Y.H8Y.i$Y.tjQjz5[.[. 8Y.u $Y.uΨuك=DY.tjj ] [.NjEpSP  9~U8Y.΁}V5[. _Z5[.[. 8Y.u$Y.=DY.tjj S舶 [.Nj󤋅  ?u9Ћ)ȉË ؍x[.9<t ttjPju}Uo8Y.=}tV5[.ZY5[.[. 8Y.u$Y.~2 u)u thG"HXDžS=DY.tjj S, [.Nj󤋅 [.f Qe[^_]UWVSX.W.HX.1ۉ]1W.+W.9UX.@X.P藯uu PuƃUX.PP[Z[.3E8Y.1SȰYu' 8Y.$Y.tjtsjX.t PFZPPjƃ t9]u 8Y.u $Y.uuEX.GX.E  Euh"XE tu RR x1e[^_]UWVSX.EX.E=L-t =H-uhb"FZo=([.t e[^_])e[^_]UPEEjEP54[.  U:.h"Ph"hJ.)jUWVSf@8uVu1Q`/1҉hW3à ;/8#)tSWV e[^_]UWVS} 54[.fDž<Y.1҉uJhPjS u.8.8thB$-ÍjjP, @ub.8thϤ"j0f8utSVW y..8#Qh%)AjWj9fDž=8[.t fDž9DžjRj fDž9fDž94[.jSVO @u-8tfu ftR.@ufDž=8[.uK"4[.@uσfDžftv@u KfDžMe[^_]UWVSQ}u VWe[ZÅuzjjXZu h "j//;s jEPW]Kƃ ?tE8thh"j.l,8"u wڍF=wfs؍e[^_]Ë@t@Ë@ t@Ë@tË@htË@ttËtËt8UWVSUE x}pHXz}z9zu};zu 9u{9Mtt9u 9MtiH$z$ ~ U~Nx9zu9t):JR ut'p@ u t19Í\ZY[^_]USEE ZAR9QD[]UWVSƉ׋EEE EME19}9xu90u,]9Xu]9XtyB݋EEEE19}9xu90uU9P uU9PtGA,Ck,QMuHZYMu#Tԉ2zur}z uE1e[^_]Êt"tUWRPY_}ËBt1UjL$qUWSQ-`[.v=@[.ڞv]=H[.]5T[.5P[.hե"j5\[.5X[.h"j 5d[.5`[.h"jt5t[.5p[.h"j\ 5D[.5@[.h3"jA5L[.5H[.hI"j)E$h_"jEPP$hx"j =x[.tJ=u@[.1 ujeY[_]aÃ=x[.tUE PujB UWVS}u _Ph"j}3b[.B9tT[.e[^_]UWVS$ ]5[.t(V*$Vn0Y^ugh" j0Pu N& yWp4$g0ZtWVP8 u WhΦ"O5M&jj0։( y0h" jju ։ƃ A Wh VN&ƒ jjWN&‰ V N&h _Xuh"j[^jh h R(N&y RY߉RZ=t*w=bt%1=bt" =tu h>"11 Њ Јt u hJ"jYu Vƅ/ t jZV8 jZVPX fjjP% [.2tS SQPR(c%,9kP(Ɖ4W8t t10hb"j_ ^9s1BFu h"j/ 1e[^_]UWVS\]ƍ}ZE5 N&(,%%048EPSUe[^_]UWVSĀ]p$tV9V/9Y^㋃p tVf9V9XZ㍅xP1RPuut5-9ΉЋt}"Q75-VPh"1e[^_]UWVS] }AƉI1RPuurt C|WjVȃRP<tCuPhħ"j^71RPuuͻ‹N tvkk ыEe[^_]UWVSTERELIu EEE EE؉1 t1҉Ƌ] ڋUӉe ƉߋEE$EȋEt\EU 1 t1҉E܉UEU}9}}}sE܋UẺU1}}t 9u9uEUẺUF uuuE,P# E =[.E ‹EJu EDEO1 t1M ϋEe ʋ}t}\SQE,#h #5[.Ãt#EhSjPVHt h"^SY`[.d[.E0P[.T[.E<1҉UEt E\]̋u)։]uEEIu E E1 t1WVuu9E #E1҉ t1EUWVRP躹9E EEEEuűE,|"Eԃ Et8"EL0wEԋPatELhaRuuPh"3CPEԃP2‹EԋXX9t"ERQuuPh<"j)E؉EEEE̋UЃE܉U1ɉMMMċEE}$tWW}9t }O]K}9:t ] [}19]9Muu܋E,!EujP1Eă1EEËEt@d9s+tNjuE‹Euu}OEJUEMQRPuEPE]tXpXjuL5XZ9u9]EE@]k,Pu ËEY^k,tԋUEVFF E܋UFVEEtP4@0P,@(FVEƒEt@P@ltȉF Ek,Dԋup(ut H}P$]GVEXE`1 t1u}tE]9tE}?Et\]̋u)։]uE‹EyJu EE1 t1WVuu蛵Puuh"jEtP @@1ҍMQRPuEPE0ju231ۋE;pEE9shI9uEtpp Euu܋E,ujP-EċE1 t1u}C놨u  EE]k,PulXZu E}ȉ81EEE9k,]Kt[ 1ۉX]]u LL\HX M܋]HX]]tK0[4K([,HX]KH B9EutC E@ b]k,D$uu܋E,{ujP`,EċEk,Z(EiB$ t1EUFЋ]EEt  E}U}ԄtOO9M}1ۄt_9]u 9MGEt\ű})׋E?E9Iu EvEEÉ1 t1RPWVSPuuSh|"jE]ȉKEԋP9Ut,E:uRuuPh"jNE}8E}ȉ8}u}up[.t[.EE܋UẺUQEe[^_]UWVSuEPG1F VM]_9EEr )ӉM؉]܋Fƒu]uFt 11ENjE9sPu h"jpN͉1+MF@UtR UR)M]E9s )E]1]9؋]sU܋EЋEÍEeM1SQRP谵FVe[^_]UWVS]E 8w1ɉMM9UMK}HPH EU,hj,RWc}EEPhEN&ƒyERPh"j+xhj,3W}tE1҉ES1EEE9EE}FN9N u;tEUSE 8}tNEEU,뷍e[^_]ÍL$qUWVSQ8΋QYRPh/"1ɉM؉M܉<EPURvSOE܉EUjEPURSfMM܋E؉Ẽ1҉UЉU19~k,ŰD$EUGm]P<E1Em}@[.@[.H[.H[.EЋUX[.\[.ẺEMEPhN&ǃ yNTQWPh@"0FPhN&ǃ yN"QWPhf"j>1eY[^_]aÍL$qUWVSQ9q[.[.,[.[.?1|[.[.1[.[.1h"VW ta#DtNJC7[.뷃b$DM&[.[.Cx[.C[.u57"[.e57i[.R57[.@[./57|[.[.57[.X7[.hJ.h"GYXpC.)lj80hJ.h"XZ=[.x8th"5[.t hQ"j5tjj)h "h+jj [_@u h"jj h "hj00h"@P@ uh"t|j/SoZYÅu@#j@[.׉hjXhjLj`$8[.P[.1urh "jIj [.؉8hDj803PtP3h("jW5[.HOG9=[.=[.tf95[.~W[.4!F_烽(ta1ۉ(,,9[. |[.d=[.tj6[.xrP[.0j[.dh1҉ldPh [.N&à t$8: ha"j1 1ۃ=[.*;,[.,@XRjPjj(($tLPhI"DXP 28rt)rz rz04z('JJ 04zh P&UP[.T[.f8ZY9tFS‰Yt"Ph^"j jPh"9 Phw"jz ‰Ju tH‰R840Ph"1 tH89s`u[1 t1+049Ɖы0|9Ɖ4}LV 9Ɖ4|9ء[.40[.<0X108014߭0ݝ0y11WVRPɫ߭ N&ܝ0W=[.pݝta\P%V  ݅y؉RPh"M\`+EU5[.9Ɖ# >jVZY@݅u؉Ph̫"j[.ܝp N&ܝ0 YLRjP011RPJ$01tZL9rKjQ#^X090Q_|OlaGl막9skQ k4 JHJZH XH J HPW4 |0u|0tGlDhjP88xuxuDPh"Y[, 1҉D<5[.[.8Hȉ9r09rÉ014840Ph"840Ph"j04 41119q09Ћ4N8JZ8<<u 8^9 +4i۷m۶R<8SPh_"DPh[.SW(~JFD\`HP\Ph[.W\DH[, X049Ѹ4}u01480Ph"1ۉ8Y98r;D\`j\Ph[.W\D𙋍09ΉЋ4}88SKut+4i۷m۶QRSPhɬ"kDPh[.SW$~FJ,TY8$D8t[.11҉VPh"B98~k,D$Aۉ<014߭0߭@[.@[.H[.H[.X[.\[.1XT011198t)k,ȋ0I9Hu0;0Putvt_|TRXR81RP؃RP10P @ 9|0,PQpQRPjW'k,Љ1;P}0PTQXQ8)Q t p룋Tșڋቅ}؋ቅ  =[.t 1P[.k,80$98p09~Љt$DPSh"pPhN&ÃQSPh'"j #tV:t&PhL"j,.gPh^"j,G$)08<11ۅt;k  袋9.}*WV h*"j,fk,V菳4Z1ɉw03PHD hP"j ,蒻_k,4 1󫋵 2zrz ,t<@PtȉB DH9v@l¹9} t8Phj"4<@8tGpBu訯E[.-Xe[^_]ÍL$qUQ [.[.5[.5-N&EM MuQQ$RPh"MɍaUS]CtS P S tSPSCr s ZS [.X]USEPsH) [.[. [.H1҅u0[.Z[9t [.u[.u h%"jX4CXtYZ@]UWVSu EEE#-[.[. [.M11ɅtJA9~ʳ9M}#t[.h9"hM&hhH"^}9x4u }9x(u9p$t버t[.e[^_]UWVS]uuu SO trNj@thj"hM&h1GGWX9w(~6Gth"hM&hhH"wVw G [^WY[.-;[.X=[.u =[.uBGWu[.GWtP[.WGtG4WPZWX[.j@j4Vj*G _4E UG$W(G,W0wE #-G8[.tz8GC GtWP { _ Ge[^_]USEM Puh"hM&h4hH"P ʉPHPPP s E]XPs2H [.[.[.1ɉH [.H[..1ۉXt [.H[. [.H[.P4JH8[.9t!tXYX tAP]UWVSUu }uWVRcËECUt[.R[.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQN& RPWVQN&e[^_]US]C%CSjSZ1]UE UMQ1]Uj蟄UU P \.PYtHJ \.@ \.UWVS] \.C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpdĨC趨${s袨 ]e[^_]鐨UWVS uE EEEE% \.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP^YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jlxËEEC1CC]C'^C :f1C C$hj1xEhj"xM쉁jhjxMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jREEpduSۛIE싀}@u jR]^_}E UG(W,}x0xdEtFVtRP>\YY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u\.EE % \.S0tK0J4 \. \.C4 l.C(tS(P, l.C, l.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hM&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hM&h)h"@륋B 뵋EEPJtEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"L}t/EEtP1uuRPh"]9]tSuuuh"uuk} WY[9t$PRuuhO"̨uq1҉U u_XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRPje؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"֥C(S,C S$]9UrSPWVh"訥nWVh "蔥 Z}t5EtC(S,C S$9Uu9EtPuh0"T EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRPfEuuWVf9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV.f9Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi"ۢ.uH‰?9u*_YӉ9u9u :9r 9r}thz"yhJ.VZYtFpVtFHuRPuWEU}t h"XXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"象$l./t `d)RPh"z tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jHiE1ɉHEMAYA1ZA XZ1ۉY Y$XZ}th4jiËE쉃\XZu u =-ƉE} t h"X-EPjh WVuh4jhËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4jgEEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"i~X@Et} t#h"J~Xu uuS9u u見X S蝋X]tS舋_13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWhySXZ؍e[^_]UE Puj- UWVS]FHE1RPuu _t C|}WjuȃRPVetPu h"\ u~ 1RPuu ^tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuo^€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVh׶" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuuRt C|}WjuȃRPV~tPuh"u Ep 1RPuu7Qtփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSX$l.t C0S4C(jj\0uu Se[^_]UVSUE 9| 19[^]USPPhF"hJ.ihJ.h}"u-CtsPh T#hJ.hjg[USSE] t$uhaq#sqZY¸tr1EEPhvd5Dp.6 @u35@p.hU#jW]UWVSPu }t}~^h2#SY_DžtFhpQ#S_Zt)hF_$SڦZYth"Sɦ[_t뫿}}uh\y$v蚦ZYuUEPhud5Dp.e @u65@p.hU#j膷e[^_]US}tQ,Shzd@5Dp. @u5@p.h"j:RPF=vu.UWVSQ5.At t)t%Pσaw <v ;v ir_yGfw$k C E1E)л 19u5y$R.1TtDSt!@ u 9t1 Z[^_]UMU 9|]UWVSƉ׉M..ÉEE1RPWVpEE)Ɖ1UQh%UXZ}Ut.H9u.H99stBRWh"T e[^_]U塨-=.tvPh""T5ĕ.5.5̕.5ȕ.5Е.h+"T 5.5.5.5.5.hT"eT5.h{"UT Ph"BTh" \ȕ.̕.5-5ĕ.5.QRP5Е.h"T,h"[..5.5.QRP5.h2"S 5.5.h"S UWVSQƉ薤1ۉjEPVO >u#ËE8uj8"u w܉1e[^_]USޢP蜓$d#Phd#Phd#Phd#PSh¾"hJ.V,j9IUWVS ÉM衔-uhU"5- hk"j.׉ljEU}jؙ#E#URPQ BuAtV--=PuRJ 3P5t.RI 9-uNE!5t.}e[^_]UWVSEUσ}u "}t"EU@uSh"荼XZff=Ut+=\.t fuuSh"7ff=u%Sth"7fLJ_f=Ut1=dp.u Sh"p7Y^dp.tSh7"H7XZj(VP? x0XŃ~X .t\fLJᵃVe[^_]UWVS9.u.5.e1Xƃ.e[^_]W|$wUWVSDEUЉMԋEGWEȉŰG WEUEa"E$EtEu"11}=-E..U1҉U܉E1ɉMĹEEUԉӋERPSQ@PE؋UEUuuRP?RPuuЋE؋UEUuuRP?RPE؋UEUuuRP?RPuhi"fO,"uuuuuuuh"BO h@J.jdh.5 u h"jwh#h.SY[.]슀.< <$u { Ћ R.DQu<-"j EPh.E4Ɖ׋]h,?&SǭE؃}Ph"Sı tuh#S诱 t I =-Ήʋ .1WQRPc>Ɖuh"SO u` .ω%.ƉuuEt5.1Et 5.Et +5.Et +5.EÉ]h#SQYZ؉E8 t,h.Zƀ.uh.h"pM 59uE|E9Ɖ]}.uuuuWVh"8MuЋ}u}e[^_]g_USE Pu5h"LDJ.HDJ. yh@J.lY@J.P@J.؃ t7@t( DJ.y h@J.lZ@J.P@J.h"j1Y]UWVS M -u h"j豟Ɖ׋-ؙljEU}ؙ#E#UƉjRPQ|Bu @u--uhuPBB mR5t.PpC 9-uUjWV5-&|Bu@tt.KE!ÍNju5-R5-A 9-ue[^_]UWVSRá.u ƀA Mz΍. S}8PR9 . e[^_]UWVSEыEU u1#ˀ Ɖ+5.u}};=.}=.&"EUEUE9 ..}=.Euy.KlE9t 5.tމnʅu+.9UE}M1E܋E9E܋U}t+}t}u w{ƆoK"v"ȃ[^_]UWVS EӋEEh.@Ph.E 5.t h"jE9E|E9u|.] }) VRP75.31fǂU }u@.5.֋M)}CsKSCPKSs FS.Ee[^_]UWVSEU} u }7M] M]9 .ĕ..19UtWtN}1E9ϋE}79}E }&"=.}u1BuEP.]Ã}!؉˃u=.u =.t=.Y}t. }mhj1X.[^u hN"j謚fǀUE.EU ..EU ...t_}t E .Hu.=.hk"YS".=.;..EEU EUEUMxa] .tEV1;uE |9EE}=.}tEt뚃}.E 9.u;]t~.H.1+]9~ Fu%uF PPR3 . *.1RPEU .+E.XZEU ..EU ..>"" -""e[^_]UWVSË@SuHt+5.=ĕ.9u9t h"*Y^sǹ󥉍1󫍍@u({u "{t"Ph"XZߋe[^_]Ã=|.u x t!1UWVS|Éסԕ.tPKYYj/S Y^ZuS5-h%hԕ.rK S0ԕ.Yԕ.u hN"j5jP;XZy5ԕ.h$(^XxPSNlZY@tϋuи 9E} 5ԕ.h"V 5ԕ.h"Ah ht.S: 9t5ԕ.h$読Y^4f=v.Ut5ԕ.h'")S;ZS;Xtj8e[^_]UWVSát.u1ҸrV$t.f=.uf=\v.ut#t..t.\v.f.fޗ.U.1tޗ.[^_]UWVS á.fE򡴕....11t;f}t.E .16t.t9r $uf:t@9Ezti 9tܻՋ p.t.u$f}u=q.ׅu q.4=.t u)h9"/'Y t.uh9"h^%AXZ=t.t]f=\v.u1v.Ѕԕ.=.tPhn"&_XPh"ZYt 1=t. =t.uL%t%1gt.tp1v.҅tSP5ԕ.h"a&=.t!1f=.u1 1v.q."5ԕ.hK"ZYu rV$ve[^_]UWVS ˃uu Dž" Dž"@uhh")ZYߍ1jh"S` t 1/9Cu苅9Cus PjB ;Cuă=.t.{ t(s$s sh">e[^_]UVSPE-;-u*=\.u!URhmdPn y h,$9X.11@uh"B=t.u111Ht.~ فt.@uh"٨^E.01C;.}. ...@uSh"蓨Y[1҉U-;-u*=\.u!URhmdPn y h,$VXe[^]UWVS(ÉEU EUE؉u=.EA"e[^_]E11ɉt<u ȉh%jhhP&P46$&tPQRhJ"< fu1k t Phd#hY"c<WVhd#hn"=<u =-RPSQ!,Ph";Y[=.u! .9u )ȃ11ɉ=j-:j):XZt1.f}Ut24"J "Phd#Sh1"r9EPh{"c9~uhd#Sh"F9 =.x@9uHh;&jjPR}QRh"hd#Sh"8(R$NZ)uhd#Sh"8 6)uhd#Sh"8 ƒ< h=.[`p.Mhd#h"B8 @ tShd#h3"7WVC$u`p.vj!lDXUhN"j "CQhd#Sh1"=7RhY"+7=.xx4"붍e[^_]UWVS=.ujjju u.B=.t+5. $ֿd#uVWh;"6 PVWhK"6VWhZ"v6 EU RPVWhk"V6PVWh"B6$%PVWh"6PVWh"6 ?PVWh"5%PVWh"5 PVWh"5?PVWh"5 e[^_]UWVShEUȉM]t'BuUE$1ɉM$1uuuuE.E̋EȉEE d#1҉UUE.fE9.~5 .EE̋E,EUE$1}$&E$1ɉM$1uuuuE=.u(}t"uPh"4uuUEtuS&}t.Efu ukE }PEP諔 Ex.}u,E@]̋u}su} { }1҉U}u E@E} u@}u:E̋u}pu} } u}u.E1E EU EU}}E̋@ E1E}.ĕ.+EU EUE}5.=..E.1҉EUġ.19M~O;tAȉM>EUEUM9ȉЋM|"EUCCƉ׋MA묡 ..)9E]| h"u}ĉu} 1E} lj}.1҉EUE9EE |K} u}t?1@.t&.19M} |.9M} |1EEUEU U.t4.1ۉΉ.9u} }9M} |1}E}u.9EE ĕ.|=.uh:"o9^1>E.E }uEEjhjjjщ¸H"E .EuE1ۉ]]]] }t# ..EU...ĕ.EU11ҹuuRPQUM %FEU+EU ;E}EE}]u)։]u}tq=..E9M9MtB;t=9Eu|CC9EM}{u9ыu}EUE령.19]tEt<19E}ă|9E}}}9׋u}EUCu EUĉEUu}+u}ąuu hN"}u}tEEM9Ɖ}uM..1RPuuҋMu 9tۃ}u E9uWVjjRU:L$EUEPuhm"hv".h@J.jdh.u h"j5h.+oYvEHƀ.t'. t9EEHPh.h". uh.EPCD EUĉEU EE}tjuuu uUEKjuuu uUE.tuk=.t Ph$jSPouN}tjuuu uUEjuuu uUEYt Ph$j}um}u} u }uu }̋EEfukE } 1Eȃ}t }tf}tE .. .;] u1;MtuuEU G_Z .UׁǾ}EU}̊EG]؋})}̉Guw OWPE̍HPD3}̍_S[^E}t fǀ fu uEPkE }PB 2=.t h" YuEft=.|=.h"Z\E̊@EȋE̊XEȍE@‰.p1WVjjj" E1ɡ.p1WVjjj2"Ã(Uȃ?1ɋ5.1WVjjjA"}̊MO_U? ˆWGEȊ_EȍG‰.p1WVjjjR"xE(1ɡ.p1WVjjjb"QËUȃ?1ɋ5.1WVjjjn"-}̊MO_U? ˆW(}t/=..t Kx .u}ˍe[^_]UVSá.u h|"1X1ۃ=.u Sho#*Y^jjڸ.CXZu҃=.u=.th"1X1L=.th"u Sh")Y^ .RP1҉XZ=.tC.9.A=.~h"i)5.j5.5.RP믅<f=.t3h"0^h")[q.t=hͰ#(r.Y=uh""k Ph"(XZ hv"(XhX%y0X=.nPh#"(Y[=..PPh?"f( j=l.t>u Sha"I(XZ9.} hz" 0X;_ .RP1҉u Sh" (Y^jjڸ.XZe[^]ËU{wPh"hJ.o+jUWVSĀ|xtH.wSh@"hJ./+jS{4EZuhX"+xƉjRP|W9u9thj"f@jrSu| 9t"xthu"h"/@Xj:1}EfU}EEEEPw!$ EEEE]1E EExER^}t$uE Pu4@V&h"G&.fEEE . .19E~[tP9}u1M;u&}_PaR.4@V&h"|uu u@렃1}Mt 9sT@E9E~Yt}9Ur߉׋M9}sύPaR.4@V&h "^% }9sf}wfE@f.u4@V&h<"%Y[|}tFaP4@V&hh"$ ttt111E}.}....fš.E]9]E@ƒt<u.E}tхtu|EZE]9]uu9XEe[^_] J.yUhJ.j )XZáJ.PJ. UEU 19s f3P]UERPZYUSBHBy;B| X RQ)XZ]UWVSQ]u uh'"S'F fw4W&h"Ph."S& FPjh8"S&FPjhD"S& Shh%&*uXZFXt ShQ"uY_FXt Sh\"uXZFXt Sha"tY_Sj v(hj"Sf&v,h|"SX& v0h"SG&v8h"S9&v4h"S+&$vS6EXZEE FEe[^_]UVSSPPVu ujVSh%d,@uLznt"t"dn0 :Z"t"PSh"jpj_UVS]u VSyYZu Sh|"jp;/t"Sh" XZu E"e[^]e[^]UjlPh"hJ.^ jUVSPhpQ#P [^t,PjPuVBV@t jPZYS:Xe[^]UWVS EEu EE}]EEE1҉.2&1ɉ ..h"VuM NtJb$Y&1=..ě...뗡7.jWh@Z&579u h"joPYYț.JpC.4E)Ѓt~S6EXZEE FEe[^_]UWVS4SPPWu uuzjP~IXZt1h;$9}P\ZY uċ2jWSh7%;@uLQkt"t";k06^"t"PSh"jimt@t.Z=.HDž"=.tDž".t 83$P=ț.t ,%=ě.t "=.t $1ۉXPjh"hq&jlSh"h'"V u h "jlj/G P.ZYt|#'.Sh"h?"Vb tj/C P-ZYt|-X1e[^_]UVS]u VSYZu Sh|"jk;/t"Sh"YXZu E"e[^]Be[^]UgPhW"hJ.j@=UWVS]E1҉ 11ɉtp1h"u uI athg$[&57ECpXDžp57CtX57=CxXDžt뀃K|wK|njuh[&57u h"jjPz_:pC.P;UtM |u4uWEp ЋttKxPWZY@u Wh$jG,jptECpNtECttt E%Cxe[^_]UWVS SVpPtWu u1hWpSh"|,@uSVh"jGir@t@1RPh[&hSSh"(j USP]jEPSuU :9uySu h"jh]US]S[Zt@ h=5#SZY]US]S- Zt@ hA%SsZY]USP]jEPSU 9t :uy Sh"jWh]UVS]u VS@YZu Sh|"jXh;/t"Sh"XZu E"e[^]e[^]UEU 19s f3P]UERPZYË@t@Ë@ t@Ë@tË@htË@ltË@ttË@|tËtËtËttËHUVSӋEU tt RPY^CSt RPY^CS e[^]UWVSӋEU ΃tt RPEY^CSljtȉlj{he[^_]USt)P8X<)P$[]USt)P@XD)P,[]UWVSEUˋuE $EE tH$HD11E ~E}ufCRVڋE E lWVڋE E }t}t#RP7_Y`}tDɉ"%XZ"t9t h\"$X9}+uh"$^_ދ9|<t h"$Yh5.h"{Džx ;rh"%$XZu8u t h9"X 11  ˆK1<1P1HL@DK@#_tM⋅9t Phl"#Y^Ht2{{ @D0{{@D}"Zt⋅9t Ph"Z"_XzG1t{${Q!^t&XZ$t CpStCH\Ɖ)ULƒu 1Ҋ t1҉RPp@ȋ+tC@SDC,M)щ‰1v' 1Ҋ t19sC1ҀtSƉ׉1Ɖ׋)׀ts8{<s$BHQjPjjR t Ph".^_@ tFC8S8tGpBu Ex.-Xe[^_]ÍL$qUQ p.l.5h.5-N&EM MuQQ$RPh"MɍaUS]CtS P S tSPSCr s  ZS t.X]USEPsH) `.d. X.H1҅u0|.Z[9t .u.u h%"j1X4CXtYZ@]UWVSu EEE#-x.h. t.M11ɅtJA9~ʳ9M}#th.h9"hc&hhH"h(}9x4u }9x(u9p$t버th.e[^_]UWVS]uuu SO trNj@thj"hc&h1GGWX9w(~6Gth"hc&hhH"'wVw *G [^WYX.-;t.X=.u =.uBGWu.GWtP.WGtG4WPZWXt.j@j>Vj4G _4E UG$W(G,W0wE #-G8x.tz8GC GtWP { _ Ge[^_]USEM Puh"hc&h4hH"&P ʉPHPPP s E]XPs2H `.d.X.1ɉH .H..1ۉXt .H. .H.P4JH8x.9t!tXYX tAP]UWVSUu }uWVRcËECUtp.Rl.EEEPWVRR EUS,C0xC CC4SPZS K11e[^_]USEU HtX Y X HtJ$HtXY B$$J HtXY B P []US]C%CC4SPCCs4S}jS]UWVSMY-A,y0yq I4 s RPWVQd& RPWVQd&e[^_]US]C%CSjSZ1]UE UMQ1]UjUU P.PYtHJ .@ .UWVS] .C0tS4P4S4C(tS,P,S,s$tBFtV P V VVY^׋FtV P V VVXZs uًCpd C ${s ]e[^_] UWVS uE EEEE%.1҉Utp9sS0ud{M9O,uDM9O(uPuuu Ë@u7EEU t1C,S0C CC4SPYNS EEUO t jSXZE1u} t1u uE0x1e[^_]UEjjuuu PpUWVSSE E}Eppt^EX EʀtÃttRP YY Ct1N9u9Eu1ۉ؍e[^_]UWVS u}j8jvËEEC1CC}CC 0!1C C$hj;Ehj,M쉁jhjMAdK1AHA 19Et EXEMQjR t1WVE\UBBRUuu uxƃ(Uu7jRE Epd u S IE싀}@u jR]^_}E UG(W,}x0xdEtFVtRPHYY Fht1҉GW EWW 111E싐Eut"EHdMWV‹EEZYFMu u.EE %.S0tK0J4..C4.C(tS(P,.C,.މe[^_]UWVS4E$EE tPPE:D1ƉE̋ENjEvS5uЅyh"hc&h"8}uv0U 1E!ڋE+E 9;EE }tY@]9~Y]̀}tIBEECE܋MЋEEȉEyh"hc&h)h"@륋B 뵋EEPTEԋEvƋEE_UtE EE1 t1u}u}8uEo¸v0E E1u܉uȉuĊME t@@]9%ME tPPEJÍD19EEtP19U9EEtXELMQjRu} t1WVuEE܋P }ԋ]܉TjP}EȋEE ‹EtXE1 t1u}tEE t@@]9} tuuuU 1ۋE؋EE9I9uEEtpp EƋE2EPjVEU t1RPu|EE܋P }ԋM܉TjPc E t1u}CMu  EEE tPPE)ÍD19Esot }_] 19]u 9MPuuuh"/}t/EEtP1uuRPh"]9]tSuuuh"uu } WY[9t$PRuuhO"u{ 1҉U ui XEЍe[^_]ÍL$qUWVSQ`EAEAEA EAEЋEtppxt E@HƉEgEUu}1ۉ]ԋE9EEIu EEEȉ1ҊM t1҉E؉U܋E芀$EEt \)ډM]uuRP e؋M]999u 9u 1ҊM t11ɉMظ 1ҊM t1҉ӋEU؀}t UȉE9E|9}u9uE؃} uE‹EÍMQjR t1RPuEX E芀{atjuXZ}ucVEtK 9u׋S(C,K9puċS C$M9ErU؋EJPCPZZYU9닁{at WVh"EtC M苉9t.CM苉p9t$1SQ1RPWVh"C(S,C S$]9UrSPWVh"nWVh "w Z}t5EtC(S,C S$9Uu9EtPuh0"7 EUjuuWVSucE؃uju[X}t$EtC(C PWVhQ"EEEEE؋M1ҊM t1EUĉE؉U܋E芀E$EEtEȉU\EE+u}̋EEIu E1ҊM t1҉EUEU+EUuuRP蜫EuuWV艫9EuQEi}lj1ҊM t1҉Ɖ׋EUă+EUuuWV89Et"}tCSE؉UC EE }tCCu؋}ܨ u}uuE؋U܉EU E1ɉMjuXZE9}u }uu}eY[^_]aUWVSu} }t#ӉSQRPhi".uH‰?9u*_YӉ9u9u :9r 9r}thz"վhJ.`ZYtFpVtFHuRPuWEU}t h"bXtE;Ftu[M;NpNHș9U싆`du<9Mu7t `d)RPh"İ./t `d)RPh"] tFpVtFH9Uu 9Eu1e[^_]UWVS u }Pj8jRE1ɉHEMAA'A N1ۉY Y$XZ}th4jËE쉃\XZu u =-ƉE} t h"X-EPjh WVuh4j蟭ËEp }쉻\P P jP^_=t w=bt=btP=EtS S-}tURjh  t1RPuh4jͬEEp }}M쉏\P P jP4ZYutCHSLC419|} tMhS"sX@Et} t#h"TXu uuS9u u X S X]tS _13)t ǃ ǃL tX\1t.1}u}t@EUCHSLX`d1ɉt}u8}t 0}u&}u tCHSLEUC4EE uEC4uuE0jjSWh4SXZ؍e[^_]UE Puj- UWVS]FHE1RPuu Ȥt C|}WjuȃRPVetPu h"\ u~ 1RPuu (tDTEU"vkk ׋GEEjVXZ1M9ȋMȸ$Et\u})׉u}‰Ju 1 t1WVuuy€}tKt19suu苃0uu SZe[^_]UWVSE@E@0Et E|E2] u t]u}tE1ۉEEƉ׋E t1 9E9ƉM|BEE0Ɖ׋E t19E]WVUEZY‹E9sq~m1}tEPWVE ]EËERPʋEEH[^}t EP4PRY }9},|#] ]Et E!ËEU t19r^Eމ}t(SuuuyE}@,@0E@dpx ECuuUED_Z9|7} EPjRuuuE}1}tEPuuًE }EPEPEPuuuuƃE11 }x}tGu xuƋE|U9|~<u@EE@dpx xt!u |}}uEڋEuu ڋE|5ڋEUƉ׍EpDžlEPpppue‰EpxuZ J1E@,@0;Bu1Z4E, t1r,z0B BRS^pH]{ EGu(u$EtDEƉ׋C4SP[lpl9|}uuUElZYPuuuD‰EEtxB,B0|t |t2EMEEME|KENt|URjPWVutWVh׶" LEP }tDP4PR;Bu2E;ExB,tB0tB BB4RPX1tuxue[^_]UWVS(}^4EUEU t1҉E܉U/URPuuVщ‰EЉERPKM܋]t+ +G|)uÉ֋EƉ~vaPJURjujjPZt Ph"TXZMA tP@G(W,@G jQYXtG(W,EЉUԉ_(w,G 1҉EЉUԉ_ BHMQjPjjRt Ph"XZEP tZruu1ɉJ J$Zu u1ɉJP rFP4PRXE܉؉E܃EUI‰1 t1҉щ‰+EE̋P tJU؋M9ˉE}#E1ɉHHXpE ϋEMЋ]ԉL\}U؃v8M9ˉE}E1ɉHXEkEuЉt6M9ˉE}E1ɉHXE ku EЉD2BH4MQjPjjRt Ph" Y[Mq EUtF V$}u$}u1҉VVF}u }u1FA rFA4QPE̋@4uP1e[^_]UWVS]ovfBHkMQjPjjRFt Ph"@Y^EP trzs({,RS jP XZtC(S,C 1҉EU苳FHE1RPuuޗt C|}WjuȃRPV~tPuh"u Ep 1RPuuAtփ~u$~t:!vkk փ~t*uuh" tFVC(S,FC BHMQjPjjRt Ph"_XUB tNvHpuu1ɉH H$NHu1xB rFB4RP^ju:ZYtC(S,C 1҅u uSXİ.t C0S4C(jj\0uu Se[^_]Ë@t@Ë@ t@Ë@tË@htË@ltË@|tËtËtËttËLtËXt Ë\UE P(҉]UVSuE H$X(1y6)tNp1SQRP e[^]UWtBRBR t RPY_}ÊtBRtUWRPWY_}ËBht1UWVSӋEU ΃tt RPY^CSljtȉlj{he[^_]USt)P@XD)P,[]UStPpXtPH[]UVSuE H$X(1y9)tNp1SQRP˖ e[^]UVSuE H$X(1y9)tNp1SQRPt e[^]UWVSEEEp@}]8ـu  Ћ}+G4tDž Ep 19}5uWSh"N EzBD1H)CNjE_dE@ EDžpđ-pp@tVkh1ɉMU9~Ջ]xuxx"2N$9K$s4)xhE1҉UU9]4^`1pthh9`~mptF$V(x|EP4EtӋx|ˉT xAdhpt녉EKED@Hu]ڀt u!@]KtAA G``E@ EEËEtppxtpHE  t1r,z0Bx}t !! )`hd&h("jHEÃd$S\DpTtt RPzY[B^UEMhSQEjXZSbdtuuzY[EUEUDpTtM]19 }9Erp@dxÉ1 t1RPuuڈ1E URjW1RPVEEtH`Xd EH@E_Ή)׋EzEtIu EEu1 t1RPWV.1RPh"E‹EE@ EEEJEtp`xd @@ƉEӋE‹E"EE.E؋EE)߉ЊM1ҊM t1RPWVw]K!E؉wEtp`xd @@ƉEӋEB‹EE܋EcE)߉1ҊM t1RPWV1uk]ӃK 1;{E@ r EFE@4uPEBHEMQjPjjRqt Ph"k[^}w H]]^S}V]t4Sx(u8E@(EȋE@,EċEEE؃}uc}u]E@ tEPPPu E @t2t@ NjuU؋E]KdQE X]C E̋E @$}t d1֋EЉĒt @ }̋uU؋E1MIdQ}u}u E M̉H}tZCr{<uX.C`.d.C@CC sh'"hd&hCh"jS1[^E @ ]]؀tf@f@E @$E@M A$t }UJd1uE 1ɉHEP,@(E؉U܋E}ub}u\tPL@HEЉU @4EEԋENUr,z0 t1EtpHxLp4İ.6AM̃HEEЋE1RPuuMtƉ׋EƃEۋMtEPjuރWVQtPuh" EEЃE̋]s E1RPuur€}trzuЉ}#Evkk BEEԋEMq,y0 t1}trzrC4SPZ}u }u1dE ]Ћu)։]ЉuԋE‹EJu EjEu1 t1WVuurEЉUԋ}ЋEFHEËE1EURjS1SQV]tPE1RPh"PEf‹Mq EJu P! 1k}t)؉}u"}uA1 rEF1ۋA r EFA4QPX؍e[^_]UWVS$u>E @EED1E؋V,u]9rE;F(~jVoFXVWF XVRz(Z,]V ^,xt}x fB fB)É^,E @M AFPV1E܉E]9]FEE@EE]E M܋]H$X(MЉ]Ըt]É؋M9Mrh@"hd&hhe"MЄt]ԋU Љ\] EU`N,t})N,E)F(1e[^_]UWVSS] EC1Ex$tPGEGuha"hd&hh"qGuWuUZYtWSZYuF}S1Ce[^_]UWVSu EXE9F(r+V,Et  9s VuZYF,UUet)ЉF,F E}tf@Ef@~E@tE}tfHfH1C(S,}GtW EE@HEEO1ۀ}t_ E1RPSQnӋEE}tEEPjuȉERPu"tOPQh" EE@ EEH1ۋEtGW SQRPl*EEG1SQRPl}vkk ]Gju蕦hDuVuhDuVuy(hmFuVuehFuVuTFU t+u  F؉F4'F,tȉF,EtfHfHe[^_]UWVS] t@ U f P8dǃ jLrƉ<WqFYZuWhx"1= .PE fF81FFC0PhZ"V/tPMX}!uhzd@u ֨ @RhedAu 踨 @uuhi"j4}1󫍅Pu|5^_@4ȋ9!9t(Ћ}1ۉ1E1ɉ [Eƀ*Pkj PEP1e[^_]UVS4]jhPjS&YtO[]hhB"Pƃa+#lao1ɋu1҉ijh$Pʲ cj2WVv2 9uE1ɋtWuhG"V PPh"V'uP Z;v.Phh"VaPWh"V@Aƃaa9tRPPh"RVƃagZ#a^u 1ɉ]uh#"KVhVXW uVh"U ^"j2P 2 9~#1ɋKthP"Y#Zt1CZ9{~`1ɋtWh"oVhP|V uVWh""T j2P6G2 X#_tuhn"TZY1ɋTt h"a]PPPPh"V\\\\\]t h"]e&t8tp SPà Rh"%)Xy谾螾؍e[^_]UWVS]CjPj~ _Z1uhd&h:"[^F9~?{jW2~ ZYu Vhd&hW":19~DBhpQ#u pY_uu hd&hw"| z"‰WWZt uƄsh"hP:ksh"hP!k #R觬$RW׭ DžuƋSS9VhQR u RWh"CPPPPh\%Q&GtRWh;"Q ; ȋC AEV։_4V͉^19s~4蝀 FY莀 Z1e[^_]USRÍEPjhjjj jS艆U tShZ"Rj]USuPhj"hJ.gnSh"hJ.WnSh"hJ.Gn$Sh"hJ.4nSh"hJ.$nSh@"hJ.n$Shc"hJ.nSh"hJ.mSh"hJ.m$Sh"hJ.mSh"hJ.mSh#hJ.m$Sh#hJ.mShH#hJ.mSh_#hJ.{m$Shv#hJ.hmSh#hJ.XmSh#hJ.Hm$Sh#hJ.5mSh#hJ.%mSh#hJ.m$Sh#hJ.mSh8#hJ.lj_USRhPP u Sh$j臼]Uuu ua @uuhO#j臼UWVS(`؟ԟha#Rh*rPEܟП119П~7̟hW؟  ̟u ԟ0F`ܟv1ܟȉܟ9}J̟hW؟螩 ̟u ПԟEܟF`벅u؟ht#j@e[^_]UWVSlj։1EEjhД%Q t(jh#S tjhaq#S u Ejh#S uEjhb#Sj t}~Eh#EPhrWh#EPhrW =.t=#}t#PVh#f }uE4Lh&Vh#f e[^_]UWVSÉ`dhPzlb1󫋅dhx|h#VhrS`h!#-f|xh:# f0tplhq#e#u#RPh#eh#eDRPh#e0Ph #oeXZ#4t#Ph3#Oe84Lh&hF#5eP$[vPh$q#PG S+Yt@uPh#hJp pS!P诗ZvPh#PҘ Sj:$X=T.u 1=<.썅PL^vPhx#Po h#h#h#h8#hX#ho#h#h#h#h #h1#hQ#h9#hs#h#h#h#h#h#hJ.YPP觖[vPh #Pʗ EP"Y=T.uH 4.f=P.u ?TS"Zu|Pp$_)9s*,$*$踕^DžV[tF"k4$a YuhJ.h+#XZuP!_tMShA#hJ.[X Shړ%hPYS|0h>#`d[릃=T.u1H 4.r|Xu=P.u*?tۍ_hX%S胖ZYthS#SrZYt|ƄG|=~'hWPhW#hJ.jWnhGPS dd!u [XhĐjVA`kx1ҿ1ɉlx9sUHh9ߋlhsߋhlX 9s1ۀx  1ۀx  롋ыP.t ~CL AQw Q1Dpk`9pk<t=P.tw7Shs#hJ.UCG t GG \hJ.wģYXt G^G `Njx9rhJ.j B;XZG\P 9sX XBtt9+믃9r s|(_hJ.j :Y[VHf gPAZvPh$Pd uhJ.hy#Ph$P_vPhp#PŐ^vPh$P dP茐[vPh|#P译 0=P.thJ.h#XZ1ɉ P.hhJ.h#ߡ_XP.LP^ v Ph#P8 j[ PԏYvPh#P u|E3P蚏ZvPh#P轐 uB=T.thJ.h#^_1T.{hJ.h#Y[T._Ph#hJ.\RAhhp#P e[^_]U=@.iu=T.t jh ."&h#]ZujDUSh&#h`.4`.XZth+#h`.8UYXth3#h`."UXZth;#h`. UYXthD#h`.TXZa.]UWVSu }1ۃ=-ÍF 4.s==P.tM#}u-#hJ.P蕟XZuWVhR#hJ. Q؍e[^_]UWVSl]u }1=-EF 4.r=T.Sh\#hJ.PKuu=@.iu =P.=-u(WVhq#jd]SK}u WVSN VWV YXt%RU!PS MUufJ"uWVSu"Ã}uPK_XfKEe[^_]US1ۃ=-ËE H 4.s(un ZtfPfPxtP#X؋]UWVS=P.thJ.hw#XZjj6_Xt^=P.thJ.h#ĝY^ދ[F@H 0. s 4.sVm`V #XZu1;5(.,.WVYXt{F 0.ra=T.tS( Ph#hJ.N{uSg_S"XZ"S_]s s.C$. [uWe[^_]UWVS}E H4.4uW[1҉Ut7Mp p[Zuh#Ã=P.thJ.h#XZCtSPNfc_X[u릾1;5(.,.WV ZYuыXtCtNPP& xu SbjSXjPPiPfc[룍e[^_]UWVS=P.thJ.h5#XZ1;5(.,.sJWVKYXt3fSЃfC{u ЃfCft hN#SPXZ[Ƀ릍e[^_]UVS]S^uShd#hJ.C 1Ouu Y[19Åt 9t@uu h#$O ~u}t h~#V!PXZ؍e[^]UWVƉjhRP(.t9xu9pte^_]UPh#qϏZY8u"h#h#5.h#hJ.FBj4UVS@fC5.=~D.)fļ.5.jhh.THt -X1.1CPS.P,5.C𣤼. e[^]USjjj0`n+CC]UWVSƉӉ9tR)ySh<#hJ.ZA j%RP6n^thF P6$5F e[^_]á.t#UPju uSHt -kUWVS =X.uu 9uEfftcB1=.tf҉jEPWRW4}Yf E1;] }߃=.tȉGffG=.t?t=.uGGG%)ƋOu9rG9=P.thJ.h`#)XZGt=P.thJ.ht# YXGW9s=P.t+PRh#hJ.e?=P.thJ.j s%XZ?te[^_]USjh -O3Y[th SH Zu S4Y11҉P]UWVSX=P.thJ.h#-^_5.5.5.h#hh -9@.߃Y[.uh -h#j}5.5.5.h5#hh -8@.߃uFh%PxZYt1;=(.,.r%=T. E_߅ujSV& .@ @uV1VSju1.@ @tjh -h #进hJ.h[##hJ.hm#ph -h~#芛hJ.h#hJ.hm#߂DuuƠ@.ZY@ mVZX=D.E}tPuPuSC, uSW,EZY~/9jPuSjSh#h#hJ.3EPS4EPS*E=.tPuuuht%S#E PS+Y[ff~ uD Z5.MXe[^_]UWVS}E U9ÅuWuu h#!?hhW 'ƃ y@Whp#hJ.2hJ.M0K Ph )#hJ.2 1S ѡ..0*Nj[Yځ~RQW5& @u55е.5.5.h'#hJ.2^0K PhR#J=D.uURQV$ @uG5е.5.5.h'#hJ.10J Ph| #hJ.1$j$$%W&V&XZe[^_]UEU ]U:= -#tjjh -*h -y= -#tjjh -)h -UUWVSƉ׉˅ut;5(.,.rWVh\#= .RPWV.s{ S$=T.t [$t9{ u9suhv#S=XZe[^_]ËHQ 9u BA ÉʅtJ9u@BUh#P=XZUWVu} u1tC;5(.,.s..RPWVX.t;x u;pt@$e^_]UWVu} ut;5(.,.rWVh#; .RPWV.t H$9x u9pu 1pp P$WVh#; e^_]UWVSujj[_ÅtJNJ/t tF@PW3mZYt [u Ft[ 1ۉ؍e[^_]UWVVj/P_Zu1,VeY/txtEVh#:XZEe^_]UVSu~.F.9s%)P6SLjj&9tC/vKSh#:XZ؍e[^]UWVS}u h #j:[ujYƉ<.uE5.W7 Zu h#3:X). .9r ...uSM؍e[^_]UWVSu.uE5.6 Xu h0#9X.Lء.19r _$(uËC$. 1ECIDžuQ}u} ujjY_t VhR#@9XZVVi_C[ٸ1Xj/V ^Z@PPxiC{G C_ Y^Et5uu YZYƅu hk#8_E UCS FC^5}u} t)uu ZYt h#8XًE U7؍e[^_]US]ShZ..]UWVS]f{t h#SG9XZ{u&{t h#S.9_X{ t h#S9Y^CS utcRPl_Zuh#S8Y^:9u#s{ WVKXZt-q"ЅtP9uSP h#S8ZY3.C$.Xe[^_]UWVS]E 8ƅu h#Sa8_X9stsF C^ j/u "ZYx3WƉWgC$19VPtifSЃ߅uЃ fCe[^_]UWVS`=P.thJ.h#xXZ=D.(hF_$u*^_u,w0dC Ph#hJ..*uh/#g6fc 195(.,.rIMWVZY‹Mt,AEJSBPj2Uf<UR̓1E1}E9(.,.EuuJZYDžttj$GPEPPuGƋG@EG t@EGt@EG t@EċG$t@ESjj(EP;눃EUU1 .9~(.1tBESjjEPl;G΋E E̡(.,.EUMԉuС .$.E؉Uܡ..EU8.ESjj(EP;C @t,u0A Ph\#hJ.N(uhh#4S CXe[^_]UWVS=P.thJ.h#~vY[}uXjj5,.5(.q.jP95 ._Zu h#4^jjjhX%fHwjjuƃ y,t0@ Ph#hJ.z'uh#3xPVLY[y,t0q@ Ph#hJ.;'uh#t3EЍXjSx4 XZu h#Q3YSWV y.Yt0@ PhR#hJ.&uhA#3j(PPV xV@.Z9 Ph #h #hJ. hpQ#hx%]  .u(Fm09 Phx%h #hJ.jV.Vh.OXZe[^]US..EU]SȝPh #hJ.s. .UEu #tS葝ZPh #hJ.; #=.t.hx.Ph8.54.h!#hJ.h$.h_$hJ.$=...EUSPh #5.. .UEu #tSלYPh #5. #=.t.hx.Ph8.54.h!#5.Ih$.h!!#5.4$5.h-!#lXZ.@ @t hJ!#jm]UWVSu }=P.tVh!#hJ. EE]99ru4=T.mf!#;]ud#Ph!#hJ.{ F{5CPCPh"hRb=P.t R3C4,-h!#hJ.t}t?SHK))PDPPCPV!#uSHK))PDPPCPuq!#<SHK))PDPPCPVK!#@@{h"#PZZYth'"#PZZYt^CDtu%PuZY!#$PjV !#PjVB !#@uY{toCDtu%PuZY!#$PjV !#PjV !#@t=T.t/Rh"#hJ.S =P.thJ.h;"#iYXg=P.thJ.j >XZe[^_]á8-x=H.t2UPXUWVS}u 1.L.=.t3}t hL"#&_=<.n1ۉ1.=.tj @.o`0+, Ph%#hJ.jjؙRS58-?Bu@t…=P.thJ.h%#&a[_=.u <.@1҉<..PYct8. PVh%# +hh.5.V0 .h5.u..@ .e[^_]UWVS8Ã=X.FC=TtP=ltIʁlt=Tt1#=.u$=P.thJ.h%#`_X.t=.WȉCȉCCȉCC ȉC CȉCCȉCCȉCCȉCC ffC ChRPZYChs,s(^_C(S,C0ȉC0C4ȉC4C8ȉC8C<ȉChJ./ .HQPy P{Y J t .Hy PXZ J: t .@ t1yt nw1y]UE PuhJ.k =L.u(h"hJ.h/#5- CtsPh T#hJ. hJ.h/#i5@-XZ CtsPh T#hJ.hJ.h/#15jMUWVS]} t~C7h2#VO%YZt:hpQ#V>%YZt-hF_$V-%YZt#h"V%^Zt1 @uh\y$w$ZYt|1j}Wjj5 .e?E? EEEPWS5 .5$e[^_]US}thjEPjj5 .].?wPh0#XZ@ڷ"@td#RPh@0# ڷ"yd#P5.hk0# ڷ"}yd#P5.h0# ]UWVS(}tE 0iб]ع1XuEEʉUUfEfEu͍Uι 1EͶEjh'jSj V5 .e[^_]UWS}t&]U1E5jh'jjjS5 .e[_]UWVS ]} t~7h2#V"YZt:hpQ#V"YZt0hF_$V"YZt#h"V"^Zt뮾 1uh\y$w{"ZYt|1j}Wjj5 .e?E EfEEEPWS5 .$e[^_]U }tjEPjj5 .7M.ʃuPh0#zXZBd#tڷ"RPh0#[ ڷ"Etd#P5.h0#7 ڷ"}yd#P5.h1# UW}t?U1jh'jjjR5 .}UWS}t]U1Ejh0ujjjS5 .Ve[_]UWS}t]U1EEjh0ujjjS5 .e[_]UWS}tc]U1Ejh'jjjS5 .e[_]UWS}t]U1EEjh'jjjS5 .me[_]UWS}t]U1Ejh'jjjS5 ."e[_]UWS}t~]U1Ejh'jjjS5 .e[_]UWVSEEu +EBU܉EP XۋUu h;1#j01ߋMEfEfS1j EP6V U:t6h`1#j/TTdDG9}ujh0uuSjEP5 .]e[^_]s UWVSEu h Zu hy1#jD/1 1ۋ9}J jQh"@ ujQh1#! uCu 9}OjSh% ƅtIjSh1# u'jSh1# u4ƅ7fDžjh0uhj P5 .ƅx9t h1#VYX$t h"V{XZt#t h1#V]YXh1#VPXZh1#VCYXu h1#V1XZV5.5 .5.5.h 2#@t6t`f@fÆh.2#VY_ \f@fÆhK2#VȿXZ6-f@fÆh2#V虿Y_u h2#ZESh#:Vh$/pރV׃X9uEe[^_]R e[^_]UVS ] }t%3h#V1ZYth%V ZYu E'j EPVoHE U:uy 3h2#Tsh#VZYth%VZYu E-j EPVHE U:uysh2#j+EPhU5 .k t h2#j+e[^]UVS ] }t23h#V>ZYth%V-ZYu E'j EPV|GE U:uy 3h2#Tsh#VZYth%VZYu E-j EPV'GE U:uysh2#j*EPhU5 .x t h2#j*e[^]UP}FE 0QEEPhQ5 ..t h 3#jV*U}tjhQ 5 . t h3#j!*U}tjhU 5 . t h3#j)UWVSEE܋] h: E^u h,3#j)U 1E1E9}t3VhJ3#gZYtNVhQ3#VZYtAVh%EZYt4jEPV袳 U:u=v3h[3#j)1EGEEjh0uhuj EP5 .C E=vhP5.hv3#QE1E܋}9}t}E܋E}܋}]܋TʉȉljщÉ1Љ1 Ӊf11 Ӊ1 SQ5.h3#{EEe[^_] UWVS] }~j PW5 . Rt$Nuj@EPjWU0Ph3#j'j$pPjj5 . EЃf=t Rh3#XZ91׹󪉍,ƅ8fEf;}~lj 0P3蚱ƒ 08t3h3#j 'D,ƅGʉLj Vj5 .p ƅ9141}u"jh3#s u ƅ5jhtj4Pj8P5 . <h3#hJ.[^1ۍ>1ʍu1ɉMfEEE'E0VhQ`5 . @u h 4#j!&E<u 5.h4#<u5.h24#hJ. ~<tP5.hE4#hJ._Pu󥀽_y-`9j&CShf4#hJ. j RZ<hn4#Xe[^_]USUBBPJ R Ph}4# uE4#]USh4#uXZ]USUBBPJ R Ph}4#8 uE4#]Sh4#XZ]UWVS } 11;]}#j4h4# uCPQ1󪍕JƅPƅTJjh'jJRjS5 .QjPj!gW,jPjAPjRjVR VRPW5.5 .5.5.h4#  oQƅRjh'hVjS5 .ffЃf=v1RLhW* HLRhW LHtmQƅRjh'hVjS5 .ffЃf=v1RWhWh4#Wh$LgQƅRjh'hVjS5 .fff=v1h4#X1G9 5Ct9C LHD04P#B .Pjh.k;9}4u d# }u Rhp#(XZ`.EH~}tj /Yډe[^_]0ƒtot/U׉U}u' r2s4Rh"&2U׉U}t RShT#\ sRhi$Rh#膼XZGU׉u}}tWVShT#^ s WVh$WVh[]$> }uET#e[^_]"E e[^_]0}e[^_]Ã=l.tL.URh.4-hT#UWVS=d.uhT#jرj=PY^X d1Dž\ Dž`hj`Ph.\PdPST\@uډ7=X.jPDž`1DžNdX@DŽdj`R`PPVdP @u! 0] Ph.hT#Buh.hU#iXZ&l. p.uPh.h<&I e[^_]UWVSSE}u =l.3˃=p.u=h.(=h.tBhJ.jWSu5Л-Rh%ʹ u Rhp#赹XZ`.~tj 轸X؍e[^_]u E rM19}V=`.tUPhw8#YYXUt.=`.uUPh2U#5XZUBSWh"! NuET#e[^_]E e[^_]Ne[^_]UVS]=X.t Eh:U#SY^uEEY 1҉jEPSEUE 9u%SuhDU#\ =X.j|8u? 8u̸]1PSEPuVuu @u1_t =l.1h. `.u}u}tPjUEPj :U#UEmY^tFh. `.u}u}tMjjUEjj :U#UE#XZe[^]UWVS]=X.t rEE18jjEPEPuu @uuhcU#kjS躛W u%SuhuU# =X.xjӬjuV|W}8u|1PSEPxPuu: @u1t =l.|t1ph. `.txpjUE1Y^ExURVɽEPVhU#jduVjpPUEf$tkh. `.t|jjUEXZEURt[EPthU#jd]SjPًUE$e[^_]UWVS(ԛ-8.t f ./ ..SVZYuVh .e[^_]É)@E̍EӉljDPh .Żh%h .趻uUWVS`Eh .ZEt&1]M;>r2jPRU Utj@uVRPMV3hU#[GjEPjh .RU$ Uu}u7}u1}u+E9Eu#/tj@uVRPV3hU#j1GM1EEe[^_]UWVSVUu=l.ˋh. `.u'. T.h.hU#hY[=p.u %tDhJ.jSupu5Л-Ph% u Php#XZ=`.~tj XڋEe[^_]1vs9}E8Phw8#踲GYXt VhU#褲XZE e[^_]鰱N@e[^_]UVS]EjjEPuVuu@ @u e}t ShU#j`. h.tjYY2=p.u Shp#XZuuuuuhV#e[^]UWVS]uEEU E$E䡀. T.=t.J`. h.t}jjEPjuV_ @tdMt]QMS XtMMMjjEPWuV* @tM;Mt W _j.`Y}e[^_]^ }tuh.hPV# = t)tu*ShV# uShV#ShwV#ShV#XZe[^_]UVS]E jjEPuVuuj @u} t ShU#jEUEU `. h.tj sXP p.u EP1P5Л-ShB&&IuRPh$ uRPhW#߯e[^]UVS ]EjjEPuVuu @u}t ShU#j`. h.tjC=p.u5Л-Sh%K =p. h uu t PXuuh&W# e[^]UWVS,EE̋}uu<=.t3EjjEPEPh.W#E܍Pk((U܉UȉMQM舻 XۋMЋUuwM1Bt(jjURPVWC @uEԋU1Ƀt();EtuhU#jyuދẺE1 1C(9~ڋ0x3{px s{ pxs{pxs{p x$s {$A(뼅t%GPhԛ-uh6W#jURDUUС`. h.t6j(EYU܃(t Gt9|]e[^_] =p.uuhp#0XZv$v vvvvv vv6h=W#,똍e[^_]UWVS]EhEpEl}󥃽pu@DžtjjtP|Ph.W#|<Dž|tWS XuCxjjxPVph @ult9xt ShU#jSl%EpuEjj_X=.t=19|Whԛ-Sh6W#jURH EjjUG ŋ=`. =h.t jL=p.u4Shp#OY[%t hn#=Zt4Wh}W#*G9|j 8Xue[^_]Y e[^_]ÍL$qUVSQ$EjjEPuVqq @u}t ShU#j`. h.tjYd=p.u Shp#pXZEE1҉EЉUm\$E1҉EЉUm\$E1҉EЉUm$hW##eY[^]aUWVS@]=X.t /Dž S@nXuhTt&h$jH1h %R^Y^t{18jPSPƃ t 9u g8"uShW#8uv ShW#j h %jx 1PSPVuu @u1;t =l.1ǡh. `.tW EZ)P<$PUEIVӽ tRh. `.tj ‹EX+aP$PًUES} e[^_]UWVStx|h.Tp.$.7Yl.l)ȉp)ȉt lt|uH1ۋx9t担td#tX%RPh%PPCC뿃} t~|Pd#xvԛ-RPh%PP|Pd#xvX%RPh%PP Dž|-|-Ã=t.=p.th.hp#臦XZh.h.hW#o EP|$w,t&PhW#J_X}uC|@0|9hsPhW#Y^P|p4hW# |p@hW#|0.XZpu hhd#h.hhW#0pt d#6hhd#h.hhX#h. %ƀt2hWh.hh X#h.| %s2hWh.XhhX#h.D % s2hWh. hhX#h.  % s2hWh.hh(X#h. % s2hWh.hh0X#h. % s2hWh.xhh:X#h.d % s2hWh.@hh#h., %s2hWh.hh>X#h. %s2hWh.hhHX#h. %s2hWh.hh%h. %t7Vha#j VԡhWh.NhVh.>(h.|h%PhOX#ܢ|@H t Ph`X#_X|p(hjX#謢j ơ } =x.=.u }y|xXDž1DžtxThj`SPPQtݻ @hu\t|@9uߋ|@(9uΉdQh藮 ^dtNjh󤋅|@XPwP躶 Y|XX=.uE t|@XhHw9=p.uh.hp#"XZ|@XPvhsX#PרX}|@t E iUE/Ã}tP@uj-s Ph.hX#j̖s u|xtjh.h.|x@u^jjPjxt0 @u<. T.=t.h.hX#|@@EHs$@s&|xtk|@8dx. dul-t.s j|xtjh.h.S . T.=t.h.hX#Ftx \b|@4h _)jjPRhx@Pt诸 @ht*|h`t5|@4`$Rܳ ^Kz8 ]kЉX1ɉh`9htkh`|G8É֋X9sV9Ct FHt F9C(u:Nu*PQT ZPtރ NjTCXhsR X1T.d1ۋ|;X4,F\s. T.t%xQuujPtAC`jjPSxt @jjjjPSxt @UjjDžjjVSxt訶 @uI8 u3藩 XjjVSxtk @u jٺ.|^_9S蒱 [DžjjPSxt @tgjjٺ.|8uר Yuh.hX#5؛-b KjjPSxt菵 @u jڸ.S̰ XZlƀ.pƀ.e[^_]UWVSƉLHT.j=PFY[ƅPt9sx?u @ƅPGh#Vs[Z.tԛ-՛-8 8V tG=^jhq$SS T F<=t:ԛ-  ƃ=d.u hX# 41Dž81ۉh 1tpƅY1j,V1ZYDžtG1ɉLPDžH1ۉ<1ۅJj=WZYÅu 1l@llh#WZYDtj,S訮ZYDt @Dh%WZYLt6X#Lu%PVh Y#2 =X.8jR18jlPSv1҉jlPWz<@l 9u SVh.Z#8u<@4849Ǹ8r9u-u F0j PV" x;3ue[^]UVS@Ë5/=X-tjtSvZYuFl6j j5SHFSg$PFSh%P/5/F Pha#j@]SxSgee[^]USQtP=/uS`Z]UVSÉu=/u VSZYe[^]UWVS׉΋]Uu E E!UuUg%td#[^_]USt<0„!1=/uSLZ]UWVSLEӋu>ha#VmRZY)ƒ?EljDUhTSPEUDEj URPEU:*u%jjWSRPEP{'tEuj>u& E9hTSV e[^_]9`-t3UVSRPjuVu`-e[^]#/t ú( /=.u, /UWVSƉӊ>uuV.HtB1/hg5<.VM=/1҉/hg5<.S.9=/~؍e[^_]UWVS,E9/L.];S5$E/ĬY^y#P.H.D.=/u/ /SƉZ=X=&wAKw2ifƞ7[nRfƞ7D=,w$==!fƞ7=Xfƞ7=KwJ=w$==` fƞ7 =%fƞ7 ===fƞ7wfƞ7lfƞ7afƞ7Vfƞ7Kfƞ7@fƞ7 5fƞ7 *fƞ7 fƞ7fƞ7 fƞ7EۣP.EݣH.EܣD.eẼEfE1E/ 5$E/ySj5$E/E/e[^_]USEPhht@j蔱 1ۅu E]u+ha#_ZtPv<.XÞ%V~<.ha#_YtPFZy<.<.1ɉ \-=<. <.t@.0ha#T_ZtP@.[p$~@.ha#$_YtPʤZy@.@.=@. @.P]UPUE`/1J$@w&(f`/ Ua#Ua#g{Ua#Ua#Ua#ۍUa#эUa#ǍUa#뽍Ua#u.f`/Ua#uf`/`/1UWVSVh b#^PL^_ZX-h%]Yu6$&1҉/Ph`/Y[Ht /b#t /H#X.b#T."b#.m &./4# .%b#/"…y11(.$.4.8.,.0.. .t1 7/E`.]ڸ%tĞ7ڸ#ud#/ڸ1#ud#/ڸ(b#g.ڸ+b#Vua#/ڸ7b#u L/e[^_]Ë<./}<./m=/tg=7/t =.uMU=`7/t=7/u<./(=7/u<./1҉/]1/á.t 1=/úD /<.@ /< /8 /US=7/t =.ul=7/u<<./u/8t/8t=/u.=7/u<./0=`7/t/=7/t9<.~j CX]6]Uuj54 / =7/u /8t <.Ã=7/uUjXË<.0 /, /qUWVSu }1+uG}-*u:Vt3st!dt1k1uUE 0e[^]UVS hd#jy~ hc#Ch /h /h /h / / / / / / / / / / / / / / / / /hc#C1[<=:tjhc#jq Fd#h /GXZ4uу@QuQhBd#R5 /j h /_ /UEtjtUt@t+t%=t]UVSu1ҀtXPeZ;E GtDuw6)u"^t u B9u1e[^]USMP;U sPЉӀuШtx[]UWVSu>WZPÃ$w&%VF%  V?F % V? VuF% V? V  VAF%?@ V? V V  V Ѝe[^_]UWVS EU qu=` /tw }8׃?π]w}8J ?΀]wu0J?πw]K]?΀]wUQU?ʀJJJ]JE [^_]UWVSE uU=` /u~ 9sSCM9sICKB~Pg_<9r)S{Y"9sC%[tS[Z1Me[^_]US] /1u7 /u'-zu=7/t-[]_[]US] /I1u7 /5u'0-%u=7/u-[] []UE=` /tE] /]USS]uh>d#h /Bzw2SYt'؃@PZu@ShBd#S5 /S-YtS5 /j h /Z"E /ySEPEXZ /]US] /-uH-[][]UU 1}DuЃ=%" ]UWVSSEIuRP؛^X[RVZY1uEVLXt S詛Y-h /jEPNVPguV2Z}tE8} tE 8؍e[^_]UWVSRhh#9hh#9Shh#P&Nucjhh#VNǃ u.hh#P9Shh#PMu0Shh#VM Shh#PMEWo Ete[^_]UVShh#8P99ZYu3h#V萜ZY1t=hx%V{Y[1t(VCZt ؍e[^]te[^]UWVSlht`ƍxPVY[{%=ehpQ#V]Vn GShV@ #jh i#Vۚ  1҉p1ShW? t t u@hi#W>YZh%i#W)YZh,i#WYZt<"u5vptp~HpSPV O tu QM誒ZYMuGCQe We _Xu s |ZYt,jj*u ;C EC3FC^ Fe[^_]UU Et1ɉME U]6t E]ߗ]á4 /t);4-t!Ujh /P4 /@ UWVS]=` /u( /$ /uD /( /Àu$ /Шu[ШtSS$ /%uF /A /( /9~1Ph( /ZYu'1$ /P1$ /:Y=$ /1$ /=T /t 15T /s-f]4 /9L-  PS.Y[@$x&e21҉P /51P / 1P /\ /t \ /8 1P /\ /= /vx ugx V\ /= /w1P /X /+5\ /X{1=P /\ /8eu15P /Q1ۉP /e[^_]1ɉ P /e[^_]a1҉P /T1P /\ /= /v6x u0\ /= /x ߀x z\ /= /w1P /1P /\ /8 u\ /8 \ /sT /]1P / 4 /h-y\ / /h-Y[ t9ىM{ RUWh /膍 UMuʉY15X /zWh /1\ / /_X\ /8=P /t L /tP` 1ɉ L /[V<EPZE\ /t\ /tp / /<9s; u Ce-Ed-E11E쿀 /9stub}t6E9s-M܉UuuWv UMuE|1}t8EE18Et < u_ 1EG눅D /H /tP_ Xj\ /)@PvH /\ /)RSP`\ /Me-8uCS;XuS%AL /_WAL /WT_ Y[\ /ML /txt/P /Ph8 /-1҉_Z @ /@ /\ /9D /si@ /u,15P /H /1ۉP /pu5@ /CYd\ /= /v d-8Huh7i#'Zu%1P /( /e[^_]e[^_]UVSQM1uu /EQЀ w[jjjj uuuVtjhEi#dY[11RjjE0RPuuVuɋE@1҉PU8.uEPjEP EUeY[^]1$ /9 /| /á4 /t @@@ Ã=.uUj11ҸÞXUWVS.t`- 0- @1/1bDž{P @$j辿WP-VDQ8QuZhF_$V|KXZ$fSftxRP,pZYx,E%=ufSfthPBYXhXi#%Zud PZkX~P-1Ƀx tA -x t tlph i#h$SRJ|1ɉx =.u:pl)ыt)PxjjxPoh,i#SSdWVh@V[ W[ XZe[^_]ú9P.t9L.t 19H.‰USR/t>BE/R?[ XE=@u$/t t7tut g ]UVS=\-u=7/t =.u$t/..u ujjj5.RP*V PT/u =\-u>57/H /7/1҉H /u 4YX57/H /e[^]UU]飪UWVSt eYƉׅt‰//H /=E/u0t;5//}jjjG 1H /E/ld2t8e[^_]UWVSVEj)ơ/u/ǁt#tj11u|%/Su5/á/ƒ// t?x1 rjhei#FY[t j0j1ZtՅtVk1V(Xe[^_]USTá/$N   tw #5/jCP7tW6%I/f5/S5/5/ߟ1/?E4/؋]a//PSy<+u C< u.tPW Z;u 1.Se.X5/jPCP9=.S0X]q;!t/tP,W XS5/Y=.ui/uhwi#hd#ȀXZMhwi#P=.uVCuҡ/ shi#th%h#X1҉H/e[^]Uj5L-XZá/i…!UEҀu]UE-EPhi#ͪZYUjjUP//XZUWVS@5.t>>t91ۍ}9tt KtXEC<tθ e[^_]Ujj虶UP1҉/YYu/ ыuUS]t CPX]UPGPEEUWVS@/<.@.e=/t1//1///=E/t[=.tj3_/t x@j荭//苝Yu*P:t!u5.BZujǴ_=7/t*p:t!ku5.AYuj蔴Z17/=H/un1H/=/tjhi#訣[1/:at hf#耣Xt?uhj:Ģ_X WrY.=E/weu:{1/1/&\P菕Zze=E/+ej//t.7iCЃ .jSP_Zdteh///^=/t1ɉ /_=//uy/u_uh/ƒ@+t t;!tA-Ҹu u ‰/@@/3=//  =trSZH?E|a</1EЍEPEPEP/ tD,EĉE-=/u Pw P_ E@Ƀ}}uEЅEPhj#x 15/Y=/S/YuS艒EЍEPhj#6C//Ht!5/hd#5/5/s 5/MZt5/Tj1ɸ/&C$Tx&*t@tS; u݃=\-u ̾J5h-j+Y =/t)S}ZHu]EE1҉UURPAƋEY_tPZXiu0=/i j1ɺ%i0S{ aFcx $x&j1ɺ$n /19/}7/1;//|//=7/t5/5/LF^_j/19/}7/1;//|莍//j1;//|/1ɉ /=7/u+;//}5/5/EXZjj5/1;//|/1/ jjjj5\7/Vjj5\7/v1;//|/1/=7/;//}ze1;//|/1/|jj5/1;//|//F=7/u5/5/yD_Xjj=7/t5/5/TDY^1 /19/}.=7/u5/5/DXZjj5.6 /19/}.jj5.7tköUGA57/1;//|/1/7/5/5/E57/f//y 1/,d9ѹ|u$du=/t/d1//5/5/G_X//19|,fFhm//19| SGFRP0EB//y15/5/1157/RPFg8EȍEPh$=.uEtEP1Z9t䡐///7//7/j(Y{j8(7/(7//1;//|/1/ / ///1;//|/1/s/15/Ѓt+Ѓ$5/ t /1;//|/1/e/1.5/C1FP踳X/b"'//15/7//1=7/7//17/ha#맃=.qj 4-Fj# =.M5.6h#Pq u jhfj#5.6Ytjhj#XZj -f%@5.ѣjP/19/|/1ɉ /PZ jhk#45.V1_PrYt VV1jPb1//j1ɺ" =.u) -?#uf%j}=.jhPj# @j1ɺk#;_ ƒ 1?PSmp?Zj1ɺ k#>^ ƒ Sp`?lj1ɺ-k#5LY ƒp glSp"j1ɺ9k#%RZ/ t u.S}o_/j -f%% j1ɺAk#^/ /19}7/(7/ @.‰/ //EƉ9Љ}5/=/E)`//19}7/"7/ @.///T/1ɉ /`/XZ=7/t/_UE=` /t@]US]SjšZY19} B]UWVSu}t UE  u iZE EE EuEE߉EEM9EEujEPEǃ uG}tAE9s:=` /HE9ҀuрtEt>WRXt1E9EsWQMR_ZHMt QZt:`xxPhm#сVWhڋ`t 5.ViX=.SWh5.5.h.5.n.\dJ1ۉ8/$1HPTH; 7/E/xPlPTP0IPTTu PlLX-?txLRDSZYƅtVDR.U$ߋX9Lt~ ujhm#SFV u C: X-t 1҉@H\.t=.tPXh#XV^_t@xPXvY[u(EU0/4/x|8/</.tPh@WXZy=.tu荄 L:1ۉ/ha#`V^_t:htm#`UZYt$`$jP54-S( =D7/tuQ`( Qe[^_]UEu1E5.PZYEU5@/;Ztjhm#~jr h#UWVSSÉ։M}uSSYNxuSLZuE/uƸe[^_]UU.]UuQ1.jZUU.]aU1.jUVSu1SYtPZ9u]e[^]e[^]UWVS}WhWWWmtAuu$1҉u#1҉tEe[^_]e[^_]UWVSËu t׉SW W& ucS& ZY9uuj輈XV@e[^_]UWVS]vESEPG[^11VEPZYƅtcVEPEP 1WEPZYDžt.WEPyZY u5.'Xu% Xu% _닅uu_;5.SY^9.u uZ1u[X]e[^_]e[^_]USÃ=.tS$X]1Ҋt%uH%u@suB@áD/u*Uh;n#|ZtD/D/n#n#UWVS jjd輇ZYEdNy V/X P tStN)EH9|=MMMjuiWPEW$ UROU׋M Ce[^_]UhIn#Zu"UWVS]SHO$@P_Xe-8u"CtZ d-8uC8uICCBBPNZ;t*tUQMWS"P MUuBBCe[^_]UWVSu9EPN[E11EtSC8e-t18d- MUURP#ZYMt}tEEG맃}t1ۉ]utV#NYXjSԅE_Zǃ}tKd-PVe-PhXn#SWC 3SP"Y[tuWEXZFFGuEe[^_]UWVSRh#P'Y[unVXtaWvMƉ$lMT$RUSh_n#Wh%URP  S-" hpQ#V5EV" E hpQ#VZYe[^_]UWVSuu1k>tVL_u L|$Wg XZtu h%VhB&WS }tjS Y^y S! ZPX؍e[^_]Uhh#juPbUWVS}1ۊtAP݀u59}s8Gt+8Gt'.<%t.tRFPLY^CGjCSȃXZutKH݀u=9us8Ft38Ft1 .<%t .tQPSSKÃCFe[^_]UWVS]S臡^u1jjjS;Bu@thVS ~ˍ19=` /t)RPZYu FSWk_XSjWƒ =7/u9PF4Yt"SWP4P9vR襭Zd1e[^_]UWVSu'X=.!8u#P^hkn#PEZYUtbn#RU3JƉ$)JYPJkL$QMWd-Pe-PURhtn#MQV4$W XUVIZUtRhn#Pe{G Sh$PS{V t'iWY>u V^ Z SU X؍e[^_]UWVS}1ۃ=.u\W8IX$SWhn#SPoVuPǃ VPJZYu S Y1W V XZ؍e[^_]UVS]h#SJ^Zt(ha#SJZYthtm#SJZYƉe[^]UVS]SYuVScYZu]e[^]'V!Ze[^]UWVS u=7/h.Zj!hj#TY_?|uC؉E-uEh#VI_ZEXHtjhn#s[^VuGƉ<$GT$RUAWuURPWd VR YtsfGftjEPVs Ht-WZKtcu_E18E htm#~XBEPE8E 0h#~Y^WTZ;u S X1ۉ؍e[^_]UWVS}u =.j蟒hn#ZY~1E En#e[^_]qVWSCFE4$8FE<$-FUMT$RU}EWVSURPW$W V E@u t]e[^_]Qe[^_]U|EPuXY1xE%=@UVS|u=7/u1V[t&VlE$P}VP3h-\|PV/ZYy VhXG1ۃ=7/uu!jjuuuu,t*E Ue^_]!+t붍e^_]W|$wUWVS4GEȋG EċGE7uui+= 7/u=H /u 7/u$Pk/RPWVWVځƉ׃WVʼnZYuu؉}ܡE/Eut u EU<uu uuqE؋U܉EU9uE}}E/!nEuuP)&ÃEU ~'=7/t(} t} uEU' t tؙ)]Ur'   EE/Em tuTi'}Ɖׅ}t(/EtC)1ۉ]uЉ}iLMtN M!E!RPMQ%à M}tDEЉUE/ t uΆƉ1ɉ 7/E7/Eu襆)ډƉ t u9脆Ɖ视 t t u蓆 AYƉ3uuA)ډƉ1҉UUI=7/t' t u}tƉECuЉ}E}t =7/tƅRPj # j}]!Su%uuwW=7/t&WVuuRPE؋U2=7/tH}tBy uE/t t@tqe[^_]g_1EE\e[^_]g_UWVQM1yJ¸u 1=/jjPWVoeY^_]ÍL$qUWVSQ8QEU1M9ȋ}|&EE%= 7/uk/9EE}11S 7/uEU)juuRPQEURP[^y=7/tL,'83 t u, uE/< u@)E/ u 蝃@u荃EЉUuu耄ZY&uu^_EЋUԉEȉUuuMZY1ۉ]uȋ}EEUE@E/Ey} u#"Å>H /-CMڂRPu à Hu =/~17/u}E=7/u~} t} ua蝂 t u u聂 u uE9ƉM0u}EU}u}uؙ)Ճ=7/t!} t} u}tu}EE9ƉM1u}u}ĸ1juP!uust EȋU=7/tWVuuRPEЋU)EȋU̍eY[^_]aUWVu} utYWV.ZYuXKt t uO݉5H-=L-4@w Hr5P-=T-e^_]UWVSu} uaWV_ xb)ޅ~j^jjjRPV tEj^jjRPM)S=7/Ee[^_] pWV9EZYt1E Eo#e[^_]0Zjs^EUjf^EUYXEU!ЃtE9ƉEU!ЃE9]}O9uE|)}t#jjjuuE<.)HP6WVƉXZutE21ɉ P/ T/E)SjjWV<.HPx<.H9~KWV5ƉXZut4WV)xƉCZYE9ƉU|jjuuSMv2=7/uts1T/WV]jjWV<.HP e[^_]UWVEU EURP)ƉYXBut1WVYZu$=7/t WV XZ57/WV hM9ȸ}|6Du-57/(~VRP[ 1ɉM E5o#e^_]"XEUEUEPhVo#XXZe^_]U jEP]\EUYYu ujjjuRP UWVtjhto#W^_~}Ɖס<.HP[Y9u9u e^_]d0o\WV <.IuuQjjf *QRPY<.HPx[9u9t e^_]e^_]UWVSu} ]WV}YZu t3@u|Ɖ׃=7/t WVmXZ]u} e[^_]|USZtjho#VXZ%q|9} <.IQRPa ]UWVSSEE] wBu@ujho#V~ZYwƉ׃uu1E Eo#e[^_]VSuWVO9| 57/RP e[^_]Ê t u@UWVSƉ5x/5l/ho#hS=wWV)RPqt/SXe[^_]UPRXZUVSÉt C[^]UWVSƉU<\t <^Ct%x=u`P-Yx=uSP+Lx=uFPAÍP^wƅPho#jR>p#"j PRM 9ud#ep#; p/<=t#; p/|:j; p/; p/9 p/ 9 p/҅5-,1 v#u t|\u@r;yj=SZY9Ës%x+uQZYg<=t*1@< tҋ1kX8=td#p#;8F1< t#uً1V‰8u$d#p# t tu䋅t3RP$YZűPp#Pd(8u‰2ʀ‰w8t1lߋ1MWUt/Ze[^_]Ë/;/~~/ l/ /‰/US/X/p//[]É19-t @uUP?kYt,.t4.t.t$.UWVS/UjS EjS }tUuuH YXtP5`/} ljE5d/5d/ 5`/ E`/Ed//XZ1e[^_]UWVSÉ։9/~`/d/< +t[^_]UWVS׉ˋ5l/Vl/Љ[^_]M=H7/tt*ttt t XÃ=7/u[USjm5/ZYNb#t:t1ɺNC=/ts#t1ɺ*C]Uhs#/PUYZt /"hs#/P0YZt /s#jh9W`/jh(Wd//hP/hD/h /h,/ h8/1/ZU1}]á//Uh/1/1l/9h/~"`/l/d/1ɉ l/@1//////////// ///hP/ hD/h /~h,/~h8/~1҉/UWVS=7/uu uqƉ[X117/ @7/u=7/u u$ZYt  /@;P- T-9U] |%!ʃtM9 H-L-U |  /@=7/t /u aP7/9/h1Ҹ WVY[u1ۅtj ]SRPlDS+Ã1T7/)9~1Ҹ F19tD5ݺF1Ҹ //e[^_]á7/tP7/=7/u T7/DUSh/9l/~$d/<u`/PhP/}XZCԡh/l///]UWVS]u }Eu@0tj$zYEe[^_]1=` /tWZ=` /tw/Py_uS[ۃl/~K1S ~YuSW_ZVd/t-fZYul/d/DVe_tWl/uVd^ƒt 0.Vd/teZYt t8.t .t(.Ӊ؍e[^_]UWVSEUMЃt/} u}u=/tG}EPjEU RPu ueu=@7/tV /tM E졀//U#U ;E} „t!؃tEU ///]=/tT1ۉ/1/1k /9{~%8u u1ɺZYGFu1ۃ}tO`/ l/ E1~RjEP{ l/1҅~ d/TRPuuCÃ=7/u}u9EEEE55/+5/E;5@.'EPw_/9/uY=/u=/uEU //1=T/~+9=T/~P/81ɺ>GhP/yY19}E81ɋUG衠/9/|1}uEPhP/yXZh/9l/~Չ19h/~=`/   d/<<@B)5l///9/}1ɋh7/ Kݸe[^_]UWVSƉ׃=7/tCP[/+/-;@.~u u1ɉZYuFu1e[^_]UWV։PuWV ~e^_]UWVSƉ19/~ /t /)C1[^_]UWVu} =7/uщu} 1^_]^_]nl////á/l///UU1wR5/ZYUS]1w%SZ1uS5/vZY]UU1uj jKN1҉PPYZUSU] zt)tuzt \tjc1B4x;&9tu&ـuH &uBS!YuSZ]UVS] uVjSw 93sPuHZYHte[^]UWVS ÉUu} /E=7/u#=/uS/Zt /1//_SPEZYtIWVM^_t R/xt /ShD/%vWVMZYu5/ 1/ShD/uhD/k/  /PvhD/Uu/@}/$`//9/}%hP/PuXT/T/=/9=/| l/l/؉ESjEPuU$ t9r)ډhD/t5/ 1=/[^7/t 7/uuu} Ul/~7;h/ `/|t d/D0te[^_]uuu} 1ɸJt1tq`/ЉERj]Suƃ `/E9s=)Уl/RjStNjd/l/?4WtV)/~뫣/z}l/`/=` /u/P8rYl/ d/ M9u3_u(t M./t EMMb_uM`/UL_uGMAt?S~tZt /E*l/`/PqSPuE u1ɉ / 7/t =7/uuu} U e[^_]g/+/4- /~9|0-)ș);/}s/)WV%U KYZK=` /tv =7/tT)PoZtu} UK=` /t+SsYtStZu} e[^_]u} MU؍e[^_]e[^_] UWVS]u }/t4 u t`5/5/1ZYt 1/ ud7/t 7/uR=// 5/=/1^//@/1ɉ /4뷃=` /t/ub//ÀuWV1҉"[^Шu%ШtS'n/5/=/Yf%ul /A//90Ph/Ln5/=/[Zth/nWV/ /1ɉ /<//vP/1҉//=` /u]ue[^_]Ã=/~U塰//1҉/]1UWVSQu} EE/tt t5/5/1XZ/tl=l7/tc@.;////l/h7/@.D;/~ Zl7/G=@7/u@.;/~1N= /t/@@.9}Թ ۃ=X.tt =T.u =7/u 11Ҹ *=T.t&}t 1Ҹ 1Ҹ11ҡl/e[^_]TUVS]h/ d/ށ9l/~tu ډ@[^]UEp/E /]USEM =/t)=7/tu ~JH1҉ ;/9~/p/h/)Ћd/`/[]/1/UWVSQSMQyq uu RPy^ZYu]ƒt1ۃ tt E/tI]8/H9U_Ut )]`/@]C뮋 `/t `/teY[^_]UWVSQMQyq 19| RP]ZYu㡤/X`/D_E t$E/u}tjU/Et d\L`/UL/T1;`/r H/E)K`/Uz11҅t `/ىt /eY[^_]UWVS} ]E1ҋE}~[9sWUSjMQ-lPUt!SMQPEgEP@ E1jRjV)E뜉+E)Ѝe[^_]UVS/1/utFjjP$ t硠/@11ҡl//e[^]UWVS5@.@.jM9Y119=<.~"!уtRP /9}G։5@.19|)e[^_]UVSu Eu=V: Y@ w>uV-SXZ1jjVsP u뾍e[^]UEo1҃t -]= 1/t& 1/tUSJZ P+JZ HX[]Ã=/y-U=7/u T/17/jhs#3ZYá/xW@d/UWV1ɉ /5/=/+9Ɖ}jht#=4/XZe^_]ø/ @=0/u10/1///0/$1/ 1/ 1/ 1/1҉01/41/(1/,1/81/1ɉ <1/UWVSEEE E}M 1/ 1/t"C 9{}E9Cu E9C֋s1/t 1/ /1҉/pxH }xUPC=6//ub 1/xHE0u 1/t,puX9} E}EE}ًEǀ}t E/‹ BA[^_]ÍL$qUWVSQ QEU=7/t E]!؃u 111}9Uй5 1/FV 1/t]9؉׋]}69Uu9Eu N^})//1=/~GW 1/tBN^ M]M])ӉM؉]܋M]+M]MЉ]ԋ]9]؋]܋MRPW[^$O_w E9ƉU}XM]jjWVƉ׃E/M]t u M]M]WVSQM]]9uEM]uu#WZYlN^~ v9uE}RM]jjWVƉ׃E/NM]u M]M]WVSQM]M]1/ȉڍeY[^_]aÍL$qUWVSQQEU}9} 1/,s{ 1/tE9ƉU}9}u9uu CS K 1/tEU+AQ+u}9}cq qMU[^Mt qyAQ ]9މM}jjRPE/uʼn!уts sqUZYus{CS 9u]}0jjRP\E/r!уeRPEUWV#EUeY[^_]aUWVSQMSN2ƉOEUXu$ux9<.~ CS!2Ɖ܋u}WVY[M9u M9ueY[^_]UWVSjj{T^_uxjho#1./ZY1111҉1ۅuuRPEUWV;EUjjRPpE/u uu1/e[^_]UVSEU =47/t5<7/9|)11[^]USZKJy ;J|< t Y RPZY]UWVSuE E>-uF"4Khf%'V'hh"~:t>u R^8_UV輱Xt̋URUfÉ<$\L$QM8*WPURh%MQS肾 W _usV7YS<S j]uuuMjTj;}t&uA&h t#7&*j %% ET/uGX1҉Ue[^_]SUWVS]EEEEuu QZYt jh1t#hF_$SQYXujhOt#*XZ8Ihf%%S%h,UEYYut@ . \6/d6/h6/El6/`6/tP Z1`6/@1/UWVSPEf=X6/uJ=h6/uA=d6/u8.\6/1d6/h6/7/l6/`6/tPY _15`6/{u#j;PsiCs/ 1ɉKs {SC;.u RWV UPGZUte[^_]UQMt.9Ptjht#.%XZP@ UVS]u .1k9d1/u$9p1/u9l1/uPa~#4t P'@5u1҉[^]UU19d1/uǀl1/ǀp1/=u]UWVSu`[1h1/t:P葰PV uEd1/h1/ 1҉h1/YS Xue[^_]Ã=X7/UWVSu h$u`1/ C Suup6/ue[^_]j }WRPsu s蔾Xh#VUZYtVWsPht#uwUWVSUBE:mP8 UuXÅE8 u@Ej URP7 ƃ xuu=<.E8 u@Ej URP=Ѓ xCU: uBU1҉SK C9~CCtPj Y1Cu>/CZe[^_]USE] =.t1E Et#tS..XNt1ۉ] Et#u=@-x1ɉM Et#^S-á.ZtP XS!P].S 5.]B=@-y1ɉM Et#]!.EEPh u#!XZ].-x$Ujh@BRP<.RP?7/USEtzE 8.MU u4@E Qh&R%- }t jhu#}Qh&R }t jh/u#k7/-a-y7/EEPhCu#>Pheu#j ]S轳Sa~P|0uD]EPhlu# XZ]á-x$Ujh@BRP@.RP"7/USEtzE 8.MU u4@E Qh?#R- }t jhu#}Qh?#R }t jhu#k7/-a-y7/EEPhu#>Pheu#j ]S蠲SD~P|0uD]EPhu#xXZ]US] }u!jS萏YZt]EPhv#BXZ]US] }u!jSXYZt]EPhv# XZ]UWVSUE t tP]+p6/^w=.t1ۉ] EAv#e[^_]P*PzPMRZYt]e[^_]ݠPƉ׃utS;57/WVe[^_]USEU tXtugR*-YYR)á-Z=-t tP XSPM-YX]] -EEPh_v#XZ]US] }uC=7/tS3*.Y,6/h%sSsXZE@]?s]UVSE] YE ]e[^]hzx#SXZ=4-~R954-~3t h %S訴YXSZ4/h#PF S$x#P蠓Y^SZ50-hx#P^Ph$e[^]U EU tSuxud-e-bJtzt1ɉM Ex#e-d-7e- d-*e-Ed-EEEEEPhx#WXZUS Et_Ejh}$EPEPu F]h#Su l7/Du>l7/Eh7/*l7/#tRRJYEEPhx#XZ]UEtHw1E Ex#].]U}u=`7/u]i1]S1]UEu=\7/ K\7/]UEu*=T7/~!EEPhx#T7/XZUEu*=P7/~!EEPh$y#P7/XZUEu#=D7/t=.tL8Bu @u]]UUE t#u?-^u2@t+-!-PHEEPhSy#N US E1ɉ <7/ 87/E 8,t)EPh$E P }t jhmy#3<7/E 8,uf@E EPh$E P }tjhy#XZ787/0587/5<7/h$j]S芨]܍EPhy#]UVSE] F1 RD+~vQQ r/Qd~ wG$x&t3-tW1Wt'^tM8wt1?:50+̀&Qπw MEPhy#1CSPi(7/Y(7/E sEEE sF@tK@sN@ sR@sW@sY @AuU9uE-EUEPhy#XZe[^]ø=7/u=87/ 1=<7/á7/ <.+<7/UWVS }8uMEPhy#Y[1kÉUPA$@PƋUXZt@=p7/t\u Ct C$t!tˆUPW贼ZYUtFVC؍e[^_]U@u0hz#j*h6/ 0Rh z#j*h6/6/ÅtÅt%UE.z#tz#URPXZUu6EPhz#h6/6/UU1t 1BS]UU#t B tB]U}ou>¸t#u1]1=7/U7/EEPhy#ZYUWVS}]7cY18-u@Q1ɀ wj WP yڋE t1҉t؍e[^_]UWVSM7/tFPtu)QjP_XA7/ZjPEPH 157/1ۉ]1E8PU-tC $~/Br +tU9 / nP-uEE-1+uEr6/j+UjEEZY];+u$.tP _CP.YSJfh@ fXZEn=7/tz1EMu*SdE؍C1҃‰U܉$_U܋Mf9M܍EPjEPËEE1ɉM ߋMu G1<+=u*tStMEPhJz#@EɅu&M}EuPhtz#}XZPhz#1ECtt%tAS Cu҉vC Kut H PE8t,P8 uUUs E_u&IE8u7/9{jQEP C]tSjZYPS* XDe[^_]UWVS ]u }翅u jhz#Cu@t:EEPhz#lusEEPh{#JƒuuU:80tj#XCttHtgtC1҃8‰C1҃{ ‰ft2t<St H~quGS C{C St H TGwLjh"{#5t)u9EPjEP }uSjhN{# Y[1StuPXZu@ttCt61uSCu>u9CEEPs!C8yjhr{#X Y^jCtF XZtC tT/te[^_]UWVSE0mX^ v1ɋUE C111~Љ w Bk D0Aރk Bu}t}1҉e[^_]á7/=7/tUSh{#n~P~Y[u 7/@-;t CtS C t jjSXZ$ۋ]UM@-t9tBt 9t$1҉]UWVSEE1EE111E@->~1EM؉Uu7u/à U܋M~ZEE܃߃A<vG}-tA}u9t%9~-7 Z9Eىu1ۉ] 1ۉ]EFtE@Ep[$G}t}t E1EEȋu} t tE Ee[^_]Uhɍ#|YtPrZ~-øUS =8/u[h 8/ uZtL18/E܉EEEjEPj腔 E9$E/uE/ۃ`[8/$E/;EMMEEE=8/t=/t=x7/u-=T8/ttPjEP EufE=H /u);P=-9u E/&Pi^Xʃ=$7/t ƒftըu18/uu uWà 1ɉ 8/=H /tx*It 1҉8/8/@8/~+jX!o8ha8#ZE9$E/tt T8/؋]Ujh 8/csUQEPEUUWVS0轸 uOÉ4$E|$WVuhU#WPx؍e[^_]US]S茸 ZuShٍ#h 8/  8/]ÍL$qUWVSQYq AQEU}WRPq1薃ӉщE؉UM܋EuƉeWuuRP[u؋}׋EUM!1M]EE9ȉr1EEEUeY[^_]aUuujjdu uUQMjhiA@BA RPq1U EEUiEi@BEjEP=XZUS-8/t,-8/Sh8/5-l 9t T/]UE-]Ã=h8/t 1h8/B$U=-<%!hWVSjubu Z Dh8/e[^_]U4tPw @rP:UXUWVSu} l8/cuWV3XZE e[^_];=t7/uldh(.WVh-T$.\S%g9@. T/e[^_]WUEU E d#Ed##]UVS]u Tuu ]e[^]-P1ZE #E #؍e[^]\USQtu u>31YZt[=@. T/j ZQujA X؋]UWVS]uE %=7/u>t>S$PhPj jjjSPh$9t|V货 Xsuojjk 1=D/1҃=. PSW t"Wq _}u)jh+#[^tP4#6B ZY>1e[^_]US]tP #3 ZY1]U1}]UWVS|}ue( u ZE E7/x9s_E xu Yw 8u 9Et 9t(@B9EuEX8EMEG띋E1ۉE10E]1}1}$1ɉMMuuPuVjWu< ƒ1Eun؍[|yu19E E H]9}/3{yMu$d#[<:N<%<.uFu!1E1ۡ<.H9~eSpƉ׍CEXutEuSY9uM|29EM|!Ѓu!WVʉSn E]z Et e[^_]`e[^_]UWVS]3t~v % V ZY1CCC E/E/E/ E/e[^_]UhD/XUS]D/-t-=D/ujhA#XZ]1=E/E/E]UhD/'XUVSu] <t1ٸD/t;pX[^]UWVSEUE|E x@.p+l<.h57/ duu8EU =07/t4 <7/ș}9Ћ}|AMMuuZEUXZ}u }es%|x!uE|Ex]EEEE1tE/ixu |t?er8|9EEx|Eu"Et}9|x}}}u} } EUW~MEEUEt*RPuu3Ɖ׃}u}t>EU4RPuuŮƉ׃}u EU}tEUu}u~uyesX}u-&Ɖ׃u#u Ɖ׃u u%11eWVTEUYXu}} E }x=7/t )ؙ1)=~WVuuuu [Zt}뚃=07/tEPEP587/轮t D/t ] 7/t 7/u=7/t =7/tu=7/uSuNPEjEURNESEPuuuND/(Eu0E/ E/9EM|!ЃtE;E/EE/|lUsjjEPEPR`us3^$`t2EUEUu}9uEbUD/P[uC<ujj]SMQuu5D/5D/$ EMt%tEUSQuuMM}= 7/u(tEUSMQuuMwpl)ÅEJU؅?֋M)΋ /M1ɉ /M)ȋMEUEU1ۋEUjjjRP~9EM} ߋEEUEU1EUCFjjjRP~9EM}9u|9] E//T/}$tzM؅tshd)EE)EǾ9KEEUEUu}WVvZZ9MU} 9]~CΉ֋E$0xu u [^}t}EUW1ɉMuȊ u XZuD/tWsS Zjj1CCCj @u]e[^_]Ј D/CD/T/e[^_]U €u1=D/1]UWVS4u}E/ E/EUE/E/EԉUt>EU jjRP袧E܉UEE}x8ẺU1bu;]tjjuu蝦ẺUCE/Eȡ E/E@u}t0E9ƉU} !uE/E/]9؉ӋM},#u k/׋E܋Uuu  9}%k/]ߋ]9]܋]M}P]9]܋M]ًuȉ}C}k/9E܋E|E܋U)ډEU 1EE11҃ut6}u}t9ű]}ű}9< E܋UEU D/>MjMQjujuWVY 7E/ E/EUut,9É|}9}}cEԉU؋}9׋]|MEԉU؃RP[^t2jjuu诤Ɖ׃utyEԋUEKE/ E/!t 9U}}I1}9}};uuJZYt*jjuutu}EU뒃uEUE/ E/EԋUأE/E/]9]܋]M$e[^_]U jEPWXZ}u}t jjRPuutjU1E/= 7/u]]USj5L-@'YZt4jٸD/Zt = 7/u=E/uW1]U=D/u 7/D/D/D/]|UWVSU EEt :DM@RtE3D/ s,jh`#E"u jhA#Ht= 7/=7/= 7/1ɉ E/E]3Ɖ׃u}57/P"ÉXZe _= 7/=7/jh#_XE+j,^@=E/@1ۉE/.EPMD/Z@t 7/ 7/j1E/X= 7/t =7/U.}Ɖ7/u1Ʌt1<.H'uM@uu57/cX]QMƉX}MtMjjRV讠Ɖ׃Mu U111`WA; <.| DQMtƉ[Mȃ(KxSXƉYjZVMEPjEPjuujjj苹 E/XZ=8/t UE]UhwjM E/jj=8/tU}tOhwjYX=.u>Pjhjjjhgjָ 2jjȸjj迸jj趸jj譸 jj衸XZUWVSE/1҉E/tkjjsj(jjTjjK/jP&b$h>j/jxT/ tD=@.5<.X<.9=@.u9t@.贳̴T/t=|7/tjXe[^_]UWVS E։ϋE/SRU谩$EuURު u.{tUM tuWVޢC SXZ1e[^_]UWVSSE։jju>$@PCuPOs {E C}u1C%u$@PCuPN؍e[^_]US--t%CBs} s} S} 1E/E/ E/]UWVS5-YhpQ#PlC} Z1ɉ E/ [ÍhVMN R!tSV uNJ< t< uvZ8tPt t=_8dPjP u1wHx^u Hȋt.8t&\uG@P9tWPΉ1Ҁx$‰uH11WQщ‹d--P- E/ZY襄X= E/t-E/E/1e[^_]UWVS ÉJtu i1ɉ E/u--@J.&h#bDPD^Zu&S5WYuޥZ̥lj4$¥$L9QfVh#PI9tVxz XhpQ#WVWdz f;?S5YS&jjщ‰--P- E/ VhP9K th=E/t@J.tVRZXDP贤_t u Ƅ@t VB[ uR. u@J.DH@ZutfLH@tCu) ʍLHt@u C@tC fLHuDPttDP@yumDP@tG VDH@dBVCYZt1E/E/ E/P--tE/E/1e[^_]US-h#S_ZYuwh#SGZY¸t_h#S/ZY¸tGh#SZY¸t/h#SZY¸tjSjZZYxP>[X1]UZu E6 ‹ENt HujhĎ#jhю#XZÍL$qUWVSQ E/"p xutWV ƉY[jj講EUXZE/uFEPEPWVĕE؉U܃}u}tEU}u}ujh#QY[=7/tuuuu =7/tEUju{7P7ESjQjEPuuS7(Eu]v SWv XZEЅu u؋}eY[^_]aUWVSE/ E/]11~1t2-t AFKމt E/ E/[^_]UWVSE/ E/]11~1tr-t IFK݉t E/ E/[^_]á E/áE/ËE/tUrLZøUj<Zujh #WZYyjPWZYxU$E/]øUR~jEP5$E/U ty jXфuHuUS]} t0tu y.39ӻ˻r1u vH[]UE1҉PP]US]tPVt Z1CC]UE1҉P]USUBt XZL[]UE]UWVS}wSKS Kr{3[^_][^_]UWVS]E EC9C|WƅujjWVRPCPt& HP5-P^ZtbShVMA Nh,?&P#^Zu @׀8 uSxY9#h#P#ZYt @׀8 u SxX8t%8,t8 t@Ћ8tH5K/RxE/PY^tE/t SxZ@xE/P C#uŗ#e[^]UL/jj臧XZUhUjtL/XZU!L/jhI/0 J.QJ.y ;J.| tJ.J J.UhJ.P^XZUWVSREƈEj}W5L/ $ f=-tk1L/5->jW5L/Pj)=L/t.VV"Phf#UX KtjhE/5L/# 럍e[^_]USQh}#_jjLjjCu >Åt4EP 0Z9u5 h#_jjjj]jjjj-j/S{څtPjRS)hJ.h $舩h#jhJ.h $mh#j۪USQjhh$5L/M f=\-t#<-;tS{$S5L/lM jhE tPE X+u}f= -t WVh#WVh# jhK/5L/}DhM/jj+e[^_]UWVSEhVh #^ 'jh"5L/Djjjjh M/jj(jhK/5L/'E3à yh2#HUX11ft#j'ƉXPr%Y9tGAj5L/jjj^jjUV# Vh# Mj6Cf=|-tj蹷)RPh#}jhK/5L/,ChM/jjjj jjXZe[^_]UWVSEzhVh # 4jh"5L/Bjj膚jj}h M/jjS(jhK/5L/C/2à yh2#SX11st#j¶ƉXP $Y9tTNj5L/葳j5L/脳jujjjj$VVh#KjAf=|-tjG)RPh# jhK/5L/AhM/jjhjj{ jjoXZe[^_]US,]S5L/th"ujUСM/uUУM/Sj5L/hM/jj]US,]S5L/sh"uU؃%u ESj5L/ ]UShSh# S:E-[tE-jhEy$5L/t@ U-tU-5-t5-5-t5-f=\-tz-t$-f=-th"ht#qY%-t%-,-K/5-t5-jZE-t$E-f=L-th"ht#|X]Ujh{t 5L/pyjdjhzt 5L/WyUS]e1u jPAXZ]0US]CCtu P$ZYt1]UVSEh#PZYtP賰^yht#[Phǐ#hPF蓰ƅul-u5%@$@XCZ@$@1ɉ $Ph_n#SSjqu*hQ#PXf@XZ@X1G@$hE/?à @XPwY9ut thJ.hϐ#:XZ댅yhB$赱xuPhސ#uPh#hJ.J CƃE/E/8 u =E/vH@E/e[^]USEjPhL/h# uxhL/hhPK>L/yhL/h #TFZY?hSh?# t hL/X5|-5L/S ]UVSjPhL/h6#q hI/hL/Y[uE>#e[^]MHu I/I/5I/hhPm=Ãy5I/h #xEXZ+5I/hW#hV Dhc#SVe[^]UE"jPh`L/h# uXh`L/fhpQ#P I uh`L/he#DXZ)j5-P f=-uL/EIUVSjPhL/hw#) hI/hL/Y[uE~#e[^]FLI/HuI/RhpQ#PRHà uVhe#;DXZ@I/f=-tPh#Ph#hVBVh#S! e[^]UhJ.h#j:UWVS}<1ۉK/K/K/%1u~11Ejh -hy#u uk=J/uhJ.hB#jj9t&`'FtrE96/ kU DЉE죸K/뉃a$&nEtPt=7WBYvhÕ#Z?957jh#VZ jh#VB h2#V^Zƅh#jԕ7h%SÄZYkh$S讄ZYLh2#S虄Y[Åh#뫡7K/7K/Em=K/t h #s7j/RUVYZUt K/5Rh%hK/[I EPjhjjjj57HmK/U P57h&#RaK/tehZ#tMK/K/K/=J/1vldZRpC.E)t8HuR}t h#KE ht%RUYZUtK/"K/K/K/hFj諎hFj蟎hFj蓎hFj臎 5K/h#j hJ/>hJ/u hĖ#@u hӖ#jhJ.zVXZtKth% h$h2#& Xt 1N11҃=J/1-L-=-1ۉ|-=K/t ,-=K/t5K/9 Yu.t h#j=K/u"5K/ Zt5K/hݖ#j蘒e[^_]U J/jh@J/U4hpj=EXZu5EZt1 J/=K/u!ujYX= J/h@J/%Zu+j dX=K/tPul6ZYL/j9YL/yuh$XZ J/V= J/IjPqXYL/tP6YL/URPgXZ=K/uM@EPj5L/  jh t 5L/,n jjYX1}UWVS]=xJ/uh#蛧Yu h#jh1#~Zt8/t P ^x-|-8#Sht-EPW& ƃ 1҅=K/t7K/K/K/K/1ۉK/=K/u'K/%;/u%K/jSZYtK/t t u!hu#ShD#"^_ hT#"[j2->uUVQPC( U-Euԃ=K/u hK/hsV$Pc* @u K/%hK/hT7%uA* @u K/=K/xj:h#uY lj=K/K/uSh#!t$=K/uK/=K/u Sh#j"j:h%u K/=K/u3K/tK/tR5K/}ZYK/K/j:h%&u t -j:h4&u} t -j:h\#u] t L-j:h$u= t1L-j:hs$u  t \-j:h#u t l-j:h8#u t |-j:h,p#u t1|-j:h:%u t -j:hy%u t1-j:h"uf t  -j:h%uF t -j:hϹ#u& tK/j:h$u  t L-=K/u K/h-=K/u K/`-K/t Ph#^_K/t PhD"|Y[K/t Ph4&fXZK/t Phڍ%P_XhK/h &u(' @u15K/hK/h#u' @u1ۉK/hK/hRM#u& @u K/ K/tJ/xJ/tJ/tj,SMZYt@K/tJ/؍e[^_]USPh#hJ.<Sh#hJ.;j.U=K/thK/htjh j DJ.y1Uh@J.XZuj=L/t!á@J.P@J.=L/t!UjjL/hR#?jh`O/WUhM/jj貹 Uh`M/jj蜹 U E E1ɉ L/hͶj蓅EXZjj腅EYXuh$:7XZh`O/YtnE sujHYXuj<XZ=L/uXE M9Hh@J.VZtU < tU EE9sE @E DJ.xˡ@J.P@J.UE Mtt @8u1]UWVSuM/N/FVtI)~@.#t8u\Q ^@P u f^?봈@M/[^_]UEP^vM/^?<tP@M/M/ M/M/M/]UVSEPh;#5XZ@-;t[Ct =L/uG-PPh@#5s Ct*PZVQPhD#W5 렍e[^]UVS,u]S5L/*^VSG:VS:EԀ€Uԃ=K/t̃Ef=L-tMẼeewfEf=-t %‰USj5L/ƶe[^]UVSuU ]=L/tSRV* y@19t N/ @_8u hS#E%e[^]۞e[^]UVSP-EÉL/@-t68u-Fu#EPPh$3SV1%tك 8]tjEP5L/ Íe[^]UVS<-t;u%M/tPH [uãM/<-Yh2#Su^ZuL/1L/h$SuZY…t[h#SuY^tVha%Su^ZtNh%SuuZYtSha#hJ.6hJ.Q1Ҿ11Ҿ 1Ɋ-1 !N/Aue[^]Uf=\-tM/tPPXj(UjhK/5L/(jhK/5L/)UWVSjW5L/) ފ< uf=\-u"0U)څ~CCjW5L/) ǡM/tPQP_9u1ۉ\-ƅy0h7%V5M/ZYu ƅnƅy\-jP5L/' e[^_]1f=L-L-UWVSjjjjhjwhjkL/fDžL/fDž 1ۉjjP( ~Ft=jhK/5L/n( ~$K/!S 9X<uY8C L{ t VWqZYtAEPuWC YVC Zu h=#V6Xc9s ts tC Ke[^_]UWVSƋO/C!wKO/XO/"8J.HJ.y;J.|J.PJ. hJ.j 3Y[뵋>WPnZÉO/F<w <tj<t<f~ u=CO/J.HJ.y;J.|J.PJ.!hJ.j!k3Y[6h$q-XZ|Wh#b-O/F ^_tbP<O/v WhJ#4->Wh#'-O/F Y[t'PPcmO/$h$, =O/"~1O/hR#4Ze[^_]UWVSQ} EUZ:EE<\t<^uvrtlZFdZBpЉw0JMqЉw@R#t38uF*uDr^ЀvZ ZDЋMA\]8t1҉Z[^_]UWVSS]h%SIn^_ug@-; CtcE.ƅUB@tUQMVdY9MU~ #QRh%hJ.l'Ãn#hJ.j w XZe[^_]U;sPPPhƛ#hJ.-'w$P/t@th P/XjUWVSSt Éֺ &"hƜ#h&hhӜ#mu :u!USPyeZYUu=$P/e[^_]VSh# jUEuh#h&hhӜ#m@0h #1UEuh#h&hhӜ#Km@0h7#1UEuh#ht&hhӜ#m@0h^#_1UMuh#h&jTh΢#l11f3A@=uUVSEu ]uh#h&j`uh#h&jah΢#lt0ffPh#!fPh#!fe[^]Åt$1ɀ8u"UJRPRPx 1ɅùUWVSÉ,0hv Dž0hU1׋,03s DEsus 8Es <E41R(4@&cZYtdG (uh#h%h$hJ.)$4@&h!#hJ. $C uhJ.j  _XFD&EsR@8t54V@W~`$WVVEP MU1e#sj@HEP8 susuh8#uhN#uh[#uhf#uhq#}U$19D&t@ uRhɣ# 4@&hգ#MXZ}tEPh}#7[^h0)uuh#Y,01e[^_]UWVS]uh#h0&h{uh2#h0&hh#ci11{ u.hE#h0&hۋ=߶xtgtEWVhPs[u s h`#n=ts hm#HZY1uhȤ#-X䍕uu-WVhPsus h#t럸"=thPs h#xe[^_]UWVSSljUQ* ^t#u uSuW1Ãu V2 ZHWu uSVWN9uSuV= u V2 XV}2 #n벉؍e[^_]UWVS@]uh#h &h8C@uh2#h &h9h#g{ uhE#h &h:߃uh#h &h;ŋuh#h &h<몋1 9Ɖ} PQh#9|(Ɓ tPQhQ#G 1jjh V = tS h fUtts h#_X1jjP9u 9t-uRh`#yPRh#u to@u h#qmu h#S󥍵Ѷx Զx9t PRh9#\)@hު#.Dh#Hh# e[_]UVShΫ#[1H9~D^Ph-&CZYj]Xe[^]UVShΫ#Y1H9~)D3Phw8#YZ9~j:ZFh#sXe[^]UWVS ΍1VSYv hB#j~fffDžVhSf4$YSZڋe[^_]UWVS։ˍ1ffDžfCf+[^_]UVSfxjRhV(VhiSB@u hR#jee[^]UWVSDjjj2H @uh&0jDS'ShiH*B@u h_#jSet <ɋDH$1ɉ<1DžDž?ڋD1DžL`jDV&\hl##hJ./ Vh:iHLA @uKu8a8tTe[^_]Ë J.QJ.y ;J.|< tJ.J J.UhJ.PZYUXPPh#hJ.u jV/W|$wUWSˉ1҉V/M]m N&h}fU fUm]mURp pSQh-0h#hJ. $e[_]g_UWVS]E }܍p(}p4EPSY^tSh#rXZe[^_]UWVSP]} CM% CSCt RPWG RPh-y 1t)X18th-h#.r^XcCt2PWZYh-h#qY^}uzPh-YZu΁}ti=V/u\SlUX1҉UtRWZY@u\X8-tRh-MZY@u"{lth-h #oqY^uSh-l XZ }ye[^_]UWVSV/Xt.h-ih-Ep ƃ \h-!jjEp&\ @Euph$p[^xP=(V/t,V/ 0V/t1=$V/ƃ}  =V/h-h#hJ.e DJ.HDJ. yh@J.%Y@J.P@J.؃ t+@t( DJ.y h@J.y%Z@J.P@J.Ѓ߃Yt\^jxt6Ph-Y[@u8h-h$o\ E *Ph-R[Z@uȋE%=t[jhu GPhh-à uT 5 V/u"h-h$Bo\Y ih-wGPhh-QÃtOGXW\`dt;`dE@hDžl-`dpt`d T`9иdT`Pjj\jjPj}TjwXPg `1ɉ`dvRLP)TPS L9th-h$mXZDžX7)`d=V/th`d rPT*Y^1`dhh`f/\ ƃ ~aVh`f/S 9th-h$lXZDžX;`d=V/th`dOtEp뭃=V/t#S\zRY^th-h$#lXZ\^Xu SY5V/t SWXZ=V/uh} tbG tY4V/9GuOxPS[*ZYth-h$lY^$E9GuV/#G%PSYZuSZth-h$kY[=V/tWh- XZe[^_]UVS]hVsT u shJ#'Ƅ} t'h-蚅Zth-hW#4k[^.h-V"ZYtVhb#١V/t jsPeZYe[^]US]} th-1Zt h-hW#sh-ZYth-hn#jZYV/t1E ]]]US]} th-迄Zt h-hW#$s$s sh-eth-hy#3jZYV/t1E ]]v]UNPPh#hJ.jUNPPh #hJ.jaUWVS|Ӊ΃=lf0u\=pf0tpR|Y_u%=@u"O|h$WiXZOt#h|V^ =vQZVSNY_u%=@t=xf0u^VS覻_ZuQ%=@u?V&]^u-O?XPSh%hS=΃=lf0=df0|8/uVPZYti|hö#UhSW^WYt=|Ph%hW4VWǺt|hܶ#g_XVS'pY^ lf0uS|?_ZuS|h#3 j/|Y^|tpj/SԒ_Zxt@xxV5?ZY|)x)؉t=9|u fDž.Nj|ƄPR謹^_x9Íu fDž.׉ދt󤋅tƄxPR`ZYu<|9u(;xu 9 u ;p=f0t=tf0hJ.-Sh#hJ."DJ.HDJ.yh@J.hX@J.P@J.0t- t( DJ.y h@J.4_@J.P@J.΃߃YthJ.h#MI=|f0t%=@uS`S^u@=lf0tS|_ZY#1=pf0 PSj|jtS=hf0u1#|`f0PSh*#l޸e[^_]UE TET]<UE MQTU TE]<UWVS}E E@PX4]p8u_PK4MK8U9U΋U|4uU9u|,S<9P<|"ETE GTE[^_]<[^_]UWVSEE} GPX4]p8uMYPK4MK8U9U΋U|4uU9u|*S<9P<| ETE GTE[^_];[^_]UWVS}E E@PX(]p,u_PK(MK,U9U΋U|4uU9u|,S09P0|"ETE GTE[^_];[^_]UWVSEE} GPX(]p,uMYPK(MK,U9U΋U|4uU9u|*S09P0| ETE GTE[^_]:[^_]UWVS}E E@PX@]pDu_PK@MKDU9U΋U|4uU9u|,SH9PH|"ETE GTE[^_] :[^_]UWVSEE} GPX@]pDuMYPK@MKDU9U΋U|4uU9u|*SH9PH| ETE GTE[^_]9[^_]UWVSSEEU JPqXI\XP{X[\9|9| TU ETEY[^_],9Z[^_]UWVSSUE EHPqXI\ZP{X[\9|9|TU ETEY[^_]8Z[^_]USU EAHtRSHtG t uF u:] M[]9t=f0uyDutJt] M[]%g01 []UWVS(Uf0 f0 f001d@DHLP4TX\x|hlEE8jj hd# SQj]S@u hͷ#js:Shݷ#XZ=5g0FډWVRP#=f0t#RPQ e[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.PCXZUtAwt&@u=/t'u&%|o@=1ҨIt*ى]UWVSEϋpPf0tvv Rh#Ã=f0=f0tBjj hd#v\vXjUR;@Uu hͷ#j8RWh$^à L g0AF`VdEUQRuui#=f0t#RPWQÃf0 f0Et*=f0tU]Ã=f0u=f0tF%=@u FaÉ؍e[^_]W|$wUWVSEUEPdfEZuE#EC u=f0tECu}EUE؉U܋=g0} g0ƉׁE9Ɖ|)E؋U9E|EWCu! EE4Cu $e[^_]g_UVSut({u{ tNV [[^]UWVS(]j&Ng0g0X=f0uEԃ}Eԃxu x EԋpP=f0tvv s h#=f0F`VdẺUЃ=f0tBjj hd# RPj}W|@u hͷ#j56Wsh$ K g0AEUЉMMuuRP{#=f0t#RPWQSEPv@Eԋxvs$EPh#*=f0u7s,h# wsh# =f0twshM# F%= u9N % 1RPs4%1RPs0h#dVXN\=f0t3jj hd#QRj}W,@Ws(h$X "{(#=f0t#QRWP4=f0tF(V,=f0tF@VDF4V8\f0 f0Et#=f0tNVF=f0u=f0t@u[F%=uEA Eԋ@>e[^_]UWVS]C=f0tS D=f0t=f0tS(SDf0 f0lj?;-(C ;-~:P5g0 ^ZujJY]e[^_]1S -g0g01txux tF@-E-}E}E1҉U}9}~j}1EM9M},=f0tK(KS g0k‹E9 E뭋E9}Uܸ UBE랍e[^_]UWVS ]C=f0tS D=f0t=f0tS(SDf0 f0Ɖa -69~] [^_]șEș}E31tZ~u~ tIE9| 1=f0tK(KS c9U~U UBGv뢸 [^_]{UWVSP}f0tG X=f0t=f0tG(G\=f071Etn~u~ t]}~9,EEF,;-| 1ɉM =f0tO(OW Ev뎸 Z[^_]UVS RPuV u1\u󥍽hu󥍅\P@ t Sh]#?_Xuu@ t!&8t Shk#?Y^||@_Zt Sh#{?Y^u@_Zt%8-tuSh#M? @a^tSh$/?ZYDoYXt DhR#Ճ=0g0t%SDh1"U ڋDSƉe[^_]g_UWVSÉ։ύEPW<Zyhҹ# -y h#j|'t)tSuSu;XZuuY[etjux;jSp;_n#ju\;jST;ι#uDu<jSVVZ%y h#ie[^_]UWVS ~1ɉ=(-u,h~P50- ~fDžDžVhm50-6 y#h#0jR 7fDžDžVhm50- y #hG#h~W50-à  f#hq#h~W50- t@#h#`fDžDžVhm50-a '(-tith#jgXZ fDžVhm50- y""Shʺ#0j؍e[^_]HyUPj `XZËJ UWVSL]0-tP_0-15`g05h05h05\g05h05Ԍ0- yB9Tg04-u1ɉ 0-Tg0<-0hjS0- y!Sh#0j0-Pg01Ʌuwu0-Tg0D-?hhS)0- y9!Sh#0j询 \g00-t`Pg0tVJu0-Tg0D-0hjS0- y Sh,#0j9=0-1uUhg050-j_ZyNTg0z ShL#0j50-0-1ۉ\g0yP:^@ujg0@u75Tg0h^#j蝠50-0-1ɉ \g0 u)EPhm8@50-ƒ tA:`t-jjj50- Bu@u¸:t1h0 -uD=g0=g0 ~-a1҉\g0u 00T-(-17u0~~u 0ug0S}wt 0Huzg0g0EUu30t)MؙRSuuҋMu u0z0~~11ۅtFMEUWVuu蛻ҋMuu t 50u}붅u0(0T-e[^_]Ã=h0u =(-U~h~P50-. (-1$-=h0uNUjjj50-yQh#0jȞ RP50-C x11U=h0uh#j蔝XZ$`g0t5D150h#joUWVS] }1WSub ~ )ƅte[^_]UWVS] }1WSu ~ )ƅte[^_]UVSUM (-0-=h0u;QRPà ~Gh090tn0tb`g0VQRPà ~ h09(-5,-tVh#0jOVh@#jD ؍e[^]UVS] 5(-Su50-ƃ 9u$-h0~1(-h0tH~Wjjj50-)RP50-  1(-1t8u 1(-1 8t8EuL8 uha#j(1ɉ (-[^18t|8tr8u%{xv$-h0=$-u Ch#_u5,-h@#j誚 y,- Sh#0j肛,1Ht u h#jh#jZXZe[^]Ã=g0:=(--UWV-whK#j_Xh0t h0h0 yPt 15h0(fEEEPhm50-n xr(-yh05g0ujjj50-Ox3jWVRPK)WV50-$1ɉ h0=(- hz#h#jXZ1e^_]ÃUWVSPE1҉P1;EE (-h0jjj50-Ɖ׋ h0xoEU ug0] g09É}EjRP50-Sy%h޽#0jO(- )}Wt1e[^_]ÍL$qUWVQ1y(-rh0u9Dh#90jjj50-y($h=#0j蛘(- )y11҃=,-~hj#ojRP50-Eh#` (-롣019MQRPWV豱U}uth#j(-XZUfEEEPhm50- y)u2Vh#0j託(-(-1eY^_]aUWVSJ.=-tJ.P/+5Hg0=Lg0Xu u1=1=-OhK#WV5050覴RPVhվ#hW5050h#hV0WVh#hV}}t^=$h0tU5050h#hVVh$h0h#hVl(V $Vj =-ubh$Ԍ01WVRP賳RPVhվ#hVV5Ԍ0h/#hP0hK#0000WVRPARPVhվ#hR5050h#htW{05050h#hVVRWV5Ԍ0,-HP10h@#hP#8}uV5D1hU#S%V$Vj薸 }*e[^_]Ã=0-y1Ԍ0h0h0UP1 |1t@=h0u7=l1t 01R5D1hq#501Z501J=\g0tLhg050-uZYu6g0%=u%=g0u=g0u5Tg0QF1\g0X=-w=1t -~ jPVYX50- -Z~jURP 1 |1t.=h0u%501hv4#1l1501q 0-h0 h0u 1Ԍ01h0h0=1t,-1 |1t̃=l1t011l1=1ti5D1h#ZYuS00utjhRPnjh5050TRPh#501j5011Ԍ0ZYUVS Sh41j胶 yh#0j/ jSjW yhͿ#0j 5g0=$-B 5@g06=1u5D1h#R[XTg0hD-SZYjh<-SzZYUh0C,-uPSh#hA#PShf#h#ۏ-wh#h1l1[^|tFu=0t5=~~ h~Ph;#thPhi#jYw@5Tg0XZx%0 0001001 y 0 0T-~0~UWVSX1t h#jp0=0T-u0yS0+0EU EUT-EEuuuugu})׋E9ƉM}u}WV!ZY+u} 0T- M19}k0U0;0s#50PY_00+ 0RP_Zxk 010T-щ 0}=000EU)001ɉ 0 0o-h#j\uXZ؍e[^_]Ã=P-US=-uh#j%uXZyx1ۉ0015T-5 0ZY~% 00‰0001+P-~C9}Ph/#jt Iu뙋]ÃUWVuM 0)ȣ0^_]UWVS$]CDž$$ x$|$x $=1u15xPu 5^_y狳EVhL#0jtPuZYud%hU#0jvtۉ15T-5 0u cƒ  09|Ru -WQQRuk9uUy%Vh}#0js79|$u9x$t h#j\rZPu ZYyVh#0jsNjE49}u;0th#뗋9}3t)1;x$|$}Ru ye[^_]Ã=0t1US5T-5 0ZY~' 00‰000=u.=1u01$x100X1]ÍL$qUWVSQ Q1ɉMMu u150=0)9}Ή50)څutċ0]؉}܍MQWSRP(Ɖ׋EUEЉUԉËU֍ ƉύEPWVT yEU)u}001970+0щ9|`tt%u؉}9}M؉]܋E0+u}럸eY[^_]aUWVS] ~E0+0 U )څ~'#9~؋50}50)É}뷋E [^_]UWVSEx$|$hDžpDžl } xLxPu gY[uEl*DžldhhU#0jo֋ltE1҉Pd19} 0+ 0 } yjș9Ή}hlpPtPQ50u ƒ2E0x} yE} Gpu5X0=T1 td@9u 0Й).1];x$|$}Rhu  19x=T1t, u&Ed9$thh#jm 1e[^_]UWVSV 0019|1`; 00}h,#jAmZY1ۉ00T- 0‰0;E~ 1}}])1u5T-5 0ZY9T-uG00E 0~$50lj=0T-90~?E00 0E)։׉=01Jt[tTA100x,T- 0‰0;E"])X1EEe[^_]Ë09 0s.UWS0)105T-EXe[_]UWVSu] ~;0+05T-Zx 9~‹=0=0)1e[^_]UWVS1;EE }P0+05T-Zx5É9EE }]u 1=0=0)]u 1e[^_]UWVS]x$|$ $=1Pu _ZyzVhL#0jok[0+0~b9}P50u K )019|5T-|^yt7ho#0}94tVh#ji 1YuxPu ZYyShL#0jij;EutSh^#֋U Ze[^_]UVS]E xz$usPDZy{Vh#0ji$tAPHYy$IVh#0ji$聬 1$ 1Ze[^]UVS|]s|PVTXYxS=1t1F $M9$$u0;|u(,$U90$u;EuVh#j2h 뻸e[^]US|]EPSPTZYy1=1uOE%=@uEhX%SZYu\SYy} t.Sh#0jh/SZy501虴Sh#0jrh̋]UVS]EUdh1ɉlE Upt1x}=-t =-|PSCS^ZuZ=-u#EUdhEl=-u$u! PVXZ=d1u ($jd1 - -t[j $P3V%A=-u =-t51$PjL$H$X$T$t 1e[^_]UWVSu }GEu EE]9~)])؋ME8tP<9s8u;@u6}jؙRSu޺_u hl#E18}t}t:11E16SVu{ 9u h#i11E1ҍCtPR XY P͖ Yuh|#jP[XZ>CPVЉUP EU 0j\̍<+E e[^_]UVSu] }u1NjjjVŹy JSh#jh$1V y)Sh#0j[e[^]UVS]u x@P赁X=1t*jjL$H$X$T$e[^]UWVS(]} $(v(11ptWPu  ~ pt1@9uNjt9|$up9x$th#jY xPu װZYyShL#OT$9X$u;t h#jjju y$Sh#0j Zp1$1e[^_]UST1tPv1ۉT181XD1um1 DJ.yh@J.-Yu9@J.P@J.9-uu%1S H1 t뭅u oډӡH1<<1u<1 B<1tϋxyRZV붉H1j5P1hH1T1 ,1]U=1uP1=1tP1=x1t P1@=D1u'h  H1Yuh #jWXZ1Bt1t9UVSut>uh8#j 輒 XuhS#j?WY[FVZH~ 8/u3E ؉C1C=D1uD1@1X@11e[^]á<1t@=1t 41=1u4=1t+UE$u81tjP5T1λ US=1t8D11t6{u+uhz#jVVXZ3h$hJ.T [Ƌ]UWVS]=41u =T1<1541 @u=1u95T1ѵ81Yu @uЋHHQf $|&@PURURpp p0]9xjjuuuu81p ph#jfUph#h#p jDV Qph#p p1҉$$$$ ƃ pP $󥋓($@`w/ @tf%ǃ$ǃ$x$|$$$ǃ$=1L$H$X$T$0$,$$$ $P6$yǃ$mǃ$aǃ$h RPy y$81p?Vh#0jTƄ  ǃ$h 81pCPWh 81rP55D1h#% t1<1@=e[^_]W|$wUWVS<ÉUMMQEPmu}j( 9ƉЍM}Qh+#Qh5#j@Sue[^_]g_UWVS\]u=1CEuPh$V蚄 ue[^_]郟}W($ۈET$X$(j8$z!Ej<$O#Uud#ud#PjRj4$WhA#V$ w'@$  R%PhS#|$x$h^#VɃuEPh4%V贃$Pw She#u Sh3"V~ Vj iZYVdXe[^_]UWVST]}T$X$uV($葇SWVhm#Pe[^_]UWVS]u fVfuPZt%t0SRjP}WRVW>Cۉu ]e[^_]&e[^_]UWVSUM] Ӊ9ss< uB1uZB1J9s]JqЉ w D$qw Dqw)DB qЉwBD9rt1[^_]UWVSMU 1EU]u tE} E1҉EU]\}ud9ruK~W w~0CEUEU}ũ}t6Ku0CEUEU}t9s}u9rKC01ۉ]]EM1 ۉZY[^_]UWVS]Uu 97 yO@0{?ș9GO1 Ҋ< u C9rt 11{11ҍO9_\$KЀ wD$0L\$Kw D$A%\$Kwo D$aGz L$σ0w9$T$CD$0$T$9r ,11ҍe[^_]UWVS}Mt}uu9E1҉N 9ȸr0WNEU EU } u}t4NM0NEU EU } t9s}u9rNF01EE E E [^_]Ã=1!u%U1hv#jLXZ1ø1UWVSSu] E}MM1҉7=\1u)S\1:-uX1 pC.=X1uA \1Q\1u \1X1UWPȏZYtAU:uC7tMM}E] ue[^_]鍢E] ue[^_]W3h#(x:u9pC.9}7@pC.W3h#hJ.}?e[^_]1UE E EE]RW|$wUWVSjEPSƉ׃EU E9Es 11E9tmt8bt$kuG *wu5 9|@EΉߊ*t xtt*@5Éщ9`Ɖ׉e[^_]g_UWVSRt8uh#PC=_DžuBh#jPJY[8zx1҉P= 1uf 11tc߀?t\j,W蠍[ZÅtj=W荍ZYuh#Ej M YUuh#jIV蒍 1B1e[^_]UWVSQÍEPS-r^_uC 1%Ƌ]| tC]SԄ Zu11 KDe[^_]UhJ.h5#jm-9t BtU-UhJ.h#hJ.hi#rhJ.h@#chJ.h:#T jmmUWVSPuh%S"{ZYh%S3_ZÊEhV(YXuVh#0jeI }t/1e[^_]UWVSlj/E 0 _ZD1t@E D1h#P[C[^bD1#\111҉U11ɉM11Ejh`-hJ#u uKzX$&7!057h#f 0렸1P-덡78-uxu1Tg0EjTg0[1QPg04#B13x1$1-=-u:#`@}1`11=1u `1d1-c1T57;_11p1a -HPg0%9`171$1Ex9~/pPuU EZYuh#jEj`jEMȋ71P}Pg06$1\11|157,DPg0s#gTg0-XTg0-ITg0-:Tg0-+Tg0-Tg0- -7Pg0$11=x-1ɉ 1575CZ411pC.E 4-umu}t 01J.01J.Hw49Uu }uj5 CL-11t HuP11E`hx#jC$h#P肴[_h#SkZYF1`1}tE8MMYEh#WZYE@J.t&hpQ#WuEZYuWh#jC1E1EEYE}tES裆 [h#u蚳ZYu`1u| XEjh#u譲 u@`1t EtSF [EPN5u/ XZ1ɉMEHjSu E&EE]}t EtS҅ [h#WвZYt uҎ[=1lW5E.j51Ss ^E6~t1C}11ExM}h#S0ZYLFLjP[_}u'h#P[_u^ h#S̱ZYE@J.ur1҉UE5DžUuzuh#S薱ZYt u蘍_=1tSh#{E@u}jPZYy!hpQ#SrEY_vS6tj.h#WYZt2jh#WI ujjW_Z*jS1ɉ P-}CTg0t 81h.#ATg0Zt 8Tg0"D1"11jh`-h#u uz$&1-ă뿃7057h#11x7Tg0f1 TPg04#E1@31΀1 7@7tjMXZF}u}Qt}PU!uX1҉C<]t>j~-u!Ft<]t9}| 9E ^19} 1}!9#A8Qt1e[^_]UWVSSÉ։M:NjU8/u@J)ف ~Puh#j6G։9r KNKNp19r)XӋEuD)Í4}9rHH1e[^_]UWVS 5D1h#5[_Vh9#5hi#5h#5h W5hS#W详ZYuh#W蜤[= u h#:5Y덊uh##5ZX<.uuh#5X1t3L@NuL@L'H9s tFCC@9u&>t!tWDhQ#j2|tHL@t<uDht#hJ.d WDh#hJ.dt@th WD0 1e[^_]UWVS]t K΄u h#R<\u FFu8uSh#j1 Dž~j8m Xuh#j1[^GjQPә t5hVPSVh#ji1 W)u YpV֊t\uF8tFWt Sh#yR#ZV1u,Wt h#j0GBGtVuhJ#jk Xuh_#j0[^C31CVܞZC 1ɉKECE C= 1u 11X11e[^]US 11t6Cu+uh#j/XZ3h$hJ.a [Ƌ]UWVSu 1t$tS=1u S1u=1uSu $uoFP!Yuh#j /C_Zt/1s\Ct/1ɉK;W趝ZC Hǀ?/uC C$l 19tP@uh#j.Y[CSWr 1$Z-e[^_]UVSu1ۉ$ 1u,=1u1=1wC |/t[t0CuPFP30 KVPYuɡ1u #$tV^Zt 1$e[^]UWVS]=x-tes{.u{.u Ct:#b1e[^_]UWVSQ]t:t4=1u3Ujh=f 1_ZUuha#j'[^#t.\u{#uCSDF YuSh#j& ʋXj jCS3à E =11<7t 9t&@uja Zt p h#b1e[^_]UWVSut>u h#j/V[_ÅtCF1ɉMMPtMzЉ v@,u}u@E1҉U'.u}tVh#j% RE@j7a Xuh#j%Y[.t;u GM1GtAt+@uVhf#%O}tgE8t_W@uuh#j$Wh bGƒWt+G 9OG}Vuh#j$Wh 1G=1u=11x=11 h#e[^_]UWVSM=1tPÉֹ=1:t9pt@9u9U}tj_ ZUuh#j$[^1p1ɉH xe[^_]Ã=1u1Ujh Mc 1YZt1h#j#XZ1UWVS}1$4$E,$E싇0$E E14Et4ËE;CuE;C uC$$9Ku; $trS[uj^ YtGGPZt0 $$$CSEC ECECEC1~Sf YhB#j"XZdUh 3 Pz $Uu-$CHCwC38f S2f [^̍e[^_]UWVSM14$$PvrHto,$0$E 1tL};{Su!;s u{}싹$$9{u }; $tCɉ3e X]e[^_]se e[^_]UWVSS=1t51ۋ4t#1ɉ v0E=e EP4e XZuC u͍e[^_]Ã=1UWVjhG` 1_Zuh`#j!Y^C#=(15,1-5,1Z@u^Vh#0j! V0X1e^_]1Ã=1u1Ujh` 1YZt1h#j XZ1Ã=1u1Ujh=_ 1YZt1h#jP XZ1UE$$ $]UWVS(}u=10 $$$EUE 1҉ẺUЋ,$0$1!!ډEԉU؋E9uE9t1!!ډEU 1EE11ɋEUƅt6@ ]9Xu]9t@P @ $$$NEU#E#UЉE܉UEu1Uu1  O $$$ƅE] tYE]1؋U]1 uEjKZ X1ۉY $$$AQ F AN tX1-t"1111uϡ11M̋]!!9ur9unt`11utLUjY Zt=UMHUPX N HF $$$EԋU؉,$0$Wh!#jh\#j1e[^_]Ã=1u1Ujh=!] 1YZt1h#jXZ1Ã=1tDUVS110tjjs sss3[$݃uʍe[^]UWVS$EE} EEuEEEU E܉UE$U(EԉU؋ 1=1Et#؋M9Hu9p u M9Hu9xt@$uj($X X҉UtMuUЉYt4zEBr EBu܋}rzuԋ}؉rz Z$E!R-` XE #Ee[^_]Ie[^_]UWVSEEE EM}1tqȾ=1tZ9{C$u9K uu9suu9stS$Åuڃ/CSMQCS MQ3{_ Su_ XZ1e[^_]1UWVS]}E=`1t,;/t'PS:^ZuSh#jT |j$V Yu#Sh#j2 tXue[^_]^ S ZtGFG4W8F VG(W,FVGlFF 1F51e[^_]US1tvC1=d1u{ t s3賴XZ- -tjjssss 3=|-t s3YX3 ^ S^ 1XZ놋]UWVSE @~}DE@Eu119}1Ҋ LBuEC}t#]1ۉ]Mэu9s F^BE1uZY[^_]UWVS u=1FhGSPG <9tjww 5-5x;Wu;G t 贘hD#*SR5-{ 9؍t舘h\#0j SR yT$X$G9__W1jT Xjjj5-|wG WxNS5-J{ 9u)T$X$GW1W8蹗ht# 譗h#0j$ W[ Xh#jZYe[^_]UWVSQ1uh#jXZohu u Eޅt6u胈Y_tcvj S ^t;uk ƉYt#uZ GZt _E81QV+[ XW$[ _h#jN[^0^SuZYtSZ u F_Zuh#e[^_]UWVSu} 1t=h7V t&3V譇ZYuusV蛥 [֍e[^_]UWVS1ۉ]U]u tu} 1҉EU]t} t} u^ <^4^F (Ku0CEUEU}t9s}u9rKC0E}1 ۉZY[^_]UVS1۹4Cu񍘜9s CS[^]UWVSЀ| uB=R.ȉ19t^p.*u&fDzu!\?uƄ. pƄ9/u VhD#h SBSyEVhL#h SASy=VhW#h SASzyVhe#h SASZe[^_]USSˋ t%RQP=E3)X 1U1ɉ EeveRu P  ]URPhp#j Ujh豨ø1҃=1t1UMU111<u @=u3} u( A=1t1AH]UVS]} ~;uqjh#P{ u%=-u -h#j@ZY1-jjPƺ 9؍e[^]UVSZÅ3h#V赃ZY[uhD#S衃ZYt)SVh#jhD#h#h #j -vSVh7#j1o1e[^]UWVS]u hV_Z@ub- 1{ǃ4$K<vCVh11 | Rh11 Y jjFdP(%($jjFlP8$jjFtP<$$jj F|PdEUUEщx$|$ @uAjj PT$X$H$L$`$d$H1҉$$$$ 2t8,1ǃ$ǃ4$($Qv`ǃ$($ Kt $x$|$ށ1$$$$w($|/t5uǃ$@($ǃ4$Fǃ$΀($x$|$%1҉$$$$1|/uDe[^_]UWVS u$Hwv$&=1t_h]#j h#h#h#Ń d~ Ph#뮋XcV~Rh#땹1jdRP1$$$ u#EƄ/ojj 11#Y[1u9E2jd PEP苝ojj 11wE1Ex$|$ƅz ӍynHʃ0Pu uo9uhH#9rH@0%1҉$$=1u =1t 11 T$X$W($1jj_Z_8$1jjZYg<$1jjY_{jj _Zud2M1jjhZYuDhSV[_y>jh虡ZYx鋖$  Ѓh##'e[^_]11UWVS}} ?jh#V| Åulhe#VA}Y^¡1 1 u1hm#jE XZjjP虻ƺ- 9tPVh#j ؍e[^_]UWVS]u hV2ZY@u- 1{ǃ4$1E쀾Yt"h YPWnz/@E K<vM E)Vh11Mȉ Rh11  jjFdP芺%($jj F|PEUUEщx$|$@uAjj P;T$X$H$L$`$d$ƆH<$P)PyjjFtP<$ Ɔ(8$P P]ZYyjjFlP貹8$ 1$$$$@$D$<6tL<5t_<2Pπ ډe[^]jUWVSu>-u~t2hpQ#V3_Xu$q0-L PVhn#j[@J.1EPSh)ZYt/G}vEVWh#jEUt@J.u1 SnMXe[^_]á1t UU RuP荪51eMUVS]u F51tRPSM tD3j SCZYu1e[^]US]}t X1|1 1t=l1thJ.j 1l1ZY5D1hp#hJ.1Su hJ.ĩhJ.j  ]USjh #%Y[xEhF_$PiH1YZt&hpQ#SSH1YZt1351LZS`&X=1th #h#j ]UVS] u}t X1|1 1t=l1thJ.j 1ɉ l1XZ5D1hp#hJ.0VuhJ.ƨ~SI Phq$hJ.0hJ.j XZe[^]Um|Ph#hJ.a0j" 1UG|Ph#hJ.;0j"UWVSƋ=81tPh#hJ.0 =01u ЉˋQtjP9YZt/}8tɍEPs4XZ=41tVh#^Xjsjs%} ud#VWPREPh?#hJ.^/hJ.LJDJ.HDJ.[yh@J.KY@J.P@J.؃t- t( DJ.y h@J.eKZ@J.P@J.΃1Ylje[^_]UWVSAօu"VP_ZtDžF%=t1jh" @txPSY[x^9|u,;u(^9u;F u%=tm{W"Z<jjjZ  ׉NX^\19ȉ}{ 9}Dž 1P  9+{!ZcjjjYG? NX^\19ȉ}{ 9}Dž 1P; 9+{ ZjjjXnfNX^\19ȉ}{ 9}Dž 1Pd 9+{ ZjjjXNX^\19ȉ 9}Dž 1W 9PPW  +^_jjj(W~\vX19}p1҉ u݉19} 1QP 9u#)B[@ @1h$莐ZYuXe[^_]UE @E E@E] hUVSutYS} u C tC01@01R: s: S: 01H01 u,1te[^]UVSu01@01`1؃8t VPjZY1u 01u,1t e[^]e[^]UVS`11؋tJ9tFjPZY1uԉe[^]UWVS01@01ƍPxY11ɋ`1tx?tBA'u9t h# 01u,1th jVS119}Vph#p-HQP yP-H Z J GSjXe[^_]UMtA'1`1]UWVSu^Nj7t#vueY[Åu jWXZ ׻؍e[^_]USh7%JZtaujY1"41tP{ Ã1X؋]UWVSP}U UWRW"ơ01@01$TW舩C1҉S URwC01H01u,1t e[^_]Le[^_]UVSuV[t#sVdZYu} tC t1ى؍e[^]Uju ZYt@UWVSjY118u&S;u0h#5-qXZ1P1uj=CP6Y_uyjS5_ZDžuSh#5- Sh#&w%-xWP yPl -H YlJ ]@PS3XZKe[^_]UWVS5 1R.DCtVjEPVY11] &8KȉMA&uV)PRh#&tK11C&u)BUPg1NjU1Xu,Ƹ^ À~|tH;= ÊVθ(,)%%#$Ƹ Ƹ^ 1e[^_]U51Phe#UWVSQ5"11"1PIÉ5"1^=F-t #uKt;uP5&o1҉jEPS6VƉn 8uE8t+n8t#`& tBUUue[^_]W|$wUWVS ÉUM7Hw$4&# uu #!uME5 #tރ uWVuu  WVuun  MΉEEUEU)EU t1EU t19uE$1ۋE9Ɖ}$1ۋE9Ɖ}|19uE}11ۉȉIE1U1 E1U1 1"EU!!EU11 EU e[^_]g_W|$wUWVSU?WsƉX=1%1  UU6EU=1&t #2E11MQ  mWUEaYutu]ƉӉڍe[^_]g_UWVS(Ɖӡ11EЉUtUSt@ vUSƉX^MƉׅuGMIt!EnM̍YWVщ‰ Y[ƉWVh"j]S_jSuA e[^_]US7=1)u c[]W|$wUWVS4É։MЋ?E1EăH311V]ЉE뭃$" "tCك<E4EȉU̸#=1# wEУ1tV!EȉŰEЃ'wF^1ƒ}'u1EURPh"j}WjW6 EУ1 11V]U]11VWEnY1 M1ۉ]11VWE7҉EȉUX}t # n1t VEȉUU1Ɖ׃ƒ'u1EȉURPh"juVjV51 #닋E]؋Eċ}ËEڍe[^_]g_W|$wUWVSEUϋE܋sá11EUUV01Kw\l&8l&}GVQ1YYuRPUMY_Kw#l&9M~߉EUouȅtče[^_]g_UWVS}USƉ׋ 1AZwSjƉYX=1uRE11MQ  SUEZ  !1e[^_]UWVS}USFƉX=1uQBE11MQ  SUE щX 1e[^_]ÍL$qUWVSQ q}W軝51XjLP*ZYt5xIu,xNu&1҉Uj P*ZYUtB@)։51@뽉1 1k1=1t -#EЉUWԝEЋUԍeY[^_]aUWVSRE} d#_--11HO;t(1sx&軞P ωʋ71tx BM菞P M҅xJ sH+ -Q舛X5"1SƉRPh$ e[^_]Ë1Ѕt /tt@11 @1US]u1Z;/uPhX%MZY@tEPS>ZY@tҋM9u;Eu3E3U ]UWVS}V蚚VP. tS[ 1Y]e[^_] ShdZ8"u뺅uUd00 PhI# e[^_]UVSu= 1uE=-t.1҉-h`#}PYZtSΙ 1Xue[^]3e[^]UVSu3t = 11tP( Y01@01 111 1jR01H01Zu,1tG = 1t,j51h]#j5 1h`#jh`#m[^1V~R@$1VPI--1 >/t[5 1>t'1H1FxFC蟛XVԀ~/u#1KhS#VTZYu$-9r :ƅuh1K;/u>thX%VSZYt 1x/4)X/ XV>t1H1FxފFC9-u 1x/C ܚX/=1uȚ101@011tP & X 115-舗 1j51h]#@j5 1h`#.01H01u ,1u@e[^]UWVS} u01@01uxYy 01u,1ttj;á01H01Zu,1ttt hd# Y0t$=-u =V-t5 1h$gXZ1ue[^_]UWVS-hƅdh#葮Yt EZÀ{0u K{.te[^_]g_1l1\1h1d1US]tvUUt[F~Xj Rs 1UE@C ?Ct8j RPUjEpSus IVCX C @C[놋]áx1USQjj]Sjjh$- @tBEPyx1Zt,jjSPjh$- @tx1PATH@=5x1 x1-X-]US ]t6;u1Ct*p試ZtH#1PjEPCp`']UWVS }W1t@01B01PWpE_XZsnEX;t-E@u"xVXS0 Ph#1Psue uK 01u,1te~ jVYX}xu0ju js_XZxV ^uuY1u u zZ unX1P1 01u,1te[^_]UWVS}] -tuu15P1EnރUR蘉ЃEYE$&VwXZ=-=l1%jwmYX=-P1 l1jw=XZ=-=l1=P1=1tSWSWY_e=1tSW=1tsjwXZ=->=l11=P1u 1P1=1tVW=1tVW_X=1tVW8=1twww*1ɉ P1zjwXZ1=P1P1fjw_X=P1tQP1E=1tgWfY(jSW Rh#:h-V EވE1UR脇ZEPՇX1t=-tP1t }tPtje[^_]UWVS} E E܍uV׆5"1ju\1jY=-tKt>=-u5tUVUt E PuRXZ=l1u V袆X\VZu1P1tje[^_]UWVSWE} _--11HO;t(1sx&ևP ωʋ71tx BM誇P M҅xJ 莇H+ -Q裄^`1PS|ZY1P1P1e[^_]UVS]h11jshXZ=-l1tKup1Hp1t1l1up1Hp1W1ۉl1MwE5P1=P1; ut-t)E Ps5P1l1ZY[x h15P1e[^]UWVSu=P1=-u1EPiE؉E܋^Yt$hPS.M =l1b[E؋E1҉h1]؅6F"1=-P #1PP[h#Qv I-xWPyP-H =_ J=s--xWPYyP-H X J 5-W_jsv E Pvk=P1=-uJl1t:up1Hp1-1ɉ l1Hu p1Hp11҉l1 h1=P1EPpXe[^_]UWVS]uV趂E؉E܋S "1jPs{K[tt=l1uk{t_G"1EpWPZYt@1=l1uA=-u81; u{C"1u s ]P1ZYt‹띋[1P1V譂Xe[^_]UWVS]} 3EsdX=-{5"1 #1P褠Ph#Stj RU5-UR h#Xu h#X-HyP-H X J 5-(Y01@01u"jS*fEPSRUztUt,uveuu 01u,1tjsKWs$UuR\e1҉P1 RpP1X 01u,1tjtJ=-tA{t;5"1 #1P1Ph#-Ee[^_]e[^_]USD81EE1EEppX=-tlExtc5"1 #1P赞ZYEP($#[EXtj S5- [h%#[5-tXjEPZYtlE8141j7XEuKt&:EP$,#X5-XԋEtP1j58101@01Eģ81j EppXZ1ɉM 01t5u EpY[01@01E81jX 01t,1t뻡,1txEt"EP$6#X5-LZ]UWVS}] 1CCC =-EP~01@01E^@u h>#VjWbjWPwu31ɉ 01,1tuju(jWu}E؉s 01H01Zu,1tpEP ~Xe[^_]UWVSE ,1@H#1X"1("1$1`H1EP}X1L1E@"1ptEXt7u!C"1hpPSE 1 sB_tҋ[ŋt1ۉEp ^x|EXtC"1sYu|1҉4pjxPS E [븅t4B4닅4P.{_0pt0J0H 䋅010T=-t"=d1u4~0@T40)Љ0=-u 4}fEED 5"1 #1PAZYP[x1ۅt--HyPd_-H J ~j=WDY[Åt?v{Z-HyPX-H = J={=WAX6 ept@t--HyPX-H J vX6 뼋Ep -tRVPK t vHyPhX-H J 5-_uxsjh`&V3 u Xԁ}D ``041 Huw)4)400toX4t-X`0QRUR0of}Zf}tJXZ:-{z-uzu apu CSu>E `tfE=1u Ext,AEftfwE= t=D tgˋE@ft501@01juo][^#=-tf}iExt x V#1H1ɉ #1H1DXÃt t7@ 01tS $hO#,1t}jEP_Zt.41uH1j1uP1P?81@E81h!x[^8<5H1RuP],@81H#1=H1H1ujjSM 828t428t*28 uxPW ZY@t 2WPiX뀃 h u tCƒv~ 1PSP6hU#jUWVS]} Cfsftf$ftgSH#1$jV$PN P|hJyӅtsh#`XZ Xth#_t h#YVh$"XZt h#XVh$Y^tq01@01sP$P`01H01 u,1th#3,P'h# PVh#{ t--HyP-H *Z J*-HyP-H X J e[^_]UVSu&t"8u%uCVP!ZYt؍e[^]UVSu&t8uVPw!ZYuCݍe[^]US,-1ҋ1tHft fux@ |u[]UWVS}01@011t,Pfu9x fu9=,-| P X҉΍^1t 01u,1t e[^_]%e[^_]UWVSuH#1XE'1Ҋ 8tu <:uz:u uz=׉u3׉F<%u }yUVh"#qZYUtU~:uBC렡,-U҅y E,- !WE,-Xe[^_]UWVS01@011t!f{usS XZٍ݉w1t 01u,1t e[^_]e[^_]UWVSutA%<11tCVP3ZYtdߋ} tX01@01V$=cÉ1fCC VCP01H01 u,1tB=1؍e[^_]US&tjP)f@SPXZߋ]U01@011 P` 01H01Zu,1tUWVS] j/u^_t[EtFxPuZYy ,8t,8t,ffCf1CrƋMH#19tMEth!#QY_tM ju_Zt@HftftfuEu6Eu E u=,-yƀx u1E\tE Dž\u =,-yuGYDž5DžXt,-f~tFXDžTDž`juEP` Wa1Zu?/ugX9`Y@Ph"#KnZYtuYDžt51h*#!nYZuzX9`hxPWYZy.*8B*84*T"E%==1tlEWLȉ`+-$Q`WU_ju+ƃt fx`tWuh/#dQWBcXZ01@01d\ujuY_f~udfF`FDžT BtEt$jTPuh<&5-"f`z01@01d\uju=XZf~udfF~ 01u,1tF FfF CfF fCFCe[^_]UWVS(EE1E11E111EhD#vEZtPE܃bw$h&1Eվ1ɉMǿE뷻EE랃}uutjY1}u+u'}u!uEE1: E؈E11tIHft ftfIu1fu'} }t}tuPEvXZEЋ볃|u5-s^-@hN#[EjWVZYtY@ft8*fuu<1P18ufHu("fu}}t̓=,-x tH#1fMfMPu̍EPW EfEփ}t f@ E܃}xf}tjWY_t jPlXZ(OE܍e[^_]UVSu 01@01jucË@ZYft&fHu sXfCFC fFC FC 01u,1t e[^]e[^]US ]01@01fEEE-fEu EEPSL01H01 u,1t ]]UjuZYtfxup)kX1UWVS(1E11h#s_t'ptvtV EѾʋE ct ]tPh#nt h#^1ۉ]ԋ 19d#cuz#QPh#/uSY`&uwjSbXZh#j w tmh#ſXwh$0_XuY1P1x 8u SPYZthh#h#XX1딡18t-HyP -H YwJ h}ujSXZtGfEGE<H#1f}f}U؉UPjEPSEfEEE؃1f}f}t f}f}j/SfZYu^H#1}tEM؉MjSEPEPYMIy߅ud#t#Ph$#蘾[_uljS9ZYuuYhջ$u_Luu"0w Ph\\#W %u%h+#uhA# uhV#譽Sh$ZYu hs#舽XEE~Eԍe[^_]UWVSEPY@1+-P X -^_}GE܊_tqtg}tb} C<v8u1:t* t/t<EP4Y[=V-t"E u 1xA gZH}낃=1uOZ1-8u(hh#YYu3P Z1t p P EPXXuEE %E1F^t\}tÊ"& <vC< w 1@1yYH @1 1@1yYH @1AE@uF9utm&t_U9UčvsՉ‹EĈ@ȉƃEM9MMP YPEP/ EXZ}ׁt }\tE׉΀>-utV]tl\t tVVr M׋MM1ɉM܉E1EURMQIZZYx>EE1EE׉E1҉UURMQZYZ 8Eu ENE<]L}9}]C}t;uCE8CdEЀ8NC]Ћ}Je[^_]UWVSE t1ۊ*?[V!t ^~t ~u GJxw][u|:u|OpW]onon`/WuOpW/=u4:u ]p늀uGt)/Tt2Jxv$tuF>/u uv~tFuc=1Uqxvtu@r t@;}u51[xP51ZYy9tt1t9s'@ZxvttE]S@ϡ1;EtP9Uu8/t]C X%%PX E91t@/Džp>t F1ptJxw@tu@o,1tSMYpF/SZt؀x .u o.ux jWtJ tptWuL51@ 놋EG@WPu@/VP_XeM/ у e[^_]UWVS}P v Gu+EHCt5Orxv tpu tAƉ+E[^_]UWVS]{FFu$1sk^<*P@1@1+-uuuuSuu%@1+-ʉ@1)@1uX uuuSuYeuXE)؋"1 Rh#u܊N#uNQSHPRh##u E܃EEPSE)HPRh#ëdW@1+-Pu }tzM]u EMEtZ|wt<1<1׃uY]Qt@뿃uHus독tEe[^_]UWVS]E %E1ɉME tE-#1u #1E@1+-E;~uE t u S=XZE 1Es}B~< O$,&:=J{s{u{y{@u{=uz1D1E} t 1@1y;P@1e s 1@1y^;P@1"1 1@1y8;P@1 t=D1t"@1+-M9~xuH@1 uE uE 11 1@1y:P@1҃}u C< w 1@1y:P@1S 1x@1H @1Us:H @1U߈ ts"1E#E PVu R<1p<1<1VvXU 1x@1H @1U9H @1U߈E {~=u}1Eu V[X u"1 1x@1H @1Uu9H @1U߈EE RuZYE @1+-jPHP pމe[^_]UWVSEu ]=&-t1҉D1P <1-@1-11ɉ ,1 (1P"1Sp1_Zu#u8@11@1H1@1ys8P@1@1+-P}5$1 1XtXZEu EL}tzKyS]P _ P KyS;P|^@P|4M}tVhh$S荅 iEM0EKySP Y P EEESqEZPe[^_]UVSMt0t"119};ivuC⋉11tJiD} u&ƒu=t uă[^]UWVS utF>%~W,[tW,XY#*Ft~uH<-tB<%t<+u:-#-i1 #11E1MxdtS~J~?Hu(UFPQMcYZMUt UQW"+YZUu뗅uV+ZtjV+11XJxRt~i90tM΅x291~*i1t"# #)#1ۃ} uVP萎؍e[^_]UVShd#K5X=1tYh7#r-HP&-H YwSs1Z8P1xj10Y^u hG#BP+1i5rO@Phi#) 9DiPhh$FXZՋJ ;1e[^]UWVSQ111Uhq#-4ZUt%jtptg Ժ;ƍ7H~hu# 1tyt h#UjPYXUt 1t+1i5rO@Ph#t"Ph,#XZ1tnHi0i0h#Հ-HQPFY_y/P#X 9~ -x99z 9~ z8 ܉e[^_]Ã=1u!UjuZYu11á1u!1 1Jxu 1øUE=-t@=1t7uR+1i5rO@Ph#5-UWVS=1t.511NxtSX1111J01B01uh<ViP)Ë11i߉_19~i9uFP蠧 ^11iƄDŽIu1 01u$,1tЉt 01@01=N-1ɉfǃ14؃} ~iE PZ 01u,1t:؍e[^_]UWVSu]=1u1ɉ 1811SSrwXZu11}=-tpt u U8Wj^X}u-W5-莓ZY@u0t hPhB#SjpSjp*}u$Sj^wSjVwtAt8t$=-tSjpSjpSjpuI1=^uj݈jhx% thx%hw#?}uke[^_]US]U M=-ut u1uEM E[]UWVS}tE1ɉEPu EPE t!01@011E1fJ81tt;E܋EEEEi}9r(}i1M9r}9uKP%׃u6t.}@ƃ}ދxt"ҀEہ‰׊U!!1҉U/A9:,1҉tcu tQ=1t1=-P;u uEt tEu- 01u2,1t)h"}upuEe[^_]UWVSjjjà ~ jjj=-tQCtN5-Z+R^9t7!RP5-ҏZY@u0賩 hjPhB##11951|btPu=1u>SKX5E t t&tt M ڋEsF떍e[^_]US1h#h+Zt$ltptZu⻀ۻԻ͡1u t8t Ph$im^j`mYV=-u =V-u@t/jP‰١-1P1@YZuS5-DXZ1]UWVS411ɉMh#*EZt+}nt}put h#裃=1E1Eă}u18Eąt2jjW{ uWh#jWMY^t Wh#@1Eȅt}E151 1Nx.}t 9u1҉1ủu؋1MjVE^ZMu u؉}tKE؀u?MjPZYEԅtjM1Wǀ =-uXE؊uẼu؈R1M ƒ}EЃE…tEEËEȉEԡ11U1Mx3t#t uE܉kuñȄ]܅u@1E܍EPjj @u q耉E]܅i\9]t}tLjSPY^Eԋu5}t/1҅tHi4h#juVIuS#Z}u}Mt7}t1jVW~ #}SXEԍe[^_]UVSu4á01@01ujVjQ 耾t-S5-觊ZY@u0荤 hPhB#u%+1i5rO;-t ,jVY[=‰tut čt ujZuVX 01u,1t~؍e[^]UVS=1th7#jPXZu hG#Ph$rsY^9~iPhh$IsFXZ١-HyPq-H Y J u5-^Z@uI0 hPhB#u~01@01SSË01J01XYu,1t}؍e[^]Uhd#$X1US] hd#$X]1 1uPUS119|:t%uh#q1X A1Ë]UWVS fE 1E1E11}uEE@<}%<a~<w=$T&)`-&F<=Pހ<'<\"FEF1FEv t!3#< t*#E0 wEA#< u=#փ8t "B;&u11}~ uxFEp"ntj@-t ɉ1:QS@-<}t!~u9SCE\U'$G#"M# $D#1E]CMt]BBuPt}t E"M@EE1E1 [^_]UWVS]} =13v$x&|$jsZYu hO$Xh%[_jshd#jsshi#f[ hn#T^hn#I[Y1벋st7jv3XZ>t hq#X6jsjs u7{t1h#Xhc$jsh`-&1~[(hu#js u hO$_hx#js { t&u hO$f^hy#[js T u hO$@[h#hI%#h#$XjsZYu hO$ Xh#js u hO$XhZ{%h#s h#jswh#js h#Cph#zs t=jvih\m#\jv U; uh#h#9_vh#s!h#sX#1[#%1a#1^#1a# U#S9tRh#j}WlWVC [w*yh#:Ph#j]SlSvjPiZYh#h|$NXe[^_]UVS]u t3u h%XjSZYt{t h%X[ɍe[^]UVSEX1=-u=-u251ju XZ=1 D3...1e[^]UWVS}]51t/1}t3=-tޅttVSYX}u-t?Hi@@} t u P XZ؍e[^_]UWVSP]u }Adtu,EjWVSE# 0ɚ Ph#>vPWVSe[^_]UWVS]t P1 =P1dPXX#1u \#1 p#1`[1\\9P1~jh&`PΙà u\P1dP_NP^؀;18t@x/t@xPSN:ZYy1EЉEԋ\1\u941E[ 1u#e1:tt@u=1h#S范^_19-T!T-51߉Sh-xWPYyP@g-H X J EЋUԋ\11\ke[^_]UWVS}WY}E11tb=-u5}t/j5-4jh-Xf-1PaHZ=-u;1u{=-uru=-t`=-tWh#qgXF+t'=-u1҃=1‰1jPyY^1WZ*u@WTXe[^_]UVSU:01@01jRrY^x jPXZ 01u,1t\rx=f-t01=-t -1ۀ=-t-11jjVj =f-tt-t-e[^]he[^]US]01@01jSqZYxjP01H01ZYt Shw#q,1t~qjX]Uu}~E p P:ca1UuT Zu h-#qUu uK ZYu h-#rqUVSuV~@$VPL_؍e[^]UVSEX9-}]ށ}01@01FPb-P-5--01H01Zu,1tip01@015--)- 01u,1t4pe[^]UEuj h:#jn-)--UE--P-P1P 1P1]US]01@01-9t-P XC-C-C 1 01u,1t ]bo]UU01@01B1R~01H01Zu,1toUWVSW -\ k01@01=-5-1thG9ua-CPW¡--J -+-1-1^^t5;8u1H+pp X@MSNjM󤣐--X 01u,1t e[^_]Ine[^_]UE01B01-)- 01u,1t]n]US--1-[]US-+1-)أ1-[]UU-)---+U У1]UWVS,ME 11˅t MPZMwDGƋ܃}tE0v hE#mFPKE0u _E1t0wLG V舵YMVuY[MM̋3XZ̋EЍe[^_]UWVSD`111EE hb#E_t/}pt}rt}duܡ1EЋ1E뿡1E؃8u hh#ljE^tt S`c[Ejh<"nEZYuE,?&EP5--1X1EEԉEĿEÉEjMQjk HMt EU߉Ӏ\uA}\}u:jQjok HuE߉< uO}tj/P_[X9UtltRUu賈ZYt%URh,?&蟈ZYR}] 1xF $p+-E1!=1u 1}NE-9r,>WuZYtWh,?& ZYuuƃ}tjuh<"ki j5-E0Vi EE؋jh&P݅tT}q 1)Otދ1E؃xu*EJ1xF6p'ljUh<"E0脴ZYUu.J1xV P+-RE^,u1j5-E0gh E5--11ۉ]*EP EЍe[^_]UWVS1hh$E[t01@01jOPG01H01ZYu,1ti11rErƀuDw@@uDx@D1 uEruDw@uDx@DuEr1uD=wGuD=xGD=EPEPEPh#]Vh# ]Y[ ȃ0 wF1҉U1ҍpЉvSh#&T1 EGuԃ}t{Sh#Dh01@01STXtҁRW]SW% 01u,1tgu0j PSh#gҁRY5-SZZ-@th#[XEEe[^_]UWVS$f11h+#QEYt(}St}at}Hu׃Ҿˋ]E&E؃8t@9tE Sh;#1Mԅuxt h"fuh:U#u^Z|u1ۉ]܉]k] EډӉM܉]FFHЃ w!̋U9и EsuhO#ft uhb#EX 1RShj=Yu9UrMˋEÉu&11EPC P[sCP3hq#gZtWEUE܉U}uM}uGh:U#2ZY t Phh%ZXZu ;u EUE܉U1C 1RPuuTXRPh#Y 띃URE@ PZZY@Uu0趉 Ph#G}t]u]u ]uuRE@ P[[^y豽0m Ph#dE؀x u_jBd1*tEUEUuu h# YY$}O 1SQRPiWRPh$X 5-WZ-@th#[XXEEЍe[^_]USME UJ~A@YXu[]USM1t@] 8Tt1[]UWVSP]1҉U0 w9j EPS迣M 9t#t9uƉׁvSh4#Sh#ce[^_]UE0 w @8u1]UVS]1tSzZ1tpVh%SF ¸tVVhb#S, ¸t<uh"St Y^¸t0 vSZe[^]Åt2US-t1:-u-Au-[]È-U-PPR-PXZ=`1tM=6-uDPPc`1XY&u?#jPhL#9a UWVS}] FhP#U_%1ۃ<-u,-R-#RPhh#8Vn#Cuġ-HyPT-H ^ J 1ۋ-t#t#<-t"RPho#U Cuhy#:U[1-:-t2-#t RPh#-RPh#uU Cu-HyPS-H YJ vu&hy%W۪^Zu-@uK1-tPW褪ZYuډe[^_]FuW#Ph#Y`e[^_]USMU 1-9u ]R@uQ#Ph#`UVS]Ct&st P } XCEe[^]| e[^]UWVSP]1ƍ@uPXtUP0UBX1h1r151=11҉1Ye[^_]UWVS }t151EE519N 1BE-uB<-uzu+t 511ۉ؃EEE@tcu}t11ӃouUE8t E!Pu"Ft51U!RPuSjGY[+#Ph#W^ru"}th#`Ph#Rjf^SPXZDu)--u~uMe[^_]e[^_]UVS] C}أ1V-1-@uV-jMX18u=1un-=-u*=n-u:j̍^tjYt - =-u=n-u-=-u --1=-ut :-u-1 -u - - -@uـ=n-uC=1t 1u<@1X1P11jPV1X1XZ=1t6뻋u h#\H 11Pt1111111ۉB9tt 51 1e[^]~U}ujjjjVE01@01jL1Z8tPX 01u ,1u1U[UU0 wj jR' Hu111UWVS}uEt ]uQ t9-u Ayu+UB1ۉ1ۿE?5Y]-uyt͉:UtKu5?:u$EEEjEPh#Yà EPh#cQy:u벉뮍Py:xuWڅuU?<:u!EEEjEPh#Yà tEPh#h-Njh#Z^1H9ujRh#LYà 1Ujhd#h#/Yà U+E@1?1ɉE11ҋMPh#j URgNhURh(#X ÊEEEjURu X( t1E1҉PjXe[^_]UME  h/#pYP u1=1u11ɉ 11h1h1RppUVSM1tuA1u1:-uztC1B<-uztBu 1˅tǍr8tuPhR#9Yy:u܀y:u.zu 1J 12u Phe#{X51151e[^]UWVSj*1^Qzth{#:8-0E 111j1Yt8zt h#W8-u @P51P)Xu n19\x9}h#벍EPYá01@011 1)<}_߉ƋM9sω9s x19r )ЍpkME)9s 151 01u,1tVSo[PY19} h#01B01)أ11ljNx=1tE7s ZEy1ۍ1)‰ Lu11 01u,1tU1e[^_]Ë-z8U 1x@ @-J8-z8]ÃxuUSt Ps XK]HÃ8uU1҉P8u]UVSƋXCF~h 1A1Z1f@ fZfXfZfXZfXZXRfPȍe[^]Uj1҉P-JHR P UPUSUJtXxv-u~u C $t h#-B0+B8PCXe[^_]UWVS4-EX=uE8t h(&35--1} t u Eu P9!E@EŠt 9u u4--PP GӁt uu ljE)WPk 1H}t 1R\uG1x\F p\Sà u! 1x F dp 4-> 1xF Dp u"4-@4-==O A94--PP 1xV P-)Rx-X4-M)ȍe[^_]UWVS@} -B ]urVY wVh#Vh# 4&h#j"S?FS͙Z؅tWh#}xM4&h#jP FSUWVS]S5-M EZY9-ulPY_H=`19s<wDu 9rMW5\1j ZYt%\1=`1M܋=\15\1 # #S e[^_]ød#-ztLUS`1tt#u*d##4#1 #154-P`1ZY]UE`1jZEODU謳\uH袳 u"4--@8xtjjXEjjh"D _UVS-Xt 1ۉXX8x tjb-1҉P Y1p84-P0 1x1P10ƃ)c t,~tŁF $& 4--PP @\ |td;Z=t g u,?&u-@1-@d|u-@Ǯ-@)&t;u,-@ -@ q-@-@r-@_a=t0 u74-@4--B0ztjj`Y-1҉Pjhb&Vtà ؍e[^]UWVSSá-@tuy =-,uyGEt7`&t,O8uQPMZYu`&^_8Et2jwV2Y_t XS4$PS- Rt -1҉P؍e[^_]UVS-p$ t jj-ubX(x,u{ upVDZuh7#P: uBPVg-BC1ɉ ^t‹(wjpV P0+P8RF Xe[^]Um-B]US]V9tjS]UWVS3t u%j _8XpZʡ-@؍e[^_]UWVSS-@}%11EuCPw C u j X1҉PYt8uj 1~^Xj 1҉VPXFYƉ}t'}ugEwRu D}twu}um-@-@}t_&t<}t jjG-@#61ۀ& r؍e[^_]UWVShEӉM-@E1E81E誰E+-]jEP(ZYtxcTd*"t~L tgF=.H#"$$& Džd't+pЃPЃv;4--Yt藧PЃw tPd@d_ƍ@;w`u h#<\u<\uh#ރ?PDžd Džd11\PЃ \w t0)Pw t0Pw t0脣 Ad9ud(=w h#0=1 á1HCw6 1?ʀJ R 1CC@wj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1Ywj 1 ?ʀJ w 1CC 1?ʀJ vH 1H@ 1;wj 1?ʀJ w 1CC 1 ?ɀQ vP 1P@ 1 ?{ 1?ʀJ w 1CC 1?ʀJ vH 1H@ 1 ?ȀP vQ 1QA 1?ȀH vJ 1JB 1?ʀB< vA 1AA 1Xh#}€ u 1 e a]tW t)蔣'~ \u聣=uh#%4--xtjjX븲Š"& <w 1C 1fxt @ 1C=u 1s\谟k u%4--@8xtjj^GJtujaY>uVZ0VXs;5d1};5h1~5h1}>uIy>u |u &u y1tm&ups1ɉK-djdB(-@(X4-Pj¡-@(Y-u @ 1҉P  躚s-X$-@ 荚-`H,hP S-p9-@ Y (\u: 151VXO"D8 .lhjډU1H\^{t &1\+-X 1d\@{1#Tþ}Tty&uh R.DYu[tJ}Tu@Td1e1jjhd1 T1Tۘھ &tJ 1xd@d\Xd\ &uJЃ wK 1xd@d\Hd\ƒt:@Ѓ v0t' 1\d\P 1xdX=d6X=d%:t #u&¾Rdh &7TYZ&d1H1tx:C X:xCdXdt\dd9‹\uADdd1 u#}t 1x#C $X#踖1Gfxufxt΀Aw@ ȋ-X2dVNj@f@f@dr@b&1҉Pa'uAW|b&u11\Nj@@"&f@1\$ו1HNj@@&@f@e[^_]UWVSS-1ۅtXC1-0x tj-1҉P YF8Pv vS‹FP U8tSj-p蘚7jhB&P-HUJ@ B Κ]e[^_]UHu+]UWhPT81ld-`(1\}1󫡨-X1pjEPNZYE81(1E-Tjh螙 :jhB&P -B t$Pt=^- hppDžt1ɉxR|T}E-jjtP‹ -pnX-`-dڙZl81\(141u jltDžpd#u^j2DžpF#X-`-dlXl81\(1pu hpp}UWVS -@1ۉ]}¡- u@$xm@4$&jj}CjjlCQu;jF Ej@UBjj,UB뻡-xu j F Y1҉V @jaj 3^ -zu jCjUjCjD-@C u-x,u p [u h^#Zj诿 -PS @0C>-Yx ubx,u\h%pz^ZuIu¡- up0-pY1҉US@PvjjfHu? 8j@-1҉P P-J0HCBHYvB-@ttjjjtCV-@^Xj蓾 -B0+B8C j -p0EC 5- ~ uh%vyZYt h%CEF-xj ƋE0FEY-xu-x  jj p0‰EEU表-@^Zu UBE밡-xt jj@0Fj:F -@Yt-Pv jj u -@FEM1҉@{j jC1҉SY^tNjjX=V-tt3j"-@X&}t-@uWf^_VjjJ¡- u@$x@1ɉutt;tj aXZÉs؍e[^_]UWVSP} uE E1E1}-X- u+p0ƉxXtӡ-p^[뼋H up$E0FEE럋]K9u}} uwj- 4-H4^SZYuht#Ssj/vI t h# -4-+A8FF-1x4M@u} u jj\1E1҉j 1ɉHEFE F -@0F[e[^_]UWVSS-@1tu=V-tt h#LGܡ-@nAuWj 腺1BUjnËUBpXYUjU$C^Ut1ɉ ֡-@tj")pZƉe[^_]UU-1ɉHHPtjjX-1҉P t/Ht3-@jy-Ytrrh#*-1U11ҋE]DUU Et 9Pt]UMt1tPt9JuB]US]jθSCU PUPUP X]UWVSEPD[y h>#9*u;5-~5-ExW8rZ=w PWVI `jjjr uNug*jjjjjjjj$jj SEpuju*Ee[^_]1=p1UWVS}u ~}th@VW辘à VWИZY}t9u9t:W)X19t-y0M PVWh#S)SVWh#)9-}-؍e[^_]UWVS]{tN7Gu p1} t} t&Wxjw PR+GxP)YWE Z1Ce[^_]USt101@01uSwt1SlE 01H01 u,1t ]']UVSt1t/}u jS$ZYstFxPx(X6͍e[^]UWVSu] -9}5-9~-9t7S7(jjSV+9ta8V(WL PSh#'؍e[^_]US - A - ~.CPjjm' x9-}-P'X͹ؙ } l1]UVSul1 ~;d1|p5l1j V&à x9-}-9t'X3w8u0=l1  ]8tjjV& ؍e[^]Uj ʹZth1h1UPU PUS]h1h1t9Xu  PGC X‹]]&UUh1t 9Pt]UWVSĀu} ^01@01 $@&vMQtVQ%YXty$1U~j0&PVhn#&jW%PjW%vvhh=-trvjV$XZu hh nxPWUZY@u}W%}$E%=W_%}YVvhh vhh VL$ǃ "N xtQqZuQtYttj :   <t?j}WSQy"|0H PSv h##$S$Z 01,1#VXS9=-}=-~~EuxV-9t1jPSW0yf|0"H PSh##rjjW# `1*|j0~$PVh(#X#19u1e[^_]UWVSƉׅu#P[u VtYt ukj jV(#XZut{0sG PVh=#"jV"XYut{0FG PVh]#щ؃p Ѝe[^_]UWVSƉ1LÃ}tVho#5- Ed#$EtE"&-td#NtRuh%PFЃ!t)t7Rhz#Pe t u1~ t1h %5-<YX 둅t}tSh|#P h0tVdYwN9d1~>}u}1ɺ<ƒu,EEptVl_9h1}Vh#0sssru>t1UPjS" @Uut0q@ PSh2#> !9t'VjS @uut01@ PShR#}!ju܋MZhq#rXe[^_]UVS]u M1P1<&t#KyS PMX P<&<uFtPh#S+ S4<&VZYt vVuQShS#MSh#EF y)KyS] P-Y P-Ph#S Sv XZۍe[^]UVS]r01u!u  1u01tX=1uOTuZ 1tO 18tCt>!11@1=-tu01uO ,1fr0[^]US]SYt ]]鋵h\%S: YZtSZu]US]#t%SzZuSh#j h11]UVS]} tKyS P ^(P ?u3Sh=-3=-u,=1u#=n-t=-u1uYEPjSn @}t tD1:=-tt!Sv=-<uu9ujPSlZY@t^u1u jSZY1E܉EEEK>v Do DjEPj e[^_]UWVS] }uh&sT`^_t}sh7$V1`ZYuh# j5- xh#V`^_Eur 1tF01@01 1P2 1ɉ 1[t jVXZ 01u,1tF@u111Eq}sh3$Vu_Y_th&"Vd__Zt CE1#~puM} CEh&E0"_ZYƅFMEu}}(th1ۍF~u 1u6u h#XV?Ph% C ~ h-u~u1}tE1 111ECh#RXECu\ 1t 1Ph$Y[E PaÃEX?vEphp#5-6 h# 1Zu h#  1P XSCPh# zCuui01@01t VX 1t 1Pg/ Y4 1t jSJXZ 01,1EO111Ee[^_]UWVSuu 11ǻ 1tB8t;01@01W- 1P01H01ZYu,1t!1uu e[^_]e[^_]UVS]u 1u VSQYX1<vjS%gXZuƃ1e[^]áP 1=1u t8u1UWVS11ɉ 1!1u@@u 1e[^_]1҉!1=1u‹ 1t1}W15P1S!jP+S- d1t }wWk15P1Xe?!1uHuUS]91t$jj1jj(jj1]US\1ɉM=1u'=1t1t EEP111P11tjEP[Zu Eģ81jEPZYt01@01jEPY[uO8Eģ81=1uы 1tǀ;tH1 1jSXZ몍Eģ81bjcwX] Cvv1ɉMMMMEPj?{XZjSdYX1EEEEK>v yg DjEPj  [SPdXZ51eU1E1YUWVSh`&P ZYj'V+_Zu <)ș19e[^_]á01@01-t,UP + 1--Z 01u ,1t 01u,1tW UWVS]~;1Wu u  ~ )Dž~E u F ~) >f8t̃؍e[^_]US]S t0 9t*Cfx!)QRP yfKC CC]UVS]Cfu"1CfKS u>01@01s>C CC01H01^uV,1tMV Ffu9s01@016CPRC S)S01H01ZYS XKe[^]UVSu] >t/CHCFyS!VH XڊVH 9-u]e[^]e[^]U5-uXZU5-u~XZUPuu EPE u h# uPJu( UEPu u UE Pu5- UWVSu] Eu]EPu}Wf EHyEWfEUZ fEUtDe[^_]UWVS u] j'V'_Ztt~tnh#VqZY<u[KySP"X P"SVGCHC^_ySwP"[P">t%h`&V0ZY<tBEt7KyS#P'XEP'1҉U1FVKI't/KyUES AU y;뼅t$KySP'X P'KySP\X P\KyS^P'_ P'1}D>;,KyESJ 'YE J 't"KySP'X P'9-u]e[^_]se[^_]U5-uXZUh-Ih-?XZU8ruPh#Ph#UWVSSEPE X85--1j=RU/%ZYj=S#%ZYU))9~߉Ӊ 1I 1<=t$t xFU蘙p UCɅxUzU] Ue[^_]KUE1@u,"1+"1Rpp h#jh#1#1UWVSu} ]t t9u t1141&Ft9t&!@t)[^_]UWVSS11ɋ "1tZuA=u܍P訕EY1 "1t5Nȃu$Ft sVЉZt F6ǃu1Ee[^_]UVS];uE#e[^]h#S@mZYSvNZ9u;Sh$j'S!#Y^ƅu+Sh%XZ/<'uh#sXuS)Ph"#o e[^]UWVS]} sSt"CtS҉XuEs1Et Wh9v$Y_}t5uh9v$XZ$-Jy R[ -z9 _F>=u y:Cu}thrz#FPZY-HyP-H X J e[^_]UWVS=#1u#1 h;#1Y11 "1tJG} tE t8tEt.#19P5#1#1%#1XZ#1CFσCF CZh8#1Phr# u.E,#1,#10#114#1e[^_]e[^_]UWVS "1t?Cu  u s YCuS ZӨ@tsCcX뻍w"1t묍e[^_]USjju' u1+ËPu@t s SZuۋCS D]UWVSuT1t#{VWZYtj=WY[XIjjVƃ t2@u+ƒ U t!Vt s VZu FV \؍e[^_]UWVSE :rtE11ۉUh!#EYUt*}nt}ptڅu&}u Džu뾅t18u(Iu 1ujSVRu1E1P1EPjSMM у 1Ҁ9=uBtHt !H)u*@t$USuhv#O EUu0넅u* pxtuS0ZaSh#VRSv FEe[^_]UVSQujEPV Ë@M t 01B01tCUKS |uujh&V E ucCƒSu u s{ ZESm X 01u,1t1҉Ѝe[^]UWVS#1#1su s --s  ZYVCƒJujvXZ=StuPF K DPY_F u v ZCFC FCFS Xbe[^_]UWVS111Eh#EXt1vt%et1f EփxuѾ뾋E E=1t&}t P- Y}t V7 XZԉ؍e[^_]UUE  E UKt h#jpp 1UWVSUUu 01@01jXU:-u0zu*5-ɇ -Ǿ-C 1s_1*jEPRU<ǃ UuSj=RZYUtR贇VPVjRe E81s C1C@C O u 0Eu 0E% uKOKE tGG <=uRUVP tjRU\ZYU w"1u"1<=u "1H"11"1{#1#1 01u,1t e[^_]e[^_]US]tu s,XZ]US1ۅuh#NtxtIuh#uYu 1P1t SPXZ]UEU )]USME )u AR)[]W|$wUWVSO1҉j EPSQEUO 8t1O8"u'EU9sSh[# E9u Shl#R.U8@}DW@tE9tфu͋EUe[^_]g_UWVSQƉeukIe9Fu[~Z9uJjjxY_UPsPURO Hx N9 uW XF!؍e[^_]UŠH8-u>1tfzuhx jjh &1zuHh jj h&BR.uhx jjh0&h}#P?ZY¸(&t1UWVS|ƉӀ8!uxu :~[tfxipftft!f u&Pb%_7;";f xuWSt[^1WSܹZYuNf$`&)E%=E%=@E%= E%=`pE%=aE%=RE%=CE EE6M;MUԉ!]]9>(u;)u V Sue[^_]UWVSƉ׉ˉ&fx@f$&SVz=Y[SVj=_ZYSV]=[^SVL=ZYlj։11 lj։11 ylj։91lj։9ylj։n9([lj։P9PVz^_xPScZY04]E9uc9u_E98PV!^_uWxPSZYuD04MU9u9uE98f9]PVʶ^_t1oxPS賶ZYu鋅|9u;xu͋3E 3U $ !~t08u9ut1u ud# 9uM F8Mt#y޸<5#uPh# ECSW YZ@u';"}s#RPh4% E}t jW XZMuUVS@#1111W5<(9t j=So YZt hSXZb Ph#j@]SjSh7#j h-h<"(j hN$h(#*ƒ &u?#j PhL#mj,h<#h#\j hN$h6#K$e[^]U=41t 111R- 1141<1 1=t1t jY-----tP 1-ZUj1ɉ P1~>R-11-Zxt@~j01@01jXZ11uƀ1@@u 01u,1tj UEt]UVS]u tVs XZe[^]UVS]u &$&Vs [u CEe[^]s [2VDF4$VsJVs Vs[Vs Gs2VDF[ ]VsVs C[XZD[*uFEEh#VGY[EEE8.u(px*u Eh#V _ZEEu uh,$EffEƋE@xWBtG,%A[A< $,&CCA<2hIEܡ$1tP^u&$Mǣ$1YE܋E܊@<<~8Hw0$&b~<'tz<\tv<"trflnhrdt`v\ru R.DqtN\y ruBMuЃ<u^?MЈAu-<@^ae\ruЈBU?Es}ttWWtWWEС $1tPZ1 $1$1tPzX1$1$$11ɺb E5$$1FP£$1XLx׉2Es}t"tRSuuh $1\0RutRSuh $1=Ruh $1* @ $1 $1 Ek5 $1h$`$11t$11҉ƹlcE}tuVuP VSvtVSVP3}tt PSuuSPutPSPub_XMƉUйjEV}t uWVuP(hWVStWVSWVN$1th؉EM܀"t'uEЉUmЊM<41҉EP$10}С$1P$1UY^MmЃ=$1t^}ѹLE}mt(t <$SuPX <$u t <$SP( <$]EЃ}t%tPP$Suu LPP$rt PP$SeWW$u%}Nu 1BuhI$C[^E@EEf}f8$15--fBYt*fBhT#jK$1}9tǃ8뼡$1h_$XPeY[^_]aUE E EE]#UWVS}0uh j jh`&MQÅu$Mh j jh &QtÃHxu Vhl$EZYuICƒH1H1CH1Cd$1C 1f‰H1te[^]% VhW$je[^]UVSÉ֋t8uVhp$MjUR1YZtVh$IH1XZ1EEe[^]UWVS11Dž=H1~ Vh$XZ1 RPhS =t=H1Vh$75 f}Ut=H1Vh$芰[^1ۋhJ.h$Ea6Whe $hJ.VvWhm $hJ.CF (twu1h -&SY_ujh6$&V &t"VP_Zu&fH1&uhP11҉zY[th$vVh $ fH1hj$S_Z1ɉ>ÉhR"V _Zu h]"VZYu6hb"VY_u Vh $, e8I1h $SN_ZDžum>jP11҉(Y[th $赡XZ uhp$蠜Y[ &;twWZt ucPVWYt uT- &ËI1WYƀ>th#V_ZƉ>1&tR.DPt7hP11҉,ZYt$h$蹛[_ Dž"!y v5Vh^$耛h$v1ɉƇH1H1$ &pI1|I1|I1H1WH116C-fCpI1|I1|I1H1te@H1t>16C‹|I1H1hH1Ze[^_]UWVSP1۾ &< &tCtg1}jSEPT th$螙Y1@E h jSP`1E43FZ9uuXe[^_]UEU M= -tMU E]j]USÃ=H1=H1u1҉Dt%PhH1XZ*0 u=H1t =H1t*0 ux=H1u=H1u7j豨hH1hedAS/ tHhH1hrdAS u/h$jhH1hedAP y h$j]USQH1WEVdI1WEVfhI1hH1:fhI1X=H1=H1u2hH1hfdS y8t8t$rE=H1u2EPhmdS? y h&$Z$-h= /X=H1t1&hH1hgdS y7$W]UWVEu H1t H1e^_]UhH1hmd5$- UEU 19s f3P]UERPZYUS]EPu h@J.hS&ƒt$t< tj S8FZYt1]US@-tsPhi$(  `E Ep$]U"=xJ1u"Ph$P: Hu9Y[u uVh,$YI][<1M9Y<}Ph;$]Y[1jP8` t5h$1uhJ.=tJ1~E1]9^~ t)t;FtF5h$1WuhJ.+FGVhS$謡XZe[^_]USBHBy;B| X RQcXZ]UWVSQ]u uh'"SF fw4`&h"Ph."SȤ FPjh8"S贤FPjhD"S裤 Shh%&XZFXt ShQ"Y_FXt Sh\"XZFXt Sha"Y_Sj xv(hj"SDv,h|"S6 v0h"S%v8h"Sv4h"S $vu8t/jk} tu Sh$E Shq&5_X뿃} tu /Ph$ 벍/Phq&[^띋$t $P蟪YP蒪Z}t E1_jPS薚 y h#X7ƒu*t=tRƱ$u hU#z e[^_]UE(P1E P1]á(P1á$P1UE PuhJ.FhJ.j H~j豊UWVS]p8ށu= P1t5(P1hp#NYX=K1t"= P1u5(P1h)$*1K1XZuu I ZYyWʰPhq$ t7= P1t.j X= P1toP5(P1h7$ȓje[^_]UE Puj' UE Puj UE Puh UE Pujj茉UWVSt1ۉ$P1Ph%P^_y hg$YKhVu茊 }t Ƅ1ۍPW8PYZyWhv$NXZ]%=`uz 9u;u$P1Whh L1d à uWh$뜍xPSO^_yS끋%= Sh$e= u0t,WhV詘 à t ߻Wh$+WY#0hVcy à uh L1h$BXZ멉؍e[^_]UEPZtPRPh$ u uh$hhK19K1U塄K1tjXj USYj0h&j訇 K1jjm1]USjjjCjj:]UWVSÉ֋x CPww wwփt=@P1~j 蟬X@P1e[^_]UWVS1=4P18P14P11,P10P1,P11 Džu/h$h$`v[^Dž SUYuÅu@3hVw ǃ uVh$XZPXEtVh$ӏ Eu {u{wu"Wh+$hJ.. DžQCC jhPjVK Ãt'$Phzd@S舿 @uS [W}YD R.9rDYt)PH,P1t4KRWQw u <tPȉj# W~ C1ɉK C C1{;0P1C0P1_=v1LABLCEȉC ffCRVCPZuuWY^S~fCe[^_]US\S1tcQRP$\S1]Ƀ=R1tf‰Ã=R1tUWVS$ƉӉMСxR1EF,E؋BEfER1KMK R1Et EEM MEE1;=R1R1>f}3EE܋Eؙ}E)9EE у}uUuG=R1=R1 }t Ct C{tfC[9UF(9V$}1uD 9~ txƋCSM$C,AExR11}fG18f@@XZtA 15R1xR1C,)C$S("s${(19sC,EM9bE@EUЉE@EMK,E)ƃs${(ș=xR19E9UʋMou{5xR1C,)֋C,C,)s$S(;h<$SNjCSMEAE@ufFZ[tA 1R1Ee[^_]UWVSu^8C@Pvu uu uhPu uR1 )P@1ɉ5TS1NP t1҉ 91CtCS OtNCSWV^ +QCSLCS >WV] +CS yP @1t|u!<|uxuxx u xv8|^u |txTS1=R1XT؋tllωT|߉TWGs0GWWG zCSlTblp@QPDt{D|~DS Cq0CS Ch> 4BhD"l1ۉp@W dhOPdh t19| H0#8@#OLlpPxp xR1TS1H0|Ãx} xR1x5xR1f-sTS1B0C9sjh-V^5xR1 C =R1t@Y @[ JPdh t19}#8@#BLlp>Ãxjh-p^Phr$j=R1t h$AwYh$OZtWC jjTS1@0 RPJ P^_DTS1@0Ɖ =R1tL‰ˉы Љ\1ۉЉ\P@)GWWG)GWdtLL1ɉLS Cs)jCS Ch)Bhp8|21R1 ]e[^_]ÍL$qUWVSQQEUA@Pq q{$ƃ 9jjTS1@4 RPjjWVv f-xR1Hɉf- f-f-f-f-E-=R1tE-]E]C WV XZ=R1t CpSt C(T1ҋ TS1I4 xtWV`([^11tjupEZ xR1f-UJ TS1@4B9s$Ujh-QMZM xR1 UB fCgu5u0C‰UjjLUfPjjSuu(ZY8tuuZY8WVSWVQUMPHPH QREWVٺU$WVȺZY8u(CWV诺fXuu蠺f@uu @Z[@fAjeY[^_]aÍL$qUWVSQpQAQ A1 %Cff^_#f@tی#Ph$$\=R1t+=R1tC CC C u#h$qYh$ڰZu1R11nu t3f@^_`P1dP1jj ¡,-ƅDž Dž1 R1X[tBBp tBBtPR^_t`P1dP1h$Ӄ[=R1t/5(-jjjj`P1dP1uh$蘯Yu5,-RPjjt0S1=R1toh$Bpb5`P1=dP1ut(jjX@[ZHfAWV$1`P1dP1XZ=R1tj *g_`P1dP1ut!jjRP!`P1dP1uu h$RPof%[^f=@h $sh0 $臮ZY5`P1=dP15(-jjjj`P1dP1utRP5,-jjEhjj5dP15`P1YƅDž WV}@@PP WVaf@5dP15`P15dP15`P16^_8th; $x1ɉ R1[R1R1tCjj RPQ u{C9s#Qjj RP|N N0ӍS19r)#u 5dP15`P1iu"h\ $蠀hj0UWVSSƉ׉uEPQU 9t:tWVh$$j芍e[^_]UWVS É5R1PSXZ=R1t=R1t h$$TXVSa^_t u=R1u1h$$T[R1=R1u6TS1Ph$$ToSZYt h$$jTXh%$_TXr=DS1t8=R1t h,%$'TX=R1t hJ%$TXhm%$T_=R1u h%$T^'=R1u h%$S[/=R1u h%$SYr6=R1u h%$SZ8= S1t=R1u h&$SXPTS1 $( @8 $(RP5tR15pR15lR15hR1h/&$STS1@Di($ʉ1WVRP ( jj RPD& RPk(dd$WVRP' RP ($hQ&$z7@=R1hR1lR1+R1R1 TS1hR1lR15TS1NF)ڋ~,f,pR1tR1Ӌ~4DӋF8׉֋ $(+ R1R1 pR1tR1u't2!RPh&$v6 =R1FSQh&$U6 =DS1t4h&$?6DS1Xtssh&$$6 j 75X=HLY4DEUE9ƉU}4Ѓ1R1뾍U1E 1pR1tR1hR1lR1ETS1];X,W}}1Euu TS1U׉e^_\Ttq֋}!qSI SQhS1To5S1TS1}󤡤R1=R1ttt5TS1u5S1脜 =R1tE@x TS1E1E=`R1t7TS1p,kEd1E;SVuPh*$hJ.$1=`R1=R1=R1ExU t1U u E#uh*$;[^ExU uۋ}G\M]ȃ}tgu EUHu}u}11ۉΉ!!u6u2EU}9}u܋}9}uԋEUEU}uE|S1ËE}uu 1ɉK<}%?}u}9t uuu,EZuuh+$:j1}MECEUEUtxu}9r WV[X M89xu9tuËEUtx5T1=T1 T1T1TS11҉EUtxEUtxt1x1 E9EEEEe9׾r 1)ӉΉߋ|S1E]3u us3S1|1҉TYm9}u9utc%?u9tWVh*$;9jSub0YXu Suh7+$9uEsE)Éٍ1EPE 1R1e[^_]UWVSEP@EUE@ E}juu艻 tT1t`}9xuPu9puHEuuh/$Ep p T1qyEpxu}qy T19@S1u @S1u덋=T198tEUMK؍e[^_]UWVSTU1EE DS1T1111ETS1H,9M=`R1t5kEd1M6SMQuPhd+$hJ.> 1ۉ`R11ɉMTS1U;9soWVtXZt`u} R1tCCpR1tEtCCttEWVkZY8tEPSZYuE_Ee[^_]UEU @,+B,]Ƀ=R1tf‰Ã=R1tÃ=R1tUWRPY_}UWVS Ep8=R1t 1Q=R1tt1;R1R1slj}1RPj@F[_DžEx48x0.FhX%PI]ZY"}O_ u9ttFPh',$s4Y_+$Pn`ZFfSPV wh+$>`_tr<Fo)efFYPVWGfSPV|E@0P4p pihfH DžU;B0B4wr r@Y[=R1ƅhhS#Px R1 R1ufEx4x0^N<9")f fFE@01x41RP4gfH1󪋅fFXZtwFhS#PYZYucA1A =R1 ~hN,$Ep pFhL.$^H1R1EHX P@uuȉhf,$SQRPVFD9+$>tFPhs,$y1_X+$P][tguE@0P4=R1t h,$CYP1҉P FfPh+$#]_u@@ uE@0P4=R1t h,$[H1ɉH F>ufWV3 C+fFPVSfWVuDž}G0W41RPdfHXZ֋>^EP4@0wP~.uJ9}:uh,$ ~ .u)h,$Ep p֝1>hL.$[EH0P4 19R1R1s h,$=R1tuHu<~t6h,$1RPEp p蔜=R1uHt%~u븉FhL.$&[[H1f1RPcXY,t#B<v^uM;A0A4o hf-$1RPEp pЛh,$ZW1ɉ R1?M;A0A4t!=R1=R1+$+$R1RPEp pPh,$ZǃS1RP,f%ZZf=@AfC1RP蚻ZYxu xU;B0B4ЋR @RPRPhPqb‰1RP1RQhPBb0Ph,$Ph-$-=R1t h%-$Xh,$XYU;B0B4}R AAQ=R1tTVC9tHh0-$1RPEp p™CFhL.$~XHt 1҉R1 DžfKPRh?-$>+u Dž 1 e[^_]UWVS\jj`_ZP$&h[-$+h2 $W[^u 1ɉ R1}hjjjj8h-$+h0 $W_Zt5jjhjjjjآu hr-$X*1ۉR1h($SW^urjhejh-$+h0 $,WZYuhL.$W_>jj%[^@%@3fs Ph-$)=R1tjjY_fXZh j5$S154S11ƅDž 54S1$S19T=`R1tD+4S1=$S1k#)WSPh-$hJ.1`R1C$w0h-$ss xR1A 1C$hL.$ xR1QC SRPRPhW^ xR1C$1҃=R1tQRPWhA$h.$a)QRPWhA$h.$b)=R1t h $9_ xR1C$D1C$=R1t/ss CNjC$1~YY=R1u$GW 萷h $TZHt1R1GWڍ@1=R1@fC$1 S( v Dž 19}L,@ HLPxfC$1C( v Dž 19}T,L0`d@݃ vHC SCS1u`tdPPĹ[_=R1u4S1_54S11ɉ R19s؋{$@1=R1@ukfC$1S(19tL,@C SCS1uV`NfC$1C(19tT,L0`d@Ktd.PPiXZ0N^uu9r~$tF~ 1‰1 t!tSQYNjN ^FV~ uH~uBFV =R1th6.$SQRPOhS#vvvv 蜓fOWhP.$SQRPhL.$Pu 1R1,v vOYf@fOFVFV RPhS#vv 訒4S1$S149s$;ww Y1҉WWY_8u؋=4S19s3CSut{u{ tRPPSXY[jj蠍XZe[^_]Ã=R1tUWVSX$S14S1D4S19=`R1tA=$S1))Kkd"VWSPhj.$hJ.8 1ۉ`R1ss WZY{u { <{u{t t&5R1tC=R1t8=R1t/u*CS 9RPWf@1C SCSut+RPWW¡dR1Y_:u9|Css菰FXZ95dR1|)js s賜Y=h.$E"h$YN /ss^1ƅs{Dž  R1^_tBBptBBtVRPZYu h.$x!_Pss觛tQDž ssvVPtUf@Y[5dP15`P1UfHXZ4e[^_]UWVS EP@EULS1ETS1RVuu EEƉׁ\TtCЋU!CQC RPhS1R5S1TS1}󤡤R1=R1ttt5TS1u5S1 ExU t U tuh.$ [^1}E@ EE}juu跢 pEUЃ1EUR10M;DS1Ӆt3}9{u}9{trzs{DS1RY!}tdExU uEp`ơTS1RPuu E؉U܉Ѓ1EU܉M؃3pR1tR1Ex@t+jjTS1@4 ؙRPEpHpDp p` TS1Ez89x t2}t,E@$ EL@ EEUMW}tu}toTS1E{89x u^E@EL@jRPEpp K` tPuSzch 5TS15[^5TS1BLЉ@D =R1uhL.$ [Huqh8$Y=R1th 5TS15hSP5|S15R1ƃ hS1lS1pS1|S1=LBALt[=R1hY;$`hL.$tY_jjjjjSW;=|S1fGWW:fGS1CJtejPhx;$ =R1uh0$ Zu9h*$X=R1tC=|S1fGW9fGS1_fCff=v]h;$Y=R1uh;$Zu8h;$sX=R1tfC=|S1fGW{9fGS1_fCffuih;$AY=R1uhL.$5ZuDh8$ _=R1tjjjjjS:=|S1fGW9fGS1f{f9}zD3<:uX19]~KؙEURP5S1VWӰ S19tؙEURPh&$ S1E e[^_]e[^_]UWVSQƉӋJt,B=S1=$9ud#s sRh=$gC 1҉Sss ssV T11E1ۋTS19)؋r09~ƋL߃=R1t VWW* TS1VEA8HLId t1RPW5R1=R1t VWWu* TS1X0Ede[^_]UEU z t]]UWVS]TS1Hdu } t1[19{ u9st7S5R1[1uWVs5R1Cs{ ECe[^_]UVS`T15TS1`T1t+NdEU  t19S u9CtCt[`T1uh=$uu uS$SPC`T1`T1X`T1K؍e[^]UWVLU1u} uĉ}ȋEERSXe^_]US]U tuwtttoPh>$ {@uRs s: Rh$XZ=R1th=$۸Yh >$Zu 1]UWVE5LS1TS1x=R1t5TS1p5LS1e+ e^_]`R1ÍL$qUWVSQQ9R1 R1s RPh/>$/5S1 TS11ۍ}WSQRPj U Ƹ8-;sAeY[^_]aUWVS\]u EUEUEUEUEM1ȋUM1 uE u uE %)uu*_Z=[1u <vuE #]e[^_][1U1EEƃE9Eu E9EEUEUEUEUEUEUEUE ]uuOURP\S<)lj$SWNwG/ 9rbEUEU}t@EUEUE ES#RPNURP\H1҉[1#}u1ɉ [11[1}u}tF?N)Eu ]e[^_]飜UWVS]\T?2} 4E uh`Ѻ} Zu hR>$h`SP: =R1t hy>$}_=R1Lu=R1uE PP%Y^E \=R1uPPK%XZ1f Fff F@9u=R1tE PP%_XE \Ǎ=R1tE PP$Y^ C0\C 04C$8<C(@DHLǃ 1҉ Lu(ǃPǃ1e[^_]UEU \T 0H   Lu5PPQ\R\Pp UWVS}u=R11R1R1y R1h T1P^_=R1=S1=R1t h>$j[h>$eY=R1u׋TS1 S1=R1ux șRQ^ (T1,T1h S5$1=\S1=XS1=R1TS1=R1t h?$^h?$[u 1ɉ R1=R1TS1ƀ1҉PTXh P5u6G뭉Eu贏Ee[^_]UWVS}]O,uhNC$h&h` ؙt,hqD$h&ha hB$U Msu)u؍e[^_]UWVS}]O,uhNC$h|&hq ؙt7hqD$h|&hs hB$DUMuu )EUu#P@EUEPU Zt̉É؍e[^_]UWVS] u}[1t5R1WVShD$ySWVu5R101e[^_]UWVS] u}[1t5R1WVShD$xSWVu5R11e[^_]US= S1t hD$|?j5[1{[Zt!hE$Gh($[ZYujn5[1xX1ۡ[19XL~$[1t@Pp0h=E$(x Cҋ]á[1t%Ux,tP*Y5[11[1ZË[11t z,tUu uuuRUWVu} WVZY=R1t@X@d=R1t1s&TS1f`u131 ȍe^_]UWVSR1tH [1 [1TS1!`t'RhjE$ۑh($ "jmatuhlpx1RhE$脑h($蘽 thE$TS1 ǀdƀah P5~jjhK$SjujjjjjS iytWVhK$S~WVh@K$SjujjjWVSE ,EEEEEPHME@ uWVh6K$S`~0E1ɉM܉EuuuuRERhRK$S EԋMQуt;t6juj1RPEURPS uiMPBtruiu`thL$}u}uhM$SY^,(ST @u,(h)M$S EjjEP11ɉ6 @SjjjS1;t-jSRYZtW@ P$@ utS9sKjRP jWVS@u/tPO ZSlX1 $ ؍e[^_]USQ]tdҀBuCu'EPhd@ @u%h>M$SXZuSh]M$S E]N ]US]jSZYZuhM$jS? YZuhM$SXZ11;VF|~$u~,u;VV | F_8tZu[tuxY8{&CV$9t N~19};{; N~ 19};{ ;KHEPu,_ZNjF,uVЉ||t2@|jmURj$O8QpUR|P赓tijWRC uYjuWUu@uuZYjuPUu@v0shN$u[1e[^_]UWVS]u}SZuBjWPS@tjW p S@tϋE p0hN$S? 1e[^_]ÍL$qUWVSQ ȋqyQIUMx uhN$SZY<$E܉E1EuuWV> utuWVhN$SLEPuuuu; Ɖ׋EUutuuuh%O$뵋M9ȉËM}eY[^_]aUWVSu 1ۉ^h %57'W _X1td1SщU&M觑YZMt/UBuShYO$u h %jV XZ뫋&&  Vۉe[^_]US1&&uhuO$N`u܋]UWVS ]} Whd#S 1&&EԉU#E#Uut7d#;tn#WPS讯W&S衯EԋU!E!U`u}u}t;uuhO$juVLd#;tn#WPSJWVSB؍e[^_]UWVS]u tEU E UuuhO$SY[ SZu E@P9sPVhO$SۍFEPS Y_EtVhO$SV 뭋EU҉EU#G0#W4 E UG0W4SZ@tuSZYEU#A0#Q4 E UA0Q4S_@NVhO$S Ee[^_]UVSP]u >u>j EP57*U ߃ Ku;=?v57hO$S A BEziuUŠu 57hZ"뱍e[^]USQ] ;uX=1҉j EP57) U:u1҅u.8u 57hZ"u Ћ]UEUitstau+u P uPeZYUD@RhP$P2 UE t*u 57?ZYt57h0P$u@ US] ;u#57Y1҅uhKP$uXZЋ]USEU MitWat&bt?L,RP@st?ttMr:~h]P$PdY[E1eRP $RPP[Z/@8Zu%S57>ZYQhoP$P ֋]UWVSu }jj hd#WVj]SB yEWVuhP$J}t Shq$IZYj IXe[^_]UWVSQ]M tu E"E𿵶"QhP$S'M $jZXZM uWhP$S 9jVQjjuuSU 1ɅuWhP$SV^‰ȍe[^_]ÍL$qUWVSQ AQEUA E܋AEjS3_ZthP$6jSY^ujjjjSTEU}u&}u hQ$SXZEE$EƋEUuE9Ƌ}s 11҅tEUEU9E}| EUS~Zxt h0Q$PP @9E}}EUuu hNQ$'EUjjjS@ $uXY_u hhQ$jPjuujjS8 uV\hQ$SU p EFI FPARTFF \PFVEUF V$UMHV(N,EU+EUEЉUԃF0V4F8PSg<_Z@)QFHVL$}$e9}s}܉~PFTy 1;VPsUWS <ZY@UB߃}uujSr@jp juuuuS u hQ$b @ r $󤋃 H PAQPA Q$PAHQLEUeY[^_]aUVSĀ]E 9pC.tE @&1҉Ue[^]Q,(hR$&$hR$dE$1RP,(5 RPhR$ hS$MjS\ uhS$LXrX CRPh.S$Ds,s(hLS$s4s0h`S$$C8Ph#hxV7VhsS$DsPhS$D 1e[^]UU E$E8E U]UWVSQEUAQ E܉UEUEUEUE9E E]|!I뾋Eu^hGT$PWE UEԉU؋E9EE]}5Eu"WVuu uuuuhVT$Pz(1 AU1]1 u`U3U ]3] uPt3}ut(EuMWVuu hT$PMEAE A E$A$tMu}t==T$}w } &=T$w&QRhT$u<1ۉYMuWVE Uà  E C E$C$E;EMu7E;E u/ACKtX EYEUQ#E9Eu0E9Eu(ACKtXYE܋U)AQ qMԋE U+EURPEU?E t]s{ px EUMԉQE܋U)AQ A}G{YK_Gtx)E}䉸hT$u"XZ؍e[^_]ÍL$qUWVSQ8EAQE؉U܋A QEUqy19WVuu- ut-E؋UWVRP?/ ΉE؉UMWVuu]- ut-EUWVRP. ΉEUMEEă}Eăx}PEЉU1M9ˉËMY}u}tE9E؋E܋]DE؋U^9E؋U܉EU}XWVuu, EU}u}t6EЋUEȉUWVRPi, Mȋ])Ӊȉ+EUԉEUEċP @+EUEȉŨ}u}tE9EȋE̋]9uȋE}uH}uB19}FEPWVuu) ыU}ut#ΉEȉUM EUEȉUjjjuuȋEЋUEURPuEă Eċ@^1EċEčeY[^_]aÍL$qUWVSQȋ]yIX P@E؉U܋w yhT$uhU$urXZ~th7U$GW EUN^ }u}u O_ uuSQM؉]* M؋])9]u 9M@E9؋U}SQuuhXU$uO_ ȉ+EUEUVFV +EUFV FGFtxM]M]SQM]uu) ҋM]ut&M]uuSQM]) M])ӋGW EUE9؋UO_ t~tfȉWE؉UjEU)ډM]RPE؋U# M]uhT$ugt tN-}uA1h 1h RXYS}uMQhpX$S jHJ8QRUP0(Ur 1B$E1r(z,ꀃEE}S_@tPS^@tFUȁ¾1uuuRuSz@uhX$SZY1EEe[^_]UWVSSÉЋt""""Ujq Pq qu uSU uWhX$S &PSZY@uWhX$VWhX$S|1e[^_]UWVSÉu uRP@ }}t}ME"E쵶" UMEE䵶"E"@ Ur $Ep PFVEPF V$EPFHVL1Fv VFE0S@uuhY$S uuh.Y$Sb1e[^_]UWVS]} tE &1ue[^_],SEUjS thNY$SjSrjSd jSVjSH u uheY$SY[z uhY$݅t)I }9y$uu9q tGPhY$S 븅t*t u5Xu}+rz WV tjj _Z@ultjSY^+uu tjjr_Z@u)jjjjSuu hH$jjjS4ƃu hI$1fdžUjuu썆PjVjjjjjSC0PSY^@uh!I$ShY$S0XZ1e[^_]UWVS4u ] 1E#h2Z$uV_ tPSu @u95pC.th&jZYjh Suee[^_]UWV`'}^_]UWVSH]u }1ɉM܉MMMMMMEhxZ$WVE_ Eԃ @t=}buEPS^XZ׃}qtuԍEPEPEPSv@uE95pC.th&jE1;EE}1SuMu_t xuPt9pu 9uU@uuuuuSsẺUЃ}u }E܋UEĉUȋE؉ES|ZEHEPSEjh`'PuuhO$S\ g$1RPuu EUSXt E;AtIhZ$S_Xqy 1U9ЋU}`9u\9uuW}u}t,1U9ЋU}=MuuWVX ҋMu#u}t 1uhZ$SY[uuuuQMSẺUЃ}Mu}t{9}u9utű}1yMăEp(x,S'Z@tJup(x,S:@t$uűMq1uhZ$S>Eԍe[^_]UWVSH]u }(,EUEh0[$WVx\ t(qtsu&jsEPjjS@uzE95pC.th&jG_ZuujjjSE܉U}u}t2E܋UEU}u"}uuuh4[$S Z$1RP,(7 Ɖ׃uԉ}؋M9ȉЋU}WVuuhK[$SjSEY^tPE܉U}u}t h[$Eċ@ EjS_Zu hM$pjSY^u h[$Rx G EG$EjSg jSY tu h[$SXZE9Eu"E9Eu}u h[$S_X1E̋p GPGTEE܉EME9s3Mjh`'V MtV(F,9U}UƋE̋P @ẺUЋEU+EU9E|uuh[$EԋU+EU9E| h*\$.}9}E}} EUE܉UEU;EU}9}}M„tE9EԋE|EUE܉U1}9}}R tIt@}u hW\$SZY^ U܋MHE܋U+EUЉQ}u hs\$SXZ1M9ȋ}| EԋU؉EUuujSA@jp juűEU+EURPS uh\$S @ r $󤋃p PF V$1~PF0V4j\V\FSv H PAQPA Q$PƉ׃q0y4AHQLS4@Eu}UԋEh\$S[^MffuSZY@h\$Íe[^_]UWVS]1uuuuu11h\$uu 9W btENtoat%itClh-&UY1EPS&EPSEPSZY@kq`1;EE}=S;UU܋UUZt&xuPtM9Hu M9uU@օtE 9pC.uEU t th&jHZYWVRPuSwe[^_]UWVSDE։ϋ$]$ẺUMЃ}u}tE uav"]t=]$WVPuu ";E] er#E H]$tA]$WVRP#1E%EtEE@u}wERj hd#uuPu A z*E }\8Ev"EtE=]$ű}EO]$EBE@EtjhWV  %1ҋMIM˄t u tfRPuj MQ!ƒEE 9shEčDU)ÍMQSEʋUXY}u ED }tjhWV Ɖ Euu EʈE}t"EˈE}t t ű}؍e[^_]UWVSXE׉M]u E]u t4jj hd#EƉRPj]S y&E j@URPUME[ƒ u묉ډUuuuhW]$!U:t Rhq$!ZYj Xe[^_]Ë J.QJ.y ;J.| tJ.J J.UhJ.P!'XZfx8tNUVStjmuVj$8Ph`]$jn:jVEP;$t SjQ:XZEe[^]1UWVS΋UM x$&Ev]$u 1ۃt h}]$y XhH$l Xuh 󫋆Rh]$ X&8Vh#htV=Vh]$Ãh]$E]$e[^_]E]$~u1ۃ>t h}]$Xh]$؉F VX1ɉ9u 9Auh]$ h]$ _t6f~8t/sDžuQzjmWj$8VҸ6tt tVh#Vh]$hWWh]$ÍtY^99W3Ch I$SZumudhl]$4E E]$e[^_]X=߸l]$u PPh.%à d#ى؍e[^_]UWVSljӉrh^$s3h ^$s sh^$ tsh#^$yXZ{thh1^$gK Cs31| C "C 8Ph#hSsSh^$FPh#htWFWh^$Vh$hS$(Vh#hWWh^$WS_ t Sh^$YXVh]$hSWS^t Sh;^$iXZF0V4ut!RPhPPhJ^$;ÅtPh_$ Sl1 e[^_]UWVSxƉ|PE_|t 9St[RhZ^$V趸 T{ sډ5Rhr^$$1Vs3щ¸^$A$1Vs sщ¸R$(Wh$hV Wh#htSz SVu]ZYuhh6$&V_{ SVh^$GPh#hS7 Sh^$$jmSj$G8PŴSh_$h_$G0W4uu h^$c"XRPhPPG"1e[^_]UWVSxpPYps'2N xR vh%x h^$h:L$x h^$h^$!x \ tDžlH]$pt DžlA]$p@hhh lv6x lPv vx l3 Fp `Ph^$N Fv61 f~ Wh$hS Wh#htR tRSZuhh6$&Sx Phd#th^$d~tu-h \1h#hS Shd#th^$**Shd#th^$GPh#hSU Shd#th^$hd#th^$ƅhj hd#FN x$$RPjSJ (x Sh9v$|XZdd#t`-&FN x$$ʹd#dtc$SRPQh^$$`t;FV hQpщ‹x t Ph_$[X ^jmSj$G8PưShd#th _$ hd#th_$G0W4 uuh^$KYhRPhPP,Ghj7#EËN Fv61Xd `FV hQpQщ‹xǃ ted؉W0VZƒs0\1\L 9sHt)))к WRhd#Ph,_$ Ftw]F 8P%V 1󫋂Sh#hSxShd#th^$  ve[^_]UWVSX1ɉMMM 0\111h7_$uu ~F ǃ x`HttWtA}ˠ뼍Ol$'뤃럍EPu EPuE_Z@u7skc [`SKh0\1uZY4hp'jɿY_! F=0\1ha#}ZufJ.ft)$URjh jjj jP*/ }uEPhht@WC u E0\1u<ttu$0\1P"0\1x0\1 0\1@s tE 9pC.thp'jپZYju8^_uEu hH_$Y؃tڋEn;EE}3uMuZt xuPt9pu 9uU@܋EEtى‹EniE ǃ>v> ÀtGu_1tq EVj@MQuщ‹E t P[RY9sNjFV j@MQuщ‹Ex tP,RZ9EsEv뎉}E?v? E?vE?%EuFs}sEh%Wh^$ah:L$uh^$Oh^$uY}vv vv6hr_$ N Fv6" yv뼋VOQMQSщ‹Ej tPWh^$ FV MAQMQSщ‹E8 tPuh^$  FtLPh~_$_XZ N Fv6^ vXZ7 hl7#Y1e[^_]UWVSD] }1`'}E_$uh_$uu zA tfitJTt,Lte[^_]UWVS}]t?u 1TEPEPEPEPEPEPEPEPEPEPSh`$W^ 4 uEyƒte$h d$ m Y^uhd$륋$1QRP{ uh_e$SC 1 hd$  XZthd$V ZYtjhP{ u$he$SVM B  4PhlF$V5 F41$1$8Phd$V? TP8Y^!1RW($ $( ,10$(+he$ _ZOhd$P諨 ZY4PW _u"jh`'R蓻 umV Y8Ph -&W= dR8ZYdt8he$S 1ۉ,DPh%Wo3 LPhb %WR3 g,9DH0|;LPhe$S莙1V $@P~ , uhe$SXZ:jjj,Bu @u hf$1$ 9sP,Q} ;$u9FjRPQd,Bu @u h(f$-hf$r$, ;$uF9$shH$ } _X h &R` Y^P踴 ƹ,hd$R0 P Zu X+tPhC`$W 2 t,0Ph#W2 ,0Phd$W2 ,0Ph!d$Ws2 ,0Ph.d$WO2 a,0Ph -&W+2 =,0Ph=d$W2 ,0PhFd$W1 ,0PhQd$W1 ,0Ph^d$W1 ,0Phld$W1 ,u/(~ǁ#,$ ,0Ph{d$WD1 ,0Phd$W 1 K ,fǀUjjj+)Bu@uh:f$SI$, ;$u ^u&H$,ȍt _Y4t 1󫍽@Wh -&V8 tuhd$SՔR@ZYu(Whd$VQ8 tˍEP@_ZYt@he$S腔 fEPh%V0 tEPhb %V0 mEPh#V/ SWh2$V7 tj$EP@1 sV\0ZYu+C xu"t s srEYXj ZuXe[^_]UWV։P Zt hZh$j@ jVXMQE 0Xe^_]UWVSuE @80ƅ77Ph5#V t 7u->HVH ,Z3V _t hh$0x jWhЎ( Ttg81ƅ9Ȏ(@󥍅8Phh$jPS7y0Phh$jPuVy VShh$j? SV[t hIx$j? T˅tdS zuW$(,s.ZY(u1$zu%B Nj] t>sV)ZYu+C xu"t s s>YXj ZutXe[^_]UWVS@J9sr[^_]UWVS]u$ZuP7E_@u hl'h]g$u+^uhl'hLh$jq9 sP3;Fs Ws/FhV%u諐 t.P Eh$u莐 E tZu EYLEPh)#u) }Chs@Pu @qhi$u XZt Vw Yhi$u XZt QY XMEPh)#u E Mu {hE EEEM؍CU`EPu u @Muhl'hi$fEftft5fu6t2C t Whi$j7 }tC(Uhj$C0ut3h$j$j7 t C0sHtS4KL9sщ}t:s@shuG us@s`u2 @u;4481t/sl`}t$CU[s@s`u @uEsd6CptSuZY@u s\h:j$s8sXu @u s\h$te[^_]UWVSPu Zu1du 8 _tLV胼 Yt4W蝑 EWu g tPMQS藎 uSK [1VY ZtS X؍e[^_]UPEPh$uK# ƒ 1tEUWVSu\Phi$V) t\Mfnj4Zu\VXtd$1jRV>VhiS@tt}f1RPhi$u 8" 1e[^_]US]uu S? @t ]]1]UWVSu u謌 [^u 2Pњ Y9Es2?Vۚ Ƌ}M)1Ze[^_]UWVSu uE [^u R2Pj Y;Er52?Vt Ƌ}M)1Ze[^_]UEPh-#uQ ƒ Eu1UWVS8uEPhAj$V uhڍ%h'hhJj$R+hj$Vv _ZtPҙ ƹ}[E]ShiV4}ĉjS Phj$u ׋ ƃ S荴 Yt:EUu؅y1ӉM]! EjEP虗 XZuVhj$u x V1 He[^_]UWVS1Rhiu54 @t|j7RPhj$hSހ>tVhj$^Vt j7RPhj$hSP;tShj$!Sw\ e[^_]UWVS]hj$S؉ Y^tVP Zthj$h'jVhJj$)V ƍUܹRhiS<3@u hk$j2 e[^_]UWh%1󫍅hPhiR2 t|}UWVS\PhAk$u uhڍ%hD'h0hHk$(dShiu2 tT\`ty1׉\`! ftShiu>2 @؍e[^_]UVSuV|ZtÍEPh"$V uhڍ%h'hhHk$(uS#1^Xu hk$j0 CPS蹔 ZYu h'hk$Phi$u 蓈 uh'hk$jn0 S31e[^]UVSSu] EPSV @uh\'hi$j10 hk$V脇 ZYuh!&h\'hhHk$6'i$Eu$PRS He[^]UVSSu] EPSV @uh'hi$j/ Eu hi$jy/ hi$V ZYuh!&h'hhHk$&Phi$S{ He[^]UWVS}hs$W视 [^u,PȔ pY@vhk$VZu hk$j/ VPhs$W@u hl$j. xtdPhiW/ thl$뮉`SuX`e[^_]UWVS}hWq$W ZYu+rP pVYXuh,l$DVShWq$WK@u hAl$j. 1҉Uu]EPhiW#/ @u hZl$j. SX1e[^_]USÉЉʅu d#t#QuRPShgl$?]UWVSu1j+Vhxi PW @uhsl$ UЉUPXۋUu hl$j^- U]Vhxi W  @uhl$ڋE9E~E19u~tj YWh$FXZj SjUVSPuVZt"ÍEPu V @u Shl$j, @PTUWVS$ƉUЉhmp$P [ZtPJ ƹY1@]Shvi Vs-j Si Phmp$uS à V HZe[^_]UWVS(uEPhl$V uhڍ%hP'hfhHk$"#MԋU ;@udE̋UЋu}y1ӉM̉]Ѓ!! ׉u}j EP貏 XZtVhmp$u 薃 VO He[^_]UVSuV[thV%V誂 ZYuh!&hl'hhHk$\"P ^fx PSr+ZYu hk$j+ PX1e[^]US]EPhl$S u F(&juS-,ƒ 1Buh4'h$AXZ]Uhl$1US]dPh%SA uhڍ%h'hhHk$y!d|lPhiS8+ @u h!m$/AX1]US]dPhv%S uhڍ%h'hhHk$!d|lPhiS* @u h/m$@X1]U1EEpPhiu* t hl$jg) 1Uhk$u豀 ZYuh!&h'hhHk$c Phi$u 3 HɃ0 v+BwBÍBwBUl&]UWU1ERhiu) @u hZl$j( 1}W|$wUWSÉЄtGjj hd#QPj]S S zd#t#PSh:m$ h1#¸n#@Xe[_]g_UWVS,$n| uh$'hRm$j( jLh-_Zd#tFm$jmh-lZY¸Lm$ud#WPShmm$hJ.=h-t VW?Xjmh-&ZY¸Lm$ud#SSSSSPShn$hJ.|$V. jUEU P]UEU P]UEU P]UEU P]UE1҉T-T-1]UE1҉\-\-1]UE1҉d-d-1]UE1҉l-l-1]UE1҉Pt-t-1]US]Sh-YZt #=CЃ v؃߃Av #h-Z>u# -1]UE1҃t\1]UUp-t H9t@]UWVS41ۉ]܉]E䀖Db1EԅƉ@b1EPj=yZY@u ho$EU׉ủ}ЋMMāɚ;~EU6eĉ}ċ=@b1}11}t4މ׉Mԁɚ;~mʚ;1uĉủu11EP[@u hIx$j % }‰  ˆUË]؅C tw@PYEȅtePu Eȋ@uLRCt}tME9u9u E9E|9}SZtjEP Y[=Db1tSZusujEPjwZY@UEM9u]9uE9E-9ŰMh(4#j# UWVSÉHP]ZtP_D 1D1V!LY@u hx'h]g$&RPHSƃ uhx'ho$j# R1RPho$hWrWVh5p$ jVW軾WhiL@u WhBp$6:t PhSp$XZjVWqWh~iL@tt Ph^p$HY_j `pHZ@uhx'hfp$uu =`-j:RPhtp$hW?tWhp$W#| j:htp$hW?tWh q$W| tHSW?YXjVWRDž@WhiLzuhq$XZjS9#jVTWDžd1hlWhiL! @t|hXu h-q$l@1dWhiL @@u hGq$@lh_q$b@R =\1t%ͱ"w'Rhmq$'Y_HS XZ=\1u0=\1u'DjHSDP jV`V̻V\1-{k?PL@uv$=\1to$Pj h%}q$ Kb1BXuthiw$n#Xuthͱ"n#Xuthq$n#XutRPhq$ h%q$JKb1_uthiw$n#^uthͱ"n#Yuthq$n#Zj L5X-XSV65p-tjHSVv e[^_]UWVS]S^t EPu S @u Whl$j< u r Sks Yyr Etuh'hq$j EPaEZt hIx$j u1EVtRUW ZYU}tRUu} ZYURh$S tFE=Mb1tFtj=Lb1tFu[=Ib1tFtL=Jb1uE=\1u+!Hu)}tj XhJ.vZY U6"=\1tj XS蹝 u豝 u\j}UWVS,ÉUPb^uhPh$@ht$St ZYucU̹ Rh8i(S @u8t ht$jm jht$u uh'ht$jF Eܣ`b1`b1u Vht$j e[^_]UVS։PVVSPhu$j UWVS]U h(u$S?s ^_uh%h'h2h2u$‹`b1ށ؃E u %ERU0 NjURM WP襋tDPEV踩ZYUu K$9ERE ËE É`b1X1e[^_]UVSP]U Chsu$Sjr ZYu wWP菀 S诀 VPÃt7EPS5`b1ƣXb1S1Fu$U`b1e[^]UVSP]U hv$Sq ZYuh%h'hh2u$P S VPiÃt7EPS5`b1Bƣ\b1S1Fu$U`b1e[^]UWVSS]U h=7%S9q ^_uh%ht'hh2u$Ƌ`b1%EVB Vb WP躉ƃt1Pu3ZYu~u$EM É`b11e[^_]UU EkEPhu$u uhڍ%hd'hh2u$=`b1%у uсE ȣ`b11UhJ.hu$JXZUWVS]h=7%Sp ^_u3hv$So ZYu"hsu$So ^_uh(u$So ZYtP`b1 \b1Xb1!‰`b1d$1󫉕tVh7iS; @u hu$j e[^_]US] u虤Ph$tE tPYt Phu$QXZEPHYtPSh%5 %܋Et Phu$XZ]UWVSuV%[u hPh$/VYu1P{4Z@u hT'h]g$p 81jS8P蠲8Ph8i(4@`%1󫍅`PhiV @uhT'hu$j tWph v$,X 'Ht#8tuP9u QXVhv$XuShv$_XjPY^u h "j> \8Ph8i(4 @uht$HNPh1v$wh%HH9Tt$hb$Lh%Tj)Vj LP4Z,H%(h v$ '_1ҋ0t`'xtO(9u 09t4#HɋL d#tn#QPh% ,딅u h6$&r^j YjmZti 119X~M%9u>uWPh=v$+ hSv$h\v$4j +F뫃 u]e[^_]7e[^_]UWVSӉϋuuh 0h Zt2tVWP?l u3 1ɉ [u1Vݔ ZVԔ w Xe[^_]UVSu]}t Oj~ NPڋE XZY@uEC s1C1e[^]UWVSu]Et,DžpVRpRtWjPuBpWMw Y_u  ܋NPڋE Z@tʋEC sF C1e[^_]UWVSW]EtJs$URPƉ׉‰ 9иr E8t!8"uo;sC| C 9s} "WVp1 Y^u  볋K(PUE Z@tE}G _C G1e[^_]UWSËtP X1e[_]UWVSÉUMU1}E;E t[ztMUj8?^t`NjUx4uup4x u}x xuup1ɉK(C(E81 S$uS$S(P:XC$ue[^_]UWVS1ۉ@}u 'E@u E@ u*PE 0rh ZYu6PE 0Yh ^_u獅LPh-#E 0 u 10 L0t 1󫃽0 00_0nuT[[Hh %HPǖH,ZYu Dž,P5&EXtj/VyR[_ÅtC`1DžT0XDž\@PTP,V͍ǃu@xuPq$ bTt/0u#xPVtZYHufDžtt,Ttt T]1Dž,tN(j DPS^+,D (t8t1ҁ,v d "1҉(VX(0tDž,1ۍK 1UvAE9s:2UFPhw8#)ȉMPM UuRW u9utD7...}e[^_]1e[^_]UVS ]uVhiS @u hGy$j EPhWy$S uhڍ%h'hhay$E߉EVhiS uEhy$XE1e[^]UWVS$]uӹ!1j EPhc%Suh'hy$j EVhiS} @u hy$j 1e[^_]UVS ]EPhy$S uhڍ%h'hhay$uVhiS @uhGy$E؉EVhiS @u hy$jw 1e[^]UWVSxhSh~$uQ@uh'hy$j DžDžDžDžDžShy$_Zu?Dž1ɉDžDžDžDžjShz$) u ؉8 R.DytRx:uL҃0jWVh %Pt;9u8tMh z$j jRVjP\ƒu?;t 1҉Ŕ@|Phi8uƒ 1Bu h*z$j e[^_]UVS0]juVh~$Sg@u h'h:z$V, Zu VhMz$j Uf@fEލEPhiS% @u haz$j 1e[^]UhJ.hqz$rXZUWVS] }1EPh8i(S @t&E1r r r1ʹ|󫍕[!RhiS @[< v Ph {$j hJ{$蝟[P\P <fDžLVhiS @t%fNthQ{$=\1t h[{$8XfDžLVhiS @t%fNthd{$=\1t hn{$XfDžL VhiSu @t0Nf=) Phy{$Ğ_X=\1t h{$譞YfDžLIVhiS* @t0Nf=) Ph{$yXZ=\1t h{$bX|1󫍅|Phi8S @t}u(j N$PhiS@Gh{$EEEEĉEEEԉEEEEE|Phi8SO@uhU?$謝Xr}uMu u uuBEH~HER.DJtx:t~&jPhy$ uWh{$F^_1Dy hy$+Y Pt`XZGj,$Xh{$Y4t8h{$ܜXZ ht#ΜXj _PhiSF @PhiS* @jh'PvZ u ftePh{$[[^Vf"fP& Ph{$& ft Ph{$ ZYj #Xe[^_]U81EE1҉UUUUUUUUEPhi8uO @u h*z$j1 1UWU1Rhiu @u haz$j 1}UVS]EPh~$Sv uhڍ%h('hNhay$uVhiS @u h{$j 1e[^]UWVSSÉ׉Ph$SD)Í6 9})j<X)ЉU~&Phw8#諚GZYUJuj>輙e[^_]j-譙XUWVS Eԉ։ˍUع1fuf]1ɉMRhiu uEh{$XE1e[^_]UPEPh{$u uhڍ%h'hhay$ME\UPEPhe{$uw uhڍ%h 'hhay$dMEUVSjjj"^ y h|$ \1ɺuBhPS y h|$ZuufiuSБ Xe[^]UPEPh{$u uhڍ%h4'hAhay$MIE=@u h+|$j> 1UPEPhY%u uhڍ%hP'h4hay$4M E@u hG|$j 1UWVSƍt1fDžfDžRhiV y h'}$jZ h'v 1l)ƍJ(R!R _9l}l' Džl hB}$hɬ%hG}$hK}$h|$hkz$h}$llhP}$_(pp(dp@!Pd!pP Yb1t b1Eb1tI@tc@tC@tP@ tS@@tB@yA@pXx@`1ҋpv9}pL9}B\pfP@u uw%k pfx p@tp d#!= = w-g 1u=w_f?v-k 11u?1p%:=$v1"- 1p1p P< hb1SW`\VPPllhy}$Np@"Xp@!dǃ0X*w'Owt4tov2tW0 Z=\1OGPySPh}$h}$蔔=\1i|$ub|$WZdPh$YXZa#d9s ΃d#yEy$VRPh6W# C %Ȁ=\1XGPGPGPh}$h}$G1d_19d&j>ޒ^=\1GPh}$RKStRTRPh}$}RPh}$l F뗀=\1GPh}$GY[Gd<G=PuZh}$h$XZ=\1WGPh}$GPh}$_ f`Wֹq|$d5t-\PQh%蜒K "\`f\TddT|$tHv|$Pt|$Pty$Pt#PQh%K "봊`\d<"\TL=PuEGu:h ~$h$賑^X=\1GPGPh~$萑 t#=\1db~$h ~$h$RY[=\1GPh*~$4XZ1t D ҃L dd`d#dt|$VRP`Q4@'h8~$ՐCu_hg~$h$赐^X=\1GPh}$藐GPh}$脐wW ÉTӹq|$\t-dPQh%GN "dϋ\fd`T T`|$tHv|$t|$ty$t#PQh%迏K "d\kT`Ph~$yZY=\1)w '$ '|$}$tx|$un}$g|$`|$Y|$R|$K|$D|$=|$6|$/|$(|$!|$}$ }$ |$}$OG)Xsj 趍pp)hXh'"e[^_]UpPhiu ulhl~$Xl$Eu h~$jv EwE11 -USE UUXt=EEEE1҃UjURP 뺋]UE Puj蓪自 US]SWPh$jF Sb1Pb1~ UuUE Puj4(j UE Puj Ã=b1tMUEE EjjEPEPjEP账ƒEBuh$XÃUSP蜆 jhh'萄 jSh uSh7$6jPkZ@uShI$j]UWVSd@u~Q1}=b1tC&;Et7EE jEPjjjV@uuShs$O 1ۉ]]]]]E}W]SjVSjqÃjh$ ZYu$$1uuuujEPj* E"1}jh$h#m EPh5% h5%h$j ju6h?$r[jjj} jWjjVj\1ɉ -jEPjH u8tghn$Z(9uV,Ph$jWjjVj Pb EҀu+=t$h$DjSy = -m = -tjWj4jVj* -RÄ = LEEEEEPq Xe[^_]UVS]E pt&I>v ![^]USQjj]Sjjh -ZthST#uNb1Zu h "j jjSPjh -u‹Eb1]USPh_$hJ.蛌hJ.h$ShQ$hJ.| jUE E ]#UWVSSE u}up8@$1%1ҋ $1 1 $1 ډ9t''  9$t' '11Y[^_]UWVSE u}us8@D$%T$ T$ Љ$$1҉9t'/ $ 9L$t' '11Y[[^_]UWVSSE }uJ8p0 Љ$$1҉9t ]' $09tu' E'11Y[^_]UWVSE u}uG8@D$T$ Љ$$1҉9t' $9L$t' '11Y[[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVSSE }uK8p% ‰$$1҉9t ]' $9tu' E'11Y[^_]UWVS UM EuT9|$y|$T$ ʉ1щ9L$t'9T$'uwy|$y|$L$ ˋL$ ˉ$4$19t'9L$t]$$9T$tq$ '11 [^_]Uhe jjh@-u{1҅tPUWVS jEPڲ Eu_X1E9}2uSPvZYt!SPcZY tG1EEe[^_]UVSQË0tRVhу$EPvVERsZe[^]UWVSQ1:nuzouPgsX1҉Uh %P, ZYt98nuxouSPZYu}SPZYuE1V耘Ee[^_]UPPPh׃$hJ.裆j2yUWVSÉ} u,PQ 1- ZY u QhG$1t VrXt*hk"WUOZY1u"su4h%,P^_uE"~u M }jP褰 ZYt1ih;$KjhU$Wh uU jZP,P/ t% 9|\ 뭋QRS uc1 c1u17h\$Wj Vhl$Etaq#Et#Et"Et6%\'u0P,PY ZY@tjj@Oq^_,t#jhU$S uh$VfY[0Z"tSh$Sh$hV~0 ,Dž@h %,PYXZ9 PWpNjXZڄtVB L<-u.1j=V菔Y^t$S@$S4Q ,t1|=c1t}t=c1u}uD]h$~Y19~4h%~GXZj }Y=c1tc$P Z@u hOt#"Xdt t6hQ#X t 術XP蔓=c1tj}t0$v jv j( @u h$_-,W3h%h,R|P,Rn 8tV,Rh$; ;u8uWVWh$j! t 賒[P覒Y}u, Ex](u jj I WS$t ~)t}u2hJ.,PXZj P$Xt ~j,P @uh#)X,Ѓu ƀt&qttP<PVhU#bbH}c1 c10SVU Y_@uVhф$XZ e[^_]UWVSj Ph܄${;11to`'tZd't =c1t>h'Fn#ub$QPh%?{ !ǃ 끍Gd#t#Fn#ub$WRPh$ztGn#ub$Ph$z"q t 0h$ h#zXZF=c1KtSpn#ub$QRPh$ez=c1hn#h$Fzsds`sTsPh$$0zslshs\sXh@$z0=c1~chSjjhk"ju.t%j S^_tSh_$y h`-&vYhWlSh0"x ,@uSVh"j n@t(RPh'hStS/}jkUSP]jEPSU :9uySu h"jo ]US]SeZt@ h=5#SZY]US]SjZt@ hA%SsZY]USP]jEPSnU 9t :uy Sh"j ]UVS]u VS YZu Sh|"j ;/t"Sh"]ZXZu E"e[^]FZe[^]UPh"hJ.wjAjUWVS EEu EE}]EEE1҉7pC.h"Vuv t4ouBjWh '57;Yu h"j PXY붋pC.4E)Ѓt>S6EXZEE FEe[^_]UVSSPPVu ujVSh% ,@uLt"t"0虏Z"t"PSh"j jhUVS]u VS YZu Sh|"j ;/t"Sh"XXZu E"e[^]kXe[^]UPh$hJ.ujfhUWVS]E1҉#11ɉd111lhhw$u u蟣 HuLf$M,9tQG.C|g$"'UC| C|C|C|57CpXDžlL57CtXDžh.57CxX57Xjuh`#'57xVu h"jS P$VX57 YDždC|pC.P;Ut0ttSxt SxߋM |u4AuW8Elh ЉtQxPW[-YZ@u Wh$j ltECphtECtNtE%CxdupVzVO[@$XZK|ǃe[^_]UWVS SVdPhWu u&hWdSh%! ,@uSVh"j f@tKRPh"'hSnSh$n0jeUSP]jEPSU :9uySu h"j ]US]Sn_Zt@ h=5#SZY]US]S@dZt@ hA%SsZY]USP]jEPSU 9t :uy Sh"jj ]UVS]u VSS YZu Sh|"jk ;/t"Sh"SXZu E"e[^]Se[^]Uhň$j U5h$h$h$hF$hv$Ph$hJ.q jcUVSQÉj EPS U:uVShƉ$j e[^]UWVSuEE@t"c1 1VFe[^_]P_1_u h /#jl VP ZYujc]e[^_]UWVSQ]E10u1-h$$u u9 2F$$'=d1td1뷃=d1ud1c뛁K뒺a7C8K t d1hK\cPD7jC@K@2K&g7@P s4K I7C(KK@KEPuh&'57Pƃu h"j Et d1tctKtK@tK t=d1d1 s=d1td1c@tKt1҉,-sc sKsC  sC sh)5#VNd1Y_Eth%VNC$KXZEth$VNC KY_Eth$V{NC$KXZEth$V^NC @RPh%'hS!gt^j j WhVPuWVhL$BgP(8Phk$;M jP]Sh{$f1e[^_]UVS]u VS  YZu Sh|"j% ;/t"Sh"LXZu E"e[^]Le[^]UUM B<t<ufJPh\$j褹 UVSRuEFxP^ FXjjp1+à yFFvpjEPjjS ppSu^ (ujuu S+e[^]US]CEEiEPjEPL] ƒ Jujuu sz ]UVSu [1҉uuuVu~C9`d1u7VJu/^˅t)v 00ShL)'hy$ee[^]UEH؋U PEf]UU otzȉEEȉEE1EjxPjEPjjhuA w/v02Ph@)'hU#bdZHxUWVS]u uu uQ fMA1CCS1CC`d1@`d1ȉC1҉SCE ȉCЋEȉCԋEȉC؍~E$PWh9 ECu h"j PBX'7jh$R\  \uTxPR\蛘 xZY\t8t PRhŌ$vr Rh$jh$R\蕞 \xPR\# xZY\t8tPRh$$j rRhR$j N&s5N&P$ptX$pPR赹 ZY@u57h$jɯ ptC S57OXDžh pC.E E)ȃth2\u: u\r^xPu @u uh$bhu}{duus`u EllCe[^_]UVS$SPPVu u{j VShI" ,@u Sh$j蘮 @hɍ$Zh֍$Zh$Z &QYu1RPh$Z 0h$ZXZK^u1RPh$jZ 0h%$YZY[h3$GZXZ1e[^]USP]jEPSU :9uySu h"j[ ]US]SJZt@ h=5#SZY]US]SOZt@ hA%SsZY]USP]jEPSZU 9t :uy Sh"jЬ ]UVS]u VS YZu Sh|"jѬ ;/t"Sh"I?XZu E"e[^]2?e[^]UWVS]fU ffCffBCffBfCffBs s/Y^} GW CȉGCȉGCȉGCȉGC ȉG C$ȉG$(s( ЃXsXCdȉBdChȉBhClȉBlCpȉBpCtȉBte[^_]UWVS]fU ffCffBCȉBCȉBC ȉB ss3.Y^} GWss.Y^GWs$s .Y^G W$CDȉGDs,s(-Y^G(W,C@ȉG@s4s0-YYG0W4CHȉGHs$+' t9131Ƀ 1Ƀ 1Ƀ 1ɅtuRh"jv 1ɋuЋ} t1M8"t$M tM9uM9t Suh4"맋E9ƉU}7=i1tuuWVSuhU"4uuWVSuhU"?9u؋E}<=i1tuuWVSuh"i4uuWVSuh"j虡 e[^_]g_UVS蹝=i1tPhA$hJ.Q hu$Ph$hJ.QhJ.h"XZ=i1t@,'ttsh$hJ.BQ jC=i1u UPCUWV=L-uHH׉=ti1t&ɉ HffJ=L-u f@ffB^_]UWVSƉ˃=i1t/=i1t 1}oQi1xi1Puk; Rסi1ΉRPSu5i1I 9t 谝0liPWVhۗ$Lj"Be[^_]ÅtUWRP"Y_}Ã=i1UWVSƉˡi1=i1tQuxi1P: M׉ΉRPSu5i1H 9t 0hPWVh$Kj$Be[^_]Ã=i12W|$wUWVS#Å=i1ui1BB4i1i1 i1 ;i1i1ؙ=i1;|*9i1_1)։ؙ5i1pؙQ Y`-'JtRz!9t !9t ҋ1҉ؙ=i1Q ;Xe[^_]g_W|$wUWVS4EU؉M܋ i1A Id t15i1/X=ti1ti15i1PPW i1xU th($QXi1H xU t@\U؋M܉M؃=ti1ti15i1PP i1A Id t15i1i1i1JH,1_9M؋}ruuh?$SI i1\Eȋ1ҍMQRPuu]1 Ɖ׋EUEUċΉEЉUMԁ}Tt2CЙ!!EȉŰ{MKEcEUԋCx1RPuu3 K` t1Ɖ׋Cu}ԋKd t1uЉ}ԋK05i1#5i1Fx1҉$Puu%2 ti1i1\TuoÅtKSuY^1}|(}؉ʉT(@ uE@XȉCXE@\EȉC\E@`ȉC` ߋu%ClÅt]SuOXZ1EtttpY_DpTtF u1EY_Fu @ߋu~%CPi1H05i1EЋUXe[^_]g_UWVSQEӾ=di1t1}=L-tCCfCU.C)f UZ[^_]USÉЃt't7uFɃu0 ='Shi$hJ.I ]W|$wUWVSC s(H1`i1t ǃ^F=i1s0Kd t1RP߭ڍ N&VV$hV$9( i1 ؙy8PۅI4N&WW$q,h$' i1A0= @ i1i1=i1u\Tu k‰i1jjjhjRj|£i1 i1ui19uh˛$5i1F$B1ҋ9r)=i1O`艅FW897~U uv`G`ai1$~%i1Bl5i1F=i1=L-Od1VT~U uVTP~U t FX1~JOd1111f_89s\)D4;~s@~U tv` 5i1F$뵋i1$Nh񉍸Flx1Dž1҉;Npst!ʉt @t$9~‹ШtGDž끅t$9~‹i1Bi1;i1u^=ti1ti1s4PPF i1@i1i1Z4Jd15i1i1i1i1H41[i1Z0 } i1؋5i1=ti1t5i1i1P5i1 i1X05i1ދvxx i1\t4Tu轵%Fl諵%CPO붡i1i1𙋝ڋËƉ߁TtAЋ!AƃAId t1Ji1Y\Tt=i1Ys8i1){0ƉK`Cx1񉅰69s)9si1k%Cl뀡i1i19rߋ i1A01q8ߋƉ߁\TtAЋ!AƃAId t1Z~==i1j.2X܋ i1ߋƉ߁\TtAЋ!AƃA׋Id t1d#t%WVRh$r9|]=i1Di1P,t,=i1t hS##X1j $X1x~j X=i1tj;_u=i1th$v5i104=L-0FF4+=_w h$j{j i1X󥋅`1=ti1tR5i1K[^i1=i1t ǃ\8 5i1x\󪡤i1RP SY=ti1ti1i1r4PPG i1X4HdLH t15i1i1Z;i1sE=ti1ti1r4PP i1@i1i1Z4Jd15i1aX5i15i14i1@4P5i1eY[^_]aÃUWVSu]tVj _uVh"jh `1ɉPhd@u G tGRhedAu XE @u!e8tuh"XZ9B<1CB(CB,C B0CB4CB8CB4CB@C BBC$BDC(hJU%g ƹ ߋSh"VJ CPhN"VL C Ph "VL CPh"VL CPh2"VL CC,$C,PhE"VmL C0PhZ"V^L tP5 X}!uhzd@u D @RhedAu C @uuhi"jg 4}1󫍅Pu^_@4ȋ9P9t(Ћ}1ۉ1E1ɉ [Eƀ*P$j PEPs 1e[^_]UVS4]jhPjSkuIjPjVSV u؋E ʉʋMQ؍e[^]UVS]u VSe YZu Sh|"j}e ;/t"Sh"XZu E"e[^]e[^]ÅtUWRPY_}UWVSuuuu É֋EU)jj`RP Nju 1ۃ`9}1EPl@hFVk`EUȃM ~MAhQlCȍe[^_]UWVSP]UpEM1^F}tF^ECS}tffCCCCC 1 :}u: 1҉C(S,C8C1ɉ C Xt1 1( Xt1CXo1=Dt1$`t19$9rPhx1'hС$vTn1D 1;\t1sin1tЉtF$9rhx1'h$`n1‹ ȋ( Xt1GB돋$9(1҉G䋅$9s11ɉ u2\-hJ. hJ.v u2Lv2;XZe[^_]W|$wUWSøthw3h$XZ5v2h${5v2hפ$kx3t Ph$T_Xv2t?v29} h$5[()N&MMEuQQ$h!$  j $v2Z0|x3x3EEhv2sH~-`v2]PP$0J @N&RR$Spv2QQ$SEWW$S h-PP$Sh4$V<|x3v2v2"]v24v2EzuN&ٞzuN&=v2\$=v2$hl$e[_]g_1Ujj6XZ1=v2PU=`-u =v2ujhu6v2ZY9v2~v2|x3ueUSáu2u2xFأu2u24v2N&wN&r\-y1]X]W|$wUWVS=w2v2ffBw2@v2=Pv29=Dv2u ;Lv2w2]f>w21Ej]Sjj5hx3| yh$[jh(x3jjhw2Bf>w2v24fpjhHx3jVP5lx3 Ã9t:y h$PYSVhw3h$hJ.rZ1`-v2% v2 x3v2@v24v2Lv2(v2=,v2u(=(v2uv2Lv2Lv2Lv2(v2=v.}fE fEm]mE(v2,v2N&5xv2=|v2v2]u}fE fEm]mE0v2 (v2,v2EΉ߃ɚ;~ʚ;Eހ}0v2 (v2,v2Lv2(v2BN&؉(v2,v2(v2,v2 0v2ى 0v2ɚ;~(v2,v2ʚ; 0v2v2rW xv2|v2 (v2,v2 (v2,v2v20v20v2=ɚ;~ (v2,v2-ʚ;0v2|x3t 1|x3te[^_]g_UWVS<ÉUM|x3tUUEčs}uyMăA}9}fE؍t E;v2uJ1@v2Dv2u5}t4|x3u+?EPuh$ Ѝe[^_]W|$wUWVSEU܉M7C]|x3MQURuh/$Ct hM$2XWhS$&|x3Y_t,sE @N&RR$Ph[$=}x3y"uCJ.e[^_]g_e[^_]g_US15&=3ud#-1SPh$hJ. jUWVSƉP¡3_tEtPh{$E 39U|} Vh$j4 su4 1C@C1t )уȋKAPEFCCp1}~CpMуt[}D;19Ue[^_]USӃ 31҅w =w"=wj=w:=w R=wA=v=w.=w "tft uȉCAʉPfPJ:u9r)@[]UVSÉ֊@<t<t,<uPslu PVh$ S"h PVh$mBhPSjPVh˰$ESgPCPVhڰ$)hJ.Xe[^]Ãt"¸$7t$tURZø$USљRPQhS[hJ.S0] J.yUhJ.j XZáJ.PJ. UWVSDuhJ.e[^_]ÉÉh$S5'a_E1ҿ!Es,s }uCEtHH1ɉ B u1ۋtЅ}t2}uK]1ʉj.h3EPjl:]1ʉubs VPh$j.h3h3h%RXZT5؃3VPh%/C 0=ă36UWVS$@<tPh&$Y[ C 8'tRhp#PhQ$^_PhW$XZCH<$3'hd#C Ph`$C6' Sssht$_C! `6'<t6'<t8'CTS C ACPh$ CZYPfwk$ 4'h$h$X1Zh$h$hʱ$h"_3hϱ$^!hױ$Y Ph$XZ뢍A9shޱ$X 6EEEEEEEԍsEԈEӊEՈEҊEֈEEUMfsfhw.ffQRPEPEPEPh$jfuVuVuVuVuVuVuVuVQRPEPEPEPh$$݋EE1u1hV$' [rE9XC҅U>}tSyM9)sxEt  Cy;8-t8-PuCyP C E1ҍEЋMs4tHH1ɉ B uЋuЅ~u'EuuPsuV~uEuuPjjumE#CPth#h#he$!J.HJ.$yhJ.j XZJ.PJ. }e[^_]'e[^_]UUMzu'uQPuu RUU} uuRPjjuUWVS u} EE11һn$~kMUD8-u^@PXZMt$Ut:u?DX,t*DX\}uCNv tL}tEEEe[^_]UjjEPEPu u-h?uuuo(USPhu$hJ.Sh$hJ.ShӸ$hJ.$Sh$hJ.Sh $hJ.Sh $hJ.$ShM$hJ.Sh[$hJ.Sh$hJ.r$jUVSƃ=D3udPS^Zy Sh$P-밋l%=`ƋT3t:h,D$RPZY ho$PRZYu\t_X/tXRPhu$RPh$hJ.\`xtRPhǺ$ RPh$hJ.PDž`t0P _tPh$苧ZYDž`9t SX`tjtjjjUWVS TPjhPjT11ۉ`d`Ph|dV @ h;lu\1ɉXSi9dsW`XZuh"\PY_t X\X;lrt\h"h%hWپEPt@3tWPh!$t~WPhǺ$ܿ lS Zh`PhedAV 1ۅ9usCaPTh"h%&hWEPt@3.t-WPh!$tWPhǺ$ CiV Xe[^_]UWVSV1}jj}Wjh :' uTEEPjjWPh :' t S[!h%SM ZYtQh%je[^_]UWVS]u CV9t)=Sǃ4$Z9t9su ]e[^_]{e[^_]ÍL$qUWVSQdYA`A EA|AEjjj! hk$ Y1tpiPEZuh "Vuj ! E y h$j t}th.0huuItCtQt_}uEPEP _XE#t[OEEd#R$:E]$"$@Ed$"EV$ƙ"EV([E܃|ƒ} ˆ{EX}1ɉMЉME r!SZ9EsECEUԁڻ}ujEЋU M؉SQRP|  T9ѹ |+ɚ;9ы}ǻ |9ы}ǻ |9]}]h$h$h"Sh"SVuh$uh$ʻ, E EE1EЉEԉEȉẺEM}`tEd9xE@EE@EEEEEEE{u Eu}u}̋u}u}zu} }EݝpEݝhEؙRPWV( Puuuhļ$׺u؉Ep݅pܵh N&PP$EM)ș WVRPӪ PSEU WVRP踪 PShϼ$jj hd#WVj}W @u hͷ#jj hd#EU RPjEP @tjj hd#EM)ș RPjuV趲 @tWuuuh$Ep݅pܵh N&WW$VSEPSh$貹4fE}MЋ] }tajj hd#SQj]S' @jj hd#EȋU RPjuV @VSh $( MЉ]ԋu؉uEȋU WVRP3 PWVMЋ]SQ Ph$|"Mȋ] }jj hd#SQj]SZ @Ajj hd#EЋU RPjuV- @jj hd#EȋU+EU RPj}W @WVSh6$'M]u؉uEȋU+EU WVRP, PuEЋU WVRP PuWVM]SQ Phc$豷\}REȋU EUă}m]m]jj hd#RPjEP @jj hd#EЋU RPjuV @jj hd#EȋU+EU RPj}W輯 @Eu N&QQ$WSVSEPuh$uh$vu؉Eu N&RR$EȋU+EU WVRPЦ PSEЋU WVRP赦 PSWVuu裦 Puh$uh$P,uXeY[^_]aUPhڽ$hJ.赹jDUWVSljU΃=3u'jh3 3ZYuh;$t [3Xi 3}u-WUPZYUujtdWUPZYUu=tRhh3Ɯƒ 3uPh$j K c1e[^_]UVSƻ@-tPV\ZYt"Vh-$5X4~W4MC St8tPRh@$x RhK$pxZYuj 3h`O4 CDO4@O4 e[^]UjWX=dX4t%X4fPftjh =tX4uF_$=pX4t!$tVWjVjjhRSyS跿X W4e[^_]U帥"}ut#]U}u h,$h5$h@$5X4莤1W4UWVSE]uu1҅‰uTpuCE xh"WPZYu u0Hht#W3ZYu1t/t#F u븥"PVhP$5X4e[^_]UhX$hW4u uIW4U}uW4=`X4tX4E Eb$] ]Uh$h X4u uW4UVSE] u1=X4X4u{"yt gsh"V$ZYtBht#VZYu 1X44V迻^sh$5X4ݢ 맣X4X4노t#Ph$5X4豢 =X4t5X4h$5X4菢 5X4h$ X4Y[t1҉X4W4e[^]Uh$h`X4u uW4Uh$hX4u uW4Uh$hX4u uW4=X4t1X4Uh"$hW4u uMW4UVSE] u 1=W4bu.sh"V臷ZYuBht#VoZYt1sNE4^hsh3 W43 뷣W4W4t$t:u5X4h3$z 1W4ZY4E4:u)#t#t"SRQhj$5X4ˠW4W4e[^]Uh$hW4u uW4Uh$hW4u uW4UVSE] u 萏uHsh"VHYZtBht#V7YZt6VZy+sh$5X4  1=W4W4L3t "t#L3PQh$5X4蹟1=W4W4e[^]UEt~W4Huh$E PEP޽ tЋE ph"$x_YZu9=W4uJ=`X4t5X4h$ XZE ph!$:_ZYu8N4E41E4USUE W4u 3Pt ]pMYt`P Z@u Sh)$; X4=I4thI4h:$Pu1ɉ W4 PhS$ XZ]]]UEulW4=Huhl$E PEP荼 tӋE phx$'^ZYu 8N4USSEuW4Huh$E PEP. tP3h#:jE[Xjh3jp XYE tE ;u1ɉ P3jju ٬à uu=P3tڋetShx$U][Zu 8N4=P3u=dX4tW4W41ҋE tP3W4tujOXZ1ɉ P3]UEuW4}Ht}6h$E PEP uh$E PEP t}E ph$x\ZYu!E ph$a\ZYu 8N4UWVS}M 1ME1 tg$%tWMh$VkZYA$Mu$~AEtu!t~1}h#dYu 葊n}ph$Zt8uՐ"QMÉ<$٬CP諾|CSMQ@P =dX4t5W4W41ҋE ¡P3t@P35W4ujTZY1ۉP3EM9t EPnXe[^_]UWVS}u ̇.jjzƉXZS臍 CYujj֔h# à u5%j/Sw* _ZڅtPhRW =W4t65X4Ss X4HQPY^y Pj 6Y^ J }~j5W4h_n#WS0f  jWS"f Sh$W4j%~Pl Z9uWjZYFu h$eX1ۉW4e[^_]UWVSPEEuqW4Hh9$E PEP菵 EwɋE phB$"W_X}hJ$P ^u ]E XShU$VSy1 uY}h]$ Yu ]E X Shg$VS41 tA5X4ho$ XZ<u}u"E X Shg$[VS1 W4e[^_]UW4}t'=E4t =E4u#r=E4uX4E E~$/ hE4h$5X4觕1W4 UW4}t鸄=I4u#X4=I4uE ES$ hI4h$5X4A1W4 UEt~WW4{Huh$E PEPx tӋE ph $UYZu9=W4u<=`X4t5X4h$0 XZE ph$TZYu 8N4UEt~躃W4{Huh$E PEP۲ tӋE ph;$uTYZu9=W4u<=`X4t5X4h$ XZE ph:$7TZYu 8N4UWVSu huS 9}1hE4S] F 9~hh%SC GSh$SY[Hu j5NZ8N4e[^_]UEu薂W4/HuhB$E PEP跱 tu uhd#- UEuJW4/HuhW$E PEPk tu uhq$ UEuW4[Ht}6hK$E PEP uhl$E PEP t}E pphw$R USEu腁W48`X4`X4Hu h$ORYE ph$EUYYBu@t)EP?mPPE ph$5X4M;MUW4UEU u$tW4]Hu E$]DBE E$]DUS] hF_$jSu1tssh$5X4苄]UWVSVEus.Huha$E PEP̢ t݋E p٭[u W4zh$yYt8uՐ"RUÉ4$|<$舧WURP Wh%S~ WVSv (S迌 1W4SvVp e[^_]UWVSEurW4Huhl$E PEP th$6yYt8uՐ"S Ǎ@$ͦ|GWS@P =X4pX4tX4EU`X41`X4X4pX4tX4jjh$M qVh$b=X4EUpX4tX4`X4(VnZe[^_]UWVS]} t q7h$V苘ZYt.h%VzZYth $ViY[t뷻wZttH3tD35D35H3h$5X41W4e[^_]UWVSPU} uRUwZUuUE @$X4Ee[^_]鿁Ë@t Ph1ɉKXW蜥CZ=`X4ttP3hV$5X4老e[^_]USEU W4t tt<]p-t8Cud#PRj hm$5X4jrr 1W4]UVSu W4}t e[^]pvvXuvh@$5X4趀,Ct P_1҉SY3hv$5X4菀1W4 e[^]US}uoW4B=M4uX4E E$] `X4`X4h$Q@`X4X]USEU Hv;oW4V=M4uX4E E$]K `X4`X4Hu h$?Yrh$?XZ`X4]USMU AvnW4_=M4uX4E E$] `X4`X4BuPh $`?XZrPh($N? `X4]UWVS @Eu} t/nW4AHh$$E PEPM tЋ5@3} 19~j k3Pw讼 t*Cu%whc$5X4~W4 h@h4P' 1ؿk3X 9XrR.DP@tC4<$t<\CFC R.K߿DJtm1KԿK߿DJtk ߿DЋԿʋMQ9~mPE4)PE 4V5 E 43߿iu6CDžؿ9}~)E4)PE 4V E 4ƃF;p\30mXu 5X4h$u!5X4h$L W4^X~ t=W4u 5X4h$΃=`X4t:5X4h4 X4HQPYYy Pj ~YX J j 6R \3P5X3V =W4t3~t-X4HQPy;P| J PjU~XZh@Ph4 oX3E\3E 9XCؿt G9}ce[^_]USËt PG1XCt P51ɉKXCt P"1CZ]USd̫3jwX=dX4t>4Phz$jd]S?v~!X4fJftPSRm jh@3%N USdj+wX=dX4t>Ph$jd]Su~!X4fJftPSRbm jh@3M UWVSÉ֋:j:WYZuWh$S臤 :WXP諗YZtj%W̋YZtWh$SQWF u FfP HuFf=tPhe$S h $SXZe[^_]UWVSQljUR蚶[Ë7 <wsBSuRUQ u8Uӊu <wrs C <v1e[^_]UWVSË@t P1s_stVY1Ct P݊1CZe[^_]UWVSljӋu\X4u<MP6uEPMQSW脨ju>y8E8 u@EPh$)[XZ H< ws 1e[^_]Å8UWVSH%Pty=R.UfTWfUtbPt[ftwftL0Eu7EtW})߉0u7tWӉ)Ӄ@YAbAXZ[^_]UWVSljUu }uu h$jM jh$W uW1ɉK fCPjh $W uWC fCjh$W u WC _t36 vCvCF C FfC (Wuh$LY Ei$:j/RU+^ZEUu R菚8)ЉUHQMƋMQURP4 { uEuVCYj@VԇZYt_{ u1҉[urVj]RU\YZEtH:UttWuVh)$)PERV`MVu WuVhI$fEPx:t1j:VYZtP>t3tJj EPRUyO U:tM9u HvWuRhn$W?fC*C ttE4tE4td#R՘CZ{u%{ t%P赘CX1e[^_]USZKJy ;J| t Y RPvXZ]UWVS\fDž1jh $P _1Dž1jP$AZY@t(t 8tt 8uSh$U7(8j;P ZYƅh$PFY_t>h$V5_Zt4h$V$ZYuh$U_SVh$Sזj@PS t%1ۉth$V"oYZ4t3hSS hh%S hVS $hh$R 1ۉ=E4 tSW41ɉ W4t hh$ hh$R/ Pj?W4GE4uj/Vx [ZtP1ɉt PjPjXZW4-cNj5e[^_]UWVSh<1@DžDžDžDž1048Dž1 ($ Dž1DžfDž1DžfDžE11,jh@3O? ZY3u P$Y[@ S ^<$Zffu/t+;:he$SǁZY%ho$*t?u+$u =E4uh$MWeY,,E4t <,j/P~ _Zt@,PZ P YE4 t 8uh$c1=pX4=tX4xX4|X4DžtDžx=E4t0 tRP@$ZYupX4tX4OXX4$,hpQ#P^_44u ,c4P處t$PWY[u/txxX4|X45pX4=tX4ut84P51҉$WVP腖y,Ph$_Xj=`X4u=D3D3,Ph$5X4Xi pX4tX4 X4uu5X4j UO[^RPh($QihSh@3 M4@3$<<8|h]$r^Z8PuH$+_h%HP>XZ?tj:Wm ZYuWߤY9sFj DPAP(B ytD9u9tyPW)P^ …YtEy_ uu1 %=tX4u =pX4t? xX4|X4`8\P -Zpfx$ ƅK#d8*u@zj pVP> gp8-X@dj VPp> 19Ћp8/ Pdx*u,j pPR> pd8=tX4=pX4h$$tXH ׉dRp^_oDžh8HVR4HYtx>$stdF*$TtRۿ$Dth$=X$$udh$@:$tdN$ƅuT$u}tPPlXV~_Zt:H-,r)=tX4=pX4hf$t;u h$x3Px3~ h$`X41u>u$Pڋ(Y^'Sh$5X4Y ƅu  Sh$5X4oY ҃th$;XZ h$;X DžDžjXu tSjYj_uRh4$DžDžDžDžDžDž 9E4u h#P2_Zu Dž8J.\ 8|uQjj TZY hF_$@PE [^88u @Ph$lDž08<pX4tX4u!t9Nj}5uPuGxX4 |X4!΃9=`X4B5X4hS$ץ ^_+u t=xX4=|X49u 9t Pha$}9 h7% hF_$PNWY[88u PhG$"Dž0 h'j-S[^hvjS_Z$3t9D3tK 3tP(hYD3tЁ~=}$3PyZ 31X4X4X4@tPj~R^_DžjR[4P5$35 3U u h$1ɉjP5 3ƃ 39u h$ע8"ty-ɢ" 3R)Ph$F  u @;u‰Њ B t th $P“_Zt h$=0N4u 0N4șu$31jP]Y[؉|tL𙋍|9Ή| ||=X4F|19=$3|19||Nj4PWj5 3耀ǃu4PjZ1X4X4|)ډ|8 3@DžftS)F u轠tڃ#u)uË9 Ph#}=X4X49X4X4|#6X4RmXb)f=0N4tYjPF[_++y @B19|@B)RFY맋c[1u9V4P5$35 3蚀 uj@N$$h $5 3裐_Zt h$F4|ft=X4u4P4}^tch8$覸Q=X4uڋ X4X419}NjX49|X4 뤋X4#[#jN8$3lY0= xu tjSXZtx1ɉ08R18 $P _Z@u*tP8$re$hE$5X4P 1;X4X4|xX4 |X4y )jFXpX4tX4X4X49؉|1=X4=X41@u @u"PjLY[㋅Pj wLXZ@tPj^L^_@tPjELY[4t4P{@t PD Z0t8t08RX ;E4t t Pa1 X,t,P`1,XtP`1_$t$P{`1ɉ$[(t.(P\`1(Zpe[^_]UWVSÉjh$P jh$S tsh$SeZYDžt$jh $S tS)Whj$jɝ uh<$C_u?F t u8t,jh $Su uVj11҉/ZYe[^_]É؍e[^_]*US1EEjh X4l ZYt-=W4uEE@Ejj Y[hhjI[Xhj IXZEE;EEj:M 4^ZYtw1ۉx3=_ptX4pt륅u!J\@ @uX4X4pt9 X4X4|X4 T@ @t0X4#pXu h`#蝉XZ\@ @t"o`Ih$sXGj%XdtdTR^1T\P =1ɉ\ $[zhPjXZDžh=T3u W4c3xP X3\t\P<^1\jf[W41;X4X4}jYh@u l@u"hPjXZ㋅lPj ^_3xPo [3du \u)TtꋅdTRY؋\P;XHX41҉pX4tX4X4X4e[^_]UWVS1ۉ,4(0X4PTXX4$15X45X4LxX4|X4X4 W4h$u __ZDDu =W4uVu=`X4t}t}u&E 8-u}tuhX$5X4 뺋E Ph$5X4 ɋDtE uPu} 1ɉ8Dž<Dž@1=W4uDHjh3J _Zt=T3tzj^h'jXZhBjY[<}tWE jP~ Y[E j/PI _Zal8tNWl8 tDE Phq$[^W4 E h#P]^_E 8|utU %9t X%tE jP Y^t/x=W4t k8 uW@k8 u"E hP _ZyE Ph$P=W4t 뽃=W4tE PYE .D@O4uJutY jjlXZDO49u&ju/^_xX4|X4W4ujPlY[=ujh3n $_ZSDu}u/mpX4tX4utRPhD$t vˋE8t8Puh4%P HThpQ#=^00uuh$Y[ȃ}E h#P[_ZuDž(J.15X45W4E 8|uXjj !_Z@E hF_$@PT Y[((u E @Ph$A15X45W4Dž8=E uPY[((uE PhG$%XZDž8 (fzt (@xRP/A^_@tE%=t1ۉX4W43t9D3tK3tPc-YD3tЁ~=}3P?Z3j'X=X4t=X4t =|X4yX4$1$@O4DtBpX4tX4ut/(f{t (IjRPQG50N43 3(fxt (P0ft 0@$VS u0g8 uX4X4h$I^ڃD =tX4u =pX4(jjjP?11y4E Ph$Y[,RPY<[Zt׃ t;5pX4tX4(|jjjP?yv뚃 $X4X404RP;XZ th(,RPj (< @tv(@ @uju04RP;^_tA gL@L Hu (,RPS; @um$uwPT95X4X4X4#5X4s3YPTX4ډPT롃X4X4#PT95X4X4|X4 H0@ @tNX4#*Se4Fe8 uX4X4 h$~Y݋(@ @t e,E Ph#~XZjJX8t8(R^1(0P.21ɉ0 $[LuX4X4y3dLPh$5X4 5X4h$ve XZ뾋D(uu=W4uj# _苅8= ju)[^X\Bu@j`S2^_X\lp1tE SPv ZY@XPT$+‹E $Ph:$5X4.`jh3 ZYt$W41;X4X4}4jE Y*hjh^_=T30PH[벋<@u @@u"h]$WMZYEue[^_]P2ø#=W4t}$Ph$5X4s -t$=W4t~ tPH2PS2 S%%YE ]e[^_] QMZƒMuQWh$5X4 KSu QWh$ދ}u#Uj PMQj MMEPjUR rPj hm$5X4 릍e[^_]á4 `3!t$uC`4tJu6`4W4%`4P4-8!u-UVS t t @`4tJt `41&`4W4 tGtBB@"u\uXu@!@B؀"@tՈBut B1`34u/`4tHt `41`41W4[^]US44`331ɉ `4\31ۉX1X3P5\3/XZtX3@ڋ]UVS =dX4t2X4SPEZ 0^Z8tPh9v$5X4  5X4&jh@h4h@J.D)y}uB5X4h$t.=dX4t X4Hy Pj Y[ J z=X3?\30ZÃu 5X4h$+u 5X4h$x t =W4u5X4h$LY [^1ɉ W4j 3uVg \30P5X3S =W4t3{t-X4HQPy;P| J Pj XZ{ Yqhhjhj e[^]UEt]1]US]u h$jY SZu Sh7$jY @]U=-u b -X4fPftPZ Z9-ÍL$qUWVSQ0`X4 X4 XjP+ `4`4Z^+`4y @B,N&ڽ߭ݕ X4X4XX419}l؞vK߭ٽf f٭߽٭؉Ή߅ud#t 11#RPSQhh$hP{ٽf f݅٭۝٭Q~DQ#ud#RPh{$)PPÃt PhU8#)PPÃ<RPh$)PP؉19}t  @~4h<'%y)DžkddʉӉف1 Q%1 RPh$)PP8X4X419݅xX4|X45pX4=tX49Z)߭߭ٽf f٭۝٭׉h$)PPcà t!VhU8#)PP>Ã<RPh$)PPË+`4`4`49}9}&h$)PVà hS 5W4tjh$h3 S uSt M4 M41DO4j hۿ$h`O4P t\h`O4h$5X4( Bt 1M41M4t*j h$h30 u5X4h$VA ^_M4M4M4M4M4N4Ы3'h$躲Y1u0jX=W4tfī3t-fPftjPh 5ī3 1ī3 3x jPB 537 3 1W4jX=W4t>ī3t-fPftjP 5ī3 1ī3 1ɉ W41W4j芾PZt ShG$jO@ =0e[^]UWVS ]uW4=P3t =W4u$u 1ۉe4e4Pu+e4tÍCe4C1ɉ e4e4h5N4WL /thh%WdM hha$WQM WqyWho$VXZ1qP =`X4Xأ`X4X4X41X4X4} t1=W4PXF_$t!jjRPPh$57%֡W4-cvt3} t1=W4P豼X=`X4X4X4hpQ#Se4Soe4 uuh$ ^$Phha4i u5e4 1ۉe4j ha4ZYua4e[^_]UVSQQMq`X4=W4u `X4=M4ut95X4h$C< Ph$YZuBj h3/^Zuj UR@P M te5R.DN@tVu=W4u=M4u1ɉ M4t=W4u5X4h3; X4 XZz`X4eY[^]UWVSQ4MY=`X4}=W4}=W4u `X4=M4u}5X4h$.; fPh$Ԭ^_j h3ZYtj.h3^_th3.)Y3uKjh$VV* u7Vh$5X4<f320h3hV$5X43 }1V(ZtVhi$5X4 EPh$VKg tEEPx_uu W4u\]`X4gu=W4u=M4u1ɉ M4t+=W4u"5X4h39 X4 XZE`X4EW4eY[^_]Uuh$j2ha4u h$j: a4UWVSP}u jjh#jWh$VCf ƒu&Wh$V.f ƒ uWh $Vf ƒ USjcEe[^_]UhhI4s ZYuI4UVSE45`X4W4=W4u `X4h`#YZuQj h3ZYt?8t:x"u41Ɋt t"u P"u @E4A@ƁE4E45`X4W4e[^]UWVSu huS^F S8B hX%PK(u]WS0 YZuSh $]PXZ19/uV &É$VW>' uڊ/ e[^_]UWVS}GE119ut4%Z9sFSU衈X49r1uÍD1EkE1Eu9uE1E9]tzMt5X4RU6 YXU;wrX4 t:"~ r\u ]9s@\Au;E XZ[^_]UWVS}M1ۊ4t <%tU J9rSMAEQЉUct?&/-3%TcMUmn>=W4u Ed#$=E4uM=W4MtEE4E}.t }cE1҉Ut @/uE1҉Uy0u MEMIQψUߺ}wQEM)щMr9Es8/H8/uM9€}}M Q9vI}.u29S.49cS.49R.m9pS/491S<4} ~!9S949 S+9S]049Z>)؋u ^ 9BL#=W4t M4u#}mډ)Ӌu N ty.uup9swBL#=W4tE4)؋u ^ tA9sHBLE H9cS%"M I9OS%49sSڋMA[^_]ÃUWS$]؍U1EEEEPShP5&uZ ƒ1uuد Xe[_]UWVSu] }VuSF u1N tu$t$fN lSZHˀ; uLUJ9uD DJ.y h@J.,Y@J.H @J. t@u҅t$ff t1҉e[^_]UVSQuh47[áX4?vPh$/ j}uh$PECƃ4 1҉UUR@)R4Ph@J.yh$uh $5X4jX319\3 U e[^]UWVSD]} Sj j VhRuW| t&hh#R8= j h#V+= E4tzW9Vt vuvvSh @uT-8jjjhSvv| thh#S< W-8Sh$FY[4jjS ƃ u(PPh\y$h1$FPjS] @uPPh^$fDž=\X4~"jP_\X4XZuWS; @,8$}uy,8A^PPh5$E >jP_+‹Y_+y@Biy1fDžRjP uY+8u=\X4~{+8#tLVjS ƒ 1BPPh"nu+< tQDžPPhhSp @u,++ e[^_]UVS]u SXu ]e[^]C` UWVS]} KyCSXu?C u8@t4*8ufc *8#tt* P0e[^_]UWVSu }EÃu3F u,@t(J*8uff 9*8#tt +*[^_]US] hN$SmYZ¸t,hP5&SUYZt;uEuh$vCXZ]US]SZu Sh$j;, ]U譭 u h$j, US] Su ZY@u Sh$j+ ]UEu h($j+ P蹜Zu hN$j+ UWVShuE ]E1҉UUUt PEXt SE_=1ɉM[h$nEEZt P1EXh3$-PGE[_EPEPEPVy$W453 ZEU3X4t\RVhx$P1ɉMEPjP]Sh@J.}yhP#uh $5X4W41 Vh$P Sj=W4tVRU0É4$&|<$WURP 7 Wh $S7 WVS7 E(tPX]RhB$?^_}u-hJ$m Yu]SES1XZuhU$ËuV1 uq}u-h]$ _u]SESG1[^E8uh$޻ YPhg$聙ËuV1 uŋEtPhg$O_ZuuE4W4^uxW45@39~Lk3Ph$ZYu0h@h/$h45 p\305X3YCE41E4Et P51EX]tS,_1Et P 1ɉM[]tSZ1EtPXe[^_]UEuGW4=W4t%5M4h$5X4W4fHh$E PEP7 UBw W4t E4u E4u)E @tW4t:u h$j.' PRPE pZY=W4t"=`X4t5W4h$5X4* W4j h%h`O43 DO4@O4j h$hN43 N4j h$hN43 N4$j hV"h O4p3 O4j h&h`N4U3 @N4=W4tjjE p UWVS0u=W4uue[^_]=]ȹ 1SjhV$ u}uVh$膸 S 1E0ES XZEče[^_]UWVS,EPu EPn Uȃ u# ỦEЋE0ufEjEP1V\X4EUXZ1ۃ=\X4~yjEP VE+E‹E__+Ey@Biy1RjEP u"8t{"8#tuk"<_["1҉jEPV u ?" y0"8E""8#7ËU9} )‰UEuNX؍e[^_]UE]UE@(]UPEx$tEjURjj0Sf 1USju~ [Zxj0jZYu SA Y11҉P$]UVSPuEj0jPZYt,0@$jjV jEPhhVe ؍e[^]US]t&S13 sPsHSB1]UWVS(]=\X4~jEPT\X4EU_XEE E̋C t 9EsẺEЋ}s)C C)E0}1u&uW3 t}R)EEЃ}umD 86 8#tw, C(" 8uE9Cr">uC,'8#usZYCEЉC{uMEЉC 1{UԺufU؃=\X4~;jEPRE+E‹EY^+Ey@Biy1Q1҉VjEP] u 48t*8#t C(95\X4Ph$5X4<C(<1EЍe[^_]UWVSQ} ]{uhCZC{({,C;C C1s sSjjEPu{(uT{,t Cu`E-KSBCEC9Cu3pVs(ZYu C(1E2Cs} z뙋s )9|Gs}UC Ee[^_]UWVSSu] }VuS u-~,tu$t$1ɉN(YS ZHˀ; u9UJ9u1VjjEPat} ut $1ɉN(t1҉e[^_]UE PuAj-UE PuAXZ=e4u e4UE Pu XZ=e4u e4UWVSSƉ׉ˉʁv )…tRUWV tUuR؍e[^_]W|$wUWVS||xˋ7GEGEhE_u hL$hEYtU 1u]EEEĉu1EEEEE11E11҉UUU}t }}uetWuu  EE)PEW| u hZ$_XC1Ʌ}lj}EU1EMu9}uho$A^_EEu1ɉMCw$<'E8tJ1M9ȋM}uh$XZFh$e4XEE@EO}jjjE 1}Ett h$O@EO}E8t h$+@EO}oEU@EO}O=E.E0@EO}E @EO}jEu E8u$ Eu E8u @E"u  NEO}~j8h$jEPNu [h$1RjEP9PEZYwP$<'}tR}uL1Eh$XEE'h$$h6$hL$uhd$_X+}t W8ơ -9~&)V5-YZu5-V XZe4 e4u xh!$2j|PS t"@u xh?$sxho$fjjjS=e4uU=e4uNhh W ƃ uj jö YXuPh #XZ=e4tl1WD;xjj1ɉNlpSZ t hM$_tV= ^t hb$u[e4pu*lu!u P6BYxhx$76jjV à u Vh$xPS_ZtVh$S褵 9pu9lt2RPplh$Se PAxvAS@ jxN l[^@uxh #5=e45-xh%hSں=v -)A5-=e4u7hh Sdz ƃ u"Sh$h@J.8 xlel] Y=e4VI Z@u hb$Xx_@at`=e4tW =u=u5jx ^_yxh.$ S̳ [xh7$&ZYtt t9Xe[^_]US?:Xȱ?v.X?v"?tH?uH ?uHɉ[]UWVSƉUʋCtىM1Cr 2<]t, [u#z[u[tt:Zt :Zu[1ۋUJM1ۋE@\EuuV t VP^P5Hx45@x4h?$j F94s4e[^_]UWVS1ɉ /t,$Xtt+i9~d\@1ɉÅu5Hx45@x4hU$k1Ҁ8IuC1tOFH@>uj RP蜓 F 5Hx45@x4h~$j ؍e[^_]UWVS ÉUE9C#u~nu Px4x4@ 445x4_1,px4=@x4u8#uxnu Px4M 1M I tpx4@x4t]Ut @uKf px4-tpx41ɉ x4=49G 4@x4t1BJM pЍe[^_]U`x4@ t=x4t/=4t;HyPvYuԋJ 5`x4Pl XZ1UWVS|u=`x4uQ48u==x4t hH$jo `x4@J.Hx4i$\x4J.Dx4"lx4`x4tQHyPZt@ J5`x4P˘ 5`x4hdx4hhx4 Ã]F`x4=@J.u 1~1PͿ[=|4tdh|49&h|45Hx4ٛ t: $='49Ѐ4r4kP544XZ=Ѐ4k 541h 4154{u5\x4sn Y[ =̀4uu = 4 4t54CPj V覶 u 4p @))Ӊ4SPVk mj5 454h4;jjh'蘩_ZDžtE;5-r5\x4hv%f Y^>'3$Ph$5\x4Η _L<;5-r5\x4hv% XZDL<Ph $5\x4vG 9tE8t#1:"u#C؍e[^]USPyYt@Ut‹EBu Sh$j ]UWVSÉk<`.AfEE19E~6Q@94:u9E~֍~@kt~UCuBEsD})EKʋEC _9~M{fufSf9} z)f{)MS9|M9~fK)y1fsf9|MS9~/E9}(CPuyRuFYXCuE9}ys(ulXZ1C9uf{th$uQs9*Cujjs蔆 uCuS)Ps]s3e[^_]UE @]UE @]UE @]UE 1҉P]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE 1҉]UE 1҉]UE 1҉]UE 1҉]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]UE ]"U14jA1U14jA1UE uU]U4 -1]U4 1]U4 1]U4 1]U4 1]U4 1]U$41]U$4p1]U$4U1]U4:1]U41]Uh袧41Uh茧41U4 1]U4 1]U4e1]UL4q1]U 4l1]US] 4)thkj<XZ*ƀxj3P?jj354Y]UWVS ]u t/{u)P.vP= t6vWKC 1ɉMCU9~Y}C48Zt>vPZYt/{u&MVU7MQURPGE뜍e[^_]FUS]Ct>P藀C ZtsPVs 1C sfs1CZY]UWVS`.1AfEE1}9}FQF @tf~uߋ}9}֍~@ksCf;ssfF XtgC,t{uu S_XC0tu SY^{hC E{CE܋Cut 1EEuECutiPEZt[8tVU1ɉMj RU"wYZNMUt)9M}MԍPuR9ZEM9}MtFE1ɉ u1uE$CЃEЅy 9}NjC fsfufu EfC  L4M)U)9~(f~CDuEԋ}))y1E+E)fC M΋U9|C@tSf)uu5L4WuCPC Phy$"EU)E)9~fS }}E}t'E܉E;USBu2ZuEC9E|P^9E}EEM4H49~*u5H4uuh$hJ.cj}V}u)MUʋM9})EK uL4}))ȿuWVEQoPCu3{uuWuuuC Ph$hJ.dc$jUjP+p远ZYthshsCtuuWVC }POC TdC tOP5P7PXZ?S{B99fSs C9|)BfSU sV_#@$?'2=.=9=R@Kщȃ$?'C*hJ.j.H Y^\sF "HSB ufCf;CfCs$uhJ.jG 5P7{65P7X6jjWPaNEtbu5P7O5L7\V ƃ11Et9}} < uEF5L7xhQ$jj5L7XVjj5L7H$jj5L7荪5L7`5L7-Y=5R.DBxqz>tKdtF<-u(=t5=t,-v3=Rt=Su%t!+=L4S>tL4|@hJ.jnF XZV/aCfS K)y1fK)y1fC\{f}}S׍ MQ9UK fMU)y1s9~fSUʋMM9ULfKswXxut fCfCjz `~x~Ja (EC99C@ 'fS?u ? =St=V7Yvt1ҡR.DPIhJ.jD V2 oes vC Zt sP-L_Xs8\Y teF t!u S_Zt Cs~ft^F uMsuC ^tsPKs 1ɉK s[s 1C@4XZu W_XF s?uC Yt sP`KXZsk[XCt2P^o1s_$uCD0tP?oC1҉T0YEC9E|ӋC4tu S_XsL 1ɉKC ^tTP9 1C ZFu2uZu 5L7teE9s$[ Xe[^_]UU@4U fP]UU1x9D4~@4]UWVSP.5D49B  MP5@4jY_Mu11@46D4@44uj.,SI .Yth$S莒YZt jfZ뤃Sqt T4X1]US]w>.t.t)9T4r!DP5t Zt;X4s ..؋]U5t4j1`4\4ZU5t4XU5t43XUS]uTu PmSPjh]US]u+u PmSPj?]UE Puj& UGuPh$ UuPh$ US ]uuPmSuuu jPQ$]Uhd#uuu uUWVSu5t4&5t4&XZugu,u4u(PlVPjjLƃE}t'E8tE$9}u[YtEE$t9}=2}Et,~(E8t P!ZU$DE9rE} u)@E }y$u{[Ej PbZYtE@M}})ȻEE9~)ω}u uVQM5t4:ÃMu$u uVQh$5t4U11MQS<XMtW5P7 >ZYMM5t4`PS05t4PSjjSg$SrE @PE@PVMQ5t4;:P0S P5t4ΉSmP5t4u'u(PjU,Ru$u uuP$t6SgXtSW7=W S=MVPlSfe[^_]Uhd#u$u uuuuu u3$US]uuPiSuuu jP/$]Uhd#uuu uUS]u5uPiSuuu jP$]Uhd#uuu uUS]uu PSiSPj]Uhd#uXZUS5t4"5t4"؋]Uj@US]SJ hh#x PR }荄k =4t7S诇Ph5r%54M54h54h14=`4t8SoPhGr%5`4M5`4h5`4Uh1ɉ `4=x4uhJ.h^r%ӛ XZ]UWVS hpQ#PM_ZuohRjP譋Ph$hJ.MS^ j?h#SNM _Z؉Ph $V^Y[ @'tCVhS/ uWg$W t ;u뵋Ct{ tዅh#RL ZY€:=uZh#SL ZYhur%S衧 ZYWSΨ ;VfXe[^_]UEPE 4UWVS 1ɉJ P ^諣 Zp j hzr%V uՃ{ uC W. h%WN VWN WujƋ;7P yC9C u=CPW|Y_ZuD YaCPsWY_ZtۉC{ CP GC Vu Y^e[^_]Ã=d4u U4t uP XZj<Uhh#軰 YtP萮 Zt h%聮 Ygjhn}YZ hZjXUWVS$1ɉM܍}14j5j袆[_ ]߉j jPM =4u:S<ZxEPj w_X}`jhz[^14y`lj4PgZY~>jh8j4Pfyjh_X= 49SE^ujhY[SZu41$Hu_k4Ph$jXjc4)t]SU^/}EEjPUY[{EE119EtMЋ 1҅t9t; tB C@܋Ekl9tH41҅t9t; tB Cl19t4EPYZu EG19tPZtGEP.e_1;}s7klE@0 t(Pdt!ztHhr2p8p4jG19t4EPZYvGVX_}kSlY^u`S[Ohj]jYju8j]SZYu'lڋS踕Sjj^ڌEP蹚Xe[^_]UWVShPVV hhv%V& hVW4 $hhj%W Vu1EWZt/SSSSSSSSSSSh#h4jj.Y[ WVXZ뷍e[^_]UVShPV覢 hhv%Vv hVS脢 $hhj%SQ SBt VSXZe[^]UWVS}11u܉54jj7_ZyjVPHI e]4$*u u^)uYjhbY[,u>tPZt4$PX4$SX^_ES9bSZYS^]_v%v%S^5P7fjj5L7Ս5L7[5L7fEPj  }tChj_jZj u,jSZYuv%v%Ј贒SʗXe[^_]UWVS}11Eܣ4jjfZY=wjSPyG xpuࡠ4*u$tPV_XEV[[u4EPj ZY}t!hj`jju ޑVXe[^_]UWVS1HH;E E8u EH1LEL0< t tLEL8PDY$}1ۉ889E SZ9$PuSD O]1<%rA <%t)R.< u"DB@C8Cuj PPS P 9T1ۉFADЋ(DB@ulD:AtaD\t?@@4D@P0ډ,Du,:t0@먍TFX4,!< uR.DP@tC8u$C<54Y54X1ۉ4h7%h w%\>4ZYt$SwPhw%54=54X'=@4t#0VPhu#h%j[#0VPh.w%hJ.|=j 01]UVSƉ5L7Tj5L7|!5L7=`hPjj  vhqPh\PjjHVh$A hN%CPjD`5L7&@jPSR)R5L7&$uhJ.hSw% j/jPp@uZYt'5L7kwPS;v5L7PSjjSхS^؍e[^]UWVSӉVjhaVj(P$P @  d4hd4hpt$fh =$.h$.hbt(Ah ud=$.u[jh&j3. h$.hf@$h=$.t"1҉$.h$.hbt(g $.4tPVX`4tPVXst %1d4 ^w%w%u j/ j/ jjhx%. jjž $/ 󥁍 Pj(ڸ (4t#u hw%P7:54T14`4t#u h$P :5`4T1`4h%&3x^_uhw%sxZYu s Xe s h4XEt28t(P1 _tSPhw%耠 S3 3hw%g jo41ۉd481󫋍$88EDž1 $tWDž1ɉ C281jj P+ 9AX8󥋅 ,014,PjjXPh+ c 8uE 1h]% _=4t Z0QPhw%547hVS+ ~IƄuSPV$b* ud#XhB$` ^t@ ?uz4tPW 54Q 8uE wh $P ZYt f W00Y Cxw% 󥡤4xt SPh6XZSj ƒt=$T+ (I+ 4^_tPQ[1ɉ 4U ƒuhKu $=t th%M Z1e[^_]UShhjhjjjjj jjh $.h4y.hJ.hx%ۃ 4Y[t Phx%Ń XZj'jP0Sv ]UWVSEPuhS/}u=xPSY^tE 1҉NhpQ#S:5YXu;hpQ#S" XZ1u+4tShB'h#x%P4띺tVRp=ËE Xw1ppWr Zpt\B9rOw wtSEE 1҉Y>lRpSmBËE YXۋplt 3F늅t 3}uWNW& Xu#4tRhB'h:x%P3e[^_]{< UWVS0u 1EEEPVEP7 ] 1EԉE܅ukVhMx%E܍t0SE)Ph"V37 h~x%SV ƒE؀8'uE؋E؀x*h%uT3 ^_]EԊk<'uMCj'SSD^_E؃}u SoY؉E؋Eԍ4VuAE_ZRShix%jz j 벋E؍J9d<%u<@Q)IB*B6j/V ZYDžtVs EXuЅt GE/}!un_HEu M܋}ԍYtqUĀx .tx uuWo uˋU;2tEԋEԍRUu-@EZYUWVE)Phx%E܍DP5 y;2tV:CXuf XtE܋M1ۉX}Whht@j^ f}ufEf}ufEPEt|e s+L7EjP5L7z5L7rS6Et55L7]Hj5L75L7TL7EEKEfmEURuuUjh@J.#m ]u uAE@ uEÉESESXZ9L7thPjjL7t-9ut hX]UVSh@4i$@4i$h@4h4 =@4tR)~?4.u@4Ph@4BZYt+hhX%h4菉 hh@4h4{ 4e[^]UWVSd1ɺ!iu$xtxܽ jPh 4G 1ɺ%iu$xtx覽 jPh4 jjjà < 1jh@4Vׇ Vh8i(SWS# ugL8PhhPh4蚇 \v$8P,Xt*hVh4O hSh4?  %Íe[^_]ÍL$qUWVSQ-T4LChx%(Pj y,4t Phy%x [^hJ.h9y%x jhb3Ƌ(Y1ۋ(?RXfZX9h3U%WI YZPWV迫 h3U%W1 |R.PDžX@$.XtIQD=f$HDQVgg uHPDAu&XhViP C iƄV:(:_Xujrjn[^TDž$Hjj$V(WhQy%:g @u"Dž$ jjVWhcy%g @u/ ;Tshwy%jPZYt,뱸 ;x|s:hy%jPY^u(hdZt4DžLh jSZ5P^_u5 4[DžL9 P‰f@ @ 19uhujjjjjjjjjSPjuH41ɉXTDžhjthPH;h uHiP8XZ{ 4hiPh@4赃 jhx%h@4dt(jhx%h@4d x%x%1DžPhy%j@$V!jjPpPVe $@t puh4ݘB'h@4h%h->jbt8DžpjpPjj$Sd @tShy%]^_1@1ۉX=@4su%=A4luB4R.DPX(Ph% ZYu7hM$Pcd^_Džu\DžTX/1jv$X󫍽p!1󪍍pi[@u 1ɉ$Nhhy%U_Zthh4h4j=4thh4h4hh7%hz%%ÃtϽPhy%j[hz%S[hz%S[hz%S[$h-z%S[h4h8z%S[=4th4hDz%S[ hOz%S[Y^h_z%S{[hmz%Sp[S>hpz%j^[h@4huz%he(h@4hz%h$SS4.hy%h4kb_Zhz%h4Rb[^hz%h49bZYhx$h4 b^_h2#h4bY[h%h4a_Z=4h4h@4hz%jxtnh@4hz%$Pj~ $-^$z4[hh4h4j~hx%h4^a414hh`{%qSZYt/h"__t h@4h`{%hm{%ht1i 4hy{%\Pj ~h\h4~ \3j h4[3 th{%\Pj ~h\h4b~ \J3j h43 t=4t 4ht|%\Sj( ~h\h@4} \2^=@4u8h|%Sj ~h\h@4} \2[j h@4c2ZYt=@4t 4hh@4^_u =@4u 4,hP$SE} hh@4h@4jx`hh@4h@4jwJ,PS _Y[t%4Tujh 4h 4jyXtjh4h4jz_h 4@ Z=4u=w jhx}%"P?w jh}%-wjh}%h4k| jh4h4j{hh4h4j}m4u:1ۉllPjI^Xluhh4h4j|*4XDžD4u DžDx$4=4ux$4=4ux$ 4= 4ux$4=4ux%4=4ux$DVSQRh@4Ph@4h@4h#h,4ux$4=4ux$ 4= 4ux$4=4ux%4=4ux$VSQRh@4Ph@4h@4h#h^(jjjl x%x P Y4Rh$h( heZZ?HPN/h}%jtjw84_V=4hF_$h}%Y^u>=4th54Pk hvhJ.Pk jh}%j\TpV VVPh}%h~%S9T =@4th@4h~%ST =4th4h)~%ST hpz%jSj7SY7= 4"Xh4h 4h@4h8~%jhX~%h4 hh4h4jjFj jh<u`hp~%$S h4Si dh%dP7 _Zt 8tV [^^jj`RP HTuB=4t h4h 4h@4h~%jh 4h@4h~%j=@4th@4X$h@4 ZYTuY=4t&h~%hh4h~%hwhph~%h[ TT4j54LXXLeY[^_]aUUd#wB']UWVS] }Vho%YZYuu ƅ?jh%@:jjf@Mjh%ZY9t x/t/@?/uGjh%MXYR4$SRPh!%hue[^_]UWVSƉˍPho% XZYd#u.%td#VQPSS$4t4PVSWh2%hie[^_]U幀4E]UUS]SUZй4؋]4USPEEPj耱EZYt= 4a4=4/u4萱SPh%hh`4e1]US]=4ujXE]EPj EZYtt 4w44=4/u4SPh%hh 44=4/u4ݰSPh%hh 41]U MhU;$V3M=4th4h%VM hpz%jMYX4Ltd迮SPh%jL=4th4h4h 4h%VLh4h 4h%VLhpz%jLXZh7%h%YX@Ph%jdLhz%SYLhz%SNLhz%SCL$=@4th@4h%S'L h 4h%SL =@4t_ZExN1jSEpye S}WS}Wttg`PR][^tEPPR跟ZYtU6U8t,U8u"E@t$RP]^_uh%EPFY[tEXt p$l(h,`d04t:$VS\_Zt'EPV4Ph%hSEpFjh%Y[@膫h%h%SDVhā%WDWhЁ%S $WPh}DS6S?Ph%8‹ t ?tPh%P߭_Zu>[h%P轭ZYtލRh -&PIC tjj hd#04,,RPj$WA SBR. tHLDJ@tSPWVh %hFP @41󫍝DžƅDž@4DžDžShQVZ  @4f=tfyfv4f=NE1f=FX!ʉ׃11Ɋv4w4t 'w4$@'w'$@'wt$@(u$@| uu1Ƅ$jj hd#04,,RPjS $PSVh%hFP\ 4J1󪍕)󪍕$R2ƅ(ƅ,J(,,f0ƅ<@DžDJDž('Dž$ƅ|0RhQ`VLX j!?jAm.jUjj hd#04,,RPj#W6 (S?PWVh%%hFP Ljj hd#04,,RPj$S SVh$hFP 0E@8@ue[^_]UVSPjjuVjjh0C'@tbu XtSjjVSjh0C'@u SY2h%S? ZYt PuU ^Zu S[ h%j1e[^]U EEE EEhEPOZYtEU 1ɉMEUhIEP%ZYtE1UWVS`NjEw1h%w Y[uF h%w @[ZÅt#hLC'6?ZYG辟t똀\t @BJu Xt@w44$t)tVP҉[Xt4$1҉94PS1?YZtXP,40Sƒt/t#VRЉXZuTRY8puo$uVP҉XZtً$HjjjjhSQRPx jjjjhSQRPx ۍh%S h4PS\ h"P h4PP\ W(R;^pT`~;a9fhGPSa\ hwVPL\ ;h%S< hwS.\ h"S hwS\ (uYh4%V hV[ hwSZ Ph %S à ƅG1ɋÅth"S<ZYu!Ph %j蘐 à uh$So<ZYth#S^<ZYth$SM<ZYth%S<<ZYth"S+<ZYtt hh8% hh %VZ hSVZ ƅGw PV謙à wh$jj9k؍e[^_]UE1҉UMU ].UEEMU ]UWVSQ]} E10$hmj6Su E=%4jRHDjjSRǃu E18‰uE@WZڈEV$XEe[^_]UWVSE 1ɉ1D󫍕D1҃=45L7苓h@J.8 5L7P=4 GuujjRAXZ1Ҁt,DžfDžDž1Dž=v Dž1ۉ11119tD5fDŽ5DŽ51H5=fDŽ=DŽ=1BC8[ty1t1DŽZfDŽDŽ1DŽBt1DŽXfDŽDŽ1DŽBhjjjjjjjjjRPj轜Ã4uDžRuh$j@DžPS(tuiu5hjjjjjjjjjPj1ƃ4t@DžPV轑ZY^Hy VXSڜ_u?t6hޤhPh$.6U 4$.DžM=4yu4Dž&1ۉ49i8511ɉ9=4t9i854t(~SW~6YZ[ڋ44ƀy1҉LPTXjSP)T hCP4"PT jSh4T 54,, 0$4(804DH$u"u $1҉DHQ,RPFP$4()n,, 0$4(804DHu u $D1H$ 4HpuDH9jj hd#RPjV jj hd#4$P@ RPjP 48t$4VHDPh%R< 4$p~ơ4$0hRRVP4Pjj:5Dž1ɉ$Pj躍^_u654h_1Z7$P1$Xu@P4P54 Pz^4$HXDH-1ۉ,048DHƂ(48<=454\44Ytu 4h£4a1X@_yuƆy$tP,40Wg$͋e[^_]UMw1vB ]UWVSDž1ɉ4*)Ph,%hS %#t+hf)/ZSh6%h豾 ju藟h%֋4Ph%hS h%Sh%ҍǃ(h%ShjlE0p11R ZYtsE;klEX{41 Ctʅtƃ{,tjjjRhRs8WPx {jjjRhQs8WPx jjjRhRs8WPxƅ,CP 1҃CLPQh4%hǃBYcLu۝XZ=4CLSSRVǃSRjj\0jj!6?$B'v=IC`,tPhO%hV VhU%P C`,tPhd%hV CXtPhk%jWy WVC\tPhr%jWT WVST"tJ%tN$VPhy%P CH@%%CX,tS\tPh%hV Vh%P 7%%h%P _X% %h%Pi Y^Ƀ%%hу%PG XZ݃%%hՂ%{Tu%PP ^_%#%:13%%$tt1=161e[^_]UWVS 4*Pƅh+%>hF_$h$;蠆Ph0%j$=4t"4XzSPhI%54; u6h艚4Yt Phd%; XZjj3_Xh%WQ$4Y[1D)SP-B^ZmPdRL P,V9 dRhɄ%W#TPVAL$TH\@H1ɉD@9DtUh"ZEZURuh4PVSuh%j¸$KEtVS Và E)ËE9th%hD'h h.%+Ee[^_]UWVS EUϋMMjW@Y[tK1MU9t FRlSVPNƃtPEV]XZ]e[^_]Le[^_]USj$uZYtD1ۉ]XEPjhjjj EPS<U Vt;M rj$S뱋]UEPM UXUEPM UXUWVS Ɖ1uP$kƅ'Ph%W- tPkY{%t_%Ph%kXZ%tn%Ph 4 Vj&4W Hv|=4uj{^1+.Dž&.DžjhhN% kPj(Vu1h 4h&.V d#=+.u3h).ho%)ZYd#u.%=).td#VWRhȊ%h谉WSП =4uj膒XDžjhhN%3jVj'U(=4+=4= 4h%V< V h 4Vh%S* Vh4h4h%jڈ$WSh%jVh%j讈V1 WSǞ Y^DžVj)TXZS=4tZ=L4tQ= 4tHh%Vs V+ h 4Vh%S+* Vh4hL4h%2;e[^_]USڸxtjS ZYuSh)%jʇ ]US18tjS ZYuSh6%j芇 ]USSJ=tsg1EEPj%SEZYtt`Huȃul"hX%hX t&j hX%hYXKuhN%jTXZ1]Ã=@4uiU@4"K4i%<$4s%-4b$ 4%4r"(4]USE] tP:gYSjR{fXZ@4E],UWVS18Z1Dž@DžDDž<jjklCx4uFtWXF 9sklS9z4uB4@s)XCEe[^_]UVSjhPju蒩t)uu P @u}0S4p0Z1 S"Xe[^]UWS] 1Sh|duw t#S;S t%iSR3$ZYt3\X1e[_]Uu hzd@u)UVSujhPjV踨t(ju jPV)Scy 01e[^]Uu hedAuUU EHJ Ju BM+KQsPR` u&y l[u Ztfa EfxNA t @fFFf9ߍe[^_]UWVS] u@(D=D4u jPD4XklhNA0 y841RPq1l脐Ɖ׋lAdP9QhslhPPlRWVh%Ep貨EXfC u>4ufC ;^Q8tWRPQL }E84u.XfC uVhD 0 tfC txPT41҉`dRPTP_HL|]d`SQX\(lppX\uX\lt4PTd`SQЎX\tj2 t j3ZNXtj4uu赗Y_FhD8L`}Du/E t)E8u!@4uhM@4ZE}`thMXGFhD0 thMYG@PtэL)QWNht18RЃSZt49sL}uFEt8u:Spl\XLHh%Ep$fd#`tEt8ud#PEPp4PSRRpl\XLHhҎ%Ep膥8e[^_]UWVSXu} ]=x4hLt4PZY9x4}x4hsLp4PZY9x4}x4hOLl4PZY9x4}x4h+Lh4PZY9x4}x4hLd4PdZY9x4}x4jGK`4PCZY9x4}x4jHK\4P"ZY9x4}x4jIKX4PZY9x4}x4jJKT4PZY9x4}x4h_KP4PZY9x4}x4h;KL4PZY9x4}x4hKH4PtZY9x4}x41ҋ;Q$s+k UA(0JPBZY9x4U}x4Bʃx4F@ t_u {4 H X[E#UlEUt(Zt hd#5x4h%v t85$441RPs$s WRP5l4S4C8u%uh u hI_hPR>Y[P5t45$441RPssRP5p4.5$4C S$CS 41SQRP踉RP5h45x4h%vP xHu1C( P/IP5d4gHu!SH1BLPIP5`4HuSH1BLPHP5\4lmu'CHpX5P45x4h%vh "nuCHp\5L4ρYCHP`u&hoHP5H45x4h%vOEERh"&jP h5HURjPcà P5H45x4h%vŠSbcfx5X45x4h%v蓠CH@Hth!%vzXZCH@Hth(%vbY_CH@Hth1%vJXZCH@Hth8%v2Y_CH@HthD%vXZCH@H thL%vY_CH@H@thT%vXZCH@HE Y%FEe[^_]Ÿ YuCHP5T45x4h%-+{jPMQKQWsPRdk B(0F}WP5x4h%vW0e[^_]UWVS] Ep+sk H(L9t[Iw`hWKQVsRPdhWWjjjj@(4WJ8WVsPRp VsRPh 1e[^_]UVSu hSP t*hSSjjjjhI SPXZ1e[^]UWVSu jFHP}W jWWjjjjj IR.E܃,11ۉt}DW@uu@tA~Ht҈Uth#SvZYUu GFH`L+/tG/jSFHPjSW? FHHL1e[^_]UVS u vDh"&j ]Sc j SSjjjjhH0SFDVHB`1e[^]UWVS jj%c[^8hLDC Ih9DCCIh%DC C,I E1҃t^tZ @F'tOE4F I}Ou/UDEjh3}EZYUMB"t}$vuhCF IX}$thb%hD'hhm%'jjjjhHhjj jjj%SjM+:ƃ4xu P/V ;S聨e[^_]UWVSQE @4tt3t.t)=t" u E x8uu u\XZjj ^_x 1҉j4 F'UG JUBXYu؍{sheBhYBChLBC h?Bǃ$ZjjjjhhJhjjjjj SjM8ƃDxu P.V9SK1e[^_]UWVS] B({119tuklKI0΃@jj hd#BJJbRPj!WA jj hd#CKJbRPj'P 8uth9AjPPV E@ tPAjPPVU d#u h@Xp@0@'QWMQVRPpjjA)$4,jB@SPh$j -PH $4jC}@SPh$j :P& $40j-X@SPh$j GP jD<@h,@ YÃst4bZ£p4Tٰ-LƄT 19~-@Vh%jPh 4q j.?h 4P5p45t4GP:P-Phڏ%hh4# DhN%DXe[^_]UWVS] 4$DV跲Y_(V胵0(C<@8jP@ x 189}gG\u CP@@<2<9s SklLT<R+A<Q@+QP$@ 09ȉЋ(}fF돋<@} EhujjhMjjjAjjj8@h4E4URP*u5@P}j8Hٞ<_Zj $^DPRH04EZ1ɉ(,~!klSLQA<Q@(,1@8048;HHD88`VpWRLV7uVP 9jj,(40EU+04RPjPPQ,PTEUjVP @V PRLk@8< 󥋽 x08x4@u}u} 40WV{z)׉(,8E@@PEpɝ_Xs$Ep@f E@fx@CklPs腝ZYVCU<8kl4@0E@)Ћ@)P880PyCUk@l( 9s)klPVPky 180(󪋅<18@98tNH0N8HV@8 QPWRL -B r0󥋅PHDž 1jjjjRPRPjPQ0Hug $(,Dž<Dž@jjjP84P@L PT} j jjhQhLjj7jjjjF,ƃ4PVH"V-E)PB89B4<PZufLW WPF8PP8 WRPQLP $AZuVh$h%dSbe[^_]UWS0]}ȹ 1E1EEE =4ujjS)@ jP4E܍EPjS@e[_]UWVSM 14f(uD11uFu@uGN t Ƅ[^_]1US0]U t/MQRSPL tsuuhÒ%j]UWVS4}=4PklUVE 0`ZYE UlVSClP<11CC,C0CLCPCT 4$p( u1;~ sJURWVPL t5E؋K,9u+C0 C0E̋UЉSEċUȉC h#V|O ZYS̋$S t hV1 uE<=uVxƄ<$SVhZ%hPI 1NiXu5WSho%4 tYWShh%PRN 54Bi<4tShv%P'N 54iSh$h%蘀 1e[^_]UWVS]u Cp}SYu 9% :%B4tWh%PM 54hWhƓ%hޓ%VS1e[^_]UWVS}u EC%E2E%1E4ÅujEPYX9uG@<5hRĉZuG@<KtG@;1e[^_]U14jC"Zt%61UWVS]u 1j "Yt5DžPj[XZuC@<=4uh%jYXh4h4h@41h@4h7%hzh@4hH%hW%}~h|%hXtWh%h< jhMőC@;XZ1e[^_]UEJ]U(EPE 4P1]UVSU E0pVSPh%EpFPe[^]UVSu] hqj軇ZYt,hƔ%hoZYFu @8@V1e[^]UVSu] FPjFphՔ%htF@V1e[^]UhhƔ%h UWVS\]D1t=u41ɉ 4h5xjP!N gSbZX@/.1ۃt"tu舀4d/.)4tPw[_th%h4js Ph%h4jW4x/.nth/%Rj) $}vWPhP%Rj=4t$R݅$Rh%WI W蹅<$ZYv /.8./.="FtPVZt F9F:Ch4h4h@4. 1@/.Ct@t!1C F z~uʃ5P7jjj5L7蚑5L7k_5L7bjhKjjhۦhj&jFjjjPjÃLPSS e[^_]UWVSQƉh%)hF_$PG uA=4th%PhÕ%54QG h%PhÕ%9 /OuPh%Ph%菕 _XVh<%SG Sa]th%hv%Sj h%Phl%Sjh%_P 4ZYtuVh%PF 54aujh"V聄 V,XX1e[^_]U1ҋE]UE]UE@d]UWVS$E}Ѝu1ɉM] u]u]܉uu9u]{ u ;}}w1] 1ۉMԉ]M]x(Ã}t*M 1]1 uM ]M]U9uU9u {;u U| 9u܋U} U;U UU|WU9U܋U]|G9u9uǀǀH vIH uԋ}p x$]C 1҉EE$[^_]á@4"UWVSXE؉UȉM]E EUE} }}$}}؋wu}9UM}։lj]19؋]| E1ۉ];EE}LuuWVI/ut4EUuuWV!/);uE}u}]؋EUCSE܉U1ɉM̋EUEUE9ƉM ]9]E؋P@MAQEUEM])M]EE1҉UЋM9M+}EԀx EEԋ@1҉MM]]1Éً]1Ӊ]ˋM 9u]9ƉE9Ɖ]E9E܋Eu};EEEUuuWV-);uE}u}E9ƉM1EEO)]9؉ӋM}EUEЃEE9EE]|Eȉ0xUMPH EE̋EU׸;EEu}uuWV,);uEu}E̍e[^_]UWVSEU }}u}M] M]M$](M]M,]0M ]$M]M]M]M]u} M[^_]UVSQMAQuRPRPjjjjO IuEU11ҍeY[^]UE]US]sh%ji ]]RUWVS]} j/W ZYƃth)PCDPW~ ƒuMV`~Dr9s6t'19ty u9t@e[^_]Uju EDP`RUEvPEDPu ܜ UWVS]=H4u Y)H4K$9C |b5H49s sW}jjjjRPRP t39r,1tu{(u t @9|1e[^_]UWVSU}119y u 9;] u}t uz(tt}h~t[nЃu"9uǂǂ1J Z$1ɉƀJ C@]t%1e[^_]UWVSU@11B z(tBBB B fǂ[^_]UVS41ۃU U]UWVS]u=4u1҉U1ҋM9bx u 8D;U +}ߋE싃E苃E}t }u{(u1+FV C S$FFlN(1tF$1F,MPFtk9t jPR襖 F tV"}uM9MuǃǃFt$9th.%hHG'hdh%薀F t'uBK 9M sM 9rE1e[^_]US]=4u!w k 4"1;@4s k4D4C([]US]=4uS1wG'E[]UWVSSÉU=4uv!v=@4 D41k 4B9tp4;u(}u1BRQFZYtD4@4k44B@4V 1Sh"&jRU@3 F hst~ SPh%jW 3 F'F(UV,~0F((e[^_]UWVSPu]=4u1E1M9z u :;E  1}1ɉKC1C CkEt CCEC S(‰C$EPC,}u uK9Su;u tK }u0~(t*u!K @N 9M sM 9rE1Z[^_]U1ҋE ]USR] j EPu U:tt htX1 k]UWVS0]{Tuhz%h`G'h{Xuh%h`G'hh% }{\uh%h`G'h߃{`uh×%h`G'hȃ{duhޗ%h`G'h뱋CjCDPVS u h%V XZ{4uD1ttʋ5R.DNuT4@׀{4ujhf"C4PSG ؊LD tB:u JNa Ph%WY hF_$W;5 ƃiWh%jlPh"%VlsXs\s`hF%Vk,Psdh]%VksThn%Vk19aW 4H'PwP7Phy%VqkG P u"OQPW RPh%VDkH9~hv%h)׉M܋]))EU؉EԋU؉E܉UU9UEU} EE܋EEE̋UЉEU9M̋E}M]ċEԋUڋM̋]M]9ȉ} +EUĉE܉U=H4u H4E1҉U19~W}]Exv(*uutu Ex(uthujjhajjjAjjjRVhE4URP腵uV>.}51Dž<Dž@;us<`RVSPL t$hl`d<@FjHk)4A Y^s1҉8,0$(8;HD8ȋ0`WpVRLW6uVS jj@<0,EU+,0RPjPPS,PTEUjVS4Q 8 tIVPSRL$(u}u} 0,WV)׉<@8ڋE"C t @]fCEf@ DPU1]1EEPVJXZ}y1Q1҉Tu1Hùxt%| q1@ 4SG0|GEE;xrB;Us E11ۃ}t E;]sP7/C_P|YV54jXZ}e[^_]UWVS0EDž}uElL4jSZYt jS^_uY13jSn_Zu[^ƅ1;L4P4} tE 9duE(u)tURYu0;$s{ЉuE, EDEHʋ9Ɖ}fjj hd# WVjWhpƃ 3WVPhݙ%V!y Vl Nj8ƅ3ܶPI Nj8XZЉ8@ 6Vw؉1=uRhnFjj hd#EDUH,,RPjWE$hoRjPHV8F$*FYFL9  $VP VEpf $V $SE[f V WEÃ9r$h%hXI'hhU%OuZ1hjjjjjjjjjPӫÃ4tPSi^X19s 419t4@Y؅ttWZ tS&Xe[^_]UWVSljfDžv/ƅujhX%Y^yhhX%S^d z躠t&豠8t觠WPh%hS hWSd =Džp!j/Sy _Zt.xv9tH9s8/tQOk YyߍxPW&YZ%=pu*T>hQW iƄ/u%谟QPh%hS $hQSc =@uWj ZuhWPb =hS Y_1Ҁ;/u 1Ҁ{‰hSBp<$BZlhЃpDl=w4uhh%S$c =whWSc =v R?V= _y RV]YRV[= ZVDRX1e[^_]USÍEPS謾YZy1]EtjS!XZxj `PS t SYS`Z=vf u]UWVSEUPE ^ƃ}t11ɉMVd\ Zt{fx vX jh%S?B uSuh%EP( @u h|#k 3Et}tESWuh%jcu[zV9 XEEe[^_]Ujh*Ij> UWVS h %411tY+ڸ%xuڸ%tu#WSXZuWSY^1yah%hPS_ WS>1u h$%蛜PSh.%jdSh:%j4:hS轼h%ShPPm_ WPмu'hD%SӛPPh.%jhM%hPS_ Sh%jtPhM%hW%juh %S^hPW^ hc%SAPWh.%je,h%S%hPW^ ho%SPWh.%j2,h %SPh%jMh,%SϚPh%j*h%hPW^ h%S薚PWh.%j(h %ΚhPW] h %S\yth%S= Ph%j_ h%shPW] h%Sp141.Ph%hW ttpWh.%jC utjh+bFXZte[^_]UE4fP]USE@k I't!I'ShWE 0,C4 ]UWVS$h.ƍPhW@jq,@1jhd%_ZRhW@P(, 1ڹI'1!tT9u Dž0AVP=ZYu=4B G jjjjhjjjjjj!ShÃ4tj"PS觗SXe[^_]U辗4tPPRRRhp%jUE 1҉P1]UE @1]UE @1]UE @1]UE @1]UWVS$pxЉ11)ӡ41RPSQRPh[]$j]S ]С$4Eԃ7x6P URjP91ɋu ;Nsklu ^c0AO0}u}u ]u]uutu9]}UEG0uW+EUu FV}t ]U]EUWE `1e[^_]UWVSd} E@9E Ek] lEpF0t0 tfA A B}ljK'fG G5GHG G,;G01G8@Ep x$+s{ 1ɉMM;H s%MQuPRL t Euu}EыK19tklSB0u+2z@s{~S(xE+C$PR蔖XZE+C$e[^_]UWVSEU΋}EE1ɉME;E k]l_C,EFU;uFt8tKQP1YZuk{8ueEC8EC4FV SVCt~8uklHCBVPDXHXXe[^_]US]5L7e5L7\YX{$ujCP/C$XZC($h4jjhhhRjFj jjPs$h@4yC(4ys$91҉S$Y1-C,SP]os(zs$C(1C$C,]UWVSuV[t$V"Yt&jP~: S uue[^_]}hjXZ1e[^_]UWVS4$)t uiVu`j(PjRƃu1O4jjHDjjPÃt͡4$3t j4PLSЉƃu11P;^ s-URSVPL tEuEt 8uPC΋4@u <@TXuuDHTX=4pjj hd#,1ۉHL,ËHRPjXPwjj hd#jhj^WY8jj hd#jh0jdS8pfH 0T4DP&$WXRHQDjP p H0SWXWHRP4Pjj'm(hN%0lppltDžxDž|}1 EPt!EfEEEDžPf@ @ @f@@@ f@*@,PW=L4v~(u@0f@:@<BhujjjjjjjjjREPhuÃ4t#Pu@,ItPS6kS|v|Cwc 4LPdhTXlpF(t|lQdQP҃ fVYexM|AEAEA Q119~.u2FN<uF EuPEXZC΅juɋEtY_1}z 9u}Wڹ[fB EB h;jjujjj(jjjuSjsjƃ4uP`VXkSEEEe[^_]hj XZe[^_]UVSuE ]wi$M'hDs A[4hE2[ 31묃u1돃ty  ?VI$$@c)((A6,,B 1ɉ Ph#jSF jSSjjjjWd0S ZS Xe[^_]UWVS(]}h#uVv @4XYu81ɉUP'M`PqZYU9‹M}ƒ$uӃ@4} E $$O'h4_ Wtjj__h5ku241RP şRPh[]$jEP( h6&tjjI_Yh7u)tjj_ZPh$jEP˭ h8t"u h#jEP薭 h9t"u$h#jEPa h:bt"u(h#jEP/ h;0t"u,h#jEP h<2^VP@4Ph%sֶe[^_]UWVSX1ɉt @@D44t=$txuP1$XytƃyjhG%:_X= 4T5|uÐ Dž81T5ktƒ8C1;8 8/T0 RPh%hW趫 541҅t4҉uFWP=ZYu Ɔyȅ4ƀy1LPTXƀ);T54ǀ,ǀ<jWP hW4"P =4u/41҉4h4aljY t^4tByu/49u4ы9u􋐀뺃:54'xk<ǹ1󫋅PB YsC )t C8$tC81$u19;x sۍRPPL tO@j$xustj_CBk<y׹󫋅PB Y$CsC C8RPL u;x ruكtЋQ__k<y׹󫋅PB YCsC C8ci1fD @9s=4t1HO'󥍍P{_\O'󥍝PًH^= 4t_Dž DžDžX51҉pO'󥍅PًY=4t1O'󥍍PXX31B iGT3B VD4y @HfFe[^_]UU J E] = 42UWVS11ɉT5PYZNT518t=suB89J4ƅƅ{@1T5k8|<teD@PhO%jPvT5Phj%hvhh%R hT5PRo F8yT5D(~&Ph%hW訤 hWV& T5D,~&Ph%hWu hWV T5D0~&Ph%hWB hWV PT5؃PVh%hru1Dž88T5kt1;8 8tuÃuTT5B1L VSXhX5jsjh\7h%7-&h5ssjh7hl%:+e[^]UWVS]}11=4t}jh"CP ufK05|tF9Lu@‰5p4t5xt$h`3jY^tjjXZǃ=D4؍e[^_]U=(4tuh%jPR UVSuu1r$ugjjjVcyÃtjjHDjjFPt$4KS;DH} DHe[^]UEx8th#hO'hm h%~@UWVSQ} E@E19u~aEX=su8u?G8.=ru8u/Gx=muWsZ$tfc fK F뚍e[^_]UWVS0uA_Í}Ĺ 1S^uċ$进ѧ$zuubPCsYtWWPZtNjE@ u WVX_XWPV tjVSnE@ t VPZYVXjjS;ƃxD4 e[^_]UWVSuXYƍ}Ĺ 1uVZt틞$S_xt,jjjSǃtSYt$SPHLPd 1Z} w#jM O'RjP8x u0h#hO'h h%+R1t4Q,1t9E t @11tt:[]UVSQMp@19|h%hP'hhG%9ù|@89¹}@1ۉȉڍeY[^]UVS]1C49C s8SrY;C K$}'ujjjjRPRP Ɖe[^]Ã=`4uUhk{XUS]=`4u1;`4s k<X4[]Ã=`4uU`4]á`4UWVSSÃ=`4ut=;t6`45X419t$USF P脬ZYF<ɋUuG1ۉ؍e[^_]UWVSSÉ։M}h֣%R>ZYuj ju~C,S0hݣ%VY_uj ju}C4S8h%V_Zu0j(u~Y^ƅj)P~_ZFh%V譫ZYuEh%V荫Y_u j(uh%Vr_Zuj`u@S^ Oh%VNY^u>hn#EPB XZt(S'>ttVPYZuG C<e[^_]USPQRh %EPj6~-htރuVtjYj jVm uj jVmTuj jV^m u7thh%P hVP  sh]$VZYuDG8PW<G4h]$V菚ZYu)+h]$VUZYu)j h,Q'VL thjh^Xۋu0lY19ȋWl[j`RC@P衷 C,S0C4S8 u+t)CQ RPDYZuƅu_, G 1%E u G1ɉOOO_O _$UWG@jhRjP8XƋG,ÅtjP4tKRPPs0s,Vt'8t"P\ PXZ@8u ǃC4S8)G W$q1ɉSh|dVԅ iRZbZujYSh|dVy u܋1;s̋tpH,9H0u0;u"H49H8u;t밉jSP BrVFMZ1e[^_]U覝1=4t =(4]UWVSE8}fHfMfMfXf]f]X]߈]X ]P Uf@fEExstExlu31MjQk T'RU U؍MudBuDEPEPEPEPEPEPSEPEPEPWhb`$u u>R 8~u Pu׳ ujgFpX1MjQk T'RUA U؍Mu$Bbu Pu} uIFu>e[^_]UWVSu] t>u1}ZEPEPEPEPEPEPEPEPEPEPEPh`$V4 uAEyƒt ƒu&UUSCEC EC fEfC1O1k0T'Ut4VP螔ZYUu$ T'}EECEfCGue[^_]UWVS@utc T'CPCPC PC PC PC PC PCPCPCP3hb`$j@}W]P 8ssWփ V'ue[^_]UWVSEUM܋}EEۋM );} GEE1EEƒ< ‹E䋀,uF;E9r+F9s,t }P;U u)9sE䋘0 }t%0tt13t]ƒt<tՋ,E39Et:ƒ}u9r&39s#P;U sxU9sډ)9sу@uEE}t(}tE8}tE܉1 )1[^_]USMU Zyu t tR9Qr[]UWVSHXH X$1ۉX p0uu]9]E}u1ɉMUtj}t}tуtat\@ uуt=t8v1]9]t UrH X$9} 1҉P P$ )H X$EE}u}0]Q[^_]ú=tUwB=tGwH w8RXs.'-v=uUWVSUM119}uP0uQjVRjGуtux`ڃuV]0]}tT1ɉ]Ut4u9}u*uu}7SjQWuPEЃuGAuFA1e[^_]UU 1tEMh]UEUUU ]USMEX؃< uʄt E0‰[]UE1҉U:U ]U EEEEEEEPU EjUWVSÉЉʋuˀ{u,C { K?H} K.C { K?H} K KI1ۋ}_ik?19Ή[^_]UWVS u]}1u܉]EPxU Zu tX3%PEUEԉU؋}uM9u džN,t1uuuuQt1e[^_]ÍL$qUWVSQhy}y}y }E1EMȍEPEPEPUE_E @/EЙ]u)։]u]uEEMԍEPEPEPUE @Eܙ]u)։]u]uẺEuE}ƉeE؉U׉֋Ue)ӉM]]ȋEԉMϋUeƉωؙMʋEE)׋EU t2 t,EPWVuut2EE}u u}tE}}4E؋EؙRPuu:EU4DH~1ERPWV9uuRP9EE]ÉUӉыUe9E1MȍEPEPEPEi @tKE=A}Ẻ}UeʋMЉ;U;EFuE=~]E}8E]1 9[YeY[^_]aUE]ÍL$qUWVSQ1A1҉U1҉EUF0E؉E1Ɋ t,}uÃt$<t ,}u9]t@u0Eu1M]ƒ< RWvWڋEy11AtE1ҍeY[^_]aUWVS,M$](u,}01EEEEEE1U9ЋU| E1E܋EE19M}M9Eyu1EEU ẺUЋEH9M}GE;E]UE0juQu@M]E@E1;EE }Vű}΃Mu uWVK5);uE M}uu)9s ])] 1҉U111*1҉19]]܃}MM 1yAQ Eù19Ee[^_]UVSEP$9p |$1jjjjSQSQjURP),1҉Ѝe[^]UVS]U M1k N( u4؄tfEB 19EtJ @u,1u.R E@M,9du 1dd[^]UEUUUUUUEUUUR4U UEUUE1҉UP0UURU }UEUUEUUP0UURPU LUE1]UVS]MU2U k V(u؄t=&ukE U1uQЃ<![^]UEUUE1҉UUURU UWVSÉ΃8t2$41jVRR $Rh{dЀ3/tjhPjRE@ue[^_]UEP0RPJUWVS]E EC0E1xp@u4Lu䋀PE19uuE1tr}t[P,}u]9UuX}ts1t@t 逌}WuS yуtu G{0Ea;hhZYoh}SZYa }U׍e[^_]UWVSEX01҉U1Eߊt]t}ttR<tN hs,5SPh%j(RU> 5M쉏$5U(5( 5LJ`5kh4D`5l4h4e[^_]USÃ=l4u1kD 5$5u []5[]UWVSƉUM] 1EUFSF C1{ FCFwtw A,<vxPW/=u7sE@,9uQVP3H &=t1skE P3 e[^_]UVSuE =d4uhd4X>y d4CFU,U9u d4@Ce[^]USE PMk K( : uBu'@ ;Et0j RkU PP 1]UVSUEu Nt+t6uXE@VvpSPFD.4t(vtvPS e[^]USR] =l4u0j EPu$ ƒ =w uE8tt h'X1kD 5$5u]U U1vEEUEPU E_ZÅt*UVS14OFZuS OXe[^]UWVSQu>xp19|h%hdW'hxhx%,]9|@89@|ue[^_]UWVS0uU=4]ډ@E =~Mȉ\1ɉ`}ډ1@8;FF| FP1RP|~ tlURjVPL tYEċUȉḾ1ۅuBu>dž9|Ӄ!!ut9ȉ׃}vjhve[^_]UWVS]`t0`󫍓0 Se[^_]UWVS4E }uth%hTW'hhx%9hjlH^_W'u CEUY~11ɉKKCSƉ׃s {$Cǃ?ǃjh>RP='@ǃEPu^_t!ẺEЉEԉEȉC1҉؍e[^_]US]=l4u]1Ҹ;l4s)=w9t kD`5B1=w kD 5[]Ã=5u ^,5UWVSƉ $41󫋅 EU RPVh%h4Pv4 E jhPjV7xShydPe @u V@.X1V5.jSuʕ e[^_]UWVSlu] E EE$EEPSV EPډXE8t%E8h%hV'h hx%1~,u3FuuuUM uxMQWPRL u GF,;x rËEċU9Uu;EuE̋M9Mu;EuՋF,MQMQuuuuWPRxà Y}w}u }t#1A}tPh%%uPu| "}tPh|%Ph2%uu2 ؍e[^_]UWVSHÉ1jhPjS5J1Dž11҉1ɉډ1ۉ؉!!ׁuO1 RPh/=fU?XqWVS/9u)9u!V!ʍ4󥉅SGX99;ƒ<<„t <uh0101ff=Uuf=u#(,D1ɉKu1󫋽{w%RXuX tHtt7tqiEt,EPFPVC,1RPP Pе~ 돋t6t%C,dDž $t tx9,sbthjo@^Zt31ۉ Dž1ɉ1҉Jx 'Xu&1󫋅fǀUe[^_]US0E }uth%h@W'hhx%_yhj?XZE u CEUY~11ɉKKCSǃ?ǃjh>RP{@ECǃ1҉oK0SUE Z@u SWCX1d3{ uUC$9K }DURjSPL t1Mt* 519t @D=u=u S뙉؋]UWVSUMtQ0t),0Ut,]))111҉XZ[^_]UWVS}UM] A<t <t11É1uvB? ڈ49'fDžU1 WV)Ӊ1!!ډuAWVhP$x30 14^uP$ƙ9uK9uCH!؍S#ƃS~<Y9k9_'X؍e[^_]UWVS]Euh%h,W'h .1uEE}lj1Ʌuh&h,W'hhx%Iqs{u}Ɖ 9uE}QRuuK0S[Puu e[^_]UWVSÉЋ{ 519tBDu3{u}s{ u}u}u}v}t 4M1;})ωxMH PC u h"kE UP XZ܍e[^_]UWVSE }Ĺ HUMx}}t}1҉H 51ۅuh+%hW'hhx%o9tCDuu}EB%}}1uuuuE1} u}w2t tu'}\JM1ɉMr1u}}}E}u}0}}u}t7}u }|ڀtu(}E}u }E}9}}u1UMUMUM}9}}u P @|UEUEUE9E}}}pEbE`Mt:EUu9֋}|}9֋}}ً0‰EU,Ɖt1xtx}9ЋU99uE|{}EE,EujSUr }4u9P7u 4XZm1hjN3E_Z EfǀUƀEEl1ɉpplxt2}9}u|H1+EUẺUЋ,E,EEujuUs }t'4}9ttP6u 4XZE0qEHEUȃƉplRP)׉E9Ɖ}ME,uȋU)Ћu}ƃu}|U9E}}EU+EUẺUЋEEEUEĉUȍEujuUx }t'4u9ttP5u 4^_E9uh0u_E,9EE}KhjC1ZYuEb 4}uu,fǀUƀ0Ë0}00UMыE`M]}v*}}u }t}iuM9ʹu}UUpx u}EEMEjR}wR‹E@vM1ҋu9Ћ}_EEE1}$tuVME]1uCu}ƃuuWVs )׉u}9]EM} EUEUE1ҋM]M]9ȉ} +EUẺUЋE\EUEĉUȋE}EuuW< }t2EED4u9ttP3u }D4ZYEu0hjjP+1}?t;_u}E@Eu1EE1}EE1Vt_}9ti@уtuH}0t;1Ɋ_]ttt}t9}t#@AuՋ0U9u1e[^_]UWVSP]E EuEE}t:C,u)C0E1҉UĉUȉỦUЍMċUPX{,4}u1( 1}jjjj1RP1ҋ};}ERPjEPS,tE.5EUEĉUȋEUẺUjuVSUEaUċMȋű}Ѓ uEYUċMȋű}Ѐ}u.hG'sWVQRUMsHH'C,UMtX(C,u 9}8SjWVQRsLH'C,tPC,e[^_]UWVS}Ĺ uE0xE0EEH 519t@D=u€t E1ɉM1Mtكtu‹]9] uEE@uȃwE9t}h=E]1ECƃuuWV$ )9މ}u}1E1҉EtqE9E E˃tuSE`tF1EM t}tȃ<ttE9E tw̋E0h#jP]S jPSSj S8 ƍ@[=wʡ4EHDEU}~ E1ɉMRWuu,SVRPމؙ9Uu9]tAˁ~ƉЋM\1҉`@EWVSuE E0E8e[^_]UWVS]E EEEEEܡ404}81HDEU}~ E1E}u?9}/jh>uu =~?EEEUE܉0t}܉}UU}} ]e[^_]e[^_]UWVS ]4480h9%h}WuVEPS$xuuuh9%hWVEPS>tuuuSЃS@e[^_]Ujj _j j P US8aPQ$d#PSh%hJ. j U=(2.u (2.HE5fPftP~Z9(2.UWVEE왉U1E}ujEPj&v e^_]U0E E1EԉE؉E܉EEEPEPu`ƒ xEÍL$qUWVSQ@@u5jhdE5Д XE5dE5(E5,E5PE5TE5XZjP虔 (E5,E58E5%f~T7h@['hP%GJGH))րx u@'˅iuh@['hb%)<[^T1ɉ PWuEp(@h@[';TZ8T8#u1Xe[^_]UVShVp e u hZ';Zu SX PVS 1e[^]UWVS]} uWh ['hn%E;  sVFFtNMEUE UEPEPs C @u1R8 tR89thZ'h%:^_S[VtPSV1ɉC F0s {u0Shjs C.@uhZ'h%@:XZu s]e[^_]g@ue[^_]US]j$+Yt:XU P UP1҉PPP1ɉHPP 1҉P]UWVSpljӉ΋EftPh ['hn%9 EjEPEPSà jjP twPjS @tejjS tSPjS @tAVSW t/Phjp 5-@u*h ['h%8Y[h ['8ZtSXe[^_]UEM M]UEM M1]UVS]uhU YtShjP,@uh0['h%98XZhU Yt1ShjP?,@uh0['h%7XZe[^]UVS]t P?X틃1t:P,ǃ @؉Ƌu4P,Mǃ- uȍe[^]UVSlM uEPUZt%ÍEP>$VS @u SX؍e[^]UWVS} ~N7N11;] },E4V:>ZHw̍CWPE e[^_]UWVSUu }u NVB1ۅttx 9{ s x 9}stKtHJ KUjj(_XۋUuC u1ɉK;Es2Uus_ZUus@S:[^뼉CEC {MECBK1ɉ JKZRhPr B)e[^_]Uh$\'\5jE&. UWVSREP1YutE@$t5s% uuC tUBHEx uC t<v UD&0Ep V;Yw{t)1 E@ȉC,ub Ex txj(Zu hT]'3XYǃ,f@S(P1.1;,s$k(рyus1(D@1u e[^_]UWVSSƉM׋ttZ9t<{ t6 1ɅuufujuP t[뷃 S Vh%2 e[^_]UVSËHt2L~tHHHZR1ɉL^Pt2T~tPHPZR1ɉT^`t2d~t`H`ZRj1dXt/tVfG,X11҉Yt/tV-G,X 1Xt/tVF,X 1Xht/ltVF,lYh 1hZe[^]UVSNjjjVnD@PjV%l8@t@4%1҅ut 4%1҅ut 8t48SVlXZe[^]US]E ftPhd\'hn%0 jP t(@t Hhd\'/YE u1҉U E](Sh jP#@uE d\'E%]i/]US]E ftPhP\'hn%W/ j|P t@JGv|y 4G7`xv | xYZt>1҉Shj"@u;E P\'E%].hP\'.XE E]d']UVSĀptQPhhxVԟ@u h(]'8.XV ShӪ%- e[^]USË4%1҅uau]h%SXZ{PtS 1Ytk%1҅utSLt%Ju>#PSXZ]UWVSÉ׸r$u2%+1u%PSzS_jSZCt PSXZe[^_]UWVSÉ֋8 Ph%,1ɺhXZu%VSSjjN%1ɉK 4%1҃uuj%XZe[^_]UWVSUM8ttY@@0tM~ tBEU  1ۅut1҉FXZ[^_]USËltu;RSlZYt&hvRpPaPh5%+]Ãx tpUSË%1҅u:u6S]% Y u=uSnZ S.YuS\X]US]SYuj$XZIpQpcvPh=%+j#Sh"jdj#]UVS]E ftPh<\'hn%* |)RxPd uh<\'*X;|t xD8t|xhJ.H 1tf J.yhJ.j $ Y^J.PJ. Sh j @uDE <\'E%e[^])jXZu Ee[^]y"e[^]UVSjhx%ZYuhx%h}#-)[^"VP?XZY@u VhS%)ZYS'Xe[^]UWVSMy t %1 EU}u%1҅ut6`u,QM3Y}Mtu1ۉ1@EU}u#%1҅uZ`LQ.X}t u 8 ى%1҅u1` 1e[^_]UWVSM48%`uu %t%ti utSYt %@utS6-Zt %`ut[1҅u%u! u@uM1ɉȍe[^_]US]'%P'jjUjjU4]UWVSQ]4Ɓ@1utg%@1҅u\uXt0t(VwZ%t4[' Vh[%&NvSq_%t4['h_%%[^8thy%&j( Shj4Ɓ1uguc%@1҅utTS,1ɉMjEP,Y@u h]'%Z,ǃ,Xe[^_]UVSuh(4#%48ӁYt:tt{ u h%SkYX[j+XZe[^] @48ue[^]-UWVSD]u Ctt,PCQPhj@EPt@uhl]'$E_E{ VEPW3bƒuVWh%:$ st#Ej@VCxP L VWh%?$UCxU3`UXYu"D@RWP_׍e[^_]UWVSÉMt0x11UjSZYUu 1{ K uRPQM3=_UM  {Mut';xu;0tQh%n#11҉Y^{ tFEU   t3"Z@uh]'3#Xe[^_]UWV։ϋD@WVXZe^_]UWVSu%1҅ut V%ZuF Ph%z"Y[Ӂ u% 1҅VGEj EPju^ ]PSh%"M1҉-1;,sYk(jQMuM Mt5j EPjQPMAPuh%! MQC럋 V4Z@uF Ph%![X ~ u#V3%1YutVdX~ tV#[ӁtK~ uEӁEuEuEuV蝢ZY@uF Ph-% !Y[t ~ uV<Ztue[^_]We[^_]UWVS(]} uS#ES|Ẻ{Ls$S# { }u }s uJS0Yt?Vh=% S SdSj3poE X%]e[^_]@Vhj%h%S*11҉fs$t jjSa" S.#Z@u78t h<]'X1}E A]e[^_]"}{ tC uPh{%Ph%(Y^{PtRStCQEЍ}ԉƉщUS&CtZU9uPEPub t{ t11҉s{ t411ɉh>#SSFS8]e[^_]e[^_]US]C Pt$ZYts$sLP ]] UWVS];1{Ly)tC$tjjS 14%1҅ututEC$u?tSp!Y@u h\'ZjjAS @u h\'X]e[^_]US]][].UWVS׉΋;M EU K 9}!E4UQM'YZMUtBu }{ t~EUh%SYjjMtuuSD tSޟZSOSX+9t'C jjMS [e[^_]UWVSP] 48%@1҅utjZE1t6HjEP, @h\'h%!_tm@hB%h%hͬ%@t+XRDLtzh%hƬ%hͬ%I Eh%hݬ%hͬ%& 1Eh%h%hͬ% 1u1h%h%hͬ%t C[h%h%hͬ%<@uuh%%Yhjjjo TPh-%EpE5u>pE54%1҅uu u_pE5XZe[^_]USS]E uPhx\'hn%R jEP, uhx\'jYuZ8t$hx\'hb%j,,ǃ, _w$jPhx\'h|%ju6M8tu h%YuESQXZ]US]E U{ u)C щ‰{ t][]t[]UWVS ]]} utSEtXZu 1w{ tC Ph%Kέ%p^_CStP }tQSS[1pEPjEPu] Euh\'WYASuMXZul0~ WEt YXt3{ tC Ph׭%XZF$C$N>K>tmC**aFVtPMQV1FEtPV2VP~ u!Wh%$11ɉddY[ۃ} ~EPuu { tSZPHtJHPXEu}OuEPu^ ؍e[^_]UWVS]DžPPhhs @uh\'h%1XZh%Y^1hPPF1׃ u VhR%AXZu{.87tq.8 tt VhR%^_\XPSǃuh\'[ttlHp VWZYu VjS ϋFVt=PVF PtZYt%Vhjj 7u7W1FtPV2VP~ t11ɉ#Vh WtSPtSttPSP e[^_]US]E ftPh\'hn% S虡Z@uD,87u ]],8 t,8Vt,8tE\']]UWVSD]} uMMtFMPVZYt3Mv/v,7S UE \'EU#e[^_]EC(f9t { tQPC Phg%f{(K>:Mu#M}tyEPVC*P Mt_{ tEj<}WQC*P9K PQMh%Yjt S*ȉe[^_]UWVS0EEE EȋEEԋEEЋhѮ%S_ZuEE ۮ%+h%SY^u,Eȋ@0SZ@E] EȉEe[^_]uh%Sc^_E܅h%SKY[u EȃHg1E9}E4 Z\FSX}1ҋE9}?EЋ UQMƉ$MQu9 K)Eƍ@E UB 뺋E@Wh %W1pC.E 1E111E܉EEPha'h %uu$ttktA(NtR4tU6uE뾃UuM@밃ptxtn 뙃M듁M늁M끾wEkpC.E%@1҅uE䁈4@EԉE1}11uE䋀t0tR~ tGߍV }9}~E4RUZYGUu9]uuVj-v EvjEPEp B uoE䋀t0tL~ t-ߍV E4RUZYGUt}9}9]tvuVuu @uE䁠41E䁠4E@tL(E܋Uu9]u)}u#U܋MEtNf}fC(ffGfJuj @ ȋuFZK>s*S>+Ee[^_]UWVSu} lhζ%hPV@à t1=whlhζ%hh% <%8thζ%h$_ XZh}h[u h]'> huPY1l>uZG Ph% tXZt{>u[C Ph% _XhhF% YhuPWhQhnRPhnR  =nwHƄn ƄoPRhhζ%V舆@u-h]'hr%, XZhtjWhà ppe[^_]átE5tUtE5PtE5UxE5]UE@]UWVS]u }uh%h|^'hG}t}uhķ%h|^'hHh%ktu #:t 9ptUC tHtJKHjYYu<tBCXCpf@up MH1҉PfxCM1e[^_]UEM uh%hh^'hh%u "t 9Jt"BH@MUWVSM Ep}y1yy9s)}_+Yyutʚ;1Ƀ}t}[^_]UWVS$Ǎ]Sjv > DFu EPj @u11EEEE1;s4sjEPC04 @tF1e[^_]USjPj[ZtÍ@Pjs ZY@u SX1/1[1҉S C C1ɉK C C$1C(C(C,CH؋]UWVS]3tP>E t9VuFt9t,NtJKNt PKXV^Xs@Q1s@sDCMYC t6HtJKHP!ڋHtJHPZC uK$HtJHPXC(uK,CNe[^_]US]jSXZ]]UWVS ]uCh%h]'hh%tE5t,tE5HtE5xE5C8tst Ӌ`!ft1f9thWhi6b@؍e[^_]UU1B$t&zLu1t]UWVS\u~>u Vv7EEEE1]Mu] EMQUE UJHOuԊEEjPS蝹PF Ph %F>PSVD}(u V*N>׉e[^_]USEtS,jSV[ ]UE t E] ]USEtSSG[XZ]UVSEu Ʋ9t t !ʉ11@u1[^]UWVS}] ?jWS" s jWV" wmj:V= ZYDžt?EPjhjjj jGP C8 }tUC8jVCP#" R. DJu <:tFu}Wjhjjj EPV0 C0E t/it.u#Wjhjjj j@P C4 }tC41e[^_]UWVS<}u tAu}*EPV[Z1@u0tC WPLZYt[u{1ۉ؍e[^_]UWVSSE{ su lZYSs F<t <t3KCtjRPQVsu ju$R{C~uN ufF tUPjjURWPVsu ju(C*WtE84%@1 u/t%SrZ@uh%SO qSnC@SCvfCDCCHSu @t CPCHC pSuCL1s@CX_Xƅ2e[^_]UWVS4] 1{ SB u%zu_vZEԃ v r u@)u;B.t/t, u'Er uu}tB }| KK9ruEtt 9st[ ؃4[^_]} UWVSƋ tC1ۅu)u%O Ƅ  1ۅut1ۅutӃuӃ u %1ۅuu[^_]UWVSljQ{ Zuh`'RÉEhn#EPm ZYtfP{ Xuh`'S[_LUj@PV? Uuh`'SsURj q7SQXe[^_]UWVSljӅt΀9u113j/Q ZY…tH@EEPjj jjj juG }t uh%-t SPZYuUUWVܷ ZYUuVhѸ%0ZYtB/1t7!Xe[^_]UWVSÉUQl YE>"ux"MFGVj趬XZt7t9}s7VS耬ZY1}u>t tCEM9tHM9MsuN\?~Vnt>0bt!# tt:xtBrt#   C  E R.MNMߋUDJt!U߈U~MDyu~~U}EjjEPX$  tE1ҊM΃0wGMLBu}t?jjEP$ t.S=~ttCEE}u$@t9E,1}XFe[^_]Åu À t t @ u1Ått u@ t1UVSQÉ֍EPjjjjjjR  }uȉjDZ~~1CtCHuCЍe[^]UWVSE։M؋ERw EYuh`'j=u _ZEu Vh`'h%u1?E}u [E܋EE1CEE8j=W ZY)9EuuuW uʃ}t'Vv ^tOWE[uXuFW É4$ EBU$W.ZYUMuh`'u[} DED1u3VBv _XjCPuO: uh`'yVY[41҉TMe[^_]UWVS]s {X1;s s WF,Xs1s s{$X1;s(s WF,Ys$1C(C$Ze[^_]UWVS,ljU؋E1=b$$^'E*@1$} $t uh%$;@2.tPXjM 11rXu 1#u1ۉh`'6Y#VQZtjM !^@t;thx%S ZYw#So1ۉ^c#@PYO#} 1# U -#} u#jM Zuh`'h0%t.u h=%u%" "} t% jM _u hZ%1 a"} C"H"<;"u As <P[^""} !h#u ZYudž!EPjjjjjju  }!u hh%!} !EPjhjjjju F }v!u h%]!} K!8M!jh%u u/E܋HL@ư`ijh%u A u/E܋PTư$E܋@DFNPpMju PWSuRUSu=ju MQWSu܋URSuju VWSu܋URSD u h%+ }  8 jh%u T u2E܋HL E؍`ojh%u u2E܋PTE؍'E܋@DNF0E؍FpMju PWSuRU~Rju MQWSu܋UR\Rju uWSu M 1'1} tjE 8tbj/P Y[Džt@j/Po _ZDžtM @t/O1!t1ۉ/ } EPjjjjjju . }u h% )jM EYu h޹%  T } luh%} Uj,u ' _ZDžtxu u h %89E u=E H j[u h`#Q 1ۅut%Ɔ EPjhjjjju , }t h%%ZO )ǍEPQM蛪 ZYHMu- 7: U艔) jY  T } E <4t E x4u  E 86tx6u @E @E 묃} zEPjjjjjju  }cu hY%} 8=LHM *L} j,u 贼 _Zt u P $Uj[Uu hu%RP 1ɉW藼}}} u ƇhkhU%u f ZYu ƇhLh%u G [^u Ƈh-h$u ( ZYu Ƈhu jy[^Pl裸ZYuh`'iXlu P>p^_} u Ɔ 1h2#u Y[u Ɔ |hE)&u w _Zu Ɔ  ]h%u X Y[th%u E _Zu Ɔ +u h%} t% jM n[u h%1   ~o} Q8Sjh%u u/E܋HL ư@ijh%u G u/E܋PTư$E܋@DFN0PMju PWSuRUJ?ju MQWSu܋URJj} <8>jh%u w u8E؋HE܋L @ư`xjh%u ) u8E؋PE܋Tư*E؋@E܋DNF0^PpMju PWuuRUIju MQWuu؋URlIju SWuu؋URKIju VWuu؋U} j=u 讷 ZYu h% @Ej hϺ%u  ud}u11҃uM6Sj hۺ%u u}u<1ۉ$jh%u ] u0}u 1ɉM1jh%u  tFjh%u  t0jh%u tjh%u }u(jP%U XZTEÅu h% @E؋M܍UE@u WM1ҍE@t WY#X3EPRU1EPU܍BP1EPU܍B8P1WURP)%$1ɋU jh1%u }u(jP$U ^_MM1ҍE@yW"[h1ɉMEPRU!1EPU܍BP1EPU܍B8P1WURPY$$1ɋU 9jh:%u tjhD%u uB}EPjjjjDjju觺 }duhI%Kj hX%u }uߋE j/u޳ _ZDžtGSuj/ HuNt>EPjhjjjjW  }u Guhe%ƆtGuh%!11Ƀ}U jUEM j/u  ZYuEjP`& PJM JM UEM j/u 莲 [_uEj P%  J M J M b} DITPM 6T*߃  % Ɓ QR󪍖 fFPfFSfFVfF^fdžƆ2Ɓ&E DžtGEM 1?j@P $$  JM E } u} 8jh%u uHLHjh%u uPT@Dju ƐVWQRP7A 8u h% }  $ɯu ^ $ZY h`'m}  4%1҅utu h%9FU m@u u hĻ%N K < - ! @   uhԻ%F EEӋ4%1҅utu} t h%\ڀE Lt @Z} t6j/u * [_DžtGEU N@uu h%/ 1,E؊EE19MtIk(P} u*t,]f9Xu#U8uU8PuU8Pu U8P AjE@P(  (,P,k4EfF} FEt'EEFEFEFF}t uF1~FH j/W ZYÅtCuWjY HtWh%1~_X f~ EPjjxjjjjSF } She%QF[^  }    @EԍD1HEԍL PEԍTXEԍ\E؋E1҉E1ɉ} u^ }t EX]ԃ E؃}  h.%}  EX$]ԍX(]؅uhT%}tlE ƅu u hq% EPjjjjjju 辱 }t u h%j FVE tMh%1E̋E ƅtFj:u [_t8URjhjjjj@PDEЃ 1ɉM܃}t)h%j=u 跪 [_E1҉UЅt@Eh`$u ZYu'E uh%qp3h<%u [_1ulE Itčphռ%u 诮ZYu. 5E uh޼%qphC`$u nY[u&E uh%뽍phs#u 5[Zu&E uh %넍ph%u ZYu πsh%u ޭY[u @Uh3#u [Zu Qh%%u 袭ZYu h1#u 脭Y[t1h%u q[Zu h%u SZYuh%u 8Y[uh%u [Zuh%u ZYu|h%u Y[u ah%u ̬[Zu@Fh#u 豬ZYu (h%u 蓬Y[u $h%u u[Zu h"%u WZYu @h %u 9Y[u @h%u [Zu h%u ZYuwhN%u Y[u\h*%u ǫ[Zu[h3%u 謫ZYu@h$u 葫Y[ t u h#%}tu h4%uXZ1E s!t@uhQ%NXs"}uhl%1[uu h%urBsthXc$SZYtSU Xu 1E؋Eȋ]ԋ }t&1ҋE9tE9S{IB,j,E@PQe uh`'V]ԉ]؋J k,1CC C$C(Ẻ{EЉCs }t"u _S׋u܉)1S׋E}t5E-}t }pEfE\} >h% `<"- } u 聀^udu h½%@d} E aDžt @khc%u | Y[M܉]t&h]%u W [Zthv%u D ZYu E܋U  E܋U%h%u Y[uGu h޽%Åt @Í0PWj Ht h%|h@&S _Zth%S ZY@yj[B 3}  jM _u h#%> @} EPjjjjjju  }u h*%} tyEPjjjjjju 襨 }tfu hC%P} tBEPjjjjjju n }t/u h]%WPT[uhu%ZY@1 S Xe[^_]UWVSEu} EEEE1ۉE싀a'tM܉UVP ZYUMtCnuFE샸a'uu u El$EEEEE}  a'EEe[^_]E8uu E%e[^_]e[^_]UWVS }]u1pC.} t[%`EUhX%u jjSǃ t:jWSƃ }tG9Et G99EuWS$W* e[^_]US]t"jjSs tu S@T06 ]US] UHSuZY9tS X1ۉ؋]UE PTuh]%h h'hhX% 2PuUWVSSljӉMBTx t41҅utSWYXu'S$ZtCP^1t<CT9FTuwFt ;CtulSVZYu_FttCttC8PF8PZYt>CPFPZYu+֋CT@$uFx9Cxuy%p%}u{?&ٸt[Ftr0tCtt&SjK6XYBuc 8t h%>XVj%6ZY@u_ 8t h%XSj6ZY@t9 8th%X1tEVWV Ee[^_]UWVSP}tDjjSƃ t)jVSE 9~TuVSiVo uӍe[^_]UVS E uh}&hg'hPTuh]%hg'hhX%$ 2uh%hg'h߃}uFƈPVXZt1SVuh%j uVv ى1Se[^]UWVS8uhxh']Shh'EPhh'}Wu WV8$thg'h%w_X14SV萞ZYujEPjEPe[^_]SVRZYt1xjjSqà jSEPXECT x t8jSYtC8PsT!<_Z@u h%豯YS;U t2C9t ;E !SEP_Z CTESPNjC|ZYtwG|tEuEGT9CTuG8PC8PZYuЀ{Yu Cx9GxuCXPGXPZYuWuW 8 /1z'1zuz uzu 1z1U幀U E]UWVSu] }uh`&hh'h{uhD%hh'h|h%_ Fu#<u;FuFPh$WS2p @u612WSPFDPgÃVWSPFP Ã؍e[^_]UWVS}] uhL%hh'huhX%hh'hh%費 GS8t)R78s<t<t1&vvRS Q. e[^_]UWVS(uuh%hh'hFE<t<FVU1QF1 G!)JO9tx dB@t8tM9r1=8}1ɿ}tAut]@}9s8 /`1ۀ=E5uU}ع1E׈EE5S}W<WV-thd%hh'h'h% E51ۉ؍e[^_]UVS]C<t<t /g S'؉U Y=E5t15E5S>Z;E th|%hh'hnh%g E5Ǎe[^]UEU uh%hh'huh&hh'hh% fPUWVEu uh%hh'huh&hh'hh%Ӹ fe^_]USi'tPh%m XZ]UWVSD1}]St[Z@j0S\1uuuu}WS\1;5]'s/]'H>v |  DF1;5]'s/]'H>v C  DFWS@\ 1҉u uSjE0EPpƃ S7[YEt 0e[^_]UVSuEPu V| uVjsV ZY@t؍e[^]Åt3UWVSƉ׉ˋtPWh%Vu 1Íe[^_]UWVSU} u19s$@u9s8uh%hi'hC؀xth%hi'hh%轶 u1W9s*jCPUq tًUGJ:N9s@u1Ѝe[^_]UWVS`։ϊB _`u1P`PnXZ `SqU X4%@1҅ut _t^Fh#Yu%Ph%S @/ Ph!%S @uWh-%S @ydhlh(%W YZu@ltDžplxDjVYZuGDžph7%W蕬 YZW腪 Z|6h?%Wn ZYuDžph%WN ZYh>#W9 ZYh%W$ ZYhX%W ZYyh#W ZYdhέ%W ZYOh%WЫ ZYpDžp Džp_t@F PhL%SU @pi'tPhY%S. @7@t pOdTX%u#Qhe%S @hVL6$&t 0$Ju%Phv%S @9vHh%S @!FPPh%Sr @v$h%SZ @V舨Ph%S>@~Pt?vtFQPhhtRE@ttRh%S @~xuF4%@1҅ 1hxh'tPtXY#FxPh%S @u(z u RuARPXQTtP@ZYT9Pth%Sj ZY@jjtPƒ ttqTjjP T9u-BTT Ph$SJj @T`jR뛉Th%h$Sj @Tu4jPSj$P @h%W諨 ZYu>dTX1҅u%#h(%W\ ZYh%WG ZYh>#W2 ZYh#W ZYh%W ZYthX%W Y_twpuhehxOpu VZ;pul/lxDpjV}Y_#%#Ph%S @Wh%S @VvtZ%u6u_%u*Ph%S @umt:u%u @t>(W&tY%uPh%S @u'h %S}_Z@pu^hh@hq PVhk%ST@dk%O@ugpll@LlqPPVhk%SY#@\puPhtfh@tYhqPVh6%SS@d6%pu,Vh6%S蚭 @1d u{puDt׃8tVYtËlpHpDVh6%S}"럃ptpuVS_ZPh$S @tXd 0uS SY^u hi'/Z#_tFP`P u,hi'X_Džp.؍e[^_]UVSË2\tPSKd e[^]UWVSQ} utu@GL%t >#Ht#}tE1@ۅt 1ۃu4t&xt HHt}tEP@uCWZt!CE}t7%EE@t]jWb[^t WYuu"Ep}t?%Eƃuًt 8u1W Zt^}t8EÃuˉ؍e[^_]UVS]u tPހ~t9d :jh%S uSh S蕠 \ZY9rhJ.~ X1e[^]UWVSEE} u |UGƃuh|i'蝘Y[jh %W] uu Ee[^_]E1҉UWPE Ph%%ԗEPƃuuhpi'hU# jEPVd @u $ 8thpi'h#ܗ1ɉM^_EuƒutSP虛 ZY} -];уM I+ѻ}hn#EP2 ZY;tjh%ST ujh%S= uu1;}1u1;} uJumo [EPjjjjjjSs }tG,9uSv 舚 ZYEPjjjjjjSs }u9G,nFu2mب d!umX1e[^_]UWVSM 1҃}twE8to1tA1]\t.u#]<uu'7t)Kt/@ t @B뼉)It tB[^_]UWVSEEEUE E܋]1ɉME9 1E؉EErE,@x Ƨ VuQ9uu诧 "E%?B ȃ}uz}E؁}E‹E9r봋E9UrE}DEt.O9Ms ? 7뎉ߋM_.MIE)M܋E9,}v M}}t ;]tC }uUUt;]tC } t}E[^_]UWVSu EEE}1ۋE9EeEEHes2 j' j'Gesy4EuyR.DBtes R.DB@t E\t-x)R.DBte/t M訥 M\u/t#w茥 7f\\t0v\0G0G0OttNGCt*tesUEu EZY[^_]UWVSÉ׉U7(ƍPSɔYZ@Wh$S6W @}uSj=D= _Z@u$p hW#SW @u@ s=Vu hV wXPj sVu Sn> Y s Vu Ss=ҁ uɣ V( t.Vu PhV@Vh$SshN$SZYsC1D0t<0u FuM  )sSP; Y_@u|u } 9K;} u@tPh"&Sj ; ^Z@u3tPh#SfU @G루tffPh"&t&ffPh#S+U @c t Ph"&@tPh#ST t%7/Ph$ST @sWj.VWjt tcVh$ST @tQ?tGuUWVC*P U[҃VSo_Zu VSo[^tRXZR軏YtPtˉrVSA_Zu VS貎ZYtX舚 /1 y ؍e[^_]UWVS,E̋A tӉ΀ytuA x1}ԍVx}W}ԉ}Z@$1FCt}ЉF tCUfCF t&EȀxu xtK|@Ft C8UF t CXUF0CxFftPEt虈_ZF tU tUȋECTt14~t K h!%EtCTZYuՃe[^_]UWVS8XCtP>YS_[1ZtEe[^]B[e[^]UWVSUu ]8Z>tǖ F1Dž@jB UPPfDž ˉhPhiUpu UJ>r*hPhipQu ,؍e[^_]UVS1ƅ@ CtDžC8P.^CP~ƋƒYu9Zu)CT@fCXP_u tt uC| t Cxt(1ɉ,uCTƅƅfDž1󫋅@p׉މ;tHH t2fDž f󥃅 ZupV耆XZtHHt'CstHHt0fDž f󥃅  t'CXsXtHH)fPR6 @؍eY[^_]aUWVSDžLDžP"1ۉTEXDž\1`1jjHVjjLP4Y@OHuWTY1CPW+QXZ$jjVSjLPX@u 8 넋H؉@D@9DDx9@s諏 DD9@r׉F u]dEuGuXu hs'wX?$RuhnPmpPC(PSZ뼋F1,1t zuB01$t$uG4h1 jSV襖fDžx,|Vhi@(if @u6 8t 81ths'h%nY^<< 4R0R,RSjP(e$4󥍽hr󥃽$t$j4PSƃ u6I 8t? 81ths'h%mXZ31 "4u5uSU ^_u1C YuCtP*ZSFX1ۉ؍e[^_]UWVS(]c{u'ss s(@ S1sSC ЉEԍENjuEEEE؋E܋uЃ9CrHuԋEƋM9MsMM̉MV3ZY{MԅUЉu}ԋEԉC} E܋}؍D8CC;Cr 1CCK%Ѝe[^_]UEEE EEPhgBu` UWVS`fy(u} u'󥾠t'Xҍ4uV`t'DžLDžPDžPhBS_ ;虀 .xt'DžLDžPjRS e[^_]UVS ]E fy(u/UEfEq*ufI.fMffEк11҉EUEEEEjEPs-%e[^]US]s's %DXZ]]DUE@u(1ҋEp@th~B Ep^ ZY@UWVSM}]utDw ` .E C[UU +29s0 "1.1U 1ۉ19t9u} A,[^_]UWVSSÉ1҅tލ<}})v ~tCf…t‰Z[^_]UWVSEӁcSct[~ V1E E1}}1EEEtHe{l}܍}u܋U9NQUt9Mu&} Ee{,}܍{l믍~}~MNM9Mr}ʀ}t}4u NɀMU;Uf}}tcuU9s;1t)ЉuRT>ZY}艇} u E苀MNjuu؉uUU} t] u3tMNjuE苀E}u | Ee[^_]USSӉʍMQM QMZYt }u1҉Ћ]USSӉʍMQM QMZYt }v1҉Ћ]USSӉʍMQM QMZYt}uȉ1҉Ћ]USS\t rXs\1C\ ]USS`t RXs`j#C` ]US]$S<>XZ]]E@UWVSRË1utOC><vGD&BTtt_9t;t1zT9yTu)1uuU@ U밋@븀{>v P ShT%b e[^_]UWVSÉ։h,j:ZYt:PǀcScufǀ,1e[^_]UWVS@ÉRiY@u Phl%aXZ.Gw*hH Phz%a th, Pj9_Xt@dtVWv<u?(9x u1Wt cScuGhu @G @(GH>A<wOw*󤋅% 1҅ut&x utmtdf@ tStJSjjPSU9Ѻrf‹fP@TȋG,D8ǀcSc_$tZDcScuQtu?Odt Ghu;Yt-fǀ2@$)f5XH~$t>~DcScu5tt,~<t )ڃf@6Vt4L7Pu"uJƃv9nC,m@1ɉ;D9s 8 ttBxrhуuL>t4L7Pu"uJƃv9C,VP)HFGWu*)؃qf9 ffC tHGY u<)9(CM A 󤋽 \ tC)9C= A󤋽 \wr sb@WuM tB)9iC< A 󤋵 \ttWH4%1҅u/u+@t@Zu)؃fPhPIƃ tjt jVC_ZP)9}QC t  CfCtKSVY^>t/t+V` Z@)9  CKttdt[%1҅ut)@^u)؃ftC t@)9rhC A 󤋽 \S)‰)=+wD@1,w,)Ѝ4? Ph%+X4 hAe[^_]UVS~\jh߿PF\ uFo 8u!5l6.h%WY[ Shv'hU#tW 1Sh jpK@uhv'h%?WXZ1e[^]UWVSMuh%hu'hh%h Ӌ}S OuO 0u싐1utXt Ctw qjSPC u3BC C^PP S@BSjuME"ZY@u 3~BCXSjuME^_@u C CS j3uMEZYtC Sj:uME^_t1ɉKSj;uME_Zt1sSj6uMEZYt1Ce[^_]UWVSu/h4j-ËXZ1C`CH%1CPsijhV%1҃utV0s^_ p11 % 1Y t/@P( ^ A %1҅u1utfpFPg( Y?V @ QP lpS@>p@P' Z W(P O>w*󤋅Ɓ1uTuP%1҅ut3 t)hRR@PP Ph%>@>u1DhRP*PP Ph4%Rhlu'RXe[^_]UWVS$Ɖ1iu1hH%7RfNJ.Xfth$SPXà 1GiPV Rh_%Qh$SP6~Ãuwj 8t8iW VhU#,R!w h`u' Vhu%R 1d4@1u$u j5SWY^@uƅS%Zu h`u'QX랍lj󤋅e[^_]UWVSS]Sj8_Zt,]t#8tCP%Zulj1e[^_]UWVS$ϋEE Eh%RZ ZYu}WƅPdX $$Xۋuhu'PYuQVhRSV-<@t-PyP XZuEu'e[^_]=P1ۍj6j4@uƅx,w n#j@,Ph@hW0u譬WPhn#薬WPhn#SVh%[N$vn#tE8%u)BPWVh% N(PWSVh%M ]e[^_][+UWVS] v'tPh# XZE1E;s31;Et k, 9t@v 6h% PV|G,1;uts 3h% PSVF,܍e[^_]UWVSEvpE E] P1}tEuSPh#%u @tBE^PPh%u @t E9sT;] us< v!e Juj ZY@u؍CT9Ube "uj[ ZY@te[^_]UWVSuE ]xKt t4SWhS"@u{Sh$VO Xte S7Ph$V @tuuVj ZYVj ZY@u@ud 1e[^_]USS]uEtBSuHPEPjZYu1}ufffDsD]UWVS4E 1҉U@hHMЋ@E؋E E@_tE@oE'EPjyMЋU؋E X^XtEd#,EPhMЋU؋E .Y[E%E4u1҉UMUu X1E1tENjM U)уȉEU~@uCtEPS萣EPCP胣EPC8PvSu  EE9w< v b #ЍzD9E7b "E@Tt 1ɉMEPj!MЋU؋E XZt؋]u1E9EFEtu ƔXu EEU9t M;At;A u1EEIʸy,%=t%=t 1tȉE@uGtEPW'EPGPEPG8P Wu趕 ]E@PEPjMЋU؋E Y^E41҉UU9u 譓XEEPW胡EPGPvEPG8PiWu ]뤋EԋE؉U%1҅u7u3E @hu$űE Ph% HEԁ Ee[^_]UWVS$]ƅj4uM^_@uƅExux uExl!W Pu h%u7@u1juMqZY@t+W3ƉP认Pu h%uڡ@tV)3Pu h%u贡@yjuMZY@t,E#pVGPu h'%us@ 3 PPu h<%uA@ut Ex,u@GhElPhhV4Vu hT%u$@ut 1;j@E,Ph@hVVu hc%u蟠$@uc;s WF,X鋃@1;Ds WF,Xh1;ls WʿF,X鋀13;⋍T9Pu{@D19t ;t_B,RPMUXZtu-Vdt&F$;BuFhuPSPG Ph%^?v$ݜSPG Ph%p?E苐84EЉU%1҅ut*FH(%h(%W蕦jEY8~HuJFt.Fhu(VJ9Hu~<t>t FH%FH%>u FH%FH%~0uF8F4eWhv4jE6WhMv8jE6(Wh:v0jE6v8v4G Ph%+>$~@u\EEЉU%1҅uY[^hEtGW4ZueE苐84EUt]hy%=jE6 >vHW7juW#*tFdFhӉe[^_]g__e[^_]g_UWVS EEE EEt uujjE5ZEE싀ƃ1ut{%1҅upul ! CiPE0wu@ t@{t:{<t4s$PE Ph %_EHT$%u@v'rt E:tQVC Ph*%:1uEPLt @v@}GLih9 ES2>ZYEE1}m5@N&EHT$%u@v'zt E:tVV$QWC PhG%=:MElE@eEEE@ht 1ɉMExdtj$PS& tڋE@$Et͋E@4%1҅uu h&&SY^Sjj01҉UuX}tSuuj@0e[^_]g_UmE]UWVS ]ESjj0Ghu/E$t#tShPj/E1u}}{ u}tEYPWh%6!$%u%QWh%6 ]e[^_]UVSuF Ph%6s b1C CCL ue[^]U幰E]UVS]tVwLShj.v$艓PC Ph%5 1FL]e[^]낍e[^]U7E]=UWVS]{ Wh,%5F0+F8PWhP%5ShjA.1F @tEi@Eu Ph=%0EPj>E1pLp d E1x xE܋ƃ1 utEe[^_]Ɓ1EP E}GG @EjEPuUJ cSc}܋]ԉu؉t t@tQDcScXEp$pEE@@[xYE@ cSctP@ E1p p_!E܋EԉU؁E@ uEEe[^_]cScuE܋% 1҅u΅uʋE;E1{L%1҅ut%u 1^uE Ph%-ZYE䋀ƃ1%1҅ut/s$ĊPE Phh%U-EEe[^_]E䃸C cScs$jPE Ph%,E1C<wPh*PBPݮ uhx  XTTu ~P1ҋPX#\ًP9 tW9r7OPh PhV%s TX#\PˋP9 / 9r̍oj5`hUZY@u ƅoATX\th Ph%(Y[ oX< uBHvW`Vh%W`Vh% duW`Vh:%%uW`VhJ%d1҉PLDžPPPTDpt;jP`h:Y[tW`Vh\%PPuDžPXT@6@t:tj6`h[Z@uW`Vhh%W`Vh%`hKƃ tPh Phs%&V:d8 h4%1҅u.u*ho%hdiPh0ڠhhdpPjh;d@Pud@Pi<wPC*PEP u%C PF Ph%KuMUd[뚍e[^_]UWVS8EE] }uP8Yt99s&}E EE u'E%e[^_]b)WPS nЃ<@_{ UfCfEf9>Eȃ(9E؉EċEEċPЉUfffM9f}DC E1ɋUȉʵfuwEċEԋEċ@Ef}tuC E܋CEEfEfEfE}uܹ1҉UЍMЍE eUfҋESftu yPE Ph% (fEfu)T3EPE+Xe[^_]UWVS$}E ^\ftPhu'hn% cCubh$RSU u#>t=G Phu'hU#EW*sPRWt^\ue[^_]UWVSE 0xjPu( uEu'e[^_]ËOwvwPw Sh %<uu؍e[^_]hx\uu؍e[^_]e[^_]UWVS`(É։ʍDž( 11DžDžDž,ftRhu'hn% t @`jVP" u hu'YVSzXZe[^_]UEM ‹]UM 1ҋE]UVSuV4Xt,sss Stttt:uj@苃t$P ǃ tPǃY%1Ze[^]W|$wUWVS }7tu PdYF><vu#%1҅uuF(fu  Ӂt1ۅu uuE0e[^_]g_hz ÉE1Em5@N&RR$F Ph/%VhnSjt(e[^_]g_UVS]Shnj|t~ht j3.fXZe[^]UWVS E} w]~tuE9{dfG PuF PhS%`VE1҉Pdh%VV *!GuE@ @;Gu}PasPF Pht%%1҃ut V[AV%1YuمtӨtW1~E84%u!uG]9C$uSh{dChTE胸,1ۅutEVZ1҅uEpE@]CO W؃~]CX{F$E}uEUҊM]脄tI_E@Ѐ8t HD)у@v , M@X@E}uE@H%j6cEpHVp{e[^_]UU1t )]UWUBvM, 0E 1ɉJI} ډу¸)Ј1_]UE1҅t3Ⱥy(t%=t1҉]USU MEttt9Xut9X []UEttPf1ҁ]USEttju S u[1]USEtt$ttP] 3#P uI1[]USEtt$ttP] 3#P uI1[]UE1tzhu 1zd]UVSEE t u wm^Qt u ]uTIhFhu t ?t61t0t,cScu=cSc =cSc[^]UWVSdEtE}?Ex 'Eu1E@$ hxh'EPLjju OÃ{E8uǀxhtxduh%hv'h*h%## hxh'uVLE@dZYx tWu[Xu1RK|EPdB#B E}WS}iE@d@ EWCPgiC9SV]jjEEPN jjEPNE }E8P\d_uqE0@Z^D$NjuuPZC| SEPq\juEPeNEuEPZY@E@$tvtguvZX1uuVSOhVCPEhE@dEPC8P/hE@dEPCXPh SEP[_Xu[jj}WMà SW#NsxC|ZY uC|E@dEPCXPgSu K9tSYS-WX떀{tjSu BMà uhSb_tߍC8EPb^ujju Mƃ t9tEuVdZYtF ~$1ɊT <2P@A"Puu9tjV븋E@EE\E1u}}G$tN}u>}Ghu5j}Ghu5jLZt tSpPx]UVSu8jjÉ^Xu h$w'UY1[1҉SCC ؍e[^]UVS]Cdƃ CdC`tChPC Ph% uGuAC Ph=%zY^KtPd sҀ(t h7%QgXZe[^]US]u:jYt'1҉@ǃǃǃ1҉Ћ]USPE]UURPDRptPQRP>RP*RuM UuU]UWS]U v0 119t@u1 gw'[_]UWVSUyv  u1΃y tËAdr@t$tt @$u@h[%DX؋UÅtF PSXFP}WWCPXFd@t Kth( u} WC8PWY_C9@VCXPWXZ؍e[^_]UWVSSƉMtGu[x|tGd} u@t1҉t H|PVJXZ?ˍe[^_]UWVSQEp1҃t<t19sAM1ɻ BAt }ut1ۅ}u@9s 8t1щZ[^_]UWVSE Eu}]Cfw EHfv f9]u1Ʌtd@w 1 w w w ?w xIÉEU)ЉE9}w "uu}u1EEftff@~jVC@P ‹u#StPWS]e[^_]뾍e[^_]UEttIt:t4x@u HAtx@uxDuxHu xLt@`uR1]US]jjS'ƒ ujjS]m ]UWVS} uEtCt=u{@uCAEPVTZYt$@u NtHUJNV^C‰؍e[^_]UWVS} 1EEEE3CdEu u%StVMQS2uCE䋀%u=tuuStPMQSjC@PE0 tK9Ht ESXESut URP'ZYSXu e[^_]UWVS} Et0tYuvtCPEPZY@t+C@3#Eu!CD3G#EuCH3G#Eu CL3G #Et뺉މe[^_]UVSEt0t.ttju CPPx t v1ۉ؍e[^]UWVSu ]ENj@t9pu9X t5j]Zuhw'$YpX 1҉W PG 1e[^_]UExuP u U ffP 1҉P]UU1zuJ u fB f]UWVS4UUuhj_ZoECCdUSǃt_{ u Pu uƃ C S@t@sdKQPuR[@u s{ u @t{ u j.EPC K{@u RURY^@s@{ 1UĊ  L @uj.EPC@Pjp tOSRPh#%j.ChP9 jC@Pu+ tP`S`Cdt  K`(Cdhv' SXZ1ۉ؍e[^_]UWVS$EEE EEU}uM M؋M$M܋M(MԅuEtLRPEY[8E(uZEЋEt2jWC@Pu uE܉C`}tp}ʃ}jVWu{Px{@u 1C$C {4s(E܉C`1E@CEX}CPt Nju Ȏ(CdE܀t CdtS` ttSX{@t4E4uSu!uSuu}uLSYMCAPu<{*Vhw'Wqq tVhw'W^q u S  C VvEU1Ejj@EPSƃ@$@ 1ɉM䋃%1҅ut6EPSFPF PF@P@u VE䉆F F@FFDf{(uXC><u,C*FHC+FIC,FJfFKC-FMC.FNC/FO%<uC*FHC.FLV/ VFHtVo eFHE8V@?jG@PRUo UuG`t7%1҅uuV 1ZiEGhPG Phr%>V} oj.FhPRj0 1E@F0EpjVt8;Cdt,Xp PjCPPCP@SF PtjR$če[^_]UWVSEtt?u[0tFdЩu1҉t Pu /Y_6ҋEt^tTCƅtDGPEPn8WRV^t @H KUQjsZYtUJ>t/@}wFH r*NjM;rC 1CUe[^_]&W|$wUWVS ue[^_]g_h; ƉE1Em5@N&RR$C Ph% ShMVj(e[^_]g_UU t,t9PuƀRhSjj&UUу1t.w 1#tRhLx'hV% UWVS 1ۉ]]] stqpCuCN@H9AHrot t]t tK{du~du?u~hu0C`P EF`PZY9E~FC3^R6t1EC7UtHJUPe[^_]UWVS81ۉ]]]E1u1EEE9CEׄCdt\URSTRP譖 t t0u5CPE Php%+1ɉKd EEt9sEsxF URV4RP; t tlVdtRNh%tV%QPF Ph%Vj_@u 81t 8t h,x'Z1F$F fdEt9sE6NEtXMPF$Pv苕 t t1F0PC Ph%V tPVujSTRPEċCPEЋCL }ffMM9Ms KMɉMMԃщu2@uj}t}u^}vXU؋PU}vEUPUt6ut#9Usu)t9s M EEu)u(}uƃEȃ}v1ɺ>]4tuhPWjE}t?E Ph%EEZjE0"h?%u:e[^_]UUt&t9PutƀU]a]UWVS}u1-0t9~t6^xtuu S u؍e[^_]UVSEu1(0t^xtuu S^ u6ډ؍e[^]UWVSu}t9suCxU u1[^_]UWVSSu10EɮEP1ZYtU9pu 1ɺ]GEttu4@t$P躑ǃ e[^_]US]t9XuPxtJd8t 1[]UMU t t9Huut xdt1]USMU t3t-9Huu쀸uX`ty @tѲ1҉[]UWVS@EPj$?E _X1EE 9CEuh%j uVo CPVh%u* @uosXsTVh%u*@tuuVh%u*@tCtPVh%uw*@tC`PC`^Ed#tEE%"t d#Au]$d# t]#d#@tR$d#y?#uRWVQuVh%u) @&sdVh*%u)@ C1C;s WAIF,Z拀H1C;Ls WIF,XCPECLE}EfE9Es% SM@ukHL1}9t 98t(A, 1M9t39tF,}čOQ}OQhEPB PEPu2E UU)U0sx1t8Fd%u'~ t!GFhPWEPh9%ui(@6ċ?e[^_]UVSu Ft%tF9CuuVCxPuݍe[^]UVS]Sjj1҅t#09XuƀلtKj3n%Y^u=t h?%S4XZe[^]UWVS} 71ۉff}fuEfǀ<| 1҉1ЉЃEu.Ef}w 0z'Ph%j ]S~ 1:BUP XۋUuhy'XߋMDغuf}f9<t >tuă PVh%R蕷SEf]f< 18f}uVh%}ȃlȎ(Y[Eċ4%1҅utjXZE΍e[^_]UWVSSƋ1;,k(Kfu{u#{u{ u {u{t]fuCUhPCPVUt1ǀ Kf1ɉHG[e[^_]UWVShEw{ E@EEEE@|tXdÀuXdBEAE1ɉMM}Ef9UrZ9]s# E Ph7%¶XZu<}])Ӊ]ff}ftftfu f9s# E PhK%Y_XLʍ]ĉu)fEE,19t.kM(Mf9HuUjSP*; UtLF΅uE4%@1҅u/u+j EPjEPGsPE Phc%;f}tHuΉuȋ]ˉ]̅t<9s8j EPjEPruSVPE Ph%D(b1ủuEEPM1ҋEPE[tE-Eƀ>f}uEȅEEEPjuWƃiUЍ M))Ufw# E Ph%谴ZY%EܹEȉEUʉU9s* uuE Ph%QEX|ۍEtjPS׷ u`jhPuhǀEfEĉ{(u 1ECECdu%Cd{4u EC$U9S tKdS t};sC t u9FhsFhE}{}uuE Ph%6 Tf}t21u~`}W9rF`E̅t}OdMQ9rGdE}uE؉EEe[^_]UWVSljUMu w@ Ph% 1҉u1ɋUYt E1ɉKhKdK`ǃu uVj XZƃ>VuMUZYuC;u}tG Ph0%G[^덋SDtKHtƃ>VuZYtȍe[^_]USUE M]v]ɉME BE[] 1[]UWVS ÉUM苰EPjRQRtBf}u;8ύG=DQK wWF(1RPQhQ%~(WQhk%j EPjSuuAtBf}u;8ύG=DQK wWF,1RPQh%蠰~,WQh% e[^_]W|$wUWVS4E؉UЋuC|t @du'E!Eu@)ЉEEƃ@%}tQuЋE؃ Ph%ub18ujjE؋謨EPj$`x'8u ǃ8%EPj s@s<Qtf}uʁXsXS`1CdChǃF8u ǃ8%8u ǃ8%8u ǃ8%8u ǃ8%{`tps|t8Fdu.S`F !AtH9sFhPE؃ Ph% 16ċC`tPE؃ Ph"%1CdC` u9t.E1Em N&}fEހ fEm}mދEȉC`{duEt:E1Em N&}fEހ fEm}mދEȉCd ǃ8K%}Eǃ;uCTt>}t8sLъCDCLCHCPCFd rFV t#tFhPF Ph% 1F$upFhPF PhT% Vd s"1F$F VjjF蝤-NtHN rV裰XVBYHC`;}؍w u PVhn%MuVh%,KdSh tRQPVh%u跪)uVh%u蠪 RVhP%u茪jE0XZ}uA}t;WVh%sHsDhWE0% @u Wh%7^_E؋^|tFCdҀ t ujC@Ps tKd Cd uًE؃ Ph%sw8uE0 E؋041ۅu2u.}؋1ۅut$%1҅uuj\Y[XZ렍e[^_]g_W|$wUWVS,h1Džh#fDžBDž<"#K8Qff@,u1siS0,G$u u iSS0S ti;S0sS0udR Yd{u1ɋS0)@N& ڽ 1$߭ ٽ2f2 f0٭0߽ ٭2 Љ ,茪Z{ 1߭5@N&u +t d#u¹%ݝC4HH H¸#%݅u%+t %WW$VQ RP, PhR%#,{t 1s,薩Y6Pjs8s4Wf6tj ,TVjdXZGu 1a8RPVvljփ 9иr781kddȃ9ƾsff+tST1󫋅,@EUUE E)E.E d}TjEPKc @u, Phy'h% C@Cto ?9sS0S9su,S$t%,R jŜP, Ph%d e[^_]g_UE]UE]U$E]U5E]UFE]UWE]UhE]UEyyuj]zU庛E]i twUWVS 1tx 4 u1ۋM9s3ru2u\tffW׋uUuƅtfC [^_]1UWVS@D@H@4tPH1҉P4YH8 w$xx'ƅ< dƅ<;  ƅ< Bƅ<ƅ<0ƅ<ƅ<D 4u:ƅ<D8%1҅ut,Dž41DhP  14H,X@(fDž11,,9(DPDT19tk,<>98tB9rIpr@uDtDu f,,ht1(4tj(\ZYDu" t\1(fDžD,0% 1҅ut#j@wPB$t @pt1$Dx@1ƋH8G 5bu`(uHX<@D&v P PhT%՜ HP4BbCD_Zu hy'Y#Nj󤋅CH_1҉tjhj|PtP6-sD/j1CDCH| e[^_]UWVS] E1E;s31;Et k,9 t@v 6h%kT PV=G,1;uts 3h%ET PSF,܍e[^_]UE@|tPd(t1]USEu1X|tuu SC u؋]UVSEt0t-uvX|tuu S u1ۉ؍e[^]1UWVS} G@4j.DVCPjw 4wVh% ~}tE@<"jWu茙< u hy'G8@Pj48Ƌ<% 1҃utjtHuƅ0eDP< Ph2%]j jve[^_] e[^_]UWVS]u t~wtFuu SHt1ujS߬ZYuNjt w1rh묋0t_1[tt1thDjUY_@(@,1҉P|P|0fǀ<fǀ?SjhPjjS8u"C Phf%|ShSƉSaXЍe[^_]UEtQw]UM E]UWVS É׉M苐t 48UMtSjjPt u E ShZt~8 1pp@1x xx$@u Shx'hU#{:SjY(h%SXZP3YXt jjW|P;t j3XZvLWFDFLVHVP1҉VDVHYt=t8EU%u=t}uE%uS4ZYvLWv4WvPhG%= YX؃t w t u F19tAE9uuUM7Ph"&*= XZUM΃^Ѝe[^_]UhJ.hK%j 3 4J5(J5t9W|$wUWVSHJ51B(J515x6.% J7fj7 s fLJ5/sfLJ5 s/fLJ5fI5fNJ5XJ5tJ7 erIHJ5@J5ffLJ5fNJ5=J5tijEP1 EȣPJ5EȣTJ5ZYFIJ5LJ5HJ5 8J5F hF%AFfVRVRPWSPh`%9 j.]SFPjX] uj.h#Sԙ Sh%j9 j.SFPj(] uj.h#S褙 SAF^(ZU)ڃ<,wJ<w1tR<CSPSPh%<+h%"<:tI<%yRhQ%Rh`%$ YXtj, $ hg%$ XZ)P\uj,# hp%$ _XRT@9@8j,# VT@Phx%{$ j7P!PWh$O$ T <x2<w><tG<T@8Ph%P ${'<rT@<w*$4{'h%Bh%;h%4hY$-h$&Ph%,T@t <uh$h5%T+^ PhK%q# Y[THFhh%L# T@Z<t%w uh|%<uh%h%# _h%Ph%# [^T@8Ph%" THjh%h %h%h#%h3%h%hA%}hV%shl%ih%@*j.STPjF uj.h#S虂 Sh%/" j.STPjE uj.h#Sc Sh%h%! hn#! T@f8fZYfw2$H{'h%h%h%h%h%h%zuh%nh%h%k! S1ɋHQ t Shr$h*%&uj.VSjD h4%! [h>% hn# T@fHfZYfw-$\{'h%!h%h%h% h%h% Xj7t-T@<m44|'h!#Ph$e ^_j7 j7uhJ.> [g v狝t݃{)!C2t!#t1 hU%3the% C Yhu% C HC SRRPC Ph% HlǃxPh% XZ h%t XCPh%d Y^19~gVH mYZuVh%? XZCj.RPjB uj.h#Rl PVh% F땋L 9؋4J50J5t9~~j7 qm0J50t 90P UWVS]u#j7tP3^1ۉj7j7S^ j7@$#+j7Yuo U1҉j75R.t:C@;:uS tD~@tB\u JDN@uǀ:u‰1e[^_]UWVSU}tIB<:u1ɍ4 E  8uAu t<@t:u <:tu9uF~@u1[^_]UE6.]USE] u|À:u%u@C8t9EsH:tt @|u1[]UWVS4}!}u[=j7tQu Wn[^u<5j7P)YtHWP D3XZhY)^1u?Cm Dž)Etw}xjjjuTL !jh@PE xDž1ɉ1ދ9rqhQuƒ ?tuZEl 0S08l 0HЀ u%V1Iu8:ut+<Dž\t-Dž t t11:uΉ1҉V9r)ډ)ށVSv,ZYu"S/^u[Ɖ‰.1<#kcu SZYPFS7/XDž6.M1j=hx%&S ƊtV:t֍HX)ىMAQPuVË tF}t uXWi.^KtF:^Dž@DžtB<:uЋ))ˍ x:t:C؋)ȉ)9))))QW_*ZYu:W-Xt uXr-i _<ljljƉlj )PVQ8 SR% ,Ymt u ^)؍P9s&PSD)ZYuS,'h XË Dže[^_]UPUjujM EUj7tP95 1҉j7Y1j7j7j71UWVS1=j7uE j7=j7uYhSo%j70s j7^_u=`P5j7kY[t?Duz1=j7j7t=j7uj7j7u@ @uPV4 1j7j7Pj7@Zu 1ShSo%PAًR.TZ:u#t =j7t|0\Nj7G|0\u j7P1ɍt:uf:Y\tAߍP5j72Y^u'j7tB @R_3 1j7ZD돁NJÀ|u :t@PFjWjM EÍ@ wCe[^_]UVS]u wu ][^]UWVS j=u uy ljd![Edu!e l8]EdUru<:<^uFG<:wMu})ߍGdPS%ZYuS([w<\ůG<:HЀw+1ɉMF0MȉE9t HЀvE농w1e[^_]UPEPhh r7h@v7uƒ1uEUWVS} uLu7uuW1ɋU à =$v7u u1Ɖ>1e[^_]UPEPhh r7h@v7uƒ1uEÍP Љ ‰ Љ ‰ @UWVSQBJ Mؙ#߉1I wEZ[^_]UE @ U+B ]UM UA+Bu)]UE +E]UWVS(ƉыXB1x}É)M1ENjEE׍9rסv7EСv7E=vEiẺMԋEA1PUÉ)‰UM1E‹EЉE܋E؉E]؋U܍9r9Mr(}v k=9s}E܉EEE놋EԉFEFEF ~$Eԃ([^_]UWVSU} u]RH $URjWG $WjVG $Vj$SG ZE] Ee[^_]UVS@ÉjjjQjRP tNtL9tHVP ZY@u: X j@]S0KiV huDC[^]áv7uÀ=w74UWVSR DžDžDžjjPhw7jP-@u w7 v7Pv71 @Hv71t3tShPh7%h t!Ƅ9hH%jXu ƅ葅 t5tv7u v7FtB<97$|'v7}v7}v7~v7~v7볡6. v7Q9}H 6.@6.|v7|v7w6.iH6. v7Q9P@6.E6.7H6. v7Q9@6.{v7{v7zv7zv7yv7yv7xv7xv7ƅN hZ#RhW%P6.G P =|v7t h Y=6.6.9}6.׸Év7 v7 v7r5v7v7v7)I v7v7Pv7tPv7 6.v7Bv7 v7Љv74v7#5v7t@v7)‰v7={v7t*1҉j Ph "- h~'hv7rjdv7v7v7h~'hv7q11v7w7lãv7u&w7 1tw71e[^_]1À=w7u1áv7u v7UWVS@É;v7;v7j¡v7_9u739u0PrY;v7u;v7)v7v7jVS` 19Z;P v7PPhv7r=v7XZVS޹ Y_@u:eM j@}W0^K hD=}v7tMjRP_ M95v7sxu@)lj|| >;v7Fs"J| u| | DT>| T 9Ss$EExSWrED CSWp;sss{uISC PrXZ=}v7uE@,t v7EX,v7؍e[^_]e[^_]UWVSƉȋ} 1ۃ9t yYC v7‰ى[^_]UWVS¡v7!9t> v7)su܋tu 9t)D @!u܋D UEPhv7kn@ZYe[^_]UWVSQӋv7!‹ v7)tu)ߍ41Ƀ9t ^NAt#\| DuD0| DJX[^_]UWVS Eܡv7Ћu!9`x }؋ v7)‰Wt~v7]ׅu9])Ës V}t Z}܉E)+F$Iׅu0w ?~'w?~'"1w}'1;SsS |C@C;Fu ;u1ɉHt SFP=pXZNZH9t9sxt PFPmY_SVmXZxT }t Z}܉ыU܋E؍e[^_]%E܉EEPhv7[lPhv7o=~v7t KZ{ SC v7v7e[^_]UWVS9v7tv79kjjhv7nǃ t؋_ jWhv7nEWhv7ov7=v7;v7r;v7rw1ɉÅuj}먋 v71ÅuP=v7@u1jNjv7!‰)[9tP}v7Y9uō3v7t]EPhv7okXZt>G 9r7 39s0jWhv7mEWhv7>nv7=v7}뾉؍e[^_]UWVSÉU v7EC1t}9xts@Ƌuzơv7EF}}1U9s hd#hd#h%P6.0 E011ۀ={v7t!1EEEuj EPh "T ؍e[^_]UWVS ]} ɉƅu=zv7uxt!tn 1f1ut uU95v7r]Åu(2Åt%=~v7u;v7rJ;v7sB1߉81=yv7t = hd#hd#h(%P6. -? 1ۀ={v7t1Eu]j EPh "@ ؍e[^_]UWVS} u'=zv7t}E'E }E&Eܡv7;E v79U s=9UE 1 AE1 @9Ov7;E r.9UrBu9r;v7Ӌ 6.U !!9u9sv7U !9tRU ÅE9E s =~v7uBE;E sZ=xv7tQWv7ҋu9s[E ؍ 1ȅuM9u s=~v7t+M UU Z(=xv7tE;E r]M E)U1ЅEv79Erv79Eu !։UEEEPhv7Y`Phv7cv7PVjEËU!SuÃ$uWhv7\aY[[wG Whv7GaXZ=~v7tE9E s+u U ڰZ#E;E =xv7M )1zE Åt9v7EuE܉ߋu9E s M ߋuMEOt)=yv7t0: hd#hd#hU%P6. E Åu; 1ۀ={v7t"EEE E]j EPh " ؍e[^_]US ]={v7t]1EEj EPh " t ؋]]UE]ø6.ø6.UUR.fDP]UUR.fDP]UUR.fDP%]UUR.fDP]UUR.fDP]UUR.fDP]UUR.fDP]UUR.fDP%]UUR.fDP ]UUR.fDP@]UUR.fDP%]UUR.fDP%]UME 1҅tt1Ҁ8‰]UEU ]UEU ]UE]UE]UE]UE]UMU 19t <t@]1UWVSuE 81ۍujPVXt C9]s؍e[^_]USUE 1 t @B9Es[]ڡP.U*UEE]UVSME ًpVPy;P| uE ][^] r0 [^]nUS4'u6* ZYuC u1]UUE H w U']1]UU1t <t@]UU1t tE ]UEtR.fDBf%f]UEM tt 9t1]USUM 19Et @[]UUR.DP]UUR.DP]UVS]t%;ud#d#7 0sPVSh%hJ.; e[^]UU 1}w7.t 1:u7.]Ud#}3uXd#]US1ɋE]  Xw Zw 8u Au1 8s[]UWVSUM E0E$]E:t*E]$E0EM Ue[^_] 1($t$?(Rug`@'(0u` 'u_vlj``ӃtA`80 1,1ҍ401󫋅,D't ;C4,h'8,'t,hP@VDV$ H1< t4  ,`,/ujtfG u>1k`;D't @u-$@'@' sjtt4 0@p00uHP@$u1S$0t9(sz4 *\p0믋H@9(s(0띍e[^_]UU%;|(sR.]UU%%;(s4D.]øUS] uShJ.^ h"S誯t3 0Phq$hJ.U hJ.j lXZEJ.]/ UEPu u UEPuus UEUUE ]YUEPuuG UEUUE ]-øUEPuu UEEEE ]UEPuu UEEEE ]UEPuu UEEEE ]11UUE t]USPEtPt i2 )wu PEPà Et :2 1]UWVS ‹@E졐R.E11 =E}9s%9]D{t}tk Y DFɅt}uzuB w7Bw7 [^_]Ã-UWVSQэX011`xwG0w(XtVWh.t0tyw HutY9}1OM‰"tZM3`tt t$@t39}ǍÃZ[^_]UQEEUEEPEPÃxuUSˋ@ ى[]ÃxuPw7@w79Ps=UVSÉjRpg u 1 Cse[^]øÃxu;UWVSÉ׉΋P9PsSCHK 4BRu[^_]US]E xtK1ɺ C H @([]US];Cs 8^u@1ɺlC H @$[]UWVSuxu^ËxFS<L$9rAL$LL9rALL@ u CP PD PF C< e[^_]UWVSË@E)щMt2֋Sʉ|t SC} 4ECEZY[^_]UWVSWÉ։ϋEEK{~uU~}uЃK$ 'sOA)VxVukK)K)a1ɺCPAY^y)Vx>K)K)1ɺpCPMVWMZA)VHXK)P؍e[^_]M Od؍e[^_]ue[^_]UWVSSlj=P.t9s?MjC,@Ps(c Mu e[^_]C(S,z{,f P{<tgFR.0=P.u9sR.0=P.u9se[^_]UWVSfU0H9s*P9rfzf;}ux]u)E 7.HuVQM t uMQ ZM9ufG}uf 1e[^_]UVSËK9s P9r"G{uCCw7 w7w7'8[u"x.u.K9r !f3r9s:.u z]u{uCw7Cw7[^]èu'B R.fAf`f' ЃðUWVS É։1E!ЈECE1EEt URSYXS9sYKu{tt/t$H9rEPSS|EEр8\u!x|u(8|u!u9H9s9u@9ut URSXZ{ u"E9Cu{uCw7Cw7{tCuE׋S1ɉM؋}t 9s(H9s!8\ux|uE9s8|u@}}u }t9rm}u$Eܹ)KPxE܉EEXK+MKAEU)щ>CE1ɺE`}~!UK)щ K+M|e[^_]US1u4ݠ' ZYuCC u1]UUE ft҉UŜ']1]UWVSSɾ=P.t9rC,E5R.=R.113C8wC(H{<t@f;t9f;t3AE9uf9s419tK0 f;|f;Q~ @1 1{8C pPW&ZYuF;s$rC8e[^_]UWVS Ë0F;CsGjh;%V u 1ɺjhB%V u1ɺ,S j@B@Pr E^ u ؍e[^_]oK A QrqЉE1}C @t E@<S9sQ8^u@}G89s;]u @]r-u%@-c-u:~] 3C9]xN9rƀ-tЀ[t+K9ȉ}PM؋U 9sъV:t =|뾃39r{uCw7Cw7w7<-t<]u{uCw7Cw7w7CE؋ R.Ћ}9sB8Dyt)w"U׉DR^1Efu+`9}8uQMZYMt U=Fθ=P.u˸jE@$E@PEp 5\ u fMA Q$JuN$f8-P9x]x-t A -f9k=P.vNf9~;{uC w7Cw7ff9UPF΃=P.uމEa~{uC w7Cw71E7* UFup>-uF3-U;Cr{uC P8]u w7Cw7{Ex8tC @tEHfE1P.u9}~Ju9sE8}3G8GEx<t4t fEfu-GR.8EuޡR.8EuFff}t)Ex,x4u|x$uvx<up@(ffEf}t^U܉C P U܋pEp(gEp0\Ep Q1}U܍D2 9EuGC H?C M+H 0؍e[^_]x]%x]Xe[^_]UWVS$@ @tbF R.f tNt R. t< R.ff9t-;sEщUfE]EӉC;s$[^_]É؃$[^_]8UWVS ]CEx;0\t [uE;{r{uCCw7w7GƁ)ul*.C @t,SUEECE^ ]7;US1ɺ(?>+9<u31ɺ1`E xt{uC w7Cw7{xtCxNt  pS9UMH}*ua CHE)PH;KE)PCHE)PXKE)`Z[^9}\x{ƋK9sI:,uDz;9s6JR.DJt%9~{uC w7Cw7PU4SY9s3H9s8\ux}u3@9r9r x\u8}u {uC 1U$J(t8I08 {]"1ɺS B@xz@ wML(hS9s#H9s 8\ux)t)\b wCDLpS9sH9s8\ux)u {uCw7Cw7<t60E8UOdBZM@5 C @DIe[^_]UWVS ]x;s?SB< $p'^[m\p{|;{r{uCw7Cw7S B@xz@ wt(hW;Cs8)t~) wCDLp ;Cr{uC P8)uw7Cw7 1E 1ɺC H @$E1ɺ C H @(븺 몋C @t,SUEECE^ ];US|1ɺ(Kg;{r{uCCw7w7Gu1ɺ1ɺCxVu{] {}9Az։vM?tH{'xM9sxM R.Dyu},t{uC Cw7w7@}t{uC w7Cw7?tx*KuNA)VHK)P CH)VXK)`_X"A)VHpK)P^CH)VxOK)K)1ɺCP^^Nj;SsE:,u@BJR.DJt%9~{uC w7Cw7PaSY9s8}u@&@x}t9r{uC ^{9s9r։v!?t{u#P9sPR.DPt 1e[^_]UWVS} UҀcE tEp9J) WW ZjLXt3SUUw$@@EjP|1ɉMZYuS Z ]lp1tEEU1}EEuEDžh1#1DžhDžxEEMU싅hE1C C{1҉S S$S(S,C01ɉK4K8K ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89a;wXR.DJu _?9wu G9w 'NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qERGPx u )MuMA}dM)ыU9uG PV;w @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMB^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM{Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM} MƋ]U9UE@EEM %=p=8pwL= 3w$==Sf=|=(4=05*=Xw =H =P<=@=`=h=wE=w=xE=D==fzk=tlw=t#=t1z=ofwWf98f=|TEsf>E]fy%Nf<f%fUB CE!! ؉ʁU! ˅EHU)ЉEM~! d!EtkEȋUt %AE8! ؁UUÁt!! E=؃[^_]UWVS0ƉUMȋEE܊E܈EF(E؋F0EиMjPh{PM U}tEؿ]9^ t9^u Ft}]Љ]̀}t]؉]1ɉM]9^tf]E fE1҉Uԋ]9u }t]]f uRUufuFuJ$M~1ۉ]1f} uBu"1҉U1f}Ff~u|}R(U1ɉMfu1҉UFu EEf}u FuME}t#ˉMuPuPM UkMuf~t#fWҋ R.Qu?f_t9f}fMQҋ R.Qu f}_zftQ R.WQu f_kf}t)f}xfUBQVf}_KyuPSPM UftOf}tgR.OJf_ f}_Zf_ 8u_CfCU R.DQuf}_f}u2ы R.DQu f_tuPhwPM UŠM t }u@}}]9]t:}9t3uuURPM U]]f} EF}toEF1ۉ]t`E@EWfzfzfz+f1ɉMf} /1Ee[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰9EtMICjVSMU WVSjuSUEju uM‰q9EtMICEEjVSMUK tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMU 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA g9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYR.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVKg @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSEUM܋}uE fEӋU9UE@EME%=p=8wN= Bw&==fEf=|*=(F=0Hg=XSw =H=PM=@=`=h=wF=w=xW=q==f}zw=txw=t(=t8=f}wdUf9U?fEf=|E~fEffnEffEff}yRTfEff>@/1f}&(f}UEMA @ MMًU)M ЋUEHU)ЉETMڊEtwMMсt ڍDU7DE%EMȋMI tE؊DEC[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹}ƒ}t H}܉E9C t9CuCtEx1EE9CtffEE fE1EԀ}t!puRU;a UuEEf u@Eu<fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t#f R.DAu;f_t5f}E R.DAu f}_fEzftOR.DHu f_f}}t&f}MDHf}_fEyuREPRM UPƒftWf}toɡR.DHf_ uR.Dpf}_Ɖ 8uaCf7E R.DAuf}_f}u4 R.DAu"f_tuRhwRM Uƒu ր>t}EEHQMuRU^ U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zsf}zbf}zQfI1Eef} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰n9EtMICjVSMUN WVSjuSU,Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUl 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVS0ÉUMȋEE؊E؈ES(C,E܋C4EЋC0E̋H1EjRh{RM ‹Pƒ}t H}܉E9C t9CuCtEx1EE9CtfEE fE1EԀ}t!puRUZ UuEEf u@Eu4fuCu p$fE~1fEf} u@u#1fEf}Cf}~ufE|fE}p(1Efu1ɉMCuFEf}u CuMFt$EEuRuRM UƒNuf}~t!fG R.AuE R.DAuf}_f}u4 R.DAu"f_tuRhwRM Uzƒu ր>t}EEHQMuRUzW U9UtUtQ}̋U֋MH׀}tuuuREPűM U‹uuf}}twEC1҉U>tgE@E^f}zzf}zif}zXfQ1Emf} fEEe[^_]UWVSljM]U;] HEXtxt/Ht suFƁލNMXu.ދt %FEAXw80tYwE@E(t<5MH$pxhEE@EMjuSUEju uM‰w9EtMICjVSMUW WVSjuSU5Eju uM‰9EtMICEEjVSMU tMM9tEVSMUMjuSUEju uM‰9EtMIˍs@M%\jSVMUu 9Et(Ss@Ӌ%=uKSVMUXZ=%GU+W Pb%GU+W PP CEE]FEe[^_]UWVSlj։ME 9EE@EEE]%=wF=(w"== =tf=0t}=`&=w"=,=tn===;k9uu1<Ff99utF9utFMA 9wuGG9wuG99wu Gi9w s;ws~ uE@eG9t9l> ދG9 R.fTQffUu<_p9wu G9w s^DYu _< u ]Cuf}<_9wNR.DJ_bR.9wuDJu _FfDB9wufu _bDZÀ>_ f_ 89b;wYR.DJu _@9wu G9w (NDJ_ G9uG9< u ]CЋ R.DQEED%EEMulMAMMAM=X=Xw=H =P =8t5!=p=x0=h%qESGPx u )MuMA}dM)ыU9uG PVO @ڋE]E9uEƋEEEEuuu uM%EEG]4븋GM90t.0uuu E)PMC^Mu%]\uuSuM '@ SUT\%=uK똁G؋HUM+W Puuu uM|Wu}4|G؋PH UM+W PP uuu uMu;Wu}t| (9uE9< e[^_]UWVSlE} UE8e p >E F E ЃEF@EFEF=P.lt1ۉ]tMEAEWX YE}M9MP F,EF4EtpF8EtfFu}D$ Ġ[^_]ËphOldunu E $= Ġ[^_]Ëhld<D$,hD$<$9D$lD$<$ D$,hD$<$D$gD$<$D$,hD$<$D$D$<$d9M`D$_D$t<$a`u!phD$,hD$<$'UWVS' } uttEE*hEEEED$E$oQ…PEt /ĸ [^_]ÉUD$ED$$:EDžDžDžDžjDžUDžDžDž W}׉ƍWOt%%VF9rى׉ƍWOuۋ})9U ĸ [^_]ËE@fEEDžDžUD$ D$D$D$ D$D$E$UMDžDžDžDžDžUE@fE@fMIL$D$ D$D$$yo t$ D$D$ 4$Uo EDžDžDžUE@MIMI Ɖȉ } Dž UE$D$D$4$?D$:4$ U H9EDžDžDžDžDžDžDžDžE@fEEDžDžW19ĸ [^_]øzR%Kwҋ>V9s%u9sF?V?r95+ .hNv.&.&N9sVu鋽 Ex[U DEED$ED$$UU}ĉ|$T$E$ܮ ƃtdE$8 ƃt'D$ED$$hU1҃ډ蘯 MD$|$E${ w Mm 8D$ED$$UK 8t[^_]: UWVSP oDž/devDž/XtyDžyXXD$h$Ut-ƍD$D$FtH4$ 4$oVD$D$ D$D$$N@Džrhp0ƅpD$D$<$TƅtfL$D$<$XuD$<$Xtg$bUnC| P [^_]a 8u)΃wΉ<$;VuD$D$<$S`TEE ut|$E$ BUt#ED$D$ $EtED$D$gt $ˋ 1P [^_]DžUVS ÛED$ED$ E D$ED$E$tK"A ƃt?uE$SE$6:[^]ËEUE$S[^]þUVS % L L; D$D$$v t@ $Q ǃ L$ SǃLƃ 1 [^]+ 0ǃ L$RǃLƃ t 0ǃ $RǃLƃ 迪 UWVS< uD$/4$n D$@4$GQƃ%D$T$$P6 4$QƄ=D$D$D$D$ D$D$ D$$ tVuw: ul<[^_]À uM1 Ɖt$)XD$ hD$D$4$W =X ? @ UVS tu 3D$/4$m "Lt$ $+  D$D$L$s cD$ D$D$L$ۇ !Ѓ2 D$D$L$ۙ1[^]_LRD$D$%@4$NLD$t$ $4 d Ɖt$)XD$ hD$D$4$PU =苧 ?G$@R tƃ QW 8#u͉4$ƃ : * 0_ 0UE$]ffffffffffffffffUWVS$A &E@ E։υU };EE EU D$T$ $""""D$"""@9rlMϋE eʉ)M]E@}UPp]uXhpl$[^_]ø""""9"""s1$[^_]É1ʉEUE };EE EU D$T$ $""""D$"""?]u9rM΋E eʉ)Ήރ߉u}U1M E#E }T$L$ $""""D$"""?UM]9ȋEE9EE },EU D$T$ $D$>9MϋE eEUM\U1M UME#E }nEUD$T$ $""""D$"""\>9BMϋEE}19}E UM T$L$ $D$>]u9M΋E eƉi`T$L$ $D$=9MϋEEƉ]u덁݉a)u}T$L$ $D$+=UM]9ȋEM""""9""")Ɖm݉]u UWVSH D$T$|$|$D$$= D$$H*)R)L$L$ |$M $w= tkM] +L$\$T$$z)ƍv)ljD$T$ )Ɖ)ڍe[^_]øUWVS8 }܉EԉŰR.ljEtGJ@t@-+RӋ}tWAʉ@uk-t͸+t@(1ۍJAt"<(5<)uf~ʍJAu18[^_]BË}tG)1}GY1}Dw11Eȉ][5̉ ‰Et^EЙ׃ЃEԉ0xE܃Hʋ]DKtMEܸ9 }Ã0)Ӹ9ȸ|땋Eȋ]܃t*}̉u2 8[^_]ÃGEPXẺ 8[^_]É믍EEЉÍ}v9s MtQBHuހ.tẺEt,}ŒR.UЋu؍LDFt uf}am}a.m.f}pm}p.m.@EЉ$] E܍ h D$EЉ$]ۏ u݋FV }ԉWFẺẺ}J1}ԉ|}<}<Ԁ}.XEE܍ h t#D$D$EЉ$]k uKE܍,h t+D$EЉ$] u}g]܍$D$EЉ$Î t2,h t%D$EЉ$]薎 u uE܍L]̉ލh tD$EЉ$]R uruЉ4$]; T:sE܍LD$EЉ$] 2u݀}u<E]DCt.E܍D$EЉ$]ύ u1ۋEЉ tC.uu#ỦD$EЉ$] Uus5uD$EЉ$]H tu#GW ]ԉSG UWVS Ƌ'<'wwEVN)щȉMEED$$e\t_FMȉFD$F$@\t:F]؉F>FDF 1[^_]ÿ'E {UWVSE .D$`D$dD$hD$lD$pL$|L$011DrD$0$|$H$L$4$T$8T$PD$\1D$TD$DD$`MD$@|$X\$LD$\D$`N|$Txq|$X\$LtL$T=qwT$`9A-D$@tT$T=qw L$`9AtL|$D|$X\$L\$TD$lU D$TwD$T|$X\$Lj|$XlGD$\D$`t$\QT$Lk)ЋT$P ‹QD$dT$hD$t ] 1uUT$$]7tFuɿ [^_]UWVS荴 rt: >t M1uU T$$7tFu̿[^_]UWVS& pt:l>t M1uU T$$"7tFu̿[^_]UWVS 迳 äE $ ƋE%EE,hUuUT$$$…plU>t M1uUT$$f6t1FűuUEEu54$1E [^_]ËUt }1]uЋu9t!$U\ D$UT$4$ E0E렃}tE1҉UWVS臲 lu Ex}u 4t+D$4$5uE)E@ [^_]Ë t 1[^_]Ét$HSD$$nUWVS E D$E$Phl D$ED$4$NjE8tBnED$=4$. HE } M D$4$2uM+E U W tMWu9wt!Љ1RMWu9wu ~oVEN1ɋE j t(E܉$$.E$.EE$[^_]Ét$HSD$$k $-ffffffUWVS8ޮ ùubi D$usD$4${uD$:4$K- DžD$D$4$H{hF$HX $$D$$D$D$|$ D$D$dS4$l1$_$6D$D$|$ D$D$4$1+ |$$ƅ>d~kD$E D$ ED$D$4$tWD$D$zd@ $F  $2D$$X |$$ƅOD$E D$ ED$D$$$D$E$tPT$$}$+$+f 8[^_]À>/uEt$D$<$St'D$<$D SWf 8E D$t$E$u}뎋E D$cD$E$vuE D$D$D$ ED$D$lS$.BE D$t$E$ure E D${sD$E$tDž1D$ sD$E D$E$ Dž1k4e E D${sD$E$ot1;$ d t$ 'D$E D$E$ <$ 1sD$E$xD$/4$sd E D$D$E$sDžDžv?d E D$XX d E D$XXUS(h MEEED$D$ED$ ED$D$E$,x E([]øUS( EE>ED$D$ED$ ED$D$E$.,x E([]øUS(萨 uD$ D$$?D$D$D$D$D$ D$D$D$D$ $+x D$([]øUS ED$D$ ED$ED$s$Sx E[]øfffffffUS賧 ØE$g U薧 U\t \]Í\M\]UWVS` E}|$E D$E$2q9s [^_]a ?|$ t$4D$$\[^_]UWVS Ա}|$E D$E$q9s [^_]Ma ?|$ t$hD$$\[^_]US 耦 eE$k t []ÉEsT$$\EUS : E D$E$c t []ÉEsT$$\EUVS Ѱu4$ct[^]ÅtEt$sT$$\EUWVS蛥 Àu} |$4$ t[^_]ÅttE|$ t$T$$\EUVS; u t$E$ t[^]ÅtEt$sT$$\EUWVS ȯ}|$E D$E$衯 u[^_]ÉC_ 0|$ E D$D$$\[^_]UVSx ]uE D$4$ t[^]ÉEt$ tT$$\E[^]US! ED$E D$E$uEtT$$\E[]USΣ óED$E D$E$uEtT$$\E[]UWVS$y ^D$ D$EUD$T$EUD$ T$E D$D$E${8 Ɖ׋D$ u $[^_]] L$ EUD$T$EUD$T$E D$ ED$D$$\$[^_]UWVS$跢 ÜD$ D$EUD$T$EUD$ T$E D$D$E$'Ɖ׋D$ u $[^_]\ L$ EUD$T$EUD$T$E D$ ED$< D$$\$[^_]U U!tSፀL]Íٿ]Í]Í]ÍM]Í#]Í]ÍS]Í|]Í#]Í]Ít]Í]Í]Í]ÍS]Í]Í T]Í]Ík]Í]Íf]ÍF]Í<]Í ]Í]ÍC]Í]Í ]Í]Í]Í]Í]Íx]Íp]ffffffffffffffffffffffffffffUWVS聠 fƉUx HEU D$ T$ED$9s)L$><$ ~F [^_]D$$k UWVS ֋PË@(K${ )9C {}9s>C K$S{})9sT S M9rNC M9s C C C$C(C,KC S$T$ʉs [^_]Ë#C KMUWVS\= &E}7<W11\Dr׋EEċE EȋEUEЉUԋEE؍WÙ  ,E%#jo}čE܉ÉEEU$T$ډ}}ً]ẼljE w  f1#E#U tEUȋM_E9s U,EEE̍PUP vSE(.&.&.&.&.&;Es MĈEEU̍JMR wډ~}4]EMȅ9s U>EMȃE1ۋU؅u)9s!2T2U9sE#EMȉE9s UMȋEE9s UEMȃE9v ED#MȃEDMO9s UO 8Pt&'O 7O 'USq VEU MÀ]]] ]][]USEU M]]]] ]][]UWVSt D$L$<$]t$$D$<$1 Dt$D$$yũED$ 8tD$D$ $ruGt$|$ D$ED$E$뺉}UE$[^_]e;L UWVS莑 sD$ED$$t{NjE88/tbD$/4$轐…tL)JBU=wsG|wdD$}|$M$ Es(uuE[^_]É[^_]äftUuu%1[^_]MyfUWVS胐 h}UtlƍxD$4$5 tD%=`u'|$U ytĄ[^_]J O1Ą[^_]J 1UWVS܏ }U)tlƍxD$4$莶 tD%= u'p$U tĄ[^_]I O1Ą[^_]I 1US(: EEED$D$ED$ ED$D$E$lx E([]øUEM tP8t P81]Ã߉P81]UWVS 蝎 Â}tc$HUT$U T$$s ƅt/tV$o uDt$D$<$Ɖ [^_]ÍD$$/u [^_]U ߍ ȘU T$UT$L7$]U EtUT$U T$$]ø]US 耍 eE D$E$Cu$ED$ED$L7$ []øUVS , uED$E D$4$CuED$ED$4$H [^]øUWVSL׌ üE uUŰPUЋPUԋH M؋HM܋HMHMHMH M@$EЅ$EPU@E)99}W~A}ủu1MEUȋEĉD$ |$EȉD$E$8sE9uu֋UȋED$T$E$BE$1L[^_]|7Eԋ U6fL[^_]UVS4萋 uuЉt$E $ ED$t$E$}4[^]U L 5U T$UT$L7$H]UWVS uEE}ED$E D$4$At}EE u[^_][^_]UWVS4車 àL78ủt$E$/E D$t$<$4[^_]UWVSr WEE}L70E D$ED$4$At}EE u[^_]C[^_]UWVS4 uED$E D$4$@t%}̉|$E$kED$|$4$4[^_]UWVS4讉 ÓL70E D$ED$4$M@t%}̉|$E$ED$|$4${4[^_]UWVSHJ /MU }Aq)9y}ȋ:}̋z}Ћz}ĉ}ԋz }؋z}܋z}z}z}z }R$UUątj~;ƍỦUĉEuƉϋEĉD$ EȉD$t$<$oE9u܋EUȉT$D$ $MF?M $蟋1H[^_]|7}ԋ Uy'H[^_]UVS40 uЉt$E $謤ED$t$E$4[^]U ՒU T$UT$L7$u]UWVS軇 àuEE}ED$E D$4$V>t}EE u[^_][^_]UWVS4[ @L78ủt$E$ϣE D$t$<$4[^_]UWVS EE}L70E D$ED$4$=t}EE u[^_]p[^_]UWVS4譆 ÒuED$E D$4$Q=t%}̉|$E$ ED$|$4$ 4[^_]UWVS4N 3L70E D$ED$4$<t%}̉|$E$觢ED$|$4$4[^_]UVS АEM thP8t P8P7@:t1 [^]ÁP8:D$D$7@<$)OH8붸 [^]UEt @:]ø]UVS @ %$7t^dB.@J.T$XT$$p4D7tE$/2P7$$L7 [^]Í$SXu뎍]t$`$gfUWVS(葄 v}tG{E{EOEEME EM<$bƃ t tu#E([^_]ËE1([^_]ËUGD$ D$GD$<$CE9E9G?@UR. DqEEmUT$D$<$4:E;E :E+m}EE;E tu}MMD$ GD$GD$<$vhD$ GD$GD$<$UhMAE9O~D$GD$<$9iGU9ut$GD$<$^9u7D$ D$GD$<$gD$ ut$D$<$gt$GD$<$9E;E v}D$ ED$GD$<$}gEHU9_E9G5MzUG;U D$ u4UT$D$<$gED$GD$<$P8E E&OL$D$<$f}D$ FD$FD$4$fFD$FD$4$7}tE9} uD$ FD$FD$4$lfFD$FD$4$77D$ UT$D$<$3fG3L$MGD$<$d7MD$ L$M܋GD$<$eM{D$ UT$D$<$eGU D$E D$E$]U  D$UT$L7$^]UWVS  Њu}ED$E D$4$6tE} u [^_] [^_]UMU E~tEU M]]UWVS b GuL78E D$ED$<$5tEu } [^_]~ [^_]U  E L7~"tD$ED$$9]ËEUWVS~ Þ}EEuED$E D$<$T5t'~#tuEE }[^_]E[^_]UWVSJ~ /EEuL78E D$ED$<$4t)~%ftuEE }[^_]VE[^_]UWVS0} E}GDEEP798GH%EW,_]ԋG1ɋ];_]]؋R_]܍49;EM}u5W,M؋ +JMIʉʉʋMUMfF%] ؉Ft$G|$]fFuE9sMF^U9jbځM9OV Df~9E9rMutPG,]؋ˉM+XÍ@‰ЉЍD$ t$EԉD$<$]cMEE9G~0W,10[^_]Ã]1^E:<$]~1U{ L7$]UVS{ ~D7p t4$ u N8@[^]ø[^]UVST{ 9ut4$ u N8@[^]ø[^]US${ E UD$ D$D$D$T$T$ D$D$E$$[]US$z äE UD$ D$D$D$T$T$ D$D$E$ $[]fUWVS^z C} uUM=tUG$XUr|7tUF$U5|7tBU$"U|7,048<@DHLPEtE@$|7  $(EtE@$|7TX\`dhlptxE tE @$N}|7|UUUUUUUUEE$tE$@$^|7U UUUUU U$U(Uċ,EȋE(tE(@$Q?|7ŰUЋUԋU؋U܋UU䋐U苐U싀EE@@t ʋ}wHt ʉt ʉt ʉ,t ʉt ʉ,t ʉt ʉTt ʉt ʉdT|t ʉt ʉ`|Mt ʉt ʉ\UUt%  XŰE@|E@hDž$ */ E@,p1҉,MI, qfL>9<ffNv tv$ uMI,4vD> qxf~g$9O HG 9u͋9 <>f|>y_u$F,HfD99f|9y.NDfHD$F|$NuĴ[^_]Éщ$E@,R|)ƍTxDlx9qf+fG9R)fL29R4 ʋ fbJr tv$uE@,RD 9YMQ, rfVAtωp$0V PF 9u͋tp9l9h\T$xy DžxEP$ty DžtEL$y DžEԉH$ty Dž4$Ly Džx|Ƌ)΋)ȉpl9^p9dE@,H1҉tvf~94>ff~~ t‰ljv$=u}O, I4F uf~0r$i4W PG 9u͋9 Ƌ9l9|)ȉ9~ht|Ƌ)΋)ȉpNj9p9 E@,H1҉lht}f~94>ff~~ t‰ljv$Eu}O, 9I4F uf~k$j W PG 9u͋9lhwDž?lxE@,@xMT6MA,@ƋQHVfF94QDfHD$A|M$uDžGGG GGGGG G$FFF FFFFF F$,B0B4B 8Bǃ <ǃ ^ǃ vǃ #ǃp :ǃ 'ǃ #ǃ #ǃ #ǃ -ǃ -ǃ _ǃ |ǃ oǃ -ǃ -ǃ <ǃ >ǃ *ǃ !ǃ f2E@tgt.Ex tAu[^_]ËE싀t(VT$x:T$ D$D$E$o1.t&.&.& Tp=u[^_]USJ ÎUM1&.&Tp =u[]UWVS,iJ NU EƍME$+FF(9u݋uD$$8CuxupD$$$3rT$$ ǃ !ǃ +ǃ !ǃ ,ǃ !ǃ -ǃ$ !ǃ .ǃt %ǃ 0ǃ %ǃl `ǃ %ǃp aǃ ǃ fǃ ǃ gǃ4 %ǃ hǃ\ &ǃ iǃ %ǃ jǃ %ǃ kǃ %ǃ lǃ %ǃ mǃ$ <%ǃ nǃ %ǃ qǃL #ǃ oǃ #ǃ sǃ %ǃ tǃ< $%ǃ uǃd 4%ǃ vǃ ,%ǃ wǃ %ǃ xǃ ǃ ~ǃt #ǃ pǃ #ǃ rǃ d"ǃ yǃ e"ǃ zǃ, ǃ {ǃT `"ǃ |ǃ| ǃ }E2xU U}tPE}Uu(x<uD>E tAuЃ,[^_]ËE}܋u苗t(MIL$x:L$ D$T$$%Ep }Wp}^X^X^ X ^X^X^X^X^ X ^$X$((9u,[^_]$> $< $^ $v$ $#t $:z $'h $#V $#D4 $#2\ $- $-L $_ $| $o $pt $r $y $z ${~, $|lT $}Z| UUSD zO ]p JHJHJ H JHJHJHJHJ H J$H$((9u[]ffUWVS0!D OEU܉MD772EE4E fEE$Hƒ=4M4%y 4 44fǃ EDPfvM䋑f8;@E fWf^fqf$MdU܅47Q)ʉ$ 2E$N‹E@ @M M4 'UfB 49}} 4% 44;4tf 7f1҉Ѓ0[^_]ËE44%y 4f y4D$ D$D$$ 4449)‹4L$ T$U؋MȉD$E$!4;4U}dž4…f 4xp4fǃ 3E$>0t3E$=E0U,)4fǃ E܅U0tE@ U؋4 E44B%y 44D$ D$E‰T$E$}~v4%y 4 494114M%y 4;4)fǃ Mԋ4D$ T$U؋ED$E$¿U؋M~4y 4 49411x4Wy 4 4947ff @}AEE܅U$-E$‹E@ N@FM MtUB.jE@ U؋4  UfB 9 4,fǃ !E܅{47Q)NUm~ 4}} 4Hx6 44m4%x4뿃ߋ 4}} 4%y  449}fG Ef` @J.D$ D$!D$ $蘼 $脜U< œGEfǂ ǀ4ǀ4ǀ4ǀ4ǀ 4]UWVSXc< HGuD7MV8у$33`B.EEt\7 E)V8N<t=%G*tE11zE}uAX[^_]Ãt $*tًE$赼E@EFF$蚵 Ut p@뮃$<UVS6 áAƍZD$4$ etD$4$y 4$i 11t)0tGB<1;NVt~΅u׀>u|F[usVmt2t00uVFtJeNVu1UWVS0D5 )@Uu :uH2tU$1YUF@fu2ML$ MD$T$<$#2M EPJ(N$JN 3jt$1D$D$$ FTst$zD$D$$ FXV  ~$879<7NT47 072P3PB0zp12džp2E싂E苂TEtU܉Udžp2ELɉMEEEUtwD$Eԉ$UiE܋U؉$Mԉ $E܅IH 1$虱t2džx2EE-EED$E$V u džx2EPED$E$+ u x2t|$E$ u x2dž|2UtE)dž|2E؃0[^_]Ë@@Dǀ@l@hǀǀǀ<HHpF$B(EU܋ED$<$N UEU܋ED$<$& Uu p2MU܋ED$<$ Up22@@,EF@fL$ D$D$<$2XE1ydžt2džx2Edžx2;Et ED$E$ u dž|2EtD$E$ u |2|$E$ |2LMFEidžt2džx2dž|2Mdžp2EEdžt2džx2dž|2E@tg|$E$ uTx2dž|2EJt|$E$ u x2dž|2dž|2E8ENdžt2džx2dž|2ExOAOU. 9D7D$E$]US- 8E87H$ <7H 47HT 07HX "7Hl X72 p2 t2 x2 |2 2$4P[]UT- =8MD7tJX071]ø]fffffffffffffffUWVSLjMEE_9tBfxft0fu9PuԀ}tMHE 9u[^_]M@EE D$E$UElUUWVS p, M7}ƉDHfx 4 [^_]Ëf=tyfDN4f>tX$]蓢TP.t&ffB9uǀFF [^_]ËEFf\Nu]ED$$]0MME$ ]UMtZf@f@@ f@@f@@]\]X ]]9Eu] $詭$谊]@J.D$ D$D$ $航 $t] $P$WUWVS * i5Ɖ׉M$` ttLMt5$LVp9uϋ}E$TF [^_]É}UWVS) 4Eu^.&9t)fxf8u@$9u׋~1$]`9> $]H4$@[^_]UWVS Xt&.&9t0fx4ftfu9VuF9uЃ [^_]ÉMFUFҋUMuUM$MUUWVS( Ñ3}fǃ  $P.&ffB9uǀ2ǃ ǃ ǃ T2@tL$ =w4D$T$$N2!9u[^_]Í $?$FUS y' Z2E ED7t+2UT$$U(E []ø []U' 2UM ~*D7t2t _1]É1]UWVS & ò1D7te3339}}<31 [^_]à D$$‹3t333뱸빋3L$PT$$D~ 33]\33u-U % 0ED7t%2UT$$1ɋUE]ø]U% 0MD7tJT471]ø]UWVSw% \0}<$ƃuOG @tI 8u?D73t-<7D$87$Htǀ3[^_]UWVS $ /EUD72E, EE$3= %y   fǃ  LNfu f9q  fmffjMUU$) E$mE@ @ME@ M  %y   LNf    yt鋓  9f  y [^_]ËE$Ot3E$8=DEMR [^_]ÃUfB   9|, <  9f  [^_]Ë %y  ; fǃ  Eu-E$E@ @aσufF 47Q)=  Ef` [^_]ÿ@J.D$ D$ D$ $] $IUWVSv! [,uD7MqV8у$2c33`B.M MEt\7E%F8V<t|‹FLJ3}9t:ǂ3)EEEEEEl D$}܉|$$ ǃ EOD$$  ǃ  US+  t[]ÍOD$$ȼ  ǃ []US  u[]Ë D$$z ǃ []US$ z t$[]Í)EEEEEEl D$ED$$ǽ ǃ $[]US$  $[]ÍED$D$$z l 9Et $[]D$l D$$@ 1UWVS4 ÂD73;3@fT$$   yP7B$,oD$D$ HQT$PT$@$詧7@|U:E؉D$D$ $cUԋ@t A:zUԋ}؉|$D$$+|$D$Uԋ@X$ @${ D$ D$D$@$ǀ343@fuT$D$$4[^_]7@|:M"E܉D$D$$8 l 9E P7R뒸 D$$$ ǃ  |14[^_]:MvUԋM؉L$D$8$Uԋ@YD$l D$$l CUWVS, ã EEEE uԉt$}|$$`EEEED$|$$`D$$aD73tD$t$$W`,[^_]  D73tUS õ D73u-3@fuT$$& []øUS x ] D73@fuT$D$$ []US)  D743@fuT$$艑 []>US E U7RtI|t7:T$D$$AD7ǀ3@$裆 1 []Ëxt:T$D$$D7ǀ3@$Z 뵸 []UWVS  ED72tQun7@@tt\ǂ2:T$D$$`@$҅ [^_]7@t ǂ2뮿 [^_]7@tǂ2{U; $D72$]ffffffffUS]E  }t J;}R ;~[]ÃUWVS ð}tG8 u^@u[^_]ÍtG~W,EO(G\p;}@ ;~9Uu׋u멉<$G8UEU t9P| @,]1]ø]UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U91[^_]É봸UWVSu] UtSx]F9}VxR)9H t7~,}߉ˋF(D$NQT$$U091[^_]É봸USEt=H~6X,1".&.&.&9t t[]1[]UWVSu~~?F,E1ۋF(D$NQT$$ًU9u1[^_]øUWVSu~~?F,E1ۋF(D$NQT$$ًU-9u1[^_]øUWVS}] UG9)9i4utU}t]G,E] Eu pW(9|_9}W(p 9 _9} E E;E 1[^_]É듋uW,G(D$OL$$D9UED$ PT$D$$]UWVS}G~EW,EH;}@ ;0~09Ut_(Gt} u̓1[^_]USEP(]U@,M H;}@ ;~1[]UWVS}t@G~2W,EO(G\p;}@ ;~9Uu׋u[^_]UWVS]ta{tZO~[w,1 t&9tItC~2S,EK(Ctx;}@ ;0~09Uu׃[^_]Ëu[^_]ffffffffUWVS~ cЍR4ր33V,U39VG8 L4U;W81҅ZE1EEEEẺEUMD>EED$D$ E3@@D$UT$M $mV,UD>Mȉ$xUV,E3EEE;4ML$ T$D$E$7ED>$TxEENjE94~-D>D$E$5dEE94ӋUЁĄ[^_]Ã4$ğ D$t$ ED$D$<$‰ЁĄ[^_]ËED$ T$D$E$ED2Mt$ D$BD$$D$M2$P‰ЁĄ[^_]úsUWVS8 ƉEЉU̍R4Eԋ4}8<$О ƀ?EEE4E؍EE'E$vM9Er;UU)ր?Et)E؉D$ t$|$E܉$tEy8[^_]Ë}ԋGu܍WMtFȉ׋uԋ6tftE‹u)uƋ@tQuEt}|$D$ $U| UEЀ4SŨ8[^_] EԍPMtыujuE)ƋEԍPCt$D$ $UA| U)u}E)9s뷋E9r7EԍP9UtU?$9Uu~X24H90t…#ȋH90utJ$`2UWVS xlj֋@X2BTttO@ ttO@ ttO@@t tO@@ttO@ttO@ttO@t4tO@ ttO@ @ttO@@ttO@t@tO@t"(ttU<$,UtB8tt<$u 1[^_]ËGX2G@%G@RR8t Ɖw@Ѹ[^_]UWVS ÏƉ׋@X2@Ttf@ tf@tf@@tf@tf@tf@tf@tf@ tf@@tf@tf@u;u?uGt7@@8tf@1[^_]Ãf@t4$t4$미[^_]USe NMU L7t%t X@t @@f%f1[]ø[]U UL7M u]_]U UL7M u]]UVS ¨E L72Uu0ÁE% úډ1[^]ø[^]USe NUL7M u8tHX2H@H@[[8u1[] ʉP@[]U L7U]SU L7U]UVS îL70tFFX2@Ttf@4$4$7@@8tf@U1[^]USEM Ut%t X@t @@f%f1[]ø[]UEU Mu]i]UEU Mu]5]USEUu2U Á ӺEڋE 1[]ø[]USEU Mu8tHX2H@H@[[8u1[] ʉP@[]UEt@@]ø]UU E]UU E]aUVS utFFX2@Ttf@4$+4$7@@8tf@U 1[^] 7PT1 t t t@t̀t(t t8t ttLt 1 7PT1 t t t@t̀tt4tt t@t@t(t t8t ttLt 1ffffUVS çu4$袂 D$t$L7$H [^]UVS ju 4$e D$t$E$ [^]UWVS L 1uE L7:x<ut&.&9t<uЉD$t$<$ [^_]É4$ UWVS }L70E D$ED$4$|t<$蝁 D$|$4$K [^_]UWVS ku}ED$E D$4$'t<$H D$|$4$ [^_]UWVS1 }uL7E D$ED$$UǍt/Ux0u 9t<uƉt$|$$ [^_]ÉU<$讀 ƋUt$|$$W UWVS }}uED$E D$E$6tAxEut&.&9t<uƉt$|$E$ [^_]É<$ UVS  u Ex8u9t<uЉD$t$E$| [^]É4$ ffffffUWVSH Æ}EUċEG,4@4E@U {}X E EG@E̋GXpXș)։uȋE;GTEȅ~E1ẺE9ut3EĉD$<$藼uH[^_]à zE1H[^_]É$V'EEFEȅE@$VEyEGM+M9E O(U @9~F t$vhF E@ffO@EE %WHUUȁ ‰ЋM ȉFEfFE@EȃvA}$RJMLO HG E9uЉ}FMăU U~g։}NjUG tUMȉ$gG UMȋE@A%GGfGfwu}G9uOT9pO(LE @ 9}Gpt$ EĉD$ED$<$EEGT9tBuW,u P GG(<$FEP1Ʌt=Uȉ}$HjMTO HG E9uЋ}E  G(MJ9~R 9}ED$ D$ED$<$B%UčJ‰Uĉy19uĉ)UBHFBLfFMEy19E0B,4v4BDfFt$B|U$du 4M$zSE u E;GTuO,u u6uč @4PA!EE;GTG8 <$<$2 EE EOT9E M MO(ʋH98OU9U+GHFGLfFfFUO9{UGDt$G|$jcu2 ȅM cUuUȋu6O, 4I49~X}uEFDfG|$F|$bFHGFLfGEȃ9FEfxmMO(E @ 9}EȉD$ EĉD$ED$<$M MG8 @!78u E<$GG8 <$gEuĉ׉EċE MO(@9/(E w(t@ 90}0OL$ EĉD$ED$<$EEGT9tAuO,pM EG8 3E RW9)ʍBE <$9ENG8 <$n[tUWVS 8uE0E,EP@,Dt@ 1H43tF0V]K +J K( <K,[+ZR,UʉUf.&.&rprpP 9MuԋEqU܋zUED$<$]ZLUBEE9F~EP1 [^_]ËVE}ǍD$uF4$]92ÅF4F0V, M܉ً]Ӊ]ut&.&.&.&HXXXX @x9UuҋEo];90G EOsC9~ HOCU4 9C~FO$w CC 9~ pw C Ѝ197~5U?9u1E)EEE1)ùUWVS] FE]SCJr9~ FCr΋M 9~B1)΅K zB 9~ HK B U9 }B}M :u 1)ȍ<?E C EC$EP791[^_]C:}87P79H79L79S9M 9u M S E<789E9EE)Dž#EH7tS} x }x$}u UM su 9+E<78;}~}낸[^_]É1)ƅ.$1NC E1'CM 1U E~M ~D79B$t ]1]ËE 9B ]UWVS Ͳ òUE D7Ex$9}iP7P H4 9uogH$p <19} KCJpH7P H4 9u91H$p <19}  &D$E$u)L7P H< 9H$p <19} E}x$} x 87}:<7} :2u $vt@:u$vuE$؃ [^_]Ë@ 9E 1 [^_]ËM )U)M )U)M )8)UWVS˰ ðED7ǂ3~aM ~Z;B$t_M L$$D$P7$t [^_]ËE D$$o$1[^_]ËJ 9M uUWVSMU ]tgAt`q;pVq<;xKI8YxQtX ~0@,41z9~R y9:}:9A1[^_]ø[^_]UWVS襯 Ê}M wuGX;P$UWUU;P G)‰UW u)։uwtb9NEU;FvE9F nEU;FaOEG <$F|$4$D$<$̵1[^_]ÉFV MȉFE‰V 4$69u뼸[^_]UEM tP8t @P81]Ã⿉P81]ffffffffffffffffffUWVS = &E} O E+H O(w0G~_1U J(B,4B]+C[,H NX^F BU D$ $]/CFU 9z [^_]UWVSEPX2uH8ˁX8p x;z t[^_]ÁuكH8HMJ$x9MtH}9űMQ ztQuut duH8 uX8J$UWVS( ݷEUMia$S#ƅIǀǀǀE܉$#EF,D$E$&ljF0EF4EFXFF]^EF^ F$EFE F F8F8~xfHf@fuEfx~OE@uFE@#h2u 7:tx}$K t$KutE1[^_]f~E@tfx~݋E@uD7{uGm뱅t}$K u%D$P7$G}$J QiUEPT$ PT$P T$P$11^]UWVSEu ]MU}}} }uyE]yE˅y1ۉׅy1pu؋M)ًP)utu9nP Uu)H)ыUt29OM)ىʋM) xHMUщMUMʉUuu܉uUU UMU[^_]z뭉U델[^_]UWVS ʞP7@@Mt7J y :ED$D$7@$,]A@7#A@t2ED$D$@$\B@7#B@~ED$D$@T$\A@7#A@7t $E[^_]uX~t7:ETt:D$D$BL$-\`@7:EfED$D$@L$[`@77[^_]7:EUWVS ؜uEӉ΋}$EP, 9u;u t5 D$E D$ |$t$$]K6[^_]èuUWVSĀs \ED7Eԋ3 ]P7]JxV HJHUE@8@u B8@] B@ ]:t$D$7E@@D$ZEԋ@@H D$u4$]蕗f8E@PhtzEԋs]sEX78 S,11.&.&.&ȋ ˃9|u 9F Eԋs/E@ Eԋs} EH P,CEfEE}Ǽ7}]qM I, 9quV2xH uV p92fEuu؋sU;z)R,M<} :MMUQыP,UMUhyEE  EuFD]䉃  FH fǃ   ED$F|$#"iFLf FHEċEԋM؅~E@,}D8uF,}8E̋@E;F\E̋@ EЅI}9|GEЋCEE@,]] R]܋]̋[UЍ.&A@uUEPrLuȅ]URu72@ x]9]ΉMEu FuE܉D$4$]u (]ԋHP}|$E؉$E[E؉C{9}(UEH}ȅt}9}E}89^y1ۋE<9|"E@EčPE9E9U܉bƋUԋSuE܋U9}|:}EcUċE܉D$4$]UCEԋ}U9{tSEM9Hb{E<79UR zsC}]9]EԋEP:xE@EH u;F}F(9~E 3tEu;Cw|MȉE3Fu)F)Ǎ)ƅ~ED$4$]utʋMȉ}yEE@@LEEԋHE@8ZZE8tE]D9FEP]9ډUMUȉ$]4 EMЉÉ؉؍][ )؋])9EUr8^y1ۋE<9U܉[^_]ËE7E}G}WX@#h2t $0]:D$D$Eȉ$SEԋ}uW PEw P,u2 R4UE9x]DFfFt$D U$!UDfF4E9u]䍃{tD$ XD$D$rD $= E@ xkE}G}WX@#h2Et @@D$$];[EH7EE@9SD$$]EԋCB[EEEE܋E;E^]9]#}E܉D$4$]$FNj]ԋSuEƋE9~@9M9CSD$$EEԋKiSKD$B$EEԋCCEfED$D$E$]JEԋCEaEԋsSE@9(EPSP$#]7Eԋ@$! ؃[^_]Ëx}HJHw1 ;G}7ƋW,tGD$BU$]UB;G|ɋELME@8s ?9FEЋEP z@tP ]ЅN[]̅  MċEËM)ˉ]D$\$ ]؉\$D$$]g*U܉M*D$E)ȉD$ u؉t$EȉD$4$]%*EE@ ẺD$$]s:t$D$$N1ҋE]E܋E@vE}E;xEԋuFECFCEԋXE7E@Ph E@E$]SK}GD$G$Q+]GEԋE`8@@$]R$$ ]8EH7E̋QY,E1ލ4}R,z9~uLIR~1ME܉]9uT$U<$]EUuՋE܉EűQpY,ЃE u؋E<}܋4;aUR,:z9~_y}R~}419uT$U<$]UuՋu؋E̋Y,QB}9~E@@%E9u~_})E1U܉M0E؋@D%EU׍FUM9ƋPB%M9uU}}E)Dž]9E̋EًU)E9EEE}ӉʋuEEȋE}EЉ]uċ]9]MEȉE܋ZE@,u܋xB,p1҉]M؉M9}L$M4$]<uՋM؋E̋]9]EEEȃE]9\]EE90}уAy9E@uԋsEErE̋Y,E܋4mEpuE܋]؋}̋q,"XQ9M$eE@8MEԋPuFD$FE܃$M:U܉TEK]CD$C$ESPSPM؋E̋EuЉ9}9}}z}ӋBM!EuȉuȉM}ӋB9E܋u9~EEBDu9, tT, #FfFEBLfF9t!BDt$B|$]@u E̋sE;  [?1ɍ, UL$D$ <$]U€w֍V)ƉL$D$<$]eljEЋE̋@  $ EȉEu9~uE})E؋u])؃EEH,E9w]]]E})uu]9}u܉1}9| u9}9}9}E؅,9E܋u9pwE䍐, E̋@=vm EĉEE܋Hىωָ tftEĀEā =wEဃ)ȋ}܋OωփtftE܋uЉpE̋BD$ D$ED$$] AE؉uE\U܉uk|nd`t$D$$]EDd]:t$D$$Ed vMċ]CED$D$ E؉D$\$$]o U܉M2D$E)ȉD$ u؉t$EȉD$4$]- EE@/]:L$MD$$DU܉lE܋M؉L$D$E@$DBE}̋R, }9}uE]E@,E]EE9E|EH,EE}؅'E@}ԋsE؋}9Ef r uv'E܋HE̋@1Et$qt$ $] W9}u܋]䍓, T$UċE܋@$ U(fv[1ɋE䍸, E䋀$ EEpu@E܋}ȋE)NjE@X0ppuCdD}uNű;JH ED$ut$$]g:t$D$$]BD$D$ D$M܉L$M $@t$D$M@@p$BD$D$ ED$D$$M@i|$$ft$1|$$AE̋@D$D$}@@0$]ft$D$$tAD$D$ D$D$E$Vt$D$@@p$-AD$E܉D$ ED$D$$t u]D$1D$ ED$E܉D$E$]1:U؉t$D$E@$]y@U؃9u1҉Ut$D$E@H$]@@U9u|D$1ۉ\$ ED$E܉D$E$]|$E@$d:t$D$$?E)ED$D$ D$D$E$]E@|$$dt$D$$h?D$E܉D$ ED$D$E؉$]4H5 }+ D$1D$ ED$E܉D$E$]1:U؉t$D$E@H$]>U؃9u 1E@Ut$D$$]>U9u HH`ppu;t#t}uNű;JXLJED$ED$$]b:t$D$$=D$D$ D$M܉L$M $t$D$M@@p${=D$D$ ED$D$$]M@}؉|$$]8bt$1|$$=E̋@D$D$}@@0$]at$D$$<D$D$ D$D$E\uD>ED$D$ D$E܉D$E$]E@t ]̋ ;qtE؉D$$]Na:t$D$$$<D$D$ ED$D$EЉ$]E@E؉D$$`:T$D$$;D$E܉D$ ED$D$E$]SE:Ủt$D$E@$]D;Ũu0 jE:t$D$E@$]:u2L E̋u;p E:Ủt$D$E@L$]:Ũu`D$D$ ED$E܉D$E$]e|$E@L#t$D$E@L$]:uUWVSYp 6{]D719X‰PtFC:uk11ɋCD$ CD$C D$C$ptB[^_][C9uP7 Q+SxSQ+S x SċKxSt1҉S1҉SQ+S y[^_]Uo izL7$]UWVSeo Bzu] EM ^\UV`UVdUVhFlNpL$D$T$ED$ ED$\$4$u>tF9u+P7 Y+]^y1ۉ^IM+MNy1ɉN[^_]ø[^_]UVSn Ëyut$U$vu[^]UWVSsn Xy}GDEP798GH%E1ɋwG,pGE9M}DMfFE ‰Vt$E@|$$tAfFE9s>FVM9utс}9uN uf~xŸ[^_]ËM}9OGD$<$VtD$D$<$$1EU6m xL7$]fffffffffUEU 9u5J9Hu-Hf3Ju @ R u 9u@Rtu1]1]UWVSl ÕwU} w ty1 f.&t6~RutF$Hu1[^_]ÉU$t8U F@RuDžtÉv$uG 멃UEU  HJHfJHfJU @ E]UVSk çvutv$u[^]UWVS k tvMq~X1Q,zQ~>1҉EM׋q tMv$1uME9xԋEM9A [^_]ffffffffUS] t[UӋE+v.&.&.&.&.& ȉt %1ȃ9u[]ËE[]UWVS]} 1115.t&.&.&.&.&.&.& ȉt %1ȃu1&.&.&Lȉt %1ȃuڋK tBu1ҍ.&4Ɓt %1uۋIuċu9 [^_]1[^_]USti YtE t$D$ $}x) 1[]É$91[]øUWVS4i sU܉   E苃 E7E@E@pE؅"7EE싳 tRyF%y }93}Ѕy}Ћ})щ})9uM)9IBljы U)y<93}}Ѕ}}A87L9+~ EЅD$D$E$m1ǃ  EE1ҋ u}u!7E8 ; |~)EЋEHAE̅q}؃E9|9;T$D$Ẻ$0E@p ǃ ; QuJ `7lT$D$$i0 E8uuE@@l8 } ; MJ Alu  D$ <$l…y )Љ m t}艻 u䉳 4[^_]ËE1"7EEU苳 u}4y yFȉE!7E8`7)}ЋEHAE̅ ; }tM؃99R D$  $J) ǃ  ; y E 9U Ǎ"t$D$$\. ; ~a x E@@xu XD$<$y)  ;  ? t$D$E@$-  ;  uԀ> u)ʃ<7E EԍEișǍry )ƋE9E@M؉L$D$$,  EE89~1$ & _$U ;  P7uR,r@E؍ E0   } [9 EP, 4v4~}}܅uE@}؉|$D$$+  y}9D$D$E؉$+ǃ ǃ UN;H@uRFuLf~-$^ D$ D$F $V fI E@$ =   tD$ Eԉ$9…y )Љ 늋@lT$D$$v*  E9 ȉljM$ gf t'D$ Eԉ$y) $ Aǃ  D$  $.y) ! E)ȃ9E@D$D$$F) 9  Ǎ"t$D$$ ) ; ~b E@@xuƋ t2D$<$Oy) $ 4$됉Ƌ  t*D$  $y) $  E1UWVS ^ diE苃 <7M19|    9 87E79 9`7E:E)$ Eu ǃ E98.@@ltˋM t‹UT$D$$J'뵉  PBh9}d T$t$$ LƅtDE; t4$8 U :D$D$4$&uU1    [^_]Ë `7Eu@@h9ME4M䉋 E;0 GE  7p >u~x`7U:t$D$$%mtGUt @@tut$D$$%@@lu$ mu ǃ 87E 9P))Ή  $ 둋 xǃ Ux[ afU U U  U 11]U<[ %fU U U  U E1]ffffffffffffffUWVSZ e%D72H7EP7]19u9uVF,E1҉MEF~`CH1U.&.&9F~59uuS9~S 9}͉9FˋU9VMIS[^_]Ë]S~Cs, 9tɅ~UMڋXCӉu.t&.&.&.&΁9u9uu9u_VY ?d7BH8~NHD~GBlthtËuu拐tt 1X c7@ xUWVS$X cƉEY7EBH8ˁ=u,7}@D-=}(7LJ D7Y\A`fAdBt%]:D$D$ $!EBt8]:D$D$ $!P7p2!P@EBlhzǁl2ǁh2BxT2@@Tth2t h2t h2t h2 t h2 @t h2@t h2t h2E[A\sfǁrǁt5Wfǁ~ǁ;fǁǁfǁǁfǁǁfǁǁ|fǁǁt[tfǁǁ~>Rr&.&ff@f@@ 9uǁp"ǁt"~@p"p".&.&.&ff@@9u}싇 %ȋtp"xt"LJ LJ 2H7EP7E ItiE9tE9tE싘 ZHB~&zr,EEz9uuMD$$]R[MIu1$[^_]ø(7ˋtiǁl2w}UM܋HQf.&% ؉9u9ut͋UMD,7놋tǁl2]tOǁl2[UWVSS ^EM ]fMf]f_(7;7Nftv,7969+D7l2tot"уt>]f9p"t"]fp"]fr"1[^_]Ét"ufp"ufr"ft|WfffufEftoEft\fYfEN}f9r"at"yfufEffEfEfEfEfEu%UVSQ m\EM ]fD7;B`N4f1Dfl2t1[^]ft_/ftMfufft2#ftEfuffuffufffff끸yUWVSP Ï[EM MMUUfD76;F\<@<UfrftMfv7? tV2vtCL$҉T$ UT$D$4$>:T$D$$1[^_]øUO ZEfx?D7;B\}1@rU f tUf vEf1]ø]O hZD7ǀtǀx(7 t% ǂp"ǂt" u1U勀 %1]UWVSN Y}M D7l2t^ftfvǀx(7 t) fp"fr"ǂt" uI1[^_]fPfftifuft_Bfthfj` %=1[^_]fuf/%뛻늻M XD7h2UVS M áXD7l2tt f@d [^]7Rt:D$D$$ 7M!A@f@d [^]UWVS7M X tP7} 3x@tOu fD7f9pdt6l2t3P7fpdQ@E % ЉA@[^_]΍N} f_f|SP7UL$2@l$,;:L$D$$UUULf`L$2@h΍N} ff|P7UL$2@$::L$D$$nUUULfL$2@t$J::L$D$$ UUP7$UM fxGUP7$fUM f K UD7f@dUWVSJ UUD7pFFy ;F|# tH4$ [^_]Ét$$UWVSJ nUUu FFy ;F|# tH4$~ [^_]Ét$$迹UWVS,J UD7x|$E$XƉ<$, [^_]UWVSI T} |$E$Ɖ<$ [^_]UWVSI TUL7tX } xQH9M IX9}Bxp,9!39M t' u pP1[^_]Ë#39M uك׸[^_]UWVSEM UtY xSpu9|Ip9~BXx,9!4>9Ut'PH1[^_]Ë4&4>9Uuك׸[^_]UWVS UztzB EBE wGGtXNjEB_ ])؉ƋEBWU)Љ xыOM9NjO9}_W,9~ ! U9u뗃 [^_]ffffffffffUWVS@G RE}E E EE E @$]ÅGE؋E @ uWUXts E07E_E))9~ىL$ED$<$]؃@[^_]à u:G1@[^_]ûkEGy1Gڸ@[^_]ËG,M؋E̋pU ʉMDEEЋGU)9|M̃ W(I9~Gt)A$fE9rTU).&.&.&.&.&AFAFA F AF9sڋUB E H %BfZE @E܃vKMȉ]ĉ}}$]cM \_ XG 9uuϋMȋ]ċ}EԃUt3uމr}ߐ)fX@ fH9u}WBO(T M̋I 9}GD$ EЉD$E؉D$<$]{L<$OH<$]7E9GTG8 <$]h~E D$<$], MԋUЉE E9-]ȉMĉ:BD|$B|U$]|UBHGfG9}s*w tUv$]8uUG 뜋]ȉMĉU#D  OUT$L7$]UWVS C Nu}ED$E D$4$t} u [^_] [^_]UWVS C ÊNuL78E D$ED$<$Atu } [^_]X [^_]fffffUWVS|=C &NEMu ME $]6EMqM$]lEEÉEMAEȋQUċE @U zދ]07]t_ @ U$ ]ÅyEEę)EEĉEċuMqQ)փE9yUċAEȋE uEE07EEkEĉEE U rUUEσ tu[ $ ]yEEę)E]É]EE E  uFE EĉEY,]Eȋ}4{U]tyu4Ur }y([9;~;EȋY}U9wU@t)G$fE9rFUv.&.&.&GFGFG F GF9sڋEȋUUċuV}ỦUUĉUUȉUUUu΋^,EEEF@ED$ED$ED$ ED$ED$4$]yE_mEąy1EċG$]y)E'<9}U&FHGGfGfG9}FD|$F|$]uE$]6|[^_]ËyQUEĉAEȉA $]AMyUQE9ATt/EȃE ]u#}5E $]EvMNjEEEEE}MEqE$]聻FU < oGU T$UT$L7$]UWVSU< :GuEE}ED$E D$4$t}EE u[^_][^_]U D$E D$E$]U ; FD$UT$L7$a]UWVS ; ÃFu}ED$E D$4$?tE} u [^_] [^_]UWVSC; (FEE}L70E D$ED$4$t}EE u[^_][^_]UWVS : EuL78E D$ED$<$ztEu } [^_]J [^_]ffffffffffffffffffffffffffffffUWVSQ: &EÉUMR.ljEDWp1҉]=.t&.&.&.&.&.&.&.&]3 VTJ>v]D{u܋]4.tH<*t*Ѓ}v‰ DOu뀉1pUWVS(9 CEUM؋ufUވM݋U 1ɋU EEԋ}R.Et$$UEx}P$u܀G$ Ut}EMU E‹E Et~MލAf qCXЙDžNE݉Et$E$Uu0Eu([^_]À}. I}ԅ~Mȃf wCXDž~]؉t$$UuUVSUE tWJ9A tX9tPZ {$uZZ[pۋt> R(ut$ ut$ut$$1[^]ûu11UVS6 AUE t\J;A t];tUZ {$u_Z[pۋtC R(D$ t$D$$b1[^]ûu11UF6 /A  D$ ED$E D$E$1]U5 @  D$ D$D$E$1]fffffffUWVS5 @ÉU:GEG<\<^ЍtR.z;%2<:<&Hٺ!fЍ R )f )эQ0 )ȍH0p3{3F3FP}[^_]ÍGuGr3%PR. Q8ȍэf ҉)у0r3{3< tzfȍI)f )ʈU ɉ)ʉ֍N03~;{3~G=E}uf%puN0H%}dUH]XAEdE*UUX]PGEG=E%p0%@p0%?uV0PPEUMU؉ȉM&ËE%>%tEU؋E | E%+%;E׋UEzG=E}]f%puN0HHMf%c|E$G =B}Ef%pPUuV0PUE]|EHM%+%c׋UEG=E%p0%@p0%{@2}%*f@ %-uN0HHEEG=E%p0%@{10}@%/%{@ 16}%@*%p0@%{10@}%m%@+uN0HHEE3MQ\11HCES{D8E<\G=EPU\EUVS- Õ87t t~9t $Q EED$D$E $!uI tG@t  Ğ7  @x [^]É댋E[^]É @uUWVS(, 7UEtBEE7u4$ UT$ D$D$4$bM踵N)‰)`EีNe)‹E)`Egҍ)nUD$4$ ɋUt\H tKx$1҉u܉.&9t-fuUE܉D$$ UuG([^_]1([^_]ËH n([^_]UWVS(+ o6UEtBEE7Eu4$? UT$ D$D$4$}kLЍB)L`E܉eЍBE)L`E>)<;lmD$4$ ‹EtaH tMx$1҉u܉&.&9t(nuME܉D$$\ MuՋGy([^_]Ë;pm@x([^_]UWVS()* 5UEtBEE7E܋{u4$ UT$ D$D$4$裴}-?L) RЍ)Ѝ ZGEeE)  IȍE) GE*SRЍ)<; aD$4$( E܋;aAQ tUy$E܉uv.&9t(~suED$$ uދF E܃9u؋E܅tЉ)43lmD$E$ jEOMEuu4$ UĉT$ D$D$u4$TuĹ-?L) @)Ѝ ZFUeȋE) @E)4FU։*SRЍ)43 aD$E$ }tux}cur}ul`GEEt}fOMrBEER3n$AE'u땋3pm$B3a$pCk}t EE$UWVS" ,E1ҍpNt-%upHptKst!ltpNuӉЃ[^_]Å~;}~8E tىU) Uƍp@Hπwx9}몋E D뛉U UUWVSI! ,084@08G4<11TD $rD$ \$4$,1t9,1.&Q9tU<u9u荕P)1󫋅4p84'Y8_4w%uwW%8H4X0@,y9r4|$$0gt,8C,{0K44y01 1[^_]Ë0 8a$08 t@0@4$0踕8G,tG0ƅ`%0R. 1Dž$Dž(Dža`,4:~Jwɋ0oʋ DK,<ʍ\yЉ,'~QaDž4>B<=B<=0 pV4)?6,4(t94s4zEEP~.(&,Dž,Dž(T$`-;Dž$,] CEP4 ]P,&Vw ҋ0qው,4O&4PD]Em PUT$,0m 49؋,s؍X(8K44K0,$[,4D,9pT$ `D$(D$4؉$09F8C4B<ƒ1ŤŠEOPTEV~pUUJP,4$0A 4,OPDŽPBE5MMP!PCW(ȁs,$L$4$0Å8X,4H0@44,-0 1s0 ,40 ,1!4e0l 1,40H 14c,0 14,,0 ,&Gwҋtr1m94s4@40 4y1441144141411ۉ411441UE $U1]UE$U E]UE $U1]U U|]UWVS }u >}0D$$M+D$t$$`‹U$4UtUuE2$ƅ_EE[^_]Ë}ut$ D$$M$E2@ x tbMut$tD$$EQ D$$$辡 Ex tUE9ED$D$ht@E$/ tEftUft IA(Q|uEt E1$t!D$D$$=RB($\tD$D$$ RB끍h D$$} D$$_t$tD$$EtD$$/UVS1 EtD$ E D$ED$E$ƋEt$0[^]ffffUWVS öƉEωD$$詹 tB4$蕷 ƀ?u1)9tXzzt"D$|<$- …uۉ<$_ 9t 1[^_]Ét$ED$<$4 [^_]ÉUt$ED$<$4 Uu[^_]UWVS$ uEUt E<t]o $[^_]É΋Ex thE%1p]S9sbD9rEtfEt(%D$$%]ˆ]C \ExtftEx(1ba?0Vu~9Vt"VT$<$]'ljFVEptft]CPSD  Ћ]P|‹]Kf:`JBftKɍD$E@$xmUu$pEE܃@[^_]ËMAOMփ_EtfEtǤ$jpE܉$_pEP p,@ @(@$@,ׅU5My tpL$ T$D$E $2tq}tWytYWytDWxMy ufqUE$soEp@@LEMA@AHADALucfx@1ED$ T$UT$t$D$D$ ED$D$E$Ktwm7GED7ntsuPUP|1늃}tXpx11EnMx. 11EMIuE4$WnE܃@[^_]px11Eu؉4$*nѨu2u>Mu$IEUw r}fm밍u$ E0UUWVS àUJEtB9swt$U$&jUt]rJ] fBB ]fBxzE:us<u.u'EBB [^_]Ëu1[^_]äftfu%u0tى4$pdU[EfUWVS ÓuVzF9sHtT|$$$it8~VM f FHNMLF [^_]Ëu1[^_]É<$cUWVST$  ED$,E$6 D$|$]a: xD$|4$]k HM4$]褖 =M t<$荖 = E$]t =n D$$P]fÉE@ t$$Ut E t E D$,E$*E, EEER.EȋEE u<.tk)ύ)ȍD$4$ʊ t [^_]U £E=w ̛]1]UWVS uu4$p UT$ D$D$4$5i}-?L) RЍ)Ѝ̔GEeE)  IȍE) GE*S)ύɍ̛D$4$躉 t [^_]fffUWVS4 ÆufF(}ȉ|$$p t4[^_]É<$PM1".&.&.&t9ufV(4[^_]UWVS$ u   ƞ7fV EĞ7 4$&V(EfD$FD$  $U蜦=UwDE |)ʉM싆t7T$UD$E$[U9sUJM|M))‹FtIT$UD$u4$U9r4[^_]1$Ğ7[^_]ËUыU|UVS ÿutgF$ZF$ZF$ZF $ZF$$}ZF,$rZ4$jZ9  t 1[^]ǃ  V ?  @J +  @tÍpffffffffffffffUWVS lj$U߄ D$$ 衒 Et$UT$U$:9UuED$$ a 1[^_]ÉUED$$ A $<UD$<UDӔ UWVSd& 9EEEEƍEE> tqE9D$t$U$:Utˋ$ <$;UDŽ! 8Euu>vt1< tHv0FFU$;$;UDŽUWVS< g9U1ҍ Ӭt"uג Džguԉ@!&.&O@6ƒ:uƅ/nFu$W>$8& .Ɖ$9D$v9t$t$ LD$D$o4$8?E+<[^_]rD$@|$/$r:tW.&P:uVpƅ끋1$a8Ɖ$p;Ɖ$?8D$-8$!8D$/;$8D$7賢$苣趢$8tv$ƅD$/4$/tY1ɉL$CT$/T$CT$ |$D$4$t$}vD$$(1҉T$CT$ |$D$4$u빉ogvIUWVS Õu}D$:4$ES t!D$cT$$ t|$E D$4$5 [^_]ËU t考 [^_]UVS - uD$:4$R t!D$cT$$$ tE D$4$q [^]U ¶Ewt ]1]ì]UWVSh rEu 9M9}xUED$ vD$D$@U$Up;UƒE9~ЉEΉ )t$|$ʉUM$3MUӉϋʉU$4uD$4UD !}|$t$$~3uU+u h[^_]ËEaUWVS`# EM 97upUMED$ vD$D$@U$U:UD$$ a EED$ML$ED$i1;EUT$$ u>) %!`ut$L$$'1U+uW`[^_] U$_3ED$P3UEDw UWVS` êEU97t$\pwbtNT$E UD$ T$vD$D$@T$$T$8T$Mt>$uT$ U MT$L$$*j L$\+u`[^_]ø;UWVS Exw|Mt_TƃtAƍU$1ED$1UED [^_]Ãu$1Ɖ [^_]UWVSpV 3}EU 9u]]p3MmLm8@EEߺ81tEI}E )|$t$ʉUM$]~/MUЉ΋ʉU$]0}D$r0UD蜈 !\$T$$]g ]U+p[^_]ê0f%CD$D$ ]iD$D$@}<$5mo8뎉f>~%E~LSC9u1Yf7k]誇  ]5US EPw*Ӑtk -[]ÃӬu$'2[]US ÉEPw*Ӑt -[]ÃӬuU T$$^ []UVS G ,uD$:4$J t!D$cT$$>w tE D$4$ [^]耆 - [^]UVS ôuD$:4$gJ t!D$cT$$v tE D$D$4$, [^]ËE D$D$4$ [^]US I .EMPw*Ӑt踅 - []ÃӬuL$U T$$, []US UBwÐt1[]Ãìu$\ []UVS ÃuD$:4$6I t!D$cT$$u tE D$4$ [^]ׄ - [^]ffffffffffffffffffUWVS  uE1ҋEL xtGEljу1Uvt 2uU@u [^_]UWVSĀ a}E|9xƋE pLA EL1 E|1E]ELI Eƒx  EB A ǁE9uʋE%u   EpxEPMHx }1E]u=.t&.&.&.&.&.&.&.&J˃4x MN K u9uʋ]uE%BzBE9:xE+1[^_]ËUL 1ۍ UL @tBEtʍЉʍI$ wu1묋}LA E@1ۍEL1 EEEu1}}}8tDAuEƃ@E}t,ى%I$))9D E9u }C\uEL^@]񍘌1҃DD  u̓E9uEL- :*.&@t$ELDu۸@u܋}L ƇL }8LT 8L 0u}L ], ]Ec M{ }~Et M  ЋU 1ҋMDŽ, DŽ0  r1ɉ]].&.& u]U1 L ȉу9uMՉʉ EMU1.& L ȃ9uMՉʉ MEE@twM Љʃ Љ Ѝ Љ ЋU‹Elt a1v`,tEUEEt @Eǀ -]UWVS`R 3uE EM9ENjE1ȉ܉ %Ev㪪UUUUUUUU ]% ȉE1EEL- EE$t&.&.&.&.&Eƃ4x  EF A Eu1E1EE܉}ԉ..&.&.&.&.&EEƃ4x  NjF A E؃uĉ}EEpEEE E<}Ǎ)Eˉ]܋E؋}}؉EE}}EEu]EË}1u!u܋11ًF11}݉]Љۉ]Mɉ]ċEԋL ]3L ]3L ]3L 3L! 3L" 3L# ]3L$ 1EEԋL% ]3L& ]3L' ]3L( 3L) 3L* 3L+ ]3L, 1E؋M؋}1ȋ]!؋u܋]3<1Ë}3L>1}uL u3L u1E䋼L% u3L& E1ljE3L 3L' 3L 3L( 3L! 3L) 3L" 3L* 3L# 3L+ 3L$ E3L, }m1u]E؋}}8E%MɁ ȉEE%MɁ ȉE1E1L E&.&.&EE0Ãx  NjC A EuċE8upuE+u(1`[^_]ËuEE$ UWVSP} fEЋ}] ]9EƋE1;$]܍ut&.&.&.&9u$E<_tpuEЍv]U+%P[^_]< t<:tًEPt΀ tɀ:tĉEĸEE]Ѝ, }}̍?tLD$ D$\$$.t&Ҁ09u$?uE]Ј, E؃0 , }EủEԋE؀`SŃ?49E ЉEȃm9Muċu̅E؍X]PE]Ѝ1 ]1ۉ}u6NŃ?}t}<9Lü ˃gu`€@DN뺀@~SGS҃?E؀8*)x0EЍvN҃?pڋ}uE̋MȉËEȉD$ T$t$EЍD ${EfU Ѓ?S?S ?SEfU Ѓ?S?S ?SCEfƒ?S ?S CC E};E؉D$<$AE؉D$<$vE؉D$<$U ]UWVS譹 E9EEXUэuUS1M䍶J 9uMZ9uԋU$E+u 1[^_]Ë]mUWVS,+ E؋U9E]Z}uU܍S1MJ 9uMZ9uًU܋E tjUD$ D$|$<$[U8uB.&˃9uPF9tӋ}E+u1,[^_]ø딋]UWVSDI 2U uU9‹E1DžDžDžvJ88E+1D[^_]D$D$D$ D$D$$: @D$$  @D $9sӉ t׉D$@BD$ <$L$  $?29:?!~95?J901?߲9,?+59*?x}9*DžTDžJD$$mD$$Q(D$$P4?9ȉ)ډщ‹09<Ѓ D$0ED$,D$(D$$D$ D$D$D$D$D$ D$D$<$$D$$vtD(,481Ɖ 1 09<DžuDž@fDž WDžHDž9Dž*<UWVS Eu 9E1D$D$LI $)DžDž4$8$u vt$4$Ɖ$)] DžD$$8vu[x=uUT$$l D$$: DžDžDž DžDž,h|$4$-pt5tmuIT$$x'멍T$$ye뇋$01U+Ĭ[^_]ÍT$$.x+t$v$P] uDž't$v$+] DžOD$$ƉDžDž|Dž[<Hv2CȍyYz) ӍQ!ӺZ) ! ڍYп9) Ӄ! ҉+у>Ã/Ӄ? щ҃A! =ЅD$$t*D$ 8D$D$p$$ .[4$Y |$0|$,D$(|$$D$ T$|$||$D$t$ D$D$$@D$ D$$D$D$4$D$D$|4$D$D$p$)$&D$vD$@J.$UVS諭 Ðuv$‰)Ѓ[^]øh`UWVS4e NÉED$vut$u 4$pX u3D$ ED$$EE8$E $]qh`)‰UE E h`9t$u+E E܋E$]V NjED$ut$u t$u܉t$ vD$D$blK E$LK t$|$ ML$D$E$}v/lj|$t$ ED$D$<$g9]uىE D$E܉D$ED$ED$ ]䍃vD$D$b}<$U^D$O O ȉD$$EPU9uD$]^K _K  LK ȉD$$dEPU@D$D$4$E4[^_]14[^_]+M MXELfffffffffffUWVSˉU23]333 13Ή 3 13 43 1343 1343 1343 1343 13 43 13$43 13(43 13,43 13043 13443 13843 1΋<1щ3 13@ 3 13DE] [^_]UWVSljEfM}܍H1ۉu1f;]ƃ6 u1M9uΉEE}EE]܉UEEEC9uE荈Eu䍙uΉUEEEC9uuE9uă[^_]ÉƻHUWVSs H9ЍPH USD̯f`TE\Ƌ@1f;` ؀u19Hu111ۍhXdLH1`f Ѐuዕ`1Љd1fN Ȁu1hXLTd\hx\9YTP0`HP1\f? uዽ\1Љd1fN Ȁuዕ`1ЉhXLTdh`GP9SP09->1ۋT@*H98uԋX1ɋT1`f\؃ ؀uዝ`9uŻ@`TXO9uu⋽`E؉`]BbJ9uߋDfǂ L $2?ƂL aD L Ƅ L $,T$ vT$D$$7H4$4H `D$HD$T$14U+[^_]Íxƅ?n)nOPEȉHTDUWVSY >u(} 9E14$G $?$u 1H t $t9u틽)x  @4$$D$(|$4$ D$vD$4$T$|$4$}<$T$D$(L$<$T$T$<$$D$(L$<$v|$0, $}$lj~T$,D$4$&Dž0Dž4Dž8Dž<$D$#,D$<$u։fǃL $1ƃL $ D$D$L $ dD$xvD$ B$et$,$m1<$ʉ)Ѹ%I$))Љ)‰ ;$D$(D$<$ ɋoD$,D$<$|$,$:L 򉓌L D$06 < ȉD$$L L D$17 = ȉD$$L L D$28 > ȉD$$TL L D$39 ? ȉD$$L L D$4: 5 ȉD$$L L D$;T$$L PL @D$D$,$E+[^_]D$,D$<$ ɋ$D$(D$<$l|$,$y$D$(D$<$6p D$D$<$ ;$D$(D$<$[ D$D$<$ &(D$<$$Dž0Dž4Dž8Dž<Dž Dž DžffffffUWVS蚖 MMUu9ƋE1@6Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\Ey1ۍTt&.&.&.&009u$ͯD$@|$<$0E D$D$<$|$$,<$耯D$@t$<$D$t$<$ϯ|$4$E+[^_]Éu4$ UT$L$4$qt$4$膱Dž6666Dž6666Dž6666Dž 6666Dž$6666Dž(6666Dž,6666Dž06666Dž46666Dž86666Dž<6666Dž@6666DžD6666DžH6666DžL6666DžP6666DžT\\\\DžX\\\\Dž\\\\\Dž`\\\\Džd\\\\Džh\\\\Džl\\\\Džp\\\\Džt\\\\Džx\\\\Dž|\\\\E\\\\E\\\\E\\\\E\\\\E\\\\T趿fffffffffffUWVSa FutJD$ED$4$NjE9t58u0L 8"tE 81[^_]ÃuE L UVS ͜EU ]~<Ílt&.&.&.&у? H9u[^]UVS藑 pEU ]~Í у? H9u[^]fffUWVS8A &ƉUċH0<@,9s1V8UEV(U}ԉEE܉MF4}ĉ}9sMt$}ȉ<$et8[^_]É<$uEĉ|$4$2Eă8[^_]U蜐 }Et'tu-E t: w]ËE t#v]ËM t w]1]Ív]Ív]Ív]UWVS* u} 4$uw[^_][^_]UWVSd ǚu}$}(E($IEEE(EEEEEEEE EEEEEEEԋE E؉u܉uEEEE8Euu4$…u?}4U4…u%tE(usKu?u8M,tE0uVUE(D$}<$<<$ UЃd[^_]äftumt׉UE4D$ ED$E0D$E,$5UtE(D$}<$ E0D$E,$ <$4 jfvE(d9%U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$9]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$`]U4D$0D$,E,D$(E(D$$E$D$ D$E D$ED$ED$ED$ ED$E D$E$]U4D$0D$,D$(D$$E(D$ E$D$E D$ED$ED$ED$ ED$E D$E$]UVSf Ku4$u1҉[^][^]UVS. u4$u[^][^]UVS ؕu4$Zu[^]}[^]UWVS跊 Ü}u <$…uL}wPU>…u6t-11U.&2 у9uUɃtЃ[^_]úUWVSX+ M $4 ƉEE$ljE4$}ƉEE EEEED$ML$}<$/t.1EM $M $4${EX[^_]ËuE$EtED$t$<$몸Ǹ1UD$ ED$E D$E$]UD$ ED$E D$E$]UD$ ED$E D$E$]UWVS蹈 Þ}u <$ …u>I…u1t(11Uv2 у9uUɃt Ѓ[^_]úUWVSB '}u <$ …uG…u5t,11U&2 у9uUɃt Ѓ[^_]úUWVS‡ ç}u <$& …uGM…u5t,11U&2 у9uUɃt Ѓ[^_]úUL -E##+ፂw]Í$]Í ]Í ]Í+w]Íx]Íx]Íx]Íx]Íh ]Í ]Í ]Í}x]Í ]Í( ]ÍP ]Íp ]Í?w]ÍRw]Íhw]Í}w]Íw]Íw]Íw]Íw]Íw]Íx]Íx]Í.x]ÍGx]Í`x]Ínx]Í0 ]Íx]Íx]Íy]Íy]UWVS אEwrE$2NjE $2ƋE$2E|7E$e2EU׋E$P2ƋE$j2 [^_]Ãu$K/ tffUS ? (U T$D$U$裬 []UWS] }Èĉ Ⱥu?u0t 1t 9s\9r[_]fɪUWV}u uu.tft^_]tfUVS]u 1ɍt&.&.&΋T11Tu[^]UVS u Ee…t5҅u.URG0D$D$4$?GD$D$4$>G,D$D$4$>G(D$D$4$>G8D$D$4$>D$D$4$l>G D$D$4$I>GtO L$D$4$/>GD GD$D$4$>GtOL$D$4$=GD$D$4$=GtOL$D$4$=GDuoG$D$D$4$=G tW$T$D$4$h=D$@D$4$AE+uG[^_]ËGD$G$GsG D$G$jG حU蜀 UM ̲tt M U],]UWVS4d MMU 9ËE1Z? 4z v2z101x9u싵9uߋD$ t$AD$$&D̲ɋtxD$$̲ҋtFD$4$2Z ̲tt\$4$d2Z @@t!\$4$ЋE+u&4[^_]É4$T؍腫UWVS C~ ,E}u E_N VUu}A1)փE}Eu[؋})@1)փE<tȃE΃\$D$ 4$|$]' [^_]ÍC)<}D1E)փEGut|}D1E)փ딃@1)փwUWVS0&} }wt1ҋGtl1ɉE܅tDM1M؉EEE܉D$|$ML$ D$4$f;~rϋM؉tw뫋E܃;Gsw10[^_]øUSE{x-P XPPHPXJP$H )P,JH09P(P4P@@B "f.&.&.&.&^_X9uۋ;Hu̲tD$$]E+u <[^_]Ë蹥UEU Mt t]%]UWVSX_x DuU 9E1V(F =?Bу+?҃/ [^]UWVS É։ϋMER)ЃEE9DE11փE? كCwʋE9EuljUt)?UZE [^_]9us vE܃EE9^EE [^_]UWVSEUEEECM]}Ov&}Wu;>}}UMڍ{sz) ֍K!ιZ) ! sп9) փ! Ӄ+Ӄ>փ/փ? уA! ځ$}w ҅UuU}:[^_]1[^_]UWVSƉU0 w'1r0 wv1ۉ؃[^_]9t}0t ؃[^_]Ã9u׉UWVS Z Áeu} FEFED$E$?$ug$EG D$EUT$<$q u?MF8?$u#vu=uGUDžtEF8?$umt [^_]À=uG}t܋UV,8,uрxtuˀx=uŃtUV(8,uxpux=uztUV0V48$uHEEFiUV8$ZHEEDž>EFFFF F$F<F@FD4$t? [^_]øUWVSXX ðc}EE9UE1D$E$ƋẺ$E]} Kf$OME Eĉ4$D U9$PMMȃ1MU)ƒ$v=yM}BEŰB8D$YUĉT$ D$D$u҉uȉ4$i4$ ‹E9BPBMыE)Ѓ]$m=yM}x}E̋@,D$EĉD$ D$D$uȉ4$qi4$) 9M@}uȃqMыE)Ѓ,t=yM}EŰB(D$UĉT$ D$D$uȉ4$h4$ ‹E9|BceMыE)ЃK,p=yM}EŰB0D$UĉT$ D$D$uȉ4$_h4$ ‹E9BEЋM)уf$xqE̋H@$x)Ɖf$E̋0QG}̋O $@c}E+1EX[^_]Ë}ȤA}f}ȃ0fv.ft& ff vE}}oM\pEM)M&E}f}ȃW}ȃE҈AyuӉ fE҈AyuӉfE҈AyuӉf E҈AyuӉfsUMR)уt t]Ã]UVSU v$̍.&щcw[^]ffffUWVSR à]Ѝ$$0$.t&.&8$>x~$0$42z9$u͋$0A$4A$8A $<A$@A$DA$HA$LA $PA$$TA($XA,$\A0$`A4$dA8$hA<$lA@QD5т歁RQD$XT$\AHQL5l>+hD$HT$LAPQT5kAكD$`T$dAXQ\5y!~[D$T$ $0$4D$0T$4$P$T$8$<D$(T$,$X$\$$$@$DD$8T$<$`$d$$$H$LD$T$$h$l$$L$D$6_D$:OD$ +D$$rn+C,hC0kAC4كC8y!~C<[ڍ~@M]u v01pq]u11r9u]u 1[^_]ê@f5fUWVSLD ßOuE 9U1҅P?EEfEEEEfEEEEEfEEEEEEEEED$4$U+uDL[^_]D$4$<tFXF\FPFTpUWVS]Eo&U SP ST M|`)ЉEu t_QC@SDC@SD1EUU19EsH{L{`$ǃEUU =M ȉE}ωދF@VDEUF@VD1۸U9иEs11NH^LE)=w}E䍐​M u -)Љ‹u s,uu1[^_]äftuduKt11fuKu2ufPfE pE럸9UWVSOA 8Llj(UE u9, M1ɉ$H?sM?d0E1fDž2Dž4Dž8Dž<fDž@0DžBDžFDžJfDžNDžPDžTDžXDž\Dž`DždDžhDžlD$$ " p ߋ$߃}rMEuQEuHD$\$$#D$$(1,U+[^_]äfEtD$$$(Ѿ$tBXB\BPBTD$$$臾$t봋(ClUWVSd? IML$U T$9D$ƋD$`1D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\9EAP ATD$111A@QDL$A@QDqHyL)|$GPGTT$)ЍT`D$D$$W`T$D$ GD$$GD$(G D$,GD$0GD$4GD$8GD$yD$T$0s؍D$$B D$0D$ckyD$\$05D$$lD$0tD$cdyD$كh\$0D$$_ D$0&D$c]yD$\$0$D$$2 D$0D$c]yD$كh\$0D$$j D$0D$$h D$0pكp\$0"D$0Iy\$0!D$0yny_كpyyy<-y^\$0D7!D$0 كl\$0 "D$0yyzكl\$0!D$0Gzyhكl\$0"D$0yjكl\$0ٞ ؃b"D$0yDyXyكp\$0[!D$0gy&\$0!D$0Xgynكl\$0!D$0&yy`yكp\$0y!D$0nyycكp\$0<!D$0nyzzyكp\$0R!D$0d`yzzكl\$0"D$0zyy|y\$0f!D$0ytكp\$04!D$0gyكl\$0"D$0rQy^\$0!D$0By\$0|!D$0zGكp\$0p"D$0zcyكl\$03"D$0XyyLكp\$0"D$0fyكl\$0"D$04yy8ycy:كp\$0V|!D$0`y!كpRR!D$0\$08!D$0\$0!D$0 "D$0zy\$]$$aED$]݃6/!D$0"D$0yx"D$0d"D$0P"D$0<"D$0("D$0"D$0!D$0p"D$0\"D$0H!D$04]كl\$0$_t E؋$zt كp\$0>~n!D$0 P"D$0 2!D$06 "D$0!D$0f !D$0H!D$0* !D$0 6~!D$06@ `!D$0IB!D$0 $"D$0q!D$0v, !D$0Xa"D$0:b!D$0!D$0|p!D$0gR!D$0N4"D$0!D$0!D$0h6!D$0J!D$0,!D$0!D$0b!D$0,D!D$0m&!D$0"D$0x !D$0Z!D$0"D$0*"D$0"D$0"D$0r"D$0^"D$0JzAكh\$02كhJكpzzكp\$0@J.t$D$$bt$ D$D${$k\@J.D$ D$D${$98@J.D$ D$D$tz$R@J.D$ D$D$l{$ՙ@J.D$ D$D$9z$裙@J.D$ D$D$z$q1!D$0@J.D$ D$D$bz$0M@J.D$ D$D$z$g@J.D$ D$D$%z$̘a@J.D$ D$D$z$蚘@J.t$D$$Nt$ D$D${$W @J.D$ D$D$Mz$%@J.D$ D$D$z$@J.D$ D$ D$ $@J.D$ D$D$*{$菗4@J.D$ D$D$S{$]l@J.D$ D$D${$+@J.t$D$$t$ D$D${$o@J.D$ D$D$z$趖q!D$0@J.D$ D$D$>{$p5@J.D$ D$D$z$>@J.D$ D$D$tz$ @J.D$ D$D${$ڕ@J.D$ D$D$z$訕]@J.t$D$$\t$ D$D${$e@J.D$ D$D$bz$3@J.D$ D$D${$@J.D$ D$D${$ϔ@J.D$ D$D$z$蝔@J.t$D$$Qt$ D$D${$Z@J.t$D$$t$ D$D${$@J.D$ D$D$z$ffD$1ffffffffffffffffffffffffffft+H t$P$tPt;uB-4?øUWVSUʋX{8C,uK(C,C4C09svK4)ȉE9sUEϋu)փ=tftЋu))щ‹{8u΃C4C,C01[^_]Ëu)ƃtftC4C,C0ΉMD$K(t$H( $P ljC8U 뗋EC4S,9t[C4C09z}C0mC4C,C0^fJ1u0u\%u5ufEff_P@US]SB CCCJ u^B4?BBBBB$B<B@4JpJTJPǂǂ[]ÃK0뚸UEtH tP$t Pt;t]ËJ4?wB,B0B4E]UWVS u] NjFxr/|ug1ۋP8t9X(tET$V($V$E@8x X(5u6F@,@0@4u [^_]h| ۍSv [^_]UVS  ]E81}8tmCC tvS(s$taD$D$$ЉƅtoC@8@4?E D$$tt$C($S$C [^]DK$C C(1vиUED$ E D$D$E$]UVSEM t]X tVP$tOPtH;uDB-4?w7t-x:t&(r@1 w#EB?EEE@D$D$$]@UBu܉F0B??E E@}EmEE@N?EP B M}]؋u.t&.&.&Fǃu}M]؉uKwE*]ЍuFPFX lFTF\FG?} mmUԋE@H?}؃ U E܋]ȉX PUԉxu}~<}~@ỦT$lj$]\/ }ȋPU]ԋ@E؋Fߋuԃ(tftE@t E@ >)UUԋExD})щHDE@uFDF:?E@}W$tB}GDG;?uV$tB$uFЍt&(M9}U؋u.t&Fǃ9u}MU؉uffB " f= fuN9}U؉MuԋE).&.&s9u}EEUȋ]4EuFD]FH?.)W,WUUMЉ‰EE!MUЍ D89U\ uuUԉ}}|;v.&.&.&.&.&.&.&BEME!MMȍ MDM9 uu}؉U)11]؋uvFǃuu)ƋE@DCE@ E@ : t$EԉD$UB$]gUB)uuԅRuU؉]ԋE@$t]XE@t @ E@7?11U؋] MU؉]ԋUvm)E]艃{DE@M?UuMU؉]ԋ}EG<0EЍXu܉FE@Q?EuMU؉]ԋ}uVdFh ^`}mw EЍ E@ E@  t$EԉD$UB$]DfUB)uuԅRAE@G?} EEuFHUVLFK?fM9}]؋u7t&.&.&.&Fǃ9u'm)EU艂zD Eǀ@??N}MU؉uԸЋU!Ћ}GDGDU)]$}}M]؋u)&.&Fǃtu[}wr}M]؋u}M]؉uԋ]̉؋u)}G}G E@O?EpEE11]؋uh}]؉uԋu]^DF$tXVt ]C }G9?EEG}M]؉uԸЋu!]CHu)U[EЍ{EPD@B?} EESz@EЍ|]܉CE@Q?EL}M]؉ut }1uF$t @0V EB))9EEЍX>tBO)ڋ]ڋ_ۉD$T$ $]b]CU܉B0S 1 EH];XEЍ}U܉BE@Q?EEE)N9'}U؉MuԋE4.&.&.&s9u{EЍ6|]܉CE@Q?mmUE}ȉU؋uԋ}Q })EM9MBMql}ԍ qUu4V)ʃtUfQt9tUfytfyv9uU؋u}~lbuu}؉UԋU}]Zf]m)uUT$UEԉD$uF$]`FUUQfU_EȋU;B4EE1}}!EED$ED$uF$]w`FEЍ{ ։u!މ Mt M9M]]}}؉EEF&puMu!MM΍ MtM9ou]}؉EKEXL@I?E@l@E?1N9{}U؉MuԋE6v.&.&.&s9'uv}ȉU؋uԋ}Q})E_]MU؋uԋUwHEЍQ&].&.&.&fDSt9uE@l}荇4GpGPGXD$GXD$GpD$ D$GtD$$]rf|U܉BGQ?uE u5UEP$t EE@t @ E@6?11ɋU؋]E@ TfvPEfED$ED$uF$]p]FF7MM؉]}؉EԋEQ}M)ȉ})EuE‰FD}ȉU؋uԉmU)u}twruԉփRu=E@l@F?XdPhUuEcE@ y%E܋]ȉX ]XUԉ]؉XEUP<]X@E-UUEEyYEX(u@(D$D$$][uFfED$UT$$[FF5?11U؋]]]EEx@O?]Yf]^}荇4GpGPGX WpwtL$MGXD$T$ U\$t$$] UM|]܉CGQ?pmEUB(uJJ(vLmEЍ|-EfED$ED$uF$]ZFw9ȐruF1ɉNL$L$ $]aFU܉B0eF??1҉UAE]ԋEЍ-}]U}GpGTG\L$G\D$T$ GhD$GdƉt$$]V |U܉BGQ?;f tURGmm1EĉUeE@=?11ɋU؋]E@O?UVS]iu9ƋCP8tT$C($S$CD$C($S$C[^]þUWVSuËVB0t?t*U UMu[F [^_]=>?u>D$D$$^ML$M L$$t^9Ft본FR?UEM t:P t3P$t,Pt%;u!B-4?wB tJ$A01]ø]UWVS$ EԋMM9E܉ËE1ˉECEKKExS?D@l];1҉΃ك)É؃9u͉ϋuFlE)H8xωx~l&v@ E؃]C EXu#MA,A0A4E$IExXEp@??u܋E+E$[^_]Åt-.&.&9j1u9׉@@eu~S?-FS?^<]؉}L59uEP<@@11كu`t/uG)É؃9rً}Gl]K;.m9sۃtٸ뭃9sr1t(Ѓ9s_<uP9r1O9[뀋}G@GS?_<]؉WH t7P$t0Pt);u%B-4?wB M ttB 1]ø]ÃB 1UEtKH tDP$t=Pt6;u2Jw$C?tL?u +BD]ø]BD]UEt6H t/P$t(Pt!;uB-4?w4Bp)]ø]ffffffUWVS cuMx11D rt"E pt&.&fDU9ux.t&fG0UofxZUWVS4 ~}̉ÉEЋ@,E܋{t-Ek@^S,sutftߤEw uEH,@lu6^};s9sӅz}G8‰ىuFl؉Flv,)9_ʋ}?EE؋})EE@,u~89Edž3)ƃj'E@,uFl‹uF\l] Lus<9S} 5E19믺}O\)ȉ9ۋuVlv}4M9~(u\9tDJBBF|EE[^_]D$E$E@FtFl9F\`^t]FDVLfDPTT$D$$m(dž% @9E,E UWVS]ƋCxPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$Cqt[^_]þUWVS 聞 jEuE E]E}}}}U M$:18FV ~$h}uEMQ~HHtk_} U}KB/&} } M}W} }؉1MD$D$F($V ÅMF0@*x@H0x,GC4EHKPЉSLCTESXD$|$F($V C8D$C,D$F($V C@D$CLD$F($V CDǃEHD$D$F($V C K K8{@KDЉDRE쉃E艃C$u [^_]MDV$MV F(d V [^_]øCE`{-@F4$U ED$ED$D$D$D$ D$E D$E$j]UWVS] EUCECBCBC B CBCBCBCBC B K$J$K(J(s,r,s0r0[4Z4D$D$ $ЉÅUBNjuD$C,D$B($UR C8D$C,D$UB($R C@D$CLD$UB($R CDD$D$UB($R C{8Us@KDC,uv8 C,{@uv@ CL{DMqD-{uvueu^CMQ+QS $ | 0 E[^_]älfbft.t&eft&W(f.t&fu5AfY{8f3f+0f(-f%*$E1E%ffffffff視 LUWVS<茖 uEċM uS}׃L]f.&.&2A3Ѓu߉׉MEEEE]čLUȉEuϋ1EԋM3OMЋU3WŰu3w u܋u3wu؃4E‹EE܋EE؋EU} U E34}Nj<1}}Nj<1}}Nj<1}Uȋ1EEUu} m Eu] 1}3؃uU3Q1к}3؃uU3Q1к}3؃uU3Q 1к}3؃uU3Q1ڸ}3ڃu߃ȋ]čL1UM 1ω32P3<H1ω32P3<H1ω32P3<H1ω32P3ÉEԋuu]]M ډӹ΋U)։u9fWrwwWrww)ы]uL2uȋUtrUu+ øU)9fGHOWGHOW)ULuuJE0LuTUU ھ])9 fOY_wWJOw)ًUML fu苜]u'ME;uMU]u+LƉ кu)f9OWrwWGpw )щfEDE\uΉ.EuLE]؉E$]ˉ]ERD$U_NjFD$U$WtE 8  [^_]1 [^_]UWVS &f q}GtUD$UN_ƋGD$U$t+4$艦=yarauE 0e  [^_]É4$諣1 [^_]UWVS e Îp}GtUD$U^ƋGD$U$tt+4$ =tciduE 0 [^_]É4$.1 [^_]UWVS,e pED$E D$E$tSEt4}D<$;^ƋED$<$tE01[^_]Z[^_]B[^_]UWVSd }oED$E D$E$ZtJEtZ}D<$]ƋED$<$Mt54$=yarauE01[^_][^_]É4$[^_]UWVSc nED$E D$E$tJEtZ}D<$\ƋED$<$袊t54$:=tciduE01[^_] [^_]É4$R[^_]UEU E MMM]GUEU E tcidMMM](UVSc mE D$E$gwƉ$舣=tciduE0[^]1[^]UVSb ÚmE D$E$wƉ$8=loobt 1[^]É4$mU[^]UWVS \b AmE$肊t,ƉD$E D$E$Wwlj4$ [^_]1 [^_]USb lE D$E$dvUT$$c@[]USa îlE D$E$+vUT$$@[]USa ulE D$E$uUT$$A[]USWa [ #fE$D$E7t,ƉD$E D$E$2plj4$ [^_]1 [^_]UWVS Z eE$D$6t,ƉD$E D$E$olj4$膘 [^_]1 [^_]UWVS xZ ]eE$D$6t,ƉD$E D$E$molj4$$ [^_]1 [^_]UWVS Z dEU$T$6t,ƉD$E D$E$ olj4$— [^_]1 [^_]UWVS Y ÙdE$D$6t,ƉD$E D$E$nlj4$^ [^_]1 [^_]UWVS PY 5dE$D$5t,ƉD$E D$E$Cnlj4$ [^_]1 [^_]UWVS X cE$D$=5t,ƉD$E D$E$mlj4$藖 [^_]1 [^_]UWVS X ncE$D$4t,ƉD$E D$E$}mlj4$4 [^_]1 [^_]UWVS &X cEU$T$x4t,ƉD$E D$E$mlj4$ҕ [^_]1 [^_]UWVS W ébE$D$4t,ƉD$E D$E$llj4$o [^_]1 [^_]UWVS aW FbE$D$3t,ƉD$E D$E$Tllj4$ [^_]1 [^_]UWVS V aE$D$M3t,ƉD$E D$E$klj4$觔 [^_]1 [^_]UWVS V ~aE$D$2t,ƉD$E D$E$klj4$D [^_]1 [^_]UWVS 6V aEU$T$2t,ƉD$E D$E$+klj4$ [^_]1 [^_]UVSU ú`E D$E$7jƉ$X=gntst 1[^]É4$'tU[^]UWVS xU ]`E$%%t,ƉD$E D$E$tjlj4$+ [^_]1 [^_]UWVS U `E$$t,ƉD$E D$E$jlj4$В [^_]1 [^_]UVST è_E D$E$%iƉ$F=atadt 1[^]É4$kwtUEt 4$+wM[^]UWVS RT 7_ED$E$iut,ƉD$E D$E$Gilj4$ [^_]1 [^_]UWVS S ^ED$E$ut,ƉD$E D$E$hlj4$蜑 [^_]1 [^_]UWVSS s^E D$E$gƉ$=gntst 1[^_]É4$$P$UDžtڋUT$D$4$$t U:[^_]É<$1UVSS ]E D$E$dgƉ$腓=gntst 1[^]É4$=$tU[^]UWVS R Ê]E$R"t,ƉD$E D$E$glj4$X [^_]1 [^_]UWVS JR /]E$ "t,ƉD$E D$E$Fglj4$ [^_]1 [^_]UWVS Q \ut*t$E D$E$flj4$謏 [^_]1 [^_]UVSQ Ä\E D$E${Ɖ$"=loobt 1[^]É4$WzU[^]UWVS FQ +\E$lyt,ƉD$E D$E$蝊lj4$ [^_]1 [^_]UWVSP [E $yt%ƉD$E$Plj4$裎[^_]1[^_]USP |[E D$E$sUT$$.[]US^P C[E D$E$:UT$$I/[]US%P [E D$E$UT$$/[]USO ZE D$E$ȈUT$$/[]USO ØZE D$E$菈UT$$0[]USzO _ZE D$E$VUT$$ 0[]USAO &ZE D$E$UT$$A0[]USO YE D$E$UT$$0[]USN ôYE D$E$談UT$$0[]USN {YE D$E$rUT$$1[]US]N BYE D$E$9UT$$"1[]US$N YE D$E$UT$$.1[]USM XE D$E$džUT$$;1[]USM ×XE D$E$莆UT$$;1[]USyM ^XE D$E$UUT$$;1[]US@M %XE D$E$UT$$T1[]USM WE D$E$UT$$T1[]USL óWE D$E$誅UT$$`1[]USL zWE D$E$qUT$$m1[]US\L AWE D$E$8UT$$m1[]UWVS !L WE$D$((t,ƉD$E D$E$qlj4$̉ [^_]1 [^_]UWVSK ãVE $D$'t%ƉD$E$lj4$p[^_]1[^_]UWVS bK GVE$D$i't,ƉD$E D$E$貄lj4$ [^_]1 [^_]UWVSJ UE $D$'t%ƉD$E$^lj4$豈[^_]1[^_]UWVS J ÈUE$D$&t,ƉD$E D$E$lj4$O [^_]1 [^_]UWVSAJ &UE $D$I&t%ƉD$E$衄lj4$[^_]1[^_]UWVS I TE$D$%t,ƉD$E D$E$7lj4$蒇 [^_]1 [^_]UWVSI iTE $D$%t%ƉD$E$lj4$7[^_]1[^_]UWVS )I TEU$T$1%t,ƉD$E D$E$zlj4$Ն [^_]1 [^_]UWVSH ìSE U$T$$t%ƉD$E$'lj4$z[^_]1[^_]UWVS lH QSE$D$t$t,ƉD$E D$E$轁lj4$ [^_]1 [^_]UWVS H RE $D$$t%ƉD$E$jlj4$轅[^_]1[^_]UWVS G ÔRE$D$#t,ƉD$E D$E$lj4$Z [^_]1 [^_]UWVSLG 1RE $D$S#t%ƉD$E$諁lj4$[^_]1[^_]UWVS F QE$D$"t,ƉD$E D$E$@lj4$蛄 [^_]1 [^_]UWVSF rQE $D$"t%ƉD$E$lj4$?[^_]1[^_]UWVS 1F QE$D$9"t,ƉD$E D$E$lj4$݃ [^_]1 [^_]UWVSE ôPE $D$!t%ƉD$E$/lj4$肃[^_]1[^_]UWVS tE YPEU$T$|!t,ƉD$E D$E$~lj4$ [^_]1 [^_]UWVSE OE U$T$!t%ƉD$E$rlj4$ł[^_]1[^_]UWVS D ÜOE$D$!t,ƉD$E D$E$~lj4$a [^_]1 [^_]UWVSSD 8OE $D$ t%ƉD$E$~lj4$[^_]1[^_]UWVS C NE$D$F t,ƉD$E D$E$E}lj4$蠁 [^_]1 [^_]UWVSC wNE $D$t%ƉD$E$}lj4$C[^_]1[^_]UWVS 5C NE$D$t,ƉD$E D$E$|lj4$ [^_]1 [^_]UWVSB ÷ME $D$#t%ƉD$E$1}lj4$脀[^_]1[^_]UWVS vB [ME$D$t,ƉD$E D$E${lj4$! [^_]1 [^_]UWVSB LE $D$dt%ƉD$E$r|lj4$[^_]1[^_]UWVS A ÜLEU$T$ t,ƉD$E D$E${lj4$c [^_]1 [^_]UWVSUA :LE U$T$t%ƉD$E${lj4$[^_]1[^_]UWVS @ KE$D$Kt,ƉD$E D$E$Jzlj4$~ [^_]1 [^_]UWVS@ |KE $D$t%ƉD$E$zlj4$I~[^_]1[^_]UWVS ;@ KE$D$t,ƉD$E D$E$ylj4$} [^_]1 [^_]UWVS? üJE $D$'t%ƉD$E$5zlj4$}[^_]1[^_]UWVS z? _JE$D$t,ƉD$E D$E$xlj4$$} [^_]1 [^_]UWVS? IE $D$ft%ƉD$E$tylj4$|[^_]1[^_]UWVS > ÞIE$D$ t,ƉD$E D$E$ xlj4$d| [^_]1 [^_]UWVSV> ;IE $D$t%ƉD$E$xlj4$|[^_]1[^_]UWVS = HEU$T$Lt,ƉD$E D$E$Kwlj4${ [^_]1 [^_]UWVS= }HE U$T$t%ƉD$E$wlj4$K{[^_]1[^_]UVS>= #HE D$E$vƉ$}=gntst 1[^]É4$ytU[^]UWVS < GE$ t,ƉD$E D$E$9vlj4$z [^_]1 [^_]UWVS< kGE $3 t%ƉD$E$vlj4$@z[^_]1[^_]UWVS 2< GE$ t,ƉD$E D$E$ulj4$y [^_]1 [^_]UWVS; üFE $ t%ƉD$E$>vlj4$y[^_]1[^_]UVS; iFE D$E$`tƉ$|=atadt 1[^]É4$,^tUEt 4$]M[^]UWVS ; EED$E$*\t,ƉD$E D$E$dtlj4$x [^_]1 [^_]UWVS : ÖEED$E$\t,ƉD$E D$E$tlj4$]x [^_]1 [^_]UWVSO: 4EED$E $f[t%ƉD$E$tlj4$x[^_]1[^_]UWVS9 DED$E $[t%ƉD$E$Ttlj4$w[^_]1[^_]UWVS9 ~DE D$E$urƉ$z=gntst 1[^_]É4$ P$UدDžtڋUT$D$4$ t U:[^_]É<$1UVS 9 CE D$E$qƉ$y=gntst 1[^]É4$H tU[^]UWVS 8 ÕCE$]t,ƉD$E D$E$rlj4$cv [^_]1 [^_]UWVSU8 :CE $t%ƉD$E$rlj4$v[^_]1[^_]UWVS 8 BE$t,ƉD$E D$E$Yqlj4$u [^_]1 [^_]UWVS7 ËBE $|t%ƉD$E$ rlj4$`u[^_]1[^_]UWVSR7 7Bu t#t$E$qlj4$u[^_]1[^_]UWVS 7 Aut*t$E D$E$jplj4$t [^_]1 [^_]fffUWVS6 ÖAE 0Ft%uFt$s4$k1[^_]Í$M <$fFt<$W1[^_]Ét$@M ${<$3FUS(6 AD$$M $̝D$@M $1[]US5 @EU 9t8J 9H u(Rt<@t-T$$[]1[]ø[]ÍpˍpUSq5 V@E @tUT$$C[]Íl D$ D$D$t $mUS5 ?E @tURtƉUM썃D$$$ KDž D$<$(qwEGEG t [^_]Í$M E$o|$@M $E9t,$pE$Ct4<$$}[^_]ËE$듃uE$끋G$UWVS 2 =u} D$|$4$|u 1 [^_]ËED$4$yt|$4$} [^_]UVS2 y=$ ƅt' D$4$oFF F[^]UWVS>2 #=u$ 詨… D$$UoUBB BU4$EE$VUt]NjMs"EtfEtBEB Ѓ[^_]׍}D$ PD$D$/ $$Lo1UVSQ1 6<ut4$-[^]%}D$ D$D$} $IUWVS0 ;Etw} |$ ED$D$$ʘƅxEH $M5…t1|$ ED$ML$$U蓘U1{[^_]1[^_]Í}D$ 4D$D$U $U30 ;UT$8$]UVS 0 :ut4$[^]}D$ D$D$} $UWVS / Ð:utb 9uXFt@~ G$…t>FtAD$$U5U [^_]K4$l [^_]1 [^_]ÍpUWVS / :utJ 9u@~ G$…t,Ft/D$$U~U [^_]1 [^_]ÍpU. 9Et 9t1]Ë@ ]U. h9Et 9uP@tt ]1҉]Íp]US?. $9Et 9t1[]ËU tH Q9Ur@tD$E $}[]ÍpU- 8Et 9t1]@]UWVS- Î8}t; 9u1G $ ƅtGt"D$4$<}[^_]1[^_]ÍpUI- *8Et 9u @t ]1]vÍp]UWVS- 7ut 9t 1[^_]ËU tM 9uFtA F EP$UDDžtŋE HɋUtOFt@L$D$ D$T$<$˔F~}~ t$Ssp븍pUWVSD, )7ut 9t 1[^_]ËE FtE $F EH $M{…tFMtI} |$D$ D$L$$UFUV}~ t$苪op믍}D$ D$D$; $US\+ A6Et 9t1[]ËM tM 9uL$$mUS+ 5Et 9t1[]Ë@tU T$$[]ÍpUS* æ5Et 9t1[]Ë@tU T$$}[]ÍpUSm* R5EU tG 9u=t99 u5Rt@tT$$"[]Íp@uፃpٸfUS* 4Et. 9u$@tU T$$[]ÍpfUWVS ) Ø4u~(Ft  [^_]D$ED$ D$D$4$tȋUBU$؟DžtFD$ED$ UT$|$4$dt}M9Muu>uyF8"udF1M Z$ oƅt' D$4$PfFF FE 0 [^_]É<$臧D$?fD$4$tՋMofffUSEU 9t5X2Zt$X@xJxJ13B []1[]ø[]US( 2D$ $PM $[]US' ÿ2PM $[]UWVS4' ×2M EpAQAtp}D$ T$L$D$ uԉ4$觏D$|$E$Bqt2t$E$"nt|$E$7r4[^_]Íg14[^_]ÉD$ T$D$D$ uԉ4$%yD$ lD$D$\$UVS& Ç1E 0t$lM $4$d1[^]USh& M1D$PM $ LD$lM $1[]UVSM UBAt%tOYI2B9r39[^]Äu!YI2B9|9[^]ø[^]ø[^]UWVS% Ï0ƍD$ $覐PM <$vt$lM E$Et $Eb<$JUЃ[^_]ÉE<$2$ 贛Ut֍lD$ $MbMAFAFA<$t$E$Mt+$Egb<$ÌM $襣UЃ[^_]ÉL$ME$M9uE<$臌UЃ[^_]Í}D$ D$D$M\$UVSM UBAt&tQYIrB9r49[^]Äu"YIrB9|9[^]ø[^]ø[^]U EEUM UM]U EEUM UM]U EEUM UME]U EEUM UME]UVS7# .utl9u4$`[^]1[^]UE@]UWVS" -Et l9t1[^_]@t5H@w}1һ9ˉrx9[^_]ËP@Ӂw;19ωr-9[^_]ø@c YU(" -Et l9t11]ËP@]U! ,Et l9t11]ËP@]U! ¯,Et l9t11]ËP@]U! ‚,Et l9t11]ËP@]UVSo! P,Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVS +Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS] >+Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE US *Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE U e*Et l9t1]ËHP@txE P]USA "*Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UVS ±)Et l9t 1[^]@u:HXȉEUU19ErȋE [^]ËPH9иrE UVSF ')Et l9t 1[^]@u;HXȉEUU19ErȋE f[^]ËPH9иrE fUS Ÿ(Et l9t1[]@u%P@Ӂw݋] []ËPH9иrE UR 3(Et l9t1]ËHP@txE P]U 'Et l9t1]ËPH9иrE ]U ¬'Et l9t1]ËPH9иrE f]U f'Et l9t1]ËP@uE ]UL -'Et l9t1]ËP@uE ]U &Et l9t1]@uP@xM A]ËP@M QU ¢&Et l9t1]ËP@uE ]U i&Et l9t1]ËPH9иrE ]UC $&Et l9t1]ËPH9иrE f]U %Et l9t1]ËP@uE ]U ¥%Et l9t1]@uP@xM A]ËP@M QUSj O%Et l9t1[]ËM tM 9uL$$\US& %EU Mt l9t1[]@t Xxx3P3H []US $EU Mt l9t1[]@t Xxx3P3H []UVS v$Eu ]t l9t1[^]ËPH@uxx11 [^]UVSE &$Eu ]t l9t1[^]ËPH@uxx11 [^]UWVS$ #uEEEEVt $[^_]À~(u~-+0u xZ E܉D$}|$F$ugEUщ¸9иeEF>t"D$oD$4$VJE@U $[^_]E gE܉D$ED$F$fEUE܉U}9EX8"J&8"0fE܉D$|$F$ΙEU!Ѓt4MEFcD$ED$8"ut&4fffffffffffffUWVSP ã!<$WfvH@Ή9w u)D$D$ D$t$<$D$D$ D$t$<$fuP[^_]Ét$D$$#=_DžD$D$<$R?D$D$ D$t$<$D$D$ D$t$<$euP[^_]UWVS։ʻ1ɍ<0ufPw 7 uuf F[^_]ÍPwW ֍PЀ w0 1UWVS<G ,4$cB BBB$BBB(B8OwuBfn'"H[v*BDžT$T$4$ЄI?D$D$ D$|$4$D$D$ D$|$4$cut9Bt&уtJv狕B8G<[^_]Àttt{BJHJx"t_N[xaucxlu]xsuWxeuQHBzB(Jqxru+xuu%xeuH̃BB(N[P)D$D$ |$D$4$D$D$ D$D$4$;bu1<[^_]Ã+w{l<$O1USEt&.&.& w u[]US  E ;Et1 []ÉD$ED$E$N8 []UWVS É]u}E E $pVEvHwu1[^_]<tPVt1ZE/V}h}~,V &E t w@t)щN] t&9D$T$E $]6?/F(<>$ tHv~ " ~ t =t u)Vx"\xRPV HЀ"u"ufzEEF(>FFF F$GF]}D$ D$D$$&)щN$x>qUWVS, EUu :Z^1ɋ}t9s_;<&uCGt1EE}}"U\Et;U)‰].&.&.&9L9u]0M돋UtEEtE,[^_]À{p{;CEtA.&.&<>tuE$نprvvxEpD$~t$$t}(u GtLt51E$j[^_]ÀÉ8versuÁxsionuE tE E D$E D$}<$ot}DDžyD$t$E$@\<$DvJ~iEp[~QUD$E$]UWVS m$WFhp$|tD$D$E$gǃxD$<$茘aEЋUԉlp h!ыtJ911#l#pD$D$|$D$ D$lplp hȉdD$$\Ƌt0<$gd3D$L$d4$ollp ȋdE D$4$aNjtPD$T$l4$llT$4$+t$謃Ĭ[^_]1)<$ft$肃1Ĭ[^_]D$D$D$D$ D$hD$l$[lthȋtGL$4$+t$1nUD$E$U]fffffUE 9E]UWVS åƅtBD$$'~Et E$@zDžMu% $]1\$@yDžtED$<$@D$G$lEG,w0G4G8G<[^_]US |M $j[]US ÿ sD$,$m|M $j[]US Á D$|M $@jD$M $$1[]UST 9 ED$E $*[]US' ED$E $[]US E$kE $k[]UWVS( æ UM܋p4@,EEGEt@E<E tDMUD$E$OUMtLօuE܅tE܉1([^_]Í(~D$ \D$D$$SϋE܅t([^_]1UVS Pt@9 u6p 9rD~D$ D$D$$D$ D$D$i$UWVS v ƉEx,}UD$$xtQUtBMI0M s!MA,Q0E$}[^_]NjuӉF,V01UWVS E։ϋE90D$D$ $u)E$|E$; [^_]D$ #~D$GD$G$t ,sD$ D$GD$G$TyG,n(dGD$ED$ D$ED$<$B7E=U?upG8"G$G8:GA$xG}t"HOx"YGD$D$<$D$D$<$kD$ED$ JD$D$E$K91SE$z>W~D$ D$D$$ UWVS ×uFt09u&x<$WeƉ<$Fe[^_]Í0D$ D$D$$蓯UWVS: Ƅt1XƅtptC[^_]ÉUx<$d1ɋU'ƅtpt<$d[^_]Í0D$ pD$D$$US ÆE xt"D$ D$E$r[]Íe~D$ D$D$ $葮US: UB4tB4R,…t8$7[]Í}~D$ D$D$$-D~D$ D$D$$UWVS4 ÏUM@8t 14[^_]ÉƉ׍PU$DcMDžt6pE$6EG4$67E$c4[^_]ÍsD$,$6d|M <$aED$M E؉$E܅$w6<$`V09V4E$X6N4~,UEE؋UЉMԃD$E$qMԋUvA)D$E؉D$D$YPEF,}܉8}xF4F<<$`E$E܃,n}<}ܜ$mnEMD$ $F5UT$MA$GEM܉H<$_UT$U؉$kE܅$5<$l_E@,vu1<$/^0[^_]D$4$=t؋E EtɃF E䍃E؉}} ED$4$=;EZM9U9PU}E܉4$(=E܅UT$ D$4$~D$4$=4$<U܋T$4$P tEO49H1,hEq<$\D$4$ ?Ɖ0[^_]Ë}4$Z<E$5m*D$4$9n}эD$ 4D$D$$ަ}E$5n 4$;EԉD$4$|=~D$ 4D$D$$|UVS$ E 0t$M $AF,v u0u&Ɖ[^_]Åu2[^_]1[^_]äftt鍃0D$ D$D$$XD$ D$D$$趏Ug HEt,9u@]1]US7 Et ,9t1[]ËM tM 9uL$$US Et ,9t1 []ËM9H uU tL$M L$@$= []UWVS xu>t=~(u7Ft=D$ FT$VT$$bt F$ [^_]ËFD$U$11tՋ}O $MPEtFVT$U$MUs9}D$'D$4$ $+Pƅ,D$4$FEF~ E 0%D$ED$F $ ljEt\UF$F 9:" D$ D$D$$EE$W [^_]o8"uE$W$DOƅtEE$W1!1U rEt l9t1]ËM tM 9u9]UVSM 2lt$M $ƃM t$M $ƃM 1[^]US E xtD$E$#[]ÍUVS àuD$L$BtM 4$[^]ÍM UVSh Mutl9u4$[^]1[^]U3 Et l9t1]@]U Et l9t1]@]US þEt l9t1[]ËM tM 9uL$$fUVS vuFt [^]À~(tD$ PD$FD$F$Vu_D$ HD$FD$F$.tWD$L$#AM 4$E 0[^]ÍD$L$@M ǍD$ 0D$D$$fffffffUWVS fƅtBD$$OEt E$@KDžMu% $T1d$@KDžtED$E<$ED$G$}>EG,w0G4G8G<[^_]US ÞE$o>E $a>[]UVS iPt@9 u6p 9rt 9t%$c$Y [^_]ÉUMGE$4UNjE$3Ut$ M9t;E [^_]_D$ lD$D$T$(~A$衸MA8,uA1)UE]UWVS Ã}9GE$;3G4…tQG4tA1щM<B,U8$EMQ,E:UB49rɉ׉ʉB4G8B8UE$2UЃ[^_]1҉Ѓ[^_]UE$.t`8]UWVS åut 9t 1[^_]Í~<$\2v0<$Q2[^_]UWVSo Tut 9t 1[^_]Í~<$ 2v4<$2[^_]UWVS ut 9t 1[^_]Í~<$1E 9F0r<$1[^_]ɉUWVS Ûu~<$l1Ɖ<$[1[^_]UWVSy ^u~<$/1F8uF8<$1[^_]UWVS: u~<$0v8փ<$0[^_]UWVS ut<9u2~<$0F49E s+F,U 4t"<$0[^_]1[^_]1ލD$ D$D$aT$zUWVSm Rut 9t 1[^_]Í~<$ 0F8u`F4;E t\9E seE V,tUEE$N,UEF<U$<$/[^_]1UA܍sD$ D$D$T$yD$ D$D$T$yUWVSe Jut 9t 1[^_]Í~<$/U Ɖ<$.[^_]UWVS ut 9t[^_]ÍFE$.~49} F8V,E E EE 9sQEDE 9s>uv.&.&.&UJ,4t9uu~4F<E$.E$[^_]ËE$-%sD$ D$D$T$:xD$ D$D$T$xUS ÞEt 9t1[]ËM tM 9uL$$FUSr WD$E$[]UWVSu} ]Ct [^_]1t{(uى[^_]US D$E$A[]US ýD$E D$E$ []US ËD$E$[]fffUEU @]US^ CE$;t[]ÍD$ lD$D$p0$avUWVS0 $}`HtыpG$萍`tBtD$D$ D$ED$$Gu0[^_]ËUT$$PDžtօt$ Ku}DžPtҋ@w4$躌)T$$PtЉ4$~taNjPu냍D$ XD$D$0$tD$ XD$D$0$wtD$ 8D$D$0$MtD$ 8D$D$0$#tD$ 8D$D$0$stыt$PD$ 8D$D$0$sUEt]1]UWVSD6 $UtEDžDžEU ; u @|$t$ D$ED$$OEU t$t$|$ t$T$$Quu EM L$$RD$D$ t$ED$<$u1D[^_]ÃuvD$D$ E D$ED$$ tlEU DžDž; 눸D[^_]Í\D$ D$D$#0$qEEU D$E D$E$]UE]UE@]UVS ]C$$;[^]fffffffffffffffUWVS螼 Ãƀ8$\fD9?.&P9b/t9rw/u9t 9t8/t)ȃ=4׋!ƄfDž.$eP /.pl@istX@XXXXf@ X $ƃtb|$D$4$(9u84$q$蓩1u8[^_]u?1[^_]PƄ$fى4$g^$lj$ׁ|$4$+D$$ t84${UWVS uM ^t^F9tX^ [^_]ÉMD$$R5…FFM빍D$ PD$D$9$mD$ PD$D$:$mD$ PD$D$;$`m1<&M䍙D$4$Bu1 [^_]<\<#ED$4$t҃Et?D$$VuύT$ T$D$#$it][^_]UVSմ ]u {u/vuD$$t,u[^]D$<$ku 1[^]D$/$Nt6u Ht>D$$)u뼍T$ T$D$D$ZhE >][^]UWVS Ѿ]u {uW~uDD$$t4u~ tmu dtZD$$tu1[^_]D$<$Vt6uftwD$$,u붋vt%u tD$$u늸[^_]ÍT$ T$D$c$$gD$/$9E >][^_]UWVS 蝲 ÂUyEx i} _$(ƅI$(+FFF E Ft.ED$4$ׄuG$014$0 [^_]Í,< t~D$4$uD$ 4$tFu.D$4$tD$ 4$wpD$4$_DŽ^OD$D$4$G)D$ 4$Ex 4$/1 UWVS ED$E$;t>Ɖ$ZE WkU4$/EkU [^_]1 [^_]U D$E D$E$l]cUD$E$]UEǀǀ]UVS$ utFwyM MJ]ZMJ [^]$F&t|] X]XMH ]X뼍D$ |D$D$A$cD$ |D$D$B$c1fUWVS) Uu }t`t`tAtA}tA uutA} $-[^_]1[^_]Ãt  t L ]tL ] MtD ]뙍0D$ lD$D$Z$wbUWVSED$] u}څu59D$Ë}t E@؋T$[^_]9s+ut E|$8XD$1ۉ؋T$[^_]σL$uT9r9ڋD$)Mt}W닉u 11҉ËD$\$N D$)‰$L$ L$t$ ؉։L$T$ ӋT$L$T$Ɖ؉։d$ D$T$9rFt>Et*T$+T$D$ $|$ }GD$9D$sY+D$ T$D$1UWVSu] }Eڅu9sL1҃[^_]Ét$9s [^_]ȃL$ u;9r9r )‰t$D$[^_]Éu 11뛺 L$ )L$ D$T$L$‹D$ ‰T$D$ L$L$ L$ L$ 4$t$Ɖ9r-t&$)ˉL$|$ ڃ[^_]9$s)T$щUWVS }|$u ]Eu9sA1 [^_]9s11 [^_]u@9r 9\$ىمu 11҉ƋD$ [^_]ú )D$؉D$ L$$\$ ؉t$щ$$9rt 1RT$9sC1<15UWVS(} D$ UAuЋ]u`D$ D$9؉ÉD$$1҉މ\$$|$tكۋt$ t؃ڋuVȉڍe[^_]9:҃T$$L$ L$ L$$)L$$D$T$L$D$ L$T$$L$L$$L$ L$$\$Ét$ӉD$ T$9D$+D$ \$L$L$$ ƉL$$ډD$$D$ ЉD$UMڃىЉʉD$L$Ɖȋ]M9r>҃T$$9r9+\$|$پȉًD$ D$ȉD$$1i]U ] } D$ u 11҉ljÉ|$$!9D$y)T$T$D$ 1qUWVSu gD$E]‹}u+9щ1ҋL$t؃ڍe[^_]91D$ L$)L$T$ډD$L$ЋL$ ȉD$D$$T$L$ L$t$$$9)L$|$ Ɖ #utE F(1[^]ÍtD$ D$D$7|$FE F(1[^]UVSܐ utE F$1[^]ÍtD$ D$D$7$EE F$1[^]UVSz _ut$&ff gFF[^]ÍtD$ D$D$;$6EUVS ut F([^]ÍtD$ D$D$7$DF([^]UVS踏 Ýut F$[^]ÍtD$ D$D$7$DF$[^]fffffffSL$D$ t9tEAf.&€tuuuu˃t@Au<.t&€tAt9AtAt9Au΋D$[US 覎 ËP D$E D$E$腎 []fffffffUWVSa Fu} %=PwM=@/=O= ctGrGƀtGwE===lu-Gƀu-G@GAEGx --PP@x-uX-tXrx BZf [^_]øpwwurT뺹ryw2r@s?@Gs@-!GS@SG--Drt7=`ubCs9d/?%uQtSa PD$ D$D$9D$@MGA-fffffffUWVS a FE(D$E$aE=fAD$ED$E$1cǃ<(9uE$aOEtMEMED$UT$4$5Mu E<=tX4E8E4uϋM9|>) ‰L$D$$ f1 [^_]ÉM4$aM랹č D$ D$D$>h$?넍|DUWVS̉ ñEhkl ~ptDžxAEEEEEE|(D$ut$$B]E$D$t$$BDž<Dž@DžDDž8H|$8D$$Dž\Dž`Džd1|X}t Xuĉ4$XD$4$ |$4$%D$04$c<(9D$hD$t$ D$D$0$U,c4$,4eB8D$t$0$tD$(D$$AD$$D$$AD$|$$4[^_]D$$X[^_]Dž4cA,Dž4GD$(D$$e@yD$(D$$=@D$$D$$@UWVS@苆 `t$(D$T$L$,D$,t "|$GD$8UT$$\$(-uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$($D$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(>"D$8D$D$tt$011D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(wD$$T$ D$0T$4D$T$ $D$D$L$8D$9\$(:"D$8D$D$8HL$L@L$8t$@|$D<*tXD$=E$EԅBƋU)։uEԋEREEE,U‹MD9F EEtJED$T$UM $u֋U$U9t5EuEEEuU܅/EEUUыr/Eԅ0tC.t*E8:t"UED$ED$L$轹MA70E<-<+<::[B9FB 9F  E;u~#9EpxtC.0tE8:tD$W$7WE<-OEx:R?8[^_]ÍVNQq t21UE}88[^_]ËE$Ett p1pu-x/ED$ t$D$`h<$EED$ t$D$<$i*tC.t$E8:tED$ED$t$7?D$ D$D$ah$Eԅd}؉:t0Ex pq yMMMyM؋EpxEEEЉpE $MЋtp+t)kExutC.8tE8:tt$4$u70tC.E8:ED$$7qx:#EE9E:E MM؉:ŨE uЋE؉tC.t+E8:t#MED$$谵EЋMq17EЉE<-WKED$ T$UD$`<$EUuD$ T$D$a<$t$ t$D$<$wD$ T$D$a<$T pxtC.E8:t$$袴A D$ t$D$a<$[u x;UWVSd Îo} u*P uǃP |E ;M!8-pxP -pD$-E$ǃP --|$E$tAx:ǃP >u|[^_]ÍrP :u>u|t2E8:t*|$ D$3D$@J.$?[^_]ÀxF|p_|>uTx:tL|9MpE8:t|$ D$T1P p|[^_]ÍD$ D$D$R$u&D$ D$D$S$PE 4l:bUVSb lutD$ D$4$H;[^]ÍD$ D$D$/$UVSa ÏlutD$4$%e[^]ÍMD$ D$D$/$sfffffUSCa (lE$1[]UWVSa lEtVu;U E} Uz BD$E@t$9s0E@ 1҃[^_]ËE@D$Mxe);u EE UD$9sNj]C 넋E EuGE@D$Ex gE UybE E%dD$ (D$D$0$'[D$ (D$D$0$?TUWVS_ |jUB Eu1ƃu}9}EE}B269r|])9ErGË}u sJu(u J J ZR9r [^_]ÉfftEË}u rucuk띉UGD$4$\ƅt[UB)ǍD|$D$$iU0MJB E2Xf넃@UWVSG^ ,iu} D$$$…0x@@ ̓D$D$D$ vD$D$$UDžt1D$$[^_]1[^_]8U$C$9818US ,] hE D$ED$@J.X$NB []US\ gED$ E D$ED$@J.X$sB[]UWVS\ Úgu} t(ED$ 1D$|$4$Q[^_]ÍY1D$ DD$D$4\$jUVSD\ )gut'D$ D$D$4$yQ[^]ÍY1D$ 8D$D$A\$UWVS[ ûfu} t)D$ 1D$|$4$Q[^_]ÍY1D$ PD$D$6$UVSd[ Ifut>D$D$ D$D$4$`Jt [^]1[^]ÍmD$ XD$D$0$USZ eED$ D$ E D$E$ 9[]UWVSZ ËeuttE D$4$~7F0u D$4$[^_]tF0uҿF0뻍Y1D$ `D$D$/$]UUM E=vEM EB]UWVS u] Et?})t6vD$\$$Vu9}tE) [^_]ËE [^_]UEU@ ]UWVSNY 3dE0x$tu[^_]1[^_]UWVSY cu tLEt>?t+fx f@UPp$MH,UP(UPDUP [^_]ÿUu91UWVS X tc}u$‹EE Bzr EBttpE tZ%E NEU>UtnMfH f@PM H$x,p(@DP [^_]ÍNE뭋M t%E E딉UIU$1UWVSW ybUE trB0~4r,txM q J$tE D$ E 0xt$|$$[^_]ÉUzD$ hD$D$<$ UYY1D$ hD$D$;$ U US V |aED$E D$E$辶 []USfV KaED$ ED$E D$E$&[]UVS-V auf~ D$4$[F0tN@9t $F0F0ǀǀ FFF t1FD$4$%1[^]ËFߍY1D$ pD$D$< $ I UWVSEU *`EU tgP0~4p,tu ~r H$t} Lj $[M׉‹M y!1[^_]ÉEzT$ xT$D$90$ EdY1T$ xT$D$80$~ E+UWVSQT 6_utFD$4$nx$P8D$4$[^_]É4$ڍY1D$ D$D$7T$US S ë^ED$E D$E$iH []USS z^ED$ ED$E D$E$F[]UWVS,[S @^Et8uj}ԉ ;$ FHFF )t$|$$踲,[^_]ÉEԉ$E؍*EEu}w끋uUR u]Ex9]Ë]Í]fUWVSTQR 6]UE }}9}7uցE0 tS9utOD$2@D$u4$4$PEt8UED$t$E$Uu-p4$PEuȋ}E+TЃT[^_]Ét$ D$D$2u4$藹4$9P볅U@E 7t"ED$G$ut$ 닺\R}UD$ D$D$$UET$ T$D$$uE7M,ET$ T$D$$FER}fUEPt/t]P uE tP f҉Pf@ ]P t uE u]E u]fUEPt.t]P uE tPffP @]P t uE u]E u]ffffffffUEuE w E ]1]UVSO Zut;F)F3E uF F[^]1[^]ÍD$ D$D$Y $UWVSN ÁYu} Uts~F<FF DWPWPW P F F 1[^_]Í)D$ D$D$v $U`UD$ D$D$w $U+UVSM }Xut~u@~w:E [^]Í)D$ D$D$ $^뺸UVS1M Xut~uAF u9<.w5[^]Í)D$ pD$D$ $빸UWVSL íW}u t5u%G u<.w~9|D7[^_]1[^_]Í)D$ XD$D$ $pUWVSIL .Wu} t*~uPF uH<.wDx>9؃[^_]Í)D$ @D$D$ $몸UEu E D]1]UWVSK ÙV}utQEu@D69E r4E D$D$<$K6GfGG[^_]1[^_]ÍD$ 0D$D$. $@UWVSK Uu} t;~uaVL\WQWQW Q F1[^_]ÍD$ D$D$M $뙸UWVS4J rUƉEԋE} 9uЋU1҅x%PލT$D$<$]7Gt_T7<}؋x}p uX]HM܉M HJH JHJ H:rZ}܉z ]9u1}ЋU+4[^_]ÉE܋]ԍ6T$ T$D$h $E܅ E܋]ԍAT$ T$D$i $MEm]LvUVSI Sut~uEFu=:Fr6[^]ÍD$ D$D$ $뵸UWVSH ÇSu} t9~u)Fu!:Frx9sD>[^_]1[^_]ÍD$ D$D$ $FfffffffUWVSH RƉׅtat1>t F9rF9s1[^_]ú䍃fD$ D$D$$뾍MD$ D$D$$pUWVSeG JRt4ljփt3Rw0FGT$D$<$[^_][^_]ÉUYD$ $D$D$$UUSF ûQE x[]ÉEvT$ dT$D$T$E[]UWVSxF ]Qu} Et,tYPσF)F 71[^_]ÍT$ PT$D$b$&EuET$ PT$D$c$ErUWVSE PEu MUOEà E} u EX؋U)1|!})1׉E8>tiF‰߃sgtftËM؋})p)ƉwE0)F=^EX 1[^_]ø‰߃rxM]썃D$ 8D$D$$uMÍ)D$ 8D$D$$AM}]썃D$ 8D$D$$  {P7f/UWVSC NEuM} F lj؉})1|!})1UU<] M ؋M)ȍP)‰UUM)Pw^F [^_]Í^l1[^_]ÉÍ)D$ D$D$$ME]荓T$ T$D$$~EjUWVSQB 6Mu} ~)u>F1w3v,V J 9rT tI9u9s![^_]ÍA9rA9r߉9sx[^_]ÍF㍃)D$ D$D$$LD$ D$D$$nVUWVS9A LU} uz)u>B1w3v,J Y 9rL ti8u9s![^_]ÍP9rP9r߉9s#9t0t P9rP9r9r뮺BÉ1[^_]Í)D$ D$D$W$YUUD$ D$D$X$!UUUE ttuB]ø]UWVS$? JEEEM<}ulٸZ9]QEu|0օuD] t 9} $MtUUEEBE $[^_])ӉމxpU t 9} EtՋUUu뭅tA=wmM^ZZUD$D$$]UMi1ɉM]썃D$ D$D$$MXMUEE썘\$ \$D$$RMUEMUWSE]~OSt<)9U rww؃t6t YXYx1s5u'u[_]Åt:1[_]ê[_]ftu'u1҉[_]úf᪍YUWVS] UЋ}ߋustft[^_]uuBfUWVSu} ]tquit?9sTtH<t3t<MHU SM)[^_]Í^뾉vt 뭃먋EUWVS] U}t>u9]t?U9s"] tLB9Err9EsE[^_]ËEP뼉8tu9sՉ u빃M1}+E[^_]UWVS] UЋ}uރstft[^_]uuBfUS]; BFD$D$ED$ ED$E D$E$[]fUWVSP; EƉЉ9U1҅[ƅD$D$D$D$ T$D$4$Ct1U+<P[^_]Í1ɉ D rFDžDžD$ T$\D$<$EuutjƅD$D$D$D$ t$GD$G$Cut$$tu<$Vt$CtT$ xT$D$„$sj|fUWVST;9 DƉ9E1 ƃ Q ƅD$D$D$D$  Q D$|$4$AD$D$D$D$ L$|$4$A;DžDžDžDžDžVDžDžDžT$ D$\D$$stjƅD$D$D$D$ t$GD$G$@ut$$~thuGtLD$ D$D$$L$q1U+uXT[^_]Ë묋$qʍD$ D$D$„$dUWVS6 ëAϋEE uE9E1,VD$D$ D$D$<$3B4D$ D$D$$7t6D$ D$D$$z7 $ɗD$$D$${$聗D$I$cG$M$?茄~f$$ t$D$D$$荣U+Ą[^_]Í߄ @$0/q>D$ $uD$<$rD$/$T3Pt:D$D$$_#xD$D$D$D$CD$ D$T$$D$D$y$C$I@D$D$i$$$D$P$$D$ D$D$y„$D$ D$D$z„$ZD$ D$D${„$"D$ D$D$|„${D$D$D$D$ CD$T$$Q@$8u D$/$0D$t$ kT$D$$D$D$D$D$CD$ |$D$#$U*VD$8$эD$G$]D$Y$z$UWVS.0 ;EhU9E1pl 1} } uqƅptBxB |BEBEE qD$D$E $C^Džy@E+Ĝ[^_]/ƅptBtfDžrlD$<$$xSrfh뎉lD$ D$D$ „$lgl<$Rl'[U D$E D$E$O]UVS}. b9utD$D$4$[^]ÍD$ D$D$„$>UWVS. 8ljEE Et9|E1E(\DžDžDžDžxD$D$$脍_DžDžDž@J.D$FD$$ǃD$D$<$蘎FD$FD$<$Žh<$Ҏ80t&‹F:=4$袱Dž'8#Q$#vD$xD$$|E+Ĝ[^_]ÃNƅD$D$D$D$ |$FD$F$j4|$$EvƅD$D$D$D$ |$FD$F$4u4|$ɅD$$D$GzD$6\D$<$uD$6\D$<$Y.$詰D$ @D$D$@J.$U8tD$FD$$DžD$$D$ D$D$4$ݑ4$D$t$<$fƋ$V9fDžfDžD$D$$^D$L$$;Ƌ$ t0<<4$pD$t$<$]4$OD$t$<$<4$.D$t$<$D$D$<$AD$xD$$-D$D$D$D$ D$D$ $0u(4$v=4$g=$wD$pD$<$3DžD$ D$D$„$9D$ D$D$„$D$ D$D$„$D$ D$D$„$lD$ D$D$„$4ׅ$*$><$6!D$t$$豅 tD$t$<$ԆtƋtt$ɇ뉍d$$談hD$8$j뛍$t$;2RUWVSl$ /uEEEEEEEE9E1MGUqEE fD$ ܒD$D$ UЉ$U赌EEEEEEM MEEML$ D$UT$$4_=EPt%D$T$,U $UUEML$ML$M $MƋE$c^E+l[^_]ÍD$ D$D$„$MD$ D$D$„$YUD$ D$D$„$$EeD$ D$D$„$6$Q]D$D$$WrOUD$ED$ED$ED$ ED$E D$E$f]UWVSlV" ;-uEEEEEEEE9E1xMUEE fD$ ܒD$D$ UЉ$UEEEEEEM MEEML$ D$UT$$\E@t"D$D$,V $U<U3D$=$tM 9HtCED$ED$E$MEƋE$[E+9l[^_]Ítv$bD$ ED$ED$E$ME 멍D$ D$D$i„$M^D$ D$D$j„$`U4D$ D$D$k„$+E D$ D$D$l„$$XZD$D$$^oLUD$ED$ED$ED$ ED$E D$E$ ]UWVSZ ?*}lE \EXE`9@E1D$pH$FXp`DžLDžPpR.dR.DlD$ D$D$<$mD$ <$ bdh< Q< t< L .&< t< t t ~ u9P>uXp<+%<-q<@nL'PHD$ D$PD$r$\y؉DžL<+<-w҉ht$`$*hyp1@U+[^_]ÉtЍLThDQtDTcq'<@L#PHD$ D$PD$r$?xDžL<+F<@[hU\l K4$̡ u9F<@t$`$qU\l<+<-t$`$P>qU\؉<+N<- t$`$_Z<+<-DžLDžP.hHD$ `D$D$4$vhQ7F<@uhHD$ `D$D$4$u؋h]PFF'<@hHD$ `D$D$4$xuhU\1PU\PF]<@UHD$ `D$D$4$u)F<@ DžLDžP1D$ D$D$„$D$ D$D$„$X D$ D$D$„$fauEUWVS4 #M(E<}98ƋE1f<!ǃP U@D$D$ D$DD$<$v@D$@ D$4$aD$7D$4$'"M4'0@@ $@@P T$$w@@$_D$4$荄,t$D$4$0>,|%=UP $蓞4$u0$8E+[^_]þ뿍_D$&$у…tED$ pD$D$3t$*yUVS8 uEUT$UT$UT$UT$UT$ D$D$4$t 18[^]ËElW E䈃mW E舃nW E숃oW EpW EqW lW 8[^]ÍSD$ dD$D$Bt$PDUWVS<& }u ED$ E܍UT$UT$UT$UT$UT$ D$D$<$E܈EFEFEFEFEF1<[^_]ÍaT$ 8T$D$t$vEME>T$ 8T$D$t$>EEԆT$ 8T$D$t$EtAUWVSh éUUċE E9EƋE1 UMAD$ AD$AD$AD$AD$D$ D$D$EމE$pE_D$$uƅR1E؉EȍE<$D$D$ D$D$4$&Dž8+xEЉ$uEԉD$ẺD$ED$ ED$ED$EЉ${nEĉD$EȉD$Ẻ$&EԋẺ$3Eԅ<<$ 4$21uU+h[^_]ËEĉD$EȉD$<$EȋU9URf9P뗉4$ю\뎍>D$ TD$D$Yt$誻ԆD$ TD$D$Xt${3UWVSDI .Uu 9E1$_D$$sƅ1<$詄D$D$ D$D$4$Dž%8+x$uD$D$D$ D$D$$+YD$D$$$ԃ<$较4$Ќ1U+D[^_]ËD$L$<$aD$$f댉4$dt&뀍>D$ DD$D$t$:I1 W ffffffffffffffffffffffffffffUWVS, E܋}u 9E؉ËE1|$}<$]m1&.&.&.&.& F TFuF }؋E+uW,[^_]$!]yƅgы]܍D$ D$D$4($+]/UWVS| Ð uE 9E1$giD$D$@4$cDžD$t$$iD$t$<$Ec҉藼0<$Ld舼0u0D$$U+u>|[^_]1䍃ED$ D$D$N($裶 .UWVStt Y EUU9M1ɅtBE}<$EhM L$ED$<$hED$<$RU+u:t[^_]ÉESL$ |L$D$h( $E .US ô E D$E$[]US Ê E D$E$[]UVSz _ D$]D$W 4$ED$ t$ED$$薍[^]UEȅyt ]%]]ffffffffffffffffffffffffUWVS0 E؋}u 9EԉËE1|$}܉<$]&1&.&.&.&.& F TFuF(}ԋE+uW0[^_]$)]uƅgы]؍D$ D$D$F$+]+UWVSÐ EE u}9U1ҍ$iD$@$_E E19xu}_D$D$$'_D$D$$L)׉ 9|KD$D$$^D$ D$$19 })׉ q起0$d_蠷0D$$%U+[^_]Éc0$_N0t1D$ t$|$$蕖b$^1농D$$ӎtыptEUY)l)UD$D$D$D$ E D$E$H]UWVSxEUU9M1ɅtBE}<$M L$ED$<$.ED$<$U+u:x[^_]ÉESL$ L$D$ $zE(fffffUWVS:#8]du 9<ËE1dENMVU^ ]]~}}^]]ċ~}}ȋ^]]̋^ ]]Ћ~$|}ԋ^(x]؋~,t}܋^0p]^4H]~8D}v<@u식d3`s\s{ l{LȉEl1؋\!1؋`LyZ؋u\ɉT1`!1l yZTىˋ`MʉX1!1ыXP:yZω}ω}E1ȉ!ߋE1NjE0yZEȉ1!׉M1ωEMyZω9EEȉ1щ!1߉EMyZNjMu}ω}1ϋu!1׋MyZ߉Mɋ}u1!Nju1hyZ׉}ωM1!ߋM1ωuu1yZ]|ɉ1!1lj|]yZωxωxU1ډ!U1׋xyZljutʉ1!ω1߉t]yZ߉pʉU}1!NjU1׋Up2yZ׉4:u‹Hω1Љ!1ωuu0yZE]Dω1ߋ]!1׉EyZωE@ω}]1!]1߉EyZlj}X1u1u1Ƌ}1!ϋ]1߉u]yZ߉MT}1|1u1lj1!ljT1׉uUyZ׉ :X}1׋x1u1lj}1!ߋu1UT2yZUu1֋t1֋U1։‰1މX!1ƉUM yZΉTXMu1΋p1΋M1Ή11MnTƉXEh1NjE1NjM1ω׋X1ϋT1ωEn߉TE}1NjE1NjM1ωXT11En׉h|1NjE1NjM1ωT11߉MXnljh}x1ϋM1ϋM1lj11׉MTnω|t1׋U1׋U1ljh11lj|2n>Xxp1u1u1ljT11ωxhn߉Љt}1U1׋U1ljX11ljtT2n׉p}1u1|1Ɖωh11߉pXnlj}u1u1x1ljh11׉unωX}u1U1׋t1ljߋX11ljUh2n}U1׋U1׋p1ljX11ωUn߉h}U1׋M1ϋM1ljNjh11MXn׉}M1ϋ|1ϋM1ljh11߉MnljX}M1ϋx1ϋM1lj11׉Mhnω}U1׋t1׋U1ljX11ljU2nh}U1׋p1NjE1ljTߋh11ωEXn߉}U1׋E1NjE1ljh11ETn׉XuE1ƋE1ƋE1Ɖ11މEh8nƉߋu|1މu1u1É]X11ӋunىMx1ً]1ً]1M щˉh!! ً]X;ܼى|t1}1}1| !׉! X|hܼXωhxp1}1}1Ɖxh !! xܼ։׋t]1ڋ]1ڋ]1‰t Ӌh!Ӊ! ڋtܼЉˋpM1ȋM1ȋ|1p !! ȉXphܼXhMu1u1x1Mh !! u>ܼΉ׋Uu1u1t1‰U ֋h!։! uܼӉƋE]1؋]1؋p1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU]1ڋ|1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋x1؋]1E !! ؉XEhܼXÉhM]1ًt1ً]1Mh !! ً];ܼˉىU]1ڋp1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋE]1؋]1؋]1E !! ؉XEhܼXÉhM]1ً]1ً]1Mh !! ً];ܼˉىU|1ڋ]1ڋ]1‰U Ӌh!Ӊ! ڋ]3ܼӉƋEx1؋]1؋]1E !! ؉XEhܼXÉh|t1ً]1ً]1|h !! ً|;ܼˉxp1}1}1ljx ׋h!߉! x7ܼމt}1}1}1Ɖt Ɖ!׉! Xth>ܼXXhpu1u1|1Ɖ11߉pbXUu1u1x1‰֋h11ʉub‰Uu1u1t1‰։ډX11uhbщMu1u1p1΋X11ubˉhEu1M1ȋM1h11ЉMX1bƉ֋UM1ʋ|1ʋM1‰ыh11ډM9bUM1ʋx1ʋM1‰щX11‰MhbӉhEM1ȋt1ȋM1EX؋h11M1bEM1ȋp1ȋM1h11ЉMbӋUM1ʋM1ʋM1‰щX11MhbډUM1ʋM1ʋM1‰ыX11‰M9b׉ :TE|1ȋU1ЋU1‰11؉UX bȋThEx1ЋU1ЋU1‰1؋T1؉X2bƉ|t1֋U1֋U1Ɖh11Ή|:bMxp1׋U1׋U1ljىߋ]11ljxhb߉tU1ЋU1ЋX1‹E11U bЉ‰pu1u1|1ƉM11؉uMbȉEu1u1x1bʋE11UEu1U1Ћu1ubʉ؋U11EU1ЋU1ЋU1`bËE11؉Ћd\2މCPlj{l F LEFyZ<3 d Ӊ 1ΉTud3nT  1Ӊd]nd  d׉ ؋d1x9n ׉ 1}:nd T 1ڋ}d;n ҉ 1Njtn T P҉։d 1΋}T;n <P dӉT 1Ӌu0nˋd NjT 1u1nЋT T1u2nd 1ڋu7n T4 d҉׉ 1Nju1nߋd d҉ 1΋|nƋd T1ӋUn  d ҉Ћd 1UnT d 1Und 1!1‰dUܼd  ωd1!1ω}>ܼ<2  d1!΋d1֋UܼƋd 1T!1Uܼ d1!1UܼT 1!1ًUܼd 1!1‰TUܼT  1׉d!1ω}>ܼ<0 1!1֋|ܼ d 1!1d]ܼd 1!1dEܼd 1!1ىdt ܼd d1ˉڋd!1‹xܼ 1Ӊ!1ȉËEܼ3d 1É!1։Tud3ܼT 1!1Éd]ܼd  1߉d}9NSd  T։ 1u2NSd ։ 1ʋu0NST ։d 1‹u1NS ڋd Ɖd1֋UNS> Ћd 1؋UNSȋd T׉ 1‹}9NS 2 d׉ 1ʋ}>NS Tډ ׉ 1Ћx;NSdlj ׉ ЉT1؋}d;NS  ӋT 1Ë}>NS ˋT Ɖd1u1NS4  Ӊًd 1]NS d TӉ 1ʋ]NS< H։ ʉP1t0NSTӉD @pӉڋX h1\]拢Plʋ` 1։ˋx 拢P pƋL 1NjE拢P ` d҉ 1ߋU拢P  1U拢P d `1ȋUd拢P щʋ` 1‹M拢Pڋ` dщ 1֋M 拢P 1|拢Pd ; Ӊ `1ϋMd 拢P Ӊً` 1t拢Pы` ` 1ȋ]拢P  d 1‹]拢P` 1֋]拢Pd LЉ 1E拢P  `Љ 1ߋE拢PL 1!1ًE$M\ ` d1!1M` $M\  d1!1ʋM$M\ڋd 1։d!1ƋM $M\ 1!1ӋM$M\ d `1ډ׋`!1|$M\ d1!1ًU$M\ ` 1!1U$M\ d 1!1ʉ`x$M\` 1!1Ɖdt3$M\d 1!1Ӊd]$M\d  1!1d}9$M\d 1!1ىdM$M\d 1ȉd!1]$M\ 1!1ʋ]$M\ d `1!1Ƌ]d$M\  ։ 1Ët7>pm ` L։d 1׋]`>pmNjL dӉ 1]>pmыd 1؉dE>pmd‰ 0 1dE>pmd 1Ήdx3>pmdd ։d 1Ӌu7>pm d 1Nju1>pm׋d 1dM >pmd  1ډdU>pmd  1dE>pmd 1Ήdu3>pmd `҉ `1ӋU>pm  d 1NjU>pm ` ׉ 1U>pmd `׉ 1ڋ|8>pm` 1!1dEvmzd 1!1Ήdu3vmzd 1!1Ӊd]vmzd 1ljd!1Nj]vmz  d1!1]vmzd d1߉!1ڋ}8vmzd d1!1tvmz؋d Ήщd1!Ƌd1΋M vmz 1щ!1ӋMvmzd `1!1NjMdvmz  1!1ϋM vmz  ` d1!1ڋ|`8vmz d 1!1dEvmzd  1!1Ήdu3vmzd 1!1Ӊd]vmzd 1!1ljdx9vmzd 11dMʋd 1ډM1ʋt M1ωt1׋U ߋM t1ʉ1U Ƌt ]11]؍  E 1Ћ]1؋U] U11U] 11ʉUU׋U ljȉ}11׋E M1ȉ1E M 11|E 11؉ExME 1M1ȋM U11‹M UM 1ʉ׋U1׋U U P ׋XUzp4 @UrU1ЋU1Ћu lH؋uF ЋP ȋD1T|NS\ыUȋUBU hDEĴ[^_]UWVSE}wʃ?@)Ӎ ΃Mqy9rfup@?v6}EЋ]E D$<$Uv@9s]ËE19s-)] }|u sutft[^_]19rӃ[^_]Ë}OM]|u seEuUEuLEUED$E$U)֋E9rqFuRu9ofEtuRu8MEtf1/fmM qKMUWVS5 ]} 9EEGWEU?@)ƒw)ƒT$LD$<$D$ED$<$t(OSSs9uݺ\1u.u4tftME+u[^_]ê[tfʼn[UE]UU ft1]ÁE ]fffL$$Yai qyD$A(tQS[èRjj [1Ít&.&T$D$ Zbj rz $z(t RPS[XjRj [Xt@fffD$$X`h px1.t&T$D$ Zbj rzu@ $fffffffL$$Yai qyQS[Rjj [1Í&T$D$ Zbj rz $RPS[~jRj [Xt@US pUED$E D$E$ []US?$D$ D$ED$$'[]USD$ E D$ED$$-[]USʽïD$ E D$ED$$[]ffffffUWVS,聽fuEEED$D$}|$ t$D$EE$@EE ED$D$|$ D$D$E$Y@EEED$D$|$ D$D$E$ @6EEED$D$|$ T$UD$E$?UEt9E& <wE)Ѓ9uEEED$D$|$ t$D$E$&?؃,[^_]"v8 u>ƆUN D$ D$D$<$ipfffUWVS.} 9E1}D$D$HtHE$Tt=ED$D$<$Ą;Es1U+[^_]ø"㍅D$E$+Mtt@D$E$Lu[ED$cD$<$T;EsED$|$ H%D$`d$T$UtID$ D$D$B$$oUWVS ۹ǸD$W \$E$qƉ؅u [^_]É+t01UWVSp腹jU[ ut$$[ @B1NjEEE1UЋUME1EHt$$xx[ @B1Ƌ}E1NjExME1EH D$E$~u([ ]ٸ@B1E1؃p[^_]øp[^_]$'I[ 8D$ D$D$H$JmfffffffffffffffUWVSD$rD$E$谄uE0D.".&.&.&@t&tD$E$u܉[^_]D$݇D$E$6t 1[^_]ËEpD$UD$4$E@<-u?EPR.DPtEPD$ ED$$U9MU9p9g^My+th)ƍF߃1BD$+D$4$XE@t<+ !M?!fffffU;E?w0D.t u]Ë u@u1]UEP>w 0D.]1]UWVS(ĵéu}܉|$D$4$5oxINE uG>wl%9EظE! EED$|$4$n([^_]Ã>w2%9EظE EooUWVSunD$ to|D$D$[ <$ y)[ S.t@[ [^_]ÍU T$ t$)‰T$$뵍8D$D$[ <$fffUWVSA&ƉЉυV=~vVotXftNgu5] ^}+}-}=uFЃ[^_]Ã+t-ut} E #EFЃ[^_]-t~F+։} RE #EFF F+֍RE #EF뺉  E Iu1aUT$ <T$D$tD$hEF!FUWVS۲u] "<-EEEE}|$EԉD$$$~$E~D$|$$TEkD$D$Ẻ$跻ekMẺE0EUR.DPщMEE1E$ SU$U~9E~T$$lƋUfffffffffUWVST蝝Eu}]E E bEEE;E܅~ 0MU tEEGz;EGEEUEUEUEUEEEE E+ E؋E$]zF 8MЍD9E  0^EUM]L$\$ $T$]9tu׉EUuM΋EEeщٸ9и| E rED$E܍xD$E؉D$2ˉщցЉ%ƉƸQ))i)\i(\ø)\ƋEԉE]ʋUʉD$ T$]=D$E D$E$p9} T[^_]ÍEEEE2EEpE7E U)Љpd1҉v.&.&.&Ɖ҃s΃EȉU9E}|T1MċEUM]L$\$ $T$]Mȋ]9ȉ|u͋MĉEU,E} uuMEU%E%EQ)EU)ȃi)\i(\Ѹ)\EUED$E܉D$E؉D$]ԉؙMʋEe}SEQM]EU)+EUEUEEE;EpEbEdEE Eg]U]EdEEUM]$]BUЍD9E ỦUM܍_׉F u ,[^_]Ë]Uv]5MՃmu$]n,[^_]ÉUE$]UtÅT$D$ $M] MmD$ D$D$U$ Gn]D$ D$D$U$F*uf~*u1f~*f?f[uZp!!f90f[ʃfu‹ffP u&O f?ʃFW Ӏ_ Y9t fx*Df*ʉك |$|$<$7U+D[^_]ÍJfzuf[Qy+.t&.&.&.&f,2f]u답f[!B0.&.&.&.&.&.&Wf]tI׉΍Nf%ff-uGf]fF-Nf%fF_Wf]uH Af]O9CD$D$ D$D$$P f 99sWfPfu9t.P9fx*P9fx*ʉW 9 `T$ D$)L$pP$Igf[!~ʉW-0$P…ZJD$D$ D$D$$T@7pf@!fH9"ۈ|$ 4t$D$U $1|$ D$D$ $f1T$ 4D$D$U $)1 T$ D$D$ $0T$ t$D$ $0|$ D$D$ $0r荨UWVS4L{1gU9U‹)߃r)ڍHPftDΉ1ff}tYFftf[tWf{uFfuM E14[^_]ÅtGF랍~Ff]fu뀍rZf]tFrc9r1Gf,f[uSf]efً99S{f{vf}uͅt8Ĥf}Xׅu9f1TffuM M1B:qQf]tىC)ȉD΃tft FۈT$ <|$D$U4$-ɋtFUT$ |$D$4$,<UT$ |$D$4$,^<U눋yuI󥉽SًfvfUWVSv΁ƅtyB tA xy f>{t7 t&ft5f{uL$M $щ.E[^_]f~}uf~u[^_]MU썃ۈD$ HD$D$U$K+MUQMU썃D$ HD$D$U$ +MUx0NUWVS(uêu} UDžDžDžDž uBB EBB]u^} UfP9~ʅ\uVtU@ɐ.&fH9uft([^_]É\@p([^_]B} U맍ۈD$ TD$D$U$h)U} UhUWVS.tEtXEPtF@u=@=~Ӊƍp=[K== }?tD$V$ɱ@D$V$螱K=@sD$V$sp@@HD$V$H}?@UWVS8~acl9U1ǃLh Lh DŽPh r捃Ld lh D$ D$D$$Khh T$$<D$\|$4$NA8t߉Lh 8#mD$\|$4$bNt8t㉃Ph D$\|$4$?Nt8t㉃Th D$\|$4$N8t߉Xh ǃ`h ǃdh D$\|$4$Mt>8t$`h D$\|$4$Mt8t$dh D$Xh D$4$),hD$\D$$AMƅ8tщ4$* uċܳtܳ >t|$$ uቻ\h ?x{U+8[^_]Í@D$\|$4$LK8t߉Lh 8#wD$\|$4$lLt8t㉃Ph D$\|$4$IL%8t߉\h 8xuxxu xXh 8sxwxLTh D$\|$4$KtQ8t$`h D$\|$4$Kt&8t$dh \h ~hh D$D$$Yx{ElǃLh 171PǃXh ǃ\h JHT$$hUVS\glh tJtKLh [^]ǃhh _D$4$>lh ut$ t$01UWVSx\]guǃhh lh t3$t$Lh $(tIu1[^_]Í_D$<$lh uˉ|$ t$0Lh [^_]Í D$ 0D$D$$FUWVS[Äfuǃhh lh t7$@t$Ph $OtMt&u1[^_]Í_D$<$lh ulj|$ t$>/Lh [^_]Í D$ $D$D$$BUVSZèeǃhh lh t$o[^]Í_D$4$lh u҉t$ t$.1USQZ6elh t$:ǃlh []fffffffffffffUWVSP Zd}ƉUԉMEԅ}@ER.EEEÃ]}ԃEȍFE]|ЍL]DStER.Eԉh EȉD$BrD$Ẻ$sEԉi EȉD$PD$Ẻ$RsEԉi fEpxEfEbxEfEfxEfEoxEfEtxEE`a i E؉EEEčEEE4$T9u}v9tq:/t9r.&9tS:/u9uF.&:/u9r)v,j 9u(Ƅ,j [^_]Éր>/tJd),j ǃs$utǤƄ,j [^_]ftt鍳$fffffffUWVS9CE$}LtR.DBt;R.0fkfbfgfE@ E1ɉMD$ ED$E$|Ɖ׋E8t~EM9t8uo8"tEʋM Q1[^_]ÉEUU9ѸEs)fmuEZENbE0US7ÐBD$ E$胙[]ffffffUWVSq7VB}?t<$DD9uzf.&9ti8/t9t`sc~/t9u)=v,n ׃rtftƄ,n Ѓ[^_]ød)€8/t Ƹ봸$US<6ÍAEEEEEEEED$ẺD$$tEMt<[]ø<[]ffffffUWVS !6A蹅t4ƅu"t$Ut,E t: [^_]$ [^_]Í$$1E uD$D$$ ǃtD$$D$<$D$<$h<$褗[USB5'@Et=tU T$؉$͖[]UVS4?utE D$D$4$D[^]ÍmD$ tD$D$1$붐T$D$Ít&T$D$Í&.&T$D$!Ít&T$#L$ u.&T$ .&T$HÐT$.&T$@ÐT$D$ Ít&T$ L$ u.&T$D$.t&T$D$L$  Í&.&T$D$L$  Í&.&Í&.&D$ffff̀rS[4>? [Ḯ̀rS[>? [ḭ̀rS[=? [̀ffff̀ffff/̀ffff^̀rS[ä=? [̀rS[Ä=? [Ḥ̀rS[d=? [<̀rS[D=? [̀rS[$=? [ḇ̀rS[=? [̀rS[<? [ḓ̀rS[<? [̀rS[ä<? [`̀rS[Ä<? [R̀rS[d<? [2̀rS[D<? [ḩ̀rS[$<? [P̀rS[<? [ḷ̀rS[;? [Ḷ̀rS[;? [ḉ̀rS[ä;? [̀rS[Ä;? [Ḛ̀rS[d;? [̀rS[D;? [Ḩ̀rS[$;? [1̀rS[;? [Ḍ̀rS[:? [òrS[:? [ìrS[ä:? [l̀rS[Ä:? [t̀rS[d:? [s̀rS[D:? [r̀rS[$:? [p̀rS[:? [j̀rS[9? [m̀rS[9? [̀rS[ä9? [Z̀rS[Ä9? [ ̀rS[d9? [!̀rS[D9? [S[.9? [f.&*̀r׋L$Q1fffffỲrJ!QS[8? [UWVS-8,r 0r D$$60r 8r +4r D$ D$D$74$3fffffUWVSEUE E0utt4$]轻x]pt/9u+]|$t$F$]iN9Mtۋ]E t&t#P9utFE0E[^_]É1]dD$ D$D$IX$:;ÍTD$ D$D$HX$ fffffffffffffffUWVS ǦuU MtUA%.&.&.&t+ ÃutF\$D$$* [^_]UWVS A&MtU D$E$ED$}|$E$ƃE $軹EL<(90t6Eu|1 [^_]ÉL$M$U:UM $…tU $<UMȉ׋usYtftE|=Eu stf`Z뉋E|떍 D$ D$D$C|$U brD$ D$D$D|$tD$E$f5Ef,zE UVS õE UtuD$E$G [^]ÉT$D$E$lƅu E [^]ÃTt01 [^] 1UWVSJ /uE 0E,E(94‹E1wD$D$4$njhDžDžD$$VtD$h8$#uhǀPǀTǀX8<$T8Dž@fDžDfFHDžLTDž\ dDž`DžX(D$ ,D$0D$<$gƅx <$ٓuT4E+u[[^_]ÍD$ D$D$D$~fn8U/ UT$ U T$Q.D$E$]US ED$E D$E$O []US ïED$ ED$E D$E$M[]UWVS, uuw}t}ED$4$讛4$趑F0tN@9t $F0F0ǀǀ FF~ >\}IED$ED$4$賔 NjUEtjM 9UE}uf~ E FUxSMN7FE؉Fy$UE UπUE댉E䍋L$ M܍,T$UD$E؉$EFEFd9iD$4$HE,[^_]ËF$薇\}Ef~ FFCFFD$4$E,[^_]ÃUML$ T$D$E؉$MEFHUE$~E UtRπMY1D$ ,D$D$?$ZE(E9Ut'$<~E UtπUEEUVSy^uD$4$躘V(4$跎F u|D$ D$D$F$V(D$T$!ЃF tRF)D$T$F0t F<)D$T$D$4$ZD$T$e[^]ËVPNTT$L$utˋt+FD$T$D$4$D$D$D$4$UVSR7uD$4$蓗V(4$萍F D$ D$D$F$V(EU!ЃF tZF)EUF0t F<)EUD$4$5EUw0E[^]ËVPNTUMutt+FEUTD$4$ЖڿD$4$賖UWVS }?ew t>Et[^_]Ft$踃V tQFtB1ɉωMT:0$蔃V T:($腃V D: $vMV ;Nr$`F,t$QF4t -$=F8t$.4$&[^_]ÍD$ 4D$D$M$$?e[^_]ÍD$ 4D$D$K$UVSâ4$kr D$E$y4$k[^]UVSx]4$^kr $x4$Hk[^]UWVS9<$kr D$$}Ɖ<$k[^_]UWVS uED$@$fED$E $g…t?t$U$蓮Ut'zu Ńtt$$luUEHutU$ZEUЃ[^_]Í D$ @D$D$< $07UVS  4$ir D$E$e4$i[^]UVSç  4$ir $ f4$i[^]UWVSh  <$iir D$$.fƉ<$Ji[^_]fffUWVS01 UR.E܍uu<0 E1]ȋ]\Kt|u 8<|Euȋ]؋uԍE9;K)11v ؃9ruvu~]؋utgu9t`wX<.u;{<0B߀Xt[EuԄYEDH@K0[^_] uA)BaߍD$ TD$D$F8 $苴ULuԍE9s11UWVS I. iD$|D$@J.<$KlE tED$E D$<$FD$$ >RE$^US÷ YUT$ U T$D$E$mffffffffffffUWVS f uEEt.\u* [^_]M %l t. [^_]E } t=Q tME  [^_]ÍD$ t D$D$NJ$˲GD$ t D$D$NJ$虲E TR. } } U R.DPwM QɨE E nE 0<rMЈE} #EEE} ;c‹}Ǎ EEJEu}&dW09uuӓ E} ?U  ЋM ME U R.DPE PEE ЋM}ljE_ EE TR.DE 0M EEu } \Et } %Et } &Et } =2ME E 0<cMЈdE TR.0+E P} ;U R.DPtOEE DЍPE} -} ^u!R.M DHE 0ME\ErEEEE E E pE _E NE =E,}MEu}9tedtH9tud1ɀcFdE P ZE PMuU{R.W0EER.W E UWVS(E܋uU }EE3O}}}}u΍ MNjED$ ED$\$E$tuU)u|ZGUڃ^uuM~EJUʃ)-E9EGO]n([^_]ÉxÍP7D$ h D$D$NJ$譫U U ]܍7D$ h D$D$NJ$rU ]ݰj  %UED$ E D$D$E$]UD$ E D$D$E$]UD$ ED$E D$E$]ÐUWVSÆu,s n/>3)Ѝ)Ѝ:~ 9w$4s ugP U$Ѓ4s DU4$Ѕt9w$D$ D$w4$[^_]É4$Duljw$t$ YD$D$ w4$\E t1붋4s t9U$(kNjU4$DY[^_]ËPǃ4s 뭋U tuGEǃ4s Ds hD$$=n,s `ǃs 11UWVSáu(s o))Љ):~ 9w$0s ug` U$Ѓ0s TU4$Ѕt9w$D$ D$w4$[^_]É4$Tuljw$t$ YD$D$ w4$[E t1붋0s t9U$(+iNjU4$TY[^_]Ë`ǃ0s 뭋U tuGEǃ0s Ts hD$$l(s _ǃs 11UWVSûu4$讛Dž$s ED1.t&.&P9u/>3)Ѝ)E:WɉM~4T$U4$.UuMG$U 1[^_]Ë4s u$PU$Ѓ4s UD$ t$$Ǻ4$H@G$됋4s u$PU$Ѓ4s UU$(gNjUthP뀃4s ts u/D$$=jE$s ǃs ǃ4s 4$HtՋ@UWVSu4$輙Dž s EC1ɍv.&P9u𸿿)))E:WɉM~4T$U4$=UuMG$U 1[^_]Ë0s u$`U$Ѓ0s UD$ t$$ָ4$X@G$됋0s u$`U$Ѓ0s UU$(eNjUthP뀃0s ts u/D$$hE s ǃs ǃ0s 4$XtՋ@UWVSUELtЋ,s t'Ǎt$l9uǃ,s ǃs $s t'Ǎt$Wl9uǃ$s ǃs ǃ4s EPE LEHED1[^_]øUWVSUE\tЋ(s t'Ǎt$k9uǃ(s ǃs s t'Ǎt$lk9uǃ s ǃs ǃ0s E`E \EXET1[^_]øffffffffffffffUWVSpUE  DžXEK/tBD$E $p-E $腕uv E t E tDž`Dždxhً]/]DU.&Ѓ/u.&t+M L +M]t/+]utftl+EthD$E $p!%=l /u=@^_Ot/t.!+M,u~.׉ڋt9E щ`p\l`d 5lD$D$E $pJDž`D$`pDD=`/=A߉փsWtftdl /tU\`Ut+M׋tu -닋u \`l=p?t9E DtX$pBg1Ĩ[^_]tN~uPf/tp誡蚡?p脡xrzUWVSì}E ttrD$<$(xX[^_]Et$<$}bDžMtAt$$h(ymt 8"tƉ<$2e1[^_]Π1fffffffffffffffUWVS}<$ُLs $_\Hs ǃDs 7tyR.E1<:uPyAu-<\u.JDK@ttDK@tBuE<:u1<:tEu51[^_]ËHs t$dǃHs ǃLs ΍yU荟 UWVSu} u<:tu1[^_]8ut#8tu<@t΃}:t% u}:t;UuF~@t[^_]Ät<:u[^_]ÍMD$ D$D$` $/[lD$ D$D$` $UUd]UWVSãu} to.&.&8u$ u|:9s :t|tu[^_]Í D$ D$D$` $$blD$ D$D$` $-1UWVSpǧƉE 9E1=m}! Mu0Hs t |$$U$X UD$ D$D$E${DžDžƉDž9^Ѐ A:sDž\7Dž t t Džy9r)Nj)T$$V\ lj99D$D$E$A^Ѐ txE<#=D$ $,#dDžD$=D$$yS<:uA)ljED$L$E$:=w!C:SDžDvD$ |$D$$FD$D$ D$D$@$jD$D$@$?qDž9y^VЀ : ރ\DžVDž.&<:tu))lj>|>:t :)Љ‰)9)؉D$\$$+5L$t$<$5 $[OދDžމ:DžD))))T$<$Wo<ljljÉtE$>)ȍP9rH8E+p[^_]ÉEDžD$$V됋Ls $Q!Hs D$<$*|70dƋY10$vY0DžƋ|$YD$ D$D$` $eD$ D$D$ ` $܎c D$ D$D$ ` $螎.MD$ D$D$` $mtp@a$WDžmE$C;;E$-;n땉Ƌ$W>$腂D$ \$|$4$V Pu Dž$H $NDž L$T$$/4$V18Dž4$VDž鋝 D$ D$D$` $W‘0<$ V賑0$UtE$<9r M4$VV 1ϋ$Uu%$^U됋E$8UVSS8EM ut.t^UD$t$$F[^]ÍlT$ T$D$` $M EuM EeT$ T$D$` $ŊM ElM E T$ T$D$` $臊M E1USY>@s t$B]ǃ@s ǃ8s ǃDs ǃ}<:tkOML<^uF<:mu‹M])ىύAdD$$]zJljEEd<:u]WF<:XЀvP2MҋM FE1]MVD9ut 0v]M :]U})rtT$<$]IEEM$[^_]Ë]뽸 y]䍃D$ D$D$` $衂ÍlD$ D$D$` $p]䍃MD$ D$D$` $;z1*E$]K<$]K]k UWVSEu} uE0D$=|$4$Dž$d]Bƅ<:d <:tCZtsu)Cd]D$4$]GUn‰ƹd<:uЉƍX)Ӎst4\$$U]yGU@Љ)ӍsűE[^_]Ë]썃MD$ D$D$#` $茀E]썃D$ D$D$$` $TÍlD$ D$D$"` $#Z]썃|D$ D$D$`` $)D$4$]]Ft-M14$]I։4$]jI]  UWVScH}E u1D$#D$<$8H80txE 11.t&.&.&.&0]9~)ƒxЉ vxwW]9׉1[^_]Íxw7@tftƄ/ DžDž)S$K9>:hf̀ 81Ƀ4uA )čD$pxr󥋵t$D$$'D$D$$%|$t$$x%D$D$$Z% D$ XD$D$E $KzudurPd)1d)rBvBDžqfzU n<(9D$E D$E$]UWVSO4}U 9E1EtqMyu )čD$UPtMP}y:u}<(9T$D$<$%U+ue[^_]øfUSÈD$$Jpw D$ Z$Ilw []UWVSHQ6}}ԋE E؋uu9EЉƋEl1D$l$-.pw }M؉MufuUT$U܉T$ D$ UT$$Luu vU܋9El} u lw tUԉ%9pw t1MЋE+H[^_]Á} u lw uD$D$ $4XƅtdEĉ4$"]AfxHuHPU3Q }3y$ u֋U3QuˋPD$EĉD$$UmDžuED$UȃT$Ẻ$蟋;Es4$O[f % ЉD$͐D$ 6D$ED$Ẻ$)x ;Es1"B9EBf9EzJ Uȍ~|$D$ $M.JNMMčD19C9}rỦ׉΃s$tft1V4$rZDUuuB r EfUSoXD$ls \$ ED$EU $T$u؃[]1[]UVS<"M uEEEQEUAEt:EȉD$ED$E$YyuEȋỦVE܃F1<[^]D$ED$E$y<[^]ÅtEȉD$D$D$D$E$xUS,H-EEEEE܍ED$E܉D$$^uE,[]US,EEEEE܍ED$E܉D$$ uE,[]US蠾ÅEEEEEE$[]fffffff=̀rS[4? [ḽ̀rS[? [̀rS[? [(̀rS[? [L$S[ú€D.[t'L$̀rS[Ñ€D.[ S[x? [US w\D$E D$E$xb []US E*D$E D$E$r []USD$ ED$E D$E$-b[]1UWVSҼ÷}E 4ME09E1E(,hEED$E$$D$h8$$hdžPdžTdžXfDžD8H<$e4D$\D$d@ fD$h@L$dfA ȃ9|$(ucJT$`@9T$(kBD$lD$dD$B$Kt$< -JUWVS }D$<$M1ED$ ED$E D$<$D$<$G1[^_]UWVS謟Ñ}D$<$0ED$ E D$Q.D$<$D$<$0[^_]ffffUWVS A&U J}8D$$U ]0U z0u LJB uqsfB EEJw9mJ@U 9v<6}|$$-U  0Muωƃ}EEu2J0B0upH MHBD$$/E [^_]ÉU U fb ߋrEt9spE9-J#}D$<$-D$ E D$<$;D$<$- [^_]fUVSǦu t$E F[^]Í_D$$> E F[^]UVS芛out$t#Ft$EFFFt$(FF[^]UWVS(E  Eu Ft$D$D$ D$D$$5FNMML$$tpt&.&< t< tED$4$PU4$F(MAE HɋUEHM@1MMG< tGE xG9t[}FE7ED$$Put< uuEE([^_]ÉUE x:TED$|$E$kMT}E xExUS4$H'MAE P UE @ SD$D$ E $Su*E HEHMUT7kS0E t$ E E @t$E @@E @t$oE @E @S01_D$$M 61zEPfUVS"E$ tKtE@t>UT$ U T$UT$V$Љƅu E[^]\R0E[^]ÍX!D$ |D$D$8!$L@U ~gQ.D$E D$E$2]UVSP5E$ tRtL@$tEUT$UT$ U T$UT$V$Љƅu E[^]Q0E[^]Í!D$ dD$D$p!$K@$U襖Q.D$ ED$E D$E$$]UVSpUE$ tRtL@(tEUT$UT$ U T$UT$V$Љƅu E[^]P0E[^]Í!D$ LD$D$y!$J@(UŕQ.D$ ED$E D$E$$]UVS萕uE$ tRtL@4tEUT$UT$ U T$UT$V$Љƅu E[^]O0E[^]Í$"D$ 4D$D$!$J@4UΟQ.D$ ED$E D$E$$]UWVS(诔ÔuEvt U>V$  I}|$T$UD$ D$D$@$ыU,$ tvtp@Hti|$T$UT$UT$ U T$ML$4$ЉƅuE([^_]ÍV}MN0E([^_]Ë$ 1ҍ}uU썃"D$ D$D$!$H@HU]EU썋"L$ L$D$J! $FHEIUT$ (T$D$}\"$ HEX D$ D$D$[\"$GUU誒Q.D$ED$ED$ ED$E D$E$]UVSgLE$ tKtE@8t>UT$ U T$UT$V$Љƅu E[^]L0E[^]Í"D$ D$D$!$F@8U ÑQ.D$E D$E$2]UWVS蔑yJD$|D$@J.<$Et8ED$ED$<$v|$ D$D$*$E $rD$xD$$0E$USϛD$ ED$E D$E$[]fffffffUWVS0衐Æ}u t$E$6E̅uu}EEEEEЋE 1 t1E؉U E UEUu}!!׉ uEtE밋u؋}#u#} t1u؋MЅtUMx*E؃Mw"Nwq\E@VR.PE̅uE؃ tEtRM\0҉Q0Au؃0q AEԃmEEԃ0[^_]E@u}\}E؀t}ME؍GEԋ}؉<$qtU@}ظ^DE@uS4$ruV tQFvIE %Fv7 ,-}ԉ}؉xE7R.DptGEԉ7Eԃ0[^_]ËU̅EE@>EE\@sEE\@bEE\@tEE\@nEE\@vEg}\G0E0<v\}AE\@aE&E\@fE E\@rEE@0@ 0EE؉$ rF<gE\}؉xE^E?}DF)uGHf fű~t$eu} EHDu@8/tF(tF[^_]ÉUD$D$@d)$莿ǃUttF<$b<$ugFF)E@[^_]ÁN(fD$ D$D$1$F߿UWVS{]`hutp7u4E4$u(4$(E$臿[^_]ËF$$뿋F$$F$$F$$뵍ˑD$ D$D$Bl#$aUS \ågQ.D$ D$D$E D$E$l$]]US |\agED$ D$D$E D$E$l$]]UWVS8<\!gƉ׉t,M=U= =T$E؉D$E܉D$ L$|$4$諒=ƒu܍M؁ ʨtUEԃ8[^_]úڋUոEEkEhEEMN1"كl8[^_]1U[eQ.U E]UMU E]fffff̀rS[ôe? [̀rS[Ôe? [ ̀rS[te? [UWVSqZVeu} u !t9u[^_]1[^_]ÍD$ D$D$*#$+UWVSZdu} ttB|$4$[^_]Í>D$ D$D$B#$uID$ D$D$C#$UWVStYYdu} ttB|$4$E[^_]Í>D$ D$D$B#$9uID$ D$D$C#$ UWVS@Xct$(D$T$L$,D$,t "|$GD$8UT$$\$(uL$8ǀ-<+>D$D$,D0OD$D$$D$ D$0 D$4D$, 11҉D$8T$<09L$,tfD$$|$89T$ |$<O\$81؉ËD$<1 -\$0|$<ߋT$4|$8Ӊd$0ډډD$8T$<NyЉ< tA< W9L$,iߋD$8T$e[^_]D$rD$,D$,FL$8D$0T$4D$T$ $D$\$(芫D$$T$ D$0T$4D$T$ $D$1D$L$8D$9\$("D$8D$<$6 01 0 0ƋG$$#G$$G.& 0UWVS Q\}D$`<$PtƋM Džt [^_]1 [^_]? U4$- U [^_]UVSQd\utD$4$\[^]Í D$ D$D$F#$HUVSQ\u|D$4$utOE%=@u5D$D$4$ɲt#1҉Ĉ[^]H 1Ĉ[^]ffUWVS8Pv[]E@ Eɠ}ԃt uEԨEeEЉ}؉]1E1Ew>E܍ 0MU‰T$UE$]U})ljEuUD$ D$D$E $]MAQt$|$E $@t~")Ɓwf] 8}}؅WMEA Etk}9z1ҍOMu1&F])9! ^t t49st҅=$]}…uuEEMHE+A AE@M MԉH $]18[^_]ËMЅ$E$]qD$ D$D$E $hm$뫉EX@$]MA }E@@eBE $]RD$@E$_E |EMH ]cωu]8D$ D$|$$UU2txzuEԃEU܉ƀ t9~tMG M L$$]BuDG uNjUtG~uU܉$]}닋]썃|D$ D$D$#$$]K‹EE1]6UWVSLtW}G $bwt6$OuG[^_]UWVSGL,Wu} t"tL D$ $[^_]ÍؑD$ D$D$:$$uD$ D$D$;$$UVS8KÓVut&== =@ED$E܉D$E؉D$ T$E D$E$=t3w $Ef>@fFE܋UVtfNȃ8[^]FfF׸E@EÿE?EEUOFfFFfFw1a1뚸̀rS[TU? [ffffffffUE]UWVS$8JUE։ME}E؉Eut\E9UsI߉։]EƋE D$\$4$U~# HS9uE)9ur]ڃmu$[^_]Í=D$ TD$D$r<$$EP5D$ TD$D$s<$$T!UWVSX&ITEu Ud E' } E EE̋EƉE$]\Eȅ E? Ef UȍBEԋEЉE؃)֋]ދuމuED$E$M!EȍDU؉UT$}}|$}<$U1Ʌ9uWuuEȉEMEEĉ}NjE4u܋E9MuЉEËE9s#ED$;D$$UU9tΉMuЃ\97]ˉ}}܉+uED$|$4$UM9t#+EU‹ErUENjE9r}܉ً}}M܋E9ED$u܉t$)$UbE‹E+EuEuE9EԋM9KEEEUčB}9EU}؉EC‹u)}U92؋u)uEԋ}9}EЉEM]}9}ED$}|$]$U}]UEE܅U؉!ED$|$$UU9~S}E9rՉ߉ËE9M̅fU؋E.& 9r}G9T)E؍LEDEEUv9uM؉E}9}M]U9UU̅U؋E}f.&029r}Gu9!F)u؍DE؋EԉEUEE9'EUċ} :9t?Eȋ}ĉ}ȉEED$E$ME>Eԋu؉0EȉEċEEȋE9E^Eĉ$]=1X[^_]Éȉ}} 9sOuƍW+}Mω:}u݋uƉ]䍶 HZ9u]E9r}}E؉EU܉}Љ؋]<].&.&XJ9u]ދ}9rU܋}.U߉ËuދM9U]3]M9lËED$\$<$UM9Ӊދ]19ME9Ms?u}}9us'<3ED$|$E$UM9~؉9urًu}E9u̅U؋Ev.& 9rUB9)ӍCu؍LuDEEu0f9uM؉E UE8}؋uf9rEH9)ÃE؍4TЍ< }}\>M).&ƃT9uUU؋uuދU+]9rEUED$\$<$UU9ЋUԋM9s͉}܉ߋ]M ֍E9}s8)1ÍED$T$UE܉$UM9ȋU‰9}rȉ}Es11}؋uv9rEp9rR)ÍKE؍|Ήuu\2M)щ.t&.&ƒ\9u}}؋UUs11(M]U9UE̅U؋E}Ѝ.&029rEЃ})}؍DE؋EԉEvp9UEЉEԉ}؋uEԐ9ruFU9rMB)U؍DE؋EԉE#}؋uEЍv9uE؋UЋ})E؋EԉE11봋U9UsEЉEUUE}؉8E‰+EuEuY}^؋uƋE؉EЉȍ8].t&.&.&XJM9uU9rED$}ȉ|$Eĉ$]}~]5D$ lD$D$y<$$ÍAD$ lD$D$x<$$k]5D$ dD$D$&<$$i]D$ dD$D$'<$$7h]U=HUT$̪D$ ED$E D$E$]fffffffffffUWVS =HEuVtG~^ЉUv.&.&tP1H1 uN9H u [^_]ËUU$]辳t"N^HXNH UF [^_]ÃUWVS<Gu7uu[^_]*F$$Ȥ4$NjF$$賤[^_]UWVS<ÆG}E wu v.t&6tk9uFVO9N uO1MO1 MtGD$ D$T$$<GWG1D$<$KtG9F [^_]ÍˑT$ |T$D$i`$$E GffUWVS;æFuE8F}9FiF FD$ D$D$$tFVFD$F D$$FtotfxWFvthV uAzN)91F Ju M ]z u F MЃ[^_]{1}i81F u1UWVS:ÝE}7t2G$$蒢D$<$ƋG$$u[^_]D$<$Ɖ[^_]UWVS G:,EE70E@$$D$E$,ƅ@ ‹} 6@E@$$蝡0tiEM 1D$E$ƅt[P } uWuYu}8닋E@$$t= [^_]äDf9ftl8Z}8E1E xIE xfff̀rS[4C? [ḃ̀rS[C? [UWVS$8ButqEEE E}8D$D$ED$ t$D$E$9ƃt 1$[^_]58 u+81ፃ D$ D$D$<$$`ffffffffffUWVS0=7&BE̋]} 9E1u9 &t8u)؋U+0[^_]ÍM1D rE̍.&TЃutS؉].t&.&.&t\="t]W$].I1B]YcfffffffffffffUWVS6@}U utMЅt1.&HOtu&xu)Ѓ[^_]ÉU P7D$ D$D$=$$U 끍7D$ D$D$<$$TU KfffUWVS!5@M} Utut[4t&.&9t8u)Ή)t4ttu)[^_]1<$Ɖ[^_]ÉUMP7D$ D$D$A$$xUMP7D$ D$D$@$$CUMUS4>Ey |(9~)ML$„R.D$E $1[]ÉD$ D$ED$E $1[]UVS3Å>Ey |(;}.D$@„R.D$w 4$U[^]ÉD$ D$D$@w 4$ [^]UWVS 3>u} taEtHR.EEt/E9t(TSOLKf9t)ȃ[^_]1[^_]Í>D$ D$D$? %$uID$ D$D$@ %$jFfffffffK̀rS[=? [UVS2<ulimNA90%[^]Ëtph9rltp[^]9r싋lUWVS1z<]l^Uu}E_ N)BЍ4))Ѝ<)Ǎ)ʉȍA )) E9uu}E]싓tp4819u[^_]Ë]싃tpu޸UVS{0`;L4$aulU4$D[^]ËE4$-[^]UWVS 0;} lE[LE$lttp)ЉȉB}H}wQǃǃǃGlhEG1E$qE [^_]1뜍Gƃ}?v8}}E?EG EElE艃hE=p)ЋM@G@EE띍 D$ D$D$Y`%$vE$fEEE3UWVS ..9lEEẺEыE)ȉE䍃LE$ٕlUp)ȉAEplt)̋Ep1thE$>E [^_]1끍 D$ D$D$`%$"UWVS,7L<$ޔƉ<$ϔ[^_]US ,ä7ED$E D$E$t []US,s7E$[]ffffUWVSa,F7}tHD$<$ƅt&tt$<$[^_]1[^_]Í D$ D$D$A%$UWVS+÷6uD$4$?Dž|$4$t>UT$D$E $d;Es1>[^_]"썃 D$ D$D$V%$+NfffUE U9r 9]ø]UU E9r 9]ø]UWVS*Ï5w w uw <(9E1ɍt-ωD$4$>t w PEu׉MD$D$4$ MtMljMuD$|$E$ w 8Ftt$E$ 4$uMEw 9t$$袨ǃw ǃw [^_]Éw TD$D$$K[^_]UWVSd)I4u} t%~D$4$tt=t1[^_]À=t[^_]UWVS )3ut4t$<$ƅtD$<$ 4$踧[^_]ÍD$ <D$D$%$UWVS(t3}G$ƅtx @D$$~[^_]UVSB('3ut/t$$tU 9P [^]1[^]ÍD$ $D$D$%$UWVS 'ñ2U<(9E8s7i1}ƉUE D$ED$<$u E <=,E19MƃU;\CEVE [^_]UE [^_]L닋 EyyEeu>EcLt9er ]6M υt&MyEҋuLMyfffffffUWVS&ƍD$s$f$čD$s$>U ET]UWVSh9E1D$<$=@EtFyL$$vL$T9~L$ T$D$<$U+u h[^_]Q=f+̀ffffj̀rS[? [ÒrS[? [UWVSæ}u t$<$u 1[^_]D$FD$<$ tۍFD$<$YtȍF D$<$Ft&D$D$D$ FD$t$<${z;D$ D$D$G&$6D$ D$D$H&$ffffffUWVSv]}E 0|$E$Ctp?9}raeto1Ɖ\$E$U]9suM9u+EE $]E E E8t 1[^_]ÅuUuCtD$$]QƋE 0i]D$s$랃t.t&:똸vLE8qw .UWVS] uEt'1 ]9}t\$E$օu[^_]ø[^_]UWVS u 9E1V F\DžTDžX)DždhV\f9DžllD$`D$ TD$XL$U$ …x^D$dD$ TD$XL$E$6 …x'hD$t$E$‹\f8tVE+oЁĸ[^_]M.֍F\DžTDžX\ P\p9{\hD$t$E$x\NP\6DžhhD$pt$E$Fx'q\D$ hD$D$4$$\D$`D$ TD$XD$E$ \87Jffh̀rS[$? [UUB +B]UUJM BB 9J )ȉB]1]UUE J9r)JJ ȉB ]1ɉ]1U} t1]ËEE@UB]UEPvPU ʋH H ]1]USEPv PH ʋ] H []1[]UEPvPU ʋH @ ]1]USEPv PH ʋ] H []1[]UWVS óu}F9r+)F|$E D$F $`~  [^_]1 [^_]UWVS x]u}F9r+)F|$F D$E $[`~  [^_]1 [^_]US3 EU ]t,HPP UP[]ÍlfUWVS}u tgt$<$kt6tu*t$<$L[^_]ÍFD$<$诬u 1[^_]Ãt$<$蒬[^_]ÍD$ D$D$(&$Oj;D$ D$D$(&$ 7UWVS}u tnt>t$<$脲u[^_]D$ FD$t$<$腴[^_]ÍND$ D$D$X(&$葻떍;D$ D$D$W(&$ecUWVS; }u t$<$u 1[^_]ÍF D$<$褱tF t6u$FD$<$tăt$<$뵸[^_]ËFE }F[^_];D$ D$D$w(&$荺OD$ D$D$x(&$[ UWVS1u} t tJD$|$4$葱[^_]Í;D$ D$D$g(&$uD$ D$D$h(&$UWVS~}u tet$<$蝩u 1[^_]ÍFD$<$t~uD$D$ F D$t$<$U뵍;D$ xD$D$(&$qD$ xD$D$(&$߸BUWVSÚ}u FFt 1[^_]Ét$<$藨tFD$<$ tӍFD$<$qtF D$<$^tt$<$K랍;D$ hD$D$(&$V)D$ hD$D$(&$ܷ'UWVS× }u -t8GunG toFF[^_]ÍL$ M썃XD$D$%(&$UIGUMt]F[^_]GF[^_]ËGuS[^_]GFGF[^_]ËGtщEL$ LL$D$$跶E( GFG F[^_]Í*D$ XD$D$$(&$^G EL$ @L$D$ $5E   FFfffìrS[ä ? [v̀rS[Ä ? [VWST$L$1t8uЄt`B͉ .t&ލ1΁ ǀt8uBt$8uBt8uBt 8uBu[_^ffffffUWVS uM EtqF> .t&9tQZut\M xU &.&t%J9utE8[^_]É똉1E0u1ދE1эdD$ D$D$:L&$0M E9M D$ D$D$;L&$M fffUWVS(ã ƉЉ9U1҅OD$ |$D$$ċ<$D@9Er*ED$|$$Fu%1U+I([^_]E @(N sD$ ܒD$D$ $e4t9um΃tft%D012 (T$ PT$D$p&$v3T$ PT$D$p&$-D$ ܒD$D$ $duoN }L$$ te$ff^N mF.t&(UWVS~ƉE 9E1t5Vt1U+gĈ[^_]ø݃FEDžF;Fu&F uF=hu ~Wt{}ttMED$ t$D$$Ї4$P9E{ED$t$$+1F5EDž*FfEMfD$ ܒD$D$<$a<$蘣9EED$|$$sF<<p EED$D$D$D$ T$pD$$v~0wDžFȉсI<<9fE<|$ L$D$$U8<$9Er8ED$|$$$mj$m~3LED$E$NDF <Džytt Eut2ED$ D$D$$st1ED$E$1$UWVS<êuU EEMEE܋EE؋E E9E8}1w~wF}U+A<[^_]ËE}+8+EԉEE؉EE܉E MM<[^_]xvE܅t U؅Et(1댃vE܅t }؅cFu f~#V~CΉD8T DND$ ܒD$L$M܋E$]M܅x9lEE܅t E؅aFfVT$D$ D$L$M܋E$Z]DžMn9fFfF fV ffuu҉T$D$ ВD$ȉM)D$4$\Mx 9EtEc҉Uԋ}^UT1pE܍E؍xE̋E܉M܉u ET8ẺT$D$ E؉D$t$ $MA\9M)ƃ9}u1hȃiviD$t$E$製1?FD$ ߒ EEEDEԋ}1pE܍E؍xEЋE܉M܉u E8EЉT$D$ E؉D$t$ $MR[M9)ƃu1yMFD$ ܒD$D$}<$[<$覜M9L$|$E܉$腼MFUU܉D$ ƒD$ȉM)D$$ZM9\D$T$ D$L$M܋E$lZMHUWVS@lj΋E9EG uY$fto|$$gt9wuҋtD$G $lu1ffh$=@=v1U+|@[^_]ÉЍJƅffЍtftD$D$ |$D$@$yO9Aff9't0G9T$D$G$t$ |$D$$gu8u Dž11fBUVS Äut$F $eE $MUYF t [^]ÉE4$cE [^]ø̀rS[$? [UWVS!}E$jxyUtR֐.&6t;F txu@9uD$FD$E $諸Uu 11$>q.8[^_]1[^_]UWVSv[ut7D$4$FftID$4$[^_]ÍY1D$ D$D$@&$띿ffffffffUEu]É.߃A.t0.tvPЃ w-t1]ÀvPЃ v1UWVS UE Hzu;9]苰uυ0qD9sD{]Y}^D9_D$υt'v@9w@|uxb9wxT9}P [^_]Ät^};tm9tЋ'밋II[:K [^_]Ë9u9tЋ}^D9_D<]][D9^DυYDM9YDt&I}>0^D9_D$명ff9߅unP=UWVS(EEdE1ۍUԋEЋxMЅuO.&Bxy‰t%xux#l;htӉ@udEϋEЋxE9zEuЉF([^_]ÍUԋEЋxUSP5PtStɤ/[]PtfHuX uHuxuπt[]Pt#u[]@ tOED$ ED$4$0uEt8u x[^]ø[^]ÍD$ lD$D$&$%qUWVS(tƋ@tt 1([^_]ËFOx]M܉ЉUUMtR=w1fuVtztufLJ f럃u ([^_]ø ([^_]uEFtOtB1M]\$ ]\$D$$DGt@MzV뒸.<븍3UWVSƉׅt5tet&u 1[^_]É $GuMT$ DT$D$&$藜MuMT$ DT$D$&$cMkMT$ DT$D$&$+M6UWVST։9E1|DžDž&F F`FD$$D$ D$D$D$F D$FD$ D$D$<$,u G @u}D$D$ L$D$<$O @,1ƒ $VD$D$ D$L$<$~QG KD$D$D$D$D$ T$L$<$負E+ȁT[^_]ËQu7Iffft#fFPЃ6tRr D$ D$D$ &$;UJߟ+t't܃t&u貟襟蘟UWVS(ÚƉЉ}9U1҅t\D$t$ D$D$4$K=1U+([^_]É4$PwstP|.ut$T$ D$D$4$%K댉 T$ T$D$ &$×fOUWVS4^}ĉÉ9EЉNjE1C<<EԋCE؋CE܋C ECECECE1E}EȍXH,P<9ѺsZu܉E 9tBKt:": =t׃v.t&.&w9uE̋u9~UȉEuE1uЋU+4[^_]Í}1fE9s/tG9sD9rEufEfECEEb1fۋ]UWVSöƉ׉MEOD$A M$"[…tKX MH FBF B FBFBZJBB!G_ ߋus%uu Ѓ[^_]äЃ[^_]ftugD$ dD$D$&$0D$ dD$D$&$Δf mUWVS&}b@DϋE$E,9ƋE1* $ , 11D r} !W.} ft/} t)1E+" &[^_]Á} um>(Dpf@fPff[PD 8Hx LD$ |$ T$L$$蚖…P @@ u+!<$菖f$R莏t,$ډL<$軌 LwdmPu .8tX<9 u拽4t t҉tH9Y PP1 UWVSpyƉ9NjE1>$H$H`11D r틅FFtGGFUCFV胍1ɐ.&.&.уu9s x.:d9 @ *HDPDDžDžDžDž<$_8=.t&脌G au$1ҋybK;d97$1ҋ0ND$F D$F$5Ƌ@ut2OD$G D$G$tF$IN$;NU+cp[^_]Ã){$M$M1녃1(@<tcE D$ D$D$$}u|d@=1$1ҋ_/@ P$1ҋ|f8 D$ D$D$ &$|$1ҋR@uu*$HDPDE诈$K茈1gUWVShEdpPt%=~hnDž1E1 Dr]`1 DrV]pdMEE`]MEE$E]1 DrFdd<$h讆dU[^_]É<$h腆h.[^_]ÉЉ`6`fXh΅\G]1}`X D r틅h HOT`@pPDXLHHX9HHD$ PD$D$L$h)dL$P T$ D$DD$l$:xq]1EDr틅lEEE!$\Xl$h(H9TX\d\$hPEE؉E؉d<$h dS|dMEEdMEE‹`MH@A‹@u@<$h{UWVS`ljUMMME EEE9E‹E1EE$Uu\WtUL&t89uML$MML$$OMt u܋E01}U+`[^_]ËG;t?OƅE$1ɋU "D@u듍ML$ME$1r"D$E$T4M<MMG;tƅE$1ɋUv.t&@uD$ TD$D$&4$H{EED$ xD$D$4${%uܸEvWt$D<$DuEaME뺋M#UvWEw ]Í<]UWVSE*ut(vGt$ D<$Du[^_]ÍD$ D$D$r&$yUWVSøEdE tEpMh9lNjE1x1󫍵1҉D r퍍T11D r틽dpPu x x$9Dž hlE+[^_]ÍD$ D$D$&$x t]DžDžDžDž|wHt;u Džx$tT+ l`XtGt`u\W9tCu+w9 t  | t1҃1҉ TL9G9}Gw9 uuttdx$tTLf.&9u`q@D$%d$%?gd$T…^ d)xD$L$4$tPTP `pLH@D.t&.&vZ~u~ x G<_x$tTLt&.&9uiJTƅyx$1ɋtH`phG <t`V9&ut뎋x$+- r8vDž:@D$-6`ptu t Džx$y,vGt$5<$5ux$%,Dž|.Ix҉$+Dž>$ 58JhD$ 4D$D$x&$j>x$z+Džx$]+DžX`A{$0"DžDžt?G t,Gt&H?wB11  ?uNj<$7JD$ D$D$f&$iG H닋Dž(D$W3Dž{vGt$(3<$ 3u DžDžvXx.fǃ 4$1ɋt.GtuŋG@fuXHS$&*D$D$D$ L$D$ $6ȉQH9rs$P) xrHH9s $1GDžPȾtp;X@XAƜ9qXGGPPP PP PPHxPFF|!DžDžDž 1D$ |$T$$x$1ɋD$D$ $y|$L$$ ~D$|$$FF|HF<w<FDž|19sMd9]2Bt⋵d|9s 9r $7ctpD$ D$t$<$>&)ʍ0&J9uB<$W.Xt;1AtF0 $+.Ft4$ .X@FXVDž|1dH1׉D$ D$D$$TT$D$Ii $THwjNxa 7 $*-x$#V5x$#DžFB0$,t2Buቅ߉UWVSp蔭mMEׅ M11D rEME EED$ E$]+HMt$E$]oX@t\}}< < ߉ډt$$]t!P@t< t< u׍ZBu}}GE؋GE܋G EGEGEGEGEEED$ EԉD$D$E$VtFEEEEڍZB&q6EEtÉE v[ttMډ[uEMA.t&‹@uUEtEЉEEp[^_]ËUuˍD$ (D$D$k &$i`]D$ (D$D$l &$4`UWVSp uE$腐>FEu11D rE@tmEEEE<$TML$ML$D$ |$D$E$聐twEЅUp[^_]øp[^_]É<$f.&.&:|y@uEu1].t&.&.&\X:Dyuu]؋]<.pDAEu@uDA@tv:Dy@uEuEx<2wE苴L1EE<2w] EBRDQ@uf.&DQ@tvDQ@u}[^_]EEfE랸}))ߋ]4)}؍)؉B)ߋE4)E؍E1ۃ@EEEzDAuE~EzDAt/}GEzDAu( }DЉEBDAUWVS%l wljE 9E`M!t8\$ND$0$AD$AD$A D$ AD$AD$AD$AD$A D$ A$D$$A(D$(A,D$,hhDžD$ D$D$$]j uit_atP%xrt& r; ut$ؔD$$u f})\D$|$D$ D$D$$ g:t$$%t$$ Ht$88f$$D$ŔD$$t$E+Č[^_]}v(.& p;8u}vThl.t& P;8udt$T$ D$D$$n#8<$\=!\$3uD$ D$D$$B|$D$ D$D$ $uz|$D$ D$D$ 4$Iz|$D$ D$D$  $z|$D$ D$D$ <$yd) D$D$ D$D$4$y}艽EЉT$UT$ D$)D$$[06R.9D$,D$$)U frffXftD$D$$1&D7D$D$$t9|҉ƋD$ D$D$n>$1D8 DAu.L$$*9|ȋD$ D$D$$saD$$ 5 D$ D$D$ $fuAD$ D$D$$lD$ D$D$ $v1&D7D$D$$9|҉ƋD$ D$D$n>$1R.D8DBu.L$$<9|b$D$AD$$АUWVSctnEĉED$ED$E $a>D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,`D$0 Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,1`ẺEEfEEEfEEEfEEEfEEE`t3 u'^"lUoUUt& x;uED$|$ `K.D$H)D$E$E`t eED$$;E`AED$ D$D$r$>D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,^;D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,7^D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,g]D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,\aD$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,/\D$0Eĉ$EȉD$ẺD$EЉD$ EԉD$E؉D$E܉D$ED$ED$ ED$$ED$(ED$,[=E`ek‹wt& puED$ t$D$E$k‹w p8uED$ t$t$E$jWc& PJ8uED$ T$t$E$ajWuf Wz?uED$ T$t$E$!E`t tED$$ ED$$1ɋuEzED$$ E]ED$$@E@ED$$E#Ef Ef Ef EĈ[^_]Í T$D$ D$D$<$=n D$D$ D$D$$UnU D$D$ D$D$4$m D$D$ D$D$$UmUP D$D$ D$D$4$]m<$mD$]D$E$.Ĉ[^_]ËED$ D$D$$ED$ D$D$$rED$ D$D$$HuED$ D$D$$ED$ D$D$$QED$ D$D$$ED$ D$D$$-ED$ D$D${$vED$$ jIUWVS${Y`duE }9U1D$L$ t$U‰T$$}xVD$t# $U+u#$[^_]$.1UED$ D$E D$E$]UWVSXuc}ED$|$ ED$ED$E $x8Ɖ<$FuH;M}"f.E[^_]À|.tH;M|1[^_]UWVS$ XbE9E1D$|$ D$E D$E$&…tD$<$HE+u Ё$[^_]跄UWVSyW^b}u Gu 4 Gt*D$4$?uUt E[^_]ËEtE[^_]UWVSWauSd~M u7&.& ~t9uUt E[^_]Í L$D$ D$D$<$hEtËE[^_]UWVScVHau} cVu5f.& Vt!9>uMt Ev[^_]Í|$D$ D$D$4$hEtËE[^_]UVSUæ`u cThlt& Bt ;2u[^]Ét$D$ D$D$ $gv [^]Ét$D$ D$D$ 4$Ng[^]UWVSU_U} tfUBb~U f ~t;u[^_]Í T$D$ D$D$<$f[^_]ÍlUVS|Ta_ua(&.& Bt ;2u[^]Ét$D$ D$D$ $?fv [^]Ét$D$ D$D$ 4$e[^]UWVSSÛ^}auwX w t&  @Bw- wi ue@w, u86\u(LuB<u),1|$MD$ D$(D$4$d[^_]Í)#捳ލ֍ӕ΍͕ƍ뾍ˮ붍뮍.릍랍5떍뎍UVSQ\uE_D$(YD$4$_x#_Y[^]_t$ ܒT$D$(Y$ݹUWVSQk\}^Uv.& rt;:u[^_]Í |$D$ D$D$4$Lc[^_]UWVSLQ[9E1E <tmD$UD$ D$.D$M‰ $MbMt#PT$UL$<$U0E+u4L[^_]D$ .M‰L$ME D$$Mv}UWVS48P[EEEE$E܍U}}؉HEU;EEU t 14[^_]ÃuuU<-1E<+u JMBR.DK+r1&.&.& LH>vD{uU 4u<.m}DCuuUЋMэMܨ@1ҋM..&.&DK@[9rM̄WȉMDS@793EEԋ}DC@1ɋU1&.&.&DS@J9rUȄЉUDS@&9ENjUDC@.1ɉUЋU/&.&.&DS@9rUċUЄEĉEDS@9Ef1.&DS@9rEu ]Ԉ^^FEȉFEȉFEȉF RGEuuESt&.&9sDS@uE&DS@tx9rhEz}BDCz}4BDCu;u[JMBEEEz}DEBDC yUWVS!LVEU UHMHMHMXˁHɁ@ ='-E썇pE)ENMb֍)É]ԉл))ƉuЉމػ))Ɖủ]ȅEEMbӍ)MĹ))Ӊ))MUQEM)U܍)MEC$xEE-$xEE$lxEÅU܋MXE^}d\$DD$@ED$<]\$8T$4]\$0]\$,]ĉ\$(t$$L$ ut$ut$uԉt$uЉt$ủt$ uȉt$x)D$u4${%E$Et $Et $EČ[^_]ú)‰U썇iEESEW- uVE; er@ror:@ unk@ nown@ LOC@ RR @vers@ionEČ[^_]ÍsEs}\$DD$@sD$*t<.tȅx%[^_]Åt<.1[^_]ÉM\T$ h!T$D$)$E[^_]UWVS0GÃRTE荰EEEE$距PlPHH8|$ x|$x|$@ D$L$T$ sD$D$4$g~ Eƀ0[^_]UWVSFQu( Gt-D$4$轥u?E tE [^_]Ë?D$D$4$aukVR.DPtMD$ ED$4$讍ҋMyE8m1Ɂ]1VUWVS FPulTh Gt-D$4$ͤu?E tE [^_]Ë?D$D$4$qukVR.DPtMD$ ED$4$辌ҋMyE8m1Ɂ]1VUWVSEOu D$4$ZFFy ;F|/} t)P}D$4$N[^_]Ét$E$3USDÇOEM QQy ;Q|< tZ[]ÉL$$[]UWVSPD5OEu E$*EEEEED$4$pF0u ǀED$4$D$4$a[^_]UWVSCëNPPƠ%9uV@ttuF*V@uuOFuuFuFf~@t8D$4$USlj4$kP[^_]ÉFu뺋F몉4$fPfF@UVSCMƠ%9Fu t$@J.XD$ D$ED$4$'[^]UVSBØMƠ%9Fu tE D$ D$ED$4$[^]UVSeBJMƠ%9Fu ztED$ E D$ED$4$[^]UVS,BLƠ%9Fu -tNE(D$$E$D$ E D$ED$ED$ED$ED$ E D$ED$4$B,[^]ÉED$4${EUVSAnLƠ%9Fu t2ED$ED$ED$ E D$ED$4$5[^]ÉED$4$EUAL%9U]U@K%9U]US@KED$%9$[]UVS@ÒKƠ%9Fu t$ED$ED$ E D$ED$4$[^]USZ@?K%9$-N[]UVS3@KƠ%9Fu Ht2ED$ED$ED$ E D$ED$4$;[^]ÉED$4$EUVS ?åJƠ%9Fu t9ED$ED$ED$ED$ E D$ED$4$7 [^]ÉED$4$8EUSG?,JED$ED$ E D$ED$%9$C[]UVS?IƠ%9Fu t4$,L[^]D$$US>ÖID$ , D$ED$%9$8[]fffffffffffffffffffffffUWVS A>&IE8tj׉ƅt|$4$Ot@u(<.tqAtN<\u~u~t(뺉U)Ѓ [^_]ËU9Ѓ [^_]1ȋU)UWVS=ǓH}};ƉӉȋ9uwufu9rى)ڋE1[^_]ÉED$E͜T$ D$D$*$ L.EE룤u9sftuu_SfӋ]QKUWVS0<ÆGE׉΋UU܋U؋U$EM9L9MyܜE荃EEuuE9D$E$论t4$ME*t4$MuuE$E4E؉Eu܉00[^_]ËuE$Etu)y9uΉE+T$ %T$D$*$BE0[^_]1UWVS$;E]Uϋu M MUL$T$ L$U‰T$$"EaËUk‹E9uC6@@EJ}B$[^_]Ë]t*]t .]{<|.Z9Z.EM9s;D$U썂͜D$ D$D$*$ L.Eډ)؋ux$[^_]ÿ뛉댋]썃D$ %D$D$*$~뷋]EE}8UWVS(59D]}u ӍR9M)ÃM L.E썁͜EЉU u2D$ED$ D$D$E*$EJBs1([^_]É4$E* t+([^_]ËUU]UE([^_]UWVS+8BE}E(M,u M0p9tU1҉u$t|$$I:ƀ?YE4$k:DžU4T$|$E$-Eƅ9s9D$͜D$ D$D$*$ L.7)U4E$NjE$|$D$?5D$ D$dD$$HNj $‹>|$ $}wyEt}wvM!򋽤(t#t<.z<7|0.}u$ U$pD$T$t$D$ D$dD$4$nG‹$i9&lxR.|f @)~ DžƋD$D$<$9u׋)lj4$}O<$xJ|$4$1ɺ0f; @|01x DNu.9uՋʋ)‹4$9gƋp)p9D$ %D$D$E*$ }+R"}$4$VD$ߝt$ D$dD$<$D‹$$D$t$ D$dD$$nD‹ $eGD$t$ D$dD$4$D‹$9z9[D$|$ D$dD$$C$utE+-Ĥ+[^_]ÍE4$d)5tD$$1ɺ~ln>8E4$3+D$D$$U &Ƌp)9D$ %D$D$%*$ }$ 4$VD$ߝD$ D$dD$4$A‹<$4|$D$ $Dž- Ɖ$+ H}u ;}$$|u$),D$ߝt$ D$dD$$@‹ $ GGD$t$ D$dD$$R@‹ $IG$D$t$ D$dD$4$?‹$_wGo"D$|$ D$dD$$? $9u}3$+ ;x% nG GGDž====Dž$`lj9w\&79&&Gt1Gta$D$D$ D$dD$$~=‹ $uuO}$<$fOwG$$T$t$L$D$D$ D$dD$$<‹ $$9 E$p}$4$V~NL$T$D$D$ D$dD$4$;‹$TD$ *@D$E$pt$<$C-Dž##?#+ 1>)0~0 $a09"$‹ $#u|$D$ $U R<$+ 0|$T$ $ + 9$sƉ9$)u}$@<}$D$ߝt$ D$dD$$9‹ $GGD$t$ D$dD$$K9‹ $BGD$t$ D$dD$4$8‹$bGG<o"q"}4|$ t$D$$軳4$C9s?D$͜D$ D$D$*$ L.։)׉}49)= $ĝS@u$D$D$ D$dD$<$y7‹$t6c'92@Dž@DžDDžHDžL@)‰t19rE4D$ |$L$$賱<$;9s3D$͜D$ D$D$*$ L.)U494$+ Pt$|$,ED$D$ D$dD$4$5‹$@t$$4$븃}$u$f}$v}4|$ t$D$$.4$9s?D$͜D$ D$D$*$ L.։)׉}4FD$D$ D$dD$<$n4‹$iF9|Dž1pƀu2$BDž |$D$ D$dD$$3‹ $|OP9w|$D$ $U v<$+ T|$T$$U Y%<$?)‰Ѓƍ@t$D$E$$+4$D$D$$U r)j1K:f.&.&.&.&.&.&.&9t؉4$QD$D$ D$dD$$$1‹ $u}$4$F$$D$t$|$yD$ D$2D$@4$x0}$<$.G$ D$t$|D$ D$2D$@4$ 0‹$q4$Mlj4$+ $zlj$H$0lj<$]|$D$$U ^8%<$cG$UOWT$D$t$D$ D$(D$4$8.‹$3E$p VUUU)ȃ= $ĝ[Ht$|$$U C4$+ z4$2~$bD$ED$ D$dD$$ -‹ $o<$~$D$T$ D$dD$$,‹ $<$IfF $7 4$)D$|$D$yD$ D$dD$4$,t$|$$U a4$+ CF$~t 4$o4$dD$D$4$4$*9E4s3D$͜D$ D$D$*$ L.>D$D$$U v9pF9Gt1Gta$bD$D$ D$dD$$5*‹ $,uOE$ VUUU)ȃ=F$ĝ>+}$e}4|$ t$D$$裤4$+9s?D$͜D$ D$D$*$ L.$}~F$B= g$ĝ}$+4$%VD$ߝD$ D$dD$4$(‹<$}$ )ƍG GGG GG GGƅ=t9yG GGG Gƅ=fDž==fDž==Dž====W GGW GW GGW G$g<|$ݝD$ D$dD$<$$‹$eD9D$|$ D$dD$$w$ $kuD$ @D$t$$Dž  + 1F)0~0 $K09 <$m‹$uD$ @D$E$D$$ + 1F)0~0 $09Y <$襺‹$uJ}$ߝ4$lj$}|$YD$ D$dD$<$5"Nj$‹*T$ $1ɺyk$ CC4$Nj$u4t$D$<$9Dž9s3D$͜D$ D$D$*$ L.)u4t$$1ɺm_4$ M=$Nj 4$u4t$D$<$3Dž9s3D$͜D$ D$D$*$ L.)u4t$$1ɺgY4$X7$Nj4$u4t$D$<$-Dž9s3D$͜D$ D$D$*$ L.)u4t$$1ɺaS4$ a/$|4$u4t$|$$+9s3D$͜D$ D$D$*$ L.lj)Ɖu44$kMt$$1ɺ7)4$ n}4|$ t$D$$$iH)$qT$ @t$L$$X…$ЉPzD$D$$U 9ȋ$rk s}$ f<tu$n>!<$r $D$E|$ D$dD$$x‹ $o4$-r$WD$|$ D$dD$<$‹$ t4$D$ߝD$ D$dD$<$‹4$t$D$$U )D$ *@T$t$$ + 1F)0~0 $D09<$f‹$u $n>xY}4|$ t$D$$Z4$9s?D$͜D$ D$D$*$ L.։)׉}4<$n>~($keD$D$ D$dD$4$$ w$n>O;|79})$n>v$n>CD$ @D$L$$ƅ[o+ 1>)0~0 $097$>‹ $uu$d)5<u덍D$D$$U R$l'0$n>|UWVS8 E  U8ud)E}?ED$,ED$(ED$$ED$ t$\$L$ED$T$ ED$E@)D$<$P8[^_]UnO M8E#ʬʰ]UWVS=" u}'|EtG9E r'Gf|t+E D$<$պyz([^_]9} r+Ey;}uET$ 0&T$D$l +$讶E뵋E9E r1UWVSt] EE}U ‰WH9ffOX9@ffG 19rvKffLG u1Dw fu11ɉLu9uCG$G(G,1[^_]ÉD$ t$T$U$vxËU뭋]>(UWVSv Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$oF,F,^(D$ML$ D$FD$$]07F,F,H^]9:f]fPV,PffN,ujǃfǃ ǃF(F(V 9~F$F(DF,1[^_]É~$F(DF,1P 9UHɋ]HN,@ff V,9ErgMF,F(F(T~ 9~~$gF(F,b8M] ](UWVS dM Eu} ]9~$t~$F(DF,u^(D~ 9V(9F,9~,)щL$ |$VT$$}F,F,^(MT$D$L$ D$FD$$];F,F,H^]9>fҋ]PV,Pf҉N,ukǃ ǃǃF(F(V 9~F$F(DF,1 [^_]É~$F(DF,1P 9UHɋ] HN,@fV,9Erg]F,F(F(T~ 9~~$hF(F,cN]]ٶ(ffffffffUWVS E}]} 1E䍘l&;M EL0T0EUD2ED2} v[Gm M0<OȈEO?Mu9uw [^_]ËE Ep} W׃T$ X&T$D$H+$萯EE1F]䍃/D$ X&D$D$H+$P1ÍP7D$ X&D$D$H+$=-M uUE1|1UWVS E}U GE11]ƐR.u荳l&uuMt;}f]):.&.&.&Ftn]DC@u=U MD$E$]wMU tFjt;}M):1ɃFuutȃ [^_]Åtv;}sW])؉ :;}sN:AtC;}s)M)ȉ :;}s :tȃ [^_]Ät؃f룍FEuȅu].t&CtuDA@u띉U ]䍃/D$ L&D$D$H+$¬U ÍP7D$ L&D$D$H+$莬U ;}<: M.t&.&ADC@u=AE}]䍃ZD$ L&D$D$ZH+$M"fffffUœEt,]Í,]UqEtwt#t]fÃu]Í]1]Í{]UVS @%EuVp΋E$L$t$UT$D$E D$ ED$D$@J.$cXj$#|*UWVSÛuWE >0u Fh+$;zMUWVS }u QUEHf0x}~E1wL0ڈ wL0YQƒ}u79}7YA.v7ڈ v79|E[^_]à EFE[^_]ÉET$ &T$D$gh+$EL UWVuL o^_]ø1 fffUWVS\fϋMM9uM1t$D$GD$ D$2D$M $MaƃM9r,ML$$A7M)11}U+u\[^_]øUWVS EE E컉e)})ljӉ))эR)É]%I$)‰))ˁ}: E E+Ju}: w) ]u$M EÉ$SrKE}~=Ut3}ƐR.njR.w\DAtu܋E Ƌ})x [^_]9u]䍃D$ &D$D$e+$聥 [^_]ÍM U$WEM E$DtiEEM E$HEbt?EM EÉ$MM7tEMffUWVSvu4$qH9MX} sjuWuOt{} T р:.utZz\ut\z\tڋU ƒ.} 1[^_]äft.t&u?u&zU 벋E Pf} 1(yUWVS~cE 9E1D$|$E$tGD$T$${tT$<$LU+u [^_] fffffffUVSçEuUMx#L$ T$t$$Ux9s[^]ÉL$T$$[^]fffffffUWVS Q6utcEt\E $)ljD$4$*u?|$4$Q&u%džt$|$E$# [^_]É4$%flUWVS äutcEt\E $(ljD$4$)*u?|$4$%u%džt$|$E$" [^_]É4$O%ܦUWVS /u t\E$'ljD$4$)u?|$4$6%u%džt$|$E$! [^_]É4$$SUVS ÌuD$4$o!tD$E D$4$5 [^]D$E D$4$ [^]UWVS?$u} tAv-u3D$4$'tD$4$3(F1[^_]{USøEU tttu P1[]6UWVSn}u t' td@t/tZv{Nw u6ߤ(D$<$&tD$<$R'71[^_]D$<$&tD$<$"'΅uʍ&UWVSôu} tPD$4$a&t#Ɖ׉$6,t/Vk)Ѕ~?D$D$L$e[^_]UWVS\$|D$hT$dDŽ$ $gD$T$虒D$L\$|~c== D=D$Xݜ$D$ht$pÉ$-wʋ|$|&\$`t$pD$P0D$@/M\$`D$xD$p1/t$pDPЉD$pK$C‰ƃ/˃9y~ǃыt$xDPЉD$x?D$X!D$XD$8D$HD$@ \$pD$dt|$h8D$pe[^_]ËL$T8pet Et$D$h|$8D$HD$TD$0t$hF$F<+<-D$,NЃ S$0` P.&.&.&Љ$2R0tVσ D$49D$@ D$T \$H' ݄$\$pD$T:@q t$8t$T0.t&.&.&.&18tt$8|$8D$HD$TD$0߃E<b$D$h|$`GD$pߍO͹)ٻ\$8D$@D$8D$<?ܬ$ݜ$@D$|؈$\$8؉ȃD$xtD$xj݄$D$|'tru|$T݄$L$PtT$0D$4)‹D$|(Ћ|$dt $\$pDŽ$5DŽ$DŽ$DŽ$D$X$t$D$PD$$D$ $D$$D$$$\$|b:ƃD$d|$h8݄$\$pD$XkDŽ$DŽ$YT$8T$8 DŽ$DŽ$\$ ݄$\$P$$$\$|L$8܄$T$@ݜ$D$D|D$ ؋D$=u D$jDŽ$DŽ$$RD$D$5$<$\$|G$$Kt$ $D$|$$$\$|݄$\$p4ټ$$ f$D$@٬$|$ ٬$T$ D$$l$ T$ z1L$X9uT$@D$Dl$@\$ D$ T$$D$8T$D$pc؋D$|ـx\$8ـ$RD$xAD$xD$HJ$%{=D$8D$@#$$T$x܄$ݜ$yD$01ҋD$|(S1|$XD$\𿃼$uk$u]|$xt%=D$D$`$\$|LD$`U|$p|$$LM1t$XD$\࿋\$x $$\$|2L$X܄$ݜ$$D$\$|'D$4$-$ $$$݄$\$p $2$ %=D$`xu xD$D$`$\$|JD$`Z|$p|$$2L$%|$x==p$$\$|CD$h$xCD$p$lCD$H$`CD$`$TC$y|$8$T$x6ܬ$ݔ$ݜ$V1D$8D$H1!$1D$XD$\?$%=|$\)‰T$\K)!؉$UD$8Jf%|$`GD$H$WӉ1|$p|$xq- $DŽ$$|$xt%=w k)9t-D$8ut$@ D$@#$r%$1$c|$8L$0D$0L$H$D$`PӉ1t$pt$xD$@D$@ݜ$zgT$TaU\EQ.U E]XUMU E]Fffff̀ffff̀rS[? [̀rS[? [̀rS[ô? [̀rS[Ô? [UWVSvu Et"4$dsEExu4EE[^_]ËED$t$<$ottGt8Eu׍GEE[^_]ffffUWVSu} 4$juT<$]uq9r9r tt1[^_]ø[^_]ËFW9r9[^_]Í+D$ x(D$D$e+$|+D$ x(D$D$f+$|UWVS2u} 4$E<$9E4$q<$aGE9FuK12\9\u0\9\u&T9Tu9M9tƸ[^_]Í ,D$ (D$D$C+${@,D$ (D$D$D+$~{d,D$ (D$D$E+$T{1sUSE ,T$ D$PT$$P=[]USÜE$uE []1[]UWVS$v[EpEEEEEE1ҹEEuxw88 w38'E u9u҃}u }$[^_]ÃEƃދMt};xsϋHME롃E둃Hut9MsEMluEY}l}b1`US1EU} ~\wEBu - t wJt Bx1[]ùr u-JuB-bP UU1Ʉtt'4$mD9t t u 9u[^]UE]UE%]UEt ;E ]ø]UE%t 9E ]ø]USUt/9E t*ڞD$ (D$D$p,$$wE []USãM E%t.9t*ڞD$ (D$D$p,$v[]UEtt]1} ]ËE ]US!E ~>uTEtKڞD$ (D$D$p,$ v~Ewǀ[]ËEǀ[]US}EU tt 1[]|UWVSW<$ 7Etc@@{D$D$4${u E[^_]~{84$?o{81EUWVSëuthF~O9tHNM 1[^_]ÉU{ED$|$E$LUzu=FUF맍D$ (D$D$Z,$>ui|UWVS }t;t-M tWt1$>;wr$><$>[^_]UWVS謿Ñ}tJWt7E1U9}t#E4E D$4$`ku߉[^_]1[^_]ÍD$ (D$D$,$BtUWVSE@EEE19ut|Ee[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(2D$D$0T$4D$T$ $D$D$ T$t$8L$$}t$80 1fkPLUWVS 3fD$|D$@J.<$EtE D$ED$<$D$$  [^_]UWVS蝬Âu D$4$=FFy ;F|/} t)P}D$4$=[^_]Ét$E$UVS% utDD$4$b=D$D$4$Hff D$4$^=[^]ÍY1D$ ()D$D$6l-$`US蜫ÁED$ E D$D$E$$>[]ffffffffffffffffUWSB'Džt)tYBfBfB B [_]ÉUP7D$ )D$D$M-$_UuU7D$ )D$D$N-$_UrUWVS薪{lj։MEu` uZGG _ tC‰t")ʿ)ϋM)9|[^_]ÍD$ )D$D$`-$^UD$ )D$D$a-$^E+D$ )D$D$b-$^UWVS\a>ÉEEE 9E1fjDž9E]qA D$.$U'zR.8tGt3\_u<.uuy.u}fD$:$&tOfu:t .uـx.}G~GUFw Uz@9t$D$$]/@0@Ɖ $P@)9x‰ ȉ@ M`/1U+\[^_]À:>E4$OL$D$t$LD$D$ D$LD$$蕏A,Dž9E_ D$ )D$D$B-$>ZD$ D$D$$TIf ugx.fcD$:$5#?fnbUWVSl!Z‹BcB $(>DžmDžDž D$$mDžtUpЉD$D$$<+Gt< tu򋽜$H@)49O)9y )ЉA V1ҍ;tftH<@ lj)9t?9rr ΃rj놉D004$K@9U$n @ \Džl[^_]à f.&< t< t򉍼8D$4$* P8 t$$L19<)׃ D$$#T848#Iu‹tft‰)‰DžNtftR :)9&44$TI@9‹f&B0tP< t[< tW< <9s>z2D$4$ tpu׋)ʉ׃ (D$ $ 8f cFt$$J'9Dž1Ct$$Iz90CD$ \)D$D$^-$RwP$3f0x0k$Gtxf\>0N7L1UWVS` E‰Eu9E1FE@ D$ .u‰t$L$E$')}5EE4$EML$ML$D$ t$ED$@ $q‹Et]$GE@ U+`[^_]ÉM@ $躀M<ʍ(E`MUƋE$u눍D$ h)D$D$-$OUWVS(覚ËuE>FE苳@ }tgUE<$ODML$ML$D$ |$UT$4$9‹Et)$E@ ([^_]Í뗋MUƋE$t([^_]Í@ $_t:@ ED$ L)D$D$ -$NqUWVShw\։} }}U9E1} om>$(p 1qfQffQ 9fED$|$ T$D$ $P@ u+<$Ѕ[D 9EMHHPPDžPf}Ɖ9DžDž )D$t$ D$D$$uODž@ u4$Ѕ8D8 9<$oRf$[RfG$IRЋщ9ft9|dRE};d 1DžЍ 81&9l!9hufyuh }9Z 9tcP fz )u fzfBfzG9u拕@ m‰))9^W׋$#<))9yrtft1'$1U+ h[^_]?z 7t$$,*D$t$ D$D$$BK@ 9N04$<=3׉T9E>f t$$#9P }u,04$;tp9J90Љtftפ9P'$1;NjE$$;$[<|$t$D$ D$'D$$%6<$:=9D$ )D$D$-$iE. D$ )D$D$-$1ED$D$ D$D$$&Hg@ 399x04$]9=1Ɖ$=9P)9| At$ D$ *D$$%r<$8p)9L$L$<$X8f&($ЅwDž$ H1Ht$ D$D$ D$D$$EDž8@ ?9$Q7x9D$D$4$W>9fw99 E Ƌȉ2f.&.&.&.&.&.&H0f9~fpfJ2r 9uً9n.@  G,)σ (D$ $Ulj$ FfDž 1DžD$D$4$T0։9^f 19s<04$CJ=)σ (D$ $ljUWVS$Éèu}6EGBEB $E+lDDžD$ED$ED$ D$ED$<$…F D$FD$FD$ D$|$E$MElEE$<$,DEt $[^_]ËF t:$[^_]øEE$u<$C$[^_]ÍD$ )D$D$-$f=E$&F 뮸xUWVS@Mu9‹E1kFB FBPƋ]}ۉ\$D$ D$)D$<$~HNj9s4$u@ D$ x)D$D$-$a9`4$$w?@ -$J?@ t҃$?2fJz 轰UWVSd{>ƋEtvF u>ED$ ED$ED$E $Elj4$w>[^_]ËED$ ED$ED$E $EDžt뼍 D$ )D$D$-$7[E1UWVS諂Lj=t@ËED$ ED$ED$E$ًU EƉ$=[^_]ËE1[^_]UWVS0/E}u  t</10[^_]Ã} uyMMUUUUu|$M L$D$LD$mD$ D$ D$E$skuE0[^_]Ã} t;a8t{bPWPtD@ 7 E #T$ )T$D$-$5Ex{UWVSX跀Ü}E EЋEEEE9E‹E1$(1 E؍EEȉMԉ}܉<$2D$D$ D$D$E܉$qDž E؉D$<$ƅtEȉD$|$$MЋIt9pMЋI t9^}UEċMԃ< t< tM܋E؉D$4$MPE tN<  < E}9yE؉D$$:Pu}ЋEĉG UW}lUWU؋EU)щM9GU؉W)ȋ}92t1ɉE؋} E9rE؋}ЋO U)ljEA4$j(@9‹}؃tftUЋu؉2ƉuԋU)‰ŰEEE6tftuЋV}ȋMԉ :M)ẼEE؋u9AE؍4uȋU܋4u4$'@9Er7‹}ԃrsSt}MԉM܋E$iE܉$^8E1uU+X[^_]ÃỦϋU)׃E (D$$t 8E܋UEȉD$|$$7P@ EĉỦ $8ŰEMEЋPEEE$tE܉$iEaf{E̋EM8Mԉ $EEu6ufiK1E܉EШUS{yS7D$D$@, D$, D$ ED$E D$E$[]US>{#6D$D$ @, D$, D$E${[]UWVSzم65tDÉt$ D$@, D$, $ًU EDƉ$5[^_]1[^_]UVSyz^ tpǃ, ǃ0 ǃ4 ǃ8 ǃ< 5D$D$ @, D$, D$ $?Ɖ[^]Í $裢 t5ΐUWVS0yæƅAqR.8DG]]ԉ]]]܉U؀0|\G1t&.&.&0 w 4H\Gu./E]9tEprBDGu10[^_]Nȃ+Mt2UW0/u܋U+H[^_]Ë}܋E+ʉH[^_]E9L1뽉|$<* $M\tM:fM؀9t‹}ȍGU9rUffMEE1W~:uFE؃:MЍP7ẺD$ |*D$ED$I-$U"*MЅɋU؋EM؋ẺD$ d*D$D$$)M&tHd*M؋EЉD$ |$D$$)MEąE؉EEȉEmMԍP7D$ d*|$D$$U])U؋M댋}ȍEEfuM.]EȍxEE9IMԋUȉ1M*1ffffffffffffUWVS8sæ~։9M1ɅUHL$HL$HL$D$ {D$D$M $MU9ЋMs%T$L$4$/=U+8[^_]-1މU؉E܍7L$ *L$D$i- $(U؋EEU؉E܍P7L$ *L$D$h- $'U؋EϟUWVSrs}Eu} tM|]x9EËE1t;l],/1}U+Đ[^_]ËE*-]7ED$ |$D$I$U&UutE*ED$ t$D$$]&U1 Dr틽tE.&ك Tu111M<<t9t0u}t E9|uӃ}E:Eþ}} ]9p}9P}9:EmE׉]U)MD$ ED$T$U<$]]U97}Mfx]9o:뗋]E+mx|tĐ[^_]]P7D$ E*|$D$H-$U$|ҋUbtED$ ]*D$D$$G$,t;E@ fu+-dtr ufF E$gED$ E UD$T$E@$t!Ѓ6E@0tM@9t$E@0E@}Gfg D$<$?1İ[^_]Q}Wf9xD$$‹E@ UdUuVLfF E E UdhE@ f` EPPHTE@X\+X\lpuN09FFUWVSYcu} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍D$ +D$D$eh.$ y;D$ +D$D$dh.$b FUWVS8Xcu} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍ D$ +D$D$h.$ y;D$ +D$D$h.$ FUWVS\WAbu} tXt't;uDEFUT$4$P[^_]ËFUT$4$tEf[^_]1΍D$ +D$D$h.$ y;D$ +D$D$h.$ FUWVSVea}u t/tYEED$<$Ot E[^_]Í;D$ +D$D$h.$. uD$ +D$D$h.$ xUWVSUû`}u t/tYEED$<$t E[^_]Í;D$ +D$D$h.$ uD$ +D$D$h.$V xUWVS,U`u} tdt-tGuP1EFUT$4$P[^_]ËFUT$4$t1U[^_]1ȍD$ +D$D$h.$ m;D$ +D$D$h.$n :UWVSDT)_u} tVt&t9uBEFUT$4$P[^_]ËFUT$4$tE[^_]1ύD$ x+D$D$ h.${;D$ x+D$D$h.$HUWVSjSO^uE }t )щʋUt7uzN|$D$4$Q tuUtQFU4,U u@ 1N|$D$4$QUt?tFUD U u@[^_][^_]1[^_]1[^_]ÉE;T$ l+T$D$*h.${E ET$ l+T$D$0h.$FEUWVSR\u}U >E E|$4$tQ9UrRtqtMu:1T$ED$4$6>u"uvuE$yE 1[^_]ÃuEt$RE ԅtEuT$U$EM U_%D$ `+D$D$`h.$ ;D$ `+D$D$^h.$U D$ `+D$D$_h.$`+D$s$$UWVSbPG[}u t'tQD$ t$t$<$ [^_]Í;D$ T+D$D$h.$uD$ T+D$D$h.$UWVSOèZ}U EEuEEEt[T$U<$(t>UFu).&Ft9uMM }[^_]Eu1[^_]ÉU썃MD$ H+D$D$h.$UpU썃3D$ H+D$D$h.$UE1U썃AD$ H+D$D$h.$UU썃;D$ H+D$D$h.$sUUWVSFN+YuEE E 8tutlED$4$tOU9UrGtstVu7ET$|$4$Y>uu}u<$E 1[^_]Åt<$E냉<$uE ωЃttkE녍D$ <+D$D$h.$S;D$ <+D$D$h.$$UD$$NjE 8Ut Eo<+D$s$ UWVSLÕWu} t tJD$(#|$4$4[^_]Í;D$ ,+D$D$?h.$muD$ ,+D$D$@h.$?UWVSLVu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]Í^D$ +D$D$Xh.$ZB;D$ +D$D$Wh.$+ UWVSKUu} tJtvt 1[^_]ËWUEFUT$4$Pt׋FUT$4$P[^_]ËFUT$4$tFUT$4$tEMG[^_]Í]D$ +D$D$|h.$CB;D$ +D$D${h.$ UWVSITu} tt@} u[^_];D$ +D$D$h.$u^D$ +D$D$h.$UWVS\IATu} tt@} u[^_]';D$ *D$D$h.$#u]D$ *D$D$h.$UWVSHóSu} tt@} u[^_];D$ *D$D$h.$u^D$ *D$D$h.$gUWVS@H%Su} tt@} u[^_] ;D$ *D$D$h.$u]D$ *D$D$h.$ffffffffUVSGÇRuED$t$ ED$E D$E$E~>.t[^][^]USOG4RED$ED$ ED$E D$E$[]UWVSGQ}E D$E$St u)x[^_]9u􍃜.D$ 8,D$D$.$E)[^_]USEP@.tsˉ؉Ã߃Av 0 B.t@.tuKȃ߃Av`01 []Éȃ߃Av0 w`Bt2J.u˃߃AwˉB.uW[]ÍYЃ v-uBg1UE8*u P.tt E]]ÃE]USUtA1.tF1Ƀ\BÅtX߃]w"t1ɃBÅu[]û[]1ۉ[]ÉU[]tUU'.t&.&.&.&!]wBu]1]USDêOE D$E$[]USDÀOE D$E$[]USpDUOE$r[]USMD2OE$@[]-DO%9UDNE M7]UEf]UE]UEfU f]UEȋU ]UWVS$CNEE EEE0PE }썿l-}Uuu9E }9sux.tb@tx U9sS@}AnVUBc} 980]n($[^_]uuG뒍V>[U|$M $*U:M)ȍ<FtOD$ $t?M)ȍDOt M}:S}9uɋM܋Uʋ}\]iM Z)ȅC9u?1;Au#@t6Hȋ]؋]9\]( [^_]ø!!"UWVS(9CEEEE܋E9ErME 9EsEEH0}}]EEƒ@dt(].(EE([^_];M sۋ}?[ E +E9~]E}9~K3uEUt +E}Ey+EEy9Mu]sD$ T,D$D$.$EKuV]ڋ]9 }9;] }|>}uE~΃s/uuUED$D$<$tE+uЁ$[^_]ú]UWVS$~0S;E MU9E1D$ D$|$E$t-T$L$ ED$D$<$VU+u $[^_]É]US]E M9r 9s9su[][]UWVS/w:EU} E9sKUP0ك@tHt-t]([^_]Í29rUUX9r͉1[^_]9sAu@u!E!뾋E뷃E막ӋUUWVS.ǭ9uE t*X?w#9r6 )ЍXt9Aхu)[^_]É[^_]É()[^_]UWVSH.19EEUu Ɖu]Ӊ]8]}Y ?w` 0}9sq }9sg9u>zPt$|$$U]uU270:ۅt9u1[^_]Ë]3[^_]Ë](1[^_]UWVS a-F8u}E9E |2&6D$D$$umtF;Gt1 [^_]ø [^_]UWVS,7U2E uuX1[^_]É?w[9rCZML$ ML$)D$D2$t(9E~9}ljr[^_]É(?UWVSO,,7EU t_Z1?w%9r8D)ӍV[t9хuލF[^_]É[^_]Éz(F[^_]øUS+ê6E D$E$( []UVS+6uD$D$$NtD$T$ tV[^]øffffUVSuU ]tE>t&8ut&.&.&9t Ju[^]fUWVS(*5}EU܉΅lt F"}uFEUT$$]uMËu-+31UEE1709}It$EUZ9t)ˋUOA< vA<@W9|E܅ttGEE܋}8؃([^_]ÉЃEt j1UE}S}0UWVS!Ç,}D$<$|$ ED$E D$E$ND$<$ݲ[^_]USD!),D$d $*[]UVS!+7uT [^]ÍD$L$d $訋ƅu$BƅtD$d $\FFF US y ^+U T$UT$$ []UWVSB '+bD$|D$@J.<$DE t8ED$E D$<$?|$ D$D$*$裟E$ D$xD$$ތ[^_]ffffUSx*E D$E$h~[]USeJ*E D$E$:~[]UWVS5*E։ϋUt%T$ML$$w[^_]ÉD$4$膚ƅtU1UWVSî)u} GD$F$uD$$}[^_]UWVS~c) l$^xD$4$-EE9l p ELh$_D$4$蝋 (9d Džt`t\Os1Wp΋ t $胜pP9uዽp$eGt$Ptt ; r`t4$&ǃ ǃ | t\1tt:$Ft)NtF D$F$ыF9pt$'; rtt$蚛ǃ ǃ| Id$苤 uAEUl p h$*l$LĤ[^_]ËWT$ D$ D$ $袒UWVS,&9U1DžDžDžDžDž$It3D$D$ D$D$<$较=~h$ | | |T$ D$ T$$觑1U+;,[^_]D$<$IzT$$2T$T$$Љt6t,$DL$ D$T$$;pt$Dž$Dž$t5tD$$ҋ;pt$6GUWVS(ê$u} tmNV$VFE|D$D$  D$| D$E$?z1ti([^_]ÍʠD$ -D$D$~L/$5iP7D$ -D$D$L/$:델UWVS í#}SG<mL$ D$D$֠$GEE썃hE荃kE+E$ԁEE;GE4G0D$E$襁GD0t‹E$苁GD0tQt$nGD0x $QGD0c$4P$!GD0$ - [^_]ÍpʠD$ -D$D$L/$Q~UWVS' "U1 u; v <D$E$uu΋Ot5GEt1 t $蘕O9uu $腕GD$ ED$<$n1[^_]$ Et7 ύʠD$ -D$D$L/$< UWVSl  U EIEj7EVt Pt LE$sEEčD$D$ D$ D$Eĉ$Yv"HM@EE|EDEEU<ЋM E u D$<$suNVZED$L$E$ҋUBuM}#TuEMU9sE$l~E t ul[^_] E(4$_|x U .9PuMEAx x E4$|a}ED$D$  D$| D$E$ttMPtFMMЋMMԋUT$D$ P T$@D$EЉ$ttH P1EUM9EFD$TT$Xt$\L7k9)B)Ӊ))ʉ)щL$T\$Xȉ"D$TT$XL$\_u)Љ))щL$LD$H/D$ i)\i(\ËD$T)\QD$dFE)ED$ ED$ED$<$yƅ@M܋];O_+EUĉәE܉]}1lj}1 ыE‰F1Xe]؉E܋؉ }<$}؍4 1ƅ F(EUjUWVSÁ\$pƉ׉L$x<fPHЅu1e[^_].&t>u)Ӄst$tց|$twō$2D$ltCD$hL$xA!TT$dDD$`L$xdP1҉\$\t$Xpt$x RpdPhPt$xlP 9ɋ\$\t$XDI`PHL$X@D$TfGD$l<IPHЅu.&>u)щL$\T$l6u*t -~0 w)KL$tD$dD$`GG$؉dFLJhFLJlFLJpFD$hG dNډD$xat |$xf|$xt|$xD$XD$TD$dD$`D$XD$TD$l*t -~0 wT$l)щL$\L$\L$0Z$-$D$p$L$(d8, $L$>8G$D$؉dFLJhF$D$؉lFCpFƇqFfLJrFD$xD$|D$p/\$PӃ؃D$HukQ9(D$xT$|{D$@T$DT$@D$D9T$dT$`[T$@T$xD$|؃D$HtD$xT$|D$HT$LT$HD$L9T$dT$`T$HT$xD$|4*D$x|$x|$xx,t@;t;$`,;C.t&$$i)\= ף)D$HD$xT$|D$@T$DT$@D$D9T$dT$`\$\$PL$@L$xD$|1҉T$HD$p/D$PL$\$8t$4|$,ri)\P(\wf= ףt$P)D$xT$|p:σ|$@p/|$d9֋|$`}D$x\$|L$@t3빉L$\$8t$4|$,`D$,L$,9L$hD$D$PL$p/L$\$4$Ɖ|$pi)\P(\= ף\$)D$4\$@9)؋L$49ȉ؋\$PT$HЙD$xT$|D$8T$<D$ T$8T$ T$CD$PD$HșD$xT$|D$ D$8T$CD$Pș\$X9ىЋ\$T}D$,D$H\$4ؙD$xT$|D$xT$|D$HD$,9L$T$( D$@L$T$D$43IL$@dD$41H|$xf|$xdNeN|$xT$t\$4$|$pD$PGlFpFdFhFGD$\L$hDG dN\$xƒs`D$xtfD$xtפ T\$\؉׋t$lstftD$\uluSҨu|udL$x눋\$4$|$pD$PGȋL$)=AfG6fAyD$0f l$xdNeN|$t|$xe\$\$PL$HL$xD$|D$H.\$\$PD$H\$\$P \$\$PL$@L$xD$|\$\$PD$H{D$,D$,L1G-UWVSǧ|$8ljD$T$\L$XE \$\$pt$t)i)\i(\Ƹ)\yÉL$p\$tΉ)׉t$H|$Li)\i(\Ƹ)\Q֣p=9Ƹ ף@L$`\$hT$hT$Pt$H|$L tD09}7)à u\$hT$P׋T$h)à 9L$`\$4L$p\$tƉșL$pT$t|$p1ωT$t1 L$@\$<;ؙ\$T$EŃD$T$D$<;D$pD$t1$D$PD$xD$Ht$x|$|D$PD$ ED$D$HD$D$X$D$\Љ$9T$@D$xT$|D$hT$lɍL D$h1ÉT$l1 D$p\$h1؋\$tT$l1 2D$pT$t9D$xT$|D$hT$lD$hT$lD$pT$t1ӋD$pT$t1D$pT$t9D$pT$t9ȉL$x\$|\$h|$PD$pT$tD$`PD$D$e|Xu$hF1dN-00tDXFt>8t$|$lG$D$\t$lD$dk XPD$T1$D$H\$hD$X$(D$TT$dT$t ;H Pl$ty1pYD$tT$pFP~L\$t9\\$p}3=H\$t\\$p\\$H ;N>VD$\9W\$hD$lP~7|$ldF$ Ttft|$lGD$l@C1T|$49|$Ht*|$,9|$Ht|$lw|$Hx|$0x >|$p|$X40>D$@D$h$t$|$tȃ|$d)w|$Tf.&.&.&%1 ڃ9t$tuމ|$Ty\$pC\$hsK\$l\\$T\$l\\$D9D$Tt$hL$h\$lDT\$d߃D$pD$p\$t9D$@&t$D$l>71t$t":t|$lt$t7>~|$t9tpyt$H9|1D$hu ؃ux\$T9؉ӋL$DG\$p*t$t|$lw|$ldFT$|$HT$tt|$@9~{9#|$D_GD$tt$t |$D|$l;7D$@L$h\$Tt$pȃ ؃uytT$@9t\$`D$4$BcD$,0D$4$`bu!~N//\$`r3/Rd$dD$|D$#D$$D$(|$pD$lt$t0Pft$4D$(t$lƄjF9ut$lkFkF\$,u59uv.&.&9vit$H$L$(t$ljF9G<v|$h׉É|$t΃sstft|$tt$HD$x D$p‹|$d9\$0t$D$t\$`dN$u0uqT$3f X1D$t*T$tRlP u6u\$hD$l@Rf$ $ 11҉T$pfE|$ldNeND$0UWVS,]ƉMӀ:M‰9Džt;:tgEua1ɉ2tRN 1MU |9}D$>dN$]I=uҿT[^_]@@@ f@ǀdFǀhFǀdNUTC1[^_]M1eDžuAM荆dNdNt_9t:*~+uـZ @ҍt&Ƀav뿅f1uUVS謲Ñ4 D0u[^]1ɉ򍃘[^]kT7USP57t̿$[]øUS}u[]Í̿$[]UWVS߱ȼEuM V~FhFhF1.&.&P9u dN9ut [^_]Ë]l1[^_]UWVSkHUM Z~>dFdF&.&P9u09ut[^_]Ék[^_]UVSѻ}u 1[^]Í̿4$4$[^]UWVS(謰ÑEEM E3 mEE1u,H0ǃ 1}tME"}tL0ǃ Gp7>Cu U1)Љ3 ([^_]ÍE؍3 E܉΋E؉$NjE#D$<$ EE3 ~|$E܉$[tm}tM썳̿4$4$MN([^_]ËWrHy}D$,0D$<$HOGD$ P0D$D$Ap/$WUNUS/t u#$p tЋE$>YUWVSͪe=t:F$V FtD$$]4$uƃ[^_]UWVS聟f}ƃt $tCƉxtD$<$\E FEF e1[^_]ÃUWVS uE} t\Et1UӋ} ׉|$E$Ut!~}} u1ۉ؃[^_]É뻉؃[^_]ÅMuՍD$ \0D$D$H/$rS멍D$ \0D$D$F/$FS3D$ \0D$D$H/$SD$ \0L$MD$G/$ERUҋEMT$ L$D$H$RffffUWVS聝fƉUM <$WEtC$pupMH  <$1[^_]Í̇ 1#.&.&#txu8u돍šD$ d0D$D$/$Q7<$uUVS胜hEU Mt [^]MUEҡt$ |0t$D$/4$IQMUE[^]UWVS  E$  1̇ E0E}M D { uZMUCЋMU 9u` tgߋt}Ct9K ttFߋteC9K ut2 MUCS$ЋUM 9tV uE9rRE9sKu}샮 E$ ut?$u[^_]ËE]1 tߋtCU11ҋE]ffffffUWVSnSUE0}E,9E1M zhEED$E$D$h8$hǀPǀTǀX71DžD8H@L,D$ |$0D$8$"8U+d[^_]ÅE ((hEED$E$D$h8$hǀPǀTǀXE (ҐD$ 0D$D$Q/$MW(ޡD$ 0D$D$P/$nM((ҐD$ 0D$D$Q/$3M(RT'UѢUT$UT$ Q.D$E D$E$>]U誗UT$UT$ Q.D$E D$E$]UED$ED$ ED$E D$E$]UWVS<!D$@J.FX$w(F`F`y ;Fp|4} t.FXPVX}D$FX$f([^_]ÍFXD$E$HUS跖ÜE@J.Q`Q`y ;Qp|< tQXZYX[]ÍQXT$$[]US _DE D$ED$@J.X${ []US( ED$ E D$ED$@J.X${[]UWVS͠M} }E EEEeD$E$&E@ E@U~5M19E}EtfEtME)‰UE$UE@몋U tE eMOTEfH @1[^_]ËUulj7wWU<$\UG)uًECMAAAD$ $&E[^_]ÉЋ}tftE@9)ЋMAD$ $%E[^_]ÍlD$ 0D$D$Q0$(IlY1D$ 0D$D$=0$HE)1u E MOuo U80D$ 0D$D$0$pHE@UUD$E$$EU)1u .fBefm7MyHMUS ŒêED$E D$E$w []US蔒yED$ ED$E D$E$x[]UWVSZ?EED$E $ƅxDžt}D$ED$E$yxY=?fGfw  G$ G,r G(Y G Eu/[^_]É$CLfG 1[^_]D$ D$D$<$)[^_]ÍD$ 0D$D$>X0$\FUWVS2}t6D$<$o"G ƃD$<$|"[^_]ÍY1D$ 0D$D$;x0$EUS 跐ÜE9ErD$E D$E$ []蠽ffffUWVSqVu F0u ǀFFF tLNtE})xX9VnHM9VF t t[^_]É4$N})y9u0D$ 0D$D$W0$D+V9Vs4$u^4$qgY1D$ 0D$D$<0$ODI fffffffffffUWVSӋ} UU u=މ&.&.& u[^_]Ívރƒ0uEt0tC0[^_]Éމ[^_]Í{} 1ugfff)ygfff)҉)Ѓ0CUtE9ut 4{ECExtEgfff)s҉)Ѓ0GE9E땸)0KыEÿE0C[^_]UWVS G,UM9 ?p9s΃ttUUGED$t$E$ޗMGU)UD$D$$E}E01 [^_]ÉUE5GED$t$E$fMGuUEU JHJHJ H JHJHJHRPVUF0U$ F0`UWVSL ljT$ L$L$,11D rL$$D$(D$D$L$uEt@GЃ%uD$t$ wPZw 0t$ uL$t$$T$9T$ |$<D$D$F|$| t$|$L$80821ҍTPЃFHЃ v$WT$ Ft$ D$UUU;t$( 9t$st$D$$D$t$ D$UUU;t$(9t$st$D$$D$t$ L$뭍~*D PЉ FPЃ vsD$@M࿀ D$Pt$ D$u>UUU;t$(; 9t$st$D$$D$t$ UUU.;t$(9t$D$$D$t$ UUU ;t$(9t$D$$D$dt$ D$D$eUUU;t$(rL$(T$$9t$st$D$$ D$D$ D$L$HЃ  1t$v.&.&.&|PЃpЃ vt$L$<$|$ UUU9D$ ;D$(rL$(T$$D$ D$ 9D$sD$D$$L$ D$AD$ :t$ L$D$ UUU ;t$(O9t$D$$D$t$ L$D$UUU ;t$(L$(T$$L$L$L$st$ D$u>UUU ;t$(9t$st$D$$D$t$ UUU4 ;t$(9t$D$$D$L$ L$1L$ 9<qt$  t$94t$L$9t4$1e[^_]ËL$1L$ 9<IL$ 븋L$1L$ 9<y|$ 렋|$7L$ 9<L$ 눋t$6L$ t$6L$ eL$ )|$7< L$ Jt$|$ 74|L$ L$ $L$ t$ ~64|L$ y|$ L$ |$ 74|t$ NL$ L$ t$ ~64||$ wt$ L$D$D@$L$L$i D$D$UUU ;t$(L$(T$$Du}cD$UUU ;t$(9t$st$D$$ D$D$D$4UUU ;t$(9t$st$D$$ D$L$D$$9.$9!L$D$$9$L$D$$9$L$D$$9$L$D$$9$UUUw@;t$(rL$(T$$g9t$st$D$$D$L$D$$9U$`HL$D$$98$C+L$D$$9$&L$D$$9$ L$D$$9$L$D$$9$L$D$$9$UWVSHv$M$} |$8}|$<]\$@9D$,Ƌ$D1\,\$<,$@0u ǀƄ$D$8$$dD$($G Wf DŽ$D$@D$ $$$DŽ$DŽ$L$<$D$dD$l$D$4D$$D$hDŽ$$D$0$D$T$8$%t >u$)؅D$&,$$ C$$$$ $$R~Ƅ$Ƅ$FDŽ$D$tDŽ$FZ$2⋼$<$$ "SG f A$fx/D$<M$$DŽ$DŽ$D$$$$D$$8$_$ǁPǁTǁXy 1LLtft$C f$f$Cf$C$C,$CD$$D$$DŽ$DŽ$DŽ$D$@D$ D$$F$e$$$D$ 4 󥋔$\$l{$ [L$8L$ D$T$$4$$dFD$p$y DŽ$|$lƄ$1$D$`D$\D$DD$HD$[$$Ƅ$ $t$84$$`@$4$K$RT$h:$IЃ01 =v.& 4Jу0 vꋔ$$5t$lN9vT$tL$lL$tىL$t$Ƅ$+ލW7*\EFЉ1҃ -=f.&PwFЃ v뉔$n$U$$t$lV$ O!, v$0pT$l9$D$lD$x$ R$$D$xD$`$N,D$l@TƄ$$$1$ 3$8$$D$[$%D$pD$xD$lDŽ$11ɾD$\$HT$hT$T$[T$ |$p|$L$L$\ $Q$)Ɖt$pD$p*t$pdM$$$9}$$\$`D$\D$DD$HD$[5$T$lBD$x$$)R$$u$1$$|$D$$4$$H2)$9~$Ƅ$D$xD$l$D$p1$$T$lrt$`2R1Ƅ$xƄ$$ !$ω$ 5$+$$D$lD$x$ $$D$xD$`$b(D$l@T $ $$$D$lD$xD$dt$$$$D$l@$3$"$T$p$$$ÉD$d4T$p$$D 4 t$8t$$DD$ $D$$D$$N<t$d$$h$$$ $$$4$\$l{|$`$ $ $8#$c<T$lR D$$Ƅ$$71$$4/Ƅ$D$hFtO$$$F$$$$tMƄ$0$$A$$$ $|$Pt$t$)ƅ$6$$&.&T$xƒG$B$vƅtM$$D$$$$DŽ$DŽ$$D$x11ۋ$n$ϋL$x$8p$$$t$`D$p)ƅ$<-$$8.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$G $$|$[$PD$dt$4D$xƋ$)ƋD$H9~ƅ~@$$r$$$$y1t$H)ƅT$H$$D$h{ $ $ D$($$$1A$$$s,$t$x$)Ƌ$9~ƅ~@$$r$$$$y1$)ƅ?$6$$).&$ƒG$B$vÅtM$$D$$$$DŽ$DŽ$$DŽ$11ۋ$f$D$$$$DŽ$DŽ$S$ϋ$$8p$$DŽ$$,$$$$y$$$V$$t$($$$2BS$$$V|$4WV T$$t?$D$$$$NDŽ$DŽ$%DŽ$11ҋ$$\$4)ޅ$L$$H$$$v$N$+$ $5v.&.&.&T$xƒG$B$vƅtJ$D$TD$$$$DŽ$DŽ$$D$x11ۋ$q$ϋL$x$8p$$$$$aDŽ$$$$$$ϋ$$8p$$yD$L$$*$ $4&.&.&$ƒWG$B$vÅtM$$D$$$$WDŽ$DŽ$$'DŽ$11ۋ$fDŽ$$$t?$D$$$$DŽ$DŽ$$$D$4P$$y$Z$D$$$$SDŽ$DŽ$%$!$$2BS$$ q$$$9A$$$ $$ $tB$D$(A$$$$$=#$D$dL$4ȉD$xI|$lݔ$|$[$D$$D$$D$$D$ T$$$@ǁ$'DŽ$t$Hu$9t$psD$4L$H)ȉ$n$D$l$DŽ$eDŽ$1ۋ$$.DŽ$$9$$DŽ$DŽ$$$E$D$$$$xDŽ$DŽ$O$1ۋ$$$D$$$$DŽ$DŽ$1ۋ$$D$d8N$`$:y$$$|$lDŽ$D$pD$`D$\D$DD$H<$+$$$L/&.&.&.&.&.&$ك8@$Y$uÅt?$D$$$$DŽ$DŽ$uDŽ$11ҋ$y8p$$$$"$ae|$l<p3$$Ƅ$$11ҁ$$&- $ D$`D$l$DŽ$$H$$y DŽ$$T$`$D$pD$\D$DD$HD$[$t$D|$\l$\|$08@$$N$|$h|$x)9~υ~2x$$$L$h y1)@ʋt$DVL$\V$$D$x9$$I!$$"&$у8@$Q$vÅtDŽ$1ۋ$$L$H\$ht$D|$\>T$pT$p$T$d$D$`D$[$$ %D$`D$l$$4DŽ$$$D$$$$DŽ$DŽ$1ۋ$t$h$[ DŽ$1ۋ$$\$Ƅ$0$$DŽ$DŽ$$$$$N$D$$$$DŽ$DŽ$|$[\$4$L$hDŽ$f$t$l$D$p"|$[|$4D$HD$pt$4F$|$l$$DŽ$$$S$D$ 4 1$T$p$9$rC$ƍC$D$8D$ |$D$$$$莿PvT$p$W$D$$$$wDŽ$DŽ$HI$$$ RD$l@1Ҿ 3$D$$$$DŽ$DŽ$|$@OL$@ML$lIƉT$lR$Hى$t&.&.&.&σÃ0 u䋜$D$\ub)ȉD$p$?$D$H=J$$D$lD$[$+L$HG$A0)Ɖt$p$1ɾ Ƅ$-$$xΉƒ$$$1ɾ ZD$[t$@T$xT$l־DŽ$$$$L$@1ҍy|$@D$@8D$@D$xD$l|$@1ҍOL$@ D$@8D$@D$xD$l ؼT$@B:D$@Yf% $ҐD$ 4D$D$0$sBL$HD$[$$D$l+$D$l$DŽ$D$HD$pL$HD$[$$D$lD$4$+H$]_L$l I$8T$lG$\$[$\$p7 D$xD$lD$`$H$$ $$T$ D$<$9D$@8|$tD$@-$H$D$lJ$J$$D$$$$KDŽ$DŽ$"$1ۋ$$t$@~|$@D$@83L$@Ǎqt$@T$xT$l頻$$D$d$$$$$D$@x|$@D$@8\$@Ɖ׍KL$@ƶT$@:rt$@T$xT$lL$@1yL$@鐶\$@KL$@.D$$L$`L$l$$!D$@pPƄ$$O$$$$$ۉt$@D$xD$l17L$@Y\$@ mT$@B:D$@5D$@8L$`L$l$$ GD$@pPƄ$$$$g$$$҉t$@D$xD$l$$;$$$1ɾ 2D$@8$|$l$D$pD$xD$`$$$@\$l [$f8T$lګ$fH @Ȱ$ DŽ$֋$mB\$l\D$\D$DOȃ0 1ƍuD>[^_]ËEtD>t(.t&.&.&ud9uE[^_]ËUuD>t:.&u$9u뾐.&9tt[^_]ÍD>UWVSû#}ED$E D$EE$$©4E܋\$D$D$D$D$%-uM(U$T$ 5Aƅ?T$ DV 9‰T$ s )HFL$D$$ܠD$ V9oL$&˃9O9uD$%Ur]} ;tL$E$UE tE C9N.&9ue[^_]ËD$%-uMEED$E D$0$B@Ɖe[^_]ËED$E D$'$@Ɖe[^_]ËED$E D$\$?Ɖe[^_]ɋD$%9v.& %9uU~ t^E|tE_UWVS, }m|$D$%U <$Y!4m܋|$D$$%-BuM>U($T$m>ƅUT$DV9‰T$s )HFL$D$$D$V9L$4.t&.&.&.&˃9M9uD$ Ur]} ;tL$%ɋE$UE$tE$C9~N.&9ue[^_]D$$%-@uMEED$E$D$0$d=Ɖe[^_]ËED$E$D$'$2=Ɖe[^_]ËED$E$D$\$=Ɖe[^_]ɋD$ 9f.&.& 9uU~t^E|tE_UWVS`#E(|$PD$YUt$X|$0D$0D$H|$ D$$D$L<$X¿4፾ÿD$DED$ED$ED$E D$D$DD$ D$HD$|$ 5$U:ue[^_]ø랸뗸1fffffUWVSp9==  =D$DEU D$HT$Lu 1ҋEЩD$HT$XzD$D~eD$DD$hD$ D$lD$D$X$>D$<D$hD$@cD$\% ?D$X\$Pt$PD$4t$PD$TD$Pأ܋$܃,݃4T$PL$P|$fD$f fD$dl$dT$`l$fu؋L$@)эyT$`(\$X׉T$,D$(D$8D$0} }1|$DD$ }y}}}1MD$`L$$MDD$@$8D$PT$@{D$DD$Dm} }R}D$ 1EUT$$o8D$PED$$D$@T$|$D T$l|$`(D$D$PD$ D$`|$Nj} t$@ ;؋\$H*t$ D$P1D$`$[؋D$<$ID$P9+D$`M} 3E 0D$Pe[^_]ÃD$lx |$`/WD$8 D$0C D$0D$D$<$މD$<$D$XD$8T$,҉D$0 D$41w )ƒ p<)Zt$LEЩE'E D$E D$0$6D$PD$Pe[^_]E$36D$PD$lx t$` D$$D$@EL$4 3L$84$臆D$4~T$8 D$0 D$0D$D$4$UD$4FL$uDžFD$4ڞ.(ɋL$PAD$H0ك$ڞ(xD$XT$\D$HT$LD$l|$`D$`|$NjD$PU҉D$ t$<|$8t$(L$$D$4D$HD$8D$4r D$`(D$X (.&t u)D$@L$$~YD$`D$؋TT$HL$H؃\$HD$HT$LD$H-@D$L"D$`|$P0V-؋D$XT$\D$HT$Lut$PD$,D$0t}||$\D$D$D$h$I[D$hD$D$d$MbjD$lPT$`1D$XD$h$YT$DҋT$`D$` F}EL$\yD$<9)ƅD$@|$\)D$hD$x$p\D$DD$H~ |$HL$h9~ȉD$x)D$@)D$h)D$HD$D$D$D$(D$<$?L$,T$ T$$D$,Eh"GD$,1T$$1T$D$<$$>D$D$(D$<$?T$1L$D$L$,T$؉D$<$HDžL$,D$D$T$Pt$t$#LɉU )ȉCD$T$$#DƋD$D$<$>ET$$t1T$$<$NjD$,`T$$L$,D$ D$,PbT$L$L$$<$<D$T$L$$UUBJL.t&.&@9s t]UWVSu} G9F}uuFV|9s]B9EE)ׄtdD$D$$UhREt}Ut\T: E)j[^_]ÃFV|9rָ롉E4$?E$>ƅD11UWVS$}<$ L$P9L$()$D$TD$h$$04$0$ $$t$89( ؋D$h!$$$;0D$t$/0D$x$#0<$0D$$$$ 7$9D$h$@DŽ$$s"E@u$|$h‹t$0 1ҋXҋ$ ʃ0$4t&.&.&.&.&.&.& LOЃ${/~Ӄ9~)ƒD$XNT$`\$X݄$CD$`$QӃ0 T$T3t$PD$tD$`|$$$$}5$r$}D$pH$P$}D$pыD$pD$Lt$tD$TD$XD$`߀EDŽ$E@ D$tD$`D$`|$p)랃i  n$D$$4$(DŽ$E@$}$8(xE@$u$% ?$݄$$(1/X$(D$hp$$ÍpT ~!9r@@DŽ$$t$PD0$DŽ$!$$)Ɖt$h$D$hD$$$3$$t$h)$D$hu$$$+D$t$+D$x$+D$<$+<$+E$9p@ $'z$$$?+DŽ$DŽ$E@}EPu9us#T$D$E$$*=E8 )n)T$T$T4$$$HY9^T$TL$h$$$9D$hb B cT$TD$D$x$$:/D$x%$L$$<-D$@$ $)D$@$T$TL$H)L$Tt$d |$D$t$$0D$t$؈$T$@$L݀Bټ$$ f$٬$T$4٬$D$4T$X\$@|$L(|$LD$$D$T$ـ$D$@DŽ$D$HD$D$t$$-D$t$D$$$$r/$g$l$($$8(4$0($$$&$D$hȃ195 DŽ$t$P9t$(tQ$$q $).&.&.& j\t鉔$\$h7$$Ɖt$8D$4T$X\$@D$$D$TD$4$D$X܈LD$@ؠ$TD$$ $D$h$D$h؉D$$T$ $$T$ zD$$$-…]f$)Ɖt$$$$e-$Z)$$$$)ЉD$$$$l#Q؋$D$@݀ټ$$ f$٬$T$4٬$D$4T$X\$@|$L|$LD$$ D$TT$DL$ $$'D$TL$ D$'9D$TT$|$X $$D$8D$hD$TT$XD$4\$@D$$$EjT$TD$$$$""$D$(D$4T$T|$D$pD$$D$ ED$ED$$$$$E$E tE }8$D$hD$@\$XD$4D$$ D$T`D$@\$XD$4D$$DŽ$D$T.|$p)D$LD$pD$LA$ب\$@)T$KDL$$$%D$ L$D$%9D$ T$t$PYDŽ$!$T$XD$4\$@D$$ D$T\|$tt$L$BBE8BDŽ$P$f"$$;yD$$4$$$iD$4$}u$DŽ$E@}$mD$@؞=D$$D$TD$40t$$)D$$D$4\$XD$t8P$1D$xDŽ$I$(݄$4ݔ$D$Tt$tD$XD$L~߀EED$PD$T1D$L$$T$ L$LL$D$:ft$tV ~ t$< D$TD$$fJ $N ~ r IN|$`T$TD$X)‹$(݄$4T@$$3d"$~4T$T$D$$ 9T$Te$T$($$$t$$$D$@؞D$TD$$ D$TD$$ D$LY$\$xL$X\$LD$tDp$T$P)ʉT$$$wR$L$`l7D$h$$$ $$D$x$$G)‹$(݄$L$` ݜ$$$L$ L$LL$L$hу5҉T$M $MU  D$`Et$PD$tD$TD$L@$.D$t:D$tP$1D$xD$hDŽ$c1W߀EmD$h]D$tD$`$DŽ$!|$Xo|$hDŽ$P |$XDŽ$!t$X9$J$@w${DŽ$_D$paD$pP$)D$$$lD$xAD$xD$`$D$x$$d5)ED$ED$4$$$d$% ?$݄$$(fD$T($&DŽ$t$X9$$C$$$ډփPD$$s9t$DŽ$!t=$$@D$P$DŽ$P DŽ$L$X9$1@c$1ۉ\$P\$T |$h$@.DŽ$t$P9t$(tT$)$$D$$$GD$`$WӉ1D$x$!$DŽ$!xxD$0t$PL$TD$T L$`$$PӉ1D$xD$h1$T$t fffffff|$L$ -fffUWVS(=&E܋u} G9F|ƋG$]EnOMEH}ЍV@^LM1]؉uUEԋuuEډډ]fQfE9r]؋uEԋMQ}9)ʃTM)ً}9s4})f.& :fJf9rۅtE};xt#}GMADE([^_]1뇉Nj@E$]S…t>Gz q s7u/u(UE$];UBEUE뎤fuu밋]K J z s fUWVS<=&E 9Ex0'E }Ux}؉EԋE@EA…u&t&.&.&A…t v0uA߀PEEiE)4u؉EEEUWVSuEH98)ʃ} 1ɍt&9 $/tTUP@} K}|> 9u~2U)49t$W0T$D$ $Eu1[^_]Í~ u u M9t$O0L$D$ $u}{1.t&DUWVS0ޙ}u D$(D$<$\$ D$ T$$D$T$D$,D$4$`\$D$T$D$T$ G+FD$(+D$,~%T$$ЉD$D$\$ D$ t$e[^_]T$)‰T$ D$\$D$ t$e[^_]UWVS}M 2A<w 9uYu߉[^_]1[^_]UWVS٘EM]E TsCD9sf9r)؃L9s&)D$D$ $]][^_]UVSEPXM 9} .&u#9r1[^]Í~M t09tݸ[^]fffffffffffffUVS 0)ˉf.&.&.&, u썊4a)ˉ.&.&, u썊A)ˉ.&.&, u[^]ffffffffffffffffffffUWVSU} EZ]9BB[^_]ÍBEu\]uttk )E^M9uU.&M ЉFCU9rߋUM})}Lt*%9YE.t&9rE})} ȋ})J.[^_]ÉBMUVSՕUBJT19r, 9st9sEE$Ɖ[^]ffffffffUWVS 聊f7} w.L U4tfMt@ P.$30E $ƅEFEFuFF [^_]øMEP$UуL ‰)U= w$| P.$t P.$pxUWVScHut"F w"7u&L 4[^_]É4$ [^_] P.$UN?L 4tU$[^_]USMtuPtv[]fu*t9ut7u[]ÄtuO1҉[]úºt؉[]u u똃UWVS]CEEEEE 1ɉE}ˋM!.&.&.&.&D}|eEUƉ׉1u}D9]ωˉ t"E9C~$EUTC؃[^_]É؃[^_]ËC$tKSx s stftE$]u2uʉE$EfK H x s UE=w1=w=v=?wD uA]1Ӄ?v ]x@u̺ ]Éڃ]U$t UP@]UWVS8& } EHMW9|ЉʉE}EGM4 9w}U$SE؅kHD9Us2UU)ЃD$D$ $MnMUGEԍDEEU]TU9W]9)UЉʉM̉u).&.&.&}9HtMEӋM11EU-.t&.&.&.&.&.&AeƉ׉1CE9rًEU܋]Љt}9lM̋uȅ ftDtE؉pE؃8[^_]EUWVSG,u ,  P.Eut?t|$E$EE$`EtsEu7Eu?|$<$r‰EtUE$wUu P.$\u먋E[^_]D$7D$E$ E1[^_]7EuO$rDžt@q@, E P.$ P.$, u딋En P.$}1Xǃ, Eu1>UWVS$T9u EHNj@EPG9~&.&9U $|ExUtt$D$<$ UEp@]L] ] )؉E1}U܉ʍ.&.&>M CFM9r}ыU܋]9rJ+MDtUE]XE$E$[^_]Ív.&9sѥ9r1fUWVS}u FO)u2_DTt&9s290tɍL [^_]UWVS0] E@ECu)uAUJEDT9:98t x؋]E1C$‰E؅p CEԍ{}E̍DEEH@]DEBE܉É}11+v.&.&.&.&.&EE@1+A)EU1҉ƃ1USE9rƋEM9+EM܍]ȍ\]MЍ\]E)ȉEE9]܋]5.t&.&.&.&.&.&.&E ؃1)EU1҉ƃ1UE9rЋ]܉ǃ)߃EDžuE)NjEftEԋE؋}ԉxE؃0[^_]$E؅t@@E؃0[^_]1؋]E }UWVSEx|$Pt~^$T )‹M  P9|$s`F )׉\$ Éً\$ D$ ?\$V9T$sZV ЉD$ D$ e[^_]à t(D$ ?\$1D$ D$ e[^_]1D$ ?\$D$ D$ e[^_]ù )D$ ?T$9|$r1ҍH ЉD$ D$ e[^_]ËVUWVS$sÅE %tT$ED$ twD$ $T$|$ |$t ) |$T$L$KStL{uL-2uD$)NjE8؍e[^_]ÍD$$hT$S {tM5)‹E؍e[^_]UEM Q t.t&.&Ju]UWVS{ñutD$E $zDžD$D$4$hptt ʃ9t*xD$4$ t|E%=at`fx ttpu ffx fp@ P$ P,r P(Y P Ĕ[^_]K51Ĕ[^_]ÍD$ 9D$D$E02$/514O1USMz2E UD$T$ D$E$[]UWVSzutFD$4$O nx$P8D$4$X [^_]É4$TڍY1D$ ,9D$D$=T2$.UVSykut&nxP[^]É4$[^]ÍY1D$ 9D$D$IT2$@.ffffUWVSyut2$'- ffffffUWVSwւuf~ *D$4$ F0ǀǀ F 1F tV$ЅF F0tN@9t $PF0F0$6F0ǀǀD$4$FFF [^_]ÿF yF$i4$Lǐ8Y1D$ @9D$D$82$+81 fffff̀rS[d? [UVSbvGut8F0u ǀ4$uAnP[^]ÍY1D$ H9D$D$;2$ +뜸fffffUVSu÷ut#1V ҃ t[^]É4$[^]ÍY1D$ P9D$D$;2$*UWVShuMu!8FF 6uaDfF FF uuFVT$D$F$V$FV fV 1[^_]ËF0tN@9t $F0FωVʉNɉ~ ωVʉNɉ~ωVʉ N ɉ~$ωV(ʉN,ɉ~0ω V4ʉ$N8ɉ(~<ω,0123FG4VF5NE6FD7UMFK8VJ9NI:FH;UM<\GLFJ\EZLDJFGFGXLGJLFJLEJLDJ^_^_XLGJLFJ LEJ LDJ ^_^_XLGJ LFJ LEJLDJ^_^_XLGJLFJLEJLDJ^_^_ D$ D$D$T$$Ke=<1ɋ8tBD$D$ N|$\$4$ y8t6D$D$ ~D$L$4$W8t6D$D$ VL$\$4$QW8t6D$D$ V\$D$4$ ?O8t6D$D$ NT$D$4$_8t6D$D$ ^D$L$4$W8t2D$D$ VL$\$4$AuwW8t2D$D$ V\$D$4$u7O1$[^_]Ë8'O-'8,$[^_]UVS vl[wEU uMtTp4u 1 [^]D$D$4$.u"udž0&UWVSkvƋ4D$D$4$-EtE$Gu͋$dtMtf~ 18t$39⋎t $4$ uu&E[^_]%U9%8}%]EUWVSjǽu]tCƉ$[^_]þUWVSj}uljUD$@$:ƋUu 1[^_]ËOD$M$…1]~˃Mt|tatOt=t+tt9EGX<^?^@V@FA~B^CFDXhH *JHXXhHJjJHXX h H JjJH X X hHJjJ9Zu5>au-Fw"D$ H$ ;F@tNO$4$%81[^_]ËXP.NF(șdž‰DžuN V DDTNꉖD$ T$D$8$]EP ~D$4$0}z4dž$$$&p5X|Plx ,H XPp[^_]Ë8f8F8FF F FFFF4XP. ~D1 󫍾$F~ 818t181D$4${dž0M8?8UWVS$V}auF(x~(V0!UN9F9MUD$N $MUF($N 9} TDTDF F,9sF0 F,|$}|$4$$[^_]ÉUUE$EEEtlE܋UT$ML$E$袭ME)UЉL$D$$AM $LEUVU(_US]ED$U $ #C,9C(}#C0[]fUVS U_EpFtD$D$$F u  [^]IUWVST~_EPwhHtwSuNP L~8xpXpTPtYtQ1[^_]1DžLDžPXDzDžTHDD$$$,ƅtǀHXdž$$ljFHDt dž w?GciG G 8G pWGMG>GE UtAtCf\ Ft$t$4$ XxD$ ED$E D$E$XE EUuM, Pdždž QXTtt!ЋTDTT9QX1XA1L=f+fdžXD$ L$D$$T PD$D$$fxuu fxD$D$$E t @E@t E DžLxpX]DzpTPO AfXmxD$T$s XD$`D$$` =b1уX`abcddefghhijkllmnoppqrsttuvw `b1d}h=f]t_LX Љ lp&D$$ 88D$\T$X$TD$XT$$…\@@f@fBB PD$D$T $XD$XL$$D$PT$$O,t$ I<T$:T$$X +XFTXT$ p9T$D$* 3${TfUWVS$>L#WEpFtD$D$$FUED$E D$4$kDžEtuD$D$ED$D$ D$|$4$踜‹!@u FЃ$[^_]ÉUD$D$$LUЃ$[^_]D$D$$'Ѓ$[^_]fffffffffffffffUWVSKUuE U VfFFVVfFFVV f F F V V fFFfFFfFF=6F t<[^_]ȉFȉFFȉFF ȉF FȉFFȉF[^_]ft~ɍDNE* EtEЉ‹ȉBȉBE9t'GʉHɉHHttX ˉX X ]X ˉX f9Vɍ\Nt&.&"BɉHɉH@tH ɉH H ɉH 9uȃ[^_]ÍqD$ |9D$D$bH3$F lUWVSHÝSuE E F=F ƒ<NvVVNNvVVNN v V ȉF FfFFfF[^_]ËȉFȉFFȉFF ȉF FȉFFȉF[^_]fN~ɍDNE4 EtEЉ‹ȉBȉB'G9}ɉHɉHHttX ˉX X ]X ˉX fVɍ\Nf.&ɉHɉH@tH ɉH H ɉH "B9uȋF mqD$ |9D$D$bH3$F ƒl'UWVS(vF[QEpFtD$D$$%FE  D$D$$kEb1E}䋎M苖U؉U싖 PUb1@xH M؉HD$D$$f$u ([^_]1([^_]UWVSGE,P}wFtD$D$$FD$<$tr$tcFt$t$t$E4$<$E$[^_]øUS }DbOE9ErD$E D$E$* []fqUEtu]11ɍT9r]1]fffUVS!DNUE X91rVȉȉȉrȉVȉrȉVȉȃu[^]11ɍv1É11f1놉1_UWVS41CNEE@Et } 9x 1}EEEEE*EP}GA у@3=0fuftpfuE@E܃!‹EH}<}0}}Gu kUzu@G GGBPWxG8GBW}O ME9kOft DAfEtD$D$ E܉D$L$4$蔨V1ۉ]E@Ex#} EHU ꋀEEƒUƒUuXM01ɅMuFBEFEEF0E4[^_]ED$$E0E@ D$$MAt MM} y AUtiUJAUQ}Q D$ML$D$ M L$D$<$耣E4[^_]Ë}GMWW:D$UT$D$ M L$D$E$!E ]}؉0fuft tpfuu^/Ex }OE@D$ 9D$D$l3$D$щT$ |$D$E$lE@E܉dU܍D$ 9D$D$l3$U/B $HfUSEP M TH}[]UWVS>HuE9G Ut OuhM Gt"V T$D$$vG$聼GB<$o9}thG tkMtOtD$L$ D$GD$4$wn"?9}tG tUE?9}u1[^_]1G!,USUE @@ @HKYXBP[]fffUWVS <ÆG}ED$E @D$E$t7ƅt|$$t [^_]84$薞8UWVSD&< GuE 9‹E1k*lt$D$ D$D$<$ =5DžDžDžDžD$D$$輛<$*ƃtI<$)D$D$4$$tntD$4$tSD$D$$FE+uqD[^_]Í"$^L8D$D$$4$8?gUWVS,d:IE]ƉUM܋ED$T$4$YNjE  &ЉUUD$L$$]̷EGfEf}UBM (9tD$T$$]肷UBD$D$$]cXMfG|$ED$4$]<M9$GfEf}BEGIf9trWu܉V1,[^_]ÉE؉MEq\$ 9\$D$bH3$E؋M7UE:98uDE܉ufp뛋PUD$D$$];UuT,[^_]ÉUD$D$$] UE܉ufp5UE:98to!D$T$$ZtfGUE]qL$ 9L$D$bH3 $UED$T$$]bsUWVS 1=f9Ms(UɋU)ɉL$DWD$DW$UfGG)fGMfDOMċAE@BEB AD$D$$U螁UBD$D$MċUQ$}F(tu 9Fpu4WGu"f}udžfdžD$|$$٦ 1EzE=҃9FD$EĉD$4${F fE`fE~}t  >D$|$$)2|$ED$4$}EEEEȉEE@EME؉EEċ@E9nFf;EfFvdžG=҃E9~džEf\MUqD$ 9D$D$bH3$ZMU.fEEfF fE~EUčqD$ 9D$D$bH3$U'UMqD$ 9D$D$bH3$UMSfffffffffffffffUWVS8]&F1EUE@(t5EpLB< GGǃ ZU)ىL$D$$]~f}Ufz|rrEXftBۍLZ]&.&.&f9sf]f9u]t^J{f+Eft7 F].t&.&.&Ff9sf9ufjE@(tuE9P18[^_]ËM:9yI;MMA(  UEfEUED$D$D$D$ D$ED$E$]uUiUMG D$E$]ztGUM,UMD D$E$]zMUP9UUfBUE]䍋qL$ 9L$D$bH3 $UEGE #EEUUEfEut$E D$E$]lvUBM=E9EUUEfEt$E D$E$]vUFEu BtB=ƃ9EUEfEEEH(tB=wtuOUUEfEEE D$D$D$D$ D$ut$E$]YsEUBMU1ۉ\$D$E$]qƅvEfEED$E D$E$tUUE@(EUUB(1ɉL$t$$]}UEMAEfAGUD$D$E$]ӜƅE@U=UUEfEED$E D$E$] tUtfU1|$t$E$]̞UE䍸q9H3E܉U|$ L$D$bE܉$]UE@(EuU]䍻q|$ 9L$MD$bH3E܉$rE9EM؋UB=VVU]䍻q|$ 9L$D$bH3$UUfEED$E D$E$rUEH(EH(]䍻q|$ 9L$D$bH3$U;U1҉T$t$E$]8UUWVS J/*}u FuIFu 1 [^_]D$D$$xtYVPD$D$$ȜD$D$$@t!VPD$D$$萜|{UWVS0À)ljU܃,E싗E9BD$BUD$$輙ƅUBfEHMTFEDtU D$<$tUF=w@fuj>t$<$ut$<$ˇ:0[^_]ÉU썃qD$ 9D$D$bH3$UE EF )‰T$L$Eȉ$luEfEfFEDFfENUBftIЍDVEȉMu؉UUuf.&f9sfMf9uMu؋UԍLQF=f+Eft6Auu}}t&Af9sf9uu}fnD$t$$QE܃8tRE܉D$<$ t#fFfFF 묋E܉D$<$+`D$D$$1CD$t$$ę#UM䍃qD$ 9D$D$bH3$UMUWVS@Ã&}EpFtD$D$$JF Tt:t@[^_]F(tڨ1EEqE؍9EԉuED$E D$E$:ƅEM}$f9t$E D$<$mFD$ ED$E D$<$E@  V=vE܉UE؉D$ EԉD$D$bH3 $JE܋Uf9b~EP|1f9ǍJfNftf}u BGD$ ML$t$E$WG1f MHfOft|$t$E$lt}E@=rfUEFD$FD$$蘔Dž@=fgFD$ |$D$4${G=f D$|$$胖bD$ED$$cB=NfoU 1@[^_]ÉM썃qD$ 9D$D$bH3$7MTD$|$$ו럍qD$ 9D$D$bH3$D$ED$E$菕\uIuD$|$$aFEčMML$D$4$7!N9wfEq}Ѝ9}̉֋9MFEȅ/D$t$$G,EE9@9}D$L$M$蟔EE9‹McBD$BUD$$U9BEA=qMԉU؋EЉD$ ẺD$D$bH3$MMԋUBHfH\DFLMf@D$t$$蜒D$ML$$1[mMufED$t$$QD$EȉD$$ȏƅOE룋uD$D$$ufЉD$T$$豑ED$EĉD$<$Y3wF,E׉B9OMUD$|$$UU싲19u/D$T$U4$&E9uU;EFD$FD$$y…F7ft։EfM܋61ufqpuU+MfPmEDGDED$|$$AD$ED$$踍Dž@=wU܍qD$ 9D$D$bH3$UBU`fU܉1D$|$U$詏1҉T$ED$U$DžUa։ffffff1̀ffff ̀rS[T? [UVSR7ut5D$D$ D$ED$4$Ot6E[^]ÍmD$ :D$D$53$럸fffffffUWVSãUE pu9lE1ptEuAx=EGu4Ѐ:d)hx9׉drD$/$t)1lU+Ĭ[^_]ËdrL:d`'$>\F d9rƀ>Xtԉ`dD$ h)D$|$`$Hpd9rv.&9>/futD$$d6/|%=@dt~8u)сt?hmD$ ,:D$D$X3$hMX\pD$E  D$\$o8 X9hƋ`L:d)@u08r9hD$d$职uYEt)D$\$4L_tD$\$408,d`q:fUWVS< Eu U9Urz9s 9roǃs"u5u7[^_]Í 9rQ9t׉ǃrިu!u)tftɤ[^_]xfƉ9ffffffffUVS gl4$htD$$D$F $3 [^]UWVS > #}$ L$K#1$KD$$D$<$h3t$<$2 [^_]US ìl$s[]US, ÆEEVEEED$D$ED$ ED$D$E$Ŏt}u E,[]ø,[]US l$s[]UWVSxÉUʋ1y}IMB EBEBEBERUEEE@EE@EE@ EUE̋EEUUȋUUMEE܋MM}ċMUE te kE2-byEnd 3Eexpau֋U쉝|]11 É]1uM1EMEu1]1 M1ΉMˉ]1u؋M1]1 Ήu1U1ىuuU1M1 }11Ήu11 Ɖu1UډU1ЉUċE]E11 4u11E1]E؍8M1щM1 :]1؉]1ωEE}NjU1]1 1Ӊ]1m}uuU식|UexpaUnd 3SU؁2-bySte kS CE}CE}CE}CEȉC E}C$E}C(E}C,E}C0E}C4E}C8E}C}}̉UȹEE9t9t,EȋU+u0<[^_]D$$D$$.#ԃ $c(UWVS`oEE9E1} w6}̉M UERE9t~9ue $1cXM̉MG} EME9tX9thM UD$ D$<$^"E+uI`[^_]D$$D$$7"D$$D$$"똃 $b'UWVSDz_9EE1uUč}̉qMȉM}ǹU7UȋE9r}9t"9t81uE+u=ЃD[^_]ÉUD$$D$$i!UȉUă $aU&UWVS8â9>}}̉11҉EE9t9t)E+u18[^_]D$$D$$ ׃ $Kafx&UWVS<:U9E1E x;Uȍ}̉/M UȉEFE9tK9t[E+ua<[^_]ÉUȍȢD$ :D$D$<3$̭UD$$D$$ 륃 $`%ffUWVSyV}lj։ʋM fFfFP@F uzYˉM V)fVfVD$\$$U]PMUBfFF F D$t$$]u1[^_]ÃQʋ]C ^)fFfF] H@ L$J UL$ $]lOUBeD$B D$$]rtH D$D$$t&KUWVS$}E΋x!fzfz:EF~ =(M9AfZfZۍ E@ EE@utN=$1EAfBB B D$T$E$]s$[^_]É=ft1MM\A4f9rM됉=w+f81&\F<f9rZUM]qD$ x;D$D$bH3$蚪MU룉UE]qL$ x;L$D$bH3 $_UZEUEMEq\$ x;\$D$bH3$UEMUM]qD$ x;D$D$bH3$שMUU]բD$ l;D$D$ 4$蜩UUWVSLT u܉E։MM  fMEE=EffEFEfE=f}EfE111EEf}u։ʋME@ EǃtVE}TG:z Z]f;u]9fEA)fAfDY|$T$UȉM؉$]MKUԋM؃f}Ef;ErE EȃEȃ]f9]f9u}EE\E9E]9f9u9tMԉU؋]܍XD$ ;D$D$ 4$MԋU6E}TG:,E}TG:EE]TCE}}uL1ȋMfAE@(t 9Hf;UE f)8EEf;}ǍFEfEu}l&gEHEA ÃW)fW]fT_D$L$$]IIfEEf;uf;uu fEfEE@ EhEHEo}uLMU]܍XD$ ;D$D$ 4$蚥UMMIUѻEHE E4w(ufFMf9MuufFEL[^_]Ë]܍XD$ ;D$D$ 4$fEf;}'1뗉@f;ErfAf9stEMA]܍XD$ ;D$D$| 4$菤9]܍qD$ x;D$D$bH3$]8M ]K)fCa118a\t&Sv.&CUWVS ƉUMED$4$!YǍED$4$YÅtxEEGCCGfCfGfCfGUB EC G ED$E D$$M9U[^_]1[^_]UWVS(  ƉUMED$4$UXEljEfGE}fyUzyAB A u.E B=f9mEU܋ED$$hEUMEABAfAEfAB A BtHUD$D$$hUU}HD$D$$jUED$E D$E$MU܉RE䋆U܉׋usOuCu1u9ut2U܋E$kEU܉E]E([^_]äu9uuΉUftt֋E$$kEE([^_]ËuBfF] fu]EvUM썃qD$ x;D$D$bH3$UM%f] z>1D$ED$$`iFUWVSpqZ EЋ}uE fEڋE M܃8MED$EډED$EE$U …l }F Bf+EfBMfDJ SURVP]XP E@D$ED$$Uԋ]BFD$D$uEF$BuE܉EԋE 8_G,E9 EEEEEEE} FE E̍XOG)9Ẽ?D$ED$E$MEee} EF ]v: Af+EfAUfDQЍT ]/}X_]̃XM̉D$}G D$$]YAE܉EGM1}Eą0E 8uE <$MȋU WD$EԉD$E$]fD$t$E$fE9U EȉEԍB]D$BỦD$$]cDžUBPfUڋN y EOG)9f9s%)D$DWD$DW$]?fGEF  UډU]܉]fDQȉEE@=f11҉MM.t&\Af9rM}EԋGAf+EfAUfDQȉEF=}f+11Ґ\Ff9r]̉C}Eą}̋}D$L$$]dD$EȉD$$]dD$ẺD$${d1p[^_]ËV]XVT$T$$]>FE E̋EMAOMu fMYUɋULJы] MU MJ MML$M $ЉE M9ȋU=YEE(}̋}D$EԉD$$]TcD$t$$>cűEȉEgy])fyEf|AωM̉\$ED$<$]5=GE܉EȋMUڋ]܉]fI|QϋEX%EԋGyf+}fyf|QV %GR}E܉EȋEE̋E̍XE-}8X][XE@=UDzЉETD$E@ D$E$]J_UMKM̃H D$D$$]aMwE@=PE|xXESEĉUȋ]ЍqL$ x;L$D$bH3 $ZEċU!E̍X . 4$Mo‰11ҋ]̉CM]ЍqD$ x;D$D$bH3$ϗM"M]ЍqD$ x;D$D$bH3$藗MTME̋]ЍqT$ x;T$D$bH3$\MEMUEEЍq\$ x;\$D$bH3$MUE }D$EԉD$$]_D$t$$_G$n }̋}U  뙉MĉUȋ]ЍqD$ x;D$D$bH3$nEMċU6MU]ЍqD$ x;D$D$bH3$'MUrM]ЍqD$ x;D$D$bH3$MUԋ]ЍD$ ;D$D$q 4$贕UűEԉE}EEqqqUWVS4\A }G,EЉqE؍;ED$t$$[…?G@=ffEGEU܉GfEfft?fE<Ufy ED$E D$ $M2MUt(fuU܉B EftgU܉}B E苇20fHEDBtD$T$$\B E1뭉UE؉D$ EԉD$D$bH3$Uȃ4[^_]ËEMȃ4[^_]É  u>f}uAfEA=f9uu AM܅uEEfG Mȃ4[^_]D$D$$YEtfEED$E D$<$1EɋMD$L$M܉$[EUGW E9uЋMp?E؃9EID$t$M$h[EM9}GD$GD$M$XƅMGEFU=oMqD$ ;D$D$bH3$M:  GEV@Uȉ]ԉuu}}ЉMً}}̉uƋE ʋE؉E  1É1؋}Љ׉}!]!1Ћ]؉ 1Ӊ 1Ӊ]U}1!]!1ڋ]ڋ]ЃEEU}܋}Љ}9UWuE܉]؉MEEԉEE؉EԉM؋EEE܉EU܋uu]41J 1 ]ȉ׃]< 1u1ȋu؉ 1ʉ1ʉы]!ىu!1ʋMċu(>‰EЉ‹}܉ 1 1MЋ]؋M1!!1؋]؋M‰}̋]]Ѓ@E}x}x}x H}x}xX0[^_]UWVSӉʋp x$?utm@)M|0(9MރEE} H P$MTUp(t$$EEU]?vIzt @}߉ÉU|$$C S$@9u}؋UM\9@?t*Ux(ރBEtfEtP P$[^_]Ã?vōJ΃|3@p(M}UމËFGFGF G FGFGFGFGF G F$G$F(G(F,G,F0G0F4G4F8G8Fu\uBMEt H(x)Z]fmfm sMM Z]IUWVS: E։MB R$ǃ?F V$$T$F V$~)71@F(^(F F`F$Fd\$4$JM1}\ȉ9uh1tft[^_]ÍGD>(8w58)|>)1tfS^(M@@t(@L>))t1D9r^(\$4$mߺ81tffsg fӃ]KMM9sMuFDM9r96fGM9rf7HfJUMt U E}]U U E]UWSUtm؞B|6Bp0B 9YB1 BXhBdBOz(@1uHu9uuB B$[_]êft.t&f?UMt U E]?UU E2]UWSUɼBg jB;ʄB gB+Brn+B,hB0kAB4كB8y!~B<[zP1uQuBu-u%BHBLB@BD[_]êftf뷪UWVSĀc |MqPuQEĉUȋAQ ẺUЋAQEUAQEԉU؋A Q$EUA(Q,EUA0Q4EUA8QPpp)|>Q1!t=^P:~Qo1+uGu?FP^PFHFLF@FD\$4$1 [^_]êft=t#)|>Q1tft^P\$4$ߺp1uPJf?f*fn.ӃKM9s}u.D9rf#o G9rfK6lfnUWVS(É։T$$L$@@SDǃ|$ )D$|;P9tt&D$111C@SDC@SD tCHSLD$ T$DD$T$T$$CPD$$D$$|$kD$ƒ​t$$T$SPT$$ڃT$L$D$ |$$ָL$ktftT$ D$$D$$Ts@{Ds@{D9T$ rCHSLꀋD$9wL$D$ D$$d$D$PЃt$$1L$T$|$ |$$|$$C@SDC@SD9rCHSLD$ 9uL$T$‍D$$d$T$tHЍ{Pt$$tftD$111C@SD C@SD tCHSLe[^_]f{Qr`T$Ћt$$ruZjfpjuXu??tCP{QD$ffD$D$QUMt U EN]UWVSjO } Et.1T$T$MTuۺ1u)u/tft[^_]êtfUWSU؞B]B|6B *)bBp0BZYB9YB/B 1 B$g&3gB(XhB,JB0dB4 . B8OB<HGzP1uQuBu-u%BHBLB@BD[_]êftf뷪UMt U E]KUWVSî } Et.1T$T$_MTuۺ1u)u/tft[^_]êtfUEȋU ʒ]fffffffUVS MDžDž<<,?z DM E5 @x  D$D$D$D$ D$t$$(uVD$D$D$ 0D$T$4$Bt0[^]~y[^]Á uDžDži뷸밸DžDž D$D$D$ 0D$T$4$AL0>[^]DžDžDžDžuDžDž\DžDžCD$D$D$D$ D$t$$'3DžDžEDžDžDDžDžCDžDžBDžDž>Д DžDž DžD$D$D$ 0D$D$$@t0Д DžDž<DžDž,DžDž+DžDž*DžDž)~DžDž(eDžDž&DžDž%3DžDžRDžDžD$D$D$D$ D$t$$$ADžDžTDžDž;DžDžG[DžDžFBD$D$D$D$ D$t$D$$2D$D$D$D$ D$t$5$#4D$D$D$D$ D$t$$x#DžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž0D$$NDžDž0D$$D$D$D$D$ D$t$&$"3oiD$D$D$D$ D$t$t$!D$D$D$D$ D$t$\$Y!uDžDžDžDžDžDž DžDž DžDž DžDž gDžDž NDžDž5DžDžd iDžDžDžD$D$D$ 0D$D$$9RPLDžDžDž D$D$D$ 0D$D$$S9D$D$ 04$T$V 1t&=S,vD$c$ `DžDžyD$D$D$D$ D$t$$D$D$D$D$ D$t$$7SfffffffffffffUSfK \ []UWVSPJ/ EEEE}|$EԉD$$GẺ$1u} }Ƌ u%1 uBfEʍ M MM9MMfJM^MHHu u p Puup0@1Ẻ$D$|$$P[^_]j D$D$D$D$ D$D$$ ‰ f@ fN9fE@EU tdM HUPMH Uup 녋uMHx0<@\ uM M  M310t ED$D$EЉD$ D$D$@$,4u}u tE E E~ vMiM DUWVS O4 <$5t V6u[/j$Et+C/t V6u<$E [^_]/t V6uD$<$|E [^_]US$襯Ê t$[]EEED$D$ED$ D$D$E$2t uȣD$ AD$D$AH4$$d mfffffffffUWVSƹ E }0@DFƅtGFU M U9BFD$F D$ $GEUtRFE VJE}9OT$T T$$EFMAE1[^_]ËM!@]GF MtFuV]SF }WT$|$ MQT$D$E$ u>E]놋ED$ED$ GD$F D$E$LE!@F aD$ $(t̋EUBL$$(t}VWVUVS uURH fu xutmLPDu%B EEED$E $[^]à D$D$ ED$T$4$uE뭸빸UWVSEU zpu9rt)t&9t8t)؃[^_]ËE)[^_]UWVS]E xS9sJы0t1}U fx9tT8Tt[^_]Ë}U9Ѓ[^_]ÉUWVS 舫q E}E pE0EEE90EuNEU9sщL$MFD$E$]7D$t$$(M)Mt2MVD$T$$]Q&ƅu [^_]1 [^_]ÉUt$E$]U&Et͋]E0U=UWVS(萪u E }}8}xEEE3UHD$D$E$(U)MMuE؉D$E$nƅM@@@ @E9s‰M܉T$UED$F$EUMXE)uD$t$E$k'1([^_]ø([^_]UWVSnS }E pD$D$$$tW@ u^JM"D$ED$$~$t&M)΋PUD$<$9ur1[^_]ø[^_]D$D$$&ffff̀rS[Ô ? [̀rS[t ? [US sX EU D$T$D$ED$ED$ ED$E D$E$ []fffffS[ ? [f.&̀rJ!fV|$t$ L$)9ȉr-uD$^ÃrfftFG΃u))ǃrtFGff؊fffffffffffffffffUE@U +B]UWVS0 tMƋuA~8t:F4@9s3`V8F4@9r$%F8[^_]ÉUWVS踦 E}}u9ENjE1yvV8t1ME+wĘ[^_]ËF4J@E$]F86]E F4F0E|U1EM yxD$`|D$EtD$ F8D$|$$]9)NjUN8#UV4V0]MD$ D$`T$ $F4~81.& @rPu B8~8BX;F4rE,yF8$]#F8UȉȍB=]I_8 4U]0_UF8$u#_UF8$]F8tgD$`||$t|$ D$xD$E$'DžuUN8]^N]^{]UWVS@ܣ EE M9NjE1lI%;E" = ,9#ƅDƅdHD$$"8BƅC8 D$BD$d<$mv@DžD B BD$4$3!) D$ |$t$$Ƅ=D\D$D$$CƉ׉\‹ :9 tD$D$ $^kt[U+ @[^_]Á},d`@ Džh1Dždd ׉<$)D$`D$D$ t$D$$#f 9?MD$ D$`|$4$`d9uDF(Q( L(9Ɖz9x&_1ɉg99@Ћ8u@8I4T9PuV(9P(o[Džp8H41`9{t9F@VT$$[Ju"dhD$T$<$hFPp @?.T$GxVuEENjExEEML$ED$M $UED$ED$U$UZ>EډU)E}|$t$lj$UqED$}|$4$UE<UT$|$E$UED$\$<$UED$\$E$U`U)ƒ}v]Éΐ.& OB9uE}̍xHED$|$E$UC(MU؉]ZGu]E؋} 8]]E9<[^_]ÉMED$ED$ ED$E1uD$E$M>ED$ED$ ED$1uD$E)ȉ$s‹E]uf.&1pYu]uE EEE))+E9U).t&.&.&2wBu\UT$\$<$UUT$\$}<$UrkUT$ED$4$Uut$ED$<$UzukML$UT$E$UML$ED$E$U[EEE@}G} (E]ЋE EEEu99]߉]339}+}ED$\$<$UEԅtȃ}t/U M.&KPU9u띋Uu.&.&.& 0sHuu[ȅED$|$E$UuUT$ED$E$UEE|}E El4D$ AD$D$l4$>5D$ AD$D$m4$>UjS UT$ aD$ ED$E D$E$9]ffffffUVS " EU M9Mr/9r 4 9r$9fu49rL$T$$7 [^]fffffUWVS(шƦ ulj֋ tRT$VT$$$ЋM^ȉ]1҉EUL$D$ $T$])ӋE111 ufEUD$ T$ED$FD$$]f;u?tVT$VT$$$Ѐf1([^_]Ë]mBUWVS㥠Ƌ; rEu =v[t3CuuaStqPCS t[P ؃[^_]ËD$$Åt@C؃[^_]ÉډSu1V룋KT UWVSב u xD$4$HE%=D$($2Džtz@@&@9uE ED$D$ EЋUԉ$T$$EČ[^_]@1Č[^_]UEU U U$]UVSΐ ]tstWJ}u tFP@Lt1ADTP@SP PS@[^]Ë븉D @J.D$ D$%D$4$U D$E D$E$]UWVS E HMPpt)rP@t6B E$1[^_]ËxMt P@uʋMAUWVS4芄o }u ;VЃEljE@uts;puXY LADTPPX Z O@H PWEuH@4[^_]É[EM܉1҉EԉU؉L$D$ $T$eU11MM1 MMEԋU؉D$ T$E܉D$AMD$$9‹Mt+AMT$D$$ MqEAAE@HEHEDAAGA AGtQMT$t$$$ЋMA4[^_]É\ L_D Y=14[^_]É\<1BEH M<O1UE @M ȈB1]UVS ut PtH J H $u4$1[^]UWVS跁ǔ uu2&.&[tCtډu[^_]Ë$-[^_]ÐVSD$ L$t 8trtl@͉ эv.&ލ1΁ €t8u.t(8u!t8ut 8uHu1[^fffffffffffUVS 貀Ƈ U EtUM"t&.&.&.&t.ZYutD$D$ $ E [^]UWVS % } uw vtօu 1 [^_]ËEEUUU܍EEED$E$ED$E$Xu#ED$E$E܃ [^_]ËE+E1:TEfH @jffffffUWVS(=& E܋}@u lE XYE@ uNtz} ]z}Z]u}]tqvD$t$E@$EP,3)NjM IM)E Hu1([^_]ËE$]/E@ d3{끨mE1u@9‰ÉϋutftU}<$](U)UU)UE @E)Ћu FBEE‹u9sEX9HY9\$ED$E@$EP,…wEfH @([^_]Ë}E9s‰EЉϋutftEM)HEE @EM)ȋM AyE@ .&];}{}]UtMqu ҀB^E9HszE‹}9snϋutftUEu0$])uUUE @E)Ћ} GE@ UbBEXE91E)yD$ED$E@$EP,…z)Ez}9|EPp)щϋE &.&6p9rD$$]1‹E@ ]+KKMKSs :  ]؉ϋus$tftME)A1=UJЃtMUEED$D$ u4$]tv)EЉϋus?tftE)P)UtUE$]w1ɋUV룋EEZÍY1D$ AD$D$G4$.u ]܍ΣD$ AD$D$H4$.bf%BBff+E XffE]F3G]33 4UWVSxm utvF tP~tI)>tI1Fu-)t'\$|$F$V,fN @[^_]ËFDu1[^_]ËF봋VU[^_]Y1D$ $AD$D$Z4$,[UWVSwí utWD$4$ F u#f~t(1D$4$ [^_]É4$2 E.4$ |$Flj4$[^_]ffL$ D$W|$v,ĉ ЉڃuDD$_ÉG)D$_ffffVD$L$ t$}t :tw@Nuo͉ эvvR1ʃ€tv:HPu8v8ъPu )t&8ъPu t&8uHt:t@Nu1^ffffUWVS1v u8tfF t#Vt6F u>uRFF1[^_]èu@VfF uʉ4$F tFF؉F[1맋V0 t~@9t $lV0F FV덍Y1D$ 0AD$D$< 5$T*=fffffffUWVSu u}E FftRxT$$<xF0U t XtTt/$[^]D$\$F0ǀP8$8F0UVS8mõx 9EEȉD$E$>U+u 8[^]f̀rS[dx ? [UVSbmGx u tt$D$t,@E$[^]ÍtD$ BD$D$9h5$$"UWVS4lw D$(׉΋ED$M L$ UT$ML$9‰ȋL$ L$(GU0Et F"'D$ 'ED$ t$|$D$($@D$$&8&L$EuKD$(9t:D$$T$9ЉL$ 9D$D$=8tyEVnEW\$$D$9ÉL$ |}E9\$L$tD$$4[^_]9&MUED$(D$$1D$$4[^_]ÍD$0E|$,E"D$D$$t$ D$$4[^_]ÅtsD$D$$t$먍ID$ BD$D$K$ L$(=e[^_]ÉЃD$8D$,txUL$$D$,D$0T$4D$T$ $D$\$(菻D$D$0T$4D$T$ $D$"D$ T$t$8L$$}t$80 }1th|$ D$t$E D$L$T$ <8D$D$4$D$t$$pljUED$ D$E D$E$4UWVS8JýU Eu}9E1X>'T$ t$D$E D$D$|$ <8D$D$$Xu(u~E+8[^_]:|$D$ D$D$4$ND$t$$赩Xt,KH󥋅D$ 8D$D$$X:pǃX$…X1A<+wLLuىDX9u˃u뷃z럃b뇃JluUED$ D$E D$E$R]UVS<*HS uE EEEEEEN>wN# t$ED$EȉD$4$VxE<[^]EӸ<[^]/UVSw@ D̍ED$EȉD$4$x E<[^]ø<[^]USFQ ;UT$$L[]FQ -f̀ffff7̀rS[ÄQ ? [>̀rS[dQ ? [UScFHQ D$0? D$ ED$E D$E$[]US FQ ED$ ED$E D$E$[]ff&.&$D$4̀D$̀fffffffT̀rS[ÄP ? [PS[mP [USeEJP 7u '9[]&[]f̀rS[P ? [USEO $1[]UVSDO t [^]É4$bu1f1ø11DO \1øUWVSƋUfffffffffffffUWVSWB@M D$0}|$hu }]\$89D$Ë$1M}D$hD$DD$,D$08\$ND$<%t,P D$,t$h\$D9s FD$h<%uԍWGD$CD$XD$<D$\HZwt$0MT$(D$$ D$l1D$X|$lD$Pt$P\$<9}L$,L$\  \$P\$HT$Ht6\$DT$h.&.&9s  sT$hD$\|$(1ۍHЍABHЃ v\$< T$(D$$D$\0|$8GT$`D$d|$8\$Xd$\t$`|$d D$X\$\\$4|$CD$HD$P$3D$Pt$P\$<9}L$,L$4t$hL$D9sL$Ct$h|$4L$X\$DL$h9s0sL$hr\$`T$d\$d|$Xxd$\D$C- t$`|$d9$D$4\$`t$d)щ1҉ىD$PT$T)iiƸ1҉D$HT$LD$HD$P0T$`D$dL$`\$dc19dÍxD$`0CD$4)D$HD$Pt$X9}t$Pt$H)t$XD$XPF\$\\$4|$C@D$\hD$Pt$P\$<9}L$,t$4L$D9L$hAt$hN0\$D9 L$$N^\$h|$4L$<\$P)ٍYt$DL$ht&9s0sL$h\$ # }E E9‹Eǭ&Gbt&ED$ ED$D$$>tD$$D$ D$D$D$ED$ED$ D$D$<$x ƅ u G$@ED$D$ t$L$<$jƅ,Gƒ @1u`${ED$D$ D$t$<$ƋG~U=2D$D$D$D$D$ T$t$<$ƅGD$<$E+NH[^_]ÅD$<$ȋPu@fffuGtwp fHfHff$t$ɉL$ T$D$p9$qPtIthtRD$<$$ky$XyD$<$D$<$D$<$4UWVS, }U ME9E1GED$ED$ L$T$9$pL$T$ D$D$$Co=E D$D$ED$ ED$T$<$qU+,[^_]Åx$腰=wttH|.uT$L$ D$D$$nUD$T$9$oqD$<$9$3UWVS( E E9‹EE@ pc$!M_T$$s-ER.D$ D$D$4$T ,t&.&.&.&DA@tD$4$6j.t&DJ@utSFNu tDJ@tEpt$|$<$调7$N$<1U+u ([^_]L1UWVSP u} E9ËE1fD$4$螿1ۀ.Ӄu9d9ZF FDFDDžDžDžDžDžB./ML$L$ML$]\$ D$|$4$1#^8=g1ɃVtt^uuE u7ED$D$ED$ED$ D$|$4$u\Ex.]ED$D$ED$ED$ D$|$4$U+P[^_]DžD$ D$|$4$|dfFFDFDDž1ED$D$ED$ED$ D$|$4$=/F D$4$舼ED$D$ED$ED$ D$|$4$cED$D$ED$ED$ D$|$4$tfF7FDFD#Dž1x1@<t 1}|$|$}|$ }|$D$4$D$4$&AFDFD`DžDžD$4$ٺ,fffffUWVSlö u} U(Ft}}, ~wBBU(4$ fF@fU(fN  Jf fBUEt l[^_]ËE, vr U(EEML$D$ E,D$t$E$蔶xƉt$E$EEFD$ $U(fBMЉU(E,) X}|$}|$ D$t$E$,Ɖt$$ pFD$E$^FD$$^FD$$8 U(fB )Ѕ9E)T$ NT$D$9$El[^_]ËE$EE$ML$D$ ED$`K.D$9$fU(E H E, 9(B B U(D$E$dU(BD$E$NU(BD$$KU(BD$E $"E U(t5BEE ϋus3tftuu )fBfBl[^_]Ãu"u fBzE UWVS hM U }E@4E)Ѓ FD$$)GFD$E=s$+VfFE@ uG1T$$F D$$ G fffG )~ [^_]èu2밸9u1 [^_]ÍC$kU *UQ$kU븸UWVSN3 M uU E@}ω}EE‰EPE)9-UB9E9}}|$4$GD$u4$W׋u$ssuXuQ}׉+u9~ED$4$薵+E~[^_]äft9}u1[^_]urpUn$jUM 9}t:D$ ND$D$=9$SgMAyEtflffffffffffffUWVS(f ljUM܋EGkE8u䍃EE썃E.t&< t< tD$ED$4$;D$ED$4$D$ ED$4$)D$ˮD$4$ۢG~Ȯ$h< t< vtu([^_]À>6F$B~d ʈdGtD$$`띍F$~GtD$$}`iD$ ѮD$4$tD$ 5D$4$ܡuEO!F $}~GGD$$_D$)D$4$ytjD$ޮD$4$[uXO@E܉D$ED$X:$_O]L$T$4:$t_zO TD$D$4$t*D$ D$4$Ǡug OD$#D$4$葠u O@D$6D$4$gu OD$D$4$=uZU D$4$虽ƒ?v?T$U؉t$E$tEUƄ4D$D$4$şuZE  D$4$!ƒ?v?T$U؉t$E($sEUƄ(D$ D$4$M D$D$4$(u OmD$*D$4$Kg?UVSTÑ $@it."|xEEE%EEEEND$D$D$ D$ED$t$}tT[^]UVS Et4D$E$EEFEFh!fF [^]Í UWVSxË 9EEtbUD$E$CEf3EfF}<$[YD$t$<$Y|$4$[FUM+ ux[^_]Í IUWVS  }x$ATLJft/1t$TDŽ9Ӄ[^_]UWVSu u4$`t&tuOxu:<$@pdžt$$pdžf[^_]É$pS뼋|E9Eut$MSU Et]Íd]U­ Et(]Í]UWVSu] }4$sfdž1҅~!1u.&{t뀃9uuV [^_]ËMt31sqsqs q M31sqsqs q 뀃9tuUWVS uD9 E1D$4$萫F u uD@@$fD4$U4$fF@@1ƅfDž5B dLdǂ`ǂǂǂǂfǂD$$OiF WWPWPWP ǀip6.ǀarpaƀǀ(ip6.ǀ,intDžDdD$t$<$$ w`D$D$4$jmƇ_WHwDG` \Dž01< t/t 201Ƀt&9c< [< uuDž(_D$p$[8 Dž4DžHT,8D$ D$D$H$x<s<;t<#tH8domaH8searH8name%H8sortH8optigxionsZ< t< GOcD+<< ~< uvfxinJ< t< I(  t t Dw`D$D$4$"kƇ_8D$4$VtDž0]t DF 4DdLʃ Јd8$D$D$ $*Mx8$&s,D$x$x}t<hlp ė ȗ DDx`0DpHH`HD@H@`tg.&<.ǃu~DD$. $hDFHGD$.$hDqPALD@W$t7‹DHDH U+h[^_]Áxservfxer< t< 9 < t< t6D$4$< X1DžX DrDž\DžTD$5ܒD$ D$ D$<$PD$ ,D$|$4$#MPB=9Dt/RωփtftPBj@D<ЉT$L@$dLt׋$ˆL,D$ $PL <4,LTDD|$@$%d<mFV9xDw@ut;u㈕$<,t$$P<$TDLD 44 K}D$ D$4$!D$.4$2cD$D`$24Dǀtǀx|Dž0Dž(|:$tUDxD@DtPD$4$}Mu덃E$;U< tt< uDž0]L$,D$ $}NLtċ4,LTDDDLD<ȅy%%=t'"$1+ 뱸vLDž0)@DDumuT>uvuYLpD$D$;1ɉyffL LsUD$E$]UWVSXö }u h3 l3ė t;D$<$t ė Fȗ FX[^_]Ëȗ 9puttl|E9EtztIND$D$ED$ D$D$t$kBt ė Fȗ F1X[^_]UWVSuU N ~a^1]$9|9t0BꀃN E9~3;E}.u͋]{uӋ] KJKJK J 뼉ȃ[^_]ffffff̀rS[ ? [UWVSd ._D$t$^M@$)VDžDžDžDžDžx@ N L$T$ VT$D$$N^T$$=F 9VωփsUtfth@ lj)#Pq덋ptŋ t|$$=ut G74$͇@9 W ‹Atft‰)@0Dž'Ztftlj)@#tP4$@9r5‹zV$d@ $}[#Džd[^_]‹)ʋ;Wf)f f{\ D$ ND$D$:$蝐$tc0P@~~ 9V)ȋ 9cVʉ)ȉA1҉=tftH<@ lj)99h΃r낋$ib@ $$YŔ@ 4$@9:ƒ{tft‰)‰DžJtftR<lj)944$@9`‹wShf`f% PD$SWuKu2ifM/f릋$_@ XUVSû 08t$+[^]Í_D$t$5E[^]UVSl 08t$n_[^]UT= Ut]UVS; ut$*[^]Í_D$t$D[^]UVS ut$^[^]UWVSâ u}t5W¸t[^_]ËF [^_]ÍD$ OD$D$|:$eUWVS># }uENH NH_D$t$Cƅu!yH L$UT$@$mtEG D$GD$ GD$D$4$Tu4$]G [^_]É4$][^_]ËG [^_]ÍD$ ND$D$:$UUWVS + EC(98 lS.:)lj}싓 u2E D$ $  [^_]Í]t$E$3t$ $3t{ t1= ;txED$D$E3uًED$pD$ED$ D$0;D$$[ [^_]Í:D$ED$ D$;D$$Z [^_]ÍcD$ pOD$D$:$ĈED$SUWVS m ''w} )ƉT$U$Ntn  UT$ $NtG  D 1 [^_]ÿ'y qUWVS(ǘ LJ̗ LJܗ LJؗ z 11ҍLUE W 5 )Ћ ԗ ڍAw ,OD>ЉD>]T>ӉT>lWMHL>@CD>ԗ Cؗ dU։‹ؗ xztؗ =w ;OEtؗ =w ;Oܗ tH~kؗ LJؗ ؗ yU) !ȉؗ UeUv$̗ ܗ ULJܗ  M싗 1ɍO]MEUtwM<9ErMtu艷 Ѓ([^_]LJԗ 5 LJԗ D>ED>ЉD>]]Ӊ\>lW ULV;D> rU=UsD>HL>PD>HL>ԗ HV=Ë ; eLRH P H З HLJؗ ܗ Vܗ MULJ D>UMD>ЉD>]T>lW U]ف9OLRLJܗ 롋З LJ LJ D>ЉD>]T>lWoMUlS.E(9E $UMD$1ۀ} ËE)؉D$ D$;D$$TUMLJԗ D>ELJԗ D>ELJԗ D>ELJԗ D>EqMUD>@E싟 ]X] É %LJ LR l mUUxzؗ Mt ; r tXLR H P H З HVЋ]!LJؗ $:fffffffffffffffffffffUWVS0 EЋ( u䋸0 }9E[u؍LZLXu썰 YuԍZu̍ZEE]]Eft2Ɖx <$L>FtFUD[^_]Í;UVSo < tTD tGUD < B4 B0  8 [^]D < 4D$ $< tD uUWVSL E苰, g0 U8 U荺Z}؍[}LZ}LX Yu܍ZUuE苈( uȉE}uuf[]UVS誷Ï ut,D$4$Hff D$4$H[^]ÍY1D$ d\D$D$5=$^lUVS 8 EpFtD$D$$4F!u  [^]qUWVS϶ô uM5D$ ED$E D$E$yTl>LDžXF\Dž`DždFhDžlDžpF tED$XD$ D$D$F$WaDžH V€ʀ UTL@pD$ D$D$T$OM P!ЃLPoo0<$oT$wo01[^_]À Voxo0<$o  PxD$T$ GP^E E DžTED$D$ D$D$$_Džt HƁ Snn0En01  G G=G G !G GD GD$D$L$/PLPP LЃHtfD$PD$L$1H  D$ $PP D$rm8LlPu  P|D$T$6PD ƒ@ u6 h ffffUWVSA& }EpFtD$D$$/F p\  D$4$uc  t$un  T$U4$DžU9B(E kb1UD$D$4$0tՀN(UV$ED$E D$ T$L$M4$y NjM!@uiF[^_]Ë`[^_]F(F$P9&F(V$uD$D$$7.[^_]fffUWVSI& EpFtD$D$$-FEE 9s  uy\$4$…u\D$\$4$ ED$D$ D$L$M4$ ‹M!@uFЃ[^_]úЃ[^_]ÉUD$D$$-UЃ[^_]ÉiUWVS$ }9EUEEEE;E MmG$~4u݋M…tEL$D$<$G7UUD$ ED$}|$4$9uA}UcE;E s $[^_]Ɉ1$[^_]ø$[^_]ÉT$$)t㉇UWVS(˭ð uE䋆EMM܉;E E苷EHMU$H3ƃUtY9Euȋ})lj}苊U|$$(U}낉֋E})lj}unE;E s\ ([^_]É׋Eu)ƉuD$ E܉D$ED$$a7u@EE9E 1([^_]D$ ED$ED$$%7l([^_]UWVS$A& M9EU E;E sjEE9 .t&9tQuUD$ ED$}|$ $Mp6}9} MUu1$[^_]Åt#UD$MD$<$64MU눁 $[^_]ÉT$$&Mt$[^_]UWVS( EE] ;M sc]]9slE v9t:uU)É]D$ E܉D$L$ME$]G5u?FM9M Uu]1([^_]ËE ([^_]ø([^_]fffUWVS EU EpLB< D ?ZU )ىL$D$$]f}U fz|rrE Xft1ۍLZu.&0f9sfuf09uut^JLB)wqft& F]t&Ff9sf9ufjE1[^_]ÉU MGD$E$]jMU ̉EU ]썋L$ \L$D$$= $]EU QEU ]썋L$ \L$D$$= ${]EU U E]썋qL$ \L$D$bL= $=]U EUWVS  D$T$$tV@D$T$U4$NjUuD$T$$%[^_]D$T$$o%UWVS 肧g }EpFtD$D$$.%Ft:ta [^_]F(t⋆u0 [^_]ËE t9ruF$Pun$ 1UWVSD车â }wFtD$D$$l$F}  8GuD$4$D$ D$D$$%@ F$EEEЉE܋G!D$ MԉM̉L$M܉MȉL$<$Ѕt"ND$ ẺD$EȉD$<$Wu.E؉D$EԉD$$;EtD[^_]ËMN$tD$ D$D$$T?Љ!ƒtL$D$$*u 1D[^_]ÍUED$ MԉM̉L$M܉MȉL$<$Ѕ[EE$D$ ẺD$EȉD$<$W/EԉEE؉ED$EĉD$$[‹E؃9tD$<$]D[^_]UWVSN3 u~GtD$D$$!GD$4$C uUEu@t*$+u*4${^tME[^_]Ë$tE͋D$$E EUWVSgL uM Ut'}8BEt^QLPDu`!@tHx9D$BUD$ $U]C1[^_]Ë]C鍆D$D$ ED$T$4$ul}D$$M UtEdžU|$ $tU#DfffffffffffffUWVS ݡƬ EE,E}1EED$ED$$]ƅ1@ @=fU1)t&.&.&.& 9M rTVÃf;EuUMUfY]][]]}t>}tNM0DF,D$t$$]EDFD$D$ljU]荃qD$ \D$D$bL=$UU]ZE}E9}twu})D$D$$]9utAFD$FD$$]OtVTP‹}u뙋u]RZ}8 [^_]ËEpE )}fG w [^_]fUWVS$葟f uƉЉfMy} ~ϋX9U)ω\$D$M$]BEffEEԉEfueMfyvDTQ9.ED$E$E@EMUEHfEEf;Euf]fD M)Ɖu]U)؉EEt$L$E$]39E U5]f{vDTS9szED$E$E@EMUEHfEEf;9]tED$E$1MUEUԋMf9MsGfED$E D$}G D$|$ ED$ED$E$]uOEEtE@EEEt5@EEESxEE@ =}g}gČ[^_]fEEEE]D$ ]D$D$x=$ <Mt !EEfEE:M]D$ \D$D$Tx=$;MdUWVS$耆e Ɖ׉MBEF =uMQ)ЉEW UfyMȉE苆t$ED$$Eu>E9G ED$E@GD$E$E$[^_]dž(Efuhdž $D$ |$UDBD$4$6B…t EME$EPEwD$ |$UDBD$4$A tʋ@f8 $dž ?UWVS,ۄ uE xEFEEEE@E%TGփBVuM ‹u9sfU܋u9M ELf+M܉ΉT$U؋ED$$:UU)UEftfDuf)tGfLGM yIDGƃ=VuJҋu9sM DG)fET$U܋UT$7$U)UUPMf WfЍL)΁M wdftGuftGfWL$E$E(DEfEfDU܍D$ @]D$D$y=$7M UaM D$ @]D$D$=$7M VuM DOƃ=Fu u䍳@]uDG)fET$UUT$7$%U)UUPMf WfЍL)΁ftGMfLGWMfE HDGƃ=FUtZ‹u9sыu96E9p*JE9pEfDJ,[^_]1,[^_]fE D$E${E tˋxMUED$ E܉D$D$=$5UED$ E܉D$D$=$5D$ @]D$D$=$5ѰD$ @]D$D$e=$h5E@ED$ @]D$D$k=$05D$ @]D$D$b=$4FE!UWVS EE @u E1OftsDPND$ t$D$E$]D<ƅt|$E$FX}ufYf|Pu E덋] []1] CEfE@ =T)Ӊ]ыM]f\QMfDQE Ht$E$]t9t|$E$Eh81[^_]DPfCfCFW[^_]ÍD)‰UwMUfTAa]썃D$ 0]D$D$=$(3E@ M]f\Q=맃1fM1UWVS}ò U EzMq uf+4GMM9U t$ED$DM$u)uD$ U T$MDD$E$9…t|xEp uf+w;udLf|Go‹E9u-t$ED$WU$lUu Ѓ[^_]úЃ[^_]úЃ[^_]úUWVS|| Eu} 'D$ D$DJD$4$]#9tDPfzuft,ˍ< fED$ ED$GD$4$\u=}} t5 D$E D$ |$D$4$([^_]É~$F(~$E 8EE 8~9럋$UpEZUUT$L$$H#T$ $<GE$V]]fff]߉D$ \D$D$\$4$ US oy }xsn]f$ZUPKFAfff]2].t&%].&fffUVSxn]y EEEEjuVj uǃ d9tj'jj%jVj\j'j>'UWVSEE] }3t>u}j/VAmZYtp A&t0MPVZYMu}] EEAe[^_]Vh"hU"hJ.<}UWVS]u 6Q_h"VS tfu7$T.ۋ=pC.)u}$T.u%h"@Zt$T.$T.""hjP] T. @u5$T.hǔ"j)h*Xu4'hД"j)MUW6ZYMtUBk D&u6h"jh)VKSWD&P)UWVS] 3Fhd#jChd#Su@t h"pC.DP轈DU.ZuDU.i$1HU.TU.F&5TU.F&jjPNHU. y 5DU. U.蠋 U.Ί=0-v@U.u h"j(U.u#U.U."U.F&U.F&hT.HthRPU. yQU.PhT.HthP5U.ңU. U. y5U.h$j'T.蹊T.hT.u/T.u8U.HTã U.ujT.D5`T.8U.91>Ph"hJ.jU.U.=U.t t7h"Bt U.t+h",t=U.thG"U.pC.jWU.ZYu hn"|;R=U.u6=U.u-=U.t$=U.jW[^11ɉ=U.u >=U.t =CGi ȉ=U. uh".XZQURPW. x%uSh" ,URPW ySh$jmPhģ"jjUWVShu E1E1ۃ}~F8-tEhԤ")_th"PZYu 8[.h"j)_th"PZYu h"]Xjh"h"XE"EP蚵uh"\0考E_t<1ɉMMMMMMBh "de" 7Mt&t"Qu+ZYth+"jEhQ"WE)PYE @}w}c}6t^%}4E뷋Edwy$L&}8tEKv_7Eh'"57MEXZnEbEVpC.pC.}uCpC.Eu84>tj@uY[t}u U9sUPUxtă}uEE1ۋtPZ\tSpXzEt'U)RPSSÃ~t C}u"h'"h19%*GEZYu ha"K}uEEuh4[.WuuEpEPN.u- yj=4[.y h|"}tLjuVjhS=Ry h"*'XjVjh54[.Ry h"'Xh'"FjuVjpSQjVjw54[.Q,u 1ɉM̉MЉMԉM_18M&H>v   DGu΍EPEPj藲 =8[.t}t.D1}tEjEP48M& Gu褡Ey hQ#j Vh~f54[.Vh~fSUSMEF}u j u`XZjkUE 0莜EjRZUVSEU tUJ @p.uc1E1ۋ4HO&VhA#޺uUaJ.HJ.Y^yhJ.j XZJ.PJ. Cu Ma1e[^]ÍL$qUWVSQpq1t.x.....p...l.DžDžDž1h<"V @I&/0$`O&S'$O&1=---r-cl.jP57 :uy57h"/-p. \....|..14݄P&4݀P&h"蚸C uD.v.kx.=7j/WsY[ÅtC?t td@tj/S2_ZDžtG;ttOd@tqtj/WZYtA?t(t d@t.t9h"Ot.Ph`.hd.hh.h"57Bu7<t h"j =h.h.Ph.Ph.h"57JB~!7<u..9sh"뉅.=7j/WY[t4PWs_Zu!%=@u7-Y79rt..6--7.57n-[=~ PPh$"jM pC.)ˋ.=.t . . . x.tcb=p.t t$h\"4t=.t=x.uh"=x.t=-uh"vbKu -n=\.DžtDžxjjVjjtS@t,YtjjVPjS@t=-=\.u4P5-r_Zu%=u \.p. . .1 .t1=.-=\.uRjhhp.PRI-y'D8uhp.h"B>hp.h"--p.-jPR- u5-h#[^ =\.tRPZY@u5-h"E̋UЉ1ۅuthRP5-h "蝙M̋]Љȉډ%1 .1\...... .nh.hrdAPn @uX5-h?"h.hedA5-C@u-5-hQ"{^_5-萫-[ .1ۉ .ĕ.=.=Е..ȕ..- .̕.?w=...!ȉډ[ ...tJthVP- @u=5.h$5-跪- --j-~S踾t.Yu Sh`"j5.11k_t n.1q.ĕ..kqt.t#h..d..`..DžDžjjVjjSdt.Zu hN"j`jjVPjSy5t. 1t.X-j/SzF^_ޅtptZYt(Ãw#EP< } wt= t0u #u u#PSh#hJ. (<1󫉕<Ĝ~j2~'CDž~r<7'C1rC1Dž~"Cr 7%}Cr<7&CrxC,r mC1%r0B`57LT~CX1pC.;E}?M ~ R.DJt#@pC. ~$F(~uF1(~C1 CDž}r<7&Cr<<7%Crc8.<._u u虮+EU@.D.y hyQ#j}Fh#PgY[u~tO.t5PBZ)ǃv%.t CRU6S@cUӃ f @.h@J..)PSD[ t!;t .sC.uf. h.´[.=D.u =@.th8.#PhQ#9t hQ#{Y.uP|jZ|$t.jjj = .u6YuhQ#jitPhQ#sji-j jh!"蝐 ,;@.D.| 5@. D.9Ȼ@r&} VG9ƉS}M)Mt1jjs s^cM9ȃM} tuXSau,;C| Is貎^{u;tQ#=(.u!!"=,.t Q#=.tP#h.5.ShQ#jjShQ#@z=$.thR#*zj蘭=0.t3hhh*R# jƃ xjh4R#PwhVjShLR#jQh@.p.hlR#yjDh@.l~j赍 hR#y[=(.u=,. Q#Q# Q#P#EE=.t ER#E= .t R#=.t R#=.t "=.t 83$=.t 3$7$ .PtPH1ɉ hP#jEPSsi0ShR#jI0ShR#k$ jjhXZjUWVS@u} E@hS#WVG tTHth wT$s&ЁȀπÀ57誔-X뫡7|-1ɉM똋pC.)HtD4jVh"豱 tVh"h%j h`.n`.jVgXZy Vh$jY ]1uȉuԉufE5-]SdtSjWyhS#^jhyt Wԟ yy8th%S#95|-hCt W諟 yh.S#}tjj~Y[t h9S#j1҉UUUUčEPeXUWVS8]u 1E6[PXh\#VS袠 x`At$Mt.ăa$s&.|.x.Л-rz#덡7X.!p.vl.kh.`d.U`.JpC.)Ӄ=`.t=h.t٬. =|.t =l.uu t. x..#=X.u |.U1T.P.hzXUu h\#j*=|.tEčURWjj11e1X.tjhpQ#Pjq[Xu5X.h$j1ɉ \.jjh\.jVÃt;tMSfZVwX"4~MFK1=L.؛-J.e[^_]UWVSE p.EX1=.h`#0KPwKZYu .hՐ"P迮ZYu .jڔ.D6L 谌$Jq5.ZhhՐ"P`u 7/%`#=7/t{#P|J_tPX~5+u!zt~Kh&WZYt Wut Fh`#J._t8u%h`#I.P>JZYt .Q$h`#I.PJY_t .`#1=.tjha#p_Z~PvmpjoK =.u&jNXYuWPj*Xj=.t7/ .ujha#JXZ jj^_=p6/uh#5-躬Y[uZo~jhIa#j5p6/ Ztj..Bu@t㡤7/.6}Wu΃=7/t$boH~ 17/=7/u Un.=l8/~jhma#Bj j!p+j UWVS]u 6JL/L/L/5L/߸hݗ#P蚫 uL/VSO%[^~0j蜑Y1uh#j9~!vu0K/h#VS蓚 u%/~k |Љ=K/vh#NXZšpC.)KutmR.DPu^S_=vhhȘ#hShJ/ ;tCK/J/5K/h#j ]SfhFjZhFjNhFjBhFj6 S(^u hĖ#jD@uhӖ#jhJ.Yh# u -K/=h2#3[=K/t"5\-K2Yt5\-h#jغ t Ph #j=K/u5\- 2Zu€=K/t8jj5L/_ y h#3Pj5L/r_ xh`M/jM/`M/ 󥾠M/%M/%M/%M/fM/ M/ fM/M/.hL/hL/hL/hUj说#=L/t|#Ph$ZfcLL/^_L?f=\-t j [-ÈE8-ut1ÈE͋L/u t{8,-u1f=--< t< u=jEP5L/ 1 f=-yd#} uR#P^m]tu8-u 8-ÈE5-P.ZYf=-tCۡR.t R.fEjEP5L/x0 f=-EP%dX3h#jtUWVS E 07F P/W10P/P/hL#^_t K#,ALQ/T#hj#{[tTLQ/MBug78tpjRPB :uS1ҋ P/buV4Q/8Q/ P/h#u uĕà uC$ &57h#@Q/DQ/먃 P/륃 P/뜃 P/듺#7=@낃 P/v7u)h#hĻ&h0W P/h#STgZYÀ;+h#S\^_ƿ&t&VRS! u <2t&h %SZYSPh#I  P/ G P/O3u<=fRhΝ# <=tRh#H_X\3h %SY^Ɖtt t.iSZS&^h /#HjPS?‹ 3 9r(<,tuxG P/QRh#SV7h>#G<57uh]#h&hKhӜ#n1k$Q/t!VPZYuÀQ/(P/kGhl#Vho#GjW7h#h&hq둃 P/'=pC.u) P/ u}=~=$P/u,P9Y@u h#jwŞ#y= P/$P/Z!Ãt~&t%Ft!á$P/0Rh͞#F  s$P/0h#FXZ s$P/0h#xF_Xt Sh/#cF[^jҀ uh\#tth#7FjQVE uCvBeR0G.f"$l&H $&a$V/V/(V/G0V/1$V/,V/a,V/1$V/ V/?$V/1,V/10V/"(V/ V/1V/V/1= V/V/V/V/ V/pC.)ӃQ(V/=V/t*th#0V/ ,V/ $V/tih#jDt:Dž|=0V/u Dž|=,V/t=||)Dž|=$V/tDž| Dž|44V/jiV/P^Cx<hSh-蠰=v Sh`#h-聐Y--X/u!-= -vx/uP-@ߣ-1hjXZ=$V/t Ph- Ph- ZY@u覠8t%E%=@tkxtHZxM=V/P6 Y_@%=@t&/h-hr#j~Džx0Džx=(V/u1=V/x/lt$P4ZPvЀ8/uj|V{t 1pluv6h$j lQh- ^Zh-ċCHfuFs kPshU#C4lDžpltZu)wfush#3Y[ftf tx)-C,--=~TSh-h#3 o{DsC(huTxtClj/VRYZlt)xlhS#>P譏YZlhl>h)8/t z/t/Bс-vPh-hdz#3 VPRll- -= -vx/uP-@ߋl=$V/xt Ph-U Ph- ^ZSP@xJ9|uD;u@EJ9Mu5;B u0sh-h#H2CP@% =@B%=@t,M1@ush-h#1Jl΁@w `||t {DPSfJZY+= V/(h-sh1"7K sH (V/ V/u&fNushB#1Y^jStāfuV58V/V8V/@V/Mhb#h&h6kE%=@V褛Bfuk=V/u%8V/H8V/@V/y/h#hܾ&h?jR`BZY+hu#CPph-nF^Xsh#-0Y[=(V/t'PRJ=(V/tPRIPS>C{Ӛ8t hѲ#jLtyp?1x=(V/t,V/ 0V/(P6K#x:DžxxUWVS|]u >j/W!YZtxh6&W荋_Zu^hd#VSz @uipC.)Ãu]p0CZY@u jjyje;LtEPtIFu'|f0h5#VSuz w~ZIfw$&1pf0pf0f01tf0df0xf0tf01f0lf0thf0edf0VpC.4)Ã=lf0t`f0-=|f0t,`f0=1=|f0=tf0uf01ɉ df0ttX%V1ɋuHP|=xf0xt)SWRYZuE%=u iSWXZt Wh$jϚE%=@9tG ÃSF=XUWVSu 6[(hd#jX`jЉÁt1hht%Vusx tVmtDžhptc57y+Xu57h#jhW)tW[ 딡pC.E%=@t d"st/$tS~A^Z@uStSZYy7h$趯[^DžlOt?t7*AZY@)l;UWVSu] 3&hd#j^ h#SVXv tUit)ft5huT8g0σvuC0g018/tj/W)ZYtPRd蒃Y dv1Wh#()XZDžplt5>WVZD@PRha1%i p p8UWVS@] 3$01J.Su]Sj]0uEUEUSj^_Sj80ZYuEUEUSj^_Sj0ZYuEUEUSjʦ_XSj/Y^uEUEUSj覦XZhV#H1411=81=<1=@141P]1E؍}ȹEľ uVSj譑xVSj蝑 x"}ujVj脑 y}tVSji xjVjV y}tVSj; xjVj( y{}tVSj xjVj yP}tEVSj ސ y1jVjː yVSj蹐 xy y蠑h^#0j ^=-tUjhX%T8-[^y eh~#0jX1 #=-u=x-t 蹊@h#!Yt8u`"VjZÅt @|/tCPL,1_uh#jgX1ZYtlj؍P(1/hHg0th) j؍- t! ttBGuB̓@蹌9=Pg0t h#jɑ=-u-Tފt X1X1e[^_]UWVS]u 6i hd#jfX 1h$VSp tLtPt9pC.th`#讨_8/u|h#Pc Y^ukh#SR _ZuZPSY^@tHxPhX%_Z@t2|9u;xuM9 u;EtjjY^uj SEhJ.\XZJ.@t h"jqj4UWVS}] 3*hd#j'W 1h]#SWao ft]/WPtwR)dD1벃vtbit6rtxu{$1<1181p1<181Z41K,1<(1-pC.9=<1zu8Quthg#3"Xt@1؋Ht ʉA?jud01[<1 81u t1=(1t =$1t@jPWhǃ uh#C =<1t.u)WlXCHHf $P&PDs XPshU#j荎=<1tC ƒ?uts WPshU#!@1k=<1^KPSC+HjSW{qC 1ɉK +{uD{ u>=<1tCHSft\wlfucKPSC usZ=<1u&sh$ɤ@1Y[R38X=41usZuKC1tl=<1tЊ8UŠ8?G贊8r4,1  1#1 1s^AX{8t hѲ#jWi[\xVS ¡(1YYu3t>jUPShU#?@1_uEE%=@u"=D1uSh#@1Y[뱃=<1u=uE%=uS+22ډ uv=@uS(=41u SgZtX/ t?=<1uSh$gA838? %8u=,1S?X5@1*.1e[^_]UVS@jj^X1EĉEȉEEjEPjz. 2;E9u 9EE`1j j/Y[h1H h1j d1$d#jPZYh#FV-1ۉ]$h1 ^Z41tt3Hu:P1.1111E 1P141t.U=-v=1i`B=41tEPX101,1tA:-HyP{!X-H J h-!X .EHm811)11|Ag)EP׽Xu uBXZu u-Y[}um=-t,Eh#^E=`1u PEuE=-u}rEj螹^=-'7=`1u,hh#Q/[u&jh#Pj艿ÃP\$ѼY|=V-uL=`1uCEP$)#.Zu EPdX8tEP=$XE"11ۀ=n-t$=1uEP購X1n-u'j4&^XC̈́RPK5ZY=n-=14-"15P1h7VS7E9jh$Vs uVSLREZYVh$:cE E}tSjuг y hS#j,}t Whgtua y h$Xj'UWVSu 6hd#jJ8$1 xo<$111ɉhdtlp11ۉ`jh-h$Vu Y`Rtf(LtntMH1һ뮃PthtPdtXfuuDžl뇃vudDžds=7hDžpYMDžt@Džh1pC.M)tIu uapt$t*tt h$jd t)ˍ4D$1@$1>=<$1tzj:WDYZt@0j.WYZ`t!hD$1W_Z@`u Ba>t0<#uA%#aD$1hD$1WZY@u ۉea8xPWZY@u Wh#j諂=<$1tED$1E@$1jSVp[ǃ tl`1hȲ#>pu jSWe W4`X CHHf wg$&s ZKPshU#Džl=s 0KPshU#qttDžl` DžlD$1ht)KPt9Qu@$1t;Au A<5@$1RslЃ t"`tsh$nY[ds5Z~8t hѲ#jV#UWVSu LfH1H1 H1 ʈH1H1H1 ʈH1H1H1%d$1fH1H1hL#[t`h&$Y&t7GtPS(oYZu Q`ShT$Whe$j1h$VuG^ A6$`&H13h$1H1H1 H1H1ˋ=7h\#WjnYZuhs$WRnYZ<t_댡7_j j57 ǃ u|8"u 57hv$D=H1Ej j57U ǃ t =H1!m|8"u57h$j~j j57 ǃ u8|8"t=d$157h$뺸l57}Z@_PH1H11H1yH1jH1_t9t a d$1v jh$uh$ H1tt h3$j}`$1H1ǃ;=H1u/;H1u"H1;H1uH19rt1= -H1H1  -=H1tuPu=H1tpC.U)…4=H1tt  1LjhhD1PQ:+PLy hD1v=H1uJLxPPQZYLu&%=uH1H1w($<&J$H1PiJPuh#艒^u`"hE$Ph%hS'SmǃuSh$Y[hF_$PBXZthW#hD1hH1V视5h$1hH1V ViFX1\`dDžXhVXPj Džy0x8#tjVjchQ#7jlC_jVj7PL!Ph`#WƃuH$SVh4%TP.Tu h "jjPh_n#h5%h5%xÃuV@YSxTPZ9ujVjTH hpQ#V*LY_uVh$/XZH1e׋H󫋅LhLDXtP5tDžu V2[ghR$6&hJ.DDJ.HDJ.ZYyh@J. FX@J.P@J.0t- t( DJ.y h@J.E_@J.P@J.΃߃NP蛪^ JPr=lI1u lI1 =pI1u pI1 PhH1Y[JH1H1P0r=H1X=H1t H1t],hD1hH1hJ.蘃5h$1hH1hJ.܇hH1_Zxd-hpQ#v([_uvh$jLUf1JPhmdP$q h&$jw^~WxYu Wh ${H1eȺH1t jSR9 hH1^ZIPqWUWVSjj]Sjjh&=@u h$j)wu0YtjjSPjh&j=@t͋EE11һ9}~T >tItt9Ӆu5U1ۃ jj@QMQLVj:V6[Zuh $SHJ1t)XV3 dZYXu C[ӉJ1=J1t h?"jt7tuhd"1Ҁnuxou-h %P^_td#J1~֋=7u pK1id#7J1POjph@&Ph$hJ.Y$j^]tK1]pK1t pK1t xK1pC.M Tu)tP1ۉXhU hcT 5xK1P芏XRrRh#RLqbZYTLS蛌jjLRPV9X}XTPT0VhP#à uj/SpZYuSh"h%hS$V'ZXu"VAYXu9S,Y^ty2LhVà LVh$juh"LRUaZYh$LR:aZYShP$jjhVjS ǃu Vhq$jrhJ1hzd@PN uW/XPK1`PhedAWN @uVh$WV^H__9~Vh$( jh]Y[1ۃ}=R1uP5PEXZ PEX}u6hk($5YXE tKEPjW6'y6h{($輄XZ6EuB5UY9ËM}QZU܉9}u2/MXDT1t؍e[^_]ÍL$qUWVSQ`AT1l0iL΋HƉ1ۉDd 7tPSSZY@tEUX\f1ɉjpPS[X\p 9u>f1҉jjSX\ \]XP8uof8u:`f8,ShW$$8pC.`9)ЃPu#@pC.TP`9PpC.T`&@HtPS,WZY@u֋Hxu Sh-W$Shp\1Q?h@-h`\1>h-hh\1> h`\1>hh\1>XZUh-&?XUh -hx\1m>hx\1>h h\1p>h\1>UWVS$1t1󫍽p-tT1k8]1u;JDž]1AuRh- _^@uhq$h`-^[@u hr$jdhx-^YP-@uhr$ޅtsh-_XZ\1\1\1}t x-1 -ƅh-u uBǃ z=`Ntu&At/CG$`'Wh2r$_Mb1Lb1wKb1k\1-Z\1NJb1Ib16\1*Hb1Pjhjjj j57;Db1 6Pjhjjj j57l;@b1 57hJ&o\1D9u:ƀ\1z{k Lmm _$'-L-B-6-*`- -ƅ--=pC.=\1uu =Hb1t_;jm<^+=\1=\1=\1uu =Hb1tjL;Y\1t Hb1t t Dž PPtVSE PE)PcZtϵDžuh,'hRm$PV[ @u hCr$_t*HkttWPA*XZuh,'hPr$GSIHSr,YXuV _Z@u h,'h]g$S{*Yuh,'hLh$j`V:Zuh,'hlr$j|`@ uhr$h,'h*WSй%1󫍅Phr$SBuhmp$S賷_XuzkhV%S螷ZYuh!&h'hqPƍH_v󤍅PhiS` @uhr$vYSI-j|VkZ thr$h'hihHk$VVnƹ󥍅Phui S`@uhr$Ujm8Zt h@'j\_hU) hPb18hPb1s8 Uh-hdb17hdb18h> htb17h> hlb17htb18 hlb18XUh`-hb17hb17h{H hb17hF hb17hb17 hb17XUh`-hb1+7h-hb17hb1J7hb1@7hCN hb17 hH hb16h-N hb17hb1<7hb17hb1C7UVS8ny h$uYhД%h;Zy h$tXjh$Ar[^]Au[jjqh)$q u=jh$qXY$u$jh$h.$Ph"h5%j 7jSP7 @t-Et Ph2$Dt^Xjh$qZYtj ;YhI$tj *Y -Pb jj hBa i{jjjj j jjjha O{0jjjjh` :{jjh` ,{EEEE jjjjjjjj j j jjjuV8jVj1EEEEEEjSjXjSjX$j`jYjREE EjjEPEPjEPS"ƒ$BuUY8b1 -te[^]UWVS]} DžhDžT1ɉL11PXDžDe h$WS9 ubfFt/RODžPg7$t'57 DZu57hl$Xu78#t570Yu[ j dR@Pv d:uh$WF?ZYu%Fx\u vh$WhP)ƒ NFjjLWv XPvy j\P*^_1u?h;$jOi T\P訂ZYu \F9|1hSWN\j/WƑtPRT.$)19}89މ}P uh$j@Xi1 di1=i1t ؙi1ti1~o5i1i19и})?9и}9и}i1i19ji1~lt i1i1i1MtIi1=~!i1=~1hPh֒$; hPh$& =di1uÃ=i1u=i1i1=i1u i1i1=H-,=i1t#jh$h7$h_$i1=i1ui1=L-i1跰t(9uXXu݃=i1(0Vp_Xtۍth$j ʯPhj$jdWb'Oj`jYjRh%hRxi1i1i1 jxlPi1@PVh$+P@g=;0Shj$jdWj襯0PV y Vhф$jX=WPO,ZYu1jZVPz+ uh$P",ZYjPS" u h#j Z9iu R5PVhq$j=j1uj1u hZ$j[7tX uuh@j1hq$u.h%P&^_@j1th"Wh.'j6@j1t(j11RP5j15j1j1j1j15j119|z<@u t#j11RPJ؉ j1j119| h$t0 j1j19sSQWRPh$j5tOtF j1 j1j1%j1RPl @u5j15j1Wh$j5*0P)Y[@uWh$LXZ $19Ћ}N9}PV u h$j4)VWZ j15j1j1j1j1u_t j1Z@19} j1 19| j1=j1j1t1RPj1iދ1SQRPX@19}! 19} j1Wr9ttVRXj j1 j1 L$qUWVSQ\yDžxƅwjjj[lx3 yhi$Cjjj=hx3 xjPZY@u h~$IXtBPNC^@u h$ji27;Y1ۉd`1h$W\f [C4$ 2'|x3̀"j|P578N |:u 57h$zv2뉁 |x3z xx3n |x3bpC.pU|P57 v2XZ|8u r57h$j.1N&PP$h٦$j1j|P57dM |:uy 57h$릣v2 |x3 |x3|x3t h$@|x37px3j|x3@u |x3 |x3A xx35j|P57Là |8uy57h2$hN$j0 |x3 |x3 |x3@j|P578d |8ud57hg$`j|P57K |:u Pv57hy$#w. |x3jj8x37# |x3 jjHx37$BYX|P57蛧Xv2XZ|8u57h$|x3Dž`|x3v2zutN&v2t>t hӧ$Ov2vj>t h$1=v2~N>t h$ٽrfr fpv2٭p߽h٭rhlxv2|v2PT߭P蔏tj Ph$j}tVSohQ#j}Džu&Ps_|$t8=3tj jh Q#Wh9$=3t j jhP#WhF$j8j jhQ# tVWhX$jWhk$j hd#h!"hz$jjhd#h!"hz$ }u]jjljjcjjZjjQ jjEjj <jj@u h|$jtjjZY@u8th$=jX}u׷j_j jZY@u8t+h$&,Y2 u h$艧Z WOXVS蠻hܯ$+ O0 jj\ƒ d#Bu$SPh%j|UWVSDu]  '3h8'SV v~jm cStITtbLu܃3뼃dw$\4'3؃3ԃ3̃3z3kȃ3\Ѓ3Mă3>pC.)ƍ;3=Ѓ3tjjhx%3 >Ejjj"3jURh@hPxU @u hT%f*Y=3y h&j=;u=3! . WZ) '    ms / =3t1ɉڸb1ɉMhjE؉Ehj E܉EhjEȉEhjEĉE hjEEhjljEhjEMU ʃ} ʃ} у} хuu ha#E1҉38gtj53_X1ɉMEd#Ed#FEȅCEċS:-%BRU[X}t(u2=3uEpKPhq$ u j $YPh\\#XZu6u.u&uuuu1>܃3 ؃3 ȃ3 ă3PSV 11ɉډe[^_]We[^_]UWVS }hM$PZYƅh"u W t.at"t=T37T3þ뼡pC.)Džt>upT3t&h,D$S,^_tho$SZYt2=T3u)U @3xujOuShT$hJ.Shq$hJ.j~=d3u.d3h$u W t@A3w$P9'z=d3ud3먃=d3ud3듃=d3ud3{=d3ud3c=d3zd3 GL38`3)\3`3 =d3"d3@`3D3H3X357@@3X=d3d3=d3d3j=T37T3h!%PY^>P3/=d3Fd35d3)pC.EU)tHt:t#u =X3=L3t =H3=T3tEt h,D$WYZt&ho$WYZth!%W_ZE U @7@tCƀ5\3jj5X35`35@3e5\3jj5X35`35@3>5@3Sj ISh$j&@3J=P3jEPjt @u h$EUuuh$[h`RPhʻ$t SֶYE  1SQ%1RPhڻ$ήf1=P3tTph%V_Zt)h$VZYtuSh$yj Sh$jj蓤j茤UWVS u] 1h$SV tRtfu23ֿϡpC.9td1ۉ`XVS:XZYVxPVkZY%=`h=@uvzu^Ph$舓[^Dž`ddPhS FSh$j0hٺuٺÅjhh$hV芫l=3u Džp$lPV~ZY8t Vh"$/^X53SZY@Sh$ `e[^_]UWVSdڕhd#jXZE 0藍1ɉ ̫3E4o%E4,o%1ۉE4$$^u $E4W4W4W4W4W4W41ɉ `X4 X4 W431ۉE4E4X4X4X4150N4,N41=(N4$N4N4N41N4 N4Ы3E43h $Xt/hSh3^ =vj?$Sh&$9/\3h#ZN4u N4`"h6$_h$P>Y^u W4h%S!_Zu15W41ۉW4Qh$SZYu W44h!%S^_uW4W4 Sh>$&Y[hd$P__ZuW415W4h$S:Y[u W4hi$ZW4t8u W4d#=W4tW48uhs$蝏X1W4h%x_th#P[^1ۅfNJ.ftPYdX4X4J.fJ.ftPZt!`X4u譢t X4BN4111Bh57h3% =v#j?x$57hU#jE4U Ehb$RP> HP̃D1$P:'E41=W4=W4Y^h'j0_Xh j"XZh jY^h0 j_XEt7U ESRPXà ̫3uSjjš_Xj XE j:0讶[^t*E 0oYuU ERPeWXZGjh X4w^_uhhj]^_hj OXZE 8j@WAY[ƅt @hPSX E @1ۉW4t1ɉ ~Sh j\k@uh\'h%XZ@uh\'hW%cDkt$u/3)JPhb%m hQ#̽Sh+h%Ifh(\,}Sh j\谱@h\'h%^^Xh@SM,[tPh\'h%/ $Y[u64h%-[^$P$9x uً4h%‹t x td@Ah uh'%V衹0P谓d%1҃ uuhA%芺Yt{ tjjM U&XZ[ލV0SVSr1d%@1҃utSXt"{ tȋS X[ڋdh@1ۅ1ۅut% t$y tIヽuc11ۅut@1ۅu2u. uhh%R0P 0t,%@1҅ut0PhVjݰW0P 8[^ tWhjj蠰Ջd%@1҅uu ha%+[u u0Py yh%׷dhÁ@1Ydh0Phjj@+0PhIj  @P薳$ZYy1h\'h%蜷[^j1ɉ$ 1Dž$d%1҅ҍ0uuSwZ@uh\'h%FY^PS腻XZt;t HptqrP PoXR胓1ɉ^WSI _ZtP{^UJSc9S轸SO;@2.tP[hӃ@tRt \tBh%h@Yu&j$RPs @uh\'h%(XZݱ}l蔒hJ.͛$ht(P1h\'h%&h\'h%e[^_]ÍL$qUWVSQ,Y1PI51󫺬I5108@<4h%S," H0"$p{'j7%j757fI51Ɋtrat<GtD AtBCt.@Lt,Slt" ctgt#su,'" @fI5F누0fI5%1ɉLj LP57LYƉPq 8u!78tL8u ;Ph%kj LP577 ~:t L9t Rh%4J5 j7@sith%%j. j7jhJ.F1|6.6.6.XZ#7@ j7j LP5756.7 :t L9t RhE%j@=RhY%7< j7 8LP57F7_X:tL8t Rv)ݝ B݅ t,jsPh%N&v Rh%EٽFfF fD٭D߽ ٭F $5|6.=6.߭ ..., where is one of: %s: %s not compiled in chiodkctlfdiskmbrlabelmount_ext2fsmount_lfsmount_ntfsnewfs_lfsraidctlrrestorescsictlslattachmoreinstallbootwiconfigchmodlnmkdirmvpax-shchownchgrpdmesgifconfigmknodmount_cd9660mount_msdosmount_tmpfsnewfsmount_mfsswapctlgzcatgunzipchrootping6usage: %s [-f changer] command arg1 arg2 [arg3 [...]] Where command (and args) are: %s%s %s: no arguments expected%s: CHIOGPARAMS%s: %d slot%s, %d drive%s, %d picker%s, %d portal%s %s: current picker: %d %s: CHIOIELEMinvalid unit number `%s'%s: too few arguments%s: too many arguments%s: CHIOSPICKER%s: CDIOCLOADUNLOADinvalid modifier `%s'invalid element type `%s'%s: inappropriate modifier `%s'%s: CHIOPOSITION%s: CHIOEXCHANGE%s: CHIOMOVE%s: CHIOGPICKERINEABEXENABACCESSEXCEPTIMPEXPFULL%s: malformed command line%s: inappropriate special word: %s%s: no %s elements %s: invalid unit/count %d/%dcan't allocate status storage%s: CHIOGSTATUS%s %d: status not available Primary volume tag: %s ver. %d Alternate volume tag: %s ver. %d From: %s %d Vendor-specific data size: %lu /dev/ch0f:CHANGER%s: opencan't register cleanup functionunknown command: %sunloadinvinv1inv2voltags [inv] [ ] [inv1] [inv2]paramsgetpickersetpicker [ [unit [count]]] [voltags]ielemcdlu load|unload abortslotportaloflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksblock countconversion record sizeoutput block sizeinput block sizefile countunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input1024-blocks1K-blocksNAME=%s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 512-blocks1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %*s %*s %*s %%CapiAvailiUsed %*s %*s %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %*lld %*lld %*lld %3s%% %*jd %*jd %4s%%Can't get mount informationonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-aclMnqW] [-G|-bkP|-bfgHhikmN] [-t type] [file | file_system]... abcfGgHhiklMmNnPqt:Wonly one of -f -G and -P may be specifiedonly one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs array%s is not a mount pointWarning: %s is not a local %sWarning: %s mounted as a %s %scannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp filedes_cipherbad hex digit in keybad binary digit in keydecryption failed (block corrupted)decryption failed (incomplete block)cannot read fileEnter key: des_setkeyunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input filecannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutionp:sxES ? interruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-f device] command [count] %s=%o%s=%x/dev/nrst0f:t:%s: Ambiguous command `%s' or `%s'?%s: unknown command%s: illegal count%d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) current file number: %d current block number: %d %s: block location %u internal error: unknown request %ldWriteProtectMounted76543210asfbsfbsreomfsffsrofflinerdhposrdsposretensionrewindrewofflsetblksetdensitysethpossetsposweofeewnocache [-u locuser]usage: %s [-46dn] [-l login] [-p port]%s [login@]host command pollRCMD_RELAY_SIGNALYESRCMD_LOOPrcmd appears to be looping!unknown user idmalloctcponly super user can use the -u option468KLdel:np:u:wshell/tcp: unknown servicecan't establish stderrsetsockopt remotesetsockopt stderrport must be between 1 and %dbytes read: %lldbytes written: %lldsegments cleaned: %llderror segments: %lldutilization total: %gutilization sos: %gutilization avg: %4.2futilization sdev: %9.6f%s: detaching cleanercouldn't malloc device name string: %mcouldn't convert '%s' to raw name: %mcouldn't open device %s for reading: %mcouldn't malloc superblock buffer%s: not LFS%s: not a version 2 LFS%s: couldn't malloc segment table: %m%s: attaching cleaner%s: resized buffer hash from %d to %d%s: ientry failed for ino %dwriting segment to copy log%s: sumsum magic number bad at 0x%jx: read 0x%x, expected 0x%x%s: sumsum checksum mismatch at 0x%jx: read 0x%x, computed 0x%x%s: bad pseg at %jx (seg %d)zero-length FINFO at %jx (seg %d)%s: data checksum bad at 0x%jx: read 0x%x, computed 0x%xsegment %d: bad seguse count %d%s: bmapv returned %d (%m)%s: inval seg %d%s: markv returned %d (%m) for seg %d%s: inval returned %d (%m) for seg %dusage: lfs_cleanerd [-bcdfmqsJ] [-i segnum] [-l load] [-n nsegs] [-r report_freq] [-t timeout] fs_name ...bC:cdDfi:J:l:mn:qr:sS:t:lfs_cleanerd: may only specify one filesystem when using -i flaglfs_cleanerd: -c disabled due to reports of file corruption; you may re-enable it by rebuilding the cleanerlfs_cleanerd: couldn't become a daemon!lfs_cleanerd:m:%smalloc failed: %mcouldn't allocate fs table: %m%s: couldn't init: error code %d%s: can't read inode%s: filesystem unmounted%s: nsegs changed%s: bfree = %d, avail = %d, clean = %d/%d%s: failed to stat ifile%s: failed to get load avg%s: needs_cleaning returned %d%s: no segment cleanable%s: cleaning with goal %lld bytes (%d segs clean, %d cleanable)%s: add seg %d prio %llu containing %ld bytes%s: cleaning with goal %d segments (%d clean, %d cleanable)%s: add seg %d prio %llu%s: no blocks to clean in %d cleanable segmentssending blocks %d-%d%s: markv returned %d (errno %d, %m)%s: errno %d, returning%s: wrote %lld dirty + %lld supporting indirect + %lld supporting Ifile = %lld bytes to clean %d segs (%lld%% recovery)%s: cleaner not making forward progress%s: clean_fs returned %d%s: shutdownnfss == 0/usr/src/libexec/lfs_cleanerd/lfs_cleanerd.cLFCNSEGWAITALLincreasing number of segment buffers to %dfailed resizing table to %d failed to allocate buffer #%d preload to segment buffer %dpwriteino %ju, computed blocks %jd > held blocks %juino %ju, %jd blocks: array too large ino %llu, %jd blocks: %s %s: coalesce: LFCNBMAPV: Too large %s: coalesce: LFCNBMAPV: %mino %llu total discontinuity %d (%jd) for %jd blockstoo many blocks tossed, not rewritingallocate block buffer size=%d: %s ino %ju markv %jd blockscoalescing already in progress%s: fork to coaleasce: %m%s: new coalescing process, pid %d%s: coalesced %d discontiguous inodesSuccessfully coalescedFile not in use or inode not foundNot large enough to coalesceNegative sizeNot enough blocks to account for sizeMalloc failedLFCNBMAPV failedNot broken enough to fixToo many blocks not foundToo many blocks found in active segmentsI/O errorNo such errorbuffer cache: %d hits %d misses (%2.2f%%); hash width %d, depth %d bremfree: lost taildepth <= nbufs/usr/src/sbin/fsck_lfs/bufcache.c!(bp->b_flags & B_BUSY)!(bp->b_flags & B_DELWRI)bp->b_flags & B_BUSYSuperblock magic number (0x%lx) does not match any of the expected 0x%lx, 0x%lx, 0x%lx or 0x%lx Superblock checksum (%lx) does not match computed checksum (%lx) ix < ULFS_NIADDR/usr/include/ufs/lfs/lfs_accessors.hix < ULFS_NDADDRbc >= 0/usr/src/sbin/fsck_lfs/lfs.cNot enough inode blocks in pseg at 0x%jx: found %d, wanted %d iip=0x%jx, daddr=0x%jx Partial segment at 0x%jx expected %d blocks counted %d Partial segment at 0x%jx data checksum mismatch: given 0x%x, computed 0x%x pseg at 0x%jx: wrong magic number pseg at 0x%jx: expected ident %jx, got %jx pseg at 0x%jx: serial %d < %d pseg at 0x%jx: summary checksum wrong warning, serial=%d ss_serial=%d summary good: 0x%jx/%d sb0 %ju, sb1 %juAttempting to verify newer checkpoint...done.** Newer checkpoint verified; recovered %jd seconds of data ** Newer checkpoint invalid; lost %jd seconds of data No -b flag given, not attempting to verify checkpointPrimary superblock is no good, using first alternateFirst alternate superblock is no good, using primarylfs: ifile ino %d read %dlfs_balloc: bread bno %lldlfs: ifile read: cleanerinfo: error %d lfs_valloc: inuse inode %d on the free listUsage: %s device %s device command [arg [...]] Available commands: rw%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. successfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgegetgeometrykeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidCan't read %s partition table%s partition table invalid, no magic in sector %lldremoving corrupt bootsel information%s partition table: using old-style bootsel information%s bootsel information corrupt - ignoringdecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOFgbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionreallocarrSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT header%s: bootcode too large%s: bootcode too small%s: invalid magicInstalled bootfile doesn't support required options.Bootfile %s doesn't support required bootsel optionsBootfile %s doesn't support the required options, install default bootfile instead?Default bootfile %s doesn't support required options. Got flags 0x%x, wanted 0x%x Update the bootcode from %s?Can't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s bootmenu: %s %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedbootmenu%s: [%.*s] (space to clear)'%s' is longer than %d characters. The bootselect code is not installed, do you want to install it now?Explicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: Bootselector , infinite timeout, timeout %d secondsNo active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.Invalid sector size %zdB0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks? Geometries of known disks:Disk %d: cylinders %u, heads %u, sectors %u (%lld sectors, %dMB) BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. Boot selector configuration:Timeout value (0 to 3600 seconds, -1 => never)Select the default boot option. Options are: %d: The first active partition %d: Harddisk %d Default boot option We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Apple UFSOlivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBRLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tableusage: %s [-fqrw] [-s sector] device Invalid sector size %u malloc I/O bufferseek labelread label (sector is possibly out of range)read labelFound %s partition; size %u (%u MB), offset %u skipping existing %s partition at slot %c. skipping overlapping %s partition at slot %c. WARNING: no slots free for %s partition. adding %s partition to slot %c. and on-disk sector number (%s) incorrectly specifiedsector number (%s) out of rangefqrs:wget labelNo change; not updating disk label.Updating in-core %sdisk label. set labelNot updating disk label.Version 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFS# %s: type: %u disk: %.*s label: %.*s removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] SMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpdusage: %s [-o options] special node getmntoptsmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %suserquotagroupquotardonlyunionhiddensympermrumpautomountedgetargsrelatimerealpath '%s' failed"%s" is a relative path.using "%s" instead.usage: %s [-bdins] [-N nsegs] [-o options] special node bdiN:no:s/libexec/lfs_cleanerd-b-d/var/run/%slfs_cleanerd:m:%s.pid%slfs_cleanerd:s:%s.pidusage: %s [-a] [-i] [-u user] [-g group] [-m mask] bdev dir aiu:g:m:o:%s on %suid=%d, gid=%d, mode=0%o, flags=%s unknown %s id: %sinvalid file mode: %szero size partitionpartition label indicated fs type "%s", expected "%s"illegal inode block size: %d cannot specify inode block size when version == 1 fragment size must be <= block size %dblock size must be < segment size%s: disklabel segment size (%d) too small, using default (%d)filesystem offset %ld out of rangefilesystem offset ignored for version 1 filesystem%d: block size not a power of 2%d: frag size not a power of 2%d: segment size not power of 2Segment size %d is not a multiple of frag size; trying size %d. Segment size %d is too large; trying smaller sizes. (Did you perhaps accidentally leave "16" in the disklabel's sgs field?) Could not allocate enough segments with segment size %d and block size %d; please decrease the segment size. Using segment size %d, block size %d, frag size %d. Creating a version %d LFS%d with roll-forward ident 0x%xWARNING: The LFS64 on-disk format is not final.WARNING: 64-bit volumes should be used only for testing.%.1fMB in %d segments of size %d Segment 0 offset is not multiple of frag size Using flags "-O %lld" would result in the first segment containing only part of a superblock. Please choose an offset of 0, %d, or %d or more, Could not assign a disk address for the second superblock. Please decrease the segment size. lfs: ifile read: segentry %llu: error %d directory too bigfs->lfs_hasolddirfmt == 0reclen > LFS_DIRHEADERSIZE(fs)spacelen > namlenspaceleft == 0/usr/src/sbin/newfs_lfs/make_lfs.csuper-block backups (for fsck -b #) at:%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: newfs_lfs [ -fsoptions ] special-device where fsoptions are: -A (autoconfigure segment size) -B segment size in bytes -D (debug) -M count of segments not counted in bfree -N (do not create file system, just print out parameters) -O first segment offset in sectors -R count of segments reserved for the cleaner -b block size in bytes -f frag size in bytes -m minimum free space %% -s file system size in sectors -v version preadbw = %ld B/s, seek time %ld ms (%ld seeks/s) using initial segment size %ld insane maxpartitions value %dinterleaveminfreesegresvseg%s: bad sector sizeinode block sizeroll-forward idfile system versionbit width%s `%s' is out of range.AB:b:DFf:I:i:LM:m:NO:R:r:S:s:v:w:bit width %d is not sensible; please use 32 or 64Cannot make a 64-bit version 1 volume/dev/%sr%s%s: neither a character special device nor a regular file%s: is zero sized%s: is not `%s', but `%s'This volume is too large for a 32-bit LFS.Using negative block numbers; not recommended. You should probably use -w 64.%s is not a character special device, ignoring -Anblocks = %d, not %d %s: fragment is not last block%s: ulfs_bmaparray returned %d looking up lbn %lld%s: bread bno %lld%s: no clean segmentslfs_dtosn(fs, LFS_DBTOFSB(fs, (*bpp)->b_blkno)) == sp->seg_number/usr/src/sbin/fsck_lfs/segwrite.cfs->lfs_is64 == 0devvp is NULL!(bp->b_flags & B_INVAL)idx < lfs_fi_getnblocks(fs, fip)bp->b_flags & B_DELWRICould not allocate %zu bytesdaddr > 0unlock to 0 with no summarySeglock not heldunknown disk type `%s'DIOCGDINFO on %s failedsectors-per-unitsectors-per-tracktracks-per-cylindercylinders-per-unitphysical-sector-sizealigned-sectorPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sCan't find block design file name in config fileRAID: config error: Can't open layout table file %sRAID: config error: Can't read layout from layout table file %s%u %u %u %u %u %uUnable to parse header line in block design fileCan't find sparemap file name in config filesparemap file name '%s' too long (max %d)Program Bug: (RF_SPAREMAP_NAME_LEN(%d) %% %zd) != 0Size mismatch creating layout specific data: is %tu sb %zu bytesabsentCan't open config file %sUnable to find start of "array" params in config file %sConfig file error ("array" section): unable to get numRow and numColConfig file error ("array" section): unable to get numCol, numSparefifo[No disk queue discipline specified in config file %s. Using %s.]%64s %dCan't determine queue type and/or max outstanding reqs from line: %.*sUsing %s-%dQueue length for %s out of range [%d interp as %d], assuming 1Can't find "disks" section in config file %sConfig file error: unable to find device file name for disk at col %dConfig file error: warning: unable to get device file for disk at col %d: %sConfig file error: unable to get device file for spare disk %dConfig file error: warning: unable to get device file for spare disk %d: %sCan't find "layout" section in configuration file %sConfig file error ("layout" section): unable to find common layout param line%d %d %d %cUnable to scan common layout lineUnknown parity config '%c'%s: Unable to allocate table%s: Unable to allocate table:%d%s: Can't open sparemap file %sInvalid sparemap file: can't find header linefdisk %d Invalid sparemap file: Can't find "fdisk %d" lineSparemap file prematurely exhausted after %d of %d linesSparemap file format error - line %d of %d linesParity declusteringDistributed sparing parity declusteringDeclustered P+QRAID Level 5 rotated sparingChained DeclusteringInterleaved DeclusteringRAID Level 0RAID Level 1RAID Level 4RAID Level 5Declustered EvenOddParity loggingBad number `%s'usage: %s dev create [0 | 1 | mirror | 5] component component ... %s [-v] -A [yes | no | softroot | hardroot] dev %s [-v] -a component dev %s [-v] -B dev %s [-v] -C config_file dev %s [-v] -c config_file dev %s [-v] -F component dev %s [-v] -f component dev %s [-v] -G dev %s [-v] -g component dev %s [-v] -I serial_number dev %s [-v] -i dev %s [-v] -M [yes | no | set params] dev %s [-v] -m dev %s [-v] -P dev %s [-v] -p dev %s [-v] -R component dev %s [-v] -r component dev %s [-v] -S dev %s [-v] -s dev %s [-v] -t config_file %s [-v] -U unit dev %s [-v] -u dev ioctl (%s) failedRAIDFRAME_GET_INFO%s is not a component of this deviceYesNohardsoftRAIDFRAME_SET_AUTOCONFIGRAIDFRAME_SET_ROOTraid%d: Autoconfigure: %s raid%d: Root: %s RAIDFRAME_GET_COMPONENT_LABELComponent label for %s: Row: %d, Column: %d, Num Rows: %d, Num Columns: %d Version: %d, Serial Number: %u, Mod Counter: %d Clean: %s, Status: %d sectPerSU: %d, SUsPerPU: %d, SUsPerRU: %d Queue size: %d, blocksize: %d, numBlocks: %llu RAID Level: %c Autoconfig: %s Root partition: %s Last configured as: raid%d RAIDFRAME_INIT_LABELSgettimeofday failed!?!?%02d: --:-- %3d%% |%s| ETA: %s %cRAIDFRAME_CHECK_RECON_STATUSReconstruction is %d%% complete. RAIDFRAME_CHECK_PARITYREWRITE_STATUSParity Re-write is %d%% complete. Reconstruction status:Parity Re-write status:more than twoexactly twoUNKNOWNdisremainstat failure on: %sinvalid device: %smirrorFor RAID level %d the number of columns must be %s. RAIDFRAME_CONFIGURERAIDFRAME_REWRITEPARITYBad last unit %sa:A:c:C:f:F:g:GiI:l:LmM:r:R:sSpPt:uU:vUnable to open device file: %sRAIDFRAME_ADD_HOT_SPARERAIDFRAME_REMOVE_COMPONENTUnable to create RAIDframe configuration structureRAIDFRAME_FAIL_DISKRAIDFRAME_SET_COMPONENT_LABELInitiating re-write of parity# raidctl config file for %s START array# numCol numSpareSTART disksSTART spare# WARNING: no optimal components; using %s START layout# sectPerSU SUsPerParityUnit SUsPerReconUnit RAID_level_%c %d %d %d %c START queuefifo %d Components:%20s: %s Spares:No spares.%s status is: %s. Skipping label. RAIDFRAME_CHECK_PARITYParity status: cleanParity status: DIRTYraid%d: has no parity; parity map disabled RAIDFRAME_PARITYMAP_STATUSraid%d: parity map enabled with %u regions of %s raid%d: regions marked clean after %d intervals of %d.%03ds raid%d: write/sync/clean counters %llu/%llu/%llu raid%d: %d dirty region%s %x%xraid%d: parity map disabled RAIDFRAME_PARITYMAP_GET_DISABLEraid%d: parity map will %s %sabled on next configure RAIDFRAME_PARITYMAP_SET_PARAMSraid%d: parity cleaned after intervals of %d.%03dsraid%d: will use %d regions on next configuration `%s' is not a valid parity map commandRAIDFRAME_PARITYMAP_SET_DISABLEraid%d: parity map will be %sabled on next configure RAIDFRAME_REBUILD_IN_PLACE%s: Parity status: clean %s: Parity status: DIRTY %s: Initiating re-write of parity %s: Parity Re-write complete RAIDFRAME_SHUTDOWNRAIDFRAME_SET_LAST_UNITRAIDFRAME_RESCANoptimalreconstructingdist_sparedused_spare|/-\ForceSoft*invalid*usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list extract directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verboseverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseto an alternate location with more disk space.or set environment variable TMPDIRTry making space in %s, %s %s bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer /dev/ttycannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? towards the first. with the last volume and work file(s) are on you should start Unless you know which volume yourYou have not read any tapes yet. (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s %s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape %s? [yn] dump coresymbolicwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). strdupwho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctl%13u usage: %s device command [arg [...]] Commands pertaining to scsi devices: Commands pertaining to scsi busses: Use `any' or `all' to wildcard target or lun %s: no automatic reallocation enabled %s: automatic read reallocation %senabled %s: automatic write reallocation %senabled %s: error recovery parameters are %ssavable %s: no caches enabled %s: read cache %senabled %s: write-back cache %senabled %s: caching parameters are %ssavable unable to allocate defect descriptorinvalid block number: %sunable to allocate defect listgrownbytephysical notice:requested defect list format not supported by device and defects: none reported %s: scsibus%d target %d lun %d %sblock address ------------- bytes from cylinder head index -------- ---- ---------- cylinder head sector -------- ---- ---------- : noneinvalid target: %sinvalid lun: %sSCBUSIODETACHSCBUSIOSCANSCIOCDEBUGSCIOCRESETSCBUSIORESETunable to allocate lun reportnormalwellknownUnknown select report '%s'%s: report truncated %uto %u %s: lun %llu failed to clean Unit Attention: %scurrent disk sector size: %d invalid block size: %simmformatting.SCIOCCOMMAND%s: SCSI command timed out%s: device is busy%s: device had unknown status %x.%d0%%..100%%..done. %8u %4u entire track defective%10u vpd%s: scsibus%d target %d lun %d <%s, %s, %s> VPD Serial:VPD Device IDs: proto%ubusunknown %s command: %st10eui64naatarget portport grouplun groupmd5scsires9res10res11res12res13res14res15fibre channelobsoletessaieee1394rdmaiSCSISASresetscantarget lun[primary] [grown] [block|byte|physical][blocksize [immediate]]identify[vpd]reassignblkno [blkno [...]]preventallowturnone|r|w|rw [save]flushcachesetspeed[speed]getreallocsetreallocreportlunsnormal|wellknown|all|#Diagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xParametersError in %s, Offset %d, bit %dError in %s, Offset %dActual Retry Count: %dProgress Indicator: %d SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %d COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d:%s: Check Condition on CDB: %02xNo Additional Sense InformationEnd-Of-Partition/Medium DetectedSetmark DetectedBeginning-Of-Partition/Medium DetectedEnd-Of-Data DetectedI/O Process TerminatedAudio Play Operation In ProgressAudio Play Operation PausedAudio Play Operation Successfully CompletedAudio Play Operation Stopped Due to ErrorNo Current Audio Status To ReturnNo Index/Sector SignalNo Seek CompletePeripheral Device Write FaultNo Write CurrentExcessive Write ErrorsLogical Unit Not Ready, Cause Not ReportableLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Initialization Command RequiredLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Format In ProgressLogical Unit Does Not Respond To SelectionNo Reference Position FoundMultiple Peripheral Devices SelectedLogical Unit Communication FailureLogical Unit Communication TimeoutLogical Unit Communication Parity ErrorTrack Following ErrorTracking Servo FailureFocus Servo FailureSpindle Servo FailureError Log OverflowWrite ErrorWrite Error Recovered with Auto ReallocationWrite Error - Auto Reallocate FailedID CRC Or ECC ErrorUnrecovered Read ErrorRead Retried ExhaustedError Too Long To CorrectMultiple Read ErrorsUnrecovered Read Error - Auto Reallocate FailedL-EC Uncorrectable ErrorCIRC Unrecovered ErrorData Resynchronization ErrorIncomplete Block FoundNo Gap FoundMiscorrected ErrorUncorrected Read Error - Recommend ReassignmentUncorrected Read Error - Recommend Rewrite the DataAddress Mark Not Found for ID FieldAddress Mark Not Found for Data FieldRecorded Entity Not FoundRecord Not FoundFilemark or Setmark Not FoundEnd-Of-Data Not FoundBlock Sequence ErrorRandom Positioning ErrorMechanical Positioning ErrorPositioning Error Detected By Read of MediumData Synchronization Mark ErrorRecovered Data With No Error Correction AppliedRecovered Data With RetriesRecovered Data With Positive Head OffsetRecovered Data With Negative Head OffsetRecovered Data With Retries and/or CIRC AppliedRecovered Data Using Previous Sector IDRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Recommend RewriteRecovered Data With Error Correction AppliedRecovered Data With Error Correction & Retries AppliedRecovered Data - Data Auto-ReallocatedRecovered Data With CIRCRecovered Data With LECRecovered Data - Recommend ReassignmentRecovered Data - Recommend RewriteDefect List ErrorDefect List Not AvailableDefect List Error in Primary ListDefect List Error in Grown ListParameter List Length ErrorSynchronous Data Transfer ErrorPrimary Defect List Not FoundGrown Defect List Not FoundMiscompare During Verify OperationRecovered ID with ECCInvalid Command Operation CodeLogical Block Address Out of RangeInvalid Element AddressIllegal Function (Should 20 00, 24 00, or 26 00)Illegal Field in CDBLogical Unit Not SupportedInvalid Field In Parameter ListParameter Not SupportedParameter Value InvalidThreshold Parameters Not SupportedWrite ProtectedNot Ready To Ready Transition (Medium May Have Changed)Import Or Export Element AccessedPower On, Reset, or Bus Device Reset OccurredMode Parameters ChangedLog Parameters ChangedCopy Cannot Execute Since Host Cannot DisconnectCommand Sequence ErrorToo Many Windows SpecifiedInvalid Combination of Windows SpecifiedOverwrite Error On Update In PlaceCommands Cleared By Another InitiatorIncompatible Medium InstalledCannot Read Medium - Unknown FormatCannot Read Medium - Incompatible FormatCleaning Cartridge InstalledMedium Format CorruptedFormat Command FailedNo Defect Spare Location AvailableDefect List Update FailureTape Length ErrorRibbon, Ink, or Toner FailureRounded ParameterSaving Parameters Not SupportedMedium Not PresentTape Position Error At Beginning-of-MediumTape Position Error At End-of-MediumTape or Electronic Vertical Forms Unit Not ReadySlew FailurePaper JamFailed To Sense Top-Of-FormFailed To Sense Bottom-Of-FormReposition ErrorRead Past End Of MediumRead Past Beginning Of MediumPosition Past End Of MediumPosition Past Beginning Of MediumMedium Destination Element FullMedium Source Element EmptyInvalid Bits In IDENTIFY MessageLogical Unit Has Not Self-Configured YetTarget Operating Conditions Have ChangedMicrocode Has ChangedChanged Operating DefinitionINQUIRY Data Has ChangedRAM FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)Power-On or Self-Test FAILURE (Should Use 40 NN)Internal Target FailureSelect Or Reselect FailureUnsuccessful Soft ResetSCSI Parity ErrorINITIATOR DETECTED ERROR Message ReceivedInvalid Message ErrorCommand Phase ErrorData Phase ErrorLogical Unit Failed Self-ConfigurationOverlapped Commands AttemptedWrite Append ErrorWrite Append Position ErrorPosition Error Related To TimingErase FailureCartridge FaultMedia Load or Eject FailedUnload Tape FailureMedium Removal PreventedSCSI To Host System Interface FailureSystem Resource FailureUnable To Recover Table-Of-ContentsGeneration Does Not ExistUpdated Block ReadOperator Request or State Change Input (Unspecified)Operator Medium Removal RequestedOperator Selected Write ProtectOperator Selected Write PermitLog ExceptionThreshold Condition MetLog Counter At MaximumLog List Codes ExhaustedRPL Status ChangeSpindles SynchronizedSpindles Not SynchronizedLamp FailureVideo Acquisition ErrorUnable To Acquire VideoOut Of FocusScan Head Positioning ErrorEnd Of User Area Encountered On This TrackIllegal Mode For This TrackNo Additional SenseRecovered ErrorMedia ErrorHardware ErrorIllegal RequestUnit AttentionBlank CheckVendor UniqueCopy AbortedAborted CommandEqual ErrorVolume OverflowMiscompare Error%s: SCSI command timed out %s: device is busy %s: device had unknown status %x Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at poweroff/sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-zCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:tcsetattrTIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s %s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%x:%llu(%d/%d/%d),%x %s: size mismatch %c%x0x%0*x0x%0*llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbuf/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/machdep/diskinfo/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorLESSLESSSECUREVISUALEDITORLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticmso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGutf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYts=tabstop=pcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%c-clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionCannot create pipeInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"Invalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberdvcudiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofweolexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechocheckdisconnecttandemlinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x), Valid options are:=number=word=stringSupported machines are:usage: %s [-fnv] [-B s2bno] [-b s1bno] [-m machine] [-o options] [-t fstype] [-u uboot-paths] filesystem primary [secondary] usage: %s -c [-fnv] [-m machine] [-o options] [-t fstype] filesystem usage: %s -e [-fnv] [-m machine] [-o options] bootstrap mach != NULL/usr/src/usr.sbin/installboot/installboot.cInvalid machine `%s' from %s (directory)(none)(to be cleared)EditClear$MACHINE/usr/pkg/share/u-bootINSTALLBOOT_UBOOT_PATHSInvalid block number `%s'-moption != NULL, =,Unknown option `-o %.*s'Option `%s' must not have a valueOption `%s' must have a valueInternal error: option `%s' has invalid type %dInvalid option value `%s=%.*s'fstype != NULL-tInvalid file system type `%s' from %spaths != NULLb:B:cefm:no:t:u:vDetermine unameuname()`-o %s' is not supported for %s`-b bno' is not supported for %s`-B bno' is not supported for %sUnknown unsupported flag %#x (coding error!)Can't use `-b bno' with `-o append'Can't use `-b bno', `-B bno' or `-o append' with `-c'Opening file system `%s' read-%sExamining file system `%s'File system `%s' is not of type %sFile system `%s' is of an unknown typeparams->machine != NULLOpening primary bootstrap `%s'Examining primary bootstrap `%s'`%s' must be a regular file or a directory`%s' must be a regular fileFile system: %s File system type: %s (blocksize %u, needswap %d) Primary bootstrap: %s%s Secondary bootstrap: %s Please specify the primary bootstrap file%s bootstrap operation failedSynchronising file system `%s'Closing file system `%s'Closing primary bootstrap `%s'params != NULL%s: bootstrap installation is not supported%s: bootstrap removal is not supported%s: bootstrap editing is not supportedalphasumioaddrkeymapresetvideosunsumbootconfboarddtbbb16 != NULL/usr/src/usr.sbin/installboot/sum.cOld Sun checksum: 0x%04x Recalculated Sun checksum: 0x%04x Boot options: timeout %d, flags %x, speed %d, ioaddr %x, keymap %s Patch area in stage1 bootstrap is too smallconsole %d console %s invalid console name, valid names are:/usr/src/usr.sbin/installboot/arch/i386.cparams->fsfd != -1params->filesystem != NULLReading `%s'Reading `%s': short readWriting `%s'Writing `%s': short write, %zd bytes (should be %zu)Invalid magic in existing bootstrapparams->s1fd != -1params->stage1 != NULLstage1 bootstrap `%s' (%u bytes) is larger than 8192 bytesstage1 bootstrap `%s' (%u bytes) is too smallReading `%s': short read, %ld bytes (should be %ld)Ignoring PBR with invalid magic in sector 0 of `%s' Data in mbr partition table of new bootstrapData in label part of new bootstrapInvalid magic in stage1 bootstrap %x != %xNo BPB in new bootstrap %02x:%02x:%02x, use -f (may invalidate filesystem)Insufficient reserved space before FAT (%u bytes available), use -f (may invalidate filesystem)Old BPB too big, use -f (may invalidate filesystem)Cannot enable writes to the label sectorWriting `%s': short write, %u bytesamd64i386com0kbdcom1kbdcom2kbdcom3kbdusage: %s interface [-Dho] [-A 1|2] [-a access point density] [-d max data length] [-g fragmentation threshold] [-M 0|1] [-m MAC address] [-R 1|3] [-r RTS threshold] [-s station name] SIOCSWAVELAN[ %s ]SIOCGWAVELAN(wreq %04x)Transmitted unicast frames: %d Transmitted multicast frames: %d Transmitted fragments: %d Transmitted unicast octets: %d Transmitted multicast octets: %d Single transmit retries: %d Multiple transmit retries: %d Transmit retry limit exceeded: %d Transmit discards: %d Transmit discards due to wrong SA: %d Received unicast frames: %d Received multicast frames: %d Received fragments: %d Received unicast octets: %d Received multicast octets: %d Receive FCS errors: %d Receive discards due to no buffer: %d Can't decrypt WEP frame: %d Received message fragments: %d Received message bad fragments: %d string too longSIOCSIFFLAGSSIOCGIFFLAGSscanning ... AP Information No APs availableap[%d]: ScanReason: [ %s ] netname (SSID): [ BSSID: [ %02x:%02x:%02x:%02x:%02x:%02x ] Channel: [ %d ] Quality/Signal/Noise [signal]: [ %d / %d / %d ] [dBm]: [ %d / %d / %d ] BSS Beacon Interval [msec]: [ %d ] Capinfo: [ ESS WEP DataRate [Mbps]: [ %d ] Unknown[ Unknown ][ On ][ Off ][ %s ID: %d version: %d.%d ][ 0x%s is already specified to %sa:d:g:hi:m:or:s:A:M:R:DSIOCG80211NWIDbadly formatted addressLucentgeneric PRISM IISamsungD-LinkHost initiatedFirmware initiatedInquiry request from hostWEP encryption: Authentication type (1=OpenSys, 2=Shared Key): authentication typeTX encryption key: Encryption keys: NIC serial number: Station name: station nameSSID for IBSS creation: Current netname (SSID): Desired netname (SSID): Current BSSID: Channel list: IBSS channel: Current channel: Comms quality/signal/noise: Promiscuous mode: Port type: MAC address: MAC addressTX rate (selection): TX rate (actual speed): Beacon Interval (current) [msec]: Maximum data length: maximum data lengthRTS/CTS handshake threshold: RTS thresholdfragmentation threshold: fragmentation thresholdRSSI -> dBm adjustment: Create IBSS: Microwave oven robustness: microwave oven robustness enabledRoaming mode(1:firm,3:disable): roaming modeAccess point density: system scalePower Mgmt (1=on, 0=off): Max sleep time (msec): Vendor info: %s: not a regular filemalloc, using %zu bufferUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuv%6d %6s Usage: %s [-R [-H | -L | -P]] [-dfh] mode file ... %s [-R [-H | -L | -P]] [-dfh] --reference=rfile file ... HLPRXdfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory usage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx ls: %s: %s total %'llu total %llu humanize_numbertotal %s %'*llu %*llu ????????????????????????%s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too long-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%lu secs (%llu %s/sec)%llu bytesunknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Sorry, unable to determine archive format.Cannot identify format. Searching...Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveCannot close file descriptor on %sCannot unlink %sUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readconfirmationread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sTar header field is too small for %sFile is too large for tar %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEGIDMTIMECHKSUMFile is too long for ustar %spathname too long: %scannot open %s: %spathname too long, line %d of %sFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryAlias count botchalias %s=alias: '' not found alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDUnable to determine new working directoryPeHOME not setPWD not setbad substitution (no "%s" in "%s")CDPATHCan't cd to "%s": %sCannot determine current working directoryunexpected argumentUnable to find current directorystdout: %swrite errorinterruptedno execute permissionpermission deniedfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcefqrsuvhash: I/O error writing to standard output [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not set%d: unknown expansion type%d: ${#%.*s%c..}: unknown modifier%d: ${%.*s%c..}: unknown modifiernull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode nul ('\0') in shell inputCan't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dJob [%d] does not have a process groupCannot continue job (%s)Job [%d] has no stopped processes[%d] %c %ld RunningDone(%d) (core dumped)No current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%d] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%d [%d] %ld lpZmore than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if else fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT/etc/profile/.profileENVOut of spacestunalloc ststrcat() over length botchd:p:rvariable name required Usage: read [-r] [-d C] [-p prompt] var...u=%s,g=%s,o=%s %.4o Not a valid octal number: '%s'Mask constant '%s' out of rangeCannot set mode `%s' (%s)umask: I/O error HSatfdscmlrpnvbinternal error (%c)%s: value overflow%s: bad number%-13s (-%c %-11s) %9llderror getting limit (%s)error setting limit (%s)unlimited ulimit: I/O error (stdout) kbytesstacklocked memorythreadnofilesvmemorysbsizeInvalid number: '%s'Number out of range: %sPScCurrent option settings%s%c%c%-19s %s set -o defaultUnknown option %co %s+-Unknown option %c%carg for %co missingNETBSD_SHELLNetBSD shell: %s Bad -c optionOPTARGUnknown option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Unknown option -%cNo arg for -%c optionUsage: shift [n]Usage: rotate [n]can't rotate that manycan't shift that manyallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Unimplemented form of eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'-o promptcmds not set: Bad for loop variableBad function name (use quotes)Bad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntil";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Unable to dup(%d->%d): %sMoving fd %d to %d made %d!Unable to make fd %d: %sRedirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %sBad flag `%s'%s: too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)fdflags: I/O error '...'<<nonblockfsyncdsyncrsyncaltionosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap -P condition ... trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# NBSH_INVOCATIONPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]unsupported expression when built with -DSMALLequnknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... bad signal number: %spgrpunknown signal number: %doption requires an argument -- sbad job id: %sbad process%s id: '%s'evalbgchdirletfalsefdflagsgetoptsfcinputrcprintfsetvarulimitumaskunaliaswordexpPPID20220122 BUILD:20260310215930Z SMALL REJECT_NULSincomplete escape sequence\x%s: missing hexadecimal number in escapeunknown escape sequence `\%c'Usage: %s [-L] format [arg ...] Arg %d: unexpected empty value ('')Arg %d: %s: numeric value expectedArg %d: %s: not completely convertedArg %d: %s: %sArg %d: '%s' value for '*' width/precision must be an unsigned integerArg %d: %s: invalid field width/precisionArg %d: %sArg %d: '%s' numeric value requiredformat "%s" too complex#-+ 0'%s: missing format character%s: invalid directiveprint failedoption requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeol2lnextreprintgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d illegal gfmt1 optionillegal gfmt1 option -- %s%lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gtcgetattrTIOCGLINEDTIOCGWINSZTIOCGQSIZEgfmt1TIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-dfhv] %s file ... %s [-R [-H | -L | -P]] [-dfhv] --reference=rfile file ... %s: invalid %s nameHLPRdfhvthe -L and -h options may not be specified together.DISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax errorreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %x%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %dusage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=unknown%u:b%c#%llu:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpmtrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/vi%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkcobaltlandiskepoc32hpcarmhpcmipszaurus%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)eraAutomatically adjust partitions [%s]? Invalid answer# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition tablecan't get msgbufrq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:Unknown pid %ddone %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%suntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDwrong type to dirscan %dNAME=%s NO SPACE LEFT IN %s (EXPANDED)EXPANDUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s (CLEARED)CLEAR%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %zu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad offset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %sstarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** Alternate super block location: %d no-eaconversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s can't take snapshot of %sEXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWNON-ZERO EXTATTR FIELDS I=%lluCLEAR EXTATTR FIELDS AND SET PERMS TO 0INCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) ADD '.' ENTRYREPLACE WITH '.'ADD '..' ENTRYREPLACE WITH '..'DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.' FIRST ENTRY IN DIRECTORY CONTAINS %s BAD TYPE VALUE FOR '..'MISSING '..'SECOND ENTRY IN DIRECTORY CONTAINS %s (FIX DEFERRED)EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dDEFERRED MISSING '..' FIXBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETE CLUSTERING MAPSDELETING CLUSTERING MAPS CANNOT %s CLUSTER MAPS %sING CLUSTER MAPS CREATE CLUSTER MAPScannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%jucg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %u MARKED FREE ALLOCATED FRAG %u MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED SUPERBLOCK QUOTA FLAG CLEAREDCLEAR SUPERBLOCK QUOTA FLAGUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGCAN'T FIND SUPERBLOCKIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x ** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKSINFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATE-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s USING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %zu bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONGTRUNCATE (TRUNCATED)MISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATING STANDARD SUPERBLOCK UPDATE STANDARD SUPERBLOCKPanic: lost %d buffersMARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEAN ***** FILE SYSTEM MARKED CLEAN *****ENABLING EXTATTR SUPPORTDISABLING EXTATTR SUPPORTcache missed %ld of %ld (%d%%) cannot allocate quota entry%s: unknown fs_fragshift %d%.*s/%s%s/XXXXXXXXXX/dev/rfss%dDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x CANNOT REPLAY JOURNAL IN -n MODE; continuing anyway UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %da:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesUnable to make UUIDNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorCan't open `%s'The bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeNo bootable partitionCannot update Protective MBRPartition %d marked as bootablebiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBR[-r]Readonly mode, no changes madeSize must be a multiple of sector size (%u)PriSecRead failedBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'No write permission, enabling readonly (-r) modeCannot openCannot statNot a device or plain fileCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Media size (%jd) is not a multiple of sector size (%u) Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juNo GPT foundCannot operate on empty file with -rNeed -m mediasz to use an empty filetruncate(%ju) failedCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc tableReadonly mode, device unchanged Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s [%#jx]Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedValue too big '%s'Unknown alignment/index/size option `%c'Can't parse uuid/type `%s'Can't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Media size too largeCan't parse timestamp `%s'Hm:nqrs:T:vUnknown command: %smedia size too largeCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:qCould not find map entry corresponding to indexpartition does not need resizingPartition %d resized: %llu %lluresize[-i index | -b blocknr] [-a alignment] [-s size] [-q]s:qNew size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverNo secondary GPT tableDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableMoving secondary GPT headerCreating new secondary GPT headerError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec]%jx %*jx %*juBKMGTPE%s: %lluen_GB.UTF-8 (active)UnusedExtended - %sPri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lUnknown %#x[partition not found?]Index: %u Start: %ju Size: %ju Map_Type: %d Purpose: Long_Type: %s Attributes: %s Could not find index %dDetails for index %d: StartType: %s (%s) None %*s index contents%5d %*s Type: %s %*s TypeID: %s %*s GUID: %s %*s Size: %s%ju%s = %s%*s Label: %s %*s Attributes: %*s[ %*s ]gi:b:luaxAhHpW:wGPT not found, displaying data from MBR. %ju %ju %u %5dshow[-AagHhlux] [-b start_block] [-i index] [ -W width ]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumzfslinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMlinux-xbootldrLinux XBOOTLDRWindows basic datawindows-reservedWindows reservedwindows-recoveryWindows recoveryNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapobsdOpenBSD datavmcoreVMware VMkernel core dumpvmfsvmreservedVMware reservedsifive-bblSiFive BBLUUID changedab:i:L:s:t:U:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] [-U newuuid]gpt->secsz <= INT_MAX/usr/src/sbin/gpt/backup.csector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidle32toh(hdr->hdr_entries) <= INT32_MAXGPT_HDRi <= INT_MAXgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile] [ anycast | -anycast ] [ deprecated | -deprecated ] [ pltime n ] [ vltime n ] [ eui64 ] %s: getsockSIOCGIFAFLAG_IN6SIOCAIFADDR_IN6SIOCDIFADDR_IN6SIOCGIFADDR_IN6 inet6 %s -> %sANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY flags %s scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime %s: getifnameinet6 address lifetime not allowed for the AFeui64 address modifier not allowed for the AF%a%%Sinterface index is already filled, %s | %scould not determine link local addresspltimeia6flaginet6IPv6 keywordsia6flagsanycastSIOCGIFAFLAG_INSIOCAIFADDRSIOCDIFADDRSIOCGIFADDR inet %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEnetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeifflag/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ifconfig.cprefixlen_to_mask%s: prop_data_create_copy%s: prop_dictionary_setdstormaskdescription too longmalloc description spacegetargstr descr failedSIOCSIFDESCRmalloc linkstr spacegetargstr linkstr failedSIOCSLINKSTR%s%llu %s%sSIOCIFGCLONERS for countunable to allocate cloner name bufferSIOCIFGCLONERS for namesSIOCGIFFLAGS %sifcapclonecmdNote: trailers are no longer sent, but always receivedSIOCSIFMETRICSIOCSIFMTU, %s byte%s[-L] [-m] %s: prop_dictionary_createusage: %s [-h] %s[-v] [-z] %sinterface [ af [ address [ dest_addr ] ] [ netmask mask ] [ prefixlen n ] [ alias | -alias ] ] [ up ] [ down ] [ metric n ] [ mtu n ] [ arp | -arp ] [ preference n ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] [ linkstr str | -linkstr ] [ unnumbered | -unnumbered ] [ description str | descr str | -description | -descr ] %s -a [-b] [-d] [-h] %s[-u] [-v] [-z] [ af ] %s -l [-b] [-d] [-s] [-u] %s -C %s -w n %s interface create %s interface destroy clock_gettimeSIOCZIFDATA%s: getifinfoUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST%s: flags=%sSIOCGIFMETRIC %s metric %d mtu %d%s: getifcapsTSO4 IP4CSUM_Rx IP4CSUM_Tx TCP4CSUM_Rx TCP4CSUM_Tx UDP4CSUM_RxUDP4CSUM_TxTCP6CSUM_RxTCP6CSUM_TxUDP6CSUM_RxUDP6CSUM_TxTSO6LRO capabilities=%s enabled=%s description: "%s" malloc linkstr buf failedfailed to query linkstr linkstr: %s linkstate: %s input: queue drop, %llu unknown protocol output: collision%s: prop_dictionary_copy/createparser_init(iface_opt_family_only)parser_init(iface_only)parser_init(iface_start)-A is deprecatedexec_matches%s: prop_dictionary_augment%s: lookup_af_bynumafp->af_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6unnumberedlink0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamode/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtypemediainst [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] SIOCSIFMEDIA mode %s instance %d%s: SIOCGIFDATA status: [#%d] %s: no media types? media: %s supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno carrierno networkmasterno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchscope mismatchtunnel src/dst is multicastSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsCAPSS:NRATE%-*.*s %-17.17s %4s %4s %-7s %3s %4s %-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s> DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): dlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()atalkhopcountlockrestnostaticproto1proto2recvpiperttrttvarsendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: inet6 %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] %s: address resolved to multiple valuesassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dFlags%-*.*s %-*.*s %-6.6s Internet6InternetAppleTalkEncap Protocol Family %d: %-6.6s %u.%u.%u.%u/%dillegal prefixlen(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 swaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSPriorityCapacityDevice%-*s %*s %*s %*s %8s %s %-*s %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeDisabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrhelprmdirrstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Invalid address `%s' in %s `%s'Invalid IPv6 address `%s' in %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrievedCan't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying [%s]:%s ... Trying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeUnexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandEPSVLPSVCan't create socket for data connectionwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 Passive mode address scan failure. Shouldn't happen! Passive mode address mismatch. wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%uUnknown passive mode AF. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dCan't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Usage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpBad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gz%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()works for regular filesin-place editing only%s: %s %s%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtvUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages%-35s %.50s2001:4860:4860::88442001:4860:4860::88888.8.4.48.8.8.8.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page downCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exit9600192003840057600115200BIOSrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!SomeOnOffDelete?reinstall sets forupgradeNetBSD/i386 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)RemoveAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)Invalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Keyboard typeInstalling the bad block table ... Would you like to install the normal set of bootblocks or serial bootblocks? Normal bootblocks use the BIOS console device as the console (usually the monitor and keyboard). Serial bootblocks use the selected serial port as the console. Selected bootblock: Serial port com%d at %d baudUnchangedBootblocks selectionUse BIOS consoleUse serial port com0Use serial port com1Use serial port com2Use serial port com3Set serial baud rateUse existing bootblocksInstalling boot blocks on %s.... This disk matches the following BIOS disk: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- This is the correct geometrySet the geometry by handUse one of these disksThis disk matches the following BIOS disks: BIOS # cylinders heads sectors total sectors GB ------ --------- ----- ------- ------------- ---- %-1d: %#6x %9d %5d %7d %13u %3u Note: since sysinst was able to uniquely match the disk you chose with a disk known to the BIOS, the values displayed above are very likely correct, and should not be changed (the values for cylinders, heads and sectors are probably 1023, 255 and 63 - this is correct). You should only change the geometry if you know the BIOS reports incorrect values. Choose disk: The NetBSD part of the disk lies outside of the range that the BIOS on your machine can address. Booting from it may not be possible. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)You have more than one operating system on this disk, but have not specified a 'bootmenu' for either the active partition, or the NetBSD partition that you are going to install into. Do you want to re-edit the partition to add a bootmenu entry?You have requested that an extended partition be included in the bootmenu. However your system BIOS doesn't appear to support the read command used by that version of the bootmenu code. Are you sure you that you want to do this? (Answering 'no' will take you back to the partition edit menu.)Your configuration requires the NetBSD bootselect code to select which operating system to use. It is not currently installed, do you want to install it now?The bootcode in the Master Boot Record does not appear to be valid. Do you want to install the NetBSD bootcode?Do you want to update the bootcode in the Master Boot Record to the latest version of the NetBSD bootcode?Kernel (GENERIC)Kernel (GENERIC_KASLR)KindMountBootmenuYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctive, (d)efault bootWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRowsectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/i386/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/i386/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failedexecuting: %s &&chroot(%s) for %sexecvp %sselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02X/sbin/ifconfig %s inet6 2>/dev/null inet6 tentativeduplicatedfe80:ipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.statsnet.inet6.ip6.stats/sbin/route get -inet default/sbin/route get -inet6 defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/i386/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,nosuid,noexec,nodevmtime,nodev,noatime,async,noauto,log/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/i386/../../disks.cbootxx_ffsv2bootxx_ffsv1progress -f %s -b 1m dd bs=1m of=%sxbdmcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%s/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/i386/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXX/netbsd/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/i386/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi /EFI/boot/usr/mdec/bootconsole=%s,speed=%u/usr/sbin/installboot -f -o %s %s %sWarning: disk is probably not bootablemachdep.bootmethodUEFIOut of memory %d%d%d%d%d%u%uwscons=YES sed -an -e '/^ttyE[1-9]/s/off/on/;H;$!d;g;w /etc/ttys' /etc/ttyssed -an -e 's/vt100/wsvt25/g;H;$!d;g;w /etc/ttys' /etc/ttys/usr/mdec/mbr_bootsel/usr/mdec/mbr/usr/mdec/mbr_extCan't find %sgpt biosboot -b %llu %s/usr/mdec/bootia32.efi/usr/mdec/bootx64.efi/usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/i386/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstypeparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ---- %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/i386/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0/dev/wskbd0sed -an -e 'H;$!d;g' -e 's/\nencoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/\n#encoding [a-zA-Z0-9.]*\n/\ encoding %s\ /; t done' -e 's/$/\ encoding %s/' -e ':done' -e 'w %s/etc/wscons.conf' %s/etc/wscons.confUser-definedUS-EnglishukUK-EnglishBelgianBrazilianCanadian FrenchczCzechDanishDutchEstonianFinnishFrench (AZERTY)bepoFrench (BEPO)de.nodeadGerman (QWERTZ)neoGerman (Neo 2)GreekHungarianIcelandicItalianJapaneseLatin AmericanNorwegianPolishPortugueseRussianSpanishSwedishSwiss FrenchSwiss GermanTurkish (Q-Layout)uaUkrainianus.colemakUS-Colemakus.dvorakUS-Dvorak%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/i386/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/i386/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresvvmresered/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2068: internal errorparts->geo_sec != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:2199: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/i386/../../mbr.c:1774: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: IAID conflicts with one assigned to %s%s: connected to Access Point: %sNOCARRIERPREINITEXPIRE6EXPIRESTOPPED%s: removing interfaceDUID %spid %d failed to exitdup2 %d%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leases%s: waiting for carrier%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_start%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z: [ip6] [ip4][manager]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: ND options: DHCPv6 options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 starting%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %snd_dhcp6_unknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption does not take an IPv4 address: %sinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundslaac token: no token specifiedslaac token: invalid tokentemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.clen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefix - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sSTATIC6ROUTERADVERTinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIAS%s: if_addrflags6%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSepairfwefwipvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s%03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_send%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: cannot read secret%s: cannot write secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: waiting for %s to complete%s: pid %d deleted address %s%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: delaying IPv6 router solicitation for %0.1f seconds%s: impossible RA flag %x%s: %s: router expired%s: expired %s %s%s: expired route %s%s: part of a Router Advertisement expirednd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_hoplimit=%u%s_flags=%s%s%s%s%s%s_lifetime=%u%s_addr%zu=%sIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: invalid route info option%s: invalid route info prefix length%s: reject RA (no option %s) from %s%s: %s: became stale%s: %s: no longer a default router (lifetime = 0)%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %s%s: delaying IPv6 Router Solicitation for LL addressreachable again%s: %s is %s%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: server sent USEMULTICAST%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in lease%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %uTIMEOUT6%s: %s received from %sINFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to completemulticastingunicastingdelaying%s: %s %s with xid 0x%02x%02x%02x%s%s%s: %s %s (xid 0x%02x%02x%02x)%s%s, next in %0.1f seconds%s: %s: sendmsg%s: sent %d times with no reply%s: ignoring unicast option as not manager%s: declining failed DHCPv6 addresses%s: DHCPv6 DAD completed%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: no advertising IPv6 router wants DHCP%s: failed to request DHCPv6 information%s: failed to decline duplicated DHCPv6 addresses%s: failed to request DHCPv6 address%s: DHCPv6 lease expired%s: failed to confirm prior DHCPv6 address%05d %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: no DHCPv6 server ID from %s%s: RECONFIGURE6 recv from %s, not LL%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: %s acknowledged DECLINE6%s: discarding ADVERTISEMENT from %s (%u)%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s (%u)%s: ADV %s from %s (%u)%s: prior DHCPv6 has a duplicated address%s: confirming prior DHCPv6 lease%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6-%uusage: ping6 [-dfHmNnqtvWw] [-a addrtype] [-b bufsize] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-X deadline] [-x maxwait] host ping6: wrote %s %d chars, ret=%d IP6Vr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->HBH DSTOPT FRAG RTHDR ICMP6: type = %d, code = %d ESPTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Unknown Header(%d) nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu --- %s ping6 statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, round-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms recvmsgpath MTU for %s is notified. (ignored) new path MTU (%d) is notified invalid peernamepacket too short (%d bytes) from %sfailed to get receiving hop limitfailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!) wrong data byte #%d should be 0x%x but was 0x%xrefused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPNodeInfo Supported Qtypes, compressed bitmap, raw bitmapunknown qtype no address(TTL=infty)(TTL=%u)TTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luNo Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time to live exceededTime exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option First Fragment Has Incomplete Chain Bad code(%d) pointer = 0x%02x Echo RequestEcho ReplyListener QueryListener ReportListener DoneRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QuerySupported qtypesDNS nameIPv4 nodeaddr, subject=%s(%s), oldfqdn, no subjectDNS label, subject=%s(invalid), invalidNode Information Reply HbH Options: Dst Options: Routing: nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s invalid socket buffer sizeillegal number of packets -- %sMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %s%s: only root may use interval < 1sInterval %s too largeInterval too small; raised to 0.01Must be superuser to preloadillegal preload value -- %spatterns must be specified as hex digitsinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %dBad/invalid deadline time: %sa:b:c:dfHg:h:I:i:l:mnNop:qS:s:tvwWx:X:ff02::2:0000:0000-p: No fill space; increase packet size with -sgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface nameUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> RefusedIPv6 address/etc/group/etc/master.passwd: (malloc) Error in munmap(): Z Pu___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stopthreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccYP FAKE error %d snaparchivedsappendschangesimmutableuappenduchangeuimmutable ,N/Aappletalk%a:%p%a[%a]:%p%A:%P%A[%A]:%Plink#%hu%d:[%d,%d]pqrstuwxyzPQRST/dev/ptm%s%s.pidjanuarygmtmidnightyeara.m.p.m.noonmiddayutcwetbstwatnftndtmstmdtpstpdtystydthdtahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6wastawstwadtawdtcctsgthktjstacstcadtacdteastaesteadtaedtgstnztnzstnzdttomorrowyesterdaytodaylastthiseleventwelveagomonthfortnightweekfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytueswednesdaywedneswedsthursdaythursthurfridaysaturdayfull-duplexfdxhalf-duplexflowcontrolflag0flag1flag2hw-loopbackrxpausetxpauseEarlyTokenReleaseSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapturboibsswdsmeshautoselect10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTP10STP10BASE-STP10baseFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GbaseT10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsVHTEthernetTokenRingFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT.sysctl hw.disknames failed/rdkno match for `%s'kern.labelusesmbrCannot copy stringCannot allocate %zu bytesCannot re-allocate %zu bytesCannot open `%s'Cannot format string%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sinitscrESCDELAYTABSIZEcsp != &blank^Gkbskcub1kcud1^M^Junknown error%s: generic terminal%s: hardcopy terminal%s.cdb$TERMINFO$TERMCAPTERMINFO_DIRS%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number/usr/bin/rshRCMD_CMDCannot exec %sR%zu W%zu L%lld %d *0*1argon2idargon2iargon2dargon2: failed: %s $sha1$%.*s%s%u%s%u$%.*s$%2.2u$$1$Argon2idArgon2iArgon2dOutput pointer is NULLOutput is too shortOutput is too longPassword is too shortPassword is too longSalt is too shortSalt is too longAssociated data is too shortAssociated data is too longSecret is too shortSecret is too longTime cost is too smallTime cost is too largeMemory cost is too smallMemory cost is too largeToo few lanesToo many lanesMemory allocation errorOutput pointer mismatchNot enough threadsToo many threadsMissing argumentsEncoding failedDecoding failedThreading failureUnknown error codeacosacosfasinasinfatan2atan2fhypothypotfexpfy0y0fy1y1fynynflgammalgammaflogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error log2: SING error log2: DOMAIN error unknown header flags setincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeatneed dictionarystream endfile errordata errorinsufficient memorybuffer errorincompatible versionstr != ((void *)0)fmt != ((void *)0)src != ((void *)0)0x%llxrpn == pn!((*cp) == '\0')?xml !DOCTYPE plist