08i:<  i:(t ti:@@<@T 08i:<  i:(t ti:@@<@T Ui:t`Ai:i:i:$ hi:i:i:Ai:i:i:A.i:i:i:xAi:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i:mD>i:i:i: (08@HPX`hpx($Ti:i:i:HPX`hpxN$ i:i:i:K$/i:i:i: (M$,i:i:i:08@HPX`hpFAi:i:i:Ci:i:i:Ai:i:i:Ai:i:i:!i:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i:ai:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:!i:i:i:4!i:i:i:!i:i:i:!i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i: B!i:i:i: B!i:i:i:!i:i:i:"!i:i:i:"!i:i:i:"ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i:ai:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i:!i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i:!i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i: !i:i:i:!i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i:\?!i:i:i:\>!i:i:i:\=!i:i:i:\<!i:i:i:\;!i:i:i:\:!i:i:i:\9!i:i:i:\8!i:i:i:\?!i:i:i:\>!i:i:i:\=!i:i:i:\<!i:i:i:\;!i:i:i:\:!i:i:i:\9!i:i:i:\8!i:i:i:\:!i:i:i:\7!i:i:i:\6!i:i:i:\5!i:i:i:\4!i:i:i:\3!i:i:i:\2!i:i:i:\1!i:i:i:\0!i:i:i:\7!i:i:i:\6!i:i:i:\5!i:i:i:\4!i:i:i:\3!i:i:i:\2!i:i:i:\1!i:i:i:\0!i:i:i:\2!i:i:i:\/!i:i:i:\.!i:i:i:\-!i:i:i:\,!i:i:i:\+!i:i:i:\*!i:i:i:\)!i:i:i:\(!i:i:i:\/!i:i:i:\.!i:i:i:\-!i:i:i:\,!i:i:i:\+!i:i:i:\*!i:i:i:\)!i:i:i:\(!i:i:i:\*!i:i:i:\'!i:i:i:\&!i:i:i:\%!i:i:i:\$!i:i:i:\#!i:i:i:\"!i:i:i:\!!i:i:i:\ !i:i:i:\'!i:i:i:\&!i:i:i:\%!i:i:i:\$!i:i:i:\#!i:i:i:\"!i:i:i:\!!i:i:i:\ !i:i:i:\"!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\ !i:i:i:\ !i:i:i:\ !i:i:i:\ !i:i:i:\ !i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\ !i:i:i:\ !i:i:i:\ !i:i:i:\ !i:i:i:\ !i:i:i:\!i:i:i:\ !i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:\!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i:!i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i: !i:i:i:!i:i:i: !i:i:i:!i:i:i:!i:i:i:!$i:i:i:4!i:i:i:!i:i:i:!i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i: !i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:!i:i:i:ai:i:i:ai:i:i:!i:i:i:!i:i:i:!i:i:i:ai:i:i: ai:i:i:ai:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i:\?ai:i:i:\>ai:i:i:\=ai:i:i:\<ai:i:i:\;ai:i:i:\:ai:i:i:\9ai:i:i:\8ai:i:i:\?ai:i:i:\>ai:i:i:\=ai:i:i:\<ai:i:i:\;ai:i:i:\:ai:i:i:\9ai:i:i:\8ai:i:i:\:ai:i:i:\7ai:i:i:\6ai:i:i:\5ai:i:i:\4ai:i:i:\3ai:i:i:\2ai:i:i:\1ai:i:i:\0ai:i:i:\7ai:i:i:\6ai:i:i:\5ai:i:i:\4ai:i:i:\3ai:i:i:\2ai:i:i:\1ai:i:i:\0ai:i:i:\2ai:i:i:\/ai:i:i:\.ai:i:i:\-ai:i:i:\,ai:i:i:\+ai:i:i:\*ai:i:i:\)ai:i:i:\(ai:i:i:\/ai:i:i:\.ai:i:i:\-ai:i:i:\,ai:i:i:\+ai:i:i:\*ai:i:i:\)ai:i:i:\(ai:i:i:\*ai:i:i:\'ai:i:i:\&ai:i:i:\%ai:i:i:\$ai:i:i:\#ai:i:i:\"ai:i:i:\!ai:i:i:\ ai:i:i:\'ai:i:i:\&ai:i:i:\%ai:i:i:\$ai:i:i:\#ai:i:i:\"ai:i:i:\!ai:i:i:\ ai:i:i:\"ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ ai:i:i:\ ai:i:i:\ ai:i:i:\ ai:i:i:\ ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ ai:i:i:\ ai:i:i:\ ai:i:i:\ ai:i:i:\ ai:i:i:\ai:i:i:\ ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\ai:i:i:\! i:i:i:i!i:i:i:!i:i:i:!i:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i: ai:i:i:ai:i:i: ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:!i:i:i:!i:i:i:ai:i:i:ai:i:i:!i:i:i:!i:i:i:!i:i:i: B!i:i:i: B!i:i:i:!i:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:ai:i:i:!i:i:i:!i:i:i:ai:i:i: ai:i:i:ai:i:i: ai:i:i:ai:i:i:ai:i:i:i:i:i:bpf!i:i:i: $i:i:i:$i:i:i:v$>i:i:i:$i:i:i:$si:i:i:$i:i:i:Ai:i:i:m i:i:i:$i:i:i: $i:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i:Ai:i:i: A%MLQdg 'fyFjE!x<;?LMc+0j5P +YAqOsV+/_;P4f&'.r88#:C"?NkNNZ I םMğ,,; I.Q({A nqތiG(7,v[0 kzvEbw">"Cg|ȩ  U[&|j9G\8r 9$`N#0tT\ ݚ~ҹheLh^ny5:g<7EEf!'}hr !|JG!x>M@{O?si_ b.~v"&W th<FXCyQ*gF!$Nz_&E]7^G큅S%M}B5jS~Q<+V+Qt . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4;4 (ffgttt\ &LLgtttNetBSDGwKPaX NetBSDearmv7hfeb3D0D 0p@-h6!F(F;hFh@oKihB F_ 鸱I&H F^B I&H;h+?U H)FCN*jB K Fhh! ^( uȄ |h |l |80MF Fj@2iF^C!jH M0# 05 H_p I H IhF^FHiFKh(РmdȄ |PFIH_J( I H hH^FIHKh( F@9Ȅ |PFIH_"( I H\ h #H^FIHKh( F@Ȅ |PCIFFH&x %. pKXbpG!8KXbpG!I JI `I wI  hh_,O3FoBH##"K]!0O3FoBH##"K ]!O3FoBH##"K ]!8O3FoBH##"K]!?#F "HnK]!x?#F "HXKK]!!8 KFh[ ?#H" :K]!! KFh[ ?#H" K]! !8?#"F HK F`! F%̈BIOs-A"@L#F?I?O#V#hY;JBD#CS#`#h7J@*J)=4I @F-F 1IBF =!?^*F-IF#;Cx*I*F)I#"%b"hhB"IhC#`Ch@FG_HJKFJ`! KC#C#`#`LKKIK!!!8 !=#(Uhh!A8KLhMchk`2B2A khc`##8bh;A1??xE][!!8!KRKpG!8!J IzJ IxkF[ijG bj IkpCj_ iIG#j( ""C#b6##j"G??Ch+#jC@8mFУhHch%#H####%oH## #%o"hH%#H##% Ma@ B=, 0 O + 0f0M0Lܳгo$0+FВK0#0#+`OэK4K0 #0 KH*FAp +hO;;+`0)hB+` 0+CвoвxI :wK0 #uIqH%*Sv g  e  C 0+$*`K@C!`J`HB(0++hIF]J]H2]J2 2JFZK$,0;XKXJYH #F$WHSKOqHJFOsEz@AFHFARF1FF8F@tF AFHFA"F@hFFHFAFAYF"F(F@\FF #Cu# @!#4 RFv.H$IF@FAk: OsEOA gw GFFF2:j ̐,0+#H$ $`h "40+"H$\Bv FA2FYFF(F@F FFFA 2" $b;ԡJFIFlH$0$ h *NЦF h  2h 2 #C# @!#FPH$OKj+ 1cQyU@GH !2F+FDH$w.7OsFEr 01F@FA] 9FFHF@&F 1F@FAQ"F@FF1F@FAE"YFF(F@F1RF y(H $JAF0FA,: 6OsFEOAAF0FA w6OsFEOAAF0FA 3It1"+F2F@!H}μVZ_y!g̐F!F I &`9FA 6DB pF Mk(ۆB Bh IF H$H(F.a} Hx6 p!#J#p? `"J`]JF H( K(FF(F@*F + i#U>`!D! p!Xj!!-OFFFF(H%#&DB { x405BI%H T x ^+\(\  HYF=V( 5O500 x00 x00 o̜8I"@ h#jF ` I\( ۽0+;J`0+;JS`]!X@th̘ KZh B)iBHo !X-GFMFliO !+iB$4 F4FFi+ #"#9FF0F:P F,̿4,i$kiBHIo!X-CFF0H:oL0B̿H F FFB (F2()i;F"F@ (-hLF!XKJh30 Hoa9 Ki" 2 #Da w!XB Kh30a8Ki@Ho w!X-CtMuOli:h`3xY2I +"*6` )ŀ.Èé..ooooooooooôÓ^0-и^ LD"0?ظظ @:h30 A2@ (I@&#HI "`CF;3@h"+@HWo F20ZԸ-и^ O3#DO3 3H@#.I "`pCF;3@h"+*и.0/li*/YBYA0xBEz30u*К Xxjj;0jikh`3k`,i[B,+iBڤO4!X w!#Lc`ci3chh( 320`x,* ;* bh*F#*c`h ѣ` Z x;+`aBу !X! L FF  +U{3B:!El!X8F Fp@4hIFH#Hp F8##+ia pB <\+9 N0 3h8"#3`3iSIH($H8F?(F 0F9Fc I F,/*/"bU"ZpD3iI" F !X8J1h8#@ C`!XF H  S;"@hO1#@;!X'8Mha1da, *1I @B"``3x 3F30, *ћ+2x.*rx *0300FF0;0S+h F" jiFQ`B#10;0++hԛ8FFF(o!X oP-GFILSBhn8&E+(EBEA030%0FF@FhF1ea0hIFN#10;0+_ hKMѽ%2FAF H0;0+4o#i9F B̿z*F(0FhBF*@FF8FF03`^`00hB¿h5=D#h  8FF@FF !X-GF2Lh2gaBF ܺB ]OO -4 '00F30%F0;0#h J* 0;0##hԛ6h=`i=F'0=Fbi@FF F(o!X-C F*LF FF 0300;0+:#h 2 L#i9B̿h FHF1Fh9F?#i5p[9#10;0S hѽo !X-OF`LF'#iB̿H F0FFUEW!{B ۷=F0Ou5D30)F[(\0hP;0##hgԚjEJAF10FScF(y0>3fa0 (Cbi(FFP(<0"!;0+%h9;(F(FF(M*i1:DB< y1IF@:hIFH"Hw0;0#h  l0h;0##hԘYF*i8D@+i-hDQo!XR pF,La.3v01F30F@h!IF!H"R!H0;0#h  0j`;0sQqjB .D#<(F#hԛ;x\+{x7?+7!X p-C#Ll2CЯH!sF o!B=@B0 F5D30)F$@bh IFH"H0;0+#h @ 0nP;0##hԙ1%@!"p x +8"B!@B0.F6D301F(0b;0##hԚ*Fo@1Q"ZU8x!XBXAt!+B%+!nB$۵F0Oy  D30IF(?o0n;03#h?z?|0!xSU0Yx\)љ[xU5F|B0!B!EE.F0FF6D301FW(?10n`;03#h?<?>0nZ x1ZU1 [x (H1a+DB!ݳv 1F2 (?0n`;03#h??13Np DBvp{0++1{H!X pH%F>>aCB!ݳv 1F2 (?0n`;03#h??1>F+D++Q*>D! J1h8#@ C`!X KF1x!+ I> /! FU;V%EF Fn)p)l) x + JHEE1 ho(FaiFF( F+n*p*l*0 x +1 (`iE0EEaiFF( F+n*#p*l*0 x +1 (#B3caE0EE1#2+Dch+HwSx310Z Ho w!X8Pc,F(?r% F+n*=p*3l*60 x +M!i (Yc/(R(3x 1KN!0F(@JJ#1O3`J`5E0EE!+ОH"1F:&3x+H ch+Sx310[F(? x!+ѓH%E0F+n*p*l*0x +ޮ xH":HTLEE1 }H!i F(ҮG @ (ŮG/V/(F1)F31(E0 F+n*p*l*0 x + EEbh*?%Fn)p)l) x +pRJx+?PIQH"VzEF EEbh*?ݮ%Fn)p)l) x +F22+?REF EEh 4H,%EF Fn)p)l) x +1 0h8EE`iA#F( F+n*p*l*0 x +1  B?E0EE! ̨̤}!\ ph`Wx(%3F+n*p* l*03x +-9FZEF0EEaiF( F+n*p*l*0 x +@(%@0@@aiF(xLF(pch HYh.'#iB?#FE۾BڠHIE0 F+n*p*l*0 x +41 N0F?h"+9Hb'̘! !p*r*-[x +)џHE0x *"HE30EE2E#2x *0b30 iRF0;0+ƫ#h "" hB (x#b20;0##hԞ=!2R# gIX(C2Ճ# 2 xn+7p+&l+.aiFyF(i F+n*1p*'l**0 x +E1 _!2C22 2C2CE0EEaiF5(&F(ch+?h.լ#iB?Ѭ F+n*p*l*0 x +1 0FE0EEbh*?Z%Fn)p) l) x +êEF EE!8Q(0O5%x310Y)aF(?!ich C73 F+n*=p*3l*60 x +}1;3x!+ АH"1F93x+1+?`NHI#W/F0F(p#iB# t(dE0EE1+?V2+QqMoIbh*? F+l:Ҳ* x +gH Fai `D2F("0x1;+?~\I "\N`0`@80?nh"+ UH5`E0 F+n*p*l*0 x +٩FK*Fhh#iDBFPEE%EF Fn)p)l) x +ch[h4H!6EE!ich+?&(% F+n*$p*l*0 x + 00T2+HE0EEai `DF(shF޻ HZoj! 86!̘@'HS+!]pG!\0Ix^+0x]+0x]+ +[+Dx.۲+ % F/F])ѢB0 ) F 0 F-GFP,F#xB +0e(!BU@B4O.F6D,;h1F3;`(7?Ph+IF+H!+H;h;;`(Kh 0[+\+ 4F(Hq&0Fcx +HF g;hJ`;;`+Khԛ,a*F0F> K"rU@h+)F0F #GԿ! p!Xn!p!!\,Jphx (*H! ( (L01'H0FpY`[x +ЃBKF!L0Kh۹K&)F0`Kh0(J@'0~0a h0(>h= IF H!H!!\!D!H p-OaNbL3hZ2`Zx%*@𱀚xJE@"h33`ZH h  ;h;;`30񇀙3hZ2`x#h *ZU3h*x*@;3`bhB@BCO.F6D h;h1F3;`(I;h;;`+:KhWԛ#h"`ZU\*]Z2`x5"h + 00Kh{̰̀)(=П0D< +53hbhxKE E۵F;hOxD h3;`AF(>hIFH!HH;h;;`+kKhi 0#` 0O%]F!!!!X! p! oP#MF `F`*hx /J`##`  +hx *кB3+`x1)>x$I "`(h0`@80>hh"+H4`og*3+`#!!-OMFNF/h*hh0B"ۜB@BO&F6D:h1F2:`(;h`;;`+xKhKԛN+i"U=:x&*^   Bܤ KFSE*iH۪ Eȿ#FD  {2hYF22`>h\IF\H!b\H.3h;3`+o FRKh  3h;3`+IKhԙD\3PT\*Xzx 1)R0:BN  E ܤ KF[E*i5۫ Eȿ#D.O q:h2:`H>h/&IF&H!%H;h;;`;h;;`+KhԟՓD\3PTFB@B2h'F7D22`9F(?[3hp;3`;Kh?k?m +iU45!!!X p-O} FF#}(Kh#!i #"#i"# 4F0O@F }FM` h7Bg E?XADq(i 030 >hIFH!HH0;0Kh + 0;0+vKhԙ0 ( 3 # " F(iZF!F0D>BFQF F[hBLo  E3ADq(i 0308 >thRIFRH!QH0;00;0+JKhԛ0+# "QF F*(iRF!F0DFF>J D x(BذD?  E'ܠIFOq10D30(?>0;0;$Kh?H?J/ #CHDh  C"!F"(?쮪 Kh+# "9F F(i:F!F0D> J+i# +?Ʈ!p! p!XR!-OO$BLFBMF0&h;#`>K hKE &`S`9Ho h0 `:FF^ >!hFd(+Ji +hO 3+`0F F+h;+`+"Kh ^ "hFgB+h;+`+Khԛ&h  XFF$F(:F1F0F<( !l!!d!!X!`-O[O[N;h3h3sh3VHXoSL#hRK"`T 030S $(F(<+F # C |Ol E ^AKh x3h0sh;`s`0;0+a7KhV  S2 ܾ' `FZXZP :Dhh  JhPhhh`P`JhhPh`P` hQ` ; =?a [!h̤!!!!X!l!-A &M2; Y J#+`Kh`JhZ`\ Y/ D+`hThhB F F DF#F!!l̤!h-CF LFFh"hB#hO bh8F P#50F h`0Z"`d1  "`'D(Н IF H ` H,`h ! p>IFFH B  p-O]NF FF3h˹IrhK* FG()FH lpCO>#`o Ob)F86o@>?# FY(pCOгhS FYz(pCO3hkh[+x/+0(FYhH)F FYv3hCF@!F(F<(8~H"F)F (#FxJvOa ovOb!F 8 F(OajJ ` v `Y (eH)F/!(F(Y/! F(SG9F@F3hs!F(FY(~i ]shoc)FF[ #FY +F!FH 4\1\0Y| F\\YummGVBu ۷BA ےllB\1\0Y] pGO0m FmGVBu ۷BAۉllB \\Y`O ## 0#cf%E#c#cE !@th̬d i!dxv#"cdff#cdf###`##`#Oa' 1#'cbb#cb#b#a##d##b##g#cg#cd#f#g#g##a#0##0#cdE@=tIFH, K#n Km KK+++KK#n Km KKKKKI ' pfCeQeddfeedt)xtQ̰8FKh<jFHD\ D8!H8FKh<jFHD\ D8!Hl\ $J@Az AObXfC= hIFH  ]Bh@AiJX B#THKJhhC @Kh# @ AH p~!@!D!K\hjHXHFX!H~h0lKJhhCKAh˱ # 0bKBRK!0I H0KMhK*FKhXAOrDp6F F(F0@XY!!!!! Kn:f*oB (КmQeppGIXy oP opC O س_гO I * @O г`O% /  | @ = 9K-AFhmF,#4H4F3Kh۱3Kh+5 #"2/K!#@0,I &+H9FD)K)JhhC40F&KDhC%KhKhpCOѨhD FKJhK) FFKohX oOrApaF; FF9F@FK0Fhp!!!!@!D!<!L!!!hF>"K(FF  BKh[5B I#IYBBAI[bBA5B 5B!X!`8Fh8#;CЪi Fij h-GF xKKh F`&hPP #;C0m+#ajsH0qKh+ #'7BlKBRK!&0hI ifHhijbH`Kh+ !k^H !j[H[Kh+ iYHh0C_Zj"TIز1C!k #PHakOKh+j LKLJhhCi0F4IKhh;HKh3pCO:hpC O0FM h`=K,J02H!F@FW> 0 @ˌ$ˎaF8FW'H!F8FW`<h+!H!F#@c8FWH!F58FWH<h-+5!FH8FW!F(FWlFH)Ffsh+?y"F)F Hzr!F(FFl=cqЅВ28sFhFFFWt( I d5vK(F`I!FUWLWWp罱W> F!LW:WW#"F1F0F4( I!W& F)FLW et^a-CMCL  Och+@IjFh#'0W( e(<9Jh8FO60F MDhOBIFW(<-Jh )IjFh#0W(<&JhOBIFWh+a+F$#C@ƀ.8.$#.IO#@HKOrCF::C@5O#"#h9??+)v_3I O0O3c`)vP"'#h9;P'Jh8F#Kb*ڣj+!I"F!h9(,;6Jh 3J-`v0F)F9CII#h0WX(; Jh # c`!$!@-mE-O]{O{K F:hX x*F&tIV#0[bS#"F#0+:;h+ɀ!0F##eJV|dK;FV,9v`J;FOq@F]J3FOQ,@XJXI(Fh ]t0ӱQK!0F##GJMJOQ 9F Vx;h+DK VhBK9FKFV,9$7JKFOq@F;J;F6K !7O0Fh z0 h2Kj;##"J#!HF#JxJ   L9 JOqPF`JOQTg猨9&F Vh,l p!ju"A!!`!H"B !X!h-CXMYNYLh+#3`30 C#i+NKOOh8hKMKMI8hh8h7hIIhVFhjpCO$#C`iV`@Kh+?Kh+(h(!VhV(h("0 C #i+ ,O2H9h)K8h"`7xO3`2C#3`)O#3;hj3b0 CML+h# h#+`;hӱKHh:n頹K"%hQOSI9F F(FI - h72!`!"Ax"A"A ! "A>"B F!X!HK"A|"A-AMI V (;Jh " V(;yJh wNxLsjp+^0CZL0#qKrHheipI(F:(nI(F:(#i3+j)F?gHfHfKh;+9dHpaHaH`H`H@A(F(\I(F:ع#YH0O3s`VK"`O78F MRHQHQH+x jxOH)F s+ S+ Y+`i(aiHHy+FHyĀCHqCHn@A(F}(4I(F:d(+x;H\0#8I j6HO5I(F:J4H(F92@CB0H(F(F%8#(I0O3s``a%H)F!"AXr!"A V{"Ax ,R"A_3Rl"BDKFhC F0O0 -OL =OOu-Kh+,I <,()I"FH4*$Kq"hBFB8 I O0*(>0+I HOq$&H!FiGL#(  W) !FH J`Y !` !a"B -GO $7H0Fh95F)FB#кXO5(F +I B(L'Kh+&I&I 25FO $"0I!H[jG0iF RIJF$H%F4 kH!FG(5F H Kh+II "k HG(232!` !!h!aGm"B /!MFHF'p1FH|툹h/##p-K)FJ -O0 MK0Fu")F9f/#X;9FK JE#p !l!`hF;`+ VEhZ` "ppG-OMO3F+hu( (+hjG(+h kDKhFF+7рL4 F FiF( F((O3uKh F# F(.@΀nI" VkKh  (ڨ FZ(оbK4+`O"FV(:8ZJh oP ;+! FOKHIH#y/+ 8KH9JIFH4J/ F FEKh+ F(0K@J+hZFKF F(O +;hIB FlG(U!B F(2? F(: F"('! F(!#y/+ e8H9&IFH4KBFHKF^Kd0[:Jh ;hjGI" U U2@_("B !h!l!m o oPt"A-O/0 /\M+hlG(+hjG(( TKhF[RKhU:PJh jNKhùNNT+hjGJI" Uk (ڷ ++hIB FlG(9KS@ F(1KS#@ F(+Kh+*HVP((O;h C#HVB鰹:h0B`CXKhBAK#BA F!(! F(+Hg+K#B"B "@"B!h"A!("A!l"A!!h!"A#y/+ 88uH8uIFH4rO0:hCmHV0+i;hKB`CXKhBAfK#BAYbO;hKbJ+hVZF`H43h \Kh [Kh+ (94+D +B;+;PHF+7@Y0CکP;h+?ծCO;h+?Ю"A"A!("A Kh+( (KhlG(۽@ "A"B -OMN @BHFO31h05@oF љ;/+2hI C 0h +<;+ P( HP"A>"B!h"A"A!l`!!"A"A"Ax!`"A!h"A|"A"A|"FU( :j8Jh ;P=P!ګPAFPF(PHAFH!h!h8LKbh#`KhZhb`O IOC O5(F8IOsK``Kh( #D 2 (!8!p"B !KL#`Kh+bhOIOC GO0IOsKh( #hh D 3(!p!8 !KJI`OB ``pG!8!pBK-OFF>I  =L#0c` (O9HF2PGwO{+F1FZF8F88g BzmK )FPF(? h0j -z / iB!#h(&"h0DaDa`# b#( K"`hiDa I "A@!8 qp&N-sh;$Kh+#I jO0p((K L%1h h( #haDa#Br #rh*5B I 7(ۄ%( !8 FIiaFFU?!8S-O 3S\ٰS<Qm 1EU[BC XFF2"O0(9bKh+5O 0 0FIFU(?OzO ,UKhUKhUiRKhBu)0F  B,Iy2U(9DSCJ8h@FO896>J;Fh  0F  (*9 S3J8h O8BA BCX)s9F0F3(O8@FYBC XKEB RI;F( L 0 IFU( 9SJ8h 1B BBR I;F("A!8&KrpL-jMN)h hp( #haDa#Br#p 3h#b (ۄK"O0`!8"B "AQ-A  2N2BOtp FFD`aQеh+F"F8LCF@jFEFD(F!Fn(O0!deE[B#,u2+OqqnBOqFЀB"Fq(FFiFDeaF !8-CFP FF.(F #( @(ܭ-ȿ(FB0FFFIF8F96 'D!8-OBCFX OThF88FUPOz # ,v#*/5,v(#C$O0'93J[Fh _@JBv8F"F(/d$Kh &C4 /*BCXIh)sYF8FJ0hFO E ѼD0$fvbDO U4BIZF "A!8-AFDL- 2*s'%' h0BADAq-#h4Fi*F9F+Da0B BA*I I (%K"O7`#Kh#hB+Da'8Fua(#6DBr##h2FF9F3DaKhYi)0F#)(0"hBDa܇!8"A"B 8 Li#hB ٥i!*9Kah8@X8!8-AFO FL- C,=iB1F,F&DF"F9T-F#DaO0!8-CFd FO-v C,8hOyBv 0O,FF"FF9F#D,0f %FO0!8-OBCͰFFQXUh 1F"hFF9=KhiF8FU,( 9S7J8h -v U)T.I( 8K#*1Bv8F*FT('0-fvD0&8FT(T9J8 61BBTI(O0 T9 J8h [ eM"A9!8F8*TTT(9^J+Fh 0TJ(9P4Jh  $J#4`8f"@p0F(FiFTD(!Kh '0B CXHh1BBB0CXHh1BBI*F u "A0 FFiFT( '0Kh۹pCOI F8$ FT(-9 J#Fh O0 FT(Kh59J#F"A"A𵯰FF6F4#g##9'N3h&Kh  FT3h[## J!Kh[##J!iF FTR`9hN+9|J#Fh M/9r J#Fh C-iF FT0 bMpF FFT p2F)F FT&(Kh5X9@J#Fh O0"A+ FThKh5>9&#FJ@h "AI-GFxFF/+O80O/ (FO /!5F(EЀiF(FT`@(Ff0/##piF(FT퐻p@@O0&Kh#:F1F(F!(FT(iF(FT` (FAqa#jF(F`O&O0"A-CFh#x/+ 1Mhh(0I"#k`O09 "C@AT0UZH9#h"J3h VN3h E'0`!h;FJ1-D(9d0C@$8F<@0 K$h5h4 JAF "4`%D"@pf"A"A-AF FFFFT>(@.Kh ( 1BB 1BB#I2F sO0pCOI F74h FT(9J#Fh  FT(/ !F0FT(9 F(/J3FAF "A S0F(4pCO)BCXPh(s U%BA## E `iF(FT0pCO  I*FO0'0#"#iF(FN7SF( P Q# 18pG-AF]VD,T(9\9J#Fh -7Kh;@$ F<F2Jh(?+=( F .K.JhhC""RS 3 F#h4۱5 F)FT( 9J#Fh  FTJ#4`(t'`g(t(@0CT` T\#0 'f"A"A f"@p-OV @@2(tO )FM@FLFF4;+ЙKHh7툹Khs  YF FT00pC O9F F ,X8𼀺"шKh+𾀅J#FQF T,@2 FTCu8r}J#FhAyKh0@$ F< *(@(HF4́+*dKjHh7x ! FT`(  FYFTH(80`JKFh Gq F#R)h 2 F0#VKh+$SU 3QJBJA"HF#>z,FTPGWS9F3 FS#TXGG9F FTP0L!F&(J%O.Fp#@,FF`;`KO JXFCKhKh_RJ)+@K`0C@Bhz(;S ˥5e5ˡ55555˻5˭˱˵5555555555555555555555555555555}˃55ˉˏ5˕˛555555555e5555S5555Y55e5c5g5w5555555ɱ555 5!Gcgg5b4K)` 2I 0I` 9-K,Khx-*+JYx#``#'K"&K'J`&K&K&KKh+$H0@΀!K"`" K` 0K"`J#`J`J`K "A"BD i "A p!<'!"A!"A"A"A"@"A "A"AKh(? vKK KKJ030Kh0%Ku E 4(FF I( 8JhE6 NF Z`KJ[KKRKPwKh(?^wK~JI~KJF}K~JC{K~J@zK}J=xK}J:wK|J7|K1gKhjK1zK+zKbKhSvK#0OsI`*᭸+S߀ohFPIPF6L(ЀNIPF(@ʀRFJIJI6<(@ƀp4+#OFO F(ѻ'8F2IPF6%0+?qRF/IV8F-I6(X0HFO 30'"A|"B!9"A"A"A"A!^TJ@6, "A"B o"A"@"B 2l|yI"HF6鸹030'8F; O !(FHF1#_"9FHF(#TrK#FNF'hoI8F6n`ch+?׮04030"8F4(ݭ#F>X{_EF'h\I8F6H(h`h(?ޮ4!(ЮTI66(gh/?ͮ4PI8F6,(FNI8FF:FhhEF!(ڞ !(O @FgF(ѹ9I8F6@F%0+?:F0I6x,I"XF6 !IFXFO 4!8F&KFF0%Kgz;#J%XF KAFL3I@J `K`K#@C IHM,@I0;0+򑂰1  oPyl:А o"AǛn pz*̀5309<{TZpv%+~#&QS$D!MD(hK)`?*hI 7K"D` K"D`KDhK`K"D `KJ`K"D@`K"D`K"Dt`}KDth0ٮIxK"HMhK>ϼDdaЬe_ ؾ  !`sI`` `rI*` `!)``mInIbFDdZKh?(DTgK"DT`eK"DD`cK"DD`D4|KM"+h]KL#[K`D4k*h XIgXIXH#WITHnL#TIQHhPIRHxK#=I@=H\$N^0Z "p[ h+4K5J`5L;++?w1L#hEr"FP#m(=#h3#`+a&KhE%I  ;S+"K`0Ӻ!R#3(#h3#`#h[EK"`9'"A"A"A"A"A!"BDG 0 .c p"B @ i"AKhh`pG"@KhбK Ihh8 K Hh5n@#I H"@"B !"AP p1F"2`F[?-'O*-+,B$[-+̼ Ex!-ф"DI:F o=I# +x##a F;x{!F8F0%2I:F R=/&a*c* C*M* &iFm*&iF$I;F 5 F#iC#a#И0@F0IBF#iC"a!0BA I;FBF  Fg#ca Kh` ``hTa. xWƔư"B-CFK FFh@= F4W! Fѹ 7I  h(1BBѽ@F#dG%"B   Lch !@``( IO0"B )CK-OF_h/YX4+J84+EB0CX@PF4RW!F\F LF2BE 1BB( i, F( `xU##:9G&@ ) FI 3O0!h @@B0b 4+ ##4i;a+i h0 F "B T"K-AF\hS8$*-4+);+&B0CP@Vh0F4 T!@U 52EBi qBB F+ѽ h0? FA:"B K-A\h&T4OV_]/Fi8h#8F -ѦBѽ"B Lhs!LGP`0I O0JKh S BB L h)K`05#h Jh  hQ "B r"Aǝ"A$ǫ Lh !@ 9`( IJO0"B  L#h !@= `( I0O0"B P" 07@ @B-OZNF3h+qB C XOB0C XpCEBQFCO#CFGFF(Mh1@Q"F( @BBa"(\V W *(RhaB C`E` !BEBi##B0CE0  BE""C"FBE/ X##h a`I* hI d"B 3n Li !@=9a( IJO0"B Ȥ-CNiñ%O F@Gi\Yd### hj5B"B -OF-F'K0@=HF4X! FSFYEHEBBЛj+0 TFR `v(H%@ FII OȺ"B -AFKFFFiԱ@=(F4T!@!jBEB!BB(FO0` h F "B pGF!KMFFh{x/+ iF&8I*F o MF( FhI*F a, F M@й(F `(s`## ##07Kiab`"@%"B -AMNOilcha3h cjh h;h C #3### h Kh!j h> h} Fzi"B "A FF@(ȿ@8FĿ@  FFBL"DBD4F eE28D[[-OFHM@,}ЀFLGRXk1F@FT @FL$O #hB-Фi, F(q#"#2(_2FAFBLU&`##0S' aC'@;#2`2BB 5 Jh O0 M2FB5J2FAF4(B`CXQh BA 1 5 Jh  F5JI #VnɆɦ"B $-CF*KFh7)I8F @" W F5 aF(70F^F `p(FX``0G(@h,!h0F4(fh(F1F4(0FK(F:``( I O0LF0F9 F6I"B /F KFFh h@"T @T!h(F4p0ah:F(F/0`h"B p%F(O0BB.3O.O TlhTB!CO0 phTADq039Q0#B9FF0OpB DB0[(DDK-A]\F@. * F7JO.#BD#<x/+2/JkF@   (AO0 ]^*) .'D|3F^D?)D3FO<p\'JkF@   (JkF@   (ڽ JkF@   p wV^iwpFh FF*F3e-p@(e"PMF/F h#(F#`3`pF F IʂOa KhOq pGOa"B@0# L#`\3  hX`ah!`!`(̿  0O0"B@8FxO08I"3 Kȹh2"` IK"FOqF(F O0"`(ʬpNrFȱ%hI(F3dh I F3pI#F*F  K J I O0p3h;+ I#F*FK"` I"B@-AFFOq0F0O0BB! FU4S #840K;+bK@A @A ` @[K "dFBH"F (lw"F<to" !@|??Dy`" !XB`BPH`BPBPBpBH`PSH` hC 8 &2),1)9Ж($/5);#BB4#($84K*K) " "$zh'TPQBCqR#4(4C C(43y/+!#3q `#4#84(4CCBB($BB!X$zhQBCA #"BL"BT-CVŰF4;+: 9("((Kh;'8FETI( T~I(T|I(TzI(T}HU*O Uh4#3# 0 !#5(TnHU ]kM#5ɲ)C(" #! (aKhh !10+B 1%(# (TRH6#"0!# #(TJH* * K#1# Ad" 0/87K"j# #c(T;Hn2# *,L#0+K!jXBH : CAs05YS"0%YB C?~T#I( *0#7#0BCXQh" KBH#  ": AEq00 Q"0  B)C"B@;'`/8ASK1><#(TMH @#(TGHFKO  C% S #F(T;H!<2!F@J5K "YFFF /K " 5-)FFOq0F(#FHFzF(T"HOq0F)(O5. ! N($@4 +?!%  U(KBXYBq*(@nVe"@iop]F FBB!hF3 SI@B 3`. J -kF C#SbSb<#h3bhF ]p?"B@8F2HoFI"F )F F8@;vFx-+CxI(FF`4hI*FF bO07oI+F:F T0F( F6F( KB L' F"ΌΟ oPL h8 h0@pG"BhpL,FO0p KZh*!F(& !(F.U0P p"Bh3S[K"`KJhhCL#h+I ##`KI Hh)F H>I 0@pG"A"A"A|"Ax p"A8!HOI"zM(`PI F"th` 8(h"j FO Kh+ JIO08"Bh"B s FSkK"`KJhhCM+h+I ~#+`KIHhH1F, FIF Hr I dp@pG"A"A"A|"Ax o"A p4IFHN  p0ͰHF$ FM0x/+I((I F"(iF FO0H&O0 &1BB *1BBJh3`pG"Bp4BIFH  p-AF=OFF|h;I2F;H9L F0zkh;k`+M(F"F F (R$ Y\B\Ah#$ FhpC O!Od(4>h+Шh H1FjKLi )FAFAFF(jI #FHT+ Kkxl<+=+/ Ckxl|+#F Lkxl&+#F Ekxl=+!#F > jx+*k' 6jx-*k( 0) .% ,# *$ (#F %#F ",FF  w"C\"CPv"CX"CDϻFKHh"C@Ks[hM.h+` PK.`0FH"xK*F3"` F1F F3hx3h3IxJ\ HL3(F!Fp"C@"Ol ^pFFF#- do[ls 8H)04 |DHSBHO)Ѳ??=H ,1dFF Fp1^FJC"D@`?  !,CC@?  !A\@C@BpO!!FBAO!!FBABpBBO !!FBBO!!@Y@C@AM^-OFFt0%+F F,T G9Fv0&+FFH##FT1FG;FFPF,CMFDFF F(F!Fk"C@"K𵍰#FF#g,F F;F2FF F(F!F (Р +P9FF F/. TF F F FJ!T" h"C@ 8 FMh)+8!F"C@-ObOFFFFO O ,o,w,5,8YH,##\FF$,u ",1FXFh#+F F MH.'+ػnIH`  HD TT'+$`.ѻ'9JOO6#3FEcf" F F## jJ #%#3FAFFXFjC $,F##u3FAFFXFYCCj`.8i',JO6$4FdOFT8i""C@УzЈ -OFFFF6##F/+FF F@+ FF1  <E$"F@F FECF:F0FF F+ F:F##p"C`"C"C|"JXFMF+h3+`N( +h;+`#Kh O0 +h;+`F#Kh $H F. K6 0# K HYh R/ ."C"C|"C`vK-GO sH5qO ;hhtoH! F(AlHe(I F`dH!F0FF aH2F!F0F1XFPF1T0D0ajF2*;h(Yh0D F1@4F)0FO#x.+cx.+cxIK%FO7O 2#x-+cx+CKh,\h#F/+?H! I(\0FN(!z2h+ 2'0F00F"!FF(PFr)FF(HpCO /0F'0O 0F !F0F1JF0F!C/2h+2'0F00F@F("Lt"/;"C`^e KYh)@"H -@Hc"C`z8L$(HF0'Khh#&HܲL, j"Mhh H 2kh#H,L h N"hhhS#S hCh;C`+ W"hhY` "p h 5#hX 2hF HhZ`8"LtѦ"C`Ѻ -G FdM*hS#S4FZ{_I8F1F(\I8F1F(&FFO E\,@.Yx0)_С\ز(|+zyyyy{kymoyyyyyyyqyyysyuyw F(hCh;C`+g *hhY`p;FFK,0k(hCh;C`+U *hhY` "pZ;+Ѹ (hCh;C`+K *hhY` "p(h *h0?##I S39F$ xF10(B0F$$ $ $ $ $ $F$hZ`hZ`O_&]hZ`  F)HF FhBhB< + /#O;h+@"Kh"I"H {h#zhIH H2F)F ,IH FIFH 2F,L hCh;C`+ "hhY` " Hp@ hZ`"Cl"CJFh>!`p"ClFK aXi0XaO0 s F"ClK\i"a"FiF aDDM Kh3 K60 F! 2 2&"Cl"JTKh "` "CRK` "CFS[2D)Fh FF FF262F)Fh FFO0R FFO0 FSK2!Fh@pG8 FF2*F!F8@hO0R]pG FFO0 JF0 H ! J HBѲBPh2`"CKhpG"CpFMF h( ")FM"BF hM.&``h( "!MCF`hM f`(FpO57MHd+hhK"6 N K\h\-h Kh#F2F(F6`hBB $h F0"Lt"C"PF$O Fh5' *<#`0F)F0 JF! FgZag ++#x6+ cx0+I" F,p F0P"D=0+<.+0F"p@N"CpvK"`"apG"C7FmF 0#h;+h ")F[h#a iH ")Fu" FYhqdhhhh a0M,jH"F!D00(bB H!D0 K,jhy"`#q F0L(j,b"Cѐ<lFh+уhch@Kh"hh3"Ph-GF!:O0FO5F;h3;`DhFsh@F+^F0K\b;h;;`#.Kh h1`h#hhF0 -(FM2FhFHrh@Fah:"g;h;;`#0 -!(F s+M! i`h!-(FMPM$h"C"C"C|z-G F(F^`p! |@  |O_!h)4euoEU~jK^b&jKh d0+dKXj(. c`hQF^0[Khh?, `h!^0#SJSjhCY`h!^0+JKh*[j+;h )F F8$)F FlNF;h )F Fb;h `h!]^0+4Kh*Zj*h,\b;h QF F;h QF FH;h QF F;h "iMK"Zb`h!!JSj[ Sb`h!KZj*";h F")F F H H  >"L"C"Nӏ-OF! FfK! Ftt&h` @EF K^bױ ^0khhE F& 0+DIF"Ol"C(-GH(Mh7%L $K & hh0*x  0;Jp0+k +0+xF;F=F+{#hF K(FjlKXjK"Zb"C"JX-AF!LF&i3ahh!/^0h+#i;#a+ #`+ #i;#a+#`ifb;a;+fj*hcj * +Ѩhhfj++"C-GF4GLF^`fj  ooh/[ `i3a/h)i0+/7K7Nh0 k5H hh e0hCh;C`+= 2hhY`="pxh ~0hCh;C`+0 2hhY` "p0h "yhh dhAF^ fj"h;+#i;#a+`?h"QF8F hhhZ`hZ`+#i;#a+`ifb;a,"C"PӠ"Ol-CFF Nh`h"3`Oh,/h #"h dh+i(F3`YhL# #hAFh +#ieh3`{j5,Fh^P-{b mh#F"Ol"C-GFhF|*h J 0chSMKNNhNK0h KH 3HH -GH ~0hCh;C`+- 2hhY` "p0h >N-3h3`! FRF!FF(R-5OHFSU#{b'IF0h " #hZ` b(*(3h;3`#%Kh h! `hG3h;3`#Kh -И0㱣hӱKhK0hE H  KGh -'sxb"P"OlӦӺ"C"C"C|PK0ɰhh##*JK0ӱhHKHMhHK0h EH hCH ?Kh 2!F` 6K`mh( $xhZ`#x02K eh"1I(F/55`$hh+KB+hC+` %>hFF;VF˼-ѐ- рx8 Kp(%F (  0 +QD"x0+?;+ JB?JB? !)PGu'x03+ (x)9) KB@3hF3Qx-(Hx(-(ъx*Fh# C + }K"Z`h`@"` C O3wKk KvK!h+ (@hpK+`oKh3B@J h  +Y\#x0xbL9!`` `I h"c2 `^J!`"]I `]I ` b[JhJ"JG`b PK` TKUJ`UKUJ` |# RK`FK"Z`* c2@ ;KB@4+ 8KhQ`hR`"`*@X!8m;K&0++ѽx0C[hh3Kh"`"%KbLGF)(a !K` (K`Kj*Ob@F F^  g(zCK`Kh+b_1&Jh;h`3 FFHKh+{!$"C"Ct"P"Lt"L' i "PT"C"C|F+xtKh+sJ bL<+ oKpKXjhoKBh +` }hK  j8^!C #F ]L#cb h*@ `bZK"`ZKh+?. *RKj;L! OJ`OKh+h N!HN FA &5F"+h`#`# =L;3`3`#h3#`;Kh`:Ih  #h;#`#2Kh +! (-'Kh+& 'K!`'K`'K`#K` K`&HpL+h#` 3Kh +` bz0PK`K`hK`LB i3az H|"Cx"C"C"Ct"C"C|"L\"PT"Cp"Op"Pl & 0eJi ;ahcL3` 6 8`K^H`_K`^K`^K`+h #`ZK`RJh;`WKh*""2QKXj X NKh+ # JJBJJB@K!h`#8 CKh`h+ٸ#!J F-hS`I*FF r"C -AF F*sL$>Kh3"1FhFF#ah5H t8F D A2H ?2H <)0H1F bz.Lk hCh;C`+B "hhY`*"p hCh;C`+8 "hhY` "p4H H1F 8-M`h+h3+` FhF +h;+`#Kh H  HH1FhZ`hZ`"PԢԺ "C"C|8FL h0*xxB%+`h8)F/N(4X8FL h@x+xB)F/<`h84 K "0%h I:0Q;+г(,۝rhј"C-CFL%dd#h3#`|-#h;#`Kh˱C/0[ChB h;`8h(5+0F"C"C|"Cј"K-AFhO6Bt%3xF+B:*,F:)*lM+h+"..` F.`l<:+5F*%*. H9F$(.F,F.$"Pј-A&MX+h3+`|.+h;+`˹KhA0+ #h`h;` F00 (F#h;#`;Kh#0@"0"C"C|!@0+@h  -O&FF5F4FHeP9h xc+,CTЂHp(v(V(DO%zH 0 h*@uHvJc+FuH F rOW (9! FkF(K-ClH h !+(7iH$ hgH 0hsdL hCh;C`+( o"hhY` "p0 h,PFx#xB!F.T( !FXRH QH $hZ`AF FFر`.dVZ^ C" F `'L `;Kh3/! F+[F0"!F$A;=-I!K-H/F #H&Kh! FK(-$H ~/hXF H ss-H-H-HH 4O _O~ \O Y|ՀՒXյ "Pf >%:W"Lt-OaLFaMF#hF(h#h` .>Њ.؀.:.2 .'/.3SI h: `*`kF *Q"JJJJJJJJJEJUF@F=J z9N0`3h33` hxK3H 5F(J>$,"O /*ј0/+ 3F"pj/K :* Ҳ * 2h:2`**hQ)`2h:2`* *hQ)`ZFB*`B*`"DL"JX-AF)LcikhB 'N'O`h@hBϿ`a`$Kca3h33`M3h;3`+;h+"#caFh[aaNOcihHhBȿ`XhB"3h33`"ci3h;3`+;h+"DL"C"C|"DP7Fx F!+$Kh0 0@+*+ Khh"E;S/ x* 0; +/# "` F F/h+x =+T Kh-+x+KhBۛhD: *G;.0+F0rBwF I"FO  h(3"&sD;+K 0 ;+ ۲ +0;0#;0;0R `. #F"DL"C"C|"C"JXFK-OF[iFS {h`x`>KFOZhVh:K3  IDEѸ#x+ D`UF xɲ)Hف(UF k+O.F#5BЕ  85qE8*\*F5F*x-*&jx]*#Ё*\*5k#1 :( #6 .(ؿO 5BO 5F *?OFDF*"d-OFF F #x*+N?+L[+@cx!+^+'ѣxx.2]*<[*&Zx:*&Zx^r]*/*Ё*њx*/*/*@#x/+(Dg4c:*њx]*À3F*3x/**3SxҲ*ف+4 UL+FfjxxҲ*ف(1 x+ 1B`j)`jJ(BL$BICBx/+E#< F($0B/#<#x+5&k;FF xɲ)ف(F0@F./#<x F1xҲ*ف( F+F+BӯHH& 3(F/+*/#!F<@F,F(Z{.*Ѻ. "8F(.(F$;3 "DL"C|FpFx3ɲ )F &x<p,XpxQ-ً,p+F F,F+pFF$M$NbhF;C+j`h`#F$h+b*+?+[+hj3h/j33`PF-oO`hbahhj#kb3h;3`# Kh 1+jB"`8h8`Fh("DL"C"C|8FM8+j`h`x,b$h"DL-CFxF0۲ +رB'O1 FO  F xZYF B<"ZU*ѽ:L *++*- F"xB   =* ЊB MHE*FF !.F+D%+HF+5!F -Gvxv F FO#00F !8 #F0и/ N F-#<=O3h;3`+Kj"JXfffg *-OF#xF-+F +@򉀣! *|L[?+v@+0; +m.# "` FTF.h+^x =+Y,@KhF/CNMLx+E\ ;+ +h;+`+#hZ"`"p+h;+`+S#hY!`xpqK&qMԡhBK yc0fO;0+;hZ:`"yp6bK_Lh!h$ `^K^K^KC;`#yp@/VKhOJ!bh,KLW;+x+1#hGN;#`+3hZ2`"p#h;#`+3hZ2`"p;h+#h;N;#`+d3hZ2`"p}C3`#pvC3`#p.N=x+0 ;+ #h;#`+3hZ2`"p#h;#`+S3hY1`xpJC3`#pCZB2`xp#h;#`+ S3hY1`xpx+ћ(ZB2`xpC3`#pm"L|"JX"DL "JP"C"L\KNLZhVhK3KY;+?# /@x;0+?𒀗ЇK0 ;+ 3h;3`+t#hZ"`"p3h;3`+q#hZ"`0 ;+ 3h;3`+#hZ"`"p3h;3`+S#hY!`xpC#`#pZB"`xp 3۲ + 3h;3`+#hZ"`3h;3`+S#hY!`xpx+цgC#`#p`ZB"`xpO SC#`#pLC#`RA*N/Kx+?G6Jؠh;`+0Z p7*C0p0X-KhBShDOKSJA`pRF0F ,DSBJO,W )ALF ( uC_/0+  F) њ)ښ@)њ =*O(`hI h: `B Q!p'B "p \I h: `* Q!pTI h2 `B "pOI h: `* Q !pB "p( QB): &/8I h: `* Q!psB "p,L+1ɲ ) !h9!`)H p h8 `(D@ )p *DA!p;D@Hh1`f  F)@gF *F@h  h F"P"Ol"JX8"DLKh8`(C0kpச ~*ۮ=)+?ծ#)F F,C0B pTF"JX-CF:KFf0 "7L)Fh'a0ih#`1Kbg`hga0/K`30vS030 `p#hp;0+*#hZ"`p h0a F"AFj#j"`+i )F#j"`i*qh `s`mC#`pQ 4#jG`` b"DL"Ol"JX"Dh"FuKh@0-OOq4Lܰ&h01O;h;;`+FO#hZ"`"pP0F15D(F>0 h!K(FhF Fl#h:h0D `D;`+ `!Jn!h F+F+*ѹ"3D0FY#h@F=+D#`;h[;` C#`#p"DL"JX"Ol -O*(NF(O!!FiFF9;h3;`0`KahUDи*HF")F3h 5`;h;`3h"p#x+H*FI  Ja H KFJF9""DL"JX-OFrO+,FFi9 9! B0308``K,ah5DVDM ,|,!,FO B ;h"pJF)F0F(fфл44tO BӔJF)F0F(K#FНB ,* *Fx)22B8FtBJF!F0F(AbЕB <+ +Fx)33B8FJF!F0F(#x+44BӉ,Fuc:h=C3D;`>00B t;?;h<`0;0+ c;`##p;h;;`030C;`#p"DL"JX-CFLFxh!p'ha0ga#`Kh00;0B#hZ"`p0 h"1F0F F9C#`p"DL"JX-AF-LFA,H hCh;C`+&"hhY`&O"pB"HAFw hCh;C`+"hhY`&O"pB hZ`W&6+DhZ`W&! hCh;C`+ "hhY`6hZ` HHKhpGhB`ќ Kh) Khj3c1 i@ pGh(h pG pG"DxќKh2`Zh:Z`pG"Dx-AFMFlF+h3+`0j  *0j`bKZhB`h`h$hB`g+h;+`KKh3A_$"C"Dx"C|ќK-AhN,j3h'i33`@F+`D< + +KhiCah#`K$5bhZ`h`h`#hEob#``O02;i+j#h;#`+chZb`x-dh+3h-Xh#+BF!@FHS"!@FH($H3h"`Za2hchQiWa Dc`F)F+ *!!h:`*;#`+#+p#.x+pK03`hKh3.pH`"`!`!)oќ"Dx*G L#h;#`+chZb`xD#h;#`+ڽ@9"Dx8 L J#hh`hRhaabhZ`#h`O3 ``#3aќ"DxFLFI#h3#`"!(FHN3hh(7hi`#O`a K"``#s`#h;#`3Kh@"Clќ"Dx"C|F-N!F3h33`H)H)FHxpCO)#" F*C!" FH(F I$( FHH)F#" F#*C FHH)F FBH H9Fp3h;3`# Kh +"Cbpvד׭"C|FLF#h3#` . O(F}`+$ K^`#h;#`8``3Kh@X"C"Dxќ"C|pNM4h+hh3+`(i#j˹#h F3`3h Jh`i`i[hQ`s`+h;+`KKh3p@"pќ"C"Dx"C|KhpGќpFNM3hBpBH*ќ"D8ML+hB8ќ"D8FPM+hh(l+h`8ќKhB`pGѤ%Jh%LcC$LehB5F"E p B2eF b`) )$O30 bhU%b)Ldp/0"Fbhc` "HOr5ѤFSMhB%RKhRL(i hCOH!HX `0 hKI ` h2(`GHFK"N '8F*7/8FH `0HhB! ! ! 5O! H9hB HP0-hd"F*H 9h h0;-hU"F$H4HhB 0FH,0-hA"Fh h0-h3"F hs! O3#`T! P! L`"H"JTѤq"JP .F0+fH2K2Hh2KaYC10N% !Ow3h33`B 0B(%K(Hh%KaYC103[h? ѻB5!^0-h(ЌFH OpO5'; 3h;3`Kh@bQh сBU`p2"HVOr5"Cؗ~"C|8FM+hB+`Ћ@! F]+h;+`3Kh8@$8"C"C|-OFFF 0hI FOaؠE`BԺ; F0#0%ݪph1FRFKhBE?  ++ +E :0+ї0+k8Fx0  BmnKnHhnKz@hZCB]а?\O B -" "!cJXF XF+PFh  3h^J!HFHF+BDrh  Q=XIHFHFO +2!FDXFch;c`+ F9#h"`!FqG;3m># fW+" "=J!XFO#7J!HF5J!HF(OsB y "IFcshHF+D(H  @IFT˱ch;c`+ F#hZ"` "pch;c`+ F#hZ"`|"pch;c`+ F#h6Z"` "p BFI F3"HѤOr5غg0Fp@ճ DPh PU4mh-(FB! p$& F +; CC+OrB 0-OFFGKHH[h x%+c PFPFCAH+%@JQhB!h"D0ӱ Fkx+Ъx2-+%+++3K $i ,-HO)Fn'KZhSD(K!(Hh3000+ kxp?+YF8F(L4F69FPFm(((F&nKC;Ԕ Z) "R,B4HH$Ѥ"H%-C.N/HH3ic-M.O+h!hP0F#*H*H!O1h O A$H2yC1#0CE!Ch;C`+# hY` "p F+hh"[h*`+  H 1hZ`"H"LtOr5D4f '=F>F:H0s;D+7Hj(p(g(F'%0Khh[h .H!F`+Kh+KAYC1*H&0FF.)$H $N0B# kC H5X0hCh;C`+1h0 hBԿ # #P`p0;! KCX0hBԿ # #Q`.Fnr"Ltٚ"HOr5ٸ  Ki !V(@B"HJiH#;pG2 pG pG"HKF60 Kh Khy Kh KZC200hI FpG"JT"HOr5پ-GFJM+i+G?\#+a@F;DO;h3;`(WOhp)Fkh",`O O1@"F:3k`;h;;`#3Kh ^/O! F;h3;`.K0;#0#63h0s. pC;h;;`#Kh 4 F0 F40O QFF,#F"EPF2B03 *4w"H"C"C|F?JFFh`=K>J` F F :K`/h..8KN0+A0˹GF)F G1K)Fhj0,^h @RF*H0h!F )!F %!K60s!F !F !F /K"a.!F !F 0+F(G H)FGl( I H."JT"Ct"IL"HѤ.b FF JN js0+""BO0H"F-OFF #`hL@FCF( (F,h+#h+$|0300F0"B/00MKh+~LK60[ BvѺt+t"{qDK!Fh0;0+?Kh+0РO rFSFO BӾ АSBЀ0!0h?ЩB Yh?= O{YE/Yh? O{YE"3AO1Y`!0`FO#P"0C0EOqE"N"JT"C|"C"H"-GF F F" F(.KN04,N0hFG*B4hG$F F0,hy@j"F HWO| &@0BڽO0C0C0 F64Д0ոД0#0*F!F8FѤ."H$ HKhM,+hhјxFH< l(p(Z($$$ ,K6 "0 D@Nx!7h."FF8F+h*`Xh(0h!FE"Lt -O&OFHFїKhhOZ"0FFuH1Fn,p,H>hO F!0FH1F$к$ F {JF7h?!'T;shh*݀$! 9V-@.+"F0F h8A3C!F\JF(0T<0З0+!8F?F. F0Fh]QK60+8F0^C0KВ?м<F X" ѯB!(F0F~s0 ;!KCX/J! *(Fak]?cWF 2S) 1>0%-?; *5?2 *-(F$&$$ "L"Lt"HpFG3M+h3+`F 0/K1Fh0+h{@RF(HY!F 0+ #K$JhSCJRhB! FF! FRF& :(OrB+L0+ F+h;+`#Kh 0Fp(OrB&6"CѤ."HOr5"C|1Kpi0HF0F -H%+H&1&0B#(M(hCh;C`+&*hhY` "p KhF0+:hOrFHH51hZ`M F+h3+` F1+h;+`F# Kh w Fp"H4D Ѥ."C"C|HKhh@}"Lt FH h@p8L0C1"B ۓPUP-Ho(F#ca823 "H-G!fO FOSF0.0>"#;F;+9jv UJ)#>;*;+\+"э0\#0"+рF;+Њ+؀+=+Yأ"Ҳ*o%H"0F6J JFFHF  0 CoCE Ё"#)J rF;OOaO}bF"0 +J$#"#I- K IJF%:#s*0 }+If0 w J$#] J"#Z*FX"HP2JMѬRX{F<𵇰OFF,mi+j%h-$7]rEO""   XUM"hBJ!~(F"hh:*+߀zHB`h!wHwHh.F`h!sHh%`h!oHoHmHdhh=޹ch˱iH hh!+heH-hcH`h!waH dh5F]H`h!gPH}YHzh!\hSJHpSHmh!ODHeOHOH``h!B>HXJHUh!78HMFHFHFHFhCDH@`h!AHAH7chh3`oCBH)t, D4C hp$r5UFF-8F ApG, 4S l)F@FDh(F)@Ft-OK"M$` #HF0Kh+hHp/r/d/+hx,h#'8$ F#!H;KdN(F_J#Fh2`$"  F(F.'L&h.@"h2"`FpL :&#hDE׀#zH"Fp!h"(hkU(@_8F \\+˹ FF(ѝ J+KEйIF&(:[HIF&(@𻀼$hh2h(N:2`QHh:`*:[FF},Ѹ?wIHh:`*[FFkF e?c2h:2`* [FF $MyF sF A,I(h)>F:2`*XF0.$J#5h2`#OrJ3h33`p"(h" " YF&~(? HYF&x? i "D"Lے"Ltۘ."JXI",M$A-A&wHhF(@030FFF0;0#kKh jKhh-|.u^r#5F0#5kDw" ,`5kDx" , O <^r#03F3jDw!%3jDx!3`kDOHF,\r# 06kDw",6kDx",;H #<6L h/#h[3H'8F&d/H!F+x0 *")FF@t0;޲.'H)F}?BB+r H)F0(F30fF@CF0F0;0# Kh 'N*hg)FF HFCF"C|"Lt O5"C-O&f$5FH]Fh00BфKhg[h˱H S/a/H/EE& KF $yBѽ@0(KHY\TTX8Fych=U h8@8-AF T 0F0+р<FFT_e L=` F##qe(FG "L\-GF7O#{a O +*MоaSUc(,B ( o(,ј0ñ @F)Di3h+8ИF0a+-*ZxJ-*ћxk%ph( 6)Da)F FKHY]\r( HpFH )FN%$ K@@,sh+ѽGf"L\Tlހލ"Lx-A(MMȿ LLؿ FF a#3+q fih#ci#06ѕp/ '`@F'@6p0+6060+ЕN0+60N0F02h+"b*x-+#F0$K y03)(ѕ0ai!iH&iM*`ha b#j+`ci+"ibq "h`FFh32%`aAh*!Zh*3"ba "L\ޟ"C(F#@FF L #h3#` Kih #h;#`#Kh "C"L\"C|x0; + "!(K"Xq`"L\-OFF8F x.>`` 4<`^x-.ћx+FxB [x :+V;hRxh*<,Mѐ:2"F-H@`F%VF#F=`Թx:+ "F#H@`FO? I2FHV!FH$\xY:, 3 FI2FE3;`YFH"O F=h %3wF I"HvF%(Fޭ޴( F H K( Yyh)!`aYqK;"L\"LlpFLcj x9ih px-)Yx)aYx-)ѝx-Њ3]xBRxF:*[xiah Ha( HVxP:. 2Fb%eb"L\ -C [M Fih+}PhWHlx-*l4hbaih[h PHx-+0FD ,h$$+hB,ۣBDH8F*hAI h3 `Fh #FB"ӔF#FB#o #D4 B#DB#` h; `#-Kh 0FSLSLS B F,F+hBH$OFh+`:hF2:`$thYC+*;h`;;`+~ Kh+?yu+y  "L\4EW"C"C|np L M#hk+p+h&;+`+k"hk;cm"JXBhF"h,#FZh:Z`F$hD`8FEhkC`+݈ #C"bZځ"h`8F !"Jhij`$F;  pGxɲ)ف+тF3۲ + pGxFI\pG\?+ pGxFI\pG@ \=( pGFKHhkBpF FFa(FWh(F(KhB`KhB`p+x-+kxO3`HKhkku a"IH"IDW-OaMF+h=?F:x[HZKZJZNhhh2`+fѹ?:xf*3h;3`+O FLKkhGLK(hha\:*2`/ (F02h:2`*'+h3+`?F2h:+*_2`۹ +h3+`?Fњ$F F2h:FF ДE-BFFYB ()h1)`h`C ( Q (|+h3+`Khh`sS"@FW *jѠ("JXKFhFlFi *џi8F(~;F (JJ"! F/ F(r Dn J3F!% F K Jj-KJje}(𵇰F FKhR*F! FKhBF(6OY KD0+ѠF9 Si3SaFKD0+4F(-Gʰ F%Kh[hKh}K)Fh F6pK"!hZ`nKF`nJh3`+ F,gKhF)cK `cJh;`[+/%h-@ 3XKh ``Z`*`VM /h -hF+(!O0uMKh+?FKHO,hHKh00h3 0"``(FM (?\(A-3K9Hh00 (F;h3;`0h`[h["-0;0+\#;\(`($(0;0+[F;h3;`0h`FJh;`+#; Kh (VBF!HNF,FIY"Ct"CѠ"C|<"JXBKh#h+I=K"hZaD-%>(2##`00F`\b0 a)F(F(]0 Fbb00Fa0 (F>F|(#&(###`(%u<(>(%&(!##'#` `0 (j\`a0j-("``##F#*h{(2HK\BBK{*`O+h*h2*`OZpbh#(FWc}(FX5K\4L $h4@DM}(2FO (L Q*h_:*`*45"\F*h=#:*`*iF##` Si3SaM TVF0F0H5w8!M*hQaa` I+h$`>(*h Si3Sa +hh+hiHxH8 F"FqpGChBhKFhpGCh hhBpGh"LF FFFch```v`FhFC(!H9!K7ih8FBȿ`&F F9F FB!"FF(B! '! '!F'! '!F '1i*Fd FCKXh8 pG"LF FF)OC`FBѰB0FBKhB` F)F0FCRB, '4h*F1FFH FBH#F*F1F~-AFDh FOt`{h;{`-- FDFh(FB|h+Fh("LpF N L5h#h(F3#`+h(F3`#h;#`3Khp@=p"L"C"C| KpFhp.! F$heh-Шh(B8-h"LKpFh FB`FBȿ`BFB"#"!F(FCB 'h(FB0F@!FFH Fp8$Mkh +ܿ3k`@ , !bFB(+hB(`BK2Kb , $`8dfffg"LpFNh +JhBh !(FB KhB`B(FB Fp'8h+ h +"!(F,FB'&h+"L"IH8F F*(KEh``8"L KFS 0hBh` F@CFh"LJFhpGhBh"L-C@FhFF0 -0ܿ#KUh;+[ Pi IF0FB sK$`'!Fh1FFoH@!B!  FBhKhB`-@;dKB 𰀲R #)F F/(x'h0)FFYHiOr@!0FBRKV0+5i!0FBBFOr@!iFB0'Zh FB'T`?K"`'N!he1FF>HpCO FB'<#`&iOr@aiOr@ !h.=0F20FO@ *F1FF)H - .0# 00;0# Kh k'#)F0F(h'h*F!FF(FBf4F@3*"! FBFB"F"CΌ"C|"CpFF FXO0p ^!FFH=! FBBF.'h! FBC .'h?!FFHK@CP0Pp-AF"FFCF> OI2F8h,JKNFF3h8h[%I"F8hIAhB IBFhCI8h eIF,h$-$ 6  p ~Rr|x8 !MFhBC Ѫh* b ! FB|E KhB`8 !R FBnA " ! FBfB" ! FB`CH"L8F KhhBXhFhBch)FGhBP`8"L-O$DF 0F@ qKhF`D``ܱ 0kKkJ`0jKhJ`h0BdKhB`3h F;+hB FF8 ,!FFXH ! FB('phF@ FGB(` FB Fjt+pxh!F{(j! FB0300(  +7K! Fh0BF2BCF'',h+ + +'"h!FF*H ! FB 'h+0"! FBtKhB`-"!(FBf*F!F8F30;0#Kh P$030BF0Fvh-'h+"L $"ID"C|"IH"C-O%JNFXFF#U`3`9FJ F:A:3h-I(FFF(=ь,Կ##Wk.m0FKF0FF03x0+x+0F%(0Bc0B_iH1Fòs+v+fH-POF;++-+^H  PF%nF1WHQF BPF%V` C 2h"FI2` F#BF!4+hBCL h6#hXc-["! FiDBF?up "O2Y*,&#`&h!FF)HuO2"! FBF0F) " #"B! FB40&hn!FFH?+#F! F2#BFHQ , M' i|! Ee"ID'"IH F F)\ h;+X.O0+SZChֲ;C`+#hZ"`p+hlx<+Ѫh+h!Fl+h+;+(i!F>+Ѫh*I F+H!FH!Fh*ch;c`+ Ff#hZ"`-"p I F F 8F&K,hh hrJhB1+K"`&`8*Qh)Qh x),!" D" K60+,KhDK`"L"C"C|F F@I Fx0 F(O0FP0J#FH ! HH"N8FYCh;C`+#hZ"` "p%(FIF FH -?- H!F?-8!%ch5;c`+ F#hZ"` "pR-A$MFO+h>3+` #;`+h;+` Kh{A3Y;3Yx#0Y&F4"C"L"C| Jh`2FpGXX x3 pG pG"LFONF3h+L[h+Gx+ %%HKh+a/_-],R9,B,M3)djF F&0\+L-`YBYA F&0O&DR-! F:<#>,33H&#`"iF A3%$+%KN0+%!K6 Jh0+%K60+%%,%FKN *, Ф* ٓ603)ЩB! Ib #@R CB<"L"JT"Lp֍(-OF FAѓIh%(=lhI F%(𱀎I F%(5'I(h%F(@c/6@.Ҁ$=O Um?(F@ȀzK*hzIhO (:lhvI F%``tHtK!hO HF FoI%NF(^mOnMsh+h3+`ph!q` F+h;+`#dKh a4@,#;`(\N$%FZh[hxYH(F4)FVH ,UH$u5@-QHn$kh{khxcLHchh FFHH4@,є&Fcx>p+''.ـ5L.@/F4N , $,$[h6H3 F5F.HX --H%%4@,-(H$'/$-(HO R/L/O D0+?#H-DH0CH0FFH { l"L"C"C|RZ ((,030 F:F OZhXhD@!0F0;0+Kh+?Y/?t/nKh }(h(f,h#x-+cx+$.?]5'/?W%,F("C|"L-CFK"`kONH $, -ѽCCY0Y0x3hAF33`x3h;3`#Kh 4"L"L"C"C|pF LF#2 X,D2;+!(F&#2p"LKXmh+(x+ pG pG"L-C' L N131#rQ3@+1;1qUh-hFX2D(FSAFF?(F0+hF9"L"CK? !8 pG"L8F M\2B ! ! ! \B8"LͰ#IK`a)8X)42d"AKAJd2`K ! *&t#`" AA!FA+P "@S  CC "L"C"Ct"C"K Y"L8F IV'!F F" `]8 8BOrOA 8 M Lh#h3#` #`k`#h;#`3Kh8@v8"C"C|-AFF %FD'*F1F@FA- F7 /`&h+O0hFhBа( R(cCch#`hc`0pF K`#C`CCCch;c`phMh+h3+`hc`` `+h;+`+Kh+3 Mh+hq`F3+`hc``0D `"OH"C"C|8E F?C K[iB F8@ch;c`+ F#h*xY!`p8KiܿKYiֿFH!F$R]pGKRi]pG 0 FKFR ;C0!Dd#pH<0@pG-G F'!F"8sx+[I0F3\ch;c`+ F#h!F0FZ"`""pWch;c`+ F#hZ"`""p3x[HI0F7\0FyF(~ch;c`+ F#h'Z"`'"p=FO' O\ ch'3&+c` F#hZ"`ech;c`+ F#hZ"`'"p'K[iB FGU+c` F#hZ"`ch;c`+ F#hZ"`ch;c`+ F#hZ"`DZ5x-0FF(ch;c`+ Fy#hZ"`'"p'=FKYi4HEK@>Fxr+ HHh-Ah h2xh+xB,K=!0FhKh0!=!F(F!@B!'F=++x;/0;0 =*+O%p=F)F0FAA1F/F5F&F)p"JXChL!2hJh F F "OX5Fx B #` Of\ 3F[EB{]#@*`-A("l DF: 0('FF?0F'`T;+Yhh)0X[-jh++iC(FG `4-hhD;"Ot8Fx#8@HIF F$TB H!F8@'+He,F#x+8'! F!FH!F"FH >VZ_-AFiFhFFKBh՘GF,մhF HAFH9FOF40=+sh-H F8hCh;C`+:hhY` "p8hCh;C`+ :hhY`,phZ`hZ`f j-OF*LFF0; #0% XkE"K)F!@=& qhղB IA%`56h;FT ZFK"OX"OtC/ B=*Ѱ@ pG=* pG pG-AFFF F;;JU$ F=+@`'!O$Z7` KDi,hB Ѡh*FAF.7`'F$h"Ot"OXHKFy F!XDiF0FF(lChZ `0F#r!:Hhg`h0F@4O:h2:`iRsq Ch!F00DGkh`Ѩh*ikh2R"*a T##"#$TCKFBB0 ;h;;`Khӱ@H$E $ T5Fh``l"C"OX"C|Kǰh!Kh@ K` K`G]K`"K`B"Ct"Cl-AFF=!F HBF!FG(F1cBF+$t="+*U"Zp&41F('`(FA 0F$$D;Kǰh!@#K`G]K`"Ct8A$L0`F KH-F0 I"#`0 KBF8@H"OXH(O!0> h+;x-+8э0 Jh0"+Jhc"+Jhf"+J6i!Fl!I xp! s"+ H"iFp"( ] "L\"Lp"C"I@pF MF+h3+`T+h;+`sKh[p@`h\1F9$hp"C"C|sM,hLH0h `#;0p@;h 0Fx0Fh"``kh#0Cc`h#a`5p"OX%O-ѽ@ch"h2`Ԡhch F4h,5[ՠhch#@c``&F"Ot"FF BhiC՘G(h3DhFKFh(F"F!FgFرCh2CiՐGph4D gh)F8F<0=!8F!.D F$hh"C-CO hFF+xr+'':H4FX7Khh޹А$0n,p,Ѹ&/(F-O&)Khh-#2F9F(F F/Ch H*F4$Ch;CC`0 h-!(Fnk\=+ 6&pCh#C`.:F1F(F.(FU(H)F"LtF"FFChX)8M*h2*`q#c`+h;+`#Kh 3 ! DRx I"8F^ch#c`chCb`ћԠh"h F` "C"C|NO@#heh0m:hhH%hf Fah+Ѩh!"i:@hh0DGkhԨhFhk`h`#i+a"OX-A%.FFHFhKH7Ch>V Fv, e, f,Hx,%&%.FwC/0h)F6C"Lt(ܽ@(H" -CFX FT030 ;x-+F!|xHM(h*hGI$0t`3`0`;0+w?Kh+sC8"8FF=!8F!vF8F%A"h##3a%8FBwhBh`BB'B0(Բ` "i#2ac`h\=+#8F% KB 1\=+ 1#30"C0B)@)%!8F|ch+Cc`"C|"PX"C"OX8F F8`h)FC$h8LHN(x(I($ H( M+h*`h@8DD$!F&"Lt hxxpG hFxxPxKxpGsF%# "` F F F%h{%h"+ jfC2s3H!F|B JhF3x10Ix BH!F"F0F)Fp w0Ͱ FiF@ M0&(F@(!60BB8BԿ  BA 0Ͱ FiF@ M0&(F@(06!BB8B  BA 0Ͱ FiF@t M0&(F@l( &1BB *1BB  F F@ I#\Ch @iBѤ5j@B!F@ؿ%hMFF(F@8W 3jB8F FxCx-*xKK"I#`x K " I#+K" I# I#:(H l0Fx F!+Cx+x8 '0(F(𘀰0+@𓀰P- - - -iF F@(Y  x@ @ x8 FF!@(=-c b#)/5bPbAFKbbbY^!hF;!!p@O  p@Op@_p@Op@_p@@Op@ O @+s @B@ +x(+ #x)+kxbxC  O0QO0NpFFFF(𘀰0+@𓀰0;+z !*9HVdo)F F#B@ {)F F#88 )F F#0)F F#*(Կ  FF(FFBB  FF(F FBB FF(FFBA FF(FFBA FF(FFBA FF(FFBA)F F)F F)F F0cxO0p#x!+)F0FCv(++x)+kx+0x@ 8 FF#I h#X=!IT%#HD%-/00 chx@ 8^`hC0\xx!+B Ѐ(+x)+Sx+H FH !Kht KhHI3Fh "C<7 "F"xFFJoAACoBAI"F 0-OF F Il/eh~+x-+@kxl+^D+-+o8FF(@yJ8Fkxh320[_F(@>.pI#(ܑOU;x%+8F F(@)hcHO>@FHs+ѫx+KЯ]I8F#F(8FF(PB8Fx5.+MJ+xh320Z(F[(Fȿ,(F,h FL0 F|F AI"F ?H =K!h:H.Uhx+N$z F"0p.?B>t$ # "`8F"BFx˹OBoCE?IH:FiF$h#I!FPF?<0 IO*hH?IF,,I!PF?&C w{^ )0"K#J"t!KhF"P w-GFFF".MF@. HQF$&#+a,DQF H:F/D5D#Hu"P"Q-O#N(F F3aeKhS#S`h%!'J!F(FXC ћKh-  L(ѷe=4#FS+`sa,FkNKhBh+ц\. " FOKFhCh;C`+ |KhhY`$ phZ`%.kx%+ѬrKhCh;C`+ nKhhY`%FphZ`kI Fv#\'*+7F;x.+{x|*+|7F^H)FJ8F\ITO6DXI FL'O4{xxOxp غW غ%o p Ff n r t v O\ OM ( ^#? pHpaF-#(@@^#a e a!F(F=F{pKikL h0"h0@+#I SzT`dO `I"dh PFd(x!#Fs#;ps `ЀH#F2F)F0vL"zI#n`I"F #&#b#t`"pFFH>*" G[F.cc d`dBe f 8,">F(F>&.#bpF@kF8#bF@kF8#bf dH?W80@FH?Jvj >kBRBckBcBl"rBbBd"bpGjF@#80#l#SC@s#d#b I>(I V]tI >n(I D tnI >^(I 4 toh"phF F+x-+5 ##bKI # ȱhԢj* H)F*03h2`[hccH)FCh FG p8FFFF)h9%x--41hF F!Hh9h!9`kh C ;` 5 F!0;h--rh CC68 FhJh@(F b8J8(F$( JD(FT(J<(F<(X\8FL#h# ##`e`8"QP) F2Bh:*J!HH JM! 2-!+ٲFۿ@1^  ؿQp ) K^" 3,?","pJH"QX"QP`pFM.h6FihH&(`p!4DH. H H!F0H!F+hD"QP-OFFFF@F0F)FBFH,Fٹ HDбHAFD'H9FD NHhM,qrk  ܀*+总퀺@@/@+@@+@R +@Xs+@^-ډHW,ij\+gnu+|H5h, s@  yhgh*@s+r@y@@/S++@++@h)ZHuh,(𸁸/@=NH%,MKH%,-@GHhx,c+@se+@^=HH=MnD}^ &H,  HH,s HH,-HH,(|H+{H{H,xHxH,uHuH,-rHrHqH*8,lHjHkH,gHgH,dHdH,z`H`H,s]H]H,lZHZH{,fS WHWHp,` SHSHe,Z PHPHZ,T LHLHO,NjIHIHE,G+FHFH;AEKD6,MAH?H@H),D>H>H ,>-?<:H%:->8H=8H-8 >5H5H+8A2H'/089CLSKT[\cdopy@CgK_KJiF8,S5*+5ѻ4к;ѹBѸI/O-U QO %;h+m-W|xPIHIHIHIH+8K,ٻDHBHCH?,ٺ@H@H5,ٹ=H=H+,ٸ:H:H!,8H8H, 6H6H,5H"L%h-(F7ch F 4\-J+Fd!b,zh\:zB%J !O P{h8F t 5\J !F @ -@F%HF 7e #$+,34<=DE"vIFH,  pK!HK)FIH "Q`jPp psFF"# "`#x#+4 FF"~h#I"F x+I3F"F ~(Fp8Fx;#+MI F`8O(Ѓh`"Q`j hh>FFFF "!F(F0`02hB" "0h"++x#hx(иB K0h30@ O O w HX Kh  "zCF"h"+I !FѴ"Qp H6 KYh  "XCF"h"+I !F"Qp8FLh h#i{B I@L H JeE FcEFH"#%a#8"Qp~0[8FL!h!I*F (F!頹 K"y` `("YaZ`bya ""`н8@ 48."Qp0Fh FxC H)F K #`0O3!H)F#`G"Q_"Nh+ + + H]>;+HH]>ٸHH%Ҽu7pG-O}7NO  FOF%2j*2HIFLOQOI"@FOrQFf 2j)HIF0(F }FERB2j* HIF$ {$))%)F  #E,9/FE2j* HJF @FG(݅BFF"Qp~Ӕӵ7 FMjj*I c  IkjB B I"F "FI 0"Qp"WhI8Fx 8 IX#\%+5#I#T(FzF(\+}" L J NFT; TH1+FI2FԀ5 pԇ-CFhFx;H1FhK +`/O7/!Hx/)\0`@\CFT0P DD+`H1FG"Qԕ"QpFaI"aHX_H*_K_I`IH#Jj\IXHDj[IUH@"kYISH:kXIPH6bkVINH0#akJCBSJSIHH&RJH0aoPICHMJJ0+LI?HHJL0#II;H DJN0#FI7H@J#m#DI3H=JcmAI0H'0B +I )H@=U<+Ba#I+HU<1I2FHU KB>KBE9KXBXA(7H*F#FQF0iB;j+/H*F#F0[0F*(;j+&H*F#FQFt1+?I1FHBFQFT:1920F"Or1FHF!#1JH%H"Wh"Qp׃ת}VEWWEV ;f"S< oz;F FFO%h*o`0o0!F(F% 5+ps J{jqDB I"F I(F!F  "Qp"Wh؆"Q8F Iy(O2 F!8@ FE"'K[i+ O2Or@"QpsF H<  "Q-O$PH4=I0F z ":H:I0F pFȹO3F;F@F ;h20HCF2F)F^P0,I0F PFxO3F;F@F(;hT0"I0F :F(CO3F;F@F(;h`0ط}_BػGRW "Q#2ݸ"Q"QO\p~"QpyI0F FxO3F;F@Fd(;hX0FoI0F FO3F;F@FN(l;h\0/eI0F cI0F ꈹ"O3F;F@F2(P;hd0YI0F ꈹ"OsF;F@F(9;hp0NI0F FOsF;F@F(";hr0DI0F xFOsF;F@F( ;ht09I0F `FOsF;F@F(;hv0/I0F JFO3F;F@F(ݮ;hx0$I0F 2FO3F;F@F(Ʈ;h|0a_+sx+H2F)F0EH2F)FH#2F)FُMٟ٭ٺپ:)FHFrX 0 ,ĢSE?j)FHFa0SE?ZFI \+ZЙK#":bPF2\J3h20[@#PF;FF H)F4;hO!+@򰀇HRF)FDH#;`0 )FHFCE?(?֬)FHF8`CE? "qH)F^4oH1 D@ "1F  F8Hf(Fp6 I(F!" K"1F(FHS$4B xڹ!Kh@x`0B)a 0O E `D0 CFh3ScE*FF J eI0(F"+(#nbBhI(FȹI""Hk0Fr1FF8Ff@kh+9F FG 5vJO R(F(6ѡDi  F4kI (F C?qPkx+U+x`+Rى+x`0BLSa;RX[hDkBZH)F  ")FVH0|U*h  FPI  `A?3(@ЦikO F0ZF a??AH a#")F F(kB9H)FO3B{ 0k[@B{/H a)`"AF0*KRF*H!Fh=)K[h+?ޮ%FO3& BӮ Z B02F0!FH%#D659FHr MdT2cTe"W< o"whԊh F0:*F`ڍiBhQ`p0pG0<@p FNIF愈 F*KKLILIS" KI" FGI" Fz!FEHmCH!FmAH!Fm[>H!F!F Rj;I FXj9I FR*k8I FNk6I FHjk5I FDk3I F>H 1I F8J /I F2L -I F,N +I F&*m*I F"jm(I F'H!F:p#R ;#sX\5V/ FIB!FH Fp@;Ŀ@&2?FQV_q +S_P--OFOFX 0F+a)cбk)`,[FrFYFFjPFYFdJ@! ` fjhkFVjFFFNPFFUJ@!XFJSI:F Fl*{ F!*NKOIOIn`+{;ڲ*j+hLgLggagLggVggggLjhCI:FBKhk{1?I F|3"wpdu)(0FWMI(h;b0jh F I6( H$0,#H#.#90"wp@dzs*L+I h;6ah0 F 'I 9%H$N%Mah2F#H*FahH 2F*Fah?H 2F*Fah?H 2F*Fah/H 2F*FpHah H"wp@dt;@g "pL("F F !I hjF;0bhI ("! ..ahjFHrpih "  I h ;ah0 FIkhjFH\"wp@(d}부(d~"4(0 FeIh"hF( I" 8 MjF I(h;d0#h jhI850B"wpd{)-A&=JF=O FF#`;`:J)F FC;hB6O%,FE5I8h;00zh 1Ie(q(O&B#B)F~F(zh "IQyh H 뎹K" FIKH* FyhB (#!FH6#*##4' im"wpd|pD&;(FLI h;0bh(FII hOs;0ahHg"9F0F;F2FHahV "wp@d@d)-O(-][LhI FZ(I UN52saOR I0h;R0rhI?s H  ihs! DZ`h+ ]#XFqh(4?J#TKFBFHI F X}LI h;0bhI F}IF(́ ;0wI W7shpC_pJqIqH w2D;aOS4_I;0 ~F@{h[D{`h+Oq ~F(9ФFJFKFOFHFDpUHxKI; 0OHFl,?^#KH##^u2BA7$h( ( } F!(F 9Ŗ@dF3PB eA-G(Fz#BRk^:F F??+FH(5GHOr1F:.HHH"wpdwTh dx" p $>S?~ o(-A FIh"D(4I" !i. "8(/I""`hxF Fh'Ih"+ jfC2s3!I .Il"`h6xFFhI\h"+Ѹ??I*eMI,(h:0#h jh I^ HN6e #"wpdy)=-CFFM$OY!IBF @FD4LMDOch`hBFh `0bh I8Fh1FG hC:ڿW"wp%JFRh I"wp)(7 FMh I(F鈱 I(F( K Ih:0 h 0A"wpdw(7 FMI(h:0 hihH0"wp@dkHIFFH B p-OFF#HF F 3 !E "(I0F:0&I p }(I0F:0BL  -F%B&~IH  F(MHTE  FBvD0OI)vHDR0Or!0D202U"D!oU!4bvDyqKFS BF X2<D8 I LFyFD#0#0   F   0D8H2 F3H2"{x{FL0E@ r2wR˺BFH"u)D:RH2;H2"{x-OF d !(Z)X/MXb EzMB2BAC2+HBO .չ?z6BBH"602!:BIܓ)R!PqFRH2;H2TETN02F#!*0FcB{!FFDEDBs2c0F4A)10DX2"(F!F{<02 H H H H H"{xs[5 pFe}k3CK#;B2BBHrO0 }pT"0jF0F)F 0 # H;C I IJ\"! F~ "{xJ"h pG"{xKC}F !O"OF F0H9F }\" FI" F#\\"! F>K2+h+#9FeH#"i2BBhV#iB("{x1#3N3LB d2C0I9(.H+J! 0*H#B d2C"I9( H2ù FH2B1o0"ACE"0H)FROu-iA"0 H025;D"{xdm)l"-O}FFO  YH(ܦH }O9  ZFUF()@CK"`I#(Ah H!#J9FH6T릳KOYhFpA@H|K"*l XBdaer- 6Eq`"f) *O  !)KpH dK23DkH!?@s! D9F^J!aH?@s! D9FUJt 1˹TJK2+ }B\PIg"(F!FNHV*1+/2+1FJ>I?H+ؿF1J F1F*h}*F#F7H D1*+|2+P2+b.J9F*H (F!F0#CFF'F3FJQF H1F6*F#F.#Cs#2n"{xR18;,Auػ5Œ@!9ZDJEIEH+ȿFDJ F1FCHQFBK2+r"EQ2B@5J4I5H+ؿF4J F1F|4HIt2+P2+K #)<;ҝ>0 )+"J1F%HVB0)+2J1F!HL+ E"+#*J1FH<K "#hK J1FH*@F|! |F(I (;"{x ](IGPs-AFCMF bN B0R F9NE8N1m1F*F+5HA93H*F1FF/H *F1FGp)H1*F1F&H1!1F#H@sD*F1*F1FH1*F1F?H1!1FH@sD*F1*F1FH1H*F?1FA9<"{x0;$5GXi{-OF-PT(x F3H2B@02FO A# { FI2cX FH( RFIF!2+i\ p JRFS @Xr+@ՀBuI#FT+!ұJ  +BFu "J Bu%,F31I{ O IFF O O3IFF ~yOpB? JTXBF #B? F(66c2 +@z/13';F bH+rC +À鐩!###F*FXH FhBuF6cJK*ـHB0R B󡀹jT@DHH2FT0 SE9J2cBy(9H 1PFF8EBABAC;DC  x<E'e,F%F=FJZ`~FE+h #(? OrB?|uFHQKpG"KhpG"KhpG"HR^I  p-GFFF5ILch!hHhS!hH~ 9F0F-PF|FHpch{ chS$h!FFH^ z"  R]pG R]pGHR]pG R} 6-C]$FiF?H$F@8BK! "$N(`L"h b! :! 6`hF Nki(iG3h8+ @33`"|-O$FFK'FBO`FB Oa F;@ (@𝁂I$H F G(2h@OaxF8xH@O \F F#F9FqH +]/i+@i-T+@c=hIJFhHO Yh! b(FshOcCFc^I 800F F7HFXKhCFKDEF x;62`vՠ  FKh.? FHF2F#` 0B ?3`#N𵣰#OFKNh;`3hFH"9h" FI I7\):h:F F7T|H6#;`(F F(F7l z 3h% r=`pH!F)&0F#3h d-3h3+fHgH(F"rC(F7:+':F(FC;FC{7B3hNHC3hIH8C&(FC3h@Hx(FSCD:I X@(FaC&8D! бpC +H,5#  'I X&H$ tD#Hn"Hj#(F*C>&iz(F7?7HN2&F&"""`ft'3j-G FI#F7 Os z$FH)FHF7BFЙH (Fz'8FғH!U*Ѫ)ЎHl"!O3d 0o{[g`#`'8F(ЂH9F)|[`` }H01F* [R#a0a[jcbk}R"bcaib[*jabezFeH zF`H#iclCcdglkj( e(0*+* dRVH`pjHFjc+R!h[bc:F#cKC|#k"hSCBBHH_S1FHFR7VCBI"0F@Ip"Fع1ù11U+і1+ і3S3;3U+і3+=/H/I 9F(],K'!h:FHF3`S 31ES13#kKC#k"hSCBB H0Fz@Fz1FHFR7C'#kC1c1#d@d&0JtRRaA cckO !hRFHFKCck"hSCPEBMHAFHF7BѕA0  O"A0蠱akO AHw  0B>HIFm  e0Fz@Fz(Fzm5H1F%h ik)F@23D f,H)F)HAFcjCbceBF$HtjAFclF e opBBdeH2F@sB KR#@r[OsBOr[HC1"#!e#ef ,LY F F hzF%H#k%!h*F8FKC"h#kSCBBH0Fzt R1F8F7#hCk8F!k!"lKC!*F"h#kSCBB HR1F8F7x#hC0FzD(F&sFhFlF# Bd,`,n3f p  o3gK ,,mB  K J Fl H@2FbI (O3 +`-GFXFh FF (Fz8`8H)FH h#@F UV2F+FJBB H18hzm@F"h9hZC7$m"hSCB -O$D FFx2mO@Fz FXzHAF(Fz$ F BF!F*xpikxBxLl(hOpEx(E(m $Aop@E=x(yѕѕ ѕ U, ,y,ly,Ѭy,(yyhy(yxMIMHMI $lOrB.opBB-O 3mKE)(Fz8F'z`OpE op@E7H4Idx0I4H\$lOp O BR   op@BX+O @0FzPJFQFCFO 0FzPJFQFC QF`0FJF3m[ED٘ O 30FQFPZF;D  jC!AcFH KH FpGHpGHpG-OFF FFO 'P0BHF !jE!2K P@F 3F8 2 6H9FZF5I ع#I 754  F9FZFF)H)I +j#b#%I2F(#j+bF F!H9FvI2F (I 3F9FsBFFHaI (I2F{(#H FBF9FL I l(I2F0BU8MpF$+mBpkhBыYl`Q`-AFF IFF0F0*F1F8F  I$ *F;mB4X*O30`-G"mFFBO %;mBHFHj j 3FO]hBZ`0V 0+ٜB؈b21QhBёh,F" FX,٣BRhB 5)2Fb 2 F)FF'HCF*F1F8FtI ,УB H"F)F BF)FHH#F)FpCF*F1F8FTIRFF  :mB!chSE =RF1F8FH#I e`tX,2d-OFm hF FF_C8FyF@fH9F5&0F:F!P#lfVci!ipp+pOsBopCB m!OzopLB9&FFhKE|(Fz+p"poj`OsBopCB &&l!F@F"r((Fz}&2F(FQFPFzpOlY `REO.bEn2f2 px3lf"Cl1n2fFkFn2f1Bp3 in2fN2 3,m@Fh 3"h;ZFXEBH&x  e:F)F@F62B-CF FFF%'#mB#kCkJ8'!lKD/^(F$0B' 0# 3+!,0( 9F*H+;F2F!FHFCF+ #I?0:F1F FE7nBH I )(n'c#mBn+ X+JHI ("m#BqXA#d!FHFCJ3/-hO? OBڼB`\&knx05"-OF7аFF_C1 ;D,3mBB  1Drh5nPFU3h#*FCFBAE:FPF6zB#E#*FPFCFBAE H He ;:FPF6BB$YqX"-OFFFVF+q+++H'I GxBlJB@FJAIF1bRF+F`(AB-  H H ;B# "-A#NF/'e 3c~@F+FB5FAF|F$h,F ?",+F"K OpyBBh %pG"-OFp 1F /B+@ mB@$O3%F'F C 3D04 X0`3v0 #  BBОHi cO3=F BD00+? @/ [#4 BBvH(1Osp 63rx*F*fHFFkHjI (H(1" AF#(11&(?tB1۱"EDDD(1%DD#DspC(1@IK@!HJIH +GI((1C(1D3{+@sxXF 3 #- =FF Or!XFWF{  +D; # ! SF ( ! ( ! !KB!HN5'0+?DHD-=';{ BB5? ;F/FF'UF  ;F/FFXqAH}R"r"Or!F42{ g3F!ϘB# (D {);Op3h( h'-?Ѯ -=F HF#!O3 1+FAFC%&qz ). D3spz  3 \zD OD= +8O p/@쀺 opCLRB_ѳ}p}CCC_0`o uOrYFO0O3  \--/׀ :Fp#AF  +F C?/ B1BЃHDD$!GSC@ ?FH!I A(5wDDvDL opC@FBuuu_#__/ P0BhC`^ `ñ(FFHI (DD#D 0wwsw`I \ F(@Ҁ ! 1B?HFFH}I F(# 1 1v 1 3wL opCB 1su 1ui 1FCR/RBڲ B? ' ;F/FFRF'1SEG盹`It00h+?mFYHk%+P BRX2 2*BhB?R8F[XjFKH(Fc_FHHD^#EI `F(#spDDDv 3 G 1FX1)FF8H9F6H6I < PDDwopCwDuw5wvL BOuuu`DD#I(dP-^/h 1/@۱HFFHI DD qD7wvopCL Buwu%D&Ce !BHFFHI F 0 1D/FFyH+OrQFLP( y rHCh55Sh03h0埱/#CHDDP0Bd0h_C`B(Fh$!;FFZHGZI g($q; www; ?w p#d0B)(FGFMH)MI I(d !$1%DEY @FO3Q_`#5# ;F/FFFi7K 5B$DX+P0B?\ =F HF#!O31AF +FC!D00ӹ  BB ]K*F5xB$D$@E B+BY"-C F#Fi?NOAEF@Fx F08HAF~ HFxF(8Fy1HIFH8Fy@Fy+H`Or!~clСk)#mB"H1 X( +!ShB khC`5 !縹H I @k" P F H H "$X8!L5% %5! %F %%UUyvyr@U8YhZ`F F!YhZ`9F Fh)И`FF!h"-CFNFF5F$ FU-28FU%JFi`AFC"-OFϰ F qIFFhoN55hmIE4lHr O ddh E|dOO 5jnDB$5Z0hnx (ZHX 5 1+$5*mBOIRH"x2*$ 4!;(hBCHF#"GFW2BBEHjnHF 5$knB EnOr!38Ff:CF9J !#G8 in JC$!FF F  !#F " 1HFv 1 vlopCB 1#u 1cu$1#w$1 cw$1w$1wL 0C 0#T#T2BBH`jnHF 5xknB 0""(@L y+# 5"KpG"KhpG"KhpG"HRI  T p-GFFF5ILch!hH hS!hH 9F0F:-PFyFHch{ zchS$h!FFH "  R]pG R]pGHR]pG R} -C]$FiF?H$F@5BH]#!H#J2"K4 G 5."0"Ih 5K! "$`"h ! ! `-O]F0{$1FFFF@5B۳hrpC`_@/!@F,Cxr+z#`OO4shxMХuhh5\,O4JOaV!xFBV`|(sѥs1F`56(ۥx(3h/8F1FO sh5F(gѳhpCOT {0_JOaXF^XF OF,1F F5>(/R F5x(۸sO ""`LJ;F! 6 "!56lFI5(Qh+` F75N4H|O_I!5F'FOr@!O5_FF2BBХs fXh1F&($`|5x2" F~( T0I F5OI F5(ۥshxIUb## F ] F5YaoF F@FpG@pG8F FhHȀ((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h``lwhd   lm(d v lcdl`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF$8F F#T#E#34+gfXX\\|q|pccWFgfWFcbaXXSBBczgfp j $d$(^(,X,`cWXFRH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOr F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 0FlF@FhF8FdF/D#$B\5SEС.D"0BP%DDEDSC"B4 2F% R3BF F)DF(4#h+%(FLI F :FF!kiF}~P.r# 0 #kD#c aq 9K *q0E0 XF XF&c0Fa  `)оB*{ BF F(%k`(F1FH #v5Dbr ##h%c+I F :FFGiFUD0D{# 0hKd""<"-GF(@Dz:"2,@4$4MB;ۡ@AFF=FH0PF zqil, J0hC FKh+Іq ","4"(FF'F pchK x+`hF2BB' pch x+ `hFh(2BBРh(-AFFFF)FFee0Fv9FCh`D`@FA-OFH M)pH#CnK hZw>C ЎOrE1F(Fe SbO"j;h]kUC$Fh #O [br #PF MVKh*FSOFBiYQF[;hӈ[Ӏ# 0 2Rcs 2*sO 3DO F#cF 2爈  oO`FFXF0;0#0[0ch F@GF9&J0hC0#0[0*F2FYFF ki0DNZ9h"i ORPKih I0iF!i# 0Y FF""""(",""0"4MFFFFH( !F(Fv 3F:F@AT ,uJ2BAH!F(F F( p I Kp@OFH Mf"7 FF0𵗰FFFX"!FhFT#H0K7## Khr`hZhiF F o`o!"$)-OFp FFFmJ2Bp.y𠀖By X"!F(F#H0_Knay88kd[Kh.`hd.~Рh(e.zRKOzKFRFdC ;Os.gRF C KF1FXFLk)F FC@;F @BF@A @F9F!1KFIЀF}-OP0 ! D  C  , s ڹ-U3 KhC7 ; o{`oKRF C KF1FXFk;FF U#0+# ""$""#C8 t FFCcK0phOzOg)+   JJ  P C  @ C) CB|@)9"#B0 FjK!F6 hhK *SF`0F`(F Fڱ 0ZkBiF(F!F'%,F(F!FOrOsjFF"ijFKhi iIk DE" :Kh+Os#{+Cx!F #"F8F"HF/I2*KhD@F1Fx+@F1Fx+*F#F8F!F(Fd1F@F!FF(F{0!Fp(Ftx+x!FF(Fi1FG@FdC3C@F1FF@m0iPu^"4""( ""$-OlMFF!X"(FFZ9F0F<IF=pCKHOF0F9F 0+XЯKh[#C ##; lM#HXAFC3CLQ@! !H0kd#H0Kk`KF h!Phd h)F(eF##QoшH3H3(цK"`oPoH00[L0"! #:F F!SH !ȱuJh3`0rHBQ#"mH(ѱS ! F@|8xPXFQF0 + _p@OHRHRH(X"! L0#Q?k!H `B"#m#H0YF;KPFk` (F1YFPF#C%Lx+-H3-K jQ\: h 0F9FF##BAK(FhsKh+>ѻB iR# B#33JC " Di  E# 0~K!Fh[jh|KB|Kh[oBVؑBUۣiO #aO hi)6R:Bh C O O iJOa*(F_Khi "  ZJhRoREVK!Fh R* OYB*RJKKF i*GS6IhC!!)BѕH0+pSlBK @`@A##=H AAh&H$&J;A1H0+   #}!F(FKh˱IOr(F>#p@[H(;h+ I" K`" ""$"x "x"<0F FH#z H!F(Fx) )H K+0#p#  K-OhQF F x+%,F(F!F %$܂&2Bu82BB"(F!F0[FbFFJO hR Bq>V! .8 &^E(^F0FuFH(F!FxF+4EYh!S FBƀXhu}K(F!Fh C `aFwI0<\%Bii(QCL|hȡLṟPFG08F dK h*+`KzhB#B]HAFZK 2ZHVK" zh(F!FBO5zm 00ABq" C 0;j;;b4$;4L3B2$ h:`ORd8Kh\1Kh#F3# 0pCOг O?гOޮ#3pi3aO  #32+?z!K9Fhq#3pKh8HOpK(F!F /KFXFw=C"ц#3p"\"@ T"4 U ""0""$"""#e8P0  OpYm   +I I HFYFO[!Oi AQ'J3A9#Kh+?<3sp6qFb(нOxd8 0[m   +H HYFO[+8a8ba@FKPf""(-O"`KFF`h0l \F1JBii'UCAqh{MArzN(F0i F RtJ3hh*ǀ+ǀqKbhB#BnH9F$X"!jKHFAF9fKhF*@h**XXF ""X TKh*SIOrXFHFAFc=#pX0+ #  WDJ;A1,RbhHF9KAFBO5{m 00ABq"@0# 0#j3#b4$34L3B(L$hi2`ORp"Kihi3hiFBi&H ` `+?9 !Fi1oQtVd[I"m"\T""4" U $"$"x"""0"x"-OFtKFFrKPPh5pJ>.00 O`F !!O O|ZB Err $ XGD XCG ,uڎQ `GKhk 4X$F0F _*?mJHPch+x%%d%aedyl(FhxORfhnononFnx#p00#0 %+hjBPt#0#z0+(H'K"`l+?o#h$H0"H:(?_H)Ffx !HB"I1(?J#hH1 @#H-h>#H-hD@ht5"Bf-OFH0g+zF3*sŀ*j0F9FF `Jg]JXA +q@#WH1WKh+rVH`O@F+jX@= F('J3A`X(v s(@hK`HH(@e 8 F""H""N "x"x"<"""p""4"$"__?y Ow *FсKh+BqI3;)s;ңn+8{Kj{Ih + hd0 ( QF sHsKh[#rH 0#2FQFF(0p0ó dKh():By5_Jh<.y.)  CIEGu -w ='"- Gfn*IEu *Xo=QC'D C##2K5Kh+? QFT#uF0H6Q*0;#u FFQF'H {  ko   ˱4C##2 Kh+?c  T*TFHUQ*0;# 4KF F H  ",""4"""P/F``Kh``O@V  F ##p#Jh3` Sp03KhOsBFBpOrF g`gyK  0 0*G`hL*BРhP*=РmAFhM F ##H0?0+E+haKh+YmXCC/XH#VHhUK"`#px o`o`n#eFKK h+ #OpC@e+hCKhZk6UkC3 eDV*uѠnIFvmFC(4KF3N`p O h#H02 kKDF=2hI9U +m"<5@$D5@AplRm @p # C @ C7 0QѺEk0@FGՌ""","" "\y"<"4"FFBB0V#H'Kh;HX=0FH0+?#"#### H( FfI""j"xK!-O'4LM jB0Qk'0HHTDLDNEpBu]X"!%\K K K 0$jBa;K`0<\Bii!pCL FViLvIhLrsEr1 F F*FFB @Lp  3BL -*F#FEO LB|2h4E C 00 FoLkCFl02"\Bii%aCB FhBrdH0@F `KiN_J_Khh*J+J]Kh+NxpF F$K'h C5@Tp5$@CO BB2FH#FfXFstHYF\ "\T"""" """4"$ p""C"@\r"" U9FZF0;FF)wG8FC1GBBF7HvtGbEs8nCwEB?z Bq $a %N1h PT xhs3hD"Z`_8FO LFEB?O$@@&NEBOJFN2s2F( F HYFKBs ҡ XD!N~`&""@-OFiOTF *@F"8F!FP(Oݱ!BBJt th B "O-hh B4G"("pG-OX"!8O#P0$6KF&F4Kh4K`;hjB0;h,QFFd pCL3F)I*F(H#0EF:h B6F-t% F)FFKEh@h  )F Fax*PF5Dot" ""( p"$""4h hPk[kpGKh @pG"4KhpG"4Kh 0pG"4K-OFh$l.UѨKh hF`J2Bv0F&Cxq#CDڀIF(@рXFWEHEВJPFIFHS(h& `0ñy+JH>(#q&&K`K"`2*syIOrFis0;#q#q8`0+oKh[  ) #C2y3# ? BO۠ !hQ 1F-F LD.F X!B:BF Ft뻈"h*ՀHI0F(@ˀF y*?J"8Hq(6J'h/@6F $HF0)IOr;#q#q8`\0+&Kh[$Jy(3 #D@E<#hH^HQ(?JF9F F\ H"$","Kdh"<"4"(H(?讠 c!F [XF0F@FQJF9F F#4F3B#uC;C#Q pFFy3# DJE-#hkHH0 %}H;hc#3B#xKhxH;h"#RF9F F&nH(;hc#3B#hKhgH;h&c#h   !F@F9FRF F!h DF#0F3B#C;Cy+ z.(*q+IJ%GH%`I(dEK`cz.+CJ28FA?J2BsE"4X"(2*s)5XKh+@VKx+@UJ h"IFF@FzOH(F hF Fp@O##;pPxXAJ hO FHF#FC)2*s-# P@A# hJF@AFFF+J Q+H@#Kh+2(Hp2*s##0۱y{xB hsJ%IF*FF@F{xHq (K&`{;{g H(F# #`_ hJF H""5>-dd"<! -O|]TxK+4HHK"`  $HH! c@"#FF9C ЬH6K`H(ЩKh3! @#آ"OK8hX"!&#`0K0=hBDӗKh*@>hBPOhBI! |]H?~H@(фH;(?{! ^F @@zyH0˱J0"Ih -DK! "$T.`",$h h! @! <` FpKh+\FH!FH@"B? K0јBKBO0BKBKBKLHhIJAB##`` ``0#KBKBKB KHIhAB K J$$`#`#TTT 8"L"4"" "T8 KJhhC\5JBK\5Kh;\5 JBK\5pG JB KJBK" "XT 8"\T8 hpF ` FChK`j bˆ6q26pp"200000000mekc#l+dme H3OrH3L3L3P3P3T3T3 *q*p " n)F Fp@-hpF ` FChK`j bˆ6q26pp"200000000mekc00#l+dme H3OrH3L3L3P3P3T3T3 *q*p " \A\@P" 4a`h"44444 z 5b 5cnRkf0000P5P5H5H5cCncc)F Fp@- F:L F$h|@, L5+]K]KIhhB[hhBWiiBSPiYiBOjjBKkkBGPkYkBCѐkkB?ѐllB;llB7mmB3PmYmB/nnB+PnYnB'ѐnnB#PoYoBѐooBBBB \\5 ]KpG "$K-OhL蒦O4??!ѡILHF*FOSCFihhO1\0$іI 01F FFOQFiF(1F\(t0KhI Kx IK@BhB>~HK(@0zHK0nNiF*vOORi8h F09hi"0"X"\"""4 Hd;h-hn=F"E@FX+U?B9hAH^{K"-O, p$JO3F!FF`K-.( .hp)FFH8$0!(F,pK(`hp)FFHhpC_ГH)FH( , KLx+SЄJO3`#hHH)FJ#`J#OOQOp`J 0a J 0a p,OQaOpp$zIF`OQOppuJOQaFOpprJ`3йРnH!(F,XK(`aK"hhC)FfH1F(F`I0F,_H1F}KKh *A J0FKF07 UJ `TJ`n9JMPJF+h\Bѓ0+{+h 5(&@7K"hh*b._?HO06Os"<% ""@%8Kh IpCO س_гOг_ KhK PBOг@OHZ "4"%`4KpFh3H2I0FhF t/Kx.Kh+-H1F4,K p +KxD%Kx+)H1F& p'M1F'H&H kh;k`+ HIJ ,kh;k`+(F (y,Y, zY,+hZ*`x竉ռ+hZ*`x +n,N,"%s"d"%""e% oPV opF KFFh @H2F+F!FjHk p"%3KOp-A$-`0K`0Khk9Fo-H-KOaaOp @ao(%K9F%NaO @ @afu( F( n29FFOpoF(,(Fn43h4Ean`+`5`]`O 0aѽ,+ѠF"h"d"%""p"-OFDKFFh 3&D:FrB#F9HRFK:F!HFp4HOEFB RF#F9FHFF(@F IFFr# >0B.K(FhJsB$)"  DOqOrAaFz FF H0DD#H"8%%& f"4-OFFF8@3RFDKEK"`HBF3F%HvE O+k 9FDr# B(FTHrHT0DD"&&f"8-CFMi Fu3K i3Oh22I#B9F0H#i%0F Pea#i*KBE)O,F.F:kL3B 0F#*FIFHF8hkL4H$aCBrAn  @#B CH@IFhI0#*FIFHFY;h4kD;hPB"8&J&V""""4 0}pG-AFIO hIn  .C#;hC3;`2BBK!Fh H{h2F3{`+FihVe`a""""-A F MF I,hBdhBHd  #F >CrBB$hiF F2 F`Z`+he`#`\`i,`Ca""&|pF FF!X"hFhFe p FhF)#  H0+  Kh[ H##`  HF H(##` HC"&&&pF N Mi3h)h Kh32hi(hp@\p""\"4K"`pG"8FM FEBA H K"h Kh0T1BPhH8"&"@"H-OFF dFFBB ѣ3C F@IO+HFAFx;+6I:F(FT"YF'pEEOHp7$)Kd.iF;8(F^)F;FF /"G,B'd3C #0b9F(FO+>K!F0FdKiF ?#?;p<#4C0juҹ"\%ZK-CB}F F@𨀐0+)Th@O`n(`OH0Ob!F LKhKHKKh+:JNL533hOOx)hFgOHhF Wq:F3hIFHFWiF"2 E[!;3h)hFH(h:FiFWp3h)hF;0#0#04#k$ \3#j $0$bj44OS<$j8D$ @L$"#0H 5L53 #P50"0#"# }T&"'""4F F\#IB?ѓ); Wp4b   L1WqOr]K+PEPE@@@ @ Or]KpGT-A0Kh+@J`L h(ڡKhA+񺹟IKx+=ОKh+9НM+h+RМHKJhhKh*Pі *LFOPFMOR1Fi rKih0FjKh1F0FBiI h# 0SM& hO)FiMnZ h)FinS}h B9iB!}H|H'(+h+У ")F hi6n/(Fn,EFnJ#[M`mJ`+h+E`O;h0?[N3h+5gH+h+59hQM#OR0ci #X4QKih8FOKh9F8FipAI h# 03hKOHNH((`LKh#KHKK4M"`OR7Kih7Kih0F5Kh1F0Fi<'I h# 0;Kh#:H7K M"`OR#Kih#Kih0F!Kh1F0FhiI h# 0y)Khk(Kd e1FhC2F)FF$HxKh* h","<"""""T"'I""$"8"0"4"p""''g"h"d'"X'" "\'""'-O@>pkB6K asKpEA"#-)F`A@O E@Ҁ(FIF\%1FHBii*PCAqJhXF{OArD0HF uJ;hh*+rK B#BnHQF0(F vsaJ+F"_JC 00BO `0  +DFBO. NHO|#Br#kLcB a0;0#;B2#shn;s`AO3IF9:LORi:7Kih0F1;h1F0F i&0H `t)F ` )F O  I  cD3[ED+?G IF>$0$$0 4 4hb $` F""T"\"4" UX"""0""KpFF @P%8 m8 H;CiB iT%0FaD% a p"<( KKi@P"0Bi@"0pGFiBiapG"<KFh 5p KB0BB 2BB    "ķF^)-OFp uF FFE|(APF!F(;Kh| @ci[E"YFuF #B#2RC2CiKE K"IFhX#B##[B#""@"pG-OFFkKMpF$S"0[\OC kBܽ#DJ4K'F[$ S$0kBB 'DX$@@HDH$[R7X|Fn*#\(   [@²\@BZ @² @²IH (.Fn*"\@ Z\"@[\"\ACIHt,(.Fn*"TX"@ \# T[""IHJ<(.Fn*"TX" \C T[""IH I(.-G F$F)@  nIIF&n*F +Ow\O ʿCCwTIF o$uQF E(FH! @TFDEB< `F N~8\"@aFqE:ܬIF2B:FU"D.E"U&E&, U$IF~{E$4IFF!B1Ri"-O}FFFFJF<F(hI2F (  eI@F&ZF`(F(F_I*F@F*0\h+ZHIFO0 }kcj`j`+k#akkcakakka@0#bB0cbklb/}GI:F@F*n0vBI*F@F*f0;AIJF <@IRQF8"F F"F;I0F9I0F 7I0F5I0F3I0Fh"F1I0FB,?/I00F"!8FN1FHF*0' 0ByrBOЪ# (15D*2*#0x "F R ]( 2(J@dAde(a@dz((y(((((((-CDM$OcFF!FFxCFO4 F DM"FF;FHFF(F), 1#-O]F0{$1FFFF@*ZB۳hrpC`_@/!@FCxr+0#`OO4shmХuhh*,O4JOaVX!.FBV` 2(sѥs1F`*(ۥx(3h/8F1FO sh*F(gѳhpCOT {0_JOaXFXFOF,1F F*(/R F).(۸sO ""`LJ;F! "!)lFI*(Qh+` F7)4H|O_I!)F'FOr@!O)_FF2BBХs fXh1F($`|5x2" F4( 0I F*rOI F*j(ۥshmUb## F ] F)YaoF F@FKh @pG"4KhpG"4-GF)1"!L"<)Gd"<"Kh * pG"4-OF$F FUBz 0kBOrt;F  F)F  @F "FIF+FGB " 4#FF#$BB1O 0#FF[EF FF^F "F+F0kB$ *H ^E " ^EBi"a PjF Fi#a)j"-Om` F" FFF(<F:FF2EWE#ѐBB*#2FHHKhHx  H%(K` )"!Ld"<-AOB F !ĀFF-0+Os#FC(F"# M+hkBFSi38F1F0CKixo)h" i"avOR Li Kih0iFiU# 0"">""0"4-GFiFFwFQ F;OKhkF8F FlFHIHHK` FKhEKhk#+FiRF0F" i"a>FQ F8HԠ0kBOru@GF(F!F~iD#8F#`"~HF|e !K (F#!F#"CE i"a*F8F#F0kBzi* H "$)"<"4")"<*-OFxKL"hc>A2̢rOR5O 0YhQrD#h[D#xH(,%2 %%K&HIFKh+𰀇H6#hQ"h AHIF&}H FFFpAO #hsH##JFt "XF#R"hkB Yi)= "hD R5 [hC]HIFLVKh+XZH| h9F%#hZ "#F#hkB Zi*ALHKIiKHKIFhByB XyBو>B?HIF# i#aJ:H(M8K"` 6H(3Kh+83F&l*K`F)K BX(LO3 h 8F (рE v(# B} i#a f"j*(" *K*k**`*"4F^^F* "<X"$"تZ6"> +7) C  i D k XCALp B i!a`4I H(K` 3 8FkSC 0kB Si# HF!F"+!Ld"<+)"-GhEL@EM+h#ABJ@Jh"#Fd+hkB]ie6H!Fe 3L2Ji&ܠ p4FE АBi#aA"F8F4'   S%@ 5#AFH###bi20Hb#8F###bio($i H( K` f"">"*j"@+D+y+"<6<]9"8M+h %3JLBH#h 8# #CH +h##CH #h+H H( "  "ķF^"+++ )pG-GFFFF)F@FRF3FFFj`#"LD&O` FVE`۽#D#  6YH-GF4 FFF%! F@F KJOF#` #q   K" #!F# F 3F m#: ^FF^ :p FFFn2Fg2F`2FY2FRppFF F((*Fmep-A @EB ȗA nҍBAӃ Bt ҍBA E|   Akk@P!BBh-OFF"iFF%@B7K@J17J7H bcBv FFajF  ]E#  'XF@XCFBYF HFbh gDUD"i 'XFCX CFHFB)F#bh!sFYGBv7F+Fs+,i!@BK@}1JH SBu F.F(Fk*F!0 B#k4`"gPF ck0 g #BB & ,PFgF,PWK)hB3B;BRHO$PFFyPFPFXF0O/F OshBihPFg2BB;HniO A B47CF@@PI IPFZBB&K@ 1%J*AFPF^I  #k`4 `@0  R#`H`B#80380",WABL,, ,,-61WABN-\-}-JD0O/FOs hBgiO 0NFBB47CF @@PI IPF80+(K@1(J;80h BhZ`Bh`l6I hPSPTgl{T@h(?P0Dk]T`F>O1F 0FlaP`hT@ zh3DP0O ,3V-GO CiFF j3K@FQJH O0$k!FFkkCE0Fl) F+kS(p#1F(F#JFVF(#IF0F#RFF(?h,zh,-AFCi&F@jF3KOVaJH 1F FY K@aQJ:FCF(F (, F$,z{,--CFCi& F@jFF3K@qQJH p1F(FQK@sQJ4DI JF#F8F(#AF8F#kF2F(F(F,z,-K-sCFh F N3hBF HKFKF0hBF!F p""-K-sCFh F N3hBF HKFKF0hBF!F@ p""-KpxMIH"N$+hmBp(hPHH( r(hS2hR[m HS4RhB4"d".".J.jL h@j . hY##`"7FHh(j,)F0 F"8F FKhmJh Kh`# #BB  8@n "$"4"oKsh;+nKԿO@bO`b`kM+h Et`) fHwfHx(W a)7)5`Hf]Hg(]Hl)h\LOR 5i#s 5#d3#a3dTKih\RKhiF4i# 0#$F! $t#|3.h e2# FF!AHH@H9H%)h8LOR 5i#s 5#d3 2Kih0KhiFi# 0$*hd3+6Y)6ؒaqK+-HH(?k!HL)h#ORa3d3iKihKhiFic# 0$+ FpHF"""...""0"4"./ /$I"Z@ ƼpG-AFFFFR BC !F@FxHa`l ?88F$"A[#-OF3FKF   h3SB/F=FїJAF0F CF"єO;hB&(`# F#O3 # F??FT k5ht-h- a-8b-%I vFZi +R#vv!v!v{v!v!v!v!v!v!vv F0 F F Fv#F u;hBЪ F ##ZFPm'BFRI2F FH(F5N8 FAFFII2F F41F FF06PBPB=I F7FFF@F8AF F304I+{$4"XF h# FF(I# F F"IAF8F FP01F FAF FV0?~J!#I F%###rogƼ/> i/K/j////0-CF jF FF'm6BJF)F F@*F!FCkCCc@FC:F)F F7/Ck#Cc#-O < F FF3`0 b/5A/7L/.ЬI "kkO0c/i/1F(F!0ТJIF FlCFџKhBЛI o(FnAF(F[#H4pCO#,FO  F  3h 0 h! FF#C-ЁI FB#ѠI:(03h+bd ^ $F( Fyj kH:D D fI F&_0F&k7+3x/+0F3F_J`I((#$kFYI!HF' FUI63'7kVNI P IF(\0r C OsFI FlOr1F'Pt0B F>I'Or1F 0Fk @3(!B FF.IAi+6ii+ *fКBSi F$w;F0?+$;F  F0? AF F0IBBUI2F FB F0 i0@dz000~0t1b11J1y11+0j$!m#80 (њ+2Q  ИBB2SEBz-O%-FFF.FF WJAF8FC # SKhB FFF F!2H6KI Ff(A(P(FI F p( FO0O0 &O %#a! FF(@џ/#" F C0IO #" FF*IIFOr HpESBF1;F#"# FjF F)0I FBF F;F1?? F|0E F0O0 2 i22(2=2O-CFFFO 6J9F0F CF3KhB! Fw!F Fr!F FmF6(I F%f-r-нC #IO I$$! AF F0I%(Fn$$!0j 1F F0I/$$!8j 9F F0I2x i2{2222@pGpGI"~@ ƼFFFF4[ IFHZ$ I"F HT H:F1F5*FI@H'@ I(4 pDLO2BC;S@۲T#0"-OF&B$8@L-OFB #+p68 OD xLFXO H:D~8@\O0  E `(p?`ahpp(  E LFFo  Eҁ ?a?`)phpOq-G$8&F#FOY(2L]!B"! F+$+F+$+$+F]B!W$T<?Ѷ?C ӝBҰ @8@X@! @\@+FFOv!p5BөO4-GF$F F0FjF# DSF"F BQE(Fj%(F2F)F'B#R]pG4-AFFI $hOCUCF*F BAEO01j:F'tB4C432-C*sF FO0 "P)Fw Fx+S+ Sx$$S3#`e` B+Rxr$CF CBFI0Fx'`("$TIF@F+F C*F3/'3FS[ hk)FF F0@pGF04[ H `]pG-O!FF0FF@I(FO0'I"6F i#aFhF FHE 4+wI:FCF(F Fjt mF`m$ PF ) F >F F(FF.4+* FF\I(F}QFFm[$BJ FFRI(FfHFj(*6 VLI(Fx JJKJSVO(FB ##"##:FCFb(?i FVFO !!(F!I(?P>CO M`m8F(; FF64K vk +"J;F!(FIz FF!(F(? a mEӯOF3c3p3z3333[3_3-OFFF!F0{I0FO0!ESB4+tIJFCF0F FjU #pFA\)#32*X 6+)eI#"0F#"C0F####"( Fj% ԫ4+UIJFCF0FP4+PI#"0FENIJFCF0F#"C0F##JFCFS(@ 1[+)дFOJ--J FOK??K EJ  C .IJFCF0F> 4Bf$* ݔ!0F&I1*+"0FOJ (?)ha3`JCFF0F0 3c4&4B44M4`4}4-OFF OaFjF8{԰H1F$PTet@E!$4###F840FOcu0% Fh +Oc"F9F0Fu0EI F4C4436G1FOb FI FB& Fja'F0|IH4pBO30C_vI FS$4{sI$B'.0pI$4 nIUvVAlIb'0hIUvV1fI$I4Os$4FUvVt"dCF8F1F tCUI:F3F FEvI4$4"8F1F \)FxF FBFFI Fk$B:F F@I3FBFKF F0O01F F0I7V7l$Խ@$Iw 7$ F<$*OܘF # pKpOsKNcȁOsˀOs OrF jjHm0 F F -G FxF(B F IF(F 鰹N*F;h%IH#h3F(EEO0HN RFW%05IH#hc KW%02F I5H#hEE%7 p77 a"$4Q 49`#+N FrF7hI\O08F(2h I(FM2*2s2hI '778-OF hF2 F*OUsڋj k2*s BO0 0Fe(0FF (Fi+Zi)WУj BS0(s'BBG0(s'BB;90FIF0F# XFX"AFPFG0F0IF0F"AFG0F0ck0Fi I 80$!m#FXF (-i"QFXF(8FFFFO0"1FG FU0 4"1FjG F^0 FzkI 8&-CF F WFCIO0F$d"HFAF3F CIJFCF F"3F(F9F FFCFFI*F;F/upFaF808D8~-OKF Fx OIhF@FO O !FV <`   I"F8FO8UND#C C#I F'|8pFN$3i)FV+H0$0FiSFlI#"# F#0 PFicIw4bJjh3`ShOrs`OC#4HF9F4iH{i Ycz 8 F50?>j$$0 C@`FBFF3eOCseO 0 0mE +JF;F! F0? F4j##h IYF F 0?  4$$j j P 4j44:Q:::::3p;0K0FhB.I !0@@e*HU#$(H$4U" FF#H"H! F0HO0!0jHh  FFH  FFHJ8!hFiFH!mH iJ abFsFHF40 KF(Y bCbEBaiAaa ea!` a`k #  BB!iMa%aiPFi #h[hBJk#ciCahaeaCi,aa a[X(FI8FO==>">>=>Z-OFT, u/*F#FXFtC*F#FKj F;iCD *F#F@F\C *F#FHRF8iC D t/Yлi+@:hzh*rzR LB{q[ k # ^ b S BzZۦBzV SO,u *F#FPF1FCMCjPD  O"OB `F8F ,u*F#F CF*FC 1F#FHFi  i F F?isF-O iFFFR mI=O65FRST hIi gIeIZ  e#i;a#i_a F20F)FZFSF~fEEF$CEv cJFRICFc#f I##b #C0F)FXFQFHC  ZFF SF)F0F<f#Bv,e iyh [8hbiFr ,IYs8aG,`a#[b##[F#BrISi IfBq Ia0!f LC#i;a_a F:e~>k>>>>Z>? ?4iBpGipG Fi(FpG-Cg(TE CEr ڀiW BE~!!ibl FpF! !FF8 F IO0 p J !e(  # 4>Z9 BIFK"F IH$ I H MU4 H, I?@ p@Z@f@=*"* IO0**    @@pGpG *8F FF +6&( *+!#% 8 : *"+J@!H\K FI*Fd      JR#0 O0A"A4-O3OBF F@^I0F%F(FhYJBFBUI0F FhO'F#FFFFjxECFoFE4+DIBF+F0F@F)F$4"^O FFRE FhgXHPCBzOEF  34+ݗ0"+H*J@!*H(K)IJF0F{IF 0FGC18H#)FO Fj$XC=FjJ FXF5EK9`E  7JR#0AQVEWAeAA"A4-OFFF#O J9F0FBF~KhB(F |!(FF#C&uI(F? p, A,f,pI F F s,# (F0O #jO (Fi#6??4jlFg11 4+ Jݗ1"MIQ2BLK0JIJF(F!* *EI#@ BR"BI(F2*?J@!?H=K*;* :+W9Kc"SF(FiF  7(F0?q(F-0?k!@"v0F #0F!AF(F0)"I(F+P K 8H#1F6 QF#F FQDA9C0F $)A iA4A8XAA"$ BO-AF)OHhFO NON FFHI2F FO0 F0I2F FI;F2F(F99PQQ-GF F0?-4 d$9H#OF$$1jj |0j4&,&.a(Fh (a F0I:F FO02F FOhF FIKF:FV0F9Q<9QY)-OFjI OQF F F!#@cI FsO0! F! F!  F ! F4F# $ PI~/@LIO$ 4#"!+#!f F0ѵ/#"!竱! FF(OO O #" FC 2I2F+F! F0яO #" FF(IAFOr pES2F1+Fx#" F#yF F0I Fw[I F W+j(BB?z  IF FA+ъ|QyQQ2(2=2OR(QpF FF!4"hF K J1F(FCF KhB J#iF F iF F0I GpR^Rf iÐKSB@pGƼ#-OFF F   b-V FxJ9F0FtCFuKhBQ+s F'`i+Mi+JBBD # F# #PF??F* F <  3 F FWI""UIJF Fq-  F0MI F(F#i$4"PFYF>  FF&AI FiE6ih/hx#EB[  лz  #C %,I F BF1F F ;FDF??F#EByH9`F F F0 " F0?~ F# I#JFR iƼ9äRRSpG-OeFU#FF##J9F0FbC ѹKhBиI q( s("F F!0O0## F##"@F??FNI7V#I F$4"UTM`AEp 5:FI3F F! F Z ЍI F! Fj lI! FcI4  ! FP!  FJ 4vI F #BBqI F b4P = FT6E g EyaI:F3Fq`I"XFH EyFF a EySI{ B AÀ.wÀ B A ))9DI F   v24'j 4v47a9`j \!0F0a F 4jT4L41i@ HFAF: F]0? 1+*I 4$$j j dSp iøStSS6SSTT:ƼTkTTO3B A۫- [m F1Q0IOsF.wDSKI F/.w .F:F3F! F<0?N!g  F j!1(I F3UTT-C%F FF.F 6JAFHF`C/+s F!xi+TOsBBI %KhKE#SV FV)-N(.a8 ( (!$I  F_0, F, FH CCiU4 i@f-OF$4F{Zк$YKXJXF FT B^F0F&#FNH*FNL . F< @ XF## #*CKBF!SFD(EFTF 7JEF3TF  3KF 5KB#@+GOzs"(F!F(=S # !( ZDBZ   v 0F T O (F!FOzs"F FT?t+?p *F#F #T DT U9UUU-CFF F *uC ! 2 UI*D!(#0 @"!2BF3FF(3F HBF9Fj#xH!Fd U Kn:f*oB (КmQeppGI$Q oP o80m#$!v I g"F!F gFU-CFFDg( C3=?AphH=C$ͽW!dHFcH>CD|1kF  !ZJYHDgO VHF]8RHRHRH#C%HHFNH)j FD 1![R,""[LBB]04(?HMO =HF$+(FUFX(Fg\8m#jF$!mF0H)FBDkFBHF=J!+F!J!Hb1+Fѕ1+HVoFH=C$KH!*FFH>XUU2$UUUUVVV8VV&V"28UV,Pp FmiFCHF #AH#@H4i=Hi+ ;H#!#"ji i;+ #j!2J830H mp,J!"")H(J+F!#J+F!""#H" H!J+F"H #SOaBFH(FUF(FH FgWVOVZVfVqVWOVVV"VVWx-C]FFFbFT(F=IBFO0 ]iCE$iy&j2F!F(F2 AF1HBu#.H#JF$4u#)H#JF$4!&J 3F8!#J@3F2@ >("I @ HJ!@@Hm#8$!=HH #SH`OaVVVF 2F9FH6zJ9FH2$#0O l"sF!PF<(wHQF0$$+rH0F1pH pI1FЀ#(F&#FgH 8m#$!& 2F9F`H2F9F^H #S![H$i3"j!F(F q$i, ]F2F9FFH@J F!sfOaHH#QF#"jFiF,Ѐ#(F&H3#F,KDiRD(8 DBJ?1# *! #,Hn i+;+#j83J&!s&2F9FHX#jg h 1ffW fWUUW$TW*"dW9WJWYfPWeWmWsWWfW-OX& FFF4F`QFJHF~AF@𵀂H,(@𐀀Kf0Z@ƀ~I (F$(@𙀽*0x-`- H-bW-fA-XtI a=-S%11111111111111DD8F0Ѵ8F D}DzDwDtD qD`nDtkCI8F(e>I _ .ؿ6["QF@3 # ". F*\0;.$.$.P#0#$*KhKEc!8F+04]$H !F8F[ R睲7x##OsH$ +s8F !Xi+isVBBձ"F)F8F$iW oP@th"t iW"d 43>+F(O>@"j+?.(?&yѸ[J\H8O.AF8&XJ1FVHVH8FF@- ( 8FI#-FGHAFs8F#F?H1F 1 .i)k?(O?8F# \E8F8F# NB8F6iEF &O_iH###&#!F#*ji -i-HfWWWh-AF FF!4"T-KnFh3SB7F>F'K'JAF(FbCFı!I"hFNꐱ!KhB JkF F"i*T* L*I a+, Fa0l*ТsH O0iF F0ƼX(X5 i@fQ+B@+pG#𵉰F F F /J1F(FC(+s Ff!`i+Ei+BgBB<ԱKhB# F##")a8 (!$I S F0, F, FNH, iX i@fIpG@pG FFhF @шzrF 2 B-OFFPKF$ F 4 896F : ۉ>00s+И0l+(O "HF*+K(J"3Yi2F(F8C.#KO F "  `J# #i?01FJ(Fz >0=0<0;0:0 #F2F(FBѫ  3Ѥ  X-C FFxk  FIF>  7#I"F 6 5  3 2 1  . (T'EFȱ1F>#S˄0 00**+7/O0YpFL&{@!J 6 {c{#{zzcz#z#h 4G. pX-AF L% O0#1F H4+CF*:F=ѽlY9jpFL#FD F5`ir)Fp@/]eF(?䮞hFб5jO h$3j3BGIRF@F0EIBFVPF @FPFnO>K!>JZ>IZF(I (?_ (9I"L(6I0F:(?J3I0F2(?BBs B r)I F#"??G!I Fn)F"$4B:Il] i']Qy]]\]]]e]0^/]9^6]]^qƼ]z^Z^^6B$$&1??ѨI ^^EA٦IHFdF(?I^(?LOrF(FI0FN(?(?F8ES"1#T??@ŀI FN$$)F"$4BY6Ix I F28F~I6r*D(zI*D8F(rvI*D8F(sI*D8F~(roI*D8Fv(lI*D8Fl(rhI*D8Fd(eI*D8FZ(raI*D8F^( r]I*D8FL(к1++O31Os1NvO@pArEI*D8F (?jr]?I*D8F(?ZO $$)F"2$4B/ F(?8FF8F$42F[b??@!Ij"!0dI0F(? FIA^2$1t]&^X]\\\\\\\\\]_^6I0F(?׮ d(эI$0F(?ɮ$`&$0FI(?&R(&0FI|(?(D(0FzIZ *$"1wI0F(?ErISF FD$:"(D^?$BF)D"^@EFN$$1??[I$:F)D"hh3SB*FF bC J It IjF"0 I j8 $p(_i'_!!ӰF F#,"!#2#c.# #@'# #!K""'K p( K) K* K+ K,r:F!0Fl)F F S@i_i_i!_FxhF  ]HKpFx +@EJhx Bxm5@C0=I @@BZ;H A ix J#@;@BO6F/H1Fh`i# Bx3@C0#I @@B$"H A6 iFHh`i# Bx3@Cn0I @@BH Ali"Oa# Jp H^  p""8____` `7sF J IHI @"(FF$pah(FHph[x+ F/h`h\ $h6`BoCh/hB(F"-OFFC BFxJxI (F7FsJtIFbh hnQFhhhoI(F(9ОlI(FF(HiI(FFFfI(FFFbI (FjF(1Ѣn# (F0%NJUISI (FL(0+ѡn)|"l0F"0onJIF#  ***ѻ YF[ kױ:I9IRF V(AF4I L诱09F=C"l0Fn"p阹"l0F!n"j0bnl)lckB(Fh1+#o˱!F(FG0mI, "l0F!n"@0k0Fm"60m}@_`BC`V`Z`bt`l``{``-AFF$ F8FF F(F~FN1FF8FFF(AF F( F$(Fn,Iz]-AFFIjFF|F+ CFO0&8FF(А"!F"9Fo<I0F"0н0"FI@F+`iF0 F@ FF~F0@#`O0RBF4?#8F^"FF(F.2(! FFFXF0#`O0,BF?#8F8"FF(F2(!n FjFIr@#`O0]ĨpF.IjFF\(,K!,J,Ht,I F8FŔ)9XBaA;@!(F8FI0FF(F`I Fĕ! IFF0FF F-O0pC``P`a+i0,M I"F   0#i7" Oa#J o|+x7#ci Oa #Jon#xc ,M0)F HX(Fh0D!FHN F^0Dia5akapIFbF <(KV!JH FlFFFh3SB"FF IjF(FF0I pa+a]`iaF"!hFXIjF F$C&iIFjFR0KOaJHhI F C0)PBaA:@ I F00O0 &Ca`aiisF FIjFCF0F$ 0K@QJH FzFI x1F JI I(FhJ I FeH pb,`#ab6bH`Zbb7 F F0J IdI(F|F0 K@A J H0 F I KF&802`lbzba`Z`V7 F F0J I,0 I  I(F<F0 K@1J HI F80A`lb`bbapIF@O5#`(F$pE@-I (FdFIF I+F0F0 I IjF0FTFI Fdbbbb܀ib𵉰IF8#`O0 F0FdYFI FI3F8FZ0 I I8F%V0I FdG(FhVccic.FXC HHH`] c<   @IF!x0I N0dFI`I(F!b0I2%BȿB Fd : H1F5 ixcHcacsFFOF` 1F FS0I*F FBCXBXA cpFIFFXFĕ pIjF(FmFĕ !hFIFF0FF(F`gl ivp FIjFF0K@fAJH$!F(F0O0 p#*]BbB;B2 @@e !#F(F I F\F(F` CCc`Pagl8FOICF(F$~0 K@1 J Hh) F)I Ld 8CbZab6jF IF8#`O0" Fp0IH: cdH c IFjFh0 K@A J H~ I F0H &c`ra耐ic IFjF>0 K@A J HT I F0H &d `~a耐idI#jF3I %]ib FIF0K@1JHI Fp8bzbȇa`ZF08 (٣a*أWA*أ=X#`O0F"!I F#0I \ ic.رL ! !\ J H` "F,IH dd(FF J Im!HONL!(>FHKI"F(;FH3FZKlƹm!HJKIDD(F"F HD(F2 sh(FG6hȔd:d.d4dU pdA`pGA`pGA`pGA`pGJF `l `dpGJF `Qm `SepGJF `m `epGJF `Ql `SdpGJF aQn `3SfpG8FFH0j#`O080 +$ A;+Z#M(Fx>(P #,T CK \"JFnpG BЀi-OTNK @@ D`!Oy0FI 0 DJgI B7I DD@uAvB;L5FD0Z7IFFF'F&F%FF 0KXxF Ai)i+8@ U, BB" B@FG(! @0 !n02KEB SEI BA@FG(By (@Ffu;e6of"-O]FFwEF 3FFqAFјJI O IF AF F*FFJI+"$Oan#Jon9FHV"9F(FnI*F0F!|0#цH)Fh"9F(FnI*F0F!l0)iH4 0 AFZF FF0 oJxI)i)vH #S:Xh"9F(FnmI*F0Fka@#+a!4iihH! F^"9F(Fn#"bI#0F*Fa!0Yhic#F(@ZI :!#nWJOao z0۹:##nOa z#LJo0+QFIHPF0DQFEHPF0D0AF FGa*F8I0F+a!09Ii9HPFd]H0s F(2K2I2H|AF FH0I0{@ǀ`P-Ȁh"AF FGiH"9F(FnI0I*F0FD!0@њIKJ)FFfȚ_ffg4igAi~g]gegRihih,gsh ghFh^:hliff"9N:H ##J#S2I3H#S/I.H#S+I)Hy #S'H'H#k#J#SIH[#SIHQ#SIHG ,PP-?:kh FG-h0"AF FG ]hh|h:hhhh-OF FF` )F F0?I:F d2F0F@9J 9If FF4I fFȐ1KO0 F@F b'YF8F`鐻YFPFXP IZF F K0hՙL0hԙM0hՙN0CO06[AF F F(-h. |IhhcȰho" o𵋰FF4FI I(FOF("hF2IjF(F0h+I I"0F J I;`;h I"F `Fl"<(i8l(l5lR FFmRI#FF ld-CF!I FF0KOqJHN4h NF(FrF8FFȱFHFm2CFJ)FHF$p$(F$d D Н9' 8N@CFL@C2Fy. >I@FjI(8F,###pb(,""p])hcNH#F. DI"8iK^oI"k0I iIo1pF NM3hB3(hp(hj F"!C(`F4`($ܰ"h-OF+pFhFF_x0+(8ICx h310x+ 5 3K2JF,xT!FPFd-K,J5 Bݒ!HF`'痱ha0ix10H%(FEHH7h 50IJDh!LX1 XW90\ I@O0<h0@W< C K5 w woToko)pF F'x0+$JCxh320x+H&NBpb\20 V1CB"FQ H)Fp@ Kh#FH]6H* woo w϶pF F"!p- -7%#`(Fp"#, P۴O,F!0FLoA\ @T`bF(2F K"#F FFCF I 8FFI"(Flz*F1F F@I_`FpF FF!"hFjF)F F$p-OD]FF ?J?I  ?F9J:I  PF 04J6IOr!(F"1F(F@< D]ah0FFhKx+ё0 x+"@OC+a*F@FyIkar0IH^$h|KEћ0Ohx[s@C(ѝ<1O+ K I HFp`B_oiooo"8pFHx FCF h++ &pI "!hFB"1FhFl"x!F*(" IjF(F0 h1+h/+Hoi oKx;@FHt"oF FF Fgh(F9F$hhKxB8F( IH0 pp FF!F(F" FF I rI"|( J3yh320[ I*F F0O0 O0p+p& wi:"F0J ILIjF F8&#`O0 I F0|0I 0 ՈpNpZi9pb"F0J II F8#`O0 "xKI FX($0 I F70I Ր_pnpZi9pb"E0н0]#HJp~pvpGhJB ~BB I H JBFpG JB IH J HpG HpG HpGPPjpPPpppphJB~BBrB I H JBFpG JB IH J HpG HpG HpG HpGjpppppp-CEDGFF FF(FB:FIF0F=F 9^), "FI0F< 9d%B 5/ IEBӨE0F=KhsQC4oIF&0I I  F0KOqJHl0 F I CF H F$ipp`Hpiq.F!"! #I  FXC J I I F0I vWq>iqPIFjF0KOqJH I F0 I  I F0 I q``apip΀iq.-CEI OsF0AJ AIH@H # #%Ss #ccb@0O3a#bb#c2I"F0FR0S0I ,/H "2P"@+J x%ahY2 'Bx:*$0%O 0;ca"IEP#`O0a 5 -x+I %CF:F!(+F"3a+Ѥ vuqoq8iqq w|q#I Fz0JI xFIhjF I F00I vրqqրiqIH" pqð2F("!0FI2F F0(6'Ԛ'o%%"!8"!$!"!I F0𛀝l * ِI >%%%H6l m-!чI F#`0S0нb0+uЁHI F#`0B0нb0+jzH vI F #`010нb@)B]qHmI FI#`00нb@)BRiH8"!$>fI$ F 0(+H P`I F0@]I F0[I F0 XI" F,(@ǀOsBRHCPKx+OHMKx+MHJKx+KHFKx+HHGH#6:I,2 F:.2>02$+*0=Hv)-.,C0C**+6H xh300[Kx:+* 0H"n /H)FR&$'i))HH.?n7/?j, 5i!H6;H0 ^H((i8irrirrss8iiii֋sN"rrs ss s( wqs.s2s> F  fFHOsBH N#sXsb0 I$jF%DED D D0I(F F08iqF"!hFIjF F0I iq IFT0 KOq J H I F0I v`֑pislpF FFHF`0FpE< &D3+ HJ=ѽp@> A- 0%   I  SCFHB F 0,Fis~  IF(K!JH ! Fs`֛p  IF(K!JHp ! Fr`֧p0" F!" H  0@"!(FXmFOb)F F( H F  0@񍽫x+x+i+ss  IF0 K@A J H I! FQ0I s`ֳps  IF0 KOq J H ! F)0I j s`ֽps-O=.I#F Fll&tDOC DOP DOS ~DOB >DA'{'p!LK JHF~!0D"0F._ + D '+?o =/ # SJL 33~@B9@B2JأgvA7B'رO 'f13?,!!@C;2%2^A$1Bc22Hr 2M2zrG"EB9FF#x*+ۀ$+,+*^s))))itutu uuuqt"ńu2+Q+0+΁Jx*?)+:;'+X/VX<>VVVVVVVVV@VVVVVVVVVVVVVVVBDFHJLNPRTKx[cx!^IFHcx3DFzJx*{J'{I+FyHLxIE> WtH]70"(HFFpHpoIeKx+СxmHfaKx+!yFxO xgHgIVcxfO;7OEݘ(0 DB^HB  F[H8JKx+СxWHO0UJBFTIFH$@Kx+ OHIF_FKH駉JIF4 9'p BI_FF0 ;D ۲+f9'I8H]|Kx+?:2H!Fj2XF   :F+H*KFKEsE$H%J%KEFH :I J J"uJuPtsluY|u`uvumuuuPuuutt%uvrpPpjttpsJBysqIrHVqKx+?"zyoHL+khIiHDhKx+?!z fH 8dO<8+_HRO :FZFYEёUIOHNKx+?ma PHIF FLH'KIF 9'  FI F F ODo#+U:)XF P  :F5H5KF3KEsE0H0J1KEF*H ;'I+J+J+Hbx!F2+#)H)J+F(H(H(H(H(H(H(H(H(H(H(H(H(HH'H'HPu"uuuvuutt%rppjttt/t8tt=tBtMtXtbtjtrtztttttttt*0IFjFLBF H< F%00I (F$0(Fivv.K"`pGpG O4S+2h @pGSBDSA"D Raa]pGFanFH F,Jh+`" Ra_aZ ]pG RaLaG]pGK[h" ##!##3a60HO0]"=F! H! FC H!F j0H!F btp(eK%[hӱBF! #*F#!+Fa0!FXH@$  % U U F"FHFLH JH$"F DDDK"DIEH4^CHAIBH  ">HB=H"!O0(" ~" z4Hp3N5`"O0Ch+!3h+" `" Z0hB+OsB H! FH4h,+OrB+ + O333vH"g{Jne7%SKh#0@pG;>+$#`Y T! "D! 0"H!"aFI "` MF(` IH!Da([ k`0v"m IFFHTIHrIH"FJ v pww h'(0TK! oCC B K` 03ȲCBKK!`(0TKI 1CC B K` 03ȲCBKK!`(0@Fd#%BF#CL`BK` 0K!`(@# C/F۲L`BK` K!`(@CS_FL`BK` K!`(@CCOFL`BK` K!`(@ CCcoF#CL`BK` K!`(0@CS_FL`BK` 0(шhTIòCS! C_FM` %B۲L`BKK!`xxK"#IB@h]!--AF!'FBO@F`)FF()FD(77 FhF]I*Fk(F` `0Fkh F xn+Kxo+4'kX%FI00F`(F'x!Fn+ Cxo+0`(=F `(ч[IFFHn & p-O]F S D`}lkXW o)-Oi$ F #YHRFIF% VO&h{&_EuSIs3BRJSH3F FRIo-FPH=F0KKKIMH-F^(qhGH5FNsh+l?H@I#-FBHsh+`9I yB p-OFF"! FFܱ؁oJ%FF#5``09FjJ.A9 +;+-%W"4O5@FK3hZ\C3`4#`#gк-@@Ff0@NIBF r(d(M(DU(aG(,e8 (S .Q. .[. . .. . .{. .. . .CCO Csg{#gs%kC!I2FiI iXCO Cs`gHo0Z-?Y0gS cg g%3+'yyHy i'] e$#H)FT,l0I+F"F T<[T< `Oa#Jk ` y7" FFxB(I#F*F 0zNF^`( FI@ݿhjF^2( FI@Ϳhf"FBx (I"F Jz`8F FJ I"F J#x/+ !FH`)FH8@¿8zvzzIFH >z p-OF#F` FJ F|;`#`0J)F F~C0,o(I#:Fi I iU#AFVxhQFON'\R,y i'pm c"F3F#H)F#F2hd0h++h`B3h H? KF+F"h IH z{{6z8F F I"F #x/+ !FH)FH8@8zvzzIFH ~z p-OF#F` FJ F|;`#`0J)F FC0,o(I#:Fi I 2iU#AFVxhQFON'\Ry i'pm c"F3F#H)F#F2h0h++h`3h H? KF+F"h IH Bz{{6z8F F I"F #x/+ !FH)FH8@B8zvzzIH, p{-CFF F#3`)FJ F AKh,o(I#2Fi0I i2hR U#@FOb`h9FC/\R iy'؀m f"$;F F#FH1F0jh IB FR{8F F0 I"F 0#x/+ !FHF)FH8@8zvzzIFHl ${ p-O%FF")F F`LrO.FFFFqJAFdC0nKhB5ѻ.&X#4Whd58F`4#`к.@8F0@YI:F u(f(M(V)9(:G(+g8(S 6555556#56?55556[6U(oC oCgoCoCoC8hO gx8hO `gq8hO gj8h&c#%I8hi#I PiU8h% No ^.?] gW #g cg.0gERCj0oCg#0+'|8 iyyJm f(+F"F#H1F#F*h0I3F:F +h[o eOa(F# Jj"0 H0#!o y|J7" FF&xB(I#F*F 0zNF]( FI@ݿhjF^T( FI@Ϳhf"FBx (I"F lz`8F Fl I"F l#x/+ !FH)FH8@8zvzzI D|KIKKKKFH N||}} }W| p7 " FFx (I+F"F 0}8KFF K%*F!FZ8F I !FF (F8@_"}-OFFH"F F!`F00IH" FONJQF@FFC чKh w28F(S ::9g9g9g9g9g9g9g9g9g9g9g9g9g:9g::9g9g9g9g;'9g9g9E9g9g9g=9g=%9g=M=9g9g=9g9g9g9g9g9g9g9g:::;9g9g;9g;99g9g;A9g9g;I=:=3=E=S=9g=e=w7Kh 6K"`N4Kh+1K"`i#saBiC#0ha!iCSc(JhC`/iCi#0hD!iCC diCcg!0hFiecC 0hI!iC3biC@iC3 I0hJFizF I d߰'} i"""TyAI hB `Bi"aYBiBbaBiB@aBiB"ao~Jh*a|J!` zJh*WvJ!`i"raZBiB2aBqJ!`Bi"BaBiBaD"`D"`ZeI(Fh\dK`cI(FhTiCa`b^I(FhHiCa bYI(Fh2 h@C8h H2FLAH l kkKk kjjKj jsi ]6FH y~~L~<"8F F I"F #x/+ !FH)FH8@J8zvzzBx**I A:F@h#F(FO3c`#h"!XhbO0#hhe`i#"!(F#h(FiiF(:F1F(FChsFO3OzrF FhF!ZC(`h#2F)FpO0sFF F4#!F`(F##2F( Kh#hBch+ ѥhmh`I*FhH$O0p"HWP(< `0 <pG FIBð(>2"#@##" #>#(h_ IF HH#`O0C] o -OFFFFB2%O )FZF`DUJ#D ;I8Fh3`D5#D :<D 3SK<3&C(H#`O0V<(D+V,"IH"H?@Ex-O%& /FFUF F/u=.zN<#`O0 G J {O O AF z `IEp %/FFNFHbB%UF7FFNFWGC h(PFFF FheFIH-AN} x FF!F@FOrJ(F)F(OpMF4F$N4D#I:F0F #Ch N}( 0F L!D ĕH "L-C["F FFAH.@!(F:踱F! "ph:I0FkF*1FF5H :!(F.FE0H JiO3GOFFO&k.0+O&iI2FACFBF)FN(Mi)9FDcd.iib``cakh5eaa #ai#sa"ǐ"L#-H@# I  gz ]IFHH  p-OFF$"!(*$#+`{NF`'FzJFD`yJ`yJIF8C tKh[ +g8(S EEEEEEEEF EEEF%EF0hQ#F0hj#F0h02hTI |###OI0hhNI lh"JIPFb(  PF3x!CIRF D ?IRF :z !##n7I"PF6  PF#x0IRF -IRF-z ڀ' PF02h%I0hO F9ObY!67ph707Ir4a,b-'' iy3Bfp8  f"F+F(#!H1F#F*hL0I2F +h[#!hH#H#Hi]FiH|i\FiHr!jHn 8 ph Hfh Hb 7" FFxB(I#F*F 60zNF\( FI@ݿhjF\( FI@Ϳhf"FBx (I"F z`8F F I"F #x/+ !FH)FH8@x8zvzzpG@pG8F FhHȀr((X(i ahi`aiaia(j bhj`bR BC ѫmeSheh#fhn`fnfnf(o gho`g88F F`H`hH`h`h` `lwhd   lm(d  lcd`p`lSd mO(e`mKhemGemCeQ BC p`"54S+BE+8#FBT#!A#38 FF8F F#T#E#34+g|fXX\\\VP|q|pcBcW:Fg2fW*F$cbaXXSBBczgfp j $d$(^(,X,cWFH>HL8LP2PT,TX&X\ \-OFh#F FF F``hH`Fh `h` `H`iHaiaia jb`jHbjbjbPS0B0SBBD\5SE'L53#T"#XPZR3B2*5q5pOrP F`mheFmeFme n(f`nhfnfFnf o(g`o}hgoyg"!KE" 0FlF@FhF8FdF/D#$B\5SEС.D"0BP%DDEDSC"B4 2F% R3b(/eB(,G8IJ ,OI3FbF (T Q=PoPoPoQEPoQAPoPoPoPoPoQ3P $ 4 4 4  (`  E !C h"(д (XE @X@ EBB"I;F2Fg8 (`$$$$Eu  JhXʱH:F1FE{ KhX{H:F1F(FAF I;F2F I;F2F(Gj"6LehFIHIHchL+ %%#hC K IH+Bbh IH4" pZ "/rKh l"pGFFK FFhKh+!@#KhKh1@<Kh3Q DF5KhjB h^2F#F H " *""""\"d: pG-A FFKFFh[KhKhCKhAfSDKeXhE h^f:F#F H$ """"\"d`3FORFG ]""d"HX"-OFMFFhhQn   @$LCi0C#h#ihFiZhKBМH i jYh:bJBO5sAJqm"@X\CZT#h#ihFhhQn   @$Ci0Ch$:$A1ih:` jSCEzsHRFKF X "PFIF0\EFF0FFO{ "dKBD@C. | cC 3B DCFx0"Z`0  @ C0!C@pd0 F  @$C@Cki0 !F0F "PFIFx0$\:H4JEhji4YAF8FU$$TRBAT`7SBBF @lh0Fki!FkO"9F@F(AF8Fxh h  E 7OE @POr9F@F"d" UTT(#TpGP#@ \C TpGR##FIH p-ONhhQn   @$Ci(C;Kh#ihF~iJ_hB кHb%,F(F!Fi+@𯁴HKhhBvqn n  $XEC XCE*|q]KO O m*@"Th$%*(iF@nB@r D!@\#Th0;0#;B2#0;0[030#3B#030wKh+yn  C0$0C0cETT0CDX:P0PecEqCX0 A .@ yn  L 0$LLFF[FOrDO| pDO| ,2D@ Or[F&XC00DI90;)0;k+NB3ykHDNk 0D 0k 4$ [ 4Br$$0 D$0k40340OE|hikBKh#i:FF"hhQn   @' Ci@ "d" U߸OOc O  _ EZO _ E, O_%I%H,hkEuiKiBuUHC%O,FO ZO \' Tu!=QhqEvwnWaFFL3BArL A TR p*8 FyFF(F2"2^Khc h[K(`h[8" ߸Kp Fh!F+OfOv2Fy)F F3#3ps)D 10Fp"T-O=ǰFF!OrF~JKƬ$uOh%h>y)b+JJp>s!tYh#I(F>t!0hXkYbO HF =GD0&pjJFI #De@BL@r[ CSfd04 @+F#"hkAoB@lBoB@iDoB@fHoB@cCB@`3B@]3B$$#O @O ;FgKhC @`O*Fhk0#F0FFp`" XFN@F2FXFV.@! 2F=Or! Fx Ozp>xh\eCC4HB@0OA###.K00n()?h#De@lB @r[ CSh00pth( t[n@+FOxSFBFh rC2  خPO F;߸""d"DT" +[JJOzr>thSC  (FYIcd#ddd#c5!0hXkQ? #DeL@eBr[ CSR #d@  @C!4 @@+FD0F$ $ $ $ $ $!OpD0 @0 H0L0$K0OA00~C?"h#De@lB @r[ CSR #@hD'a =Aq%@45<48$P@B0OqrH :KhK <48x08@j{(0@DAF8&UFUOsXFF9F#F&%D9`BA#FXF9F`#O3sӫHAF*&F0$-BOCȿOؿ# @O 3JL@|*O3BCBs[B @@`p   XJ"JBXC2G/2GOBGrG00 `Y @G")F$OqOsJ I"Aq0DBrOlB8F/('Bv8/Fy";FJP<#F @pFLC4bBXSB=F6";F0F)F@bHH@J` DHODBڛ`@OrJp#F"0F FF)F(1H@`0AOHDBHF N9hPo`(F!#i<$8D0`a ,`Eݲ <$nw8tOF n"8"d  H 5-bO A$%*ON@CHODLjJDrDBD  RJh*opSC*30 akLO3H$ IA"TF3a@' ٻO1z+O,%x#<#(5#03Kh+?:#05 F/Keh+!F,Hh3d3d4  $I R#K"%k\5O3O#t+ gVKh2"T  @"+C@C9FCXFO##DF F':F>"#ON߸"T"T"4h!%ZkR^haL4PkR3bisb@bbD5lc@_OSfKhcKheKheKh0cXTc#0HUP0hckP @X0DbijJB"9cO4A" j:kF3xa 9iB9c0H& ̠!0+@)L#+r&H 2#M9{i`*h[KbC FTOV"s1F#DvFZX:>" ","@"DF^"d"T,"HG"߸""O`z_Kh+V]I # ha)hOPFObhObxiQKhyih%h0+xiOr!WpT0+K#EKEI"FfC(uѽJ0+P# 0*{+y; |.hO`1F F)1FOPObFv "FF(Ob )hOPF"H0+hMj0:4D\Bi"iBCDFhInDr  @#"C@!CF# J|P#"T"P" oP@th_T+hj/I00F8"!8F1FHFB0' 0BfBOЪ# (15D*2*#0et "F ]( 2(J@dAde(a@dz((y(((((((-CDM$OcFF!FFfRCFO4 F DM"FF;FHFF(FP, 1#8F F I"F #x/+ !FH)FH8@N8zvzz MpG-GFFFF)F@FRF3FFFj`#"~LD&O` FVE`۽#D#  6YH-GF4 FFF%! F@FKJOF#` #q   K" #!F# F 3F m#: ^FF^ :p FFFn2Fg2F`2FY2FRppFF F((*Fmep-A @EB ȗA nҍBAӃ Bt ҍBA E|   -OFFFXF# " `0F xFPx(PI3F*F m,3a,M,%A,!JI+Fb< ,P$BRFG701F8FFF h Fj$6F6  @  ! J +FJ IF&PF}$61F8F JVlX 1F@F}0pC O+FIF&pfPF}(FOZa"$$`SEB"+Ox(-AFAN0 0FB FZ"Fб"F{+FF 3j*FBF[ (FZ x2(*] #!3+BDk\CJ I "@CkT06h+F6&F@F (FZ06&8"{ 060hpi;` D"-Oð F! FK(LѽBp/P'"h3h*E+C? Fo0XC"@"Ф|""И"Ш"и,"М"Р oP@thH3h+)jZki3!JFP'+8$&FB|MHl;kn F(; 0DH3Z@[ !O*&D0HDDt 0PFH&3 KhUKFF ADJ!HRF6;BkhO ii*j[3%BO @DO1% 3A5 ; F#O FBf[MOpRF06S CF2F j!@FF`O1V,H06RFOKDXh BKF &>H!:(6Eb0+ݬl3kn F<`+i1Kh+@ӂD?G4 5 C0"F 2 *C 0ѥJ# 3Pf$&B06KDhSF&  [#. 6*" o"Р""М("И*jkiIH3"#K.FLD0DB0+€6;𻀱Kh+𱀰H4. Kh-@9LlCm񧀧Kn!HRO@"! (( F jfDh0D6kC3j#06h!t$( O&FB&$ O K6}J2MEx #"L"!lS;nrJ#3'4/5Dh0!jlH3&&#h0#@!F$(@R^I^H%8| &)F" jHh03jf)F 1ZC"1 DO1BAOanAJAIy!5$0"h0F%0216J8Ic#v@FYF.J1IS@FYF 6*FB/&0O  &DB%#ME@FY1V3F @0FY#"!{l+ʮJIF% 5ME% JI#Z"М"4"LZ>ci"3+DF#F%B"KE8CFF 6"DD}dF #KEMJNI H# DD2H# 3F%05^@K"q!C>I?H^>Iº!F8I;H6Io!7H  RF4I5HeXfRF0K @lV&+K0F@&"#ciD%HZ`[ !O)J&DV0(D ei6HFHv@K hCF:FF0F)DHDC.ݸ|4 "D""РpG@pG8 FFFOb F(h `hh``h`h`(i ahi`aiaia(j bhj`bjbjb(k c( h`(l dhl`dldldPPRRhm`eXXZ~Zmwe(ns fhno`fjf^`^8p FFF FF(R hN`(J hF`hh@``h<`h8`(i4 ahi0`ai,a(j( bhj$`bhn `fnfnfttvvx xzz|.|GеF.8ـ3+5+-+%+++ +p-O}FFFFJF$F(hI2F l(  eI@F&ZF`(F(F_I*F@F0Dh+ZHIFpO0 }kcj`j`+k#akkcakakka@0#bB0cbklb/}GI:F@FV0vBI*F@FN0;AIJF $@I:QF8"F Fh"F;I0Fp9I0F 7I0F5I0F3I0Fh"F1I0FB,?/I00F"!8F61FHF0' 0BeZBOЪ# (15D*2*#0c "F: ]( 2(J@dAde(a@dz((y(((((((-CDM$OcFF!FFdCFO4 F DM"FF;FHFF(F, 1#-AFF:"`0F@FF0h3,x[x+(I;F2F 2S-"F-G= -S%kkkkkkkg= +dDTOH( FAFDTO($D4OXDOxI;F2F(3% I LF H@ I H^ch5"x4IH4- L pw-CFFFFO 1F(F\AEFtFۏByI3F*F (-O}FFFFJF<F(hI2F (  eI@F&ZF`(F(F_I*F@F0\h+ZHIFO0 }kcj`j`+k#akkcakakka@0#bB0cbklb/}GI:F@Fn0vBI*F@Ff0;AIJF <@IRQF8"F F"F;I0F9I0F 7I0F5I0F3I0Fh"F1I0FB,?/I00F"!8FN1FHF0' 0BdrBOЪ# (15D*2*#0c "FR ]( 2(J@dAde(a@dz((y(((((((-CDM$OcFF!FFdCFO4 F DM"FF;FHFF(F, 1#0" L xk%h3150 +۲T2 *0 ## wK"`pG#1FHnO0?FH -OF-h"!F}R#h<chh#icii0#j$0j+#k3ck80c%@0*B0$D0#F0"G0 l2L01#m)T0(@#,+fH KF(aHC9 ]H#COr@c,,F3TH$;bOI"(MH#"!nF EHIF3l >He+npC_ICE6H6I"x舻^pE_,B)7xrWBWA 8ysP"(IjPF\8J'QFl(QF0FfF FWFxF (F +F 3JI  ##'&KFD @#$#"?J) F%#3$:K)FB5Khd XCm1I20H,J#`+^л XOsBS BPBMӳ #!C CE@)F!"FA?B;BFH  '08NWh_o=vK#~ p"F!(Fns @ʀOsBB@# +s r[ +t ktO#tO#+uku [[+[ka+b kb#bb [+[k)#pZ`3ih3mJ1h@ ,B"1DC#qilq DCC %"p:q zqq7]J[FOa#x3B˹#+p$ kp#p x1+BLIT"jES1"F)FjC?樠Bu!BH)0 ! " B BBF DB 7K+`S 31O3z3B%B" h)+p'+O""   ) !!T3Bѥ!B+F(F(#r2[C#2hCR[siP3i3[CB#hC[+3]O ׻O ӻfffgRRaAC-SЂhh *Yd @8  Ae K hM N OB`bxT1 #@-'B=#@@IFH < p-CF FF!F"FA F(;AFB퐱}Kh"!@Fh:F!F(FCU FHKhI"FF Ph+ IJF Hihhs`h:F#'sFMh hJ@FHb Hp"!(h hJ3F@L#%#(0KFH]I$𵉰FFh3SBF*Fh/4'78F# xNKF2FBF  OEcqHqHtpK" pOaX`2+F@"D3`2!+shCWI`b .ձ@ rh{:r`Aqh hiBEOrDHq;F2F61 @=K (_hW #9Mc#ADIQE#3)DB#,H Ԩ+@  #M'! {:"shF@ QEW s`)D`FsF'+}##-Nk##hbM ph##@#8e6#(;#I IshQ + [B( +D Hs`B13s`KB+ D;%#H;e6-GFFFF ` w jFh3ScEF*Fh(` 0+7ѝPkB/5,D h4TBFF h` 2B  0  59FFH&0F #-CF#M -FF(F@h+HCF:F1FHHIFh?  ?H !!h R0;h< IC@@# p K Lh K)F.I#FFH $ pIFF H I"F H I"FH I"FHIH"F p pdmpF FF+ * *x *##pp\* Cx+IH(F;'*"*+;.F;B+I5FHr p FKhhSHKh\B Kh ) ((O OCOC`O0$$d$0FFFP;"F/O#WO? F`,HF+Jh`)Kh[ch(I; h\B#(FÈ*# ##ty*%!%!-#h)9h21 RX^# #=#ctIH ###%#1h (/#@# w$0$$d phh6FMNO F+hh *3h[S9hO  A L#2ycy 2 F$0$$d$ K : *B ( QppGI oP p F6IFF((4I" F 頹2I(F(FF FDB ,I-Hr #x/+ $I%I!F(F>*F+FxQ<,Fp/+#xk/)F F1x/(`FF+/* 2* cx.+1F Fv&F4F** I(jB=/+ p-O]H#1#3@#SaKbKSbKbK 3ObhH,H##*RѡJ#3J`J#3[h+(HNFtFO*FIHHL:hOa F;hs3 + FH8D"F9 + + M#SpFp1F0#xs1 @ObQ%""sMFt!Fx+F3/+ AOb F% @"@!%0 CgIeHN2`4+aIbH PaJOa10 P A0ObVIZHP%#8x+`+'?+&D+كRI KIPHIIPH!% @)ObQ#0$;$+%#a;+R#kYkk×kkkkkk k}kk=ȡ/ n&IF b( @FQ F?خ#CK"`KhCK"F+F @e @%E$$$h$L p"P~Ƭ+?0<$Hʁ IF (@ @Q?/(їI BHNs A1m IF ( @ÈԉI BK# IF F( F}Kh|K"`3 xIF (ݮtKuJuIuKjHuK uK uK uK uK uKuKuKuKuKuKuKuKuKuK ~rIF rF( @3F(?SKhchhI; h\B׭cKh+h+?Э H@F[F(w)F@Fa1DG@F@B 2O #! SF*FF#BRD DCIAIF+*2BDSQ++FQ F 9F8#FCCKE@+?m"IF 2(j ^ ,IF (X" p$d $0&>,0 4FW`$ IF F(L I#h HHI Obe$ pk Kxi+ H3#p!Hy $ $FIHZJOp IF I Hb IH#IHH$$FKFIFhc h=\%B KhK K J I(FF I2F H#F(F$d$0Ħ o-CF3KF3IFh h 3$OO \ A )Kh#F(I)HrHF3C%Kxi+$Kh+#Kh{#Jd!e0/2F+F0F)FFxOF F00C0G F2F+F/F(C〸$d$ o$ $0"I;J hh\<$B PCyˆ+"B€ F$d-C:M+h:I:H ! =F+h4I5H5N5O%F2hkiih;R\A:hR\B(F(F,(O&%2Bvӽ0F)FFk\B0; FIFHcy F+ ; Fi,5FM Kjbbb$0 o(E$`$d$XW$$I-OF; hFFJ  F(RJ (DѡH#XFIFF(UiJ*;DE+9@F@F5*OF<ղbyBs5՘ B1F"@O@ .M0F*FFH@ BEiDFzJh:@FxIFxH@FVFr*!(I@ CiKhk F F+F2FeIdH @F˱c@FZFKF(F/FCSKh+0Fg/Ѵ0X\CY F)F)F FCcy+ FBI*FFBHv KFGZF(FÈFCÀ4Kh+0F`F Fa4I+F2F+N@F@F\GZF(FKF/F9C3h+?y / B  B 2h*?e "F@F#+F"FU0ZI FDPby*.ZFKF(FuFY$dc`${ o pcy+I F F Fi FTK(FjbKFbbZF:F Kh+?O I+FF HD I*FH$$# o= p4K-Ah3I3H3O&Ѐ$2Bv.K/Nj0F!F4FCy+'Ic h\Bj-е00;(FoIFHd(F (Fli,j mjcy+Ѵ0I F3h; FO IFHD F FLi$0 o{$X$$$dK-AhIHDM ,j&GF,.,j#j$F4J 2y 3a!20h+Fr\i[FXF1F$F6K !$" #y3#Dcii i i i i #j i cj i +F"(!*i3hS$0i+F"!4p$0 o$$8 p%$@$P$-9$XK-CFhIHH~O#"Fy`!T.8`vH#uH"#ÈCÀ5"HFF hTmjIFjH2iHIF(F( hTYcIF`HaHIF+!0< FTF\H"F1F(F(*hT9VIFPHTHIF(FRKxR)r)vPI0!BB(ЈBCIAJHKH 0"(F(EK"?KBK@Kh R # O( #4D}`(<`1D'B4(3( 3D(B]S(,2DC(,S,C,S,C,S ,C ,S,C,S,C,(3H%W/ :`0$0 og% p"$ $@>X$p$P$ s$XpG׸ٸ!gYKIHm& $p pKh)Kh,Kh2IH. F[h9@# FKjFIh(|hT' IFH$h% pm@pGpGaJFhS BDKBKm I H ]"S BD %I$p pF L Fh"i DBHDh*F`i9F0D.D`% KiDao J3 Im Hx .F]%$p: p#MF`+iBli FphiT0FSFha.aK(aImH##2FK>%$p| peK FhCK$h FF`GKh I%#F??KgmhT@ I;F2F@ H(F$%$$$p p8ML4C0+"mIH|JK$#e###c`* H!4R8%$p$X% TKsFh F;H F!F`nhGKhK*F!F:0 KEm&hT I+F"F`H Jp$%$$$p- p8FL hF F8)FT(4pF KM`khB NSS0IHz l`p$% pb.K-AF-NhC5,KhñȀ)O:!(FpjFh#(F;u`(4 I(FHIHDhTFJIF IH2`hT3JIF3h33`,F!F HA$%$ oPl%\$L𵅰=L##:IF:H##CbF5I3H4M8#3K@3I*+F2H7"-M.I+H.h.A##(IF0F#.h#C,F!I0FN8#KI*3F7"(hnI(hh)hH+h[I JJ$p o$ p$(Wx-OF,ŰF FNF0# FrHsI"DLF\E#hEӫnKhCmJnKnIiHLEF0dI E#y+:dJOq8Fy0S#y_J^I#hhUH.#..2xy"h`y1A:KR#D@F:F!y>PJ0/GKhNICH#hDy"h`y1A:KR#D(F:F!yCJy"h`y1A:KR#D(F:F!y:J#y+ 9I8FRh6I8FLX0+$I2Hy.B"D .F@F)J0#y+F(F%JF(F#Jy.B"D . F@FlJ0Ѐ!(FJ!(FJ o$:϶FUfw$0Kh(K[h CpG%ȵK(-O", )$Fh*C(ЭHKh+' , 3K0+:2Kh+0H_-KEFi- `=].s):BOsA+hK J K!I.ؿF H2F> `;,HsH4+?#@!@I2F2H i#Ob5/F5F.I5Hm4I,H#2I(HP!*Fch!(Fu(abhS %IFH#I#+Fh??G 3 9FHeIOb8D % o$0$h p$p,$4FC\j%p$$sJ#-OFh,M*@iNl"BkKBBИB ,MeMhCeKhdIeHz#` F~(]Kh+ hr ``hn``hj`hf` ib a`i^`aiZaiVa On nf j  kC c`k?`ck;ck7cl3dl/dLF@ xx|| !hMK+($T%$0 o """a" """CÄ ehih iÌ sn(? Nk#BNFxB宦KhJJh"IHdK"`ePFaFHF]FY@FUFNMXFFFB>8F=F90F5F(F1F-Ob! F#Or #`Os:Os9`Os8caa00 7d650XjKa#ca0C@S 2dKa=;$ & _Jh*7 Fx3\#=#caiNl#B#i#|3 #ch#h##k#k##dcccfDH&"hBN*BIBJCH+ FBIj#S?I p$X%$-O-!%K"$ %H@(9mH5c9mH3h+0DhRq`DD)BK Hm$p$pTw%$Xb.I𵩰N3hIHLMch"PF ((`rhRJIFH "hb+`K"O`I:h hS5#h CCF BchF(F@hRpIFkHPFO.3LF(hp COccI]HbK3h:`)^IQH]H\O58FZJ;59;99;9h3`HIQHPH#h۱KKNJhNk#)FKI9Or#9#Q :D3s93hAKxt+j>K=K F# C KhF(( hQ,"F I@F H Kh3"FI@HĻ$$ p$0 o-CFx2LF.+ FFCx/+!h-H 2F )I;F h-A!h%H9!h#H#J h"IJk hIJ/I hJI hJI hJiI h~!h p#h[I JJ$(4<|CJS\cjI t-ANODFF8h "F (I 0 +;#0B#H+pyH!Fu%tŔŽpmFFhF!0lFE*Oa&H)FQ~F l(`O0#xF+K"Z` mpA+hFhDB< +#<H!F+I f F%tFF FFf K!FFh HF F\BI B1F(F@%t𵅰NL`NI hKIKHv`JI  ZO aFI#ihF(Цh@!0F(`#p>Kqh?+C0`h*F9HY#8K3FF `(FQ.*3K%hpOOpCco h5%AOq hp#"! hh" h!` hC Z7 *_+-+H1F .FAOq<(c%} $^" w%E$/0ðFFFJOqK" FZ`*FC0N%Lbh*IH#c`%V>𵉰 FJ!FhFH"iF F DB8hbq pI 2O%Yt%p F JF FhF!ZhF. NiFF0h "F)F0h !H`p^%dFJP!8"H]jD)Fð JOqH"C]O0rzF FKh.F ZhBZ`C!+I:FI2F "h!h"^php\ O3@hS` XBXA#F%hB8 FEx- -*F!FF H@hB!FFH8@H񯸓!FFHǒv oDŽ(7((QHpGHpGHpGǭǺǠ M F0Oa\I M] oI n; f+X1 HmZe "ppG oP-CFF9?HCV=H DkCDH+hBH[V\*5O O FF#"2K!F@Ѿ?>IFH N pHόFAMM F.hs+`6(@a;K@A:J9IP3K6IF P< M.MT1I1J0J1@Y#Bw+p)I H!*p!"HF( I 4  F!F &<,w)F FA/ Hs8B/"ѽAH l0"F)FH1#H)1+ HA 񁻽%+ o+A(&)X-AFKNFF3h!F#,?DI F|ȹO3oB##C@FO 0*Ѵ@ J*"` FTB /H"F)F 3h+ Fx+h+#F1+#j!# CoBB?#)F8F,j2C!oCB?#)F#8F)FJ #8F#J)F #8F%+)`)j-OFbNFF3h!FW'O,P . PFOp0RH)F%@F  FF  IH"F)Fp3h+ @F FXFR@F jh+.PFGO40Ѵ@ s'F1+Ѵj2OC#)FHF,j2C&#)F#HFPF !J SFd!h )FFHF58F ! J ;Fd!L")F FHF_%+)))K𵋰8pKM}BO!/!!9F(F0H)F @ F)FD2F(  H#$<.I%FH(%+%+%-`sj-GF#HF"L%F!hF F)3h B"8FQP@#9F"hI k3`#I"8FSh C!BAEPF(@#9F"hI54%-` ))-AF/MFFq/Uj2C 2CM'HA/!S .?;!F@F!K"A 2KFHZh81+. !F@FA(.FH",%$B H)FA 7 H %+) o+A* &0% FF#SO0 0*I"F KjC+F Fg1 H!FH* %+*:-OFQ>[===>a=>g H1F"H1FH1FH1F%+%+*v***+𵋰FF%#UO0 ! (I"F I#jv#>CF+F FY K]h!F*FF H)HH* %++?8+FpF F&#fO0 p*I"F Mj C3F FG1+K!FHZh1+ OR#H* %++A+S-GFF`iKh۱#hH# hp (%_U(F N#FH jO7(%7O QF JF("D@F O0 O FGO i "(" BHI2F .j'FFAKj C`#("9F@F (7k  IF(" Fr(O eE('FFO MEݹ 3/K /J! ,3F4Q p  #B##QpB##QpB##QpB##QpB#1HAF#H########%++[* +c+j-CF`"*x FAF/#FH#|P(FN:FP #O3%F%9FHFUO)0 j F#CN(2B,I2F P0/#C#C  #"F1F!IhjC!F0FJ3F!uf# #5BܻO1H1FB  H)F# H5+[* %++c`+0FF%#UO0 0*I"F KjC+F F_1H!F zH zgzg+z;g+;; ;R0;* %++-OMgOFF;h!FO[E,j F>F ]J ]I TZF4!O FPFWIO FOS AC@1+*F hO0?Ѵ@ X M6")FHF?F)hE ?IJF 2 h")x(Ѹ?7IJFOX T# C/ID# F#F1+Ѵj2OCCFOR)F0F,j2C Q#1OR0F(F[F*F1FF @D0h(FN P0DF"1F"FF @D0h FNs%+%[++-OFMF FF@FLx@F r, L?+4V(0 JKKF[E;x%+4ñJK-FJ>chJ K-FJ2@3+/KB+1+쁡HQq,G,O,Y,a,k,o,t,~,,,%+[mH H 8X"OcOs0V(0 )F0FZF0oF(0`#Nj0lO;0F(0mC3Nf\Jh34m;3 1IHmC3Hn/k#h4+du/`F(aC- NFH7 tQrHNakHH"p+ ьIOrHrIOr0F5chBjBPFMF(?}-RFyhQq"Ts3FGjJ!DDDu Mbl H )F0F"SFN0 0{2C@3+`Hcl{O + K^"F)F0F$k$*ѹ 0NILp#C3F@G2C@3+9IDH *;ck O O 0oF%0kMNF(FKF0FNJ0'hC*O CDEX@FND F@FN>Zh +O# F%;ackCEK0 `0 C $IF0F$RRF ` gk%+%+,,+,;%/t,4,%.,k`"AF 9B   hBЋh;C 3D( KhBъh*O:\F MF( ! 1*)F0FN0?#CI* F*)F0FN0?ٮ# OcO ;`BF;F)F0FN0!h +8hMoF(?F;F)F0FNi0  E?PFNhFF#;hRFI F*')F0FwOHND0?CFM4F0K JIh\FO;F)F0FN'0?jHCF:h!F F%+,-OLF=!''aFB---7i-HU-x*h*BoACBOA.I@F(9.?3F0+*?a)" !!!!!!!!!!!!$!!!'EEEEeEeEuE%EUvH9F"p"sHBF9FO O O Fj+:yH:"F`@F@EFaH2F9Fx+!$h+o@CBBOA hZEeLM` " (@𺀹@IJIH9F["F`@FEFBH2F9FJx+!h+)r %pj ZEeLM*" @F4 0 0`BEe(H9F@F0"F`@FEH2F9Fx+h+kMEe#MXL# *|"xH9F Msp ˹ H9F../.y-/[...//6.?TEe4 &йѸ3.(JHM+СH9FѸѸؙH9FїH9F3ѹP@cp#I8F(GxJ#8FD908CEuE @ "(`AB *h @ #B(+`0#u@@Fo H#`#3`#3FM0-hN9FFnH/p#.!9F* !8FOq1`AFpOr2JFbKr_J+h8 p09FHh#CZK9FZH"#4qUI"8F(msz=+ KJ8 Be %15DLH %0"!4O Oy #2F4Os(F;`/|//- /%+//00$0@+0Ut 4+H#4K , ( Or 0Or #PF0 JFKv04Ѹ1FH1FqOrxB=#<I"8FF(3z=+?􈫈J8 B'17D+~Ht h#4%3FT%u#h!(F 1 oHl.RF豇hO- MaIFfH7h*FdIcLp00G##u"@T"@%.(FpD \ FDB@ـ(րMH)F0"h`!(F & ' X 'pp:FYF`(F  F??8` `h"* hM)FF1H8 Bx.H)FE0h(/((0:h h:2`" F!M0:Ѹ hF:h!C '##0!XFFh+%+0^-#-*0t0%.004h,",,έ#7I0F#"#3I0F$ '#F.I0F#JF#FX#(I0F##:F#M F(!I!H%FSF9FVM0Ѹ = FqOMh+"FHFI#00# I*FHF3F(#3F Q[%+,IFFH`I"FHZI"FHVI"FHPI"F HLI"F HFI"FHBI"FH< IH"F8  pEfӅӠӳ8FKhIFpF CF H)F` 8"F)F $D*FFH%0V$DmFFOahFW, I"F hF mpmFFFOa&W8H!F mp&iF BmF(ZH!FxhH!FrM2C&h Zk`+h  &2F (dԉ%0mFFOahFW8 H!F8 mKh  hiF d(%0-HO MFFpF0 ,iyI F xI Fй+*hOa FW rH!F InI(i#0(' F EFgIh FdIh8 0FaIhF(l^Ki ^I(,!0F>F#p XF ,#+p>TI PK 3x3PH0FMQ珱MK@LJHFFHF`HH!FGK@FJHF%;Kis;IF(C?IF|-oYF0FFFݱ7H[F"FFB80FM4 F)F $(]h&FpEC]B]AF*I*H#FFEF0FFF$H"F0+HF`(H!F6O FFIH#FhEFO   ԮԲԶ%0-X& = pbժՂ-O'OcjF9FXCF=FO WQI"F0F 0!sBѩFO hEO(FMqh0F  chB h9FL?F(=I"F0F F('F0Bҗ0+!a `2JOa1K#9E  `8 bF'HZ57%I vF gK!JOa8FK8Fh0:FFH2  8F(:FFH `( bF Hd|Adeռr%0b#FFHF0L+FFF H( Fp@LI Ft(1F I pZCiJipB FИp5 FF(FB )F Fp@ O0-O F-"F  (ܙH OdLL I 2F  ڌI +ЊK"F ---OcLK FxOKL OCKL /+@{K F-.++@ O 05F/+@p@PiiKBOAgKB/A|eKB/sx%BaKIFaJaHaKaKS`KS O G\F < ; 3Y+\ OK+K[d_ ^/+7MMO O ZF#F!0 !GR3F0ր?H L #8K9L F8FW <gE8F]Fvi % % %%%O #V<BVzOs.+E 3 B 2C fz@Ym.aA( KVJT ;[:Ad׷쀹3` HbOaV@J I=DH%08FL!hQK*FIhVKO2`8(F 4hahx{H( "!h Hdh J` J` H %`& `&&& KhSK"IhCH!P%`0%`R%4-OF MF0+<p/61F,M-I3FBF(h  (h|(H[FOb ?($K"$I(h`#F8F MFJ xh320n+?+!a+'p+q+K"I(h`"FI"F(h#0)h#H0 I#F(h"F%` oP%{L wj/Rw%`T%`8-A N3h Kh M! L#'h+`!`c'`#3`%{L%`0%`T%`8 K$`A Kh F K Jh+#`H!%`@%`%`4& x%5-GFF걟L!"@< T2'h@x\bE T)HiN/z.F+L>H+F@<O"Gh27p<B7h7 pE7ѐB٢\+ZbE.F"p$+$"!|K2F!x x8#tH+p,FxK@:fм[\Mм$bRENU2*$(\(*XxB*32 _x0/!٘xB31 \$LLl,4L$LO Bp73oDGH,,(3B #A$S%hF(5WK:F `hTKQ%hHRKhRKFRH)FS%BOKhd #FBL4!hJKhkHK"h`hQ#h3#`BK`5h*x#h :h#3`2h*h)F5F(/K)F5Jh0h,Kh,KF,H)FB)F)Khd #F1h)`$Kh+?[ K h`h3h33`K`L,"! F#F"O aP%b#hSHY& `A%{Lim%4%`%`4& d& h& t$%`T%`0& lM%`P&i.#O1h)0+;h+7hF(0K" Hh01hnKhKFH)F1hBKhd #F]9hKhk K"h`hz;h3;`K`6%{L& d& t$%`T%`0%`4& h-OM(FF0`)`;#3`Kh$`3h+OJ)F0F (-3h+*+h yF(,9GKGIhGK: hh";#9!*1FF@>Kh=K>Hh<X.;KO2`$ F M($5J)F0F (#F"F!F  YFzF-(%vh+(H9F$2&K +hZhRE-ћh#4RFKFH9FK K(+hXh??2BA$0FK#*& l& d& h&d%`i& `5L& ۚK#COKK)& ۠6K#COKK& ۠8-Gm`!`H~_KO2` m([J!FF (XK$WI`WK #hHSKh+SKSHh^QI >!OHth\CN\#x0#3`"F( 7K`3h+Kh;>K>HhC\;N%,,,-=5KO2`O 2HFF]#JF3!F.K0F1,5p*HFx(K*F(FF FJ|#z)FF;VMh, F`F(FH(KO2` FCJy,0FINK(F_&d%`ބy& `l8޸P޾ޱ+$~-A@LKO2`(Y+GJ(C;R#!B#>I|xx|+ (8H($5Ihd4K5I` !F2H.M$܀+h3;B0۹ %K"`BJ#J6(ђhJ#3K,FHNR$ /0F>)hKhkK"h`hO+h3+`K`4& `*l޾%{Lim%4ۣ68+$~%`0%`T%`4pFm@8O49K` mp! FR$ F4,!  -H-K/!(FF F,`AOb&Khk%N F1h 1hh;`+ -#KJ FhpH!FK O2`!F hZ ` "p" FXB1F c Hj$& `[b%d%`%`$^0# 087KO2`0(4JiF?;+0HYh(F;+,HFh)F(HF(F!F(FR, +!HFh!FHF F!F F8-KHh\,+ Hh!F F!F F KO2`& `"*6>H%`P%`4p(LO3#`нp@ K NMh 3xK43x+)h Hp@.JI(h##`p& `%T%X%`_߅p(LO3#`нp@ N M3xK3x)h#p@HJI(h##`p& `%X%`*ߛ@KO2`]((JiFV(HYh( Kh Kh# K Hh HYh(K"& `߰%`h%`&@{KO2`]((JiF(HYh( Kh Kh# K Hh^ HYh(K"& `߰%`h%`#&M FFFObhFo>$B HiF}( ~V$ObhFBIObhF4K"` MZ&@ KO2`](JiF(!H& `,@ KO2`](JiFt(!H& `B\@KO2`](+ JiFO(+ HJiF>(& `5b5 80 KO2`8 L#B%h#`H%`IhH& `%`ht8C+e KO2`8 L#B%h#`H%`IhH& `%`h80C KO2`8 L#B%h#`H%`IhH& `%`h81 KO2`Kh+Hi@ & `%`481 KO2` L#h!F .#h!F & `%`4!F #0(KO2` Lh!F H FZ!F FH F(& `Hp8=KO2`p(:JD(Xh>F33K4Hh/K1Hhz,K.Hh.H!(,I gF [z{'Khd K&Hhr F)F Q!N"I0FFP0F41D0F " FhXAOh8GKJ h;#`o)F !& `T%`%5k%`4%P& xJKK`& l& `JKK`%d$& ` FOF(O3;`(N#3`KHh3h3h"Ih H33`;`, K"ph"@HC& `& h%`>& M& <(7&L %M#%H+`%Kh+h#`0 O3(,+M !J##`(h`KhFK? + F !,`F#H#pOb)h? +Ob!F H JiF(& `& dK%`%`$%`&<&<V(Kh@ F(OO3J`LhI FJjI FJe(I FJ_("FK I L` K"`( F H*F IF Hh #h"%`\& `%``^%`KJh+K#K"`K`%`h%`& `%`KJh+K#K"`K`%`h%`& `%`8F F)F F8@ۿJKK`& t& `JKK`& p& `(-GF FF*@(nhCI0FJ(@AI0FJ(=?I0FJ(nO,6Шhe,4h^%! m!F hF#-F-Kh+7,J,K-Hhh,I,Jh+ F+IF'OO%&Od%#K`#K`Khs JKHhhIJh+ FI QF !IF  K` K`(?~"O0r%`h%`%`%`%`%`"LK`& `0KO2`HB( Kh Kh# K Hh H0( K"`# Jp J`& `J%`h%`Oz&%X%Ts F(KO2`pKNh31hHp@̿(Lhh "(xkjhI0hz#0hSF H Ip@& `&d%`i& 80mKO2`8L#H%h#`%`& `%`h-A@RO3MJ`KO;h+JKKHhL(8+GKh#CKFHh>$8h "CNYh`:;hK@J`"?LchchEE3$ch;c`+L7HB (Nch;c`+O2H8 (E1JiF(ѩZabi2`+c` FCK%Hh#hZ"`x(p (;h"bhBZ:`"f#5a,Z=#+p5#hZ"`x +Ѱ0KHhv#hZ"`x +& `%f%`%`T'%z %j oPc%z 08O3J`0((J*(!Xh-F?? FAIZhKhT-t##& `5%`08VO3J`0((JiF(!XhY??Kh]hr I*FF F+s##& `5%`0KO2`(ѽ@H\@IhHV& `O2K F{@H2I@h8%`-A(M8O3+`((!JiFq(XhF(HxFXxK*F0FJF8FFD4 FX"F1FF"FI@FV"F9F@FR@Fj@F#+`I8FIN& `*޸PZ-O@}(KO2`(($J(!H F(7xK*F FOF0r|#N!FLF;^#)F;`#` H#KRh(FI}L& `5޸P& |& %`hۚ۠(pF FO3J`phI0FI-XI0FI(I0FI#($hhkCJ KI`` Hhhh#$& `%d%d%`-AFFFF8K:FIAh[@hI #c`0F JhF``B=H"hIAhD%`A%`hWO2L"`((@jh5I*:F "0hl+h+##`MNO"& `n%`(NO3 F3`н@]Hh OF0jh8h I@@hI#c`"hI8h,#3`& `%`Aw805 KO2`8 Kh3 K Hh8@ML#H%h#`t%`& `&d%`%`h8C+ KO2`8Kh3 KHh8@# L#B%h#` HH%`IhHB& `&d%`%`h*8 FKO2`8Jh2KHh8@ L(OIh%h"` H%`hH & `&d%`%`h#+-OMEXaKO2` M(ܛJ.(ЗK$NU|FEєKzhIh^1Fxh "64IOB(FO t#' @0BKh#FF+21 VNF#xӹ3p$0hhCFktKwHh@mK`0B4$+ \+Wcx4;#x+4jJhbxP1@*#O "dF0bx P1@U,:B U< 0FBS+UB38F@hI#c`h=(F!F(FhI#`8FKF FFh(< :F)F0F ` #h+J!#h+;\ 8(" #`TH x +1  %dE0x#OFx !p%).Cxc=hZ5`&Ղx" 5P 7!W![nO۲  7!W!D0RѲ0!0!0 w-GF FFFmI $lI":(a P#`#0+€/!PF(@PF]F@!0Fh%`+ZK"`[J:!F([?sn:!0F|F#;3x&`-k "(F4+x;x#BOsBV>H;FJF)F.;I"8F(# `#6I"8F # `獱(hF `hh``hh`+#`x(H:FIF@F FO0 E(F*FQFFh+3`c (F`` h++Kh-ѣh;hH+8` K M^%d%`H%`Dh;`+ڊiB ( hZ `ppG5-OT I"&F&2(@O3`"F`;F(FIh 0 x+Й0H)F$6,7 F T .3x+;!0FjF(wIImvI FIh(UtI FIbsHrH*F!FO ##p0+.x5x-x/!0FKhH)FU FHIUKWK+h#`K!Nc%. *LO /U.1+ )Kc xd#e#FF (8hHF HO5h#h+ H^$h(`OO5J%`d& o%8&`\& tR%`n%`h FkxO  #!i@Ci숹;h۹h!`h ښHki,cI@BbIBF(F^.i+ЏHkIh*;hi"isi[ (F1((FO5# H10AFW(Khs ==0 >>wKwLhB!FvH4(;tIOBsHrKhhqKhN/H@#/0< F~!F F0H0#01< Fn!F F1H #1.(? 6YI XM(h(< UI h+((~ (h(< MKh+3(,6KMII(F1F(FGOFI(F&FEI(F;hhBFBN#C0,L@H!h#>I(F h#$;IX#K9IhR-KhT<1$H0J3I hB1I(FMP(F.Kh-H(F(b+K(F+J+I_h(F)IS& 6(&K&J)FF:j%`(%`X%f%z h%P%`(%`,%d۠%`h%d& %d0 >x鋢I(F6<("+9&KM,FsKh3K*FI4h8FIvKh3K*FI4hI2F8F I( h h0юHJ ?Kh+ЁKHhM n#h'"(h3*3*h5F `LF([ !FPO5FFFFO,F50 `6 "!FZ6x3mJ3h20Y3O4(%FFFF'FcJ CFhhO O4FF%FFFFGFOH.@w/@x?7 OHl+?+O5>FFFF EI@F063 "Fz?J(3x+м;I@F (y9I@F(x*+Cx/*ZxX4**-34x+.K#C,Hz7 "FD F77x-*0 "F4F|QEu w7  "AF"k0%`h%`DzYtBp ws& & @FIرs,"FDsAFN(?O3{x+ sN8sI@F~(FoI@FsmI@FnlHkI@Fe(hH 3 eI@FVdI4QF(?Ю"Gi@F"\I@F@(ѿ++?Ѯ.IUH1Fr*د#@;xKOH#OK#CMHMJ2+IH@1HKBhKK?9FxAK:FAIh#K8Fb;K:F +?K,?GKh[N y!HFB#D`@;t B2p+r 0># KhKUGw +?,?$2$0N(K}H}I  {H,?!pKh+"vJ1)smJhBOpAgK h dK# h A)'fKB'82??Z!F(Fx8#`^#')G)#)F0 NK8hVTIF FPJ2*s OK) JK  DKHH#PBBAh h h h h''+23K#"hhB3KP Hh3`Ch0!&`%`@%`0%`R%9h KhSK"IhC H 13 1Ch0!`%`0%`R%9 K"`SKhSK"IhC H! J131#@;`%`@%`0%`R%9%{LKF "`! Id"N Kh0YFF FH!\%`@%`%:K $`J#`J`Khxr+s+I FId"Id"Kh0YFFp H! Id"%`@%{L%9& 3%`%: FF0$@XV0Y@<# DKh{B %%BNFKFI0hS% 0hVIF @#`QF  -#3Kh+ 5./0Jh*@4JhZ//30K1Ih(F/+Jkh20ZH0 !h3`$,T,FKh*@+ d$$/d,(-d$/B--@K"`37%9%& `%d%f%`h%d%`%f b%d i& x&`7 w%f/,@Jkh20[ -$Op 'C..FE8[)-4JB[$$+h+Ů.Kh+? G1.O)K"`IF QF *h@BB IL#hkKE йٹй? G 1kKE кٺк? G0$/$P,?:d,?F$ w%?%`%d%9%-A!N 4hdHLKO2` FApGO I#;`~ AFF0h1hH0hKI@F"` @ ;hF;--k G)F U%f& `%9%B%d-OlM" J#LFxj  # ;F     N (hGDFxHAFwKO2` lM;h 4OrYi F@(0`pHАK"`"9!&(0`ډHn MKh#"Oq97+ Kh+s~K~HhOB|K8h[403xJ,h0O2 sH+0F(( 0mKh;+#eKkHh#0hH0+(є97+6[KbHhYKaJbIhJ0+ё $ #ZI0BF XH   b(XFKRHh0h(O33`#;`+DKh *+;KIHhy \ GI CHBFS6(0K@Hhc?K )h A870Cc C Cy<7B":'&BK-Hh90 Bј0Bј B%K˅0:78'#!I0h(D K0hh+%`\%`t%9%d%d%``%`x%`%dF& `Ls%f K%;V%A+%?%A%`4%`%`h97+ #"!#0h ;h"Oq0 fH 0hRO33`}8'aI0ht(_H_Kh#"Oq0hh TI#0hJF0  j0PH0!0h87X(KH:h97*~+@O 0+?Mk;h3h#O;`=Kh;77='<MF0+ѕ , <  # !1'@C`FP%Kh%JhO2`[F'"H!K*`F( 0;#097+ѬKJIh0+?᭻ѻ ?":`d%A%d%`%`h%d%`%f %`4%`RKFRLh h/1F@~:F!FBFP@! h>0H#h9FDO#0BKh+ؿ<#Aq!   t#9s Ozs"!"raC h+h#+'HP&H hO3 #`4!K(6 hAF ph+lh#+H h*F!8F'`0Н90+ #"!#8F h1Fr%`\%`tbM%d"C%9f-AFgO gI#;`eKhF&*𺀽*aMd``K`Nh1h"`*h`) Or+3`YN|s|ˆ6sˆpMKNIh$!$!`KKh(!(!`IKh,!,!`FKh0!0!`DKh4!4!`AKh8!8!`?Kh.K.Iphl!l!`Ob0qOb&H(%IOb`"aOb HAF ;h+?M# ;`CFAGLe&G!qU%9%`%J%`4&`%?%f& M%f&&%d& t& p& l& h& <& d&<&<-A/!FF#p(KB0FF!JF /##p-"H1FR . H1FOb1&g8F.#DD!(VuI `tK#S<qH(F9  F3hK#S/eH(F,^M kh3k` z  ) FpMH#k`WIhUH( PHu(OH!DF  JI @K2I\`FKhX3EM+hS  4+dNx|+! XAI](F: #=H)Fs&K`;K7Id 6H6K C ؉(pCOK,IhIK0# 2F#F8(H"H8 ؉%`%`& & %`l%`h%`%`j&&8%:%d& `%`t& El oP<t+HKH#&(쮡KFH(஝K"`?  KO4h+@FK`HK0=JhBЎK4 EKh(bа?O0oO`L0 /4 O03! f}Kh+D|Kh{Kh+zKhzKh+9yLzO AF .@Eā#BAp  0~-@ Z `gH [+`FO0F;+ A ؉ JNJ ىVKh0=4-(!OH  # G# $ F RBJ2*s (Vh +O9K 9h# >8h\#Bs##r [?|#3B# 0F0?m X?h#3B#DH#BAK hTK# hH4& V۠&%d& `%J%d& |%`l& %`&%`%`%`M(h(N,` # # KO2`Y 6@on0?L8x!*$*(b*7FxF2 ) ))X(*2F!x"-92 -?%[(88+=+? "((xK!*F0"8("("8(\-]x33x-"-![3[!3[F#8#8%Xt8LK (8 K8#8`$8jFF $838%X%P%{PML(8{QoxF#FIjCICH#OB,(ڂ0)$8+ 8hhpCF 6H(8Kh;`+ hZ ` "p)H'HCz3,8#H)h "#0F08 8$hh`G48+zsh;`+ڊiB hZ `"phKB?tI ZI Vp \%Xf%P oP}IpGFI I"F @h@ L#h3 `KhB#hXBXAx%`KJ-O-hhC˰C{ \!@FP#0` 9t#@0s:(  .{@08 P@GXF1F @0 P08F FsS @9KJ Oq8Fh2Jl{IEFXFIXFJFI+ FqJNDOaaXFOaaXFF3qJ:D #HO0hZ`xMc& p`nCh;C`+!XCР + (,(\( `nCh;C`+DB> hZ`xhZ`xI`hw4& |& FOF9FD.!0FF!FDFp9F0F*Ft|]d F$$& -OFLFF#x{I FMhf`*h+ЁH!FV m@+.!#1&(+0vK(F 8+p +VCT (lKhFF(&F;+N!SvG68YH9 ++3hn_!QI(иPIбknD!F( HHGHhnO0}A(0+8HknB(3H3H~G(0+&H+Kh[hnBhZ`x ( (hnCh;C`+D K Hh ()KHh"OQCT xTIhnCh;C`+,AI+ KHh%`& &`%`%`8%z wX%fhZ`x h 3@ B""p ( ɱJ$pri2`hnBh:B`*BѪhQ`x!J`"qhKBKHhthnCh;C`+~"C p (0~ B 30@hY`x Z< O#p4IHF%j %z %`& KhF;sI FC-xI" FhK"`320[K"Z`I FCK"`I FC  K"a I FC(K"Za w&d.܋h;`+ڊiBò +K hZ `ppG?K@Nh5hO33`=H(6ѕ;I[K;`X HOaLF0TJH !H\#p%{L%`P& 0%`4%d|%`8~6& `%f %`h& |%`l-A FȀ)M0.hO3+`&O;ik4O0F.`!K"Hh>F H(H !H(0 "x+J3h20[( Kh;i3#;a,0+L H!h!h 2%`h&d%`%f w& `%d-O FpMNNO0O33`ILchk%HKIHhO0F_FCH(\BH !#p>H.!#p;H@(*9I"7H4 Ȱ6L4J6Ib4I2#4#p0#cpx,"!j F(#K"F*Ihh#L(I F\(O3 h??0+Cљ (;hch3#c`-0+L H!hT!h ~y%`h& `&d%`)%f1%f 5q%d2!FJH0I H&8F F !CIF C I2F(FF` I2F(FF(I2F(FF9F C F> %OaL F0 p%XK"-A`KMhp.hO30HL($H !xCx"+0!F"@<x bE#Tp.`"+Cx"+020;##p%T%d& `%X%f %`hp @BFFhFhFIF"  p E F)F(H!F +x/+0F1FFF(F((]/(а@ ;-O$hF%FB.K4$hB"!FFh1F0DoO CCFE? O ;hS%5B8F&  DE;hX3FhBE 9  FFB3 #'& %`TjF KIhhC0 н0+P#J`<`P#%`@th& (FIH*I BhKhD` hKhD `h+ JhBĿ` h+JhBݛ%`%`a%`%`Jxh320[ "vx RxJ3h20b; * +  O0]@p w w7FL#h+#AOq#Ff0!hHL#h+#AOq#F(FR0!hH0@0%d%d-C&\5FO\] GBҞB#;p",, <) Ԝ@BDU85\,ѮE5-O;FF$x %)УE#F"TcF9U FVx c.L3/.-.G%.2Bc%!B٣pM.wKh+ۀvKvJh+F0Z#F)m..)ИBT3m.n.gKh+hKh:0#F)ИBT3]M+hS`H..Ac.?F=1#F[Kh3+h+WH/+10eF  +ђ0  FO 01*0;  #;)FB F/+ FF!+x/+хB5*ݼШB^..0фB@c`B9pB44TB-c/!B% *O<p݃B9"B p#+!pB >"\TmB02 pBT3/* K(JB3Bc`#F%`4&`l%P%T%X pGFFFF1F8FFhꐹ ,o#`J"` J"`O08F$C\ *F"T,##`>BNsh;s`+ H ( K#`o#`3hZ2`x +0 oP-CF OFF8FCsFBFHN yIBF&aB #H9D;U$BKI J K(hhhhB+`  2`%P oP)%`(%`,%`-Ol FFF & #cQF@CHFdPI@B~I2F(F}Kh+6Й FqhBi.F2i Fi0%:#! bh1@C1ii20iI `@B" a`eHPO0 l "! F~BF]I+F]H<@! Fn0XH*F.`#$0<`0+ ( !XF Aq RFIF FR0jh$+9 iO 0+;!HF  t#9s Ozs""r!8FCCh+h#++hA+?u"H*FO2";FAOq F00;tp #2F! F0 I+FV E(\<#`j%d:pN{n%dbM8F F{)F F8@pFFch;c`+ FCFѣZ"h+ѣ#`h#+h3`(Fp#hZ"`xF FF!F8FCFѣZh+ѣ#`h#+h3`(Fp FF I FFhI F #x 0FpH)F ^FA I"F I  FF0I"F %I fI Fl𵛰#FFF03 FKhBO#HBE#H(F(򊀉LN/lЉKh8FnF(FjD4 F|"F9FFI"F0Fz"F)F0FvB 7FyH9F (F@ҀuHF F| F8!F F~lHF(F*!F(Fp,@dHF FW F!F FX x+RZH #h*F0h+>WIR#VHP"(5RKRI0hBQKO2`%B#< F!F F$B#< F!F FB(F oP)& `H%P%`%`4%z %fh%P%`(%`,%X%T78B" +FF0 + K#`#ob@pG!!H&lK!Z0K>13Hb1hGpG&l lKðh#Kh;Kh,@ C~I |I {H0! ! |vHXtJ1 tHtI !<hGnKoLh!hٹ FgMA,lFx@+7hN#hx#_K1hG+qbH(FT(4 h#hx#hx,+#hx##hZ"`"p11h[hG(3#h3#`NMNI(hF`EO"FOq0FH_3+`+h0FZ*`"p(mF+h6Ix{+h8x + F1H@3+`(hkFhx:hx,*hx *x"#QpMJ1h[hG Fh2` FK!FFh& 3H&&L&ty&l4 &d&h&.&,K! `&, I`K"`9&$!KH`&&(&t Kn:f*oB (КmQeppGI1 oP o-CFM O"(hn1+`&O  "(h4 0s FF H>I"(h&, &t&$&H! ! CF3И,BH! ! F !F K/!LA F>`A" F I H" I !FIHI pB*K"sLXhIp1N[P+x;(F~)FFph`I"ph\K "h0n+HRp& &R&5 HP"iF Khs K\A F:(H!F*HlFG& MF K!h` FfH!F HN "& bg K|Al#x[ FK!FFh  &, K7FLA/! FrHAJ# F+F0!F ^F pFx# + + `F+FK , ,њB10 kx pSFB-CFMFF  +hJkhDFh>!FH$FX$ 1C K`1H-1J! p/K"&IXh1F * Mf(#x+ + +p K>1+HAFJ@[B"FBH~K"`~&,&&(\&&&&&tU} &&ypİ*HOr8(Fp %HFDpr"H*!HOrF(hNhh ! FI FKihk1F <(݄B!F(h"(h @4H F.U ~K-OF,"FFXhzI&yI `wJ!0FuKuI"hm=PqKhqKn1;" mNOEFFO ch;c`+ Fl0+hCf(Ѷ1F}` #hZ"`x(Ų (1+ % t (k+Ѷ.1+  f % +ж1+ж>1+@HAFpn1+#0&6K"h 4KC53HB  -,K1 (?p vF F FN H I>1 "K"IXh& J! +џh* "" @BѐJf HcH&\)&&&&, y&&&&,&$p°9HOr(F(@6K"6IXh! ! 1J!(Ff/K0I"h%,H.F+K>1C `'H'K""IXh%J! @! ! Bp (FFF(݄BK!h !F !F Hl F&\&&& B&&&,0p°;HOrF(@8K"8IXh6! J! F3J!(F1K2I"h^F%.H.F-K>1C R`)Hq)K"$IXh'J! ! ! Bp (F2FF^(݄BM!F(h!(h !F !F H F&\&&& B&&&,00MF(hI FI hBbCc `!(hDJ! > 0"b#c&,&0 MF(h I FHC3(h! 0#3&,7HOriF(a4LhFdcy#cq0K"0IXhJ1 #10D#00#01 1 #11KHk1#!1K`1# 1 2 #223Ht@HHL &p&$"LI h  hI"@o&, t{ tzF,!@ 8F F 8)Fg( pmHI ` h h mp(AH#h?JOaF`$$O4O5 3IS"PF -J`,K,I *I (I &I ;h%J !%H#H(O"I0K&h& i& A p' d V   & &| &$ &L&02 f& l&(I"(K2``p0&I&H!5-"H#Hb c\B\A#J1#<1K Blh#13h8hMh:h IHK$[h[ ^I 3h#8h3( &L&0 | o  &$ V& H!@&6I s(2H#`1Khk -Kh+P 0Vh X&Kx+ !!#K`"L J h(HK"`Kh+!F h+O3#`hKxCC L! h I h"! fO0-M&&&0&, t -AF`M.h.s@^HnF]I .\Hd[J x/)@=XI"F=;UODW)@RO;hCQI:F>0OS;`NJNI>MO0JJOc`;h+II:"=& >` *aCI"F AKP``@N3h+)2h?K`">K`>K`"6K`1Kh*-1KOb`5Khk`+h3+`lhT,! F^#;-Kh`` F#x/+! F4`(к{7 OR`"H!F HHX+h+q>[m.8Kh`KhI"F&    & ^&P]&L b e &|&h&T&   -& }tI:"=sNsK8 `3hsqKh)ր8h0Z@ 0`jK:"jI`=hK" gI:"=cK"l!cI:"=^K"``I:"=ZK"`\I:"=UK"!XI:"=PK",!TI:"=KK"T/I0+J#`-J>J,I0)J#`*J>@0'J #` 0 &&$&h&T   jH n[2 &0 &8 &D &H &@&4 &<`&0 '&, &(IFFHvIH"Fp ( p JhI ( @&t HCh;C`+C hZ`xK[h+ ##@ oP&L! %H` )F&J! [&J! S&0)MF (I#`! !H!F LhLDch;c`+ F2B"p  KhXBXA0#hZ"`x (pB3 &39 oP9FJpGB pG pGKu^&\'+)"HpBIxF{YpF1 x,*F@2kZp FI*F^!?!+&$ ( K @0^"ed""f"HpG(? "de"&&$8FHLM <8 <Kh2ùoFH  <T< "*"FH 4 + & 0 40!MFl!F|!F|#SC@rp"CCI2C32""bOr$ !b#sCcl! 0#c& pMkh FB X(Hh+ H<#x+Dq2;p@H0p& CdKsnM0FKhƲF*xZ Bl "Bjxԝ$F Hh0FG Fp) 5 &F+O,MA #xc?0FF#I F #k` I F#k`FPI F@I F0I F8I"FH.H#!FN$M+4,B+! F!#! &V R X  \ p|&1K1#Kh &8"KIXhtKI"h@&&&ð#O ")F8h&F+x +M##p1㹴B!#1y#0K "Xh@CB*8h")F;pKh(F I0F K`n#y#0#1& &&86J0[ `pG -H!M XO! WI h TI ;h#`#0`##O2! F(GN"8h1F(3xS+W+B+Ob)F O@ &6Ih+  *Kh++F!!E&NZF)F 1+0+жqZF!(Fnx @+o&H  Eٛ ^+h;`+ hZ `piB (F&7&& &,&88F L hF F8)F^(Рh )FV(4  #KCBA^@  F F@y! H@ݹ'y;+&!0h&)F0F"렱P0F?(F`H#y#P#qcyCcqhB`+x !;#B`+x{*:-AFBL%hk!+@OO #h"+%`7h8F3y;D%`+O4NGNNNX;n;;f+:oBۻmZe-I 0{(I5%` n; f+ oB ۋmZe!"p1h!HX1! H9Fzh#h3#`0F#h)FD#`h9FH5%`d#h"+#H#`A' H9FVh#h3#`(B&< oP oHHpFF; B"BF*pp\+ ^+Bx@:Ӳ F;Cx0ֲ.Fx0:ֲ. ۲2x(ИBSxJx0:Բ,PF7I(9 ! FF6=! FF(8#p FF(Ny5[!(FF8Fn4F`y! F4#h+L#h+H##`LI F(FF)F?! FDpp F]F@y!oh(F#x!+ ` FK!F!FH&< ~\pm$L%F h\1Oa!JhF IhFFPN"F@1hF Fnu0#u0 mp#y՝`#y4BT<hD<3h HiF: !hF#phF8 s&}pF FFy[ FF(F pI0F2 FVF!F ~7$MI"(h .I(h"I"(hI(h"<H F0(*I(h("0!HpX HO!l( HK!f( &,x@f tx ty|&@0!I$ K,3CL^F0 0KjXK "h FNPPB +! ]4B@&@ &,Hb!H,0@F&@"%L&I h #I" hx! h{?@ t! h{I" h.H}0(3(H*H( ZI hPI h" N h!{|I" h> hx&, tx ty@fpFF(g1;H;L;H h! hCC|! h{:2I" h1H/H/I h"s,!/0F1FF h%I h""H("H1(F h!{ Kj˱G=*pH0+ HH%(F pHHHH2F1FHv &, o)/4&@t:?JYf"KIhH@&,Q V ZQ LKh "`]pG&lQ BKh "`]pG&loDBF FF(F 0F"F)F8FCD$-OFFO0>HO0>(0"! &6O3FF TF5F7FF o ,𱁻@ 2*W rO O O O O O "FV2 ? tHJO7F ( DOX FvTк#fHAO x*"+v#_H0>>"`Z`8FIFVHVK"`O7F"3FF < mO #e x*О*IH3@D455+5@5[5x&l5555?4,"Fm"F eB4H73HHO7F hD/H/H/H.H" GwD+ O h*O2 ,ظ? H hBH<3 O d, hBH3 < +H?|FR?{6V5566656n6~66-OF O0>FO0>FfHfL8%*F! 6 hah;F"  _I"Os]K%%o hlF8WH,FO8FFFFmD%FF&FF# O29F?KHO4e%FPF>h8F>eE@F1F5pD ùO2 QF9HAHFQF m Hx F !k(.H? !k(9F  DC #ЂBRD+FO2 l HJ3O18FC#OcC#_` "9F(H5Dx5 56jO667-CFHFF 0DH#&O2` Fo2??" F ??4H&4F8C0H$CF-H:FdH;CJG@@p@BgGG/7!KBv)&C2Oc!FXCzs!J kD I, ,."H,H)FC@@d@pDtv K#7!7T7n7}7 o -AF|( (H%(F*A>$pCO !&,$ F=FHK[h;K"8F3F%oFBF(&FAF2F8FRA6DѣZ H+ HJ8F!*F"q&l777-OFx]-+@xKh# ]Ov!F ]l,FO 9F F`0#!h+ F FXD0=sFHl!F2F  LFH)FeIhpCO~H!Fo>xOOh@Z)F F !FtHFl)(F$*1F8(FlH!F3h xOb!FpCOF@Ft@Ff 0B1Flꀹ0F{"(Ft(0!F QHhzhCOH!F NH#"(F#nh{hOr@!@F\(FF |p:HAF&{hS"SF(FO6F1F(F4F(FF^0H.0FT-H??h@F'H!F@*@!@FAF!HAF(P1FHAFR#EE #ZFHSF(F@FY F, FBF"H!F&lq7777885@8,8A8W8m88 h4M x4JOa@Fh#Fohhp20@DXh۹Or@!@FCF$HAF#Hh?tHF ]O>%P)F0FL0Fh+(F0H Fh0B_г_г@O ! Fb H!FzH!F +A8 oP8A9 9FF+ * *pGF \,\&FRa/٤A/  A, 3B0O0KOh`Z`]  KhK Kh3 K"`s  ~  F&&[&- H! 9 :7=8F!D)FFzP F8Jh3`pG&8Fh#x-+4`o8F " F (+hBO0O0KpFh+NuhŹ ! F Fh` F`!0I"F`shu`+`hh!Fbhp-hFJ@!hFnhF &,:NF@Kh# F@O0&8F F@Kh+)F F8@8&FFF1F(` +`#` 1F8F `(H1F `KM;Fs(x08 Kh+ F@h&pF-J+x+G$I(F(!0J1F(F^`p:^ 0FM FkhB F!!l` 0 KhB!pG&K!i Xii&-A F xFx9 KF!a F M' J)j/`^J F)j/`^+hCE4F&O-AFgNsjB$b(("#b #P!wb kc<#czrou>؆(i*K(c"(Y2(ZН0b03c0sc#s#xCOs$0#0 0"0n(4K"8@ؖ(:(/K"-,K"'O;ذ_4ذo-аo#K "_ K "aO'а?'аOK"KK"K"K"K"K"K "K " K " K" K"K"<ĕH&'~&jT7 (IjFl'LH%'H$(1Ц b0P+#b HH"(#jK b`#j+ܿ##bűfH0(nfn+ܿP#f0H( Hf H(@th&:i:d :o:a:tߦ(&Ll(D8(A #&)@@@@@@@6((O0HHHHHHHHH(#ml0HH(# # &:|::::::::& D:-AH\OyL@ 8`HQ#`K(FF^(H#`w#` HmHhHcH^ aHZHUH(#FF8K"`KH)FxKp)FHN)F(F3FH<)F(F3FH<)F HK)F(F~H<}K(F<{Kh+uyKh+@p)FwH)F uH< l(^pH)Fax#ckH)F#i`a+x#faafH)F x##aaKFHe8(F9F#0F:F&F3x$mK"`ll#H)FD (? x+?NO;:;p;&7;Kj l&Kj d&L(=KhKhKh Kh#!j J Kh#!j B#(=&&\|&&\&\8&\<Kh(K( 8 pG&&K! &Kj$ &K! &K! &8 -KLhKh#Kh!j <xC<x#8 #,=Kh#!j Kh cK%(]h;8@ 5 #jB8&\|&&&\<&\8&\&\pGFK! ^@!&Kh;K xjpG&\&Kh+ ø&\Kj &K!i{&FFF(1x(.+(4#x F-;۲L+JO7V4(cx-;۲L+CFZx.+CF#X7`,`#JyVb o <FXI8HO1@uiF F(())HK[M^)) H K[M 1)HL)H4u;;<;;)B8FFFx ++!(F<#x++4 F8@8 LH! + !& !! !#`&4uBKhCCH@ `pG h8"MFF  "!F "!F KhKpo FJ`8 "!F&&[ KhCN Kh4@ӹM F@&\&FKhX@0w F@&FF#XBXAKhH K!  ;4&-CFFFF@ @B 0??FH-!H!C WH)F (FBH!H)FE8]ToIGCH!DBLE4B<G-C "O2;9;M;d;{;fdKhB233BpG&-8CMF+h3H! ,`8  ;-G"N3h+!OAq;hC 3S,S<B*[B\ O DDOb8MFFBy۽8hhB ѺHQF O 2KEBъi10h 5I h &-; JhRhBRiKhpGCpGO0FpG&-K-Oh,#hBB !REB BikBDK "O`iOBuehB2??ЅKh"BRiՂJRh*A jB B  h>Eli $ #S``<0hB#+bPki  (i(8h,@O3a<K!F<`h@f&-&Kh@@ipG&-0F hDHh8#hBC!B 0ZrR@hBQT20BS -CF-M$w?+)KBKb+B..+A0; + OO ! H!  kBH!  bK;+#c+$2x0: w($$K&-&.<<&pFFxM)h! F*hlhM)hY6H1F   5 F@hvkh "` p 5  l<>FFFFرK1A?+x2*+!kxcxSn!b(,F ;^+#x*+ cx[s+d+УkKBKA4;`4`n!(F,FuSBSA##&- I<HFH H H H ,@KH!4!!8!!!;FKxb?BKxx?|cCCKxx|3Cx?C|`Kx@rx|C y?Cx|2CKxBy|SCJy?Cx|Cx|2C4Kʲ1h ):po?B c?;phY`p??4C dphN` pq?a9phfO`p&-KpFhh)ݔB ,`pB <)#FBF;)FF x&B F4FF &-F I I Fx I FPKh+ FI@ &.`&.X l&\ tF I I Fx I FPKh+ FI@һ &.`&.P |&\ tJ Կò\pG&-(7FIHxH0(@F0ӲHJ !rH#FT!p ! FF H#FX!KOq$8!Fp= &.=&-FIm( FI@f&.H @DcB ѡ"c+ !@%cXBXApG pG pG*-A FF FFF<`@0FwF(Fȹ(F;F0FO1 J)F((F( $$$&.FHFHI*FFI"0FFxH{I*F F*F0F I@I*FF8F;F, FAAAAAA8FHQFnpI F I Fzp F8@(F8@ (8AiA-O F F  FF8)F(!pCO0I FF F;(2FOa(FR8)I"(FF(F0F F+* * *# pI(F@I(F0I(F +x"+/t#h+ ;#`2FOa(F(+F 9FHFGm+*F! OTF O\FFF>|AABB d x(HϿ&6sFhF(F!* F"h#R3FF(FppF F&h "ap#i#I(F&a$hB FFO1JFh+FF h:&.L (8B8#D8 HiF+2 8 8V&.&6pFF F)5hB AhhK`hB%`JIM+iCIJ`hah(hkjI`hJ|ahhip@~3B J`h2FIp@*p dAԑBB K"8p ((((O2KbpG&. dK"( ((O2KbpG&. d-CF|O N'#x:F!FB0# (FD ((D( (F#)FHF((F(#&.&.7% L FDx(F0"F!5&.FLX"N8xJ8x8B&hF 82h;DB8  8;D 8hF+8 &.& @𵇰)L#38B=B+8 (+DBO&8#D;h[scڢBh(0F8 8[ 8+2 "]D&.& @%LN8#Dx3h[sczx8HI F>pD+&.& @sL8xhFK (h2DBF(F8 83D 8 38xSp;B8[x+hF+ 8&.& @pLXB"8^]k. KO2b 8B x@ p 0F&. dK8x#@&.8 L#x%X8O2pKb 8 &. dpFM F(F@sB p(+BB KO2bh@ xU;;;&. d7F% x0!*F F ( K$ `pG&.-CF xFF+7KhlhB)! F0Fkh%`c``l`h 1F@FPch@F0;= F;:LFh1F(#h`&\FF"FF/pGL$XKjB"!F$8"a&. dK-OƲhLF{'(hh.M#8H9FO*( *O(h088x#8+#+(F'8F+08Y#DB0(h(('#8(/$0 B1I IA(F~(F(C+sz"<(oWc1Fe(#48v#48#48k#488x8x +#488B< + 8Bm< +?h?<#488U#488x+?M#48E#48O#48O"#482#488B< +8B"< +8B< + #48#488x + 8x +8x#8$#48 &.&.&6 d(pP/x?(p5 .FE :FHIF(PQsHIFwzH8x+?48(@8 ;k#880F5ѠEMmKEF7EF@+; +p; +R#?=======! +R#===+====7+E+Z/+ѫiF#+biip@Thq`p@ #x%F4++ ++L h:+x #`(FS `Ax"kixp@x"ki@xKh+p@ tx!+hj: FhbKh+ohjIHp@ҺKh+b  I Kh.YF(1FHp@6&6&&BR;BXB^pFKFFX`\0F)F Fp@й&6NKMi@4@F/#s`?(Fj(F H, , K!F`@HH&6iBd&70*LhG7#c`Ph%H\hY#HVh!HPh[HJhHDhH>%hAJ+F!<.5-ѣh H%K"`0L##L H H&6BhBsBBBBBB&7sj2c!Kh@ KXhi8 pG&6COppGKiFH?] )B!F KhD```&6K𵑰hd#xS%oF;.FG%B W&>#x5 &,!F J#`hD` `Fh&6DF F-G#-Le&O`Kh3s[;`O ch 0 C KhO0> #hOHoj ( TP[ԁKh 0kiPHwKh0 k+J tkH@80+e.-F0+e.@ch+s/+F+N++D (@-y-@k+7666666666g666 F EH=К0KO`: PFO7+i+$ -@>,0 +@9.-6!(F d(e(F+Hch #c`ch+(F(À((#Fi.@chi+$0FI#"(F#jcHi3@_-##b>&6&&&&BB&74&jD&\|&7+-@-&!- j+| - Y -W=-U(FH(|--)##CaGp)#@az(@V(?_xa;+##a b x(?Ei#a+ 8O3+?4)0 (?(rH e&>#bwi#@+$УikJX(F(#j+(F b0(F_Ha+##a j( j#FF/ OShX@x`_*-9@-E!-o -?(F(ch+f+ƮDKh+?F(?>N+x+Z :Kh 3Kh+#7*#C`Os,Kh+ch7+Occh7+##%J#! 01+ 8#@ch7+OCOs~#;+?^#(YF1H")F @ (ИhFP0fB;B&[  &C>c+R#C?)1Y w{#ym_=;{UYY ma!]__m=mI#" e&#+rJ`2*s^0Kh "!`i#+rJ`2*s<0m"!`i2*s#"#[Kh+ 2*s "2*s"##?";K"Fh4~K"Fh2*s#"##uKh+*2*s$ s2*s"##"!2*s0_Kh+"!j\Kh H F #+r;`PKh+ /"8hFG#+r;`"8hFUx j?2=N*s#"##3`'#*  #ck`ie+rd;Ck+d#"#w)p ?l)p^( F Khd?٬H~H@԰&\L&\0&\&\H%Kh+ N"l K`blK`lK`c(?x6KhC`2*sج#"#KhCB`h`2*s#"#ai 5nhCsh&LCC`2*s#"#ai `Lh&s#CsFPBPA = 8eKhHh`dK"dh`cKbdh`d%bKh+@Q`J `IhW]Kh+@G QN0hXIFWH0hDUHIF TJ#TI hdPKh!z KH!0(s #"#y(?ӫRH0]2:H*s9K9K 7H!0(s #"#b(?2,H*s'K'K0(s #"# F(EF H0(s #"# FFHl&&9&\&[&[9& C&iCFCa &CCB;CCCC0F(7 ???.Kh-(0(s #"#(?H!?Kh0Fq" 0F0Fl#&abF(?1F#aR#wIF uKhKuJuIvHh.F0F sH!ʺƪoIF F( -e& % -??.O1(F!vc#`IF> F( - -?(FL#UIF miFp( - -?}(FvBKh+HIF% PLFS(e - -.%(F$F(Y4J% 4I(Ph.%#7IFw+q4J`3HhBOvvbF`.K"`1h+߿+Khs[#+r!J` I hD `h+߿Khs[#K"`K`Kh+?#c&\HC&& BC0CDD DD!&\,&9&7& @&\xKh0pG&.FF #O2B@# 3-OFFFFhD,FW E[լB< +4##pd@F>2F!F(B'J;hB Y)(*B8FHFFBFIF(FQHF9$HF9FIF\[K# &.-OF'ѽHtE0 *5"pF*xc*"pB#ҕ0+;+hx]DFh~ENF>/#F*+N%F{D,pF FFR ! 98+hD`4D(``` pO0-MF'O O $ò0 *+pO `& d4O07F e 00;+ (ݝ0;+ A-@,A, Kh+ C B Kh+ B C 0m+KhB# (K"`&\&&7F' d 4F<`E$hxxBD-XXx](g(B 5`@(. @,A,,e !Kh+ C B Kh+ B C K!h;B# K"`D(ѽ@ _Xxg(F;+xF0-((H30d(f(i &\&&7L h`hhh@&7D FFH0ѽ@!H&7DD. FFH0ѽ@!H&7HDNVK-GFh/@9FB)Fx F0F^O78F!(F8%F(#"0F(?? F9*F!F0FF0F8OsCEE F9fS #xCcxM+ѣx++xG+ <<+)F Ft+hB0F Fk8FG&KhF @ F@U&F xpG%*Zx%*33s*0@0pGL h H `H&7GF-G!Fd Od O FFsh;s`+ 0FZ (F'#8F#p3hZ2`x - 2BOI !HF9FFtR8FGF8V@F[CHhK(FG)L-AF~!DK"xxBFI4F#x##8F3p xBcxB44;>FFXF#x+5*FAF FH,D;;  -OF8$F%FF4,K,JF,K8F&!(FrF=!K)F!JxsKx< Fx5BxBDKJ(5D$O 9Fz (FIFt5D0;//pF F  G8FHF FF0I F@c8FF(F!D4 F KJ!F;FF(F8bI0FF0F8Z FG?>|x-AFFF %(Fx+F0F~!D4 F7F( K!F JCF/!(F((F8sj+?FH1!F"@A-AGF=F$?s!`FF?(F#p#+%+ѮB,B4jxB%+ Kh(D#+%+ѾB,B;zxB%+ Jh(F Ft FD&&-GİFx D$#"(F??Or(F1F(pl5>`8hB,Կ  0K)()F8F4*F!8F0+F F8*F9F0FPF&(4&.&\T-A@7KhF+[5Kx*F<F(O1HTFq/K(F@FnF FjDf6!(F$K)F#Jx#KxCFFz8F7 gE0FF0D߹I"F0FhF0F7_8FbF8F+x[(F7 F I:F F,F7&iGNGE GW }GnFKh#! FP3F!FJF"(FeFp)FFF F4F78F7(F7 F$&GvF I`I F8I F@  i9FGmF iF F0 F m@hF mHK-OFhFF3EKhO0 BHoFбFxFF3|*-* F(F(F 9H!7I F($C F/F(FnFXFjQFD4 F*F[F!FFXF7PFFPF7-й *е@ "c Fh((F(O3H;`F FP H<`(FNF(F#x+ F7&\$&CGziFG*K-AFh F.IO0%HF(?(!H1FAq(FF FF8FF(FF0FDD4!D F#!F+F:FF0F7(F7@FF@F7y, FAf&GGiF( p@CXBXA'] 0FL#hx(F!0)FFt:I Ft iF(FT((FF F'0$hpCO(Fh!*0)FFtI$&\P  Fh((#" F#|pKFh FiFK!6BBK!6BBѴ??BA &p  &&7&7HpGxF DB F,C/*FFO`4KhB 4Cн@ s&[a K$BB Kh@_@K&7&\8Kh 8??oF?? FBB   &- X 1@)p4 Kh"`$pG&7-ODO;h+-y$%F&F;hB 0+oj$%F&F8Kh;Bn a(F1F"F FF4X ;hB FFF?? 0:hcB0|Կ""00j1FD(F0#00000F FFu( &[&&[& @&(l&9-OFFF@Q&KhB@$Kh+BKh>&??@.BD0Kh;BBB G(F!FO CoBB3(F!F0+B-&O qKhC@𵀿gF(ıFeԹ3ݹ q(F!FƹcJ0hCbKhе??b_Jh*^^J^Ih h CX"` ZKh+v(WKh+VH(F!FF?? FѺ!F(!F(Kh+! ("! OwMFLFr+K"`1KhX )K"O0`OK~[???&!Kh+D K(FIh hB@rB) O1!!F(F!FF F??O,&&\h&\(&&7&[T&\&[  G&[&- &[&8t KiS Kh( Kh+Kh8pG pGBppG&7&\l&\&-GFF FB(4KhB#3Kh.Կ&&??.Kh+-KhABOpu1 FO3*F#Fw&b"KhCѹF (F!F F?? FѸOE7O0Gzae(F!F. {Fy &&[&[&8t&\(-OFFFp$  X FO߸oF?? F>!KhùOܼK h9(#"F@F+FFLO F F (o??0$%FF F&- &&jD-AF FFF?? F &AO0C*F#F8Fh8 MFF+hB(hBԿ  8??4&K(FFhB pG K(FFPhB pG F @F޿8F(Ma+hB F(`#IS``#hB Jhh;`7h7 F8@7Zi:Zah8& &7KhpG&7-GFF,O=hFBh F(G0FFPFEPF7y0F` F7rB-8! F0F`0F#EEF=F#wa#a 3+h 5`\`ki,`3ca#hB J F%Fh3`(F-hZi2Zah &7hpGhpG@ipG Ʉ 0 FȄ#wpGpGi DapGipGipGapGcpGkpG8F@k FB7ec8@kpG-OFFFgF$??#(F[FQFF0#!2F1@FIF;FF ,-O FF ?? O5,F(F!F Kh+rѱK(FIh hBEr) O1!!F(F!FF F(F!F(ѣNF'F3hB (LhHF9FFYHF9F>FBx>RDF (e 8 K ,O5,F0 .q@cF.F F +HKGTzKhCў?I9tKhoBF3FF6H mJh к  6H ( (O hx $O (з6FeuT VKh;K` LPF"+ !HF9F(FKhk_T FFHF9F@Kh+??7L ( (0 Ous .O  K`0Fmұa$L#hͮp (0R"KO"`F FO J?`uy . .+4F FH ( ( (@ ($F FOFk&[&8t&- &jD&9&\(&\@&\0&\t&\|?? `u9 Kh[ . . +F FF##hPU&\@7F FpKh*Կ""#(F!F#+0"&9-OFF.w O33 vKh+ћKhABOpw( FO3:F3F*KhCqg(ьKhF , ,хLqg#h ( (0y|L#h (RWK@(VO:TF# M?F?ycKh rE (DF"d @YJhC@ 3WJh*I ezg0K`HFd  EJ h*DK"X`#F "6(-6Kh+?#T FF  й # ( (4E ( (4E4E (дBu/`FFXX??фKhS й  +FFEuF X#  T &[&8t&\(&\t&jD&9&\@&\|??pF F"jB ( KDTC+& O;h;BTZx=* јO+ Zx=*јO- QF "FFENINHZx=*јLJKF!PFH< ع+й- kiB!! =kiЙBpmkiBԿ!!)ekiB̿!!ZQBQAkiY!eFFF; +7#+Ѣ +<\+# p0+?<   *r=!PFPEF;,+*7  XF/0x(O!h8H@E&7 )i>|HII III!;IHH !HFU@UPQ H H H HP8hT#iiC"Pi3&7&8&8&8&8&8-CF$ F0+3cFFF F)F0ر#JOa *L(M  +hB! I!??ЍBtI!BA JOq$! 5 @Q5&[&[&7&[  &\`&\(KhKhKh+Kh3pG&\(&[&\`&[8 LeiiBcia0#`8#iS%0+hHY]5&7&8(F FF0@7Kh#FG(bO4 F1Kh (A(: F,N3i($$+2io@G;D)FR#58iD3iS'D(F(гi (F'хBJhABJhBJhD$X(!F0F2iC;)FR#(СKho&.&7&(&(&(&(-OLvF FF0??t1+@O`D2C?? з??вBADv#1-𜀣ih+@O1FiPF+ÿC!i3#ȿQ#0)F#FrKh+{Ѹ@ O  1B82??08v+HFFFE} 1B~ )s8F1FOG(QKh#(z1+#1F!O HD$ #C ZE  ?t ! "v6  "qO #h(F  a0KhDEu Fv0"!]60B$H({& ")Fv-H_82BuZF#aiBܣiN a0 1PB`1h" =h\T!iQ"2A#3&7&\T&[& @&8&\ -AFKF FFh+ 8ȱ")Fg( Kh0D(FKhDB &\T&7& @pFF*F#FOHqp@-AF MF$x$1B  2F;F $4&9O?h/@# F!P&\TKi(!h,!pG&7K(!a,!`pG&7(FK8  &7(F HK!F8  &7 ( ! I#3` Ch F{).Ѓh#\)   \B\A` h+J\B[$)3`\+#C`O3` F( F0 6|pF FF!*F F#hBF0F(p-GFԢFLFF0P+ 01;0#10#0({1F(FA-JFO0F 01[h#0H nF(05HN0q0 ` u)F0" 1B xHp 1BFۣitNh0rN+D*FO1$B ([eH3`@05#01.gcKh*bKh):BF;FIF Gi+`iBhD @%i@8U 0BF;F G]J)@ F \*h;hO1DFhBO1a!iFi2FQ (FS<.#h(#`#0;5F-u0Ihi hI\iB"iR#PZ_./ѫ%E'L#h+.@0+0F(0F BF;F !GO300 CEE .Kh+ Jh*@+>BF;FIF P&7&8&8&8&8&8&[&\&.&[&\T_.hEF _(E0FbPihDU1FF($I0"h01+0݂B4A!FdJ)F (~<,yI;Q#B;8Au BF;FIF0F#h+PJF)F0F)d &94x-AFNLFFp . (#! . CKh+BJhC0+ #x0 " F0$+5M)h9:FCF0F(R Oa$1+ +0F;x8FAF+ $1Y#DB$aHCXH~#I#0$C$1#0(+h+?w$t&7&[&\&.&98%L0+P8(F&7-GF@LFF8 (%#!J`8O8쐙0+2;h"h3DܠB߿ch#`ha;h"h;3DBOܙ&Kh;h"h3DB#" Fw"iFGZ m#hZ;h3DB"IF YKh+Kh+Kh+ Kh+и"! ?O2! &7& @&[&(l&(p&\T&\&\ I0peCiB0T# poCD# 3&7KwYcpG&7K zKh+~ # `8#B ` F@BDRk `ZiDihP"`\&7&\4K" " pG&7??-CFFO0F'F(AF`` -j0 0"U 0;`.4`0;BL(9` 0U4F&7&jD)-GFpFO0F9`($O@h<U (FO1@h#D3`-0;+`ѹ? ,( 1h:D DhB@ h<F&7&jD-GF hFhFO D/0h3`+h+`"F!TFGF`"F@F4O BFJFFPFF?FL#q1n8FFiqO3O2W(13&7-C NoCL$L'F5h3`H0BܬB5` ??07BF`& @&&78 FCFO08 F0 (#xCH!F0qt " FFj( CK 0 JB hB Ah#A[b#&;0Kj+ KHh*J!`!`pG&;0&\`L&7L#j+3d+#b ''b]@BvH9F3O3&;0MK!F9 K JcbB  ! Zc3 pG 3C <&;p&;0&Kp-AF*MF,hBsEA+(kxh+c.aH``n Fk@Fhjk+hFEѼ:FocK``BB$hhkO 4dBq;FFFFO 1F FsF&;0-OFXKFh+iа??c)pDPUE2кBs ۘEBd0F!F-h1UEO 0  #h bEA:@dذYEu*FKF0F!FMOExI hB#лBr ېEBE F)F-hB 8hbBA/ O4%FEBy"F+FHF1F# FF)F0F FѴ??6I (DEBx # FF)F0F FѴ??>I9$&;0&jD-CFTF FqFF??.0B#p JCc`Kx8HxHQi&\&\ Q08(H!bK"`pGQ&(Kh pG&\0L#h+ `&\0 L#h+HiF#2##`&[Q0 L#h+HiF###`&[R0 Khs Kh[l??ѽ@&[&(0 x J^+pKxp]KxiFH )`RAp()0$NM4`,` x,+ I#H!F0`x,* I3H!(` pK! J FhKh@H&[&[GR[RsRR(0Z09$?+.GK`0R++D+++BHiF0je *'*-03EZ+-+%У1* ;Cr+d+W+^+w+@@@p@`@@p@P KhQE#0 TDF!PDK!DN!DR!DW!!BH H )!BH-#0 piF&[RRKhSKh+Kh(Կ  pG pG&\D&[&[Kh(KJhhDpG&\L&&[-AFxFFMHiF,F F&!HDqF0`&x0K\.cx;4F4k$./1F8F(#+pR&\x+ Ch*!J HhH]Bh*!HhJR&[XR!# `](KiFH*FRS"S gIFHHR&[(hS@ pG(h ЀipGHpG2co( HMKl8 pG&[XKliFH ]&[XRFh FF]x-+0''x0; +"(F!FO0 "1F(" ##`/@B-OFpNlȱh+ +Ci G#d >l"iF `FFx*\x-(^/$( (٠ ۲)F(+(#3eG#F F(#x++K2`O F29($/(z$ 7 Fa O O F FF,S+KQH:n(0+Xx-(3+(@3% FGO@/!xF=*phOr@5HK3a O O -Hh;+ :&2U`ci!F G,o7[ 2-ѻ;#;#[xd F3x *iRF(x+"QF%&[XShS>S&[&𵇰#@FFF(FgH-hZ aH=^Hor A-x* h;+)>ic-ci+-  G@-h~Fh+`+f-Уh>K"`-&--"ih[ `2[ %`---"ih/;#`%;#[#%`2;#;#[+H!c-- -!+#i`H!OF+#iih #ih+H!#i!h3T#.?~2SSS&7TTBTfFhFFxF0; +#O F"x!F40:ײ / "+1`M#+`8F")F2O0+ܿ3 PC3KhKh(   pG&\&[ H K"` L#x#i h`h!ciFG$4T&[ FHx FpGBЁh ;B$0 -O$,M#FF'FF*xb+A#`O XFnh$5O 1hRF@F, A8(ټ- IEIE 0h7FF#F@DBDAh O )vh# `+?h` H8(*(ĿK`f )l pGZKhYHvVK" "`"2SKhBQKh oo F WGI# `GKhBIO3 2 13BKhBKh+AKh:K1+2!*.0 :J&0h"oO23KxB ,JohC`&K"`]+Jh**J#`!KhFk,KhB,K"!J 1 13 1+ h+?X|h#+?RO4ool&\&\&jT&jD&;h&\ )l&- )`&[H!&\hF]FHh2F(FdF0F`!D4 FJ+F!FF~8F)F2(I"FHHf&]-CFtF#F:FD:F#F(DeEu&IBBA4!!@#d#"F]7L3EE0B@! K2#JKXChF ]bMB@K IhT "FXh`BK"` )p&]&7FK\` )pK$""$cpG&]8FM K*hB+h FZ*`p"K$8 )p&a&]KshK"`pND F"FH-4`4(F&jD&7&]D(-CFFFIB`@H Oy#0JF3FF0F FR `F=-8F-#<!Fnf˿-AFDppFF# 09F#F -(-0F-",!Fnf-OFF FO O O :F;0 )٣a)أWB6#\4#FCK A)أ7 O1O0-OFFFO O %BF;0 )٣a)أWB'$FC5CA)أ7 O0-O%FFFFO BF;0 )٣a)أWB"7"4FeC5CA)أ7 O0-AF F$x F%(_^4;FXxn(+c(/d(%(Ns(x("Uk3FF ;CF "U iFhFzhFD #jFx bFFF (CFFFFFlO`89F0F(FK FHEK"$&]p Р *K@Խ@˻@ !JpF 4 F3 4g@)F F]p@ ǽKh O`K)F FhEDHKh\ K44DhBp@޿"K`k&]&\&( )x&(& @&7KJo];f7F F0)F F0@KxJ)FJF FN0 )`gg8F F)F FF Kh+޿K"`Q, F8 3& @&7F'KQFFh+ѱ!dF ##F)FFpB. )! K)FhK:h"[ CBF3n`0F1NO0 H! h h1=&` F18&\d&i&g-Fh h1%##`@ pG-OFFF(V_QFDPKKPDE 0`(`3F*F !FSFxѢA 2ҲEјBЉE*31B%*F3F BKCO``Ѐ#KV#U# B 3+4+!F:9 "B"5   "F`pF:/ک *FE3B#sr  /F!@E! \,E!@F! 1&\dHpGg=B KhpGKh8Kh8Kh8p@&a& K"hKhFBCg2g&&a K Jеhh\,нSgKh+U}(Ow9KhZ8I8 6Kh+?h2C 0Kh+?\??)Q\0Y(Կ  O( KhO???4z)p+C?'m)p C`!(Kh6&a&a;&9&i&\`&Д?̮#9BF6?S( gk'AWU)h"B Fπ+`"pB??, #t2iKh0%)peKheK hE9`;F1@??F Q! `9`)pMK9KJhhKKhKKhHKhjEKh%F@F1 ;KhQ,5J@*sl)p9`(yQuFF??F F+rHFAF^FQ F?}J@*ss1F F7 9 (+"$ Hi HgKh(tS&9&[&&&C(Kh* ) Kh Khd U K KXhXK"`&\&[&a )&Kh )FhhX $ i<лB`r0F`WBrh.ƳBr F FFBrDh,`%FBrۄh, (F`0Fh h\hZPhB S``Y``` `!``#hZhB `S``L`` `!``F@h0# Fc`@pFDhcBv! x0!F0Fs#3kh&``[`#l`h0 Ya` p&,`-AFFF F`"Kh"K`T,`hh0#k`T FA B!Fh`m `F'B#J`h+* K"`+FBF1F F(O0:F!1 (#&\d&i-AFh F~FŔfFRE|!Buڱj iBRrh*!iEj|EڑB)5BERE| ijB 1RBuڬFFhhBaEpE58F#hp`Fa `a`#ka.`Ɣ)h9iaB!bEqE##2iR0BB}8F3i`F` a`5aKi+?n hXhB hFBTi4 FHaPa"ZahBсB8Fmh+h"8FZa"h[hBJa ѽAJhBћhB8FhAzKhXhs@ h8 &i-CF FU#@@tE+hjhXBEњGs2CB2tAiFHAElhGt  5&j-OؠFFFh+Y2h*VLO0i[/:!BO$a!*F9F*F9FI@000 y_9FO$b2h*Fn3hBB4 0"#2"F( F&iK""`ZapG&iFKh Mj>#bKhb FG?? Feh4;h;BgO$&7&i&,&2K-Og??W-J h,KhQh #OZ&Kh U%,F0;B*(C2O FF??F@FSEs ۰??ЏBv XFQFK F%DF  &,&7&pFh\ KDD  p`0 F0 4F&iH&j8F L 58@ $i!8@Hj[ b&igCH&j08F Fa 8H"F+Fd(2BA &j0-O FF #dK2h IbKhaKhS!FXF]KhF\KhBOrr 3OxF@FF F??': #?? 3^F%F # GKh@ #??8՜BF{ ڻ B s 4+6 )ȿ4XF!FĿ342iSFF3H??G8[RF??F$FF??F6+eSFF;H8FLFO FPFIFa'GF& @&&\H&[&[&jDKhk-mBoRFKF@FXF!F({ђKh3Kh Kh 5Kh*ЌKhCEKh+ЇKh+ EKh+E)FFF .0FFtKm-@!?? ЌB{ #B{,&hb"!ELE{ `H0R0OVFMFFLF-i-(PH#"!2( KpV ; +BKh+ KpV 2F(p+H!*E%XF0J[!F`R#` Kv##F5EvXF!FS(PO Ku##FEu ڱEK `"K` 5E005 # X&\`&[&[&i&[&\&[&\T&j0&[&9&77+!+! JFWCH7_FFR#` Kv8FAFEvکEO7F7x5FFO38F F H*F#F(2Bu(F!F8Ti&j08F F H*F#F(#Bu(F!F8S\hB5FF&j0FF#;`#Khӹ"J2??^Eu ۴??(ЖBt$F FH`??2BAڀj /#;` Kh++Kj+Op&\( &j&[&i pFF +xKm,K"eK`p%i F F0,F! :#2F)F3F`a#0 Fp@0Km#a&i&7Km8  &i-OFOFFF;kh{k(OJF+FFPFF# B@2??е??ДBuۊI IE|  .R??𷀁KVF FFIFhCEu??а??УEpF\FB|ɀh ( O #C#A#oC#C *F`F #F+(5 2 ??yЊBsrBAsBpm9`(f#FF?? F{L*(J #YFF 3FOO0FQ??dСB|eNEuEzk0KhAEO|z ۹j FfFY&FF1FTVFFFIFf5FDFfFF#n2??АEvڸv0FAFs`#0FFAFF??h;c{cEz*EFzF&i&8t0!VT??o FFO1(F!F :0"KbKh+ѽ@&i&[8! KFhpF M#"F(CKh+ѫj  8 &i&[L#iKh#`Hh@&i&\d&i-OFF  x+NGG 8Lh{@ՑH!8FFHb(O9HF M+h+ЈKh +h+ѣj#bX#bF(5и@F?? FuQF F0FF F#FUF FWѰF??+Ѹ%@F+FѸKKFhFFF0FF F??06BO4%FEw??FFѺ?G.Kh+-Kh .H!2&4F5F FO;#O2)FO3LFx#h+Kh+? { ?? ZFV#h+ Kh+?BAE &igbgC&[&\(&\&&\Hg IJhC`Kh@#3&jD&\ IJhC`Kh@ 3&jD&\  Iz J!FhC`kKh@3&jD&\FбI \KI h+!RI N! JI@ lF @!F <! 8!F 4!F3&333-K-Ah,SСO`B! DE(F)F )F .!>I  K"`MN7hh*h3hBEџB 3Js[`` K"`b Kh#A ༽&jD3&7& @&&&\ -CFKFFhHF)FFFHFp3+] +@F9F &jH-A!F FFF0F!D1F`l6#wa F(Fv!D)Fal"8 M,hB K""`8#hS``/i/ F/ )&jH-OFXOMhUI `F h/PMXF#  `0F BFOaHFTFp@F$h+~;h0F+`#k` M0!+RFIFXF( 0 + + `Fx+FF#` ) !p h `x+! FhFF0FB{h`C``hx`3`F#hX `Zx^* `F"hxEa,$*O3!!pF\)12B#`Q!`x,  )>|&jH)-OF M F  MM,O`тKL `O  "FOaXF(b{Kh.LxKB Fx vH;FX(sK<0FS$(F7F@FLFHFHF8FDTD4! DfIKFBFFB8F/aIPFwrFPF/,VJhB+` # k`XFб80 + ` XFF;IKB Fx(#3`p Fo" (0320[#; xFF1+ 2@xF0^20^F;X2 @320X0FF)12I!xFF3)12IF;+320[O 0+3x+И0+0FbHE0F^F@F{h`C``hx`3`&jH ) oP&jDg8Xg>| wKhI Fv I FnI Fj먱I Fd됱I F`x! Fx(     )ggggiFF FY( ( H!@H!gg;K-Oh{FV F1FO! $аF F0 F1FUFF5G??#H!`O4&F Kh+JFCF8F)FKh+ "F3F8 F1F!bFgQF #Fj3F"FPF/]PF/Z+LFFF&jHg&\`&\T&jD IF%4(F O* 4ChBаh43F%: &jH ) IF%4(F O* 4C^hBаh<3F%: &jH )KhpG&jHKXhpG&jHKhh pG&jH vZ8H!d( !\(gK`&jTpG pG LK" h 0 ( +#(F&jT)ѳOr` )* #)O1BA #3`pGFh/#3`#C`pGCh#h;C`\pGO0pGhpG!Eg[bA(!g pG#BF F0F!'O a|!h!hF)bhj h/C&`#Ya`TFFFFF$B9]0F4"B`-GFF# FD DS FAF&BB"FCF8FGH F(@(7(/(? pG8+)08pGa+)W8)78-AFhFF`x*"""D?(F4BF ?(+ =pF hsFFx ha;+!# %')"!F@ p ""##p4 4`+` # # # # #[ \-CKCJDIhh } -!Ix,[,L[-m pDx^,00KLpx])0x])p 03F-K-J/Ihh[)ѐ.ɲ)'FOFksF].kѤE 034F.KJIhh4F\,FxK[.0 pFB0 Fn. $0 p\.B FpB#0 pw F&|&|J FpFhF F+""p0 JIHh h.d4 F"F)Fp@ *26@ w&|&|?K-CFh G $I3FF:F1F(F0(R/K)Fh/Kh.I"F3F }\Zxb\3Z x[* آ.۲+(Yp3]*,[,&l\&|&| w&|pOp #`aF@30 \+эKJIhh d"HFAFo0KJIhh [8  "YF^2hxF0#320[Ԥ# @FF.?F ! |mKmJpIhh[#FF.AЁEbKbJfIhhEdKh+/#T3Ѥhxù1hPF;+?Z1 R;+}+?MKMJSIhh!h xTh3`#h3#`"!FO,"!@F.)0CF#0Ѥx+ !.F"U! |\ h, !.F0x ( "hxT0KD0#hCD#`"TH"!)1H"YSCJF @  BF!hD(0@PF x+x ]&|&|'o t-CZ$N!FO|`V[4,Kh+ XCK`Kh0K`h;h:hi H(FMF.&jX&|& &&&4&|8F F#`KTh``8 + F {"B`FJQh`CKS` + 8Khmh (FI(hF(Ch;C`+ ڽ0C !F F 8hZ`x F&|`-AFRLFF"j*7*[%(Fcj.3`bZh*LhEIcjhbCI |N%"c%bh!?J?Ht>M(=Ijcj%c%hcej9F@FdFj3b+ј #*ј n*a.j[{@3`cjjhcbjcm:x#*Zxn*"a@F:F!*7 ce#pj3b#3`EFxB *+!:Fceej""b)hhBab?kpj3b.#p"ceBp&|`2&|7Lmchh Ch;C`+ڽRCСm hZ`x&|`-OFL Fm#hhkchI ||KJeX3eK"c#f#cfPMmرCh;C`+ڽCСmvImm|GF@"k`hZ`xmPE p` (;нXp0۱H"~I k뀱|I kXzHTp4tH H#p0p4m@HEн0oH:!k(F#ehHp##fcn#h[h#`#h+hch c+9F!k8 F]I |#cfhYK F XIXK|chxObNHjahLHObo"k NI|!kOb*V!kOb `N*}F `}AJOa[F(Fo(FmHEн8I(F.e(??B~mh Czh%fb(I k e(!kH#aK\#f瘱nD< + E CF`n0F*Fj 3b&|`= oP&&|&|ajs8 oF- I"F |* F @F- I"F |8F F-?(I+F"F |8F N F0h-)F# Fm<F;F)FF0` Fm20h&])M)O&khB&Kh@>$Khh+5h.XI"FF | #*hsCX+6h!;h@hI@h4F(OR#F!hFF F;h!hFz 3 ]&&|&|FMF(h I |l`+i" `` libF1pH( h_IF |N  &6-CFALAO2DF[ij2B AjbiDba"p&--\-Jx8h 0@0՘ \*&*Fij2B AjbiDba[i2aAF!"iOR Jh????Эij2*DB aj)DbiDba"iFJDQh*F1Di*DF+D& wFBhFAiF*DFSBAAai a `/*F1F#c`D`2D"e`ZU-OJ#L`H!1#cKh-E#dXf 0+(-h.bh*43h+ ьKhrhB#` +bk"!kphhh*ZhKhB+|KphhxBxA8 #`#d(h+ak!k@h(Ыhh*ZhjKhBhKh`+eKBhhBY*[h+h+bk2F!k@h+WK@hhpBpA|+?zR#bWWWWWWZWWZZWWWWW]cW]WWWWWWWWWWWWWWWWZ `ZUZWWZZ[ WW[W]%W]^^1^W`WW`a-aW`lbhB! hYCZdC `fh #"h!sC(i6Px`b`f`&|&&&lX# 0h˹K(ihKkhC ћM!bk k+hk)h Ml+i(k+ek5&kj !0Fj#cA0Fbc#HE#IH">## H#|I}H"1#vK(ihls rO:htKB<#A qH@x3p# kI (ѽ"0+0"!&C06B9h_H09h$ 9h ;h[,XKhh+h-*RI"FF {QF- FP ٚ0"!O  06B9h=H9h$ 9h &D XF-XF-{0DFB9h^F-H;hJF!PF,XF-BF&HF06B9h&HKI K8h 0O B9h^FH F+I8hj[EѢ l&|&|x&R&$ o@th&|8h) +qKkhC pN!bk k3hk1h &iH!4 #cMdIbH#"`H!!(?k+:YN!bk k3hk+?/1h )k+& !z@FF@k"cccF:F!@F0hk# .?ccc9KkhC 7M!bk k+hNk)h lbhB! hYCZd1 `fh #"h!sCki'khjiRhB i !K`!K!Ih{*ck9FXF#FF(#aFkifk-к"i @π#i!kH[hz#Iki8Fj#ih#r9D&|x&|&R&|&|&F#i#BB "i#H9FRhki8Fj#i!BB\DhO FjڢN @ 00<Ϩ @<jaki[hcO!rk0k;hvk9h oih(qгk+n;i3ZOr@ a8a0Qkih}I {vBrvH9D#"#iFS2ADhF#"9FXFF(_V2F9FdH`EBKLDhF "#9FXF( O ki irkkiBQI"i(JJhC `h+?#`mi{k+ki3 (iOr@ a0ha0*i{ hickB8I"hi(?j"m"3I#3H3N ( <Ϯ (<6Ɯ=k+94?3J&kh* 2DB&3x0;f3xp p?1B#"1F#" H#6&&&|R&$& t&I8F \`3x+sFO2# iC4 0Bȿ8FљBEF BBڐBFDNFBE# FETڣj2F FSF FF0BѴ0+#K*Fi1FA("iF80*FKDiYKiO;FHBF悲"r₱FEڢi 9[hSX2F9F FSF7^FFpFFF.F0F**FIF Fp@F)F59E< KOq%*""Di@J@ JOqJ@IHXJ3K@ FOqJ2J@h IKOqF&&&&2&7&6nF)J048@"KOq%*""Di@wJOqJ@IHRXJ3K@ FOqJ2J@J@K!h+ ""KMOqF&D&D&A2&_&^&&F )M"&<@DhOq"J+##Di@J@ JOqJ@ JOqJ@IHXJ3K@ +FOqJ2J@J@K!h+ ""&&&&&&2&&&&8F)70hOq%*""Di8@J@r!h@"hI 3#2Oq@ Fh@B8&2)  JOqiw J@ JOqJ@ JOqpG&B&&&&)  JOqiP K!hJ@K!h+ ""pG&P&&&) JOqi,JOqJ@ JOqpG&n&&&)  JOqi J@ J@  JOqJ@ JOqpG&&$&&&&) J@ iJOqJ@ JOqpG&&&&)) aJOqiJ@ J@i!pG&B&&)) aJOqiJ@J@r!pG&&$& H`pG H`pG H`pG# K`pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pG# `pGK $` F&TK $` F&T h+#`pGI"Op &I"Op &I"Op &I"@  &I"@  &I"@ s &I"Opg &I"Op[ &I"OpO &I"@C &I"@7 & K` & K` &I"Op &BI"@  &I"e  &I"q  &$IOb@r  & F N0h)q? @N!O0$ h"F|A0h)h;F" F&d-AFh Fpchc4ihF?(!0Ff``&0Bܽi7Yih(pi BY!G6ǿFi7 j8iD j@##biEi@#aJ'F`#B7<2*/i3aд)FB<#>^5 +(! r@Q! l@Q!@ e@R! _@R!@ X@S! R@S!@ KIH : p8!L#h+87(6=F= IpIN"! I8O09O0@xM(hB``(hB!`(h6t@ !`*! ap J0C/B<##` 8  &'} +(-OF,򇃞KhB@iS$@,|#! +(Os=Ej#i FG#k FGi*@D0 P.O O i* 2B3QZ գFO `hX   h0x+ppK&_F&`O FB3FF !0F  (0FT BFF #-o mBBF 0 D PB+ݴ D %u@ DB!I"+=J0 qQ ;I;HT%#7RBF.&*VF  0E&=,I2F*H0KF, iO  HhX+ BF  0E?"ѣ Oc 5P-um8DCF*FQFDpa= I;FJDB &|$ p!6IVHO1i9iO1@#մ QFCF*F8DD2 bE!jKhD F$@0%zs C+, F X@00h3BۏI i(F0F-&FF+FF+ E?8h@7"FSK8h@+F"!8h@"!8hJ8hGr8h<'003x(q(>(1d(/<(!>K[h;NE`jO F *  u(XEа ڰoqD(*I @SB+x+&K[h;D=E0+?  [R#s"ri7 0PAB `p3D7D!qB9FBֿ2Rؿx(хc'} p w'}& w?Ѯz(`(x(8a80BĮi[? (8?o|`D(^Z?G+?R#Kװڰ?(?h?<(@0L>( (uO{pD@SBj(F@FDv@F? 8h&KiS 0YpG&(KhBiS pG pG&-OFFF*$ PB*UF $ FD!m PPO U$()Ky.FFh.=320[ Ը 7I .F=D>>.=320[bd-nT ѹRFIF8F8FRFBnb"D<"##[#C RF9F#;U8F O)侹KERFIFF&p  w pFMh౨`AF0FADC4+hB F)Fdhh)F"##8F&F M(hAKiO3+`" FFBFO0p#"#N#F a j(` F,hc I F z0b A&$@u#BpF M+hZЀ N2jB 0\0iB,hD Fplh A&Lh6"##&Kh&Kh*&wFUk F1F*F p@pGSK!F*zF @pG R]pGF F@FHu@FHٿ-C 0FFFX F8F ZIF*1"F!c+FcL-OFFF@AFA-F@%*)FF(FF+x+|CBw5'D3DB~۹?dtd  O !(kѸ*FO.ؿAFܿvv[Eȿ3FBF(P+FiKIBF%F5F*9F# F6!FPFCvPF?h FD(F0?` F?^'kx[.DB4''%F'}0Dh FCF !KFhC@8F F8^?>F F?F"F F6p FF sB``F F8F0F86 F`?F0F?[p,'}&L   𵅰F F FS{9F)"F!c+FL-C 0FFFX F8F IF)"F!c+FLSK!F)F @pGI8MhAFhA D8& T7hFLhHd4 zObiF Ob I 0 ` `iF o  ]KK0$   ` F DF Fɲ?((9#H*(4!H%Fx XKMhFZ"F!F(hH(h5(hFPiF #_"Z! p! H HF HCR#0&&d'}'}&K$`     F F/ Fɲ(#Kh*!$FiF AS#`"!F FN0#0&&d-OFOE 3x3FxF3 **O0F pO [E ZDD6  B5OL`D %)c Fx* * .Kh#F+*21 P#F)ЊB " F~ B $B5@5H`\+ 0+aF1 + Kh#F10IԑFBcc*ѻi :F)FG(?z3P,hC) ThPziS)fK w7hFL%hhFvIF i h h##` 0IHF `xI(FThFYIF(FL hh)9 J IF[ E&H8 &rp i F Kh;#+ *FIF0Fp@ϽK&H&7hF#L%hhF IF(F hR h`##` 0IHF `XhFIF(F h8Kh[h)JIF[ h) IF H 8&62C&DWr` psF5M F(h5j!(hA(h=ED a!F ?@X W?h@ P!F ?@H1F!H4@ H?Ra 4PE(h@!"bC(hB@F0IH> !4nGh(h7F F7 (h>F F>" FFH FEr Fp'} p-OF- F F1  z  "YFHF1.,0̀ O FFƼƜKFNI3hI2F|2h*ўIPF>2FIn2h*I2F3`bKh2Kh,FCFr(@ 2F!HX1!0F;\xFͬ 0|MCs 0BF1Fz1t(h8vIR(h.`qM(h@rIF(h#+`oI h@mIh`h 4 iH x& x | w"hFaH }NK"`E[KO0`}WK!F h~!hTHSK! " `=K` F!FP C h C`L/0 T TFė#QFOpF ~(t+h;R(`'z O Z" B <"8F!Fx(H\7R/$K h3SBF"FhK `h w&L Ktptb@f&&H~&&h+.'#"0F!FB#h*OrB84CKhBK%`(hEH1#x{[- ̬ 0<* OrB ` h(F&& B0#"2%K!" S#1 #IO3a I H Kh H .)FA F 0@ K pA& -OrFF(S+!!(!FHO0#0iOpG4I(tfF1Kh(0J(0I.+I(pF(O OW 8F'qF8%0Fh?F #cU0F,ѷ=Kh J(I(F{Bػ F(X#0O5 F9F(*F(5q"&:`w-OF'RK !F.@bI"F vX'-6)F !0FF0FP5 FOAF(FI2FID3F@FI0F|pB x%+@+*!:0p+x'+5<*+//!PFF#pPFDF߀/#;@FC XF(@̀T'0EPF(XFRI(F7.5x-D'P<$I (F(0#(0*0P#*0oɀtM.hj"0FG(hE  !FKFFiHge.@@ F(F^O@XF(F@\;hBF !F >j;h.𺀝BѸRH>? >O?@E@ @;hB(F@,!8G >E:HCh;C`+򖀷<;hB(F=d @8h48h2?ZI?`H>([h3`gE a< %F(aU H F([0F^Ы(R.? OpGRp°@(FFp+xc.!(FF0H")FBp")FkHH"!F&&-CFhVOFB# F#p_-и/-у k20#)F@F[#1) FJ+F4V wF!FFF"CFА"!(F` I"(F/a*F1F F(F F`,F F&pM(FF@)FF j0˱) )D<.+(q`I@HI@pHp&&&p+I "@0kb"F&H2&I "@0kT"F!H"!"FdCF#("!I"I FF F}MN1Z"FH1F0p)F" H5F H"!Fi!&i%&&(i8m|&6-O6]LFX6 +@J© <( |Kh|H{I|H H Y'+j pF;x+XF(D_E 6ROs82#"S,:iI8F9FF0FyB#cIp8FaKh0D[Y sOp"1F0r5F F 0F ( \23 P-0F+f'0h'5r!(FO3&%ѩ9OsBH0©CF02 *s:IP 9POp|(#X6# K!(F'F 0Kh #.NF r!`3#rClB&@u*FcO3u AFff5Ft Zt tWO3;`>9F ;hY( @F' 6]&& p$< w?Q&1& K pOq"O HFXI"HFF(퀮I"HF(7ѪK_FHR!A`@!J6#A0ЪWchK@-JI[h ("#AF0𴀕HA1s+@À1l+@𾀏K"hBxH©~0(@𰀉IF(@&-OrF,J#x F~J#w FF(\8# \8.@sJ#y F-pJ#z FnJ#} F\8jJ#| FfJfI:xeH+ FdKF< F- 9FFFW  FEKMIF26K' (? @F'CI /: l%H-@Iv ")FHPN!")FW`H2I0j W"C`)J~ #FE%I%H'I#Hб&I H쨱$IH쀱IHX IH0IH(@#:4p:&r w&&&&5&S&pv&6Yi6VZHOA](ЭJ# F\6+ЩJ# FIHF(?vIF(FI8FI8FI8FI8FJI8F[7+<ВJ8FII8FI8F8F@I JI (:KAJOqTAHOA#\8XOp0K JI0'XI8F:4+ЂK Ir(JAKF (ݧChCh'"\\8sJ9F C\8(9h"nHP8h'kH !Z#phJ9F (9h"eH:8h'wbH !D#p^Kx+\8C\8[J9F (9h"WH8h'X0sTJ9F (9h"NH 8h'FKH !#p0+\8C\8EH!#x '\8C\8>H843( ;I";H:J#{ F?+6I"8(4I"FW  F#K)(IF2&X&W6x*.&4I - &69&S&4&&&8&CN0+>lImHVFpkKh, .!FB (fIfI8FUWbJbIF@FI0#_J@F_IA0#]J@F]I9]I 5 @F3+C-wVMosUI ;2'5QI(FOd6# "O1 SF#(KAFIFd)Fd UxR `?I pHU(h},#x39HNF7Ho뮹W5C4I 3J4I "1I v Xf X6x+<CF" .є4S!J0F!I"K0FIr-?w8v& p&&.&50Z&&S&@&e(KiHpG:-C)}F F.HIFF(<є3+83pD# "q%K8F@BI FO=I FK:I FG0#8J F8I?8J F8I:035IF F03I FJ+ F#I $.H-I.H)\63,H#I+H(F| jBp&K(F&I$H I#H&HQ&vx&^8o#&6.6&&f&S.B& pF[ - 3]b]*#D\% ;F+F"x _.9p0"x 02,"x02,"x02,4B#pp\*9F+Bp0F9+-G%FFFhCE؅3hAF0FlGF,F%F 2h)0F#G(9F,C;h8FG(;hJF8F0G(,FE( (1BrہBA O0 hS20K`Ch `pG h zrpG tpG-C -FoIOUO FN!FFF0FB( "d+x++ m mñ10aj*j+КB ؂kkB؈B4O0 pGO0pG pG-A F]F! F,CF.OS"#)FORb,F8FD_\5JBJBѕ0+*k\3B I#F2F ZI#F2F T ]TT-AFF F F"IhH!F8@F&`$ FI(F9F@F.I;F FP F&E,.  I"F@F +F:F!0FP(!B/h-GP'[hFw8F&F@&F(Fc#hZhBh&`$X6IhhlG("X6SFSF" Ix #hP"6:F(F06<&pFiOpc+hzFS \"FIF0Fp@H h-AS1pUhF;h8F)FlG(I;h\o)F8FGF#K"CFr"CFjJ!{h(F SI"(F "(FhLI"(F"!F(F(F0B; IcN I*Fi28&RZ8Fi F[Fh F#`#8@ν8-O'F FFFE!8F&F(6&0F&@F&`h8 U)& 0Bah# "hR3 EBhB3B01F@FlG 76  !8F&RF(FO   B;#4K"1FOp<#2#:F5AF< (F+ah h1&(chZ `b`@3S`|U! 0B`h# "h R3 E B3B0HF lG h J  3C, 1! Fh/ *@B(аOp( ))@@Op()@"( KS K(FpGHpGHpGHpG:8F K)FEv]`.]0a0BXahOb)DNahOb)D `FH(ФchFx*ruK ph-@0$(lh0+gAFGFHb0$Q-?+h&'f"(Fr bxOcG+h"f(FroOcG+@UIb"YFai"HFNIHF&F-@h aF(?9 bhDIJ(F(.-\*Xx3F3+ `! fFE0F1ر10F,1L# Fph0SAFGBF{+h(F0G7vQ-?$(h0+AFGCF$QXbObahnI `bahOb爨"YFF(?d;&d&|I(F4 I(F0I(F*бI(F&僧I(F I(FX"I&"")F IF4I26 TԮԲHa|#[#Y-A'$ FF`@m:FF 0K3`'8FGR###"(GF#F@FF8@#3`#h F0G0@F0G$A-O]% fOr S F:)F`)FMOr~O¨)h)̿!! 8h:BHe8h=Tr k|!F O3 ],ۀcOr`"ZJ`cO2`" Q+  xO (# # ` &1FFF) B󱀹 sЦcOwP#KsK`coC"2ЦcOwP#KhK`coC"2#!3'1 7:#O3?F?~ gO: Y [TI m@FO300X?dbR#(Ѻ?#"!21 #~3*FSF?FPFO300ZЧGW#LF@F!,Jк?GOp-L"F"*K`#"F1 б OOUHH  @%05,3qO +N p ,TH @"02PFKh*"`o&'} oP1 L(&d"E` SEªOsM$ #'F BKh+>ªOs$K@ K"!Fh#T }1(`0U j(h""0b"!FH^,1,1 101$141L#(SR#8 1"YC$1KCR#,#$)h1(1)@.,L, 101$141(1RR81 !SC$!SCRÀJ$1+Հh.^΀RÞEr ǀ@À2vI P O O ! X "HFnh+hlI@F$1h#!RBR[nVeKhP*hcI2Qk$1hh+h$1hFXh KF!Y PO :  O30/0+<@_(?$h0G$AO:!F8FGF}1+#}1$1GF418F,1L#=$ + K(hh( (?X @T+?R)h$1h#R#M2SC<1Kh+?CL h J#hh_`Op%BF(?|  Jcn#)J!^(I0FI&Mcn#%J!NmC!"JHbh#nC!J<b\m+JI+ FI0FlYIMJ&d Bĩ&.4CJQpXLm;"n*SC!J! I0F MvIAI0FpMI:I0FjMI3I0FbMI,m0FKJM)FFTI!1B""F!FOOqw-OM+h*afHeH0F5F FF 6I1F4I(+@г.OܰCFzаX IPFOCFl5 `[ ObK FIK[ kh*[BIbB FIHO(hCFe#cN JO#HB-OF|M,@e(&EFU+IR64,ѫJID 6v!60F$ F0O4 F MԒLHx Ih`HlK(lcc Hb,eTDO  XIZFIZFDKIZF;~Ka``~Ia4~K ;84vKDrFD ЉdETAD !LLAPAi#F IF(FA0)2BdFF0`@I0F,F F$@ OboIOboOb)Fo!b( F$ `rpOp,L',H@a 0)H@b )%H  h;FF7"1F hC2IF"Os1F$ h0$ F$ 7 ")F hC h00 h@ H"!4 " FTdp&DW;Z-OF }F!8F@qIc#:F:oI :F4O@JFE"FCF dI#*F0F }eh 2F Ue(F8]a;+Sx+RI$0FF0F-$1Bݖ056 * +s0:F?Ia"FF3 KZO(sE 5IOb_0O9:F,Ihh*Iht3`h3`+ #I"#HF(!KhJ h!* @qO"@F`O#O ; A"T  - Ia#h:Fdh`@dAde&&&`pC Nh kh1+D(p0+05 F3D A@ C A&`F"!FF"! -GFzz?K"?L!?M&h9 1') D aD!DB @  #<1L P D T PFHPFzLFHFtBF(FD4F7FPFhBF(FT4F>FHF\BF8F(F$F7FR!KJB(MFFr@@FGWK"K";&`;N;; FiF8p@XBXA& OAJxI K"!H`KJK,K J!H K$H]ڿ ]&n& &&~&&@  FIH FKFH)FH<&&&DFIH FKFH)FH<&&<&H) F4 F$(NM( BFAf"9 BO10h1O1(h1O10h9(hO190h7(h70h@6(h@'}&D7FtpE8h#I+F"FHH0] pD0 ŰjF"F(F !(F#pKhKx:DjQ IE0I&&`j };H&:L"F F FP4Kh#F3J!x | "|!.HtP,I < r#H"(K !0Ff&K #2 #"1#1F O1FR(FO32P rj! -x:!JJH"F t J" }&`&r5 MFH0iMxzX8F1Fȱ0FF@8F#&J!xj| V1H|!"tOs K( pi, F7^ F@ &`5 M!F@< iF O3I]iF O3<]hFhm#hXhh"## !8FLch/+ !h)(F z84 MKJ(FF&&-G-IFЀ_*M+OO .F 0F'I"F sHF(8"K :h&!IO 8(KO OF FKI"Fc&@PF(ѝ0Py+SD0a#0030&r&P& &`e-OF-FF%JV$!F0FF)"F(y$!0F>=FF,93x+f1F(F_0F.DEE]4K@3J4H   " F` V+ щE Z!  $! FF "XF ` F V*KEҤ1F(F"F,D FZ#P)F_(F%$!XF\F,p8F $< ;-CFFF!FF"Fб%B@F)F"F@FG(F"Z FC"UY%0D%05-pC F-$!&oIO阱D " F`> V+эB p$! FFHS+]pGFHS+]pG-C@n OpOF dFNIFFz@o#@q GEFyKyIzHGEF wKwI@F/F_)F& #+h+;+/0x8 N+)F) O3+` +h+AfO;x+eM+x+И0+bI F_ Fbh_ICF"F0F(]I;F*F\Khh+h!YO@m ZSB'uSAJF7O3^QHu!F( + JJ)F F7۹GHQDJEK)FDIF FF0F_2@ ;J4KhJF!OpO3+`/H1)F' +h+0O;x+?d/M+x+?_0+?ZI F_ Fb"(K"FI0F#I+F:F (AF2FI I"F FF0F_-n}&&$~'&T M&2&B&^M iFH!hF IjF l M]AM iFH!hF IjF T M]N7p%0>% + "V H $y` |H<IT  0 fK|+H"|+K`HK`HK`HK`HK`H K`&`&&&Z&&r& F!F aK@hq&D}$%!F*F rD#! 5 "\H!F ȹpCOWH"hSI"THTITH"z }Or! OO<!"F  `@A" @AiC"``(ۅB?K@'!?J?HB `>I F`h"h)i 9K"pO3 !F#` h(@())I-H_Z(+Kh+!n Q&H@"%2`B] t#!Sl 1@33O3CF qm D1F(F(F3ht!q&a&&&<&<;%&n& &1-OFdðFF3qF0IH.h0FuF0FE#FDJ!`N!Fv0F۹<;Jh3` o*F!!F F"0F"$(hGF( FC+JSh3S`XFkh+%I n#ICF eF0F0F"Jh3`I e!FI I0;Kh#I F=jhKD !B !/Ji3a&&&$&`&7FCh F+ + HiJ#)F F#40JI2+ F*4-Oװ@FH#DKhHLJ&O1F   Sh/+}!`N $ |#0/{(F"h)@B@  |JN-AЍI ( Op I I I $1@ۀQ-@ـ~I ~ }H1FzH0谹 01BBtH{sH8rI \oIqH8hP;D 1+1&2o3h+L  1+Fchh0k)F0F(7>c``1XK!XOh;D6?X1h#a DOI"h IF #;` #** 9KCD !B !ci3ca6,*$`i7FFFOi71+(UH`QIF 4(T .(MIT F(T  0Fb"CI\F00FVHF9IBF@3)F:I F6 @F@AFFFPF4 0=+C+I"F(F2FOQ FXF(0F&(F"DZTT HT`T T F@!Op%T T T "T "T "['OpHF(O5@3۠88 FF4"!F*FF FF@[8@ -CF FF04"!kh'` *h*p! 2Ykp3B0B(p!``!`(&Op F+hB ih KkBѠhp" \6 pGh0Fi 00  %hB#h)F FlGP A####5G(+s#h" F#G8" F!Fz F)F(F"F(8@Fh!j!h@!ҿ-A%Fp'F#hB #p'F"hB"ؠh!`hA!ch35k՞n.0Fn h+FBbh"3nBhbh]"Vk+F3h0 0FG h+FBbh"3QkB4"-AFF2HCF YfFYbF+HU*IFF FZ~8F\@FU%IFF0FZr8F\2F!I FZj0F\J)F FS F F\(F.IZV$CL\,I" Fl8 IZ(IZz(UtFnzD}pmOc FF!-CF2F)FT0 h F` mp F~ p FF"! Fd& I"F(FXB qC ha`! ` h! pd| FI@dz M%OcF)FF-2CF*FF;F0F mF F8-` M FIAdeh D#@ i*ъlce pG* dlfl mepGj bpGl mepGpFĕPlp"p pO3 0pGo 0pGpLk, ыk+#p+##, ыk+$#+Ѵ23"+БBK+ U#`.МBт##"M#<0p+ F!j +Ah#hhhkGb0#h hh[kGbhlbbkZeke$*!аP#N!B٩)V!XB)тB3 !F1") p!!!"Oq" <0Kk+ ыk+#pG+ ##+ + г ++#3###jF Fh *!ac#hchhkGb0#h hh[kGbhlbbkZeke  :*K"ac<0# 00pGhp!-OFh!FF&Op hhBؠh!9#h`hc`"KhOh1FlGch$#B$Сh  REXEъl2  kѾJmE jBp"8Fc6p73&-OFNk FO YE ܵ0+ۙBݪiRbԽiO  h)Q.AQ+IB +IB*IBв *E  &JBjh+ѫi;DhCE!p ih;D"kQZ"ZJB0Fg(Ѣlm#e#hhaihhnG(hJERE IBѼ3JBѻ   9  @ q "E ;h-OjFNFF3h 0`p#h^D3k/ճk3,ѓK"hn\hniB8$FOpFIJFCF@0F-i(hI 0B C#S1/chBұkK hhlG(*hvKPBѪi 0ѡhYD k@CS"  gK h;F";F PFIFFQ } "  ;F@ :` p2 YhF[Dm +tqh+m$03OpAx0 qp0 @3BFx;Fh[DkOp%BFx;F h#0hmFKho3BFYDkDdFkG8F*K B,ٝpI x)  #$Ii-@#e(F3 4  p iIBxL-#F  ' I #-K& &&$.-CFLFF0+@@OO 00BOp"0B@x0BOpj0BOp\0BG O0BH B0BI 50BJ (0B@0BOp 0B@0B+hhhZjBE&030iS,/kk+qh]IB#\IB \IB[IB[K ZIiC𻹚j X^0B/[/Y5D () Op0 DI)@@>K"h=Kh0 8Ii-L3K"h2Kh0+K"hq(KGh0h$IBѫjpi @   GI#F:F0F-IB ѫlpim@IB&ѫlpim@& q "E ; @PV&@&_   _IB ѫlm0 [Ii[IBѫln0WIB-ѫl[ns@i`@QI2F#F(FOJ!Op! GIF0 i,(F!B *K0 >Ii,ll;Ii,|ll8Ii,tll_5Ii,lll2Ii,dll/Ii,\ll,Ii,TllZ)Ii,Lll%IiCe#JBѫl30h P!+FS+hhd:FiiG+h "WChhjYMF /m / Vv~ 9-C 'PŰh F hoChhj;D[h3;+ En*FIiGOd*FIiG#h"O1hhj#hY#hai*Fhho3FGh"0Űh F!F0GO1#OpC#"(h!Fh0G E0𵋰Fl$"(F1# S"#FO1}Kh#F)F+Zpl4'x'I FN訹#+vlm# e 20 R, F FF// /#+vl"!F0lmC"!F wlp F&Kl J !(F,"O1 #OpS3F$(F`l`dXf0Fp-C% F! F(nOp8N8%` `@/a a@)#b b$-!+#Y#/+Q`7 5!Op #Q F3"+@O$-D `K@!JH#"2 !JM 3"2#%"1#!FAF(F F * u< <0Kk-C+Fc+++г +[! tF(W.O`FW !5(aE ˅Op `@ a@} bOpxK"!F0#M 2J3"2# "#11F(F F k+1F < !1 ! e-O F h%`h+Fp&(B-πhO lNO  (2"!8Fi#hh#,0!@Fi-@P"F0F#hhh0P"F0F#h9h#hhFXhF@@+FJF!xA @ B ?L ! P "h#" h"#"h0G?F/ h"QF"hlGO8 7eFŖ#%"$ E ;B2E #1F(F e  SS E@ E8S(E E(!hS E< E E2O@F y &i-AF F+bhhmG+hih W?Si+OzBzABN(;khp!h s`+h1`i h hwF (D1Fn@q  E0#sK`ca3c# FA R :31DHc;(ѽ .?-Oϰ FF"!(Pph/! WET0+ + # #3WEO3 Rj FHKh O#F@ =P heFžžŞ @T0+ + <žŞ pWEO# 0*F~HYj#B%FWE80HFlG(B@F `32 05HF0 0 lGF h FO1h ##" 0IFG(F #!###"#hFhkG"eOp "JF$j X @żŜO % #S=KAFF ;K7#<## F@F XFL+h"WE h 8Xc";m#;e h*Fh0G"ckH(h hhlG"hbZe Fed!F0Fhp+FG(CBc[B#& q q <=8=x=Z+WEh ghp3D  i RDDs;sch;c`O0x$JFrWE?p3m h :Fh0G _h 3_kB@5 @ #i@#p#h[B#p"ch[(DZC)D: i RDD.s F;s#hh[ ch;c`!F0FmP% B5-A FIhp&Fha +h`hkhp `Dhp"!@Di1 F(x 0DDAFK F 0 ca3bckh3k`#h)F F} F)F O0 )-OFӰFFF±?5YF" "< :_< :O<:):: `!" "&O E$#2F'(#@F DDG)F0FI FS*[F J! wOK 68FK"D|$,D<8F i#F aORO3Oq#-A F aklO@ZkVh9FQBu9FOGOzsCCBu#XCBuOS FA@ZOCOC@Ch-OF+@ A"hIF F  l G'W IFH  hBh:E"h Fl G(s2Rnj K B{B{EBWBx R,L"@F)FKF"KFF 9F0FF <JP! 'h"1FXF;Fl;F"F FPFdFF JP!vT, ,!D Z1xO x&f&@-OFh FFhmG+hh F*M O h!DD@FFb(qFH#B4рH"P X.2S1"`",3@`tJ 3C,@uC,"#,pJC,[# mK@lqmJmHF3B @qa"ZgJ 3C,@a"ZcJ 3C,$E#CO|_KBF_H^KJ#,.IB:OQ!1B5+IBє *#ۨXX $$ #+`,"H!IFF F(c]b/+FKB KB!EEL#3`!EEZ #+`#3` L L&X&&[T 8T&8 T&,>-OFFFx+O0F "]FF#;p"+xc+8M+.C+2G+++/#;pkx+ FQFS+* !m+s+g+*BFKFOA 5"*BFKFO*YF-OMhF! #m#5(FJ (##h FlG &h"  KhBrF F F# *F0Gh+޲`Ҳ F@FJ!-@a6J! +D۲ Op 'pB@KR h!hF>S !F=T ! FU !F.P-E<SlI3F:F 8F 0F(F@F0%S + s+F0" YJ!T-&*x*"RI*F#O1& "F#?B)F(:kx+@)x`)@ B#h0a9 F*FlG(0c2F#"##h F0Guj:CFnCfDBFvAF0FhfEv  jBAVFF#CCEFA8 Ja#I\R a6J! I\@# &&@zfI 0" FF`Ih"6 V0AaF FFUI&0V" FFNIHF&9JK!hObF Fv mpd{Fx I"`I F8I F@  p#$F F !DB p0F︹-J#!O31!(CXBXA F4KO1-Gmh9`(Y/N3hBph*1+O$A,KА)1;0p` m"h1T# FGF%F $O hB+hBF!F(FlG0a+h" !F(FxOcG(9hhp`4 F&d&XKJ(FF&Fx x/(ѢF]/* F/*RJHOaXK/*Jr&`~F!F@ϿF!F@IF F(8hN0h0I*FH0hO;h; I*F}8h Fi ;jF!sIFFH&0h I"F F $`& &H pFF"FI@F /F(!F F@} Fp"FhF Fh"F@I@jF  },0} FFQ"FhF(FI"F@!hF^0DI@jF }0 5 F,!F@_-AFFFF@F0F)Fr0 ICF:F F0 F(FK$D"` %A&X8 M4htIF FF(D8&XX-CFNOD%(F 9FHFFF$h IKFF(F`F(#h F$B04&XhFMF4@{4!  4"9FF@;("1F" D&XpL4S#4T- TTp.FV;42 I3FF (F;)F(Q; 4:(F/&XhpFF FH)FJF Fp@T8FF9!FF+I*FF @ 8zFO@FO@FO @ۿK8 pG&X0%*F!HU!UFF H I FJx I FD@ @K` F0@ >(&l | @-A(N0h(q/HO$A\#F"!F F 0h0Q###"GF(3h$*pRBpR#h i F(( 3h$h0G0h$q &d|h#p$B OpV ! Bh"Rm*3  pGsj$ Fp6h#hFXh+F2F!Op#h F0GF(@!F g pG MFб&M$&K!F&J/h$H,`#H I"F H Kh,/`$ F<K!FJ0F,!KJ0FKJd!/`,"F(I F@1F &&l &+ pGHm@HhR  pG pG pG8F#Q۹ҹOp F8@suy (3B## 80F!0"hFKhhOp_-OjFO0 FO# # 0Op&l pG pGFF F&Bcm+#~۱In먹 Kh$1heOp&#B0# #eOp6p4 &lFQpF F [" M K)`" (`p3C# @D4C $ ! &@&F IFF X1F("H:F(F!F@ſ&p16H[4 - p"!hFlF2#jF!@c0Op N K!3`F 2hkF]I TI"F O @pI&\0-GFQ#0} Fh(F0T# (O@9a;Hz:IF(FB2F!8FF 4I8Fz (F)FFFPFxF( 0=+8Ft)J;F!8DLX$0F#Nfd"HBF)F0h ICF*F0hFOsH*F$hI"FF[ 1F0F }0h0I0h IH&rebCF0 FQ#0h0U# N@9 Oa8h0 I2FH8h2F I Hf)F F2 NOs& 5KpF F2#K#FhF6F,ж0@;U#0(Ѷ0OrU#0 a Op{(Ѷ0 OrU#0ap<H K"`7V &T-CðF F"!0F "AoFO99F i{h+ ѵ0OrT#0 aC5+I JAFHJI (JIHI 3x#I2F !@M0@;T#0f&&&Op8F Fe0J T#0ha8&R!0pFih`iF0F[#FIF(Fp@G8F F XI l0T#0 Ora 8Or8 F0F Q#10I T#0iH00OrT#0a 8- @@@I1-GOr-F!,vm(rkK`@5!( F|(b`0h58^J1F e3hc]ZJ1FF Z ,8UJAF OTK PFPOIRFFHFHFFFHFOs@=d'FBJKFAF h @9#aOs9L%9N'F---e5Kh{b54-2J2I 2HC+L&ch++ h65GKE<4($K%Lh:"F h= h*: h:#@K2JF&!JF"!o2F F FP8&I?& V&Θ&&&&'}'} N N-AF1HFq0I.NF(94h<@Fc+IF F%H[F&H(4 K#J aHJ:0h8*FI0hP"I(FRF(F@ /F HHI*F F FBJF ( 8&eb:l!!npG pG-O%,F FB ``.=-;1 DBt  B Ey Ew # B Ey tsBBt h.6`v Gv@@51Kh"0pG&-OFF Ey 2UF FLFF*2vs#"#.w:F3F F)F*CsG2]D3F)F:F FdBt ` !t&!PBBt R`ER1h;` 5328OrPF!0 #P`08$ N MV; F!,]#",E ;>0&ΠKh H&Π&-CFF FE3F*$+F"Fpp'B2B43LE۸@a4 ؼkh Jj   Fih JkhJJIF0K@QJH@h F@ȻS>_8FKh _J#Bز83 2"+ K"h KhB (4Bx2F&Π&&-CFFF0'0'_8F Lh !- #@8K"=hB7K h4#<(0&Π&&KFh (@ K&Π>0-AF,LFh !- )O#8hFBі  #@"FR4eE(3FYF(00"8`4'!_C30@FJ+F!Q@Ff'@sgr  J!F0FX#'p 8&c&Π&&F8KFFh s&*F3FB W(WлBO0"! F7F"!!!i#sC`a!s+Da. a!bb0cbX3bѕ0#iC#a t1BB/D0#iC #a h3BӟB62&ΠF!  " FxC$Op ` ! m-OFDM3sKOqsJsHm#rK@nJn#oKOqkJCn#mK@gJn#jKOqdJH ")F@F0bI@FY808^N <F/ Baє80YI"Y 7'FF? BY&pXQIFPIF(I vF@ DM7hQ7I+:+ #;0a+I(F[#0#0#0S0 ++ ї(F0#KCIA0(F7;B̿II4?_5Pj wJt8.#R>0 h-OFF Kh " h  hKi i    ###"P+@`O7#YB Bz!۹йr#9B0 J IFPF j j}k F/FMFF FB s F Bs @F*FK JBxڷ h >M+h# ' (`0' =FB 6I hB[+@{)\7 h-D5-<)( O1jpjt D"[xK@ p 5D%0h3`#KEr ۳ b #8F-)-ѷYFB#1"F&8FM+h':(`2 IBs IBs ڣh#"r#8Oc@#&8@-OOfq-FF$M PTRF%Oc)Ft (^CF F $M\I0$( F0FXO1QEJFu FF\*Fy!`  X4%F'F+O+  e``` Fo0CE&0F" f  /#9 j-C 'PŰk FhhoCj;D[h3;+ En*FkGOd*FkG#h"O1hj#hY hk*Fho3FGpFkKĕ#####0h p0hhlG(pFkK,lFĕ#0h0hho#GBb[B!Bp p0hjFhlG(𵑰%F F.F hB-E-9+6G#h0#iF FG`#hh!#hFXh*F!FOp6#h1F FlG h* 5* ڛA####6#h09F FG%#hh#hFXh*F!F@ FfF(F𵉰F l"FF )YBF9< FO , B FIBP3F3 H!"AO1Z F 3#1F:F!r -CD" FF! j! #@AF(uPLFŔ 4@Ŕ@F0lGDK0"hTyO3FFF F!. h[kG7K"h ThBr *F#F#"0 G(J # 1F###Os""K"K6#2O3"#AF0FX # F(0FM0[ h0G0 8Fzh;3O0## W&d& h g Fk#K hh0G@@0 -C Fǰ(1 h8hkGFHiYh"0FOO #h"O1h#hhV3xs#h0F9FhlG(0pFa G-GF FD"! P#!00h[j HFF(?:IP"0P7HYj"F#B55Mĕ 0E0QF@FlG Os"(K1F'K6#2#JF#AF 0Fl `32 F60F0s hB h@ G q(8F O0h[ [ W q W h g-OF-FhF0G#h FlGVKhTxwO7FF F@!hkeF[ Fx F#"0 G(Ft!"z # # ###hi[k* "!"G#h"0 FGCFR#h FlGF(J#hi*G F#G? ##(#hkG#h" F0G0)  #hE0 0# 8   # Fx#" eG(%(FO &dK-OFh#(1+@ہ +h3K@AJHi.́Jh\(FOJ#O~OxO FqJ>F"(O2)CF@=%$h 8+h\ @ O Xh 0hFph&K"! @FdRO@C"!HFdF 1FOp  2s pH 0$1hh{0$1hXhr@"!FO #P+h0+H"]HOq`!Y`@aYHYaYHh(Y22VI b@b#@u3133o O3GF GKb0F0FU+++Z&7F,(FG(##z09K" O4 F-+h9F(FlGp#C !#h;+67hB~@Z ^8#Kh)"H(FF @'+h0+!(FG\B\A+?ɮ!(Fq&d@R&&8 j lA80 h h& hE h&*h"Ohh0Kh@!Cb@!$ 0F8+OE&O$!(F(?(zaR hR4 Ch(FQ$4 YhB0Ftd 14NB$$!&d-O+հFOs K !O2h FF@! FF@8FaO PFU! F (@@FPKhS+ + 0BW+Lі(1+`#S`,ARd cErSO !IRBR F[!djFOpJFIO FFH%*P}J` 5C0+0G(  pKh[E-؅$[BO6 @BtFHO MFF a6FOpZ(!H1O 1F  RHD! Fc@od>!vFXFFPF 0F #D 3D FrYFFWvXFO ! QFFWfPF 1F  WX0F\ F B+K@Q+J+H F#"9F23*F33#O3AFFB6 O R#Eѹ F"@F8F s?0FLF[  &&] hh@c-GmF FtH!O#`*@20F9F(;x/+ d8JOaF FOb9F F(O0F(*Ob1F8FoOa FoN(#x/+;x fx&v  FF8F3CDDoFIOb FoOb9F Fo}(F( ڼ8h(F2`/(F F m~rF(  O F!d "iFR ( F .~(ڀ@ XBXA-GFFFwHF(=иO&(FxF0(Fvf8Fc+ 4I" FF(I#FJF0H73FIPF]O7,~&|Op!z -AJmH"F@‚H(oH(j(@ۀHObF((F($I( (@l(ZF(хI(3ObF `I(( b~IF }I(ObF `xI( bsIF oI(rIF F(@nI(kIF(FF(@iHObF ``I(]I bF(FF(@QHObF `PI(!F `SIF(NIF(FF(kNHObLF `pGI(FX; `DJOa c `06I b;F `5 -$!@+0F Jm(($0I(tObF `2 `FX(I(bI b$F(F,#HObF( I( `HnI(F F$J cI (?v"0~ X$ `pG# `pG# `pG# `pG# `pG0Fii, FIBdDK"hJ!(FPK,h6 7 {!P"FFH F 0&&@&P-O@F# h #C 2XchC#k;գk3$%ke 2X ++O cCFFK J!c %[0hkh0G87 %Op O3cshBٷh wk3 ! 0BO1c50@FlG(2EE1cmpCBCA ^K"O h\K\JFWJ!  +@O3FRKh #FFMK O # KK"O10 ##P + "X?KF Fx*b >@X%*Ye)pO #;00hhlG FF#YC{I2D H;FJFQF@Fh#kD##c;0+ˀQ 2XbhBA䀩BpF F O |O3Fx3(O &p&@r wjK ; h#gKh,1 +4(  h 3  k"cE#kC#cUF=FQ=#k 2XbhPc#A#mBhH 20FCe`>O Op Z?jQFjZ?bQFO &&d4-CFFjShBgp&h~C" k)p [hYjK@hLhJ!hR\h[mMѹ>dB_JiI &!4h4Dj+H@gWJ(!FO h3DkQ񔀛kZ=# # KI&(F# AJ &!t7K"HF!Fh9J#k 5J(!X"~b#m4 @,J#F  УnOp\ht&J#F`kh[o3h3Dfh3Dm\@YJ(!KF F@O J!FkkJИG(+#p@#n&e ) Feh#p&FFB9(G+Q+ F, P!&J#F #Hk* !JHa- JF!hJF. KJ!H)hkԉk?C2 ++ P"F , rR&@@x"&ѠBh!-A2Fjj5 :NO FB=8HO@P"Z5"a2Ja@b1Jb1"c0Jc#hv#g hhCE$#OpE0 Fvj(ۡji j /k2p50L"BlhjFAFlGHGF kRh\gF3 @x = -OF7FFFO p' E6ѹlp'qB(a0IF:F30 Fi1 x#" kih hb####ice+je8@ii D hjB6* Ѩi@x1zHk1&#k h#`m!cH*Ъi*x"mB"eA!c##c  gK-Oh FF8F$(th! XFMF([I #[E$5FOsO H0t@uO5"AF@HKA#2ZF##s@FKEkqhj1 oF(bqhOp b  h0^(Rsh` DAFbrh!F  XZFIF F  # #ccAFf8Ff)3hcc0F[ 0sh3s`,O03PW8F8F &d m-GF FOp 0@W"O1+O / #3t0 /+ "9F/#0ehOEEAij F(ahOph(bh`!bsaBF  FP"hO59FFBcc"b ""Vch F3c`(Fh9F 0xOp>!vFa(Fy&-O FFF!4"0F #%`Br i IBEA  bB! p!```0KhOO(rIhbhpӧh#Op B qj(Hm3&@  K'hhO333E򒁫j+@ O WFh+hREl(FGp#E٠hXDk3ћI#a)v&B#I#+:*@3+#h ˱E@p XC2k3Sh1X3A1PS`3A/z-0V Bz%E@QB<` L~p"F pF FBCHC 1DP{`#ugE"V 0FE@ׁp HC10XIhYB Fg"E@ҁ/:E7!)p1p#hKD S [h^C8vhF1F@F hBzFuHjC ^`chB7;B6@QPYF FQC2DBBp򈁫Brڦh V BgF F zUshY AEz 2kE@Ez= &d&CXbhBAB@cp"a +FHDIqC` +q!#IC`##3k#3ckCc##p#hO3BDjUccPQmA+hmkGhhCDb!hhjCDBZm**kB cj+HhXh@QPCQ`h , *chB:F7!* vIFȱtIF~HS )r T R"T "X *7jhBh 9FlG(h+++# 9Fj#Fp'l QF(FGh+ #Br  [ BEs #FQF(FH  f#E803 V 02CPАBAF 0 F pE.p!a"BBгk3 S1kgF2p6F Fx:@0a @2Hp"I TC"FLD FiCDIa`I 4-O%-FLhF(Fp& #B#-u(Dp!F(npFO p70E"ӤDPԧK$\CBTХK@]QJH03nJk՛k35Sh0pBp" Fnc#k)գk3&ѧpO p4 p" Fn.lhS8IhhlG0##W<[hEp4  p7`0!$ @wKh;Ow'hlG4 1 BBO3 F&4F0BqBHSOp!e[e+ Z whu T B2E 2!F(FHeC'F#+rDBrv[bJ s` %Op 0Bw (`+ sO3 3.@ O 0E/ 'Opp#{Ck?8F5UhQkJ[BFL(XFhlG0DkX#j F-z ;B2]J 2)FPFj -F ,F70>J0w`m7Cgg& pGD;kYkL(`^F3#B 3h0Fo#G0 S 0BABB #0F3h"Fk#G504N3h0FlG KFFH#0BLp"0k3t+kqYkh+rj 1h b0F#"0G(R##ihY#BpF F#3hjkGa"km!Fam#bmcb+nbknb3h0`a0FGCF#3hF"F0FlG+kcC +c2uG3H2GSFBF)F8F g 043tA#[ BB sp#p k3@#k@𬀞@񭀣n+lZhEhS8Ihhl"G(S8 hh"G( h   Xch b#"0G(9,FĖ##)F"h0GFHH*FhlG2F D ;B2D 21F F: d ' hRB   o" DXchB#"0G(  05Xch+r h    b#"0G(:##ahX#BpF F#0jhkGacmam+bmkb#nbcnbcmha+?^j+?Z#mC"e"~*?RC#eMo h   [B3 DbhYC2"0G(yk3=#k9щXbh*q3  +/hhBkjGacmam+bmkb#nbcnbhah0+")FGBFu7050B#p!O0 B$Op 0B p%=@#h[b##CE@p!0FF08"O0'hp3B'Op E@,F' GE$p'0Bрe;l1F.G6i1. BB10 BB*F1FhlG0cccm+?|j+?x#mC"e"~*?pC#ek`)FFGb "3ch0.!FXFlG(2!`.| Bk5UhQ-q wEEicd4@300XHhCЊk263F2Cp C`|O kCKkB k  +hB Pp"z7JYb٠j("c:JYcz#@u3 <@33o O3#CF ,Kb8F 8Fw/?++hTjV##0h0G?/ƀ8x@g ^3O20`#DFF$O<RO L 5@ a382+- ` O@uOC4O @- 2D+F*F#3O39?FO0 M87@F:hB S g(IF F@? i]m%IF#n+#J!iOp@A iHcnFn+J!i@B n+J!i@C #o+ J!iOp@E icoF pFOpFF"FhF.2%3?KD`T 4#0VJ`k;+إhݱ1{"2OpN R(^#10K`0Kh0I*k#:*  ,0=!F z 0!F $J $I2h2"K#J#K"J "I2h2 K J K F{J I2h2KJKK JIcih#KKo&Ҡ&d&' i Q'  Q i ̉' I q'< %   𵭰FP"! ##`TKhSTI " RIy h0:]hűhBD"; hP!D 3kjIJ" F -H0H3AKh+9@I "F(1=Ny3h0:YhhB D";'1h)D41$#h7'7P#o8G3h.J+DP! 3usoѸ&Kh+6"%IZ#MF!z+h09^hhB#`!+hDeFmX`1,2BP!J[jf""0bcO}O0{&'\&J'&ZZ'8-AF$AF,)' I"F 8(8oJZZ :.-O]NFOR `!lL+ЄOD;h+@O4;hCOq 8`zO;h+@"uO0+@ rK"O O`1XaO|a O`fK  1Ox a`_K`H X``1Xa a;hJwYI  3Ha`PSI`S03ap0"`d'<"! H a*F d@sDK1FR"CKCKK#2#OpAF/`h(8 @B ]Oa (L8`IH! (X8`UJq 8`(WS`!2 a0F0F3h+Kh$1+Kh+Г|!jOpc Z(!F1 XX&Ҡ&&&''''''< Y &d&'8''\&FKh3"FI@P ҽ&EF p$a3F2F1FpF(fR###" G(K$hRBqR &dk+K@mQJHzhDY-GF F%@V)@U*Eܽi+XKE ѣk+ѣhh{#{5SEѣk+ѣh|1 F$1{CpF8"!FhFԱ Fs$Q!1$hikO2 FFJ#|1`p((F(Fh)FhF"iF FhiF hF[*FhF(&Ҡ-AF^8"!F$-O60F2(F($A#h F0G#hi" F"#GF@#h F0G$a4F#h FlG0"FF !~VXK "hCD8"G(P"!hvc F 3"60G(# F # ##"#h0GBF#h F'>FO8lG! 1,!F$$"(FK$hB/WFFE.K@Q-J.HF#hk+G#h 1F FlG`BѸ?F76#h 9F FlGB 1BBѶ?>F7hBs!1O2F(Fw J#|1`'O6CDY&Ҡ-O}FFFFJFcF(hI2F cL(  eI@F&ZF`F(F(F_I*F@Fj0Ѷ$h+ZHIFPO0 }kcj`j`+k#akkcakakka@0#bB0cbklbOd/}GI:F@F60vBI*F@F.0;AIJF c@ILQF8"F FH"F;I0FFP9I0FF 7I0FF5I0FF3I0FFh"F1I0FB,?F/I00FF"!8F1FHF0' 0B :BOЪ# (15D*2*#0 "F ]( 2(J@dAde(a@dz((y(((((((-CDM$OcFF!FF CFO4 F DM"FF;FHFF(F, 1#O`pG-OFFT ,# uR:E; B #FQF*FXF kErSF*F#FkBr6 \cErFcFx!Oii@1lAa !Br  B *k"1kB{> a :E~#71 N B,ucF8#FE9 B *FAFHF>iErCF*F#F k J EEIBADCEr 6Br:B F{SA,u8E9B #FAF*FHFiErCF*F#FBr hOFj EzFFؐd0%###"U#"( (F)F 0k#pGB3D0 D0pG0pG0%k#F B05hEjB %jjCX@Bl"d 0#lB C##d@, pG& L<'B~##`36hhshp&ҰpF0K@aJHk=`h] Fp@X0[`hK`(FF5FD FBh I F@pFk%O5(FpD1Fx( 1Fr(@5CFeK@JHiFQ H! mF(K`8F[0+e #8#c3#dff# c`eD0`` F^D)D88 FkF# B@3hXjB jBCXD`"l 8-OF1LFFcB[[- I#F:F @ E F<|FkF#ձB N3i#@Q0a/+l 3ix;##pP3 &Ұ-O]FF66k",kЊBnO2`kєD "y*l`@+ 0 "1FPF]h !* ؐKT8 ""! #(##*#0D0+< #!###+F}J(FtO Oc! vIRF0Mѵ<h+!(F ]@2*CO #D"0+ѷIFF ]IJF(FN0BZ#YC0BF(OI (F4((Fj "0C0ZлnлєD0+N@KC4\ ht/*9pt;JAF8F #kF"@$"@P0I@(F60BPFB R(0U1Pm\* +#0ZK@QJH JBFF8F 0[ K@Q J J JD dyd| w2d{Fh\jB" $jbCX@Bггk#B30+h3h8  2*s K@1 J H IBs IBs@! Oa!G8@hkBF2Bp" F  8  K[hHpG&Ұ %8FMkh khB(h<" 8&ҰLch `h&ҰFMkh #xW&B$ !F<,F F6FF&ҰsF F6I(FF8 "Q p0I(FF0 "Q*I(FF(!F()!(ph `I(FrI(Fl( ("I(F` D`"I(FV(IF(+x+N0h()FD#lrhC#d6/6<BJPWF< #J( IPI" ]IxF##TI Pp( dRG'-O ]$BFOc@h! 򝀤I 00FO7)k#FFD)*ѕD0k *IИI Fkh"FI 0(v#D0lk,9lc ,k,C,k,@̀QF(F;F_ ?" hHh( ՚FC3|(CFFF!pkh sI #` F4F0pkh jI## #0#0Z"!0F~@F # ] 1BB 1BB P#h2hB 3 #II(D HFH #AI(@@E # :I l(@A+ @F4I() 1I@F #(њ0-ԛ+ՔD0 S3p#h jhK 3bF F !I4#lI #hh` #hh0C0@ID0F FbIF @db0(X#O;(" F F@s Jx!Fn F!FQ F|@K@1JHI,iG:lOD+]  FODZ*@w#` +-AFMkh #xW&B$hh!FF<5DF F6F&ҰJ#0FehB ѥhB J034+#PhB32+ 0pGE D 8F Mkh ,h8,#B FR<[B3F&Ұ8F Mkh T!#B hF($ F8B3<2&Ұ8 FF0k++`# #`8#8FHi F# ###i `SBii0+j0kj0j0j08𵹰Fk>EF# 9B3hXjB jBCXG"hF9FhFiFD1*F F @B1*F hh*F-#p@B l   S*FFFh-A'F:FJ TkkENkB ktڸ k V\kBuF70@ ;0 h TkkE^kBkt0*`p -G FFFFĕeF#0 0F ##"###"0P%@(`O0hkB-@{ ! DEz FF|F -K+`00*FC!F0 G ;i h3`#[b #0C03k+УB " 0 Fz-AFkFF#FB#+i-A; 1BBM! Fй*Kh;` @3B0#0!"!F04:F#AF0#(0C0#[ba F)F0  qBBL0&pFhV#kFB ОB % K` p(F3P-0й#c04#)Ft(h;`#[B #0(F Fh  " FF(-OFd]XF ЋK@JHKh#KOqJ P IF(@ȀKh{ J)F (@H! 3F(|IP D4uI Pv(EFFFF'`p mIعV +ChI(Is J <0k@08Px+П,;F F "!PFCF,$/ "!P F7/ "!P )ѝ`0FI""BI8 j=I0s J y +?v6I "`鸱! F + sXXF d] kD0`"9F 5PE0[[  D(EP#C0@ 03 0)@GQ&&Ұ.RUZVUGd5$ 0 !X0  0 0$050#D0Oc0WFF׹00s+И0l+(O "HFJ+K(J"3Yi2F(FXC.#KO F " 2 `J# #i?01FJ(Fz >0=0<0;0:0 #F2F(F Bѫ  3Ѥ  GX-C FFxk  FIF>  7#I"F 6 5  3 2 1  . d (T'EFȱ1F^塀#S˄0 00**+7/O0YGpFL&{@!J 6 {c{#{zzcz#z#h2 4G. pGX-OF0z;CEx'O`.{("ЦVBVADD EjcEa`DBa~FFEB,S `` &.(J{O O `~ .gD afDBмдE(FcEDcE 6FE CCF dE(dF  O0 dE(dF.7/zy y pG;hhB4O0 pGO0pG#4 ;B2#bF#`F!1;bE),$+"h3`1,+bEO1AmAtBw  16)"*gt(؃( C +ER@   pG8(4  pG(  pG pG pG pG-G$xFF#F ʱB 4uD$G4-*8""3+ y%.= оСB v#D+F45-"(r` pGFJ cy)+0@ pG pGJ# 2J] -pCFFF!"1FJ(FhF0 K#`0F p#(k*BO18hG,# IpG-C4 &FJFO Fx$!/)pDvEB 4,"O *FHF)* ""2i0O!-OF' &.@&r"OEsF 3)p FO3 #!Eq] BZ" 42 [F0L V  s4C9dI F!FCFHFi DEy DFeB  %F Bs:!7PQ`#%FF OoABq8F#BBt11"  O8 Fh;/ * pG BJ# # kFJ]  kFJ ] F pG# kFJ] 0F#hMFF3"! ")F: I h M0#6!Oc `0d{42-G@4FFF)63B6KhTqD&'p+#Jf] 0F %h"hjjCX@BѸh"BhQQ2*0 h 0hjBCX@B Ky+8 pG pGpFpuvUB Fp@p8Cb) F1)sKO^qJHJMBBs MBs#4"8Oc@#6J8@ F*I@6BFh5F&@Xl2R1JBsڣh`h"w h3#h1F FlG ¹Ob"@BqZA0@@C"Bq2hO&d8@8uF8a@"(F2 F 82F82BCFg+KOdq*J+HO2q UF(D&K`(FO3BO9F ``0FrO?FFK@2#Os"`#cCcO3(F21iFP222`! F FJK8F Mkh 9khB K!"D B021l* 8&'pH8 ^ pG'p8h  hjCCX@B%hz0+  bhF(F 8 -MmF cFF!" F+F(v!*Jv#(F08!Oc I"Fr0(F m"!F@F dy-GFF FF(FF82 Bт+h1F8acaq4FB!Fع22H+h43B(2+ѐ5F4i+?dJ``F`-O$m FO!!FOcNO4 F $mpI0s@"!:2Or!Fc2K13bK@!aJbHL v [ 3psppqsqq6 #BES2" ^O[+FXF1FX `*F8FM(B,8FXF`PFL6`+H6+XFH&ZCFFF@3E(FO )? 1pp? A 8pFFF@3E(FO )? 1pq?A q(FF8F*F8FM~FEBh Or0D*F1F8FMdF0FOsE]E?|O4|@dLFR5K@ AJH|)FFFkCK@AJ Bp"a4+F@ @1¨L)¼FFi$MB4D5O4uhh G/ܴ Jh` qi ``B xc p'p&-OFFFFFΟŖ4#PH !B%1D0!uFu]eEy1.-8R-R0(K;`'8F!() &~F1FO   м FNEF61)- ؅B /@8` FRn+FB "1FPFjBr3F"+F~&O  >  мIE16.R F  B}()8O)2 O (F  2Ɓ" "B<Fi0t/?K4KGO pO  8 $("ЊDƑD N E~ Ѐ @ Ey Ā  OO\  ( K@Ta JHBrp/?Op'p L;FD HSE s(93q;F)DTIF(?12k @B # E# 6E&0 B1E Kp"! F2EO3"\( )2*K@laJo#D !I DBEOr ڨ/?O@J ?LK-OF FFFyFĖi#0ji2K@JHK$B/4D3O4#O6F  s\).F2* 4k +$+,'Ѻ @,ѺВK0O0()[D41A! +Ewy  C E wjhh C CE Aں@8B 44 F2"QD1[BBKEA Es "Oq F(qѺZKh1 BKEr CEr ں?{@u!FB(DwSF"9F[@BdT 8DFXFH/ svyrB0)*"*@m3B  B mES1#12*<")FFKCEF s9 gGq"wSF9F"l[@BBQL['ph&] G)F@FFhBx FD G "@B q `wSSF9F[@BB!22B sOq 0F2ES1#1F22b . ٺ?a +@OsV2" 4KEAhhKF "2 0?OB x$)BF+F," 4dKFH!F@F hKEr"KF)D F A BOq bB# 44"SFqik <@B< K p"!A0#]R !BwDy3+'tt!%ymA ?-?B?014)u8F| ?-CFFFk4 1F@F  >F(hѹ h0G#k+ k0"F   F  2S2BwO=F3FS('K F# # ##"1F@F g( k-xI;F2F`hG c(hP2G g Kh;F2F`hG c(Єb'3T? sF0K@k!JH4O3Ov]#ahh6R-C kh0G8u$vUB`h Fp@ʺLhFk Mh0G#!Oc`h+0P!)JP# FxvCF+!K"hO3R[Er FF#FPFYF4+F00FkCEE@31BFF@13h!X*FpQF#FGP@&d-GFKFFF"hO3R0ABr FFo4!*81?+ Cc"@3"BF?# F<` 03h@h8O08 F8F1h2[Z`bh`eiUi F8@h"+h jhZ`jh`hh(F+h jhZ`jh`hh(F-AmF FFO#xK4=-Ѹ.%I&H *F! FHX#I` H mݰ7#I`H,CFK *F",#h3`BF9F0 Hh+аh#+8FgFMj#ijm@2FiFhCF Hq FIO0 m( FiFz M@#BpFF F3H3Ip@]JՈHeih1hIE#!R""HL0ѰBh +а<h9+IH$ Fp2Z`jh`#+`#jk``ci%bsh"Kh%0 IH Գ Fp@Ӿa Fr0j/MMjK 7jUpF$ FFF#FaB?aFB?`2bC``p+pFF FF%I&H Fj#JCF3!"*A-@! F"0%"! FB@! F0F!F(Fx"h K0I HpHzc FMj/ 7jU F" F"sOsFF FB*F"Kj0IHGOs)F2F FCF" KQ0IH.p 9MjU 98FMO5O3p10%J(F8FoO31 1CF FFCF   FZ0 F\O4 F)-OFM FF$ݰ7#`O0 MX&XFB o YF6TFB"FiF$F&FFFF:#`O0i$;! FhhBҲBFh2Z`bh`hs`h1F70hS FP*bB2F9Fhj*ihca##`i&a2c``aKh\ 7FHB!@ N-CFP44T#qjD#SD<X#C#qCCD#hHd ԶD BB`T0+3D&0` HF (F5FIF(F/AFDiL1pFSo@E+P(#P1T1So@E+X%#X1d1So@E+h"#h1RulR->p+DP#zL1;L1+DP#oT1;T1+DP#dd1;d1(F,52;2b.Mb(F,5p2;p2pb.l9lb7F# FFF/F(AH1F! FD181@3S,B@C,(0а#`H!@Ľ)" K0IH@Nj/ ?5jU) FF$I$Hq"(0а#`H!@1+ڰ7#|s_|(#"1 K0IH@eN(j/ A9jUCoOrF!Q#0HI"H N9jihF<1!IP03 F^ F033S< lKI FJ@+Fݻjjj0FpQet#jF(FFH[pQ-#0j033FS< F@ ^(FCF!@t13t1c+H!d"K![j @)7F F2I2H`#|DC*H%!P)F0@|(1D1B0|18\ "T_HMQ-I n; f+X1 "Kq0I H0@KmZe "pNKj/ o oP ?5jU8!F HCFѽ8@ I H)FN0H)F F8@A7jp FFFQ kH0I F3 Br K F-)FF"#FF##b03 "r <1@?!p@ʻpjjjF81FCS81x1[hh#j12P8C5CEUH P2P! Fhh#j Fdhjp+% p032FUs+CC+C M` O(8  pNVsBC% px1hs4˹k RC F W%U&vsBCdh F F ! \! X<1CC<1<1sZF(%x1hu F%(/K/Hmp@ǽ(Fo%( (K 'Hmp@mh81V !H!p@ܺ#FJ!<1E.C!C+C F,J", 0 H,NO3,1pNjjk EAN8FHN#x1h5!8@+j+I(F[mhC F<18@\kjCoF FsOrQ@!G0 Hm#0  h+F9FVF@H*F9FO0𽥱@")FxH*F9F! h`% xP h2F9FH1D1 FNk&k8-OFF gF`X! F 2"bFF SFIF h0 F32:C1C2X0#BE HIF I F #j+032:C1C2kPky7FhFEQ0-AF7U< 8,H AU2a CБ&FV !F #!@F1FFHh#hx1h0(#j+% F  FA eB+js33S<0"AFmhH 1Fokkk-AF FFF FI FA;H)F:I F9I F 030+[cj"! F FE0ѯh++H-C"A! FA.9#j+ "HP0۱foQhF)F2F FboBiF(F`@#j3 FgI F #j#" FI F~ FA HkkkjkyNl jl.FQ ;Fxbjl0 F@#lp+hF=03P=Cj4"!k<1 033S<ݱcj030; F0 HM"A! FF0HC Fp@w%FNF F@-OF-hFFO 8ĻEV(HFX(UE*#j+/W0 FI322F)F F033S<KFBF F _ Fe FEdh F E F 2F)F FlC-A FNcZG!(FW(,"0>I>H(< ((>(D9H)F(S(5J6I6H^@03H2JO1I.HM0M+x+#+p<12F;F FAFV#+p#JF%IH0#JF#I'H(!J"IH" FD!\1)FH1x JI H xv"!O0f^(mOjKllll_llOlX'JlolwlblllF F$I$H ", NAFH!81IH,T,dO3,1( I# H81Hx!FO%j/lmm4jFa!b#j3 Fe F@?-CFFF*xFF0#`O4jC JH7II Fd2S`h F$` FxJ`O2iF:F;H\!FFfO4#`8h(U8F;iF0F xIFFj# )Hcjkb> > ***> jF9F0F+j(F$2{`h`#c`x1Zh``"Z`#j%Fz`IFH F#"( F2+`h`z`mIm`O4mim "F+FAOq0JIKH#+`)h%HHOb5OzqF(F F@H)F7ѯh7+Яh +7H)FW# FpF(.H  x1h%oh 50F)F(*FO1 F=F2[`h x`FK"!5h-0FQxx Fx Fr`x1h`Zh``*Z`+j+#"(FhK:FOKmmm Im J)) FFIH0 F0ѯ,h7+ F@2"h +ЯhV+ Яh+н@HO_j/-AFFFFFFp- ٯ7#&I `%HAݿ%"B#j+ H ;F'>Em**F1F\0#jñ<#AF* 9FFH)F<#0F9FF H>PF**F1FA>Oq)mn)nF-OFhFIFF F8I"HF O弨I FH00A F!FBI FF(𰀞I F(e0C0 W&46DFE F (F(ۀFO EI$1FHF LF 0FN "4`9F@FKJLPAEO6h<1FCC<1#x1] "&(@x1p<1#C<1$&W+  F""F<PFDO  ;k( N(4(6($U(JJp( x( n(K J JZCS#$FF 0 3FSE۲E W#XF3("FAF B$D{ 0; 3FEܲE }W#XF3("FAFHF0<1#C<1O00կp#`  SCjаE T(FSF{!F8x1? : FEncnmntnnn iPnW)(F^  (P5RJC  P,B, !XF!XFBIȐ0Ex9W&x+j 6Eu(F;FxBFYFij8F> Fб"* c K Dc`> F*> FD8ǒp1pFFcHJF(p1tAt&p?J!?H kh+8I9Hp N(6Hg$p>02H M3hx1hll1+,HA"1FF>0 dh%H 0&Fl11F+""t#FF!^(C  "!,jDF IOr(F,0I H l1+?|vOvc%Ov}vvvKh*hQ`X`pG'J̀hpG-CF FFF0&K@G%J&H|#KOq JK@#BѮ#`O0hh 2Z`bh`+h#`\`h,`3e``#` #aU0hB$h*a tF(l`w OwwE0K@JH&KѮ#`O0h#hBhO2`hD`#U0Fw OwеFdF.`''`okg`<`lc4Fbw Pw0KO$qJH#eT0w P/w0K@!JH#T0w P:w pG pG0K@1JHdCd w PFw+K𵋰FF@#  0&K@Y1%J&H^'$DDkB 2FiF 0O0 kS$0;>+ٮ#`4Z R( CB(<$DDkB k"S$T04 Vw PZwX! FH *0 F I$ F"F#4B ?"a"FB(?b"FB0?#bc#es,7%h*h.hSHhЈBA5FBkhjS`kh`Ch;`(F c`l #UU0hXj k#V0p@pG2+Z`Bh` "a2+Z`Bh` b2+Z`Bh` bcO1F F@ ƹ-CFFhN'T0۹3h;3`Xh#l+alG^K@A^J^H\jh+ my Fh+h*A2cZ`jh`0G#+`ckk``ecb.oC"#KFmFU0Vp+8lKEҠl"IF^h l"h2hh?PhiH`Ph` i`P``"a Fsh``a3C #|HB#,U CF*FhlICF+5oLh+?iFh@B?\cm/W00˱XHBHBrHAqAa0G)=-?4'Jw PlwF HFIF hBc4 FF p-CF#O MFF43.OaCF2FAF iFF F M4((@- ICFH2FF4BF1F(F y$ X pR]pGM FFF3F*FOahhF8F .IjFF Fx` M)R]pG R]pG R`]pG R]pG RD]pG R]pG R(]pG Ru]pG R ]pGKpG XK0 pG X MObiFmF$CF (+|O#`O4 F MNI4t X%KpG X@L  w4Խ@ n X8FMOcH")F^j4O %%ծB")F O4~V#`O08 X p ?F F F h F@ ;F*0O0 I" 20I" *0O0 JF O31CO31 F@WpF FF!"hFx "hF+hIjF>Cн0C$ B I#(hjF0O0 $p iiCjFl3 P00 pG pGF>PEV#O5`(F-ٮ7#"F";F"=2ѝ0>#C0<#u F H4>  FF(є> *wh F dhhpGh F dh#DFB +:*#+ ,F$p FFB#/x+F" F( "1F(F(:!(FF(\"0oC !# "Zc;`O0p3p")F!Kh.F;#Z1 R4oC"# "0F.#!c3px.+i+oC"0#! "acO3cc O3c:+} w0 FF1$hd#`(Fe0$E ( F0i+dh-AhF FOh۱ah(FhSx+ai2 ich01i *F0F! '$hh(h#` iB@hx1hpGCj@hF"!hF "hF hI#jFC$i~-OٰF F#!Or OC F8H'8FY#0 Ft0іH8F  0[x+gF(_ 0D<1%JB(F0"HQF++ѹHQFS$$ # #(FI(d(FizsdD(F{0#P0lcd,b(FF#k`{h`d`5}`@x@w-AFF - i#\x!hD`#` FRzh* - -*FhF( "L052i%BD!DB,D#iBdhY#04 5!F1QR 3B۲ 5D#0 1ARQ2"bA2^#3"bA2 ##"B##22*0FF FF(H(FI0F H F 1h"(F1^:HH F 8F 3hFZ2`@#pP`F FF x+#;`+` /!FTF!" F # # "F;H!FO0 %)F (9F0Fr\H1F/#<-8h (`xLx]-GFFFFF3x"+ <"+@Ѐ?6@΀0x #; #0B%ӹ0E ##p1F GF(hѭ.7#`O0 (FEE1F F0 E,2F;\+@sxx+m+0+[b+ +{ n *Q" l l l l m l m l l l m#;PF.F, #, #, ##0(KhxY2 Ս0xY2 J050!,"6 6#0+FxF30 سBF0{"!,( ;FF?4 6 wXFxF2 + +pG+FpGPx; + +pG?FpG-OFF(F(BHO==!FP=IBF=HA(FO $pg(FFZF[{Ϲ(F @FF(С"HF]@$P#c``=!8FB:F)F8F(頻s@FFH8F @8F6F0FF8F ( #U4JF1F D0CDZp4LFPxtpFh% i#jBi% fjUjB `j # 3p, `5, `5-OF1;FFF+i  s           x; ' T       +Zm=Fq v   1     D N X d n    4'-?(FF{ *F!F([" 1]^(N7 Z' @# 0FuFh$+=h 4-#40C0 )-40HKhB !#*FFCFG #1HO0 g(!F#*F&A0#x+I F( F _#1@@-0"p)F450C#0*Fp#!EѐIH@!(.*юHE4T<"##D7#` 5 #D3! 5D34D Q Z KFBF9F D0C(?J44Tp40C#Cc0)lQI(F#l1I(F#l1I(Fй#l1yBy_yiy5yyy~zz)F8FBF(?dp H!Z)Fp0tR40C0I-41# 2BI(F>(4# 27I(F2(4 # 2,I(F((ФI(F" 4 H)F%40#040CS0m0*F #!^FFѐH 40 S#cC#040CS040#0׻40#c0ͻ40C30û-81?3vO:041F8FBFKFZ(0BF1FKF8FZ(Ӭ#P4S-81?3xO 04gAF08FJF3FZ(JFAF3F8FZ(PO:JF3FAF8FZu(p43FJFAFZ-==!(F4H03I "F(FF4O0p#0'0 :F/(D0#sC0I "(FF4p:F(?"I"(FF4p:FPz zzzz5z>zYzezrI"(FꐱI"(F`I"(F0I"(F([w4!'p")F8FFHO  :FF 0 #0 RFIF0 #0F0;F(? 4r m 8h2F9F(?cpJF)F[I"(F<(Bw4!p")FD :F!Q0?f0FF(?_ O(* %4 82F9F(?pBF)FztI"(F(rI"(F/?? "D##" F8FH 4+?cH9FbI "(F`H)F鹷0p)FR :ѹ *F(/!(F>O3 4"1\(?۩7 @#  'C` *F(Ʃ/!(FO3 4" 1\(? 7 @#  'C`w-j40?mX*Fp>Xb40CS0X40# C0LHǹ40C0?40#05zzzzzzzzzzz{40C 040# 02!R0##C0# 2",@@0OR!$KSP0#S0#T0KsV0Gs^0ٸ4#0Ҹ-ŀ81?ʨ2#4S470'(?~h+H)F-4$ M(F<$(H-<1 33S<԰H?" F(F  H0 S`40C30m#*F!( (Or(rcrH)Fa40CC0K40#C0A40#0740C0-40#0#40C042#C#Bb2# - qHQF40#C04{t#``-к$G4{t4{t4{tXHP-hUHH$ (4(FFPH)Fʿ?"p F (F Hd FH)FpF0(FF#;:!(FFб" +oA HF FH8 F1H0H=!(FF,I(F F08FFF0&H޿FF&"I(F F(E8FFVFF(8H¿I(F Fh8FFF(O6&{+P{T{{}{{{{|{]||2|;fI(F Fp8FF[FJFHwI(F qFp8FFvFF5FHbI(F \XFБH)F}O eI(F KFFI(F CFvUI(F ;FVI(F 3FI(F +FfI(F #(~I(F F{I(F FxI(F FuI(F F rI(F F@oI(F F6lI(F (FF& OfKBfH&v1@񃀸aH/~8FF#p[I(F F(r(FF(>c!h@1,"\f(@NH8F PKI(F FYHI(F FFfDI(F FGAI(F FF>I(F ~F& ;I(F vF&8I(F nFf5I(F fFVx2I(F ^F/H)F/Ѳ,H)FܽFV+hBkh+  ,5Eш|T|j|>F| 1@||P*#6{KTcN||FO %h#j"`,"3 36 @FFAFFF0F 0!ܪ >D`@(F;к~0`+-?H4P7#P740CC040#3040C#C 040##0-?(F@h2+~ H)F뼃hh2ڼ40C0м40##0Ƽ-?(F F(#;F{I(F8WHwI(F uI(FDeG.>pI0F0oI0F(~IC25$e40Cs0}40#c0s42#CBr2#g40CS0]-?P0# 0*F!CLHu4 G40C0=40#0340C@0)-??" F(F 4 H +>-H)F-??" F(F 4 H +>H)F-??" F(F 4 H +>ӫH)Fۻ `ǻ } }$}F}@}N}U}Z}d}k}}-OLFF &FOY 0@6n.81H [j+Ѻ HOBLD'BFj(F8OPy/}-OF FFF+H%K"`Q33S,S<J{NO81@FL:F2FKH"BF# ""J)FHFh"FV(Fm22!q @A @ 2 FF # innP'-AF F)4 1+X1+bx166+]1F"8F'   $ 0g47+Y0 }8g<7+Y8 s@gD7+Y@ iHgL7+YH _( [(FA V T 1Y6(F K& F1Y6(F =&"F0FiVF(Km T"0F,6y47;470F,6o<7;<70F,6eD7;D70F,6[L7;L7-O=FF I `F(HO 7O IU#CBbE##"-/#0O3`P7CP7iNN2[BUP+T (2&IXF.p+T ("F(';+IXF(и#T+٪R#`4Y  Q@,CA@+٪:#`7Y  Q@,CA@<OOOO3FRCFO4 F0@pG)F |r0pF FFbV?  I*F FCpFF F&B<K!J +*ѣBx*K!JHh6 1B q"Z,({z<FC{B"`)C+Y-O {FAFF,@LqpHBF(^3h<1Y@>;I:F F^0L08FIȐ(FI8FF I8FFI8FFI8FFI8FF`I8FF0I8Fz%+@X3h<1Zi FI3 [<[LJJ 0l+oJI+ FI F0耲l FI0P FI0׀rj FI0π0F|IF F0ĀP0soOr!Q0qI F0𭀖x0+@%3hHch0F (ѩV#`O0@((яBѩ"#|Qjx C   B)F+* FBDPHE٩p7# F#lO. 9D ;B@BE٩V#O [FFFD,B ",+F+##p-OF FFF  COJF'NKE&[ɱ.ة"7#`O0(  FU]>epF7(#թ#`,k.O#pcAFPFK(]ъ o)h 0@_h 0Ao7\-( h 0Ao)/- -%ѩ\-OKJ`,. F[猱.\ p >00`p0005p4\7q,.?w>[7h8FuYc w-C]FFF<F8uF%BF(FGP0RIJF(F0и )F= {0 (FGZ=h(FtI0,Srh#FE:F@AD(EqhE(eIE(F!P"F9F(FO ]"F9F(F[KCѩ$V#`O0WK@KE;FOa0ѬPI(F6$H<)F {l0 0(;x#A)F{`0шx1Fp@Ly"F1hF xiFlF(Fpy.x1hd#>0B*2F!F(mh !FEi!F(F((ѨF`B/#0 K@!J H!K@!J@ xCcO~-AFh FFԨ#`O0Fx+Ё)F#1x+x:D0А"! Fjh FcgAFhZ#h{x+ѻyoC@ghXkkgx``eȱ h89Fh0FL9FAFx+Ш#Ix`e(-AFxFvuE5|2E xAFHx29FD:xFF.8x2F!D|2 +D|2%O0𵯰FFF!!"8F"! "1F I @@= ,٨B7#`O4 F/ "F(F:i pG pG pG/J0FhQhz pFO00"%I" F3#OBOq#0IH#@"Oq#0IH #""!0 H"! (`0 IH0c8FQ(hC4(F#x18@8-AF>pưFB ШO6#`0FFOr!hF  "hFOC&:F1F@DBp0|+hjFIOsh> *F@Dh+hIjFOshiiF`LT  z( c,1 KOq J HKh++P@B O0cLOCjFlCXBXApGQ Fh scgD#Q00F F("!hFj")FhFjF I4B + ")F F{CXBXA 0 (i8pF"!(F>T k"!6"!FdI *p i:-OF<]%F1K@!JHF65D*"!F0O0 <]Cj%YFhJFF(F 9I  MDO O &cWO"z-C&FF"#Fb!#6"!@0bD0FC F/.F!F0FF(PF!$0 ѨJh +(F$O0,F.DBxB Ҩ6#`(FO0##DBӣh@/ "F8FWF H "IF@Fe.EHF^#D5Fc`𵑰Ni FF@"!hFV {b"hF1Fh-A0h00 "i 0 I@#jF8F-I@iih+|Fi" 0 F#0C |2""!x2^-Gm6FOb!FA  ("BШ#`O0x+x+ۀ+++w*٣i+"F0FQ0@ހnhV8O0+)*+؀hաxF(" $ h> :SF0x+!ij"8F "8FfI:Fn0нX0jj(FlBKx+++xKh0#Zx* [h#  0#Zx* [h# 5@"!d")F AX0;hCI&0wѨh+Шh1+;I;Hx)4"ci0Fy+Fz&*+;+ O1 !0F m*x5F(?H:(d(F\hF(F+x(?h@/"iK%iB"x+ޮ xFxByy(F D)b#Vx)i@icj KF#!3 F ct+  pG+#`$`4V#` F+ F#` F$`$V#`FF+I"O0pGc|-A%FF )FF"t! PF(7#``1I2HJ``0+F/J !<+I5<``0ѧh+`hB&IjF0 нP-ѽ0c H`hCF F$' " ^I`h 0I`h0AF FG(I`h0 an`( F.@@Bq(BlBp@Bfh-OFFFO#`eiU`hCF+Fh SFh3SsEF*Fh(`bi cDB.ؽBD*F h(:FQFF%hJFCQF0F`@5i]D%DciaB!hC`?HF #O9!jFIZ]Bgh-AFذF+)#L5FŔ x"hш4(O3jFO!8F,I#6"#`O0X4(O"O31F,#8F"cB0h%-O5P*P䍭 iFP @$#"@h 0! FF@hhr F@m!Fv0O0! Fm0I`h0O0 B~𵺱h!NDFBD#`@@CF5{;DFVű.اF#`  `(Fmx` hB٧4"#(F#;`BhhB9`3,1-OFF *ا#DKB ЧV#`O@F$F#F&F"FB  `+dAFFF˼Uмl QF, lBБ Eؼ4ѻxFE\DB!F#k(DFAFFDZF+2Fѧ#`cSc FFF0[8+x #pO0 FFF0E8+h #`O0 FFF0/8+h #`O0@mShYhm#e@!nK h nO3#f03F$ F@:8F0P33S< Ր>0+ D&0ke#hx1h"8:heB0YmkmBRh033S<Ք>0+ H8@ 2к_pF F OqF0`X+ha K0#h+0#pOppOr0 0cSc-OFŰFFȰFLF3 =H O0E 5HOsv: S<VOq F(d0 `ñ*/h( B " JBћh ћh`#+p(0> kpS+ *pH #@hOCk q"? Fp(Os+wcSc+ T0k`sjH $@.D,%DB/ /d9h0щhB C#0$00#)@1FCQ$p$DB/Ѓ<0k4,@6#p#q<0 0/@3+8##p#cpnKS BB 4(1x23B=#;( F x2(1x3DOs@@񛀘W0: 232B́<#; "1 F 12t 23D/0<1Ԙ0՘Z0 2*@"FP!cpFBF!;: 2F+r(k!L02BQ#`p#p] 2 Cpa#p#qmPF, /S`6p(p**(1Zp(> 0>! A}jF*@# FHHO0j)?dc]p# `FFi0/H.KBBA&BF!Ѧh+&Hi '8F ] i H"Fi(hBC!F(FJ H(h<1E[ 5# #F0P Fh0`H"FS oP)jdm8#YFHxhAF4F Fp*F!Fl#sU,FF-OɰFFRFZI8FF(l(hZF1FF(tХjO   PFF@MH'HFIOOrKFQFHF  6#2FIF(h[F 5 4#2F[FFU 0# p,0+DкD xܠQ @#.JOqXF,H &I;F*F@FD0ihHF(HIO¼$HI;F*FJ @F% FNh0tHI;F*F`@FVF NHt`dx@"-GF"M FFUb FO, ,62B$%B&F, ѽH V,XB3BѱFV ,Y,HtFHF5,6#T ,5T,HbF0F~d*-CFFئ<#`% FB1F y0 B O #DBҦ"#1F y0O0*O!FJFLDH ICFF0Fr0T HIF0Ff0lk*pFmئ#` $ xV+ѳ(ьhHIF(FB0.)F y0J3F@A0O0 mp I(F0#` y0>% 31]aS0[#h^ +D(8D 0-O F+Ph@`_0Ֆo0ZFIF(h#/FK ZFIF(hy##F(ЕK+Aئ:#`T0@$P0RZFIF(h#F(GC "E=(FRF(V; @ ; 869F(4$B66V<0h0  gHVSk@z 8FP5 F##d8p"$IF CF&#2FOq0 FO4 Fp"! F0OBOq F0# 0D# 0 +h" F 00FhFP<129033S<C.iCiii iBղ# Fhn0CF(f H F@2"K0IH@d jU-O&@Fh$ hdciciai#bhca#ifa8# IF(F =Z<$`jHRFZF1FFH?O3#cKd<1@񜀙I(Fd%!OEsC `jH(1FFHO3#cK@0 Kd#kZ `j 3H1FFH+؅H"1F##ckj :g{' {{zck#k:{{ z#h+;cn+8`jhB4єh00H#k1FFlHB iH:1Fg{' {{*zkB#k1F_H:{{* z`jH#k1FFSH^li+NДh Iaii iBBk+?#h+`5 h#F"1Fh0 $7S : h1FK21 r G1FF H F@sHC1FJJ w;8 PFHh# F3d8@J!. 98FP+h;+h#F J![hjGr FHI# F+`# Fd8@8 E/J! p PF1FHa1Fk*kH" hJ#!+`#F!#c Fd0p@32"b!2Hl 9J! FP`6h%# 3F F(C0H #h<1T,I Fd@6 F2F9FH#h<12  H@9F F!2F9F 32F9F(a F0K@!JH  #hf+` (ah F F#$ F@d !h0Ch0"2-CF` F hhiBrjBX0F(h3Y {̀GrIFF&H hiі@0 F)F" F$F!%#F"!3I Fd3N##C"#[ [C#h!I(F h"!K%ky e0Fh<12>#F!Phih" F# F+`# F 0iZ#+`i FQG FH F 0@K8F0P3 FFȹ HI Fd8@  (aH F8@ 288 PF H Flh0 FCh0#d8@ J! a-GFp7X<@hN#33C23 3FFѹHGj"K0ѱIH]81 23ѮI" .0(F0ѨH G?@ &qdh$fX6(FG8v2C(FGݽ33CH (F+h a+>i2F(F<hFHEXq1C!+@$#i(F1F#@0ci1F((FFPF`a(JhRF#i!ffah0Ch0(hh0KE@X<#k3(hiF(@ހ?? "k `rEvRH Nh#3cbGHS#cck Dcck Dc$0KE@0@,#h+p##`7dX<C (F80H G!Xl?v3C `jG F%H 0+fh+c0KEe`jG FH(F(h+F2F!cX<2C(Д@ *K(h !(FGbe jU0Ygk )cSc(hK+iHEX<F#3h+N(FG 8 0FP33S<Hh0Ch0# Fd8@H FI hiky@Ա"h±1 rdnDhB"I]Ki]KpGky-OF0PFFF# x+@jmKhBCF:F1F F'OE> **(#j+:7 cE85# 2F h;F0;#0 ?0"Fx;33FII e" ^"\" B2BG FHQ#Rh B30ՕH 'O+h+ѐI3F"Fx (+эI3F"Fx#O L pB:F h1F@}I3F"Fx VP3+ѹR60Y6#2F h;F20oI3F"Fx3FmI"F x21F h:F F@F eHf0Fb+h +#h<1_I Fb hi h!ZK*m+m##+e'[<+<##F 0B"1F:F h&06+7#3+[l#2F h;F@*h*@@ ѹ@O !2J **XFtXH IFCF:F)F Fidh-OF FFFB AI AH+F Oû-! F*F-bٔ@+\cz+YѴUEUO.OBK T(F½ *>2DB;ӽ D*7h1F F"0/T(½ 2h P"iP" ʃ !F)FXFXF. F HX !DkFHF e  p)`]F FmIH4h#`hBBiF FAF3hCH  I(F ]phiF(F7`.m,e,j/)-A"hhF AHuh- xhF *FAF H0+1h;*FAm+1h;*FAe9(-G!]O0 eFdO RFFZ`!RF` p $L "a`"Z`$`"E`IBFH0n "FC Hz !] dh`0FxeFj/ FFh F!8F@ |iE`iBh?(; F8,hx1h J O32CпO32#38 h*[h7FP50d000>3)S,&B"C,"* *S,BRB"C,SDBC,a C F0@;)B"BbO`z  F Hgjz R0;k hK*F!N0DzK m8FP#Fh!JVEh0+ h!8@8 m-GFMi@̱!h(cnB  gHF(F#(FdIcfd(F0F(ѳiZY)h˱ihBF0 FWH033S<w/(F+hN#3C bjhBєh#(Fffh013 *0r"#h ++(F(Fi033S<s;C(FK(&Cici a'cia+?}kj$'O F/'BD  Bbi0i2Fx)њ2@*٤ #`7/ K!(hdl(FzIYx1 Dpqoky pGB F*pF٤#`O0p&F`!=dB*F"@rBU0F( @CO `@@O o pGO@pGHpGXhHh hBhhBhJIpGh@Bhx1h F" F(dhx1h F h[h hhb@h"Bhx1h F h[h hib@h"BhHh0+@n8 pG pG@ 2O0 ciPiӱ(Дhh *ñ( J0B O0( *XBXAFcScx1-ChF  4#jpbj ѐIa*F)F0FaF(@܀dh;h+їh0+{n3KOqJH(Ia{nh FF znoCg2@{nh#)F90>"F00ab("FO 00aTF-Scj%00 F{F(#kfyn81`ynX1Z)F FF"Fa F(?b)Fa`oynXxXCXg5)F0FaB1(FN8( hF(?f")F!F@FAF|)F"00aF!FY0Dkx+ (F8 HFFF0FaFxBIF8F'8< $B")F+  ЙB"9FX$eShBC,HF<" F>HS FF(?Co<CCgiFO3iF8# Fdg11X|"!0FaJFHAF0FaAFEE9F0F "!a4F(9FavYȀ?{0`j3S,ՑhBC,HF<"8 FH#cVqIpF0+K@!*J+HAi )H 1)F CFѣh1+Уh+Уh+ Уh+iiJH 1ki hܱhhB#hhhBaiPah{Y`bh F`5knB#h0kf0FpQ`Fvec)8F@L XF Hp F8#0ep-GFFFFF8?HZ$ F10 hHh;hhB!` F"9F(FF(L4 F(;hEa`#a#a 0`0#a8h E!J!F}PFtkjKMFE+FRF9FH!F 0ѣ h+ IHi Fi#i##`shc``t`e~~F@ai9032 SPORBBДh0;`n(h!l(Fv&0F(h!$"gn1FBرhjBijB  #HE1F"(F-FH k(1F(F#k, (h+п0"Xfh ?hcjBF8Fx#!h0ff(hl#h+ѡl(F(h 0 hpGiBa-O FFFFJx06#`qF(F&#"AF8F-F-(2hhB!*YQ`ch`3h+JѹK0#ai#a0;3!F(FYF- FOƻ4 F(HOʻ Ga`2h`"a` B``3h`E J!F0h hBѰe0-GFh O Աi'h.hx! RF4CF0F=Hu 0 ##`  !@F^萹`hCh;C`+ڑf (0hZ`x +-IhFtZ(-&1F(&IhFtN$I,hFtH( "u(x+0B+K"F47Gtx,(  pC+"BJ" ` (* F pC+'K'N8v'KK[h;"FFg(HH( 'K'R8F<K8G'K 8%L`h%`4e`8'KF  "F! 2K87F ,H'K'R88+FO*` Ȅ ,`8 F !F" K87F ,H'K'R8-OFFFFȿ`O̿OO8m0@F4`hBh [(QF(LE!FIFB LEE$0O8U B0 pG pGpGpG pG pG-CFPOF(FF;hCzhHF u0 #;`  !HFxhCh;C`+ڑ (0hZ`x +0"! F7IhFt `-&1Fd(1IhFt/I``hFt( "t(x+Ѡ`E$IhFt( "t~(x+`hFIta(IhFt(IhFt(IhFta( IhFt b(?y IhFt`b(?q:!(j q'RPvr#L`h#`un IHZ``8 'RPy K[h L"OcFF0,80( 'RP'RF KFFF[h["+FFFg H %`(  `'RPFK8D'RP 8%L`h%`ze`8'RP-AF FFF #F*F! gK84F P @'RPJOc0] 'R-AF FFFD #F)F" gK84F P @'RPJOc0] 'R8@P@@@ @@0pG-A4F N# u(F !'F09+F% +O8F 6hhpGHiSipGpG-O FFAFG@?F@D&WKOz hZhFAFDjCA9FCD QӢB ӴOغ_=#cC ?XFiFFF'VFFFF`9FF B0FX1FF :(FP)FF 2 FH!F@F O30F FA Cc"BFܱB)F0Ѣ@"h_KhKIGKz #F0 \RČ'V-AFNh3б3i( &3iwi@FB8GD8FB` TF0 i"FD$!FF(D'V8? M$?i*j#DBiDa8 F( 'V𵉰FM$0+DLEKEH&hFFG&hAKCJCIDHGDO& CK%*;FAOBJ(z):F@OAI&h(9F?HG#h* >N>K)*3FK JF HGK$hHFFG 'V \ĿR>ĮĬ66ļ ĺĸĶijİ$3DRWiFizHjOiC(D#@S@a j30B P#@JjOi*DC "@b@E! +a3-OIMD+lD(#XC00F(tCI0_.h$4 FO ,@kBO( O k ( B%O( O D+l ( DB/@FHF-II_ 1F04 ( F 4"I_k+k 01F4F30F 4I_sik 0F"D4@1FjF Kh K IFG+z kl'Vee \vp$NjulB(hpU$0PE$4'VK[lhpG'V-GmLHP-@z"#!O #,#3`3FUM0#bH(3a `O3dHObC#T??+@  Ѣt$0qHmM!'h2@geB`F`c@clc#c:"dZe@Yjh#e@iY!a#af"fca1)B!f2f@c`'0C#SH "1F3`PI&PH_ zLIg`KH_ 8j`nF`d(@ mAH_NF (?{#0u'm/sA9* &,7AJlx~"(.=CRtz##rK##&0E##%0?#lkh2B8;k`4kh+?13#$0*#h+%;`!lh:B3h+;`'V \ś me'V'WŬlh:B3#'0##(0##)0##*0#3p#sp K2F IGj1F(`(?>#H0 9żKH0p pG'VK h pG'VF2LFoB40B0 t0BѪBpBj0BhBр`"1F(F'BF(`ciaH_ciD1F(F0Ѣ@"iFh^KhKjFIG#z ciBF(ci`aH@'V'W \RČ-GF9OFF=il @#i@"#aO3D  0 0&0"(nB 030Da`{nBO jHiDaVaciiB !F@F_i!F@Fca_iB#ia{h!F0_&0K,yi!,@yi FG'V0$BKlD0v44'VKpiB lC@.j& DBЛ@ DhXipi@l_xi'VJpil  @@@"iuBeO4 D0Da bTiDap2'V-AF_O:iB lh@% DB{Х@Dh!BFZ! F2{j2Ѹ%FKD00@*iC !P+a@i Caki3kaiB-:hB##;`i)F0FAO1K#/03 ,KO0CCX AFY+8)F_+9hB=`BKi+8_f8)FAP@*FZ!*F!Fl_FFl_t%0#"iZ!h0@#`'Ve-AFki+;!F(F9ji:jaF+fЖ%)oBF!FVF\ #B7J Ӱm;hD!(D(#t04Fh F*kO4DD< "FHF_F(FHF_%`i8FF`#O0!jBi3 O1!E# #+aika3B `#FiD!AFF* *BF'V \O;iC 4FH FUF80`3`%(F1Fl_t%)"F!(F*0+"F'VKF[hBh!F@@'VFNH(0+%(FF)@LKhKIFG$ #`'0C H "#5 Fp'V \m-O FF(@8N-ؖ)0+KhKIFG/(0+@ 'DkBGEȀ4hE٥B shE AFF~ѵi%" B,##𤀫EqhKBxl%!FFF(1i < l Ѫ@3E cBD@HF3ZK%*F!2C66   * E  "HFGK HFl$F3*0+*FPF$9K'0K;H "#7 F tiE(F_3iEK(DDFH FF0P+`K)0KhK IF 9 Ѥ  D )FH_% BF_*0+?BFF$FF $'V \ mY'V𵅰FFj/N(U=FeCі(0,8/6Ж)@,I(KhR'K'IFGDo+9F(FBshB)F^F(*F!'0CH "#5 F%(FF(Ж%)oB0B*F%N #`'V \Ǝm-OF4 F(0\%'0C "H t(F $/ր8F0BF_\ B0ҐB F6 (0FO3*Z (O33BI!FF(𦀴B"F9F8F 40BؐBӘBVKXhbs"#@@B #B*0 B=F!$PBo cBS@  ј%0+дB28Z!7 )|0B0B!  J2H^FF/H_`0q" 8FSFCF&HIF^ FF@0B?~2F~ IFH^%0[B Ҫ(Z!-! *0+дB٢!`)Pu Kh K IFGH FF0 #`m \'Vƻ'VF K'0CH "#3, F@4'VmڹpGpGpGHpG \HpG \K0h3pG wK0h3pG wK0h3ppG wK0h3pG wK0h3pG wK0h3pG wK0h3pG wK0h3`pG wK0h3 pG wK0h3@pG wK0h3pG wK0h3ppG w9 x` x pGFpGp pGp pGpGpGpGpGF BpG\*0 pG-AFFF$;F"DB FF h T !0B"pKhpG tyhF;+`ڌiB (]K h\ `p]KpGipFN$V4(F  Fp4 , gDK +K[hG pGgDF0 S pG0pG(h9!HBpGXK0h30o O0 pG w@FFR;BpGFpG#BQ#@@#@3K0h3pG wK0h3pG w7Fx M K*F~h(I+F"FH0L%F- p(9 xH+ pG pGHpG ] KJ3(FFpGL;+A,A 3۲, 2ҲBГBO0 B+F-OhF:VF,FF:V1OgK@ --+hC@`.@TMF;F$s4,Of@ 1F_-F`"`=F`3J=+hCV`.TF&"!hF8 ihB \( I"ZBFA "FiFPF&DD-A&K ` E.-$`O0"KFXhB+6`3.-$++$07bl8FJE(JFvfl{$`/?yEvd #`.i`#^CYak|8tXKhBKhS HpGO w KhBKhS HpG' ipGpG pG F H I FqH"h IFHI s@HU p&R]pG R]pGFF R]pGFFpG pGpGR]R]R]pGF|pGpG pG pGpGpG(FpG FFCBР#` I)F`J!Fh 'EhFhBӹh "` J"x46@d(T`x10: ( w'W$FqFbT[ FxCOHчB0BO"PӳOгOJT[O+Bڳ OhEO8Oг@OBF F FB<%xE%hxCOгOгO40COгOس@_аس_г _O0#hF00[]h;iP!0xCC@! pGh`K3pG'W$8FCi FB "iQ(F( F !F8 hpFFFS2Bңi5C"iYaB#Pp3#S(K}F{i"OQ;a#jjBbj2b2BFx^*3"`OQ#jjBbZj2ZbFhFi i$HP&`S/B2`jB2bBѢikR:D#iQUiFFAi)DlXi#i,i+Da8FF FFFhi.ݶ##/ݷ!! D+>n{9Fa2+FROA F;F" FiOA FR2i)F FR"OA F&i" F9"OA F@V+FrOA F?ZiOA FR i)F FR"OA Fi" F9"OA Fi2F F`&Fz2OAR+F F+iOAR)F FL>?Fe)F FD>F^ F!@F(N FF3h+#OsB3#@\ CTkCK52hh*"Or30B#@b\CcTK2hh*"Or30B#@b\CcTj"j1Q 8F !@[jbZb P t w w-AF`2FBSBLB Tx], O ,0xF+`!(F+ "F1F@F8@FB8y7! ],1BFZB "`xh #`KZc`x[)Yx.)3`2Bӣh #`K3YBx.*Zx]*3#`'W$JKh20')`) pG pG w-AFZSBF FSA'0ip0iF FG2BҔtu(J)8YB;x\*GZx|*D0iF FGhKiBѣh #`t0+ZДu!bh#hpB5 bE1ٓ\,ѓ|'31#`x|*xBoiF FG3)YBxB[xBBғ|3Q)ѝɱB! F6+  FiR"iOA FDc Fi DOA3OAi F*i FSRi"OA F3@'W$pFN$V4)F4 p , |8)KS<GFpG|8F)K Fh+#OsB%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6 t w w-OFhBh'kB"I(FXFPOA F#h3#`"I(FFFO A#j@"hh1P( ! FOD#j@"h`i`!(Fv#jiD#c2Bx^)3!B#`c x]*3)F F#`t-*nNB x]*HB@-*@Kx]+@ `)F FW2B@h+\K3=1!`Bأh #`1Ff x-+]+ѣh #`1Ff FcEFҙ 320 ԩ ! F2Bȁh #`fh #`f#`JF~   O F(F FQF)F F  0+#OsBij"(j1P !kj(bZjb 1!`Bأh #`1Ff x-+]+ѣh #`f=! F)FF F2BJh #`fh+#)0'W$ t wx-*@*ZB@&Yx])""`-( F FEKh*7Eݢh "`fh*"OrJEEZF)F F  UK3#`E߮ik"(k1P, !kk(c #3kcQFHF(ݣh #`yK3O YFHF( QFXF()F F  ѣZ"`x]+h+Qk;#jiBkxCkp|OFF0+"OrE5.j+ckk+`kj+]k+Zѫjp{U9F F#jjg)(k%@>(j!7D@"!(FB "jh;`#`i+#OsE O\ AkX@PkQF(Fñs(6WF6.K  (Fh3c(*K(Fh3Z#jO@Q FhOA-* ! F[*Jx:*?"=*? F1BFҮJF)F F[YBx=*Zx]* YB:x:*6Zx]*23#` t'W$ w wj FpFi(KI h1!I h10Be F#`]#0#0 c` =e pIOQ F p@Ź w w wh-A^`Fxi\-[-zChBӃh #`Nf`s#`2x@)BuB@&!O*-.-MУh+@#hՠo( FL}-ܵ"ڵXt<+|Т0O`Q F2FiXXt, F12FOA F[#j"Zd""OA FK@{B ! F(ji;` C`_Kh0BF*)H"`;FiOA F2jiOA FiOA F2;FZiOA F O Q"O Ah #`=K3! F i+?Wh #`5K3N!B\\)ZZx{*W3 F#`1BF0x,*-Z"`B+(J[xh320Z# FBFݢh "`J"*F9F F<2B"YBx\) Yx})3#`+FOs#`B3B\)x}) ! Fj~h+ #`$XBXAt'W$^ ] wڮ"jOA Fl^d .2Fb^2B YBx\*[x)+)"\! Ff .OA Fid2F?2B>YB:x\*6Zx)*23#`h^`Fxi?) ء$ڲ * +#^)׀ [) \) h+ {)|)!ChBӃh #`K3"jOA Fl^d .2Fb2Bx)+o)! F .OA Fid2F2Bӣh+~ЈK3Z"`x)+ 2Bx*.?){)^B |NZx6hW6`v,*Уh #`tKc`3#`0h #`oK3?)ހi*)+FOA F@iOA FRkiOA+F2 FRiOAR F[1BXx*(?*{*NZBJPJ[xh320[A ! F;#`}! F"OQ-#j jBbZj2Zbs"OQ#jjBbj2bd !ji Gh` C`1KlgPO Q FJaGChBӃh #`$Nf`s#`1x<) >) РoX F/"OA"O A!iOARpi+FOA F2RiOA FRi)F FR"OA Fi" F9"OAJ'W$ w^ ] F2BF(x,*%Z"`J[xh320Z FBFݢh "`I2F)F F2B x})3#`3FOs#`BF x3}) ! FAh+ #` w'W$+-OFFFN ІhBGvL F KB #FF&!V%0$ F)FP" 7D(u0O&a H)FI+FH%KuPO5"" " R""tpOahF!+Da`#B #~K32BJ"OahF"KaaaO``@ #qK3c`@chIFMFF OF0XFPkxB@_->ز_!زo𖀲_kB)GFc#k!cO1ZhFx*F)FhF_tв _kB@)c#kGF D)F#c)1OزOزOуFOOвOOI;زOFXF&xFhxBO7вO4вO#jC#bk-@怹@!@"`c(r!(FF({Ѡc`k(΀#cc0O pF OвOnkB+)GFc#k!c[)F#co$kEO3#c8Oв@OUUT E 9 I 9'W$-F5F{))DGF!c%s))D_hCbcW+xF_+B%u#CUAFrC_Bjk@!0;|!(Fc0F#zk;9FBA?3+F*F<WB9`:`B2V# B+ "F,0Bj \E;bFP#B@#@# V#09h3EGGB7ӝB0F*@ehFF5UxAO.бO-бo#jC#bME##`#ld @0Oe#0#j[ #K3PFP(BV" k+?3B8F; * 'W$F)K Fh+#OsB%K"jh$KhBak#B&&cjB/Ӡk\k+AX@jk30o30pB60BѠk@ B2"k2# Bܰ B3#j(F3(6 t w w8FK Fh+) \k AX@8k˱ K4(Fh3(K(Fh3y8 8@q t w w-OF- F첑FFLBءE@HF2hShS'PxAO`Bر _ر_Ӏ_〱_ OVO𲁱O𴁱`_uH@_𘀱O𒀱O JF!F0FSF(q%xED0O,ر O‱(O}бOsiBZ"xS10 _*O3iBshXhBF,S10+=_*J:8O}б@O3iB"xS10 _*5_,9a  +a*ѝШb~ w-OFFFFB0F;hO YhQ% xCOгO]гO FOrس@_Qس_г _|4F&FUF"xHOD JFO +F1F8F9JFSFFF8F.E[b#xCDQ(0xBO JFO+F1F8FJFSFFF8F EbbFOJFO +F1F8FJFSFFF8FE*bOiгOгOѹh"xBh PS`t5"F1F8F+F(?v+F"F1FkF%"F1F8FBF2FYF8F(WF:hk=ORhR "xBD"F1F8FXB:hiRhR!P%xE DR% xBO=h"xBh-OF- F첑FFLBءE@HF2hShS'PxAO`Bر _ر_Ӏ_〱_ OVO𲁱O𴁱`_uH@_𘀱O𒀱O JF!F0FSF(q%xED0O,ر O‱(O}бOsiBZ"xS10 _*O3iBshXhBF,S10+=_*J:8O}б@O3iB"xS10 _*5Fi+kh  h  EJj)bk*8k?_DEw;xR#0+e=   BZљB! @(!DD#DF7#k+E8F' RFYF(瀸cl+? ' RFF(83HFF |D [\#0R B,?qEO[FSEF8x3 xBkB8F  (ѺE~2Fzcl+B H l0 (?N 0l#B\ blcC\ ZFعFYEh 2 F([Fw (и?{ ¸OqOr#?h $@E( 6  =F(EL3lX#3 ZFu+0y( >F'& &&pGpG pG ~ pGpG pGpG8#MF`+x %`8Oq(FX( 'W07FM+xD 0(%`'W0Fhx[z@(/! F8  # ``pG!` ```pG# ````pG pG pG pG pGF0JP!H~lHH 'X0 (  pG pG$P0/ 2#0/O-,M@PPpT`X0$p`T0*$0S$00e 0Z 0000\00 00S Q^A 3 # Z20# TP@PY*   T0 B2@TPT00#03R0S0 YR00J 0S1\0S# 0, Q 0S Y0Sr 00C 0100R 0!03S  [;[ 00,Ѝ P0030#P 0#S 0 RS#0 S  S0#3RQ  PR# 0 B0 0Y00S  000C 0S00 0S  AX 00S 00J 0S 0 SEH S0" 0{0 C R9SB0 S H$0 0CR20% L oV1000S 0!03S 00C 0t0 S 0 0T P  $@$0S$0C[0SW  00,Ѝ 00R3ZB\\00S SC @PTP>: 0; , $ V10e }p |@-QM@00(,4`  P"U `A0``o0# "0S o.,^U-00ĵЍpFW`&,- M zЍې@-QM@00(,  P"U` `A0``o0# "0S o.,^UU-00ĵЍpFW`&,G-M0p`@0W PV P%Y P.X PmZ PNx P4 PAZWf  :Z 5ZV+  .Z )ZY  "Zt ZX5Z! L Z<  ZЍYXZ-  Y Y  Y YЍ Y YZVY  PЍG z` zL z< z z y y y y yT yd y y< x xO-PQ Ml00R` 000 p`0 g@P @0S nSc a0CS0  jPL jPF  ЍiPzZ V000U000iPLZ V070U070@iPZ| V000U000iPZ V000U000ZW V080U0800oS iPU000V000~0@DiP 0iP iPiZL V080U080]|iP~ viP piPSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000&iPZw ZpiP XiP  x w w wl wL w v v< v4 u v u u\ u t$ tT tTA-`M_NP 0@H@>S JM+;  8"` `P!0 P3 P0 Xp+ 0p mp@ mp@  Ep@@@dm mmm 0P2mP`Ѝm00@xŸO-1MM @PD 0"$D"Ġ "( ,p C.F D`pX5;@D8 (@x0Sm pıp `  ᬱ00$ %0!`t0p@ !0x ]P[P 0S R=m001ݍЍ6m0S 0K0S R Pp 08D<4! @P 0 00Z  0-0h,R gH"1ݍЍ%p s$ r r r r q0@-M 0P Np Pp@ P & Ѝ00 0Ѝ0@A-@@0s- PP0P0 %p` ``u0`0lppjX`p l``^0`0l 00p@-@PCM1 /e\P3 @@1pPA ` $@~l009t2 7 @0F F 0 P@@ a0S VS00 SCލp|@@0S6l@0P`0` @0 u P@1:Jl?00@Dl00 @ n$ n,p@-MQM@P4SZ TE /\PB QP0s* ;gPDQa0P `%pP @0@ apqG D Mp@ ۍЍp-0si/%@@00p! +Vk@P0 @0  P@1:k?00@p 04k0#S3p@ k00k@k@ĠDX, PpÀ ld ll@-sP`O-$(pX,1R`P@.Wz00Sg [0 0 PQ:%"K Y2$> 4"0x""2"2BS"2"2@0*sW00Sd [0 0O Q :!; B@T"#.P@P@Pt00{ Qu w{a O Q :%"; Y# [0 0OQ:u' 00{S( w{T n 0OQ: %": B@T#P@P@P[0 0wO Q :Kz'Pw{ 0gOQv: )JP- -MR= =O0j2 T$> Pw{M HO Q W:5# B""""BR"2"2@0K"20S$. 0 0P@a= =MS= =O0M8 """""""@-DM@ ;P- j jBp 0d0?`000T0?P00<0?800D0?@00L0?H0?X0\ 00 0i,00,0eL0P dSl0 F&00FFF 0L ` G(00(0CA$0SW"x7F00200- V ( F!0 " !0 0S(0S/ @2/0 S '*c0 0,d_\H040"0000),"L8 !Ό, #:<E06\S00R 0Ϡ">! 0# 0c 2<0S400<0 00,S4 8 0#"0 0"!/C1 ͌ 0 0, ^<00S4  #$02t rt p p 0  SB  0 & F% F SQ#!F SQF# &}$0S00(0,000<P  =RH0LL^X\ P,0h@000D0^ 0YW$0Sm"xN(0S  R $ RC 'Q !:6\HS Q00P$0/! > 0E<4 L , 0<0$2#0 0D 80@00,!ςC!, \0 R0.*,&R 0 04.>Â0!2c,0\<8,"΃0,!/#148448 000S,  %7 ^008(ج$רրT 2/00 S *Q00 <S$0 h0000c0,])L80E(\/H^0402,!><000#:6S00P0 >!00  0C0R  CQI $0h0  ) 0d^  Q 8 ,   Q0 0  0 0  R(`0,0dPT0  P0  R000 00SPT8< 2 00/, S *$(\0<Q040 =S4%0 @Dh000c0&], E42!><000\H8) 0L#:6^S00R0">! 0# 0%!E!2c 8Q, \?H/)L0 0 ́/0,0S400#0S >!, 00 4  .1@0HL  h00 000, C00 00S \< 0 h0 CQ0 D00@ h0 C0000S \ 00$0h0+;  +; cqp;0 = =MS= =O0 O-M@p4bk`00b0T0 W( <000/L 05PP   0P@v>P 0d0?`000T0?P0 00p4 <0?800:K<[01:0+2;4 04`000  000V :0x0PO 0TP dP@ PA 4`P0S R~ R z R v 0 0H 0S0`d@?@$ #@TET0}N0`d@00&b0v^D PEDpl@ C 0'0@`PVv x0S apt000@H0D@0 x0@0DP 6 ?O 2 0SYl  0!" 0#/!!  . /J㩐 B 0S!0(0S00#0S>0 Av.@ B Q P S000S Q0\a00tyq  0Apq ` VP@0 ?oR20S;a00 ߍ 02a0x0 0 {q@< Q"000X@0NS- x0 P0,P]000 p0  ZR 0pS 00@ `0 0x`-`0S 0 0W0ZS0  `xd ?TxP0  ?<x80 ?Dx@0 ?LxH04p\XVZP Op`T00`0S(@T`0S@ 1)P L@(㏂@"bX02':"  @b"R0 \TP'hLPP00& @ @ ߍdT0/ 0%)$B@C "!!b0C0/,Y0U @p0'"0 S;A^ <0 Fhpq6  @8@+^`#00`0Sp @*x00@ pW@' W!Wʬ 0_ 0 Q  sP_T00_0S_ @0'"_00S< 0 "2#@Tÿ_T00 ,,p@-@ aBp30-T[L00P 0 0R/P/ / > >  DP 0 H Sp@-`P P 0@ #  TQp Pp / >@ >4H  P/j.0 0# /P/ x000@-PP Lo>O@ 0" P0 0A-@P @`pP0% P @PPA-`X@@P jNpP0& P @PPA-`X@@DP H@pP0& P @PPtO- M` ;pP8 찟`萟 PP P oN & P @P0S  Ѝz ,/@ W 1X D0p0S 7A-PpQ `@Q ^P@D 0DB(000S  Ì@- M`ppPP( e^  00S@ Z^0"S" 0p000S0 7/ ЍF^0"S1Ds\0pT000S @ Ѝ1Ds$ ( Dd C@-@ @O-MP@pU  PP2SsPR pPV (P` A P@ FP) 0nS: P= MP p00Q Q P  IPB"0 qS 000P Ѝt0 0 0S Ѝ0oSP  , 3\O-BMM@p], 0 0OP:fMPP  OPp00WP C `KP@@% 0PPYp 0P0  0PPKp H@P$ 4z40D0 0 dQ`k`V`pP  bpw 0 UXP @PP0 PpN |ZP  P ] 00BލЍP/U ` P p;]0SM  GP G0H 00PPp<  G\t 0 0GPT! 0 0 0\0 0 0G0P`\  0 00xZ00)\ 0 0tGP\ P0 0iGw\X 0 0_GPm A A  @l ?8 ? ?0 > > > > > =-M 0  ZPЍ -M 0  DPЍ >-M  0  .PЍ ?-M00 0 3GPЍ <-->( 0P    0/ 00 p@-PFU@p \,0,? 0`0  6/p < p@-PFU@p[,0,? 0`0  6/p\ ;@-M@P 0003/ ;@-@P 0003/ ;p@-P+U?o@20Sp0 003/l ;Pp@-P`UV00P00@Sp  0P5/ ;p@-PU?o@20Sp0 003/ :p@-P`@Ppu[(0( 0@p@/\ :p@-P@P p 0 003/p :p-@- M  rp@(0$003/ Ѝ@ Ѝ/ :0@- rp@0003/d 9G-`-P@ M 0 0O0Sp Ѝ[40 ,0P@:/ 9`G-`-P@ M 0 00Sp ЍZ40 ,0P@:/ 910!Ph /////x/p/h/`/X/P/H/@/8/0/(/ ///////////////////D 9 8 9 9` 9 8 9 9| 9h 9 9D 94 9 9 8 8 8 9 8 8 8| 8h 8T 8@ 8, 8 8 7 7 7 7 7 7 88 @-@$ MP05A05#05!0%0%WP$00$0Ѝ R/,0p@-S@p(P$ARp$0S* >$0( 0C\ 0 C$ R*0#$00S$0 537 $05, 00 $0(0!PpO-DM0fYp0  0 R 0 a  Q R Ro:#5B$0P$0 @Y Q< `@@ QQ3 Q0 S0A1@ 8,0Q i S40 5,37,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P q S 5>37 ,05 5Q0,0h 0 CQ * 0C,Q*0#  ,0 0,0S 537,05 50,0S 57,05 50,0SZR0#0C RM00C Gx:#5B$0pS 5<37,058`0,0= Af[/o" R  :AF[oP f[ 0@AA \QY 00,0S 5#37 5,050,0 QS 57,05 50,0S R0#0C R00CP,@DЍQi p`0 FQ)Q* AR  bQZ fQ ?R0@SP  bp@S: B77r C#, 0c0#p80 S ,0 S40 5,37 5,050,0FQ0 00,S Q 5070,5  ,0 5SQ@f05= 3 7 0,5 ,J_`0OuOP  Ѝ@Ѝ/O-`Pq,Mp;  RP$ (Ppp @P$PX P@ @ 0 P X N ,Ѝ000:Q!0P00,Ѝ8p@-(M0P `& (Ѝp0 0 ֈ,p@-@`PNpp p@808 0p@-(M0P `& (Ѝp8,Hp@-P@0 @  0`Npp p@n,0@-,MP@Np  {&8 ^,Ѝ0Xp@-PP0 (M@ 0`Np  c& F(ЍpP,C-PP@,M@/ `  p`FV`R V `@0@ [T MNA ,Ѝ00 0:200,Ѝ8p@-(M0P `& (Ѝp0 0 ,p@-@`PNpp p@808 0p@-(M0P `% (Ѝpt,Hp@-P@0 @  0`Mpp p@z$,0@-,MP@Mp  %8 j,Ѝ0Xp@-PP0 (M@ 0`Mp  % R(ЍpҌ, P $ Q80 8@-M80@08 Ѝ880/LL0000 0<R 80880Ѝ/,hP/p@-@0@00S 000 Xl t PP `00B/L00p@GP,X, h XO-@PM3 00 P9E `B7 ?O0U0PSppp0 0CW Y 1AUU V00- Y^ 1AUU1 0`Fs R30< ppp0 0C6 U 0U4 [ 2 0000i`K M 0Rs L 0 0 B0SH Lu0a Ѝ V00 0{ `L 0 p0pHX20S) 0 Bb P 0 B`FZ  BLuZ 0 BK  BL 0 A Ld 0 40S B 0+ 0 &wЍ0S \EPE U_* 0 jL!Є 0 0 0̬,p@-@PWLpp p@0RS00 /H0H0p@-@  @P:Lpp p@<,40 Q00 0R00 /,p@-`@PLpT T   p@php@-P X @ 00`KpTT  p@p@,O-P!M o 1D`00 S,0H?@@Q^ L  10$+10[CPp `u,  PPDEQ|0Bp5 q@[0 S8 0?# R R!R@[u`  ,0 0 L00NC1000P,0@Ѝ i0 00z,D0D 0@-00 @T F͌(Y P6>C͌ X PT>JB͌81S P$ >̌[ P=^B͌ 0`3@@@ 0S7800PH0`@P@P @P@Pp@pP@P@P@P(@P@PP@(P@Px@PP( @Q80 <0x100C00S000C(0h0P 0@pDP@ 0ApP? ,  ` 0Z`! 0j1 W40 0 0 0 ` V  ,0 `(V,0Z 0 ``dqYh  0 [ Piߍ, 0!`0 1S ,00 0 ఑1S D 0|0 0?p00(,P࠳0A Q Q(`80 0@$4 [$  B `R6     @T  @T,0[  @,匠$ Z!@p,0P p W  `,0R4 @80\ 00 0 0R-@pP@ 1L0%0PPX1P PP00P0001T00P1 X000`P`(, A$48`@@D 0P0A 0HZMH0Uj0 @, P  X 0h1T1 P0 ` 0V0p00 `&V0X,00 P `ܰA[@` @PP ` V @ T 0PZPD0U |Z 0$4,8`@@U 0 (P!  AA8@@$,4 Y-Tp0 p,`0 @@DH \V 0f1`Z1 @0 p P0U000 PU0V ,00 @ P尡XP 0@P P U `Z@@ DH @\p>\ ``,   , HH0X p0尡D0| 0 r>p[`p 00  0 ^ p 0 p`  0V  0` P  0U ` 0 P   0Z0^ύ P   0[0Jύ P   0X0̍ P   0Y0q΍ Pp   0W0( 0 $ B4U,8`@@ p`0, `$@  ,P0UH@少FʗD|=pTpYP$, `48@UpD0 0 0Rz 0St 0 P,00 8UK e 0PSa 0L000 @T @rT0 ,000 @(0P$ ` pC,U48@0 @,0@10 ,P0U 0H !Aʓ D  |G=p0 0Q1B?pPp@`P P @T  `Pp0(0S](0 00C00,Pp` V% 000 B!0 SB  0 T00 @T P@T0 ,P000 @0,,0Q0@ 0@1.0`` PPp@GP @T  p` P`p0SK 00  P,01U e!0PS:  P0 0 0 @ T @T0 ,00 0 @T!0R1VP@P0Px @U  0P0 0$4,8`@@0`$@(0 SX(0 @00C00, [$ 0 0 B 0!0@SC  0 X 0 0< P U  PCU0,00 0 P0|,0Q0P Pa}@0P  T  0 @5 0 0R}080000Sx$ `,48@f@dO-`YMq0tcSA P T3? 00K͌0 0u0S3?HPK͌0H0v0S2?p`F͌(0p0t0S{t2?@F͌(00w0So(2?pC͌ 00y0Sc1耍?B͌8 00{0SW1? ̌ 011s0SK1?81NB͌ 0810 @Yߍ 00u0Sl HPv0Sw p`t0S @w0S py0S 耍 {0S  1s0S N 8@-M@ @ 04@P$( ,Ѝ,@-M@ @ 04@P$( ,eЍ,d0d 0 R/DHQ @Q$00?H/`,x$X0P0/ D D  R #@ R 00?H/x$0P09 A-D   R'P?HU0`@S@T;,p10 0D C   S(  @T #@ R 00/xx$0 00h,tP h H ?30 R - D#@ GR<0@ 0G//Hx$O-P⌲ 1Q0'  0  0 oЍ|00 0t000x000`0\0X0X0T0P0P0D0D0 @000( d$`,C-pP M@ `P X2Z@0@ @ 0""BBB `@"C @@CC3PU C! pP pK 0p RZ @B0 @@@(P9 0 @@@(P. =p* #p& p0 @m(P  &b000S :3S ЍP YB2S@ T`h0S;pPd\9 |A-Z`ppP YBn2S@ T9000 R Aw A r1[0@-0tM,@ CS*>-0R< CKD[1C+D;1C Q11^0fKh[+v0x+z;0#0| 0:01_01o01 R 1 R 0S8Ѝ0Q x0 0 0E\l0A Q Ѝ0'###|<>*!f65<5\0l 0 S/4G-MTؤPpk @+(@($p T0CS0S|3hPXT$: 0Hk{+K[@+;, @`-@8.@0@ p <8%`($P4x,~@fhjlnkp{rKt[v+x;z |#!d""e"#-@#`"h# #:p R 0S |(@0800S \ЍQ (2 0 0-D'l J p@@\  0(PU(00Ѝ>A@J@ < ^v#x:'#0# 0H#p--`_|opryz}{z@|wh}tu`afghijklmnopqrstuvwxyz{|}6@ ;` l6,4 4L<13`A-'^X`` p@  @0\(`V(P1O-MP6 p6006006000Jҭ`∂0 0S00 U0SpC0px @v   $ `00 4S 0 0 40 s0 0bR$ 4S4 0%00 Ѝ$0 s 00bR4S 0㋰ ?;21 R R2 $Ad r  `R$ $ Q 00%0  0U0pS0p @   $ `00 4S| 4 0 0  ;0 $Q B q/ 0 ; 0tpl4 S S04X0Sb 4 000r0  cR$HU x p p P pop P 44 $0$ s 00bR4d3 0 0gS D3051E `H pS 3051E `9 p2 0 C0  ; 0 p [K40q0cR 4S0\20$0$ 0Cr?o  aR2$2 p 0G- p 0$  0 s0 0bR40 ;0ǿp P< pI 40 s0 0bR4 4$R{ 4 00 0q0cR 40 s0 0bR41E00#?c pF0E00#?c p:`000! 00,4C 4 00 40 s0 0bR 440`00E,aED$CXBA@@t 0*- 0 00044 4=O-@PSDM3P0 8 `$Qq  :Q#R3Z 300S 82P@P@P@x@-@=P `=P &<P10S. 0P:  0@S0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S000@S0@S mS 0C ;S P  0@S;C o ٸ ٠TO-P0MfS`ppvpJP S0ʍ p 0rr H"Rp (0$00 03S5PK TT5P K 0XSڰ%$ %T 05"004S03P00S7 p0S4 4S. 4S 0d/、 @V㌑T2p" 2Pq 00@p2Z& LQU# P P P ᮼ᫼oH5S4S 4S0?o2 ᘼY=t3@x2 PvX  <PZ<3@x2  <Px2?;~0x2V  <Px28x2X>3@|2 PT 00@|2gЍ0 D $l h $ <% p 0$0(0GXf x<P Y q<P Z" j<Pp2?;~0p2y20P:0 0rr G"Rpp2Z#@3@tx"|2wZX%ZUV/  ;P*x28x2>3@|2]Y>0@p2zZ8t2=3@x2>3@|2$PNX'V"  ;Px2.#@|"8x2@>3@|2 P 5ZX8t2=3@x2>3@|2P'>3@|2%\  װ ה @0 00J00- $ Tx Xl l  \pT 0t 0x|" Q/804  P X0 0//O- M\@0P`pT \2 !0S S0SXT Ѝ 0 O-|\ Q |pPl0@`P QV00` hPB ,0 R0200pP00 CP E0P  H  ర帰 就帱00Q0L<0 800/t Τ ` ΔA-@P=9Pp Pp@p `EPE`0 2U @0 s 2@ p@-\`P@T 0S1 RT0S@@]0SXp@'G-l@`pS0 ST0S"Q0S 0ST0A-0M`@@ᢸP, , 0 @S@j0 @ 0K~†"  2 0QU 8 P*#) ^@Tۍĺ+G * X - LM  R  ʂ0   Ѝ}pX0 Q0L 00S P:@- &n/} 0 0p@-P0S$ :@#RA# #p `0:#P#c B$0:#!BA##p|T0 P-0M 00S ʃ0  C Ѝ{804  P T0 0//{tp@-Pᒸ|``p@0@ d>0SP0P0:3S 8 L40 00 :#p{$O- Mppl3 dS0`P\0 *`B'WX p p PT p   r  `R  00/"1 R# @0S S9 SW0C S p2051E `fpx  @U ` Ѝ R k  P   Ѝgp P ` Ѝ0 r 1 `R R   S7J @y  ` 0  S $q 1lR Q   Ѝ5p   B/oq"`Rm0E00#?c Ѝ 0T0 P00n-4  z&&&&%$ Ŕ#G-@P(S(3P`X 80$ RE T ʌ3S23SplW " Rpx #8Y 0ST*각@V$:D |0 H 000 ,,p0c0T* @0 T    :0 0C0 00q,@-@5p@40 00@- @5p@qd,000 00@-,M0 P` ,Ѝ0q(,X0X00@-@ ,M @Pd5p  F {,Ѝ0p,0@-,MP@S5p  5 j,Ѝ00@-,MP * _,Ѝ0-M 0  ЍT0P 0@-M0  0@, !  Ѝo,t0t00@-@ P M@ 5p , 0 00 00P  nЍ0o,0@-M@P4p , 0 00 00P  UЍ0-M0 0,0 0  DЍ000 00:3S ⁨/nXO-J03\ 4P"Xapp`$/P 0pp/P=o6τ p_ͭ dc0 0#d#l`m0,F?2?Y 0pw2w ?0b2P`(0$ 300 0m`p@-D@D0@Ppp$ $0l m 0 pl`p@-@0@P:#Rx  ^d - # 0pplP`p3:pl $dp@-@0@P :QpÓ\\p- #pp@P`p :kp$dp@-@0@P:#Rx Ó \ "R-- , #ppP`p:pj$0@p@-S@PP @p (0008 <@%8 ppj,L0L 0@-@0:#R#R"#0:il0l 0@-@ :QQ- :ih0 0@-@ :QQ σ #ppPh :h0 0@-@ :QQ σ #ppyP@ :hL0 0p@-@P :QQ t Ã#ppKPp :fpg0 0@-@ :QQ σ #pp#P` :Qfp@-@0@P:#R  Pp @8 %8 "R--  #ppP`p:pp8 :fL$,@-<@<0@00:3S 0 0 ed @-8@80@00:3S00e 0 0@-@ :QQ! “+a `"pp " " #ƒP`T :Qdp@-@0@P :Q Q#   +A @pp  #VP`p :Qp cdp@-PPP. 0@` :QQ! “Tlƒt l pp#P`p :Qppcd0 00b$,0 00b,@-@Z Mq)pQ* c0 0 `00050 508003 Ѝ0 < 503 ЍL L0 0`0` Vj#cBP`a< 0 000:P/` 0 0@-00r`xT0T 00:3S 0 @-pp+P`/`HX0X 00 :3S 0- @-pphP`/_$0$ 000:#Rs/_|$0$ 000:#Ru/_H00, 000:#Rs30/_(0( 000:#Ru30/^ 0 000:/^p@-MP@0 PhD`000ssOp 0Sx000 SC q R0 :#Ѝp R 00(00 3/Ѝp^X A-MRBP@0Sr QP 0S `\ 1 hDP00pp 10p Q41 1`p0V0S  `100V0S  034pp* 03, pp/ %ЍP  QÁP 0:x 0  00 ` 00s60 0<600 T]x <,T@-,@@0S600$@-$@@0S500@-MT@@ 0S Ѝ<  000 00,60 0Ѝ4@-Md@@ 0SЍ 6 0R  (00 Ѝ  6 @@-$M @00! 0@ @00@ B+TP0 { p @` ԬP @PE0S 0  `PЍ` D P 00 C40Ѝ @0 H P0  0 /` (400 000S :P /G L0 H0 0S :-P /F400 000S :P /FlL0 H0 0S :-P /F(400 000S :P /EH@- @@\ ʌP 0 @E0 0@-0@T J 3$S B0pQ e7@.P H @E4804 000S :P X/DX PT 00 R0S *P@04//DX000 000S :P m/CL0L 000S :P @-\p @8/C0 0A-0`V* Z 3$SP! #Rp@4Sopp3@Tw AIB0tQ 6A.CX,0@- @  @^Bx000 000S :P F/B@00O-` MX$ p P 0 |p @sP  0 Ppp@ 0 #@  Ѝ@BP  P /p@-JP 3S P`4`0Pɪ3VĪ  0s3 S00 0P 2 $R 0X0S H03 20X #$04p03ppDp@-jP B3S @P4P0@Ⅺ3Sp@QA-`Pe JSU>sW; 3$@PS2 SW)N0, S0s0 `SWP3PSSpP4Sbpp3PUp,0\4000?0C00401C0010L10|1spp@-@P X0P:"C0T0XppG- Ԁ\.P@p  `᧪P LTL VW PT VW  H000S8 0ጪ0 0 =xO-($Z A`Pp^P@8P ( v-T2XP* T NP 0  @^-00 W-0\ xp @ RX #@(  !-0@<x0@-?0p   0 0X( `@B$ pP`@U  0000;x8A-@PQP% pW0!  0S0:,8000 R   R   R  P #!4`T `TX *P Q Sp QW02:p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S -03@0SpX@ (@ 8Q0@0ppp@-@PTa`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  03@0S H000080S@08@0p4p7|D0D 0 0S P@ ?# Q@080//6,$0Q 00/5,$0Q 00y/5,L0L0p@-PR ` ?@gpp5X,d0Q` 000S X@ (@ 8Q@@//4,0 004,0 0014`,p@-P`0`0@T X0:20T1S@0?;@0M8000080S@08@0p48,P Q@0?30R@080//Rm/R/p@-@S `P?[ppRP X @0*8"@0 8 R #@( @ //P@/ 0@000DP00 0SO (@@000h0S80@080 P0 R#0>, 0(0\,0!0s0 S ^LPRP0 (00SDP0 R^ (0S*,͟ 0L X|͟P LT R8  , !F$  Q$  \(  r Q  , R(  0 ,!$ 4  R 80pX@D0|0H0000|p 0SL01H@804 0,0000t,04 0Y 0Y 00S0` S0F0R8040,000㓉(09!IAYڸ@LH\R\ 0YpH0@\0S0000P P 00 SPR P)!R00S 00P ɟ`V0 0CS SkpN 0 0S0 @S P0P ` P R  0R  `9,00Sh@ Q0C0` 0 S00( 0S(00000 0 S(00 R0 000:3s T  T R 0` (`  R q@  t@T,0Q0@t@T80\P000S^T8, 0@000h0S(00S80s00S. 80m 4m7, 0`V 00PP0 0C<0S HDD0L  LL l<0L\oɟ`V?A80\V 0TD@00 R 0 R PPZ{ !YR   rY $Rg  0E0 }0p_   0E  @000$R , h6@  ^@000!R 5x8 8000Vx00C000C05, 00SA0 5# X0:h2 , 5@H`e0` 08 0  4P, pu'00S0 @000p 1P11qW4r$0 \@00 00S| 0 5# X0:h280V @ 03@0S 0S,4, 0pQ0A 00C0܃ 0 SPP 11 1R@Yx RRQ[ 0    S#, R R   p6#`FpPC20`P@ !?3 pGWaFP `p?0@000L0H0P 0P0P00}` `0ᑂP0T09^L P0 R3(080 { 800  P, 10 Sp`lЍiP008 0080@080) R d1SlЍ( 0 09 x \0, p0, Q0A0`Ӊ8`! ,\'PY @x *Dd *L `~~P}$|h@PY P0@, QLJ   8@,@ APX@T `P `pPT` P0 @ ` p, P@APUEDP P " Y   @@T`Q 0B0CPcP P8p0 CQQ @0p  0@4$<0S  P 0,0[1,01`w @@`[o P  XPj0$00S 0$ p0@X4<PLPA\P0(0 0S(0,0 ` p, Jz2 @W0,  \B `w80(0 @00C{(@ 0 080 0 y 0PXx  0Q04`000CP0X0H080 0DP# @ \ 80@ 开J U0L J D |pPe d1Sb , D5@  lUP:X X0P@ V@DT 0H H00HE@H00: 80 0R,`0A0X0000C 0@P `040 0E00J P0U U R R  X R RR)0SE 0 R@$8,  8@0 00-@ ` `)0,0 000 0S 0 PC@08 U0 00P$b pQ_ R$R $Ry X  QCH5S@ ` 9, @ 0  `j@ 00p0 `]00P f 0@`P 0 B00Y 0 P@0 0p 0 P4+ 40U( R X R$R`V_ 0 0 0 ;, `@p@0` 0UH%RPR p RO $R $R X  Q R; L5S>  ;, `@ d0  `@ 00pW0 `00P  G0@`P 0 B00 :0 v  Q@  0`000 @000P  T P$ , $=@ 0   @000P" , x=0 0 0 A R! U =p, @@0 0p1S U >, @`@0 0PL5S 0 0RU h>p, @@0 0Lp0 0 0 3@000=, >@ 0  `C0` @000tW $  0 U@`; 0 0L}P2Pj @00p nU xʕH%Rl0 @@TI 0$ppP@<@U; <PP$p@`0` 0HAUnH50S0X0S*  0 0 00, @p@0` 0H%U~0 0 0 @000jP$pPbAhrp@-@PPMP/ 0`0 R    80x  t000 000P 0  Ѝp80 @000! B/ 0C?0Ѝpň0 00Ġ,C-@PM⤐0 48! \`` Pd0phlpPc80  D000 0 B0C 0/ ?0ЍЍt@-@P @TO-PP ! 7 1D00S0H``?c`S., p !@G'T :#| 0cp @W0 S 8 0? P PP0 S  Ø0 00d, 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP @0 @T $0`U VP `Vp`S0P 0@PUpT` @ʊT @pp  ! !@-@P@峊T R/0A-p,SP` @T @坊T0`PS RQ A0@ ", "Q//@-`Q'pP@0D "! "T "! "U ^ 0N "! "\^pPV@@-@@@0S (0P0C(0ivO-M|:|z|*0p(P܂ pP L*40\b S @ s!@nRXl HR@ @i`80IS0c0@T ^OoB@TP AA  RR0)\ 4  |  bR\ P)` R&@) R! CP'I@0 8R S[80S  2( 0P00B(0X @C0 8R CPf S ^\ `( 00Q @800 808,0RJ0H 0@0( (P)0S700S00l0S# 0 S 0 80R#0l 0 P0S  0P(0@P(H70 RЍ07 0, w(,04 SBG@ `T & ,04 S5(&0CP ,00xP0S (0P0C(0Il&@ - \&0 0@,@ R 50$600 80RpfF`@000 (P0 80@P0,@Sf 40 CRbڨ%% pp|% p%@ 4p,`Y a| `nR`F`V,00P0S  ( 0P00B(0X``!R  @ Q[Q $ 0,@  B0 00C S[ p@40084 0,0104#0zd4`000P ^% (@(#P@ ,@i4 Rv 0[, q  P+ p# _ d# ,@(@?QW, 0 #\ (6 ,@  P Q0,@( R $@ P  @ lP " $ 200  0 m80 S -] *(D2 0( ܀(B@0S  Y( 0P00B(0܀( 00P0 ! 뼱 40,`V7ڨA@ 10,`4 V0`Fx!,`0 xP0S "( 0P00B(00@'A@0S  ( 0P00B(0 0@v(uu`dtt8Psssssrrr`r\rH$qqpqTppp$oho,o$nntnmm<m$(lllkO-hs Md3p`C@4 P 8040800c`,0P Zn38@3`0T'#0CS 802PL좟 a0@DS,00S0 0l0S R "0 04 208@0P0T0hP \RP4 @P 0, 0CS P 20 0 P1084 0, Ѝ04S00h0S40~1 0T4 s @ P0Pk@1,`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T000P0 0, p0  8@0SRC0PE@DP8@K 00SL008P@jjjLdj4hiii hggggp(@- 8 40,0g(@- 8 40,0f1!0O- @ M *BT8 h!O T!0 pR( X+ 0S#,PK U`0   R    PU0 PU0P0U0 S @T ЍpW,0P q`W0 P`00P0 [SV 0$0 00 08QD0S0l%R h%R /!R!RtP/P//t 0 000 0P/O- M똅P2 5` 80s5 t SD Pr T@R!1S<50 (5p0 P\`崦 50 00P 40 0400:@ p0 @ l%R h%R 0ʀl20 h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SO\Q*SvVrE Q SVW~V= Q SV_V5 Q SV@, Q SV# Q SVWV Q SV Q@S  ![=0Y2 0 C S@p"0TP!pR t0S8"R ,ŸU0 8@=0A00+ 1OaLOp`PU 0S 100S H0Z 0H0 , 0Q  ZFPU ЍZ 0   0 0 00R0 0 !R 0ʀl20 0 !R 0ʀl2%R t5S 0ʀl2Sr Sp Sn Sl Sj Sh SWech`KD`h1P0S\ PNPN D QG\E,@- 00ʃlœ\ 1:t“ '^ tƒ'΃r 'tƒr A\ B\ r^tƒ    //ss1P0? 00` P9ʀ: l2'΀S00r200 /@ P 0000CS0 00000000000000000/Hrrup@-P@M@(\\" rf Ptf vf0 P P 00 000 0ЍphPd-X\\ rtv /L0 0 t 00S `0008=0!@00 R/@-DZ\Z8$$1 @-00*l"R @!@ R  (1:'.r"tB00 R @R   AR  $D0YYloKo-0 000:h/p@-`@M0@P0*l"R R &Ѝp   P 00 00@ 0 @ &Ѝp`   P H00 040@ 0 @ &ЍphT@2C-08R M0@PS "03@ @  "0S 1hp0&R  l"R R- ! f#@ @080@0 Ѝ1:'.QPr23Ml120l T10 0E0!Q:20h1:'.Q"r23020 00 0$0!Q:20t 00 00h0:0!Q 40-0!Q WXh0 000/4|0| 0p@-00@00C0S S p0 S P00[pᑑPp00p@-0CS@0 S p0 S P00=psPp0000 0p@-00P@)pp@-P@p0 0 0S JQ R@-\,AQ /,0P JP\@-\,AP /P/0S/p@-   A BJR@Q`,PTa@@@RA  Rp03O-0`Pp$MCP@ W 封P 0l#0C S-0 00$ЍT0 S80  2 0@m  B@DT p`$ЍIɟ,0P @I%!R1 Q0@Sf000(00^0Ŝ@$ @D DP[Z :0J@D U0 $0$0Z㰁? p@0`@`Pp ~P, P U   P`X0(P I0EXUP(E 0(0C\00C_$Ѝ Y TPP  D0|0Bp H0@D002 T `V `+V `` P|gh40 00 ,p@-@Pppp@D0D0p@-@  @Pppp@,O-@PlMP6 0,0j Q 0p嗀`Pa PZ~0P0[ W0  <0P 0R 080ȅP 0@SF0 0800`P0S 0P 0 0PEPUT 080 00PS0P<0=  $500`0Pp0 @R  <0T R8 0 0<00800C?8060P`F0PY`00 ', l480 pP pK 0 `800`p8ppP P8 E0<,PpR%4\ Qձ(X  <R! p@p G"RX : HpG U  $ $ < S8 8 `<@(Pp4$0 ,0 1 D400pH0@0@0 0PU<$0 (Q0 0C0 Ss 0( 0C04 Q00SPy 80 0? ,0"8 P k0PI08p0 00i8 0k80pG0C?80l0P0C00S`FQb0pP0000C00P0 0PS8 0B! We 0 0pGH0㴢01 WD0|0p~lЍ#p` 0<0T aR0<0 {Pq 09j~lЍ`}|^~xcb0 0 Z,p@-@`Ppp p@L J0 0 0B,p@-@Ppp p@5Hp@-P@0 @  0`pp p@!T,H0H0p@-@  @Ppp p@ ,00@- 0Pp/ `00p@SL,0L .W @0*S /SR@@00@@@@0 00C@@0`` O-SMԑD@ HP 0U p` @ 0Z C 4/  Z: $Z <RH!  R! ".Q   R>o P   @0 0|00  GPr 00 R0S0 0?P4/ZXЍ G\r 00 R0S@0p0pP4/pWZ YQ# @-@M R ! R "R pP^  0 0@`Ѝ/@-0QM   S S PpP$@8R @ 6Ѝ40@- M@ @#ЍA4H0DD @-M@ @Ѝ @p@-0@R P\RP ^R3 @%` ,R'R{ LR @Qa0 L !a}0 p  % <{ R`VA 0 FR8h!@P`  Q ^0@! {cRE0'  p @m%X {m\R:R `O-$M`E zz@PP 0@%pp 0 ;S p< @`\p,S0 T 0@ @0 C00  S  Qu%S+0@GS0  iP%@0@@0 `fv` 00S1.Q0*Q  0S@0 SH^0 @0p0dP% @ 00@  d 0 S-`30 @0|0 0BB   0 0p<@0D0@00 S_S{b 00P$Ѝ0 S0^0@p  0 @  c%  0 S^0p0p0 p0 0[0@c%@+%B0 0@`0 S00 @s0p 00pp  00 p   0000!010 @0r 0 p       Tp0 S\R W' I00 S{0<$ Pm> 0 s0`f  Sv` 0S0\S 0 S]00 C00T RQPp@-@PM0P`0S SP!  0 00Pl 0 Q00Q H  < x0 ЍpS08777l7lO-M0@DS@!00@0p0S= Q0 N[AK `  8 g=M%㕞R ᫱nੑ)bP P  02#cQ`0P pW$P@PW 0fSMPЍЍ 0Ѝ@NG-M0@HSD!00@0p0SD CP0 ` k@ 3㞜>C l.b  ! ƒ120BQ0P pW$P@PT 0nSPЍ0"ЍЍ}LO-M0PS!0 0  0000SW @har*sE? 0 `Ə⊡1 - ?D%ᜲ✳B.b CĠ C,ᜁa b ! 2ਁሂBsPF @G$SP (0  (0-( ?,D*Ec,`% f`Co1c,A ,0$0b  0Ã#3#cQ?P $0tS P@ 0cS0dPSP ` P0H *P[w00|IXfhd4FxE xA-pP`0\ %\0@pS sS lS P0\UUW 000@1CP0PCV`1E !00O-PQsM<00 P` 00S040  t@    H WY 1   RSI EX P  4  PX %X%X ,  R:@vP 400@, %0404@p;l[` @0P`@ p0 :XBX HQ  0H  P0 P`500>X A0Hs =R* =S00 C?Q^` V`1 PQ -^. 0XXC cHqQ  ^`z PA0H^l ` Y PA0Ha0Hs Rm11OSp00sߍxI@[,HuP 00040?uP, 000 ^` P`1l X   QU PEQQ$Q V! 3`,  RP*P  0҄p 40P040 P PP`1  ]1S@ 0C11$1S= X! H0 Cr 2 'X POQ0$S'St! 0S'S'SX AT 0D1S1$a @D`7&HAq0 $VX฀ `OTb 011$a t!AT @DAA$Aa0Hs RA0HS3HAڕ0     00C2"0OQ60}SS$! t! 0S}S}SP1SZ !0C1pqWu #P1`,Q*P  0pb 40040k10Hs Rf1tx1OS!P$!01tWAT @DA`1$P bOT1a$010$1A0St00t00S|00|050S%   ?R ;R P0S %S0 01S. 0C11'AT+ #,Q,*P  4 @ , 40, P 0P`1GA0HS30H1OS!0$t1r00@1@`tPz 400`,Vp p2tPo 400p,U000S   ?R ;RO eRQg P0S %S0 0AT @DA1 $OTC0 $01@At!`V ᥡ```&``VP``P``ù`@oobP``V ᆾ``@Q AIQ AAT6 @D!XA1 $oV 2CtP 400,PV`00`00 1&H 0 GX @pq0000y!Ho0㨂0000)000uV@p``P`V@p`K@`fpG@opC`@p?oo@pb:tdWW(T(N- - M00 ЍЍ/- -M0 0Ѝ Ѝ/- - M00 ЍЍ/00/ $A-PQMp@ 0S XA qsP OP` v00) V T{ 00 PPT00e 00ЍT ম 0 0 R T| TdP0S T`,  hDgp 0S R s0r (0 000ST00P a  p0(0sP  a  p00PHT<B0> t | <L 0R@-M  H@P  Ѝ0A-pPP U) @T`0DV 0PS |U@P V  P oA-pR `Q Y00@ PPz % P P (&0 GS  rP  5 0?s s0 0/r R0 /r R0 /r R   qQ Aqpp0U ?Qs0 \PQ  0?s0S $  pP op   1@⡏pqP V0?s0 q%qP w0?s0S   pP  q0RQ?s0U@ pP0?spWB 0pⲀḏx$SBPB "T X$5  Ž0?"ss0 nR 5 sRB fR- p00?oR20S   pP:!qP$qP&$ pP Rr$pNr qP$V    p03?/o"/00   0 S/r RUp p0?s0C-@QM|!pP `0K P !000S9 @ЍPP p 0 .p R 0S 0P@ [P@ @qЍ 0 1P LP+P P *PP004 O-M Mp0:S(0S:S@ 0PS:S``!E PXP  0 ` iP 0P:S  ۍ Ѝ@ ۍ ЍŸC-PM M@p`tP2 0/SB ݝP M\qY PD P 0 ۍЍC\0P L!  qP4,0P 0S/S pP %qX0 ۍЍC0  PۍЍ p 0q XW P0L 0 $ۍЍ404 0 $d | $   d G-p`@P  _PpU  VP `P@PP @ PT   0!G^E`E-@- M@00 Ѝ@ Ѝ/? Ѝ@ Ѝ/ 0p@-S @0  p00s0?0 0?0P 0 p@-@upspqp@opmp kp0ip@8d 0p@-PS@:pS oP!pn@- ^ @fR^ qQnR sR^qD 0  Q A- @X `PfS@X pCPwwp 0@nS sS@XOt@@@ 0 0S00@PA-P% Ppp R,R    0S,S@BYn`P   `00pp@ dG-pt@`P#P6]pWY*nU> sU\ fUH0D Y-R0 @ oP$ H0D@ /  H0@0H0H0nUp@0 H PO sU: fU& L00L0@ XP @P m 0S0000W 0 0H0@ H00 ,00H@,0, (s0?0H0@0H0VH0, 0H0 0@SH  $03?0H00H0$?P0s0?0H00H0 | O- M@ Z pP pY ` `(080H0{mP3 0  0u0?0 Z0w 0/    0Yv / 0   00P? <09@60@ Ѝ 1!00@- 0 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00PA-p0 @`P`VR mPA0 uW000 x /   0 0 0Pl8  O-@P0 $M 0IP `>n`Z5 p p 8 m0P   07 #n `| PP  Pm0P n00$Ѝ 0 nn,`0 pV(0 0$0,0& P 0q S00jPo `V X  P2/R`V  P/r R`V 00mLp0@WH0@0D0L0: `fS* `   P$ pW$ Ͽ|P|0nS sS`ov v`X P`5_`0 000 m$Ѝ P`_uP$Y00YPa hA-`@0PppW S# lP uv0Ͽ   ?0 000[  0 Pk0A-pW@P`S l0S u0  00` 00 00Sk0O-LM<0< 0*0, 0, 8pP ||@P00`P 00_P{T P?PyPlPP p pP V 0T 0 ,P`8 0 ` 10#s0$090400S) $ .S  ROSD =pP" 00p`vC <0P;0P?s004 0?s0V,P `lLЍ#o@P? pp`v , R 0S00 R 0?s0V0TS 0 t000 00 0( P-Z80j80 R(KlPLЍ@0@SB  p@t`00 000 000f0bPYh (@[  [0pP ;  )\[  R-Y %\^[\= @[0P00GS,v  0P (X0 KrQ40E K/RN  [@ [H&,0  @ 00@&,0  J p00 DYD00S &P Ph 0 d 0SR v 0e 0  00 0000n0g p( j807` Q  Q 0?s0T00  p    000 ?[/v 0 S00P0@ P  0BP,  |0 80o Y80 [!0@B PT@@p- 0 0 000s07P (f@p@tlp@t< , Ri 0S00 Rb 0?s0TI_~PeT` wP80   00 (-:P00mPp@t0u <0 QJ0Q?s00 C 0?s0T0  P0 0PP:0 0 0 0S00P% $pj0  < m0 000P p P2ION L 0P/$P0 00 //EXA-M`0 KpH gMM%P  1N;A\㓌al1#b 0 0#@B4d!4PЍD P0`0>//D@-MP0 C`CNC k,'@`0|0~Pl n "020#AB@C1dPЍD1P00&>//CA-M@^0 sb*cEQO  - ?D0垂|垃B p@LLD&$b@C >c 000@d$C4d1PЍc$Cp@-0M`P02@P 0Ѝp[0 0  B0S Q20ЍpX1!0G-@Pq0P04 0 `4 `S002,0.PP00|``Q  VPe`EȄQ  V|0`0ȇ`H00@;XDl@-@P iii i$i,ii,00!R  ! 001/001P// @--`@@X0@00s@ H PJI HH @9\LA- @-d`4(M[T0 pR  X a  !00 (ЍP P 30X 0B00g 0Xb!00 P ~Pr P# X0 00 "iP 0SA !00 cP00K200X 0 PP 0Sf {!00 cP00Bʈ200[DX 0 ./2'D'L"2PI  cP00e020X 0V0 " P 0S K!00 cP00OX0 " P  pcP00Wʌ10X 0!90[D2/'D" 'JP  WcP00,X0 " IcP0000X 02/'L"P 70S !00 /cP00ʔ00X 02/'L"P 0S !00  8LVd L t , l P X | x T d D dcP00h00X 02/'L"sP 0S !00 cP0000X 0=0 "ZP 0S !00 cP00O,100[D 00 /G/OX" <PD  cP00;ʄ100X 0 *P 0S U!00 cP00100X 0 P {0S <!00 scP00(D20X 02/'L"P a0S1 "!00 YcP00ʨ20X 02/'D"P  FcP00|20X 0l2/'L"P 40S9 !00 ,cP00T30X 02/'D"P  cP00ʜ300X 0 C P  0Se !00 cP00:300X 0 U P 0S !00 cP00T40X 02/'L"mP 0S* !00 cP00ʸ40xX 0Bx UP  cP0040X 02/'D"BP 0S m!00 cP00\50X 02/'L"(P 0Sk S!00 cP00k50X 0[2/'D"P9  wcP0060X 02/'D"P  dcP00xP60X 00" P S0S "00 KcP00/ʰ60X 00"` P :0S "00 2cP00700T 0a X  P  cP00x30X 02/'L"P  0S !00 cP00&30X 02/'L"P 0S  !00 cP00Pʰ20X 0@2/'L"nP 0S !00 cP00L20X 02/'D"TP  cP0020X 00" BP 0S m"00 cP00 ʤ10X 00" )P 0S T"00 cP00D1000[DX 0   P y0S :!00 qcP0000X 02/'D"P _0S !00 WcP00 t000X 0b P E0S !00 = \ ~ ~|  ~ }l } | { { z` z$ y yh yl x yT y8 x` w x( w x w wD x w w w v wd vT v v v u v uh v@ u< u8 u t t ud t tX t` t tP t s s s| s, r r scP00w00X 0g2/'L"P 0S !00 cP00t@X0 "% kP  cP00\ʄ10X 00"  YP 0S "00 cP00Z10X 0J2/'L"?P 0S j!00 cP00H20X 00" &P 0SE Q"00 P 0S D!00 {20 /G/OX0"4"00 k303030X0 /G" "00 WL30T30=X0 /O""00 F30X0 /G""00 8300XS!00 +30D30[X0 /G""00 (40040X0 /O"!00 d40X0 /G"<"00 40-40=X0 /O"W!00 40H40X0 /O"!00 5050 50IX0 /O"!00 T50\50X0 /G"}!00 50X0 /G"@o"00 50150sX0 /O"^!00 6060X0 /O"M"00 <60X0 /G"?!00 vp60x606060X0 /O"%!00 \600X!00 L60X0 /O" "00 >0700X!00 1`70h0[D0 /G "ZH ZH  0/O"X"00 700X)!00 700X&!00 ,80["00 "00 \( d80A J~ PH T @ "00 "00 !00 !00 !00 "00 "00 }!00 x"00 s"00 n"00 i!00 b!00 ]"00 %P  [D0 /G"}P !H H  0/O"0S;!00 r20x" 0"00 g+"00 b&"00 ]!"00 X"00 S"00 N"00 I "00 D"00 ?"00 :"00 5H lH 2/'L"|1 00X1 0041 @@0 c1 00)0 @@X0 60 800@ !TD- q, q q$ p r p q p( o ph pt p nx o oX o o oT n8 n n n l l l l m8 m m m l k l l0 |00c40 00}>X0 00t7r!00 0 00f0 00]0 000T0 P00K 1 p00BD1 @@0 5x1 @@ 0 (*1 00$1 0051 000 2 @@ `0 L2 00Bp2 002 00I2 00o2 00K3 @@ 00 o43 P00MX3 p00|3 003 003 00R3 00!00 @- M{VPLOAQQ-@\Q\P 00 Q P 0;B 0` 0 Ѝ3Q Q) {F ЍALL1\1 ^ d0P  010b0(#6(7`0{F q p   ;B Ѝ 06x5/ /P 0S $0S 0S P? @4@P//A-0Pp`8P' , R( 0"0, 4000R40G@BT@! V @D8 ,0400G,0 4 00( @(4/P8,0S0Q 400 @-P04 R 0    $ < @ S. p T P  +ˁ0P R $ R  R S /0?00Q?0$0SW$ 0  0p6?@0U 0PEt@T$0Sp0  0@7?p0U 0PEt@T$0Sw  '$   0   0s 0 8$ @pRxp=?0Up 0PEt@T7p0pp@>?00S: .??0000CST0S7 0@7sN?0 QP?0E(0 S@p0(0r0 ?3l5?0U/ 0PEt@Tw0pS ,<00Q?0LQdD0*;J?0\0T  0T :/0PEt@ 0S%U0P`0,P 0U 0@@ T 0 $ R4,0000 e??00U&  PEt@T   !R 40U 0PEt@ T:H0* @D7|0H0; 0; 0$ R D :/ $ R D ;/ $ R$P7s@D;D O 0;??0@0L fP c< a _ _H ]h& [X X W$ T S SH R S Q N OP O NU F $0 S P D0 S2D57[U0  0   [PE`0 粰\ 0>* @7s@D 100Q?0*P;X00T :90PEt@0S0UR?0\ \ ^kPEt@^eU@p_ $0Ë 0Pv( $, 0PEt@< 0QoU(w(D?q@D0D 0B  @'8w<#0#[" 200Q?0]0 qS2@D0P0;T0G?0L K?HL0P  ,300DSB?0 @p7s0D@C s PFl0~90r0\l^PEt@^U3q@D00Q?0 ,( 粰* @D7p*R <!B"0$ Q 0l0S>/0p0P0X0Xt  0p0P 400Q?0   @q 400Q?0 7?RY0@p0v0 70pH500Q?0E?l 0U^[PEt@TU*U 0@0SU 0 000QO?0 0S 0@p0,> \, PEt@ 0\6UԂf7s0D@Cq,I?L0:O?00 s0P7s@Da 0@D'q0@ph0dlF?0 Ԃ7s˂PD 0D@C7q  0`P 000PP@p0 QR 408 B`4 08@ZV000PA-P@Pp` 0R>/ S  'P00S   0S R?0P 0S $0S 0S P ?,B4 BR/  $0 /(#(3 C- M0P000@P`^0@\ S?R 0 <032   A0Q#4<0M0@0 Q Q0c  B\Q} S Qs 0 S?Rs @0 <0@\32<0p0l0^ppWn H Q0c  R#2Q S Q0 S R*0Q  R*0Q  R:0l00p0C0l0pSp0x 000 0?P,04p??0 0 0 0 30 Ѝ0SzpSpl0Spp l0@@@ nP 0S $0S 0S P?,A4 BR/A/Q /@o/A-Xy@ 0(+p3/PPv 8`VG (0 ( 03/`P0 0d @ 0T   +P 45R*p 0 B0p0(0 8#8`Po RS> B0V P T  B T p  B0p0`0 0@ 0T   +P 45R:o Rp 0` B0p0$0(3/P 0S $0S 0S P ?,B4 BR/: +/P 0S $0S  R 0P0?0@@/O-R|M  80⤰@ 0    0T0X0ps\pW0  p p0 |Ѝ0`^`V0P@0t;JUS1@Z0@P05ᲀ0 Ts00R 0x@S0BSC@ RUP!U0!01P 0020# P0S|Ѝ0W0P0S |Ѝ0@ ?o2,0%R00(0S2( 0 0@0$0 0( $0,0  00 B0 4 pP 0R@ RN 0ࠃࠑ`@@$0t@<: 80C1 ( R@P00F#3 0S# Br #RVE  ` R*  ^ F C 0 Z( V F( *FW BR  ( Q  Re, %Q  R_0!LAS4 @P  0010,0!(0 , 0 $0_dO-04M0C000 C BP [P1: bp Wۄ2  B37Ro @gqq`36 B p`Wl B37`@^`pNV*jkV`H$Va `\``\pWL\`pNWNWN\ \  ?QPK@ U2E@ AaPA0% 2@  `"<0@ 4Ѝ`p 0@ Q2W ۅ >`V7*pG(p\ p`$p`p`p($p$p@ V(`$p PI:`@`L\p``^`@`^`@\+ \#$\```a$(@$,$ V,(`@O Ql$(@$,$ V`G(0L`$`0``$0P\(0`@(8 = < :LD, -0qR0Cs\@0qR0CsPO-,P$Ml0AOEx@D8SAO<@0@D000@^0| 0S`"!!Pt0@p^4! 0TT* RR 0 P ^ ^ ^YY 0 PU<PU=PU>PU?PU@PUA0PUAPR@oPP 0C<` `FV*\,^X!X~\, 6 QƋ5* 0L1CS0!S 1 RL\  U  RЍ `PVpl , 8 RƋAX, l&\XE\\pl<N ^Al A&lR8 &&RH 1&,lA Q l S`1 `!U00  SR#00p08 0\00\09Ѝ<` `FVx:8 n, lB\ Plr8 LNl \&lR && R, Ƌ`X  SR#p Sp`1 `!P 0S $0S 0S P *R9R/qRZRE B0//0@0@[ B3 /R/O-MPpQt@`Vp V] t0Sj0,0SD0p0$t0S)` Pl8P pLpԥDP@4H0  R;. 0H0``0t0l t0S` Pl  l \ 60thx0`0p`ЍVL0D C0 `C,0l`\`fpG0*S tX 0 ! ,0W0:A-@P 0S $0S PmpP `l0t,@0S@1VTU@80C  pp@-@P$ 0S! $0S H`PP0,0`0 S`0c`0S ` *00 00(0ep`p900(p@-P@P pPL ,0D0<00 B@C y0 X ʅ l@\@t@0000000|0Fx`h@H@p4@-@P 0S $0S P0 Rp@-@P 0S $0S PP Q000U0:60ppG-@P) 0S& $0S# PQ`P0&0R:kpƙ @lT@40C0X<0QPUPPp@-@P P 0S $0S `P0`P|0pp01A-!4TpS`BCEP0 R R R0 PR\ \:0S@U!1!f!gll R ^  RX  p\h$X  p\h, RO- M` 0P0Qp 0@S QW0 S  R| R7  R( (pQyW, R B‡RP&"SnQ t0S Rr 0SV S 0> 02#03/0@SPn Pf Wo0S S00\0 00#400 00 0  0#400 0 0S0c0?o20 Ѝ0Sy<00000! S *SL0Sq00Q R0@SP Wg WuM0S0(0 Ѝ0 0S&+Bql0S0 B8@ B0 #22c0# 0l0Sb q000 R09S ES IS [SD gS0, q 0S0+W  2R-C0Q` ! 0P B X:G PE [ P ! X8*H 0 ,0 SR B000SS@ ӇS  00 # #8 00#"0  w0 ,  Q R I   R&   0P P0S00  P,0SQ:{ R,0, R  R [  $ R  $ 0P P0S00  P,0SQ:O R0 i0 0t0 0  R ,00SP0^01$ ^U0 R1 200 00 0#400 00 00 S0 S 00R01 00 00 R  00 0#400, R E  P20 u0 B00>0 B00cR5 0 00c,0S+  Qg0#0% *0 B000, g00R  0Q RC00 00#400q00y0S+Zt 6l8&`6 &!6ƅ909&tl0QIt0l0" Yt0SW :W㴖s 6S \0l S B8 0 l0\0100S\ R8 C0t l0\000S0Zt0(l 8`R B  ^E 6&!6ƅ6ƅ909&6Rt0l 0Ct0 l SOt0 SW S Sl 8`0 \ W 0S0^0 B000R ^ ^  [ [ [ [ [ [ [ KPo᫲[@ ``S`051:P&0@ƅs0,!ƅ0 0!1001  &6`Rt0l 0C` t0l x\0S B80 l0\0V00S;#  #800#"0  0 0 0 0 0 S0 S 00R01 q00  R000 000**W6: &R \ R80l0 C  B0 00BL0D!C0C  ^t0S*l0\06~\0l S B8 0 l0\000S20k\ R80l0 C   A-`pPSq@PB Q00V0SH0S: (0sU Q P10 00000 |0 `hp' 0S)t l00\ R#6S S L0D C0 C060P@0 05 1# 0Rppp@-@8PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0$ (2/qV00PpPO- M`p80S04< 08Q1S00PP 0 0S| $0St wpVkV`F0HSt0FSRp WnZlFYo᫲[eV @(& `4/@Pj * *J@0`( `, P X  P "L  BT  A4 *   6/ `, 8(6/ `L @(6/j 0 D(3/80S6! ( @ R% D PR! 00C60p删$0 ЍOv `fh00$0X(0 | Ѝ",0  000%-M 0 DЍA-PKUn`0 0@ 0Q@   & 0(3/@PR &@z 0, (P3/ 0, 8(3/ 0L @(3/ 0 D(3/08P. @ R+ D SR% , 8 , @@ L DD &!0 0C&006 0&;> 0$0;/ O-Q$M R0ß ! 0 R0#s0!1`lß0P @` $* ) ` #z0 `&qy0 v0 p0PAr01!:RuPPQp'9RuPQ(6RuPQ+P5R>"uPr !@$0# "@QP` .DR P \!R!!P! \ ++ +P ! @$ @$ $PD!0# 0##P4!3?R4`P `QPE@QU`&Qv`a#4&@$t@a @Q#d& 0Q p& 0#s0a 0Q d& Q@$t@A&D$ pa Q$d&0#s0A&D$ p1$4#B R   "^r !#4"$Ѝ0 L3#2`S#b(0@m ո L  Ӽ Ӑ T |C-`R@p S]N `  1!"\ C 0  .`  N1@"T C 0   C-`R@p S]N `  1!"\ C 0  .`  N1@"T C 0   @-PP |p CMNp`P`  1!Ȓ"Q C 0  P` @-PP |p CMNp`P`  1!Ȓ"Q C 0  P` τ0@-1 S]N,^@C 0   0RG- pe Q RLuRnq@W-@He_V @0@0\\ 0\ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 \ 0 R 0ɃP 7ᕓi΃7nP"R 0Q ?Yq00H/II7c ? Y?II^NNPV=H10C=@L   0R `R 0PR`RP0`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0P`R0`PR0QP0 00@  0C 00 Q q00H 'ᑒi7n00R#@-qHp@#/Ǡⳮ 0 I 0I 00LR<G @ 0 q0CR Y> 0 B\0 00000C0/ LR 0^  P0 0Q000S@\ R 00 R00@\DЍW  =xQ / !02@[1Z Gೠ69#6pQ^p N00O-@Ⲁ MAX``PPR ಐs@D+~@ p+0  RlX+ Y|   ^  DT0V `P \( RP|\ P`PP8 TA ` 0P X 7  Rʰ ^ T0. `P\ T0$  ^ T0 `P ^T0 `P T 0 P XР Ѝ  O-$MⲰ[PPR|1Z@+8+00+0`0* X [Pv S ~:|:0nSWuPT0N`PppPP`pp.pn\Πv|P::0lSWuP0L`PppPP0`pp#40060c^~P H\xƂ0̅|PP0PP#4 0ƒ0lLXxP0QPƃ9 Q0T pQ `k^⧎P p@6a pA S#0r 0   0#406 c0TBt `V 6 pW @0S p`W0\  P`Q U0p XF+=00c^0~ P0CppP .pp 0n\Π| S6`FPQ3ps00p00Ppp#406c 0CVn`6D0Th pW `k007PlUs0PL 0pp00P #4pp0060c^~0 \ƂR `FPQ̃6p|pPpp,Ġƒl LVn`Ƃ 0T# pQ(0 S P `a\uP p 0\0 `W5 p 0 S$Ѝ0pvH Qx066㳀 H Qx6Ƃ峀v P `'0 S P `0 S  P`0@\ 0V p` 0 @`NʀO-M6S 3k^P003`0030 0300300A @b9 Ts0@ Bp000@p#406 0c^&6S6 ⼖@ `0$0 p฀n9 Zs0 N0 00#4 060cXx0qX xq@DphWt@>挥s0pH000p#4060cTCt0 BR@@@CAԕBԅApಀphY>s0H000#4060cWsw0 p0@sW hD B@gTr >s0=pG@000@#406p0cR#6 SveF&0PnR2s0 NP0``00 @#4PP0&0b Qq0&0Ѝ 0&;p0v7 є ф x l `0G0@-0J ; &̀+ V(08;0,+ $ˀ 0 &)0S0 0xS0 0LS4&&&&0xA-@ s0`P Q!r  pp "$  a AS2s 6 x u0U0U$0Q  00  0 000*0@-6S S0ظ0@@6 0C606@PP@@!PPƂ0*0@-6 S0q0@PP0#4@@06c 0C\| S600@PP0@@@#406 0CS6 S0ظ0@@6 0C606@PP@@!PPƂ0O-Q0  MR@R, R 0p&&]P +(+|x0O p ! R:AQ j  &!R*\ R3 "[&&0 Z'p:s00 00 "$ 缦0j JP3s0 Z㼦,N(r :s0s00 00#40缦0j JR#r0{ Z㼦:s0s00 00#40缦0j JR3s0 A Z㼦r :s s00 00#40缦0j JR#r (ßk>0 NΌ⼦  Z*r   "$ 缦 j JPp \ ἦ A > K O  \ P+R +R ,RE R  Q ,P3 "[X6 S_p3 s0000 #406 c 0CPp H66 O.V G.0 0S0 0xS0  0LSX4&&&&  Ѝ &]R3 "[jP ЍOg Pj 0 r :s0q#0r   :Q0@-!DƓPV ƓPV @Ɠ@F !6@o0ƓAQDƃ<  Ì!!ܕ"܅  0S A-@P p0 C5`-VUV `&P X%/@- M`@pl)PP P'  - `p z: @P Ѝ耿 @@ Ѝz@@v@c:T  Ѝp@-P>)@P @000pa 00p@-@-)0P 0000P 00Mp@-MP`)@P P @Ӹ 00\-p ':PЍp2P:U ,PЍp0A-S ` @p0 CP-U 0 y%y1r1FPP$0A-S ` @p0 CxP,U 0 U%t3i4FPP$0S A- p@P0 CT`,V `̾/0S A- `@p0 C:P,U %y1r1FPP嬾]$/0S A- `@p0 CP,U $t3i4FPP劾;$/0@- M@ ,p  P Ѝ0r Ѝ0n0 Ѝ00@- M@ ,p y!r!F P Ѝ0X Ѝ0T0 Ѝ00@- M@ k,p t#i$F P Ѝ0> Ѝ0:0 Ѝ0- M Ѝ- MtiF Ѝp@-@P$t3i4FPPpp@-@P$l?o2FP p00pp@-P`p@PP  P#p@-@@ @-@@ @-@@ @-@@ @-@z@ @-@t@ @-@n@ @-@h@- @-@b@C @-@\@\ @-@V@m @-@P@z @-@J@ @-@D@ @-@>@ @-@8@ @-@2@ @-@,@ @-@&@ @-@ @ p@-P`l @PP  oP%#pp@-P`Z @PP  ]P#pp@-P`H @PP  KP#pp@-P`6 @PP  9P"pp@-P`0P" @PP  %P"pp@-P` @PP  P"pp@-P` @PP  P"pp@-P` @PP  P"pp@-P` @PP  P"pp@-P`0P @PP  P"pp@-P` @PP  Pm"pp@-P` @PP  P["pp@-P` @PP  PI"pp@-P` @PP  P7"pp@-P`0P @PP  mP#"pp@-P`n @PP  [P"pp@-P`\ @PP  IP!pp@-P`J @PP  7P!pp@-P`8 @PP  %P!pp@-P`0P$ @PP  P!pp@-P@v"g>t3GP p0P 0pp@-P`@PP  P!pp@-P`@PP  P!pp@-`Pu@A"aaFP pP U pp@-P`t@PP  Pi!pp@-P`@PP  PW!pA-P:@"g>t3GP p4`P  P `t6p@-P@!g>t3GP p0P 0pp@-P`@PP  `P!pp@-P`@PP  OP!pp@-@RP EP pp@-@P!l?o2FP p00pp@-P`@PP  P pp@-P@PP  P p@-@@ @-@@ @-@@ @-@@ @-@@ @-@@ @-@y@2 @-@s@H @-@m@^ @-@g@w @-@a@ @-@[@ @-@U@ @-@O@ @-@I@ @-@C@ @-@=@ @-@7@ @-@1@ @-@+@ p@-P`@PP  DP@ pp@-Pw@PP ~P1 pp@-P`f@PP  #P pp@-PV@PP ]P pp@-P`E@PP  Ppp@-P5@PP <Ppp@-P`$@PP  Ppp@-P@PP Ppp@-P`0P@PP  Ppp@-P0P@PP Ppp@-P`@PP  Ppp@-P@PP Ppp@-P`@PP  yPupp@-P@PP Pfpp@-P`@PP  XPTpp@-P@PP PEpp@-P`z@PP  7P3pp@-Pj@PP qP$pp@-P`0PW@PP  Ppp@-P0PD@PP KPpp@-P`I@PP  Ppp@-P9@PP *Ppp@-P`(@PP  Ppp@-P@PP  Ppp@-P`@PP  Ppp@-P@PP Ppp@-P`@PP  Ppp@-P@PP Pzpp@-P`0P@PP  jPfpp@-P0P@PP PTpp@-P`@PP  FPBpp@-P@PP P3pp@-P`~@PP  %P!pp@-Pn@PP _Ppp@-P`]@PP  Ppp@-PM@PP >Ppp@-P`<@PP  Ppp@-P,@PP Ppp@-P`0P@PP  Ppp@-P0P@PP Ppp@-P}@Yg>t3GP p0P 0pp@-P`@PP  Ppp@-P@PP Pxpp@-P`t@PP  kPgpp@-Pd@PP PXpp@-`P*@aaFP pP U pp@-P`9@PP  2P.pp@-P`H@PP   Ppp@-P @PP XP pp@-P %@PP GPpA-P@g>t3GP Gp0`P  ^P `2p@-P@g>t3GP p40P 0pp@-P`@PP  Ppp@-P@PP Ppp@-P`@PP  Ppp@-P@PP Ppp@-@QP Ppp@-@RP zPvpp@-@0 P 11p@PP!0S !pɭ!0$@- @@!ȬItP 0R @-P Q o//P ሱ0t 0 @-0 ,@-P Q @s@ f<0< 0 ( g$0$ 0  H $  0S p@- X@P`@@PpP p@ HGA-P`pK" ~/@P  P` ppY!ᓬP` P!U @0G!00(Glp@-P @`VPpP p@@- 9/@P $ l0 0 0 FXA-pP &/@P"  Y0 0 0 CP/`P  ᪴` P0 /,0, 0< gN@F x@-@P !@ h }0 0X M  -A-M `V $P 0P>@P.pP  0P|> ?ЍAЍ/ЍAЍ/ U0 0t  Hl@-@P ծ@  }0 0X  lp@-@P x0 0 0R0 P.0P Q # p@ppC,p@-@P `0 0 0R Pi.0P Q " p@pC@P/0 0 0R /BP/<0 0 0R0/P///B8@-P d0o0 0QP  00SQ "B<P/0 0 0R/A@-@P \0 0 0R  -0P Q {"00AP/00 0 0RP///A A-PPM 0/o0" 0P R Ѝ R0 p 0 p-`P 0 S  R @  l=`P 0/  00@|A-@PM 0 0 0R ЍQP 0 ᱭ 0p-`P 0S ` P 6=`P .000( ;$0$ 0 ȱ?Ť 4 P H0-0/o 0"^ R  R/>P/D0 0 0R /@-P o>P/D0 0 0R /@-P Ԯo>0P t0/o0" 0\ R RP Q $Qமf O/=H<P 80 0 0RP f O/=D(0A-SM`.P@U Ѝ0 PP ,pP 0 0 0P* S'P0S0"Q00$ ,@P X 0 0 0 @Ѝ( P .<4P 00#  R0SSQ///  @-;@Wh Q 0p@-S(M-"@ RS#  P <` `YP P (Ѝp(ЍpPH  ;0  (0$ $0 :xp @- @۩- t@-$@@٨ D9A-Pa`˨@P 3(+pP  !Შ@P a-W@, M(0( 0 ( <9l (X2P S0 P \0/S 0 P */\03#//0P S0 P \0/S 0 P */\03#//-M 0  cЍ-M 0  XЍ0@-M@P0  @0KЍ00@-M@P0  @0>Ѝ0@-@P ,0 0 0Rx6 /P/0 0 0R /2S!Q  P*0  S */@/0 SR* R0:/ /6tP $0 0 0R //5P $0 0 0R //5P $0 0 0R //5HP $0 0 0R //5P/\0 0 0R /2 S00 P0* /R0:4P/\0 0 0R /2 S0 0P0* / R0:4hP/h0 0 0R /2S! R0// 0R0* /3P/h0 0 0R /2S! R0// 0R0* /3|P/H0 0 0R /"0R0/S3P/h0 0 0R /2S! R0// 0R0* /2P/\0 0 0R /2 S00 P0* /R0:2(P/\0 0 0R /2 S0 0P0* / R0:1P/h0 0 0R /2S! R0// 0R0* /1HP/H0 0 0R /"0R0/S0P/80 0 0R / 0 R0* /0pP/80 0 0R / 0R0* /0$P/80 0 0R /0 S/ //P/80 0 0R /0 S/ //P/T0 0 0R /2S0 S0 /! //@P/80 0 0R /0 S/ /.P/80 0 0R / 0 R0* /.P/80 0 0R / 0R0* /.@P/80 0 0R /0 S/ /-P/T0 0 0R /2S0 S0 /! /- P H0-0/o 0"^ R  RG/-@P/P \ /QQP/Z,P/P \ /QQP/Z,P/P \ /PQRQ\/,P/P \ /PQRQ\/+0SC-M`p pP   Ѝ(@YP+ A' 0Q xRH  `Qq%* 0 000S  P "Ѝ辮 ?Qq:0"S꭮0"S  pq   0 00S  ꑮ0"SO-MM(@P p$`Y<10000(0  00[ Q`$ 0 `;/0 `xP Mߍ ᚊP 03/P 00  $ 0:/P 000 PPMߍ:Hp@-@0@02APLs07LUa`L~0 0LWLP V~u0|0 ^P0ppO-KM P30 0뀰@p@ @@@$@@@(@ 0 0Cs0S;0fSR >"SF [Sl2 0 @3/P 0`0  0̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SS `,`0 S S0p p S ;S 0 S S0GU0 RP0/S8 0(00>S; SB 0S p@03  0Bs0SR  0 S S6 S4 /S 0 S S,/S >S S`FVw0St `Vo0(00>Spi0   $ 00 0 5 S =SB0"SO0SL   0"R "R R?C$ >R:0 C-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R@" tRT Ѝ mR8 pR oR sR ;R@' tR ;R@>P P"Po \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [R \ BR   ;R@<{  @!1 0 q"R /R  0iP 0 +r  R:Y  Yy)     SP R0g* \Rd  uR` < PZ +r PV*6I0 r 0 P P#*-"-  P P* --  &0     ) } }O- M@` @ 0Ds0S<`SSS  0>S 0 T  @P (0SP  R @% ЍT T$ @PV `vP @P \ kPE0S  0S,CG-P-M*`#@PL ,pC pF 0F fpppS>0 ;P Pu&  }0  p `r<)%Ѝ000 p``'%`Ѝ ` %Ao/A-PP 5$P`p @o#@P$@@g#@P p40,p0P4080<0<l  @-@1 ˌ@@-$@@  @-@@O-4@T ,p ͤP @Dp@Ѥ@T `P煑Q@0< <0 hPZ PZ PH u\ @-R 0P< P 4Q ,  D )@0@ 0 8, (0( 0 / t txp@-M@4 00R1SP,0SFR 1`V. P` 0 0P 40, 0C40P& `ЍpS( R$$ЍpЍp Z0 0D p yl0l 0D ݦX cT0T 0D Ԧ@ i<0< 0D ˦ sT sh0 s\X s8A-P`,p#@P W 0 !,@0`#,@0`C-`0M@SPpD  P#y00Ѝ!0 P ,0ST !0 {P ,0S(0S0 0 0ZP 0S>0S0"SM0:S D0}S "S000"S KP  EP d @@ 0>P N#, (0( 0\ ~0@ p~}<0p@-S \  Q @PPp 0 0  o||0S 40 00<$  0  0 @-< o}|X40@-S , 0C40P @ @ <0< 0 ͥ( $0$ 0 ĥ o@}x{ o}{80O-M@ Ѝ@p`  PP @ ` @ЍĒ  PP0 g 004QY _ 4 ,R\ 牱 0Qv  Ǣ P 0YIV  B B!ል,0 P 04 `<0 4 0<0  P,UM<U7U+ Y&  ᐡ@  cP  ᫝PP(  0,S<SS= S"kP @<0 P`04 <0y< ! 4,0P ӝYP |, x 2t0t 0F/` W\0\ 0,H D0D 0 , ܴ kxx kzdx kzxdp@-@PP0S L  Q<0  0p@ 0 0K/ྤ kwwp@-@P 0`0V !PP p l0 0  0@S<0  0pPp( $0$ 0K/ D<, jLw4v0O-S M@PR z`40SM x `P@w ЍP pP 00 0Sq 200PX 0S. @0R*  P# [` P 0 P 0S P'J X 2H` ЍORP 0  03/P  40R 1#PP 0 0U/ 00C 0zP |`@zd `0` 0U/L H0H 0]/ۣ P Up  hs,t8 gv4tL gxv(t(@-`@ 0,S<SS  0 0 ౣִ fusPG-W pP0`WTW@7 404 S @  S4 G000!,0 000,00$ 00,0, P  ?o @ 2\0S0S P@P : i g404 SS@ [ @D !@0@ 0c/F, 7(0( 0c/=L e$sq esqG-PS @- Y`' T 1p 0R H  004 00R% TP 0S 0 Ga( d 1`0` 0i/0,S, (0( 0F/ csp cqp`G-`P& 0 0R! 4P 4 R @,0Q p  ,04 P@Tp:80#  0P 0  Q@-P80080/$p@-P@80080p@p@-@P 80 0R@ pP4@pp@-@P \0 0R@ p`Px00S@#:rp@\p@-P@e@`pA-PP 0 0R4pt`P40S @40@S ,0o P? `8A-@P 0`0VpP)0S P @T @ <0< 0]/ @@ `@nlA-`P /o0P0"Q@@T @0R p ]@P @T @ 0 0]/ӡX _Xnl0P \@- ^ 400\@/ 0 0F/ഡ ^l4k0P @-ox@ T\ @\400\@/ 0 0F/ ^<kj@-PP M @1 0R Ѝ`@80  Ѝ@y P 4 0R S!*,\&1 B!p@w400C40<00<09 7 h ud0d 0s/DP vL0L 0s/;8 w404 0s/2x ]kTi \l i \li P/4?o 2 R0S/0@ S/0P D- ?o2 ^0S 0 S /P/0 0@0R/`P/0 0@0R/4 P H0-0/o@0"^ R  R /W 0S /A-`@PpP (0Sp X0P  pA`0 `\O-0S@9 0@S7  `@ P. X8qPp@- P ' P ! P HPX0UUUB#1 !0@<  ?,B PO 0s 0 XX% X@0Pp#r 1<P 0R R@-P 0S/x~o/@ <0< 0\ ( $0$ 0\  Yg`g0 Ygdg G-@` QP p 20 Q0  ڑPY @P Y7V W'*000p@ Q<Q =Q R YD Y<RT O  <R R B^0 QY 0UpS 0Y V W*V0 X " pV0 X ! p<R@ O 0BSP=R   <R R Y@ YLA-`P@P h0U 0 0 pP  mp P@QPp@-  R`PP`@P 0`0 Pp\PQp@-PP @`PP  <`@P $0P0 `PpQPp@-  R`PP`@P 0`0 Ppt@-@P X0 00R 00S P0008P/0 00R /P/0 00R/0P h@-o  QP  \Q\ ş/hPp@- 0 00R@U T `P  ᫟@pT P L0L 0p g@p, (0( 0p [ Saa Sax`P/0 00R/ P H0-0/o0"^ R  RH/P/@-H@T ?o 2^0S|o0S A-@(`MV PP !0 P $0S6Ѝ/ 0P `pP 0 0 0P6 0S3$ P, V8 u@P0 0p0 `@ ` 5p` 0$ 0R0"S |0| 0 ఝЍޟ0"S@:@Ppɀ\ 4 P^^$/P/< ?o 2\0S /0SP/Dp@-4P4@P@K 00Fp0S   0@-@<< T (@@+@@ @lT@-@P (0 0RP/0 0R/P/0 0R/0P D- ?o2 ^0S 0 S$/0S /(0p@-S@ `P0` P 0P llh@V @ @@pDDD@I @00 ,0ٜ Nx|D[[A-PP &P`p @`@P@@X@P p<``` 0,p0P4080<0,@-@ @  @-R 0P< P 4Q ,  <0Q8 80 ~(0V$ $0 vZ L[[ LZPG-? pP0`W<W@ 404 S P ` ^ S /000P,0 10,0$ 10P : C A 404 SSP 5 P@ <0< 0( ( $0$ 0(  KXW\Y K4YYhp@-M@#S,RP, R8S 1CaV) P` 0 0P 400C40`ЍpR S  ЍpЍpd k`0` 0< ՛L |H0H 0< ̛4 l000 0< Û J,XX` JU$X< IXXA-P`,p@P W 0 !,@0`,@0`00p@-P4Q8 @Q j4 ,<040Q<0pPp o0 0P x HWXV@- MpW2 0P`@S#  qPK00 Ѝ 0 WP ,0S x @0 @YP  Ѝ50]S$ R 0  0` 4Q$ GVUp@-@P 0`0VPP p l0 0 0@S<0  0pPp( w$0$ 0 4 FTU 0G-S@PK Tp40SF   P@xP P 00 0S>WP7 0 03/P0  40R 1#ZP' `P 00C 0:P  @ꀐ pG \ X0X 0 8 404 0 /d E<MSp E PS@40S 0C40/ 0 0 @-s DSR0p@-S \  Q @PjPep i0 0 S D$RRXp@-@P 0`0VPI0S R<0  0p@<D @0@ 0 ,, w(0( 0 #p CQxQ CdQTQSG- p)W@ `V 0P 0R 00 ]` V 0S  Gx@ <0< 0F/0,S BlQPA-PP 0 0R4pP 40S @,0a, 40a@T:8 408 p@-P80080p@-@P 80 0R@ pP0@pp@-@P 80 0R@ pP4@p߈p@-@P \0 0R@ p`Pw00S@#:qp@8p@-P@d+@_pp@-P@X80080p@Qp@-P@L8@I@@pp@-@P 0 0R`P940S ,0AT 0p@p@ a0 0O/4 ?<JXMpA-@P 0P 0R@ p` 8040S ,0X ,0Q<00<0@@G@D @0@ 0S/ܘ, (0( 0S/Ә݌ >HML| >$MLXp@-@P H0 0R@ p`P@plA-PP1 0R`@4P%80,0!qW% P P ,0P < 0@400<0AkAD @0@ 0W/v, (0( 0W/m <L J <GJ0P D- ?o2 ^0S 0 Sf/0S /p@-`P@rP (0S p p@ ,$  0 //@-TP0p 0 J <JO-IMP  @T `p0 R 2/0T\ P Y  9/0  p>PV @T!1 0 003/Y@ 9/T LTT T @T@" 000Q 1/0JT' P70S+ 03/P. Y 9/$T@T 0 0( ࢗ 0 0 Iߍ 0 0(  0 0( Y 9/Z 0 03/X T0T 0( r ;J<J :I4I :IH :HH :\HH :HH@P0/O-MM(p@ ]T 000 000R+`P$  T%0 `P4  0@ 4/@P`P@003/0 @hPMߍT0 00P $ 0R000 Mߍ0 #,0, 0H  R00 8FFH 0/0/@-@@A-pPM`P1 @T. 0@0W  WS 0A/R 0CW /RW  W0 0 B/Q 0C#@T @! @00 .<0h 0 R* 0 05hp@  GU Pz@㷘Pۍ貘?00@ۍ S0Zp Pp xp PQ@ET p@-R 0@S PR :   Pp0P  ,0 `09\ \0 6L0:H H0 .80;4 40 &pC 5CD 5CD 5hCp@-@Q PPpQp0A-SMzPA@`7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0 rP\\P WP PU /U\U fPnPtPbPUx 0  QQ 3P0 ,0, 0 CpCB 3B 29DA 0S p@-P@ Pp 0@Sp/p@-@QP Q PpQ p@0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Q>p@ #0 0@  17x?T0p@-S+@PPU Q PpQp<Pp/P PQ P Q>p@ Q0 0` Ԕ 0(6>d0p@-SG@`PU Q Q bP<]Pp PU Q QP QPU Q DP QpPQ 7P Q//P >p@) c0 0| | .5(=A-PP_ 0Q`pp XpWU@PQ  PJ V<`p p0 8/PyPv`<``Q P P 0S )P P PPP L P P 0 :P -d<0p@-P@PP Ώ $P6`#2`p |{011/@-\M@p`P \1S! 0 € ( P 1ЍrP (00p` P10 m @80A4 40 $0B 0 ๓: - :: ,:@-@^ P ^%QRS  T00QNRS"  TŒ 00 Z0 0 y +: 9G-@R(MP00Q P 0 ` p Pl `z0T?o20S00(Ѝp`0 9-0 2/   \-0 2/    \0 0000000 0 00Q0/0 0000000 0 00P0/p@-@P(MP`/ 0S, R00$P (Ѝp0-S 0 0 0 0 0 0 0 0 0  W P0V00(Ѝp@ R 0S V007Q0000 00/@-@p00T000@-@T @-@T000 000S/@-㈔\p000 000S/@-xp000 000S/@-hp000 000S/@-XӜp000 000S/@-H\p000 000S/@-8p000 000S/@-(p000 000S/@-Ҝp000 000S/@-\p000 000S/@-p @- @?^ 0."00@S  \ . P0?0? 0bR0^ < 0  0^ \#l0 02#/0 00#/l0 02# /H0S@-@1/00/T0T0p@-@ P`0S @Pppんlp/000 000S-/@-p-p@-000 000S/@-]ϰpAo//p0@-@ MP  vHP Ѝ00; 0 `1 "1p@-@M  wDxP pЍ$0; 0 C1 "1Dp0@-P M@ T T T 5 0 Ѝ0 H@J Ѝ00: 0 0t !0p@-@ ^B @208 0 0 !0p@-@PP (P$Pp07 0 :@ !`0hp@-@PP (Pp07 0 ݐ9 ! 0Dp@-@PP $Pp07 0 ʐ9 0 @-@P  <Y.+ < 00; 0 ଐ90 |/@-@P ( 07 0 (8 D/@-@P $ 07 0 $8 /R/-~x` P RgJP5T   RDJP\ P?e0 ?o)0⃑ iPI> 08P?e0 ?oP 0CP(5H RJ@= IP?e0 ?o5H0 SP RJ@. 0SYR03<PR 03<@@PP!R  @0!32P@@@2 R@֐ P//-~x` PP5? PP?e0 ?o%0⃑ iPI 0 08P?e0 ?oP 0C5H@IP?e0 ?o5H0 SP@ 0S0Y 03<P\#4@@PP/8@-@PT8U5U5E03#0@3#C#!@11@  /  ఏp@-PQ@p : Sf G Sd0 ] Sp0  S?0c0 !-0r-w0-0 R00G >Rx  -   r -  w -  Q  1 &Qx-2r-@w- TT Tt T-x:0p Ss0  Sw0 S?0l0Q s! R0s  SS   S?0b0A0a0-009 0 %j *,O-P4A@:  ႅpPA PA  مpP% 00焅` 0@T' P0=S AP` AT BX ! 녆`D0>@ @0 َ ِ005 d) C-PM\\"@X2T 0@$LP@g X`P @刐@@@@嗐pk pp ᐐp` Pn o   .p[ X0p 0S4@8@<@@0R000000,0,,0,L1L 000@000{,X  #o0S mp@ G C  ЍoЍ @K0 0 ) #  (((Ā'' O-PMp 0GW"S00` 0w@ƈP-TPh +T@`0? ǯ0 t 0{t  P  Ϡ@00Ds Pa0DSW0DA0DS"70DWu Y :\ Q SP ԏP"000T; W0 0p 0 U00S 0q S 0F0 Ѝ0S U @0` 0ꤏ000S   Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR `@P0?L L0 sQWppoW # #0M0 00Ѝ2/O-PMp 0GW"S00` 0w@P-TPh +T@`0? ǯ0 s 0s  P  Ϡ@00Ds Pa0DSW0DA0DS"70DWu Y :\ Q SP P"000T; W0 0p 0 U00S 0q S 0F0 Ѝ0S U @0` 0Ԏ000S   Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR `@P0?L L0 ࣌QWppoW   0M0 00Ѝ2/O-M`P؃@D@ [Hp0V:V^ U0DPW pT"S 00 @00`Ѝ0h00e0 0L0by@[0S V00Q000S0S Q .:[ 0:0SV00ЍW00 Q0!:[00:S0S @ d0K` `0 VH0MD D0 "00@ "00 D x-M000 0 0 000 0 mЍhO-pP$MS@PHL T P0S X0S d30 000@ 000@ԍ0 0TP`ˍ0"SW T 0"bC P 4$;RPE` P 0*S xS S& "0 @P`$ЍX0 00T0 0P000P00S5#0QPP`V 0cZ0jP 00$Ѝ5%&;RPo"00l !0 t!0 ?/&1RP:*&6RP$0SPP ` 00 0 SP0 0 -TG0 0 #P0S?0 0 6 0PT  `:m` 0PT  `0c0 (<D LT $4 `T@-M@" | d@ 0S D <0 0 |0 30Ѝ ZB4<-M( , Ѝ mD90 0#0/W,00/W G-@SP+ pE`J)4Q" $4Q J QXP0 S 0C0P Y 00 0 q$ 0,O-Q4MJp0@T Ri 0S 9 0 09 P0S009`0S ) )唩唙  @| PS0+0CO \I @p  q 00  0C 0B00 S00QE 00X0-SQZP0-S0` 1 04Ѝp8pH0l@q 0pD8 0  `4Ѝ$H@q ( 0. 0 B0C0@䗟:Q `  B 0+ B R{0P5 WV :R 0S000h7@0| | -Q000470,' 00(00,0S `=o{Pz 0A00Y  p` @ @$P p P@T   ᅆP2PO x   Q Q  0@RTYpBpx 0 bY Q! 500S 0:S  0S5 00+ C :S:`E ?`4Ѝ0IS0 `S``X0S4ЍpB婄d_T` P 0 W 0S 0TdP4P`0 0S x$t4t 0,400S 0:S < pu3 0 $a4  0Ĉc;R0S00X0300300S 0:S 30HM\3W 0 0+ Cr0p 0S0- :R 00X!  0#0, 00S000200S 0:S 020CQ 0E L200S 0:S Y2(0 1S0,000)100S 0:S 00C(00!S( 00 00+ C1 0+0S1 a0"!1 0-|1 a0 0 P1P!0 000S 0:S $H000+ CN10I0 a0 ((UUtUpPU(T<T,NSSSSRM|| T< x 4(L   xI NI$ @ t<( LG T@O-pQ` V 20 R" P@T60㸢 0R1-[@P-T@PB T"lRPP ^yP@ -@Wy0P  :R8 (2 0 0S" 000P@P:T0S! 000100S 0:S 41 0?@0Sx1 00@\P 0:S  XQ (1(:R0@ 0S 0 0ZP0 0P00 0R 0 VU0S 0 L0 0 <hJJhJEgJII DCIDIC fxHC<H d h  @ H8B@-@P  @0/ 0 † d t h@-@P @(0/$ $0 ெ@ D 0 L@-@-\" \ \ R3s 1# 0 P010 RL^%0 s 1# 00  0^w00H0D D0 6400 00 .aT00  P ,  0G-P `@p0#03w00qW@D T@! C 0 0R ! P  @ G0 pQP@-p Mp! @`AP |PP& 0@p0` 00 p0@P  Ѝ00@ Ѝp@p@P@xh0 0 X='(0@- @ @XI'p@-@PP` /o0"p@ J04 0 அ D@-@P 0 @J A0 0  \`p@-@PP /o;"p@ zJ06 0  $@-@PM 0 0WPЍ00 0 e @0 p@-@PP U {00QUPQ{p {00QUPz00Q0/ 0 6 T-1@R !0/A-pR P@a@T T0 1 !3/pWG /p@-@PT 0p@/p0@-Q-@M< 0  RPP0P 0080P@D0 Ѝ0RP  00A-P`pA@PE 0U0" V W0 p`Pp`P~P/ 0 㼀0@ 00D $P,`(p0W pPpPV W |px`p`lPP```T`PP`Pꕆ00\8`8|p@-@PMP& U 0`1S ,0S  s$0S  l pЍp@0<< <0 S(0;$ $0 J $ @-@P 0S% y0 P @0P '0 000 01 1 00y40<0 00  0 \ $,p@-@PP% U 0`1S ,0S  $0S  Ipqp@09< <0 (08$ $0 ܃\ `l <`p@-@P y00C0S0 Pyp?P07 0 ൃ --M  vHЍ Ѝ/ -- M0 0G ЍЍ/0P0@-$M R P @0S$  S"0 0   B! $Ѝ00 L0 @0 P 0S$  :dZ4(:P 4000S$/00//99`ŸC-PLR <ЍP@0P@0 Y( @P@ PU  P 0  0 2  r~ @Pt@P@h0d d0 ̂P0 0ł+ %`d 8@- MQ ЍA-`t!PPp1!M @00<80I 4000p40 4p囄P ! 1 0 <8 30:!ݍ0   p SPP@T Cn`4 P8ToPP @T@00, ,0 M+ L T!1 A-@P0!MP0<80a a 0 ` 4 4  3P>44p p'P2 D0  pp PP!@T Cn`4 P8TPP @T@0S  l嬎 p0 0 <8 30!ݍ\00囎LD @0@ 0 ́+S`$QQ $LTO-@$FM`4 M PQ0琴t0d40㘤 T V [ ZX (d 0H00;|P0S 0H PW 0 P(00gP E$Py Pt$9Wk ,Pk(0,.gP $&W ," ` X#P3 0 d4 30Fލ Ѝ, 0P3 `~P[~Pt / P@ @W  D0Sw SU2"0  @ -8x t 2D0XX (:P(( -"y 2  0TB!z1 0V9!{1 0ۀ[0!_1 0Ѐ&!0  70$0SX / ᕀH! 0 P  7 1!0  @ 7  ?@  ) l 8 (  <   \ 0`X \$ <  @-PD!`P@1M @0000<  pT TU00P @1@P@ 0 0 0 30%Ѝ./00U000000}P0ݡ0PP0 ,0, 0( =)X t@ @-@P  @ ~0 0<  ߤO-MMP㴲!"  2,$00|404(0 ,0S 0S 0S $0Sy `0@  4 A00Pp@ P82x`p00380 Pp@! a cPb뢁00S" @0=S`T`V`W`V `3dpPꋁ0#S7 8PU0  @800C80w 4@x  oP#i @Px4 P]P 0 t `T$ l@$ l lL !  4 x جT ؄ T<Ҩ (0S800C80  0<0pP p`8p 0 & z z0X0P@5P5XP0 0Pھ5 40xC  Y(0y0Se Sc P]z M PVz F$POz ? YP< R10<"2 0 |4 30ݍЍ0@址\"\0 @ 0  < (080<0 S  P 8pW (00.0 0 <    `dPם Pӝ P`l#p3p H 0E~{#3 0H ;~ 0Sl#3 H 0/~b#3 0H %~,0SP#3 H 0~F0S 0,*,0D"8pXd/'C-`"p2TM @PpP0t0L00? VH WQ XZ u0!,P   x0 00  PLQ PQ,P[PjP0 @v !0 0 L0 306TЍ 0 P 0}V 0 P 0}W 0 P 0}X |0| P 0~}@1@ P&P AHP l @p D -M_ЍO-``"p\2\M @P‐0焰删0T00U V^ Wg Yp 4P"x0  d00 0   Pc0Q Q,P\PiPP 0S 0 !@ʉH!01 0 T0 30C\Ѝr0  0@ i0 \ 0|V j0 \ 0|W k0 \ 0|Y l0 \ 0|@x@ \_%~ 4>}d ӈ \ 0` 4-MEЍO-Mt5pl% ` 002000oW4 [= 0S% Go0 0-0 P LnPg 1 S S   $@ $ S_  0s000 S SR S0 R R R R @ RQ  B RQS 0S1 @+S6 -SYQU @U0S 0S 0  m00_o`R0+S4 -SF 3yPPUpxP XPL7 Pp S 0QUL @UH0S 0Sc 0  8000+S_oR0S] @S=0 &PP &P P0S @S 0 0`SPxPPU? "1 0 2 30uߍ 0+S3 -S0S  `P{0+S$ -Sz0S 0+S& -S P kp0S P S!@#0Si 0S # r 90S P{00 0 0 d 0O{t p0p d 0E{[T 1P0P d 0:{o${{ x` ,\ 4 O-P<#@83M MpP`0080u T~ X 2U 0&N M.0A 0;PY 0SV P +g+g% 0 N 0 8 0DX=PP @PP3H0: SW 2"0 &P i6 ) *!1 0 8 30lލЍP 0 @PP - H6100SPp1p!0 &`!\1\ t 0zT@!<1< t 0zXw !1 t 0zm6 T~P \0S  S 0 0 &0 0 &H0 0 0 &0  @P#v65Dt@4l X| ,\ 0433A-@P0M`p5 V> W'  0    P @T@T 0 pPP ц0Ѝ @ˆPx ^t0t 0y\ X0X 0yV< ]808 0y  8 ǔTĈ@-@ M 00  @0 (0 0 0 30 Ѝ"pp@-@| M 00  @0 (0 0 0 30 Ѝ"pPpG-` @PP  BBz0000 C Ra CREp0pY)00 C Ra CRA CRS:Y 00Cx QaCQWC@00Cq PUaCQWCQACQ7CMS  0GSRQZ / S V*@G0 TT-@A CRSd p A BRGZ00V0S^  Z?0Z*Y 00As Pa0ASW0AA0AS70AQ @410!00 y0 0Cq P0@p W:aCQW0CACQ70CS 0} 0 x000GACQ7Cx|0Cx x0 x Bp^Sz @Y@0`< <0 x ĀݐX ܸ ðܤ hxO- l1@0`@? ` R<T !4*4.0q0 ,p( ??p?0 SP#20Q *00\*0V0 R* Q *0V000?0R*00t?RPp1?p# fy R ? Q*:  T: 2222 °21@-PL@ MH0`@p400 06@ Ѝjd@-@PM  0 0 T0 H  @EЍ$03 0 x1 ڤ@ P@-@P(M" $0  0 0 0 0<P d0,(0 $$  (Ѝ( B$0$ 0 wL08 xp@-`P0M@P& T/ U8 ,0 0(0 (0 $000P<P00 <8(4, $0 00Ѝp 0 0 wTt p0p 0 wUT P0P 0 wy 0 ؈ L\ ؘ00"02 O-P0TM`0L00v Vj 80  00 0 0 ! PPO @p =0 p@P< 0+S+0S((zP,0(0 $0 00P0 $T,$,0S2 0 0 L0 30*TЍ0  9P NUP2y00h Yd0d 0D vL XH0H 0D v~ gT8e h @$ռ!1 O-IM0p010erWW PPN x@` 0 `@P; 0+S+0S(P  0   P   0S+2 0 0 1 30Iߍ P sP2|x00< 808 0T jvdոոc D0/* 0 p@-@P0MP000' U  k`0   "" 0S0 0p d0 0 0 30Ѝp!PP004, ,0 vTb b`P xT!1 @-@PFM0 Mp0d40. `ᾌ!PPd@!ь+ P w@w R@d \0 0 d4 30Fލ Ѝ0 N,0, 0 uaa HD@-P pP0dM `00\00 @q ዌVX P0 0 \0 30 dЍ0 h,0, 0( u``H |шP88@-M8@ 4@_b0 rЍ&@P1Spp// 0 0@-PP0M@000& T MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)@P00F, ,0 F`@& ,-@$ (a ,,4@ 쏠@$ @)b!,`P! @$P%@$͌n䟠@@0@P&(` P `PM,"+ 0Pl]! `.!+ `&dA+ `, `&  `eQ &$`- +.,`뿠.`$`&`0 ` &`%,`&,b!Ϡ (@ `͌*`*@ `@$P`P@n]@$0`@$ *@$`" `&lO@@ꯠ@@@`M `  `.`&eQ `  ",` "`, "`&dA/    $ `-&`..`%`&`   `&` ,,`$`&b!Ϡ$$P (`͌P%0`P%`P%` `&n_ PPp'P @P`"p'@ `&]p'(@l@@@(`M &`  `.`&eQ$ ,` (`( `)(/(  ,, "dA` 0) % " 0 0P " "!( !$m` "!)⏠ $ "fa0,n=, /H @ +@韠+ @@c1@ % PaA P +0 뿠`%,P! !PPnP $P * *`Q *0 (0&`0#0͌ꯠ0#? 00a00@0=&`  O@lA  &`, ,Ϡc1  P&,` P,`,PPϠ`PP&P ! `! ] n0@$&` @ o `eaPP(0p'0p'@p'00 4p$P0np@ @@ M 0%`Q( 0#0#pp p, } dA ,` )4`)͌)`g`p?p`` (`p (m(,$p pplpP0pP%pP%fqP% _(P P ` P`PP@P`+@+`+0]n@o @$@ + M ( ( eP菠P  P 佋P, p*4 p' P%( p' P%  dA! b*L40,080`0``)080 0 `&͌k0_00 `=&`. `.o` `$ `&l` `&`&`&_`4P P+P%@@Pc1M`)$P `&`&p Po``, ` ,n` 'pmp0#0#dA..0,p=faP@$@$c1 @`&M`&n0#`0#m0dA(.=.,fa0p@$@$c1@ p`&M`&n`p0#m0#dAP.0.=fa @$,8@$c1 π@4`&M`&n0#`0#m0 dA= ..fa@$ @$@ <@-`Dc1HP0#0# 0͌|  0 0 30ЍL0H H0 o`400 00 oQI | @-@P 0+ EF/N Iv 2A!#L0 0 0 0 o 0G-PPp`7 W+ 100.!؁0% "0 0%0?S@@h  p 0hS@H"p ` *0V@@p`F  GqpH D0D 0 ao, (0( 0 Wo  !1 @-PP0M@0 00B TK ` R0 0R1130 0~? S pp4p 0~? S |U PE "0 0R1<30 |0 0 0 30Ѝd `0` 0( nTD @0@ 0( n"Ft E L< ` 0 0@-PP0M@000& T MP0 ^#2 0L00(0p d0 0 0 30Ѝ0)@P00F, ,0 nE Dxh 0XG-p!M@1M ࠐ0 (e050,U5PG0R T0DA +"@P2  [PUo0 ;u0 UB @P  HU0PUo0]p@Yp@  o 0 0 5 30 ܍ЍHpPDpTP  0ePPOpp`|Pb\CB- M0  Ѝ@-P pP0lM `00d00 "   #X P0 0 d0 30 lЍ0 ,0, 0$ m%AA d  13L @0+/ gE#ͫ2TvO-tM0 p03?0P+D0 Eh0@`p$000#!00`c<e $P```&P `@ek4L(p  8h p!, Pp'P0 pap=Ffk TDp  , e[dK|l`  j, 4ˆn! ᘈP  !`k  < g{!4 l[L(  , 舊ilL8 ,` h a LlɆ`H`  !h` ` 0`adK`` ` PPlˠP%PT`p ` p`HY`&k`p ) a{fii\ )` die[ P @ @fk@$@\ (aˠ Ih`  (i D荎p`  *` \8pp .*X a{ndK   "ꭌ %hie+!4P, /HP P0P P,@nɄ@dP* Pa0 0) P%fkj錈T@l@ P eZ\0! M0,0p (6m:Glɇ % ! h e[PPPPPXHp$Pp!P`,l[ !0dKmn{ @ . aP ,  . l̈`4&fk   ,la芄 !  <@`lɇ @(\ @h  @$@p@. pp!l[p,ldIapp'n p `k g},d 0$  , dK ! a,<j D' !lɎ `L g{(`a* j荆 a[ !, 8 !l@ lˠ @@d`` @.`@`@$hpa@n`(pK p ` `& ``{)Thfl D !  )L` $ *i PHa &dK * 8]fk ͈ X `  *h@00 p)p` p'ip % e[ "gz `0b,@N=S9J.@n!l @ @a@$(l0 @䫆`"X@,b+g{ ͅP@@@!D` H` `` aD$ j! T ``PP,P%`& PL`4lˠ[dKj p  p'` a{ b* n%$!  P 8e[` @" @$ @ fkLdI$b8 !,a ,   "n H)lͅpPPP%h P` eZ`$ `&`d{@@@$b+ @$flM, .,lˠd 0d $,e[! <a\0 &<0fk 000#` 0 dKa{9 . "n -T, (!lɅP$\`k  c,:" b+ @  ` lˠ. np p p, " "ac;͈  00*P 0#0 zn c- p tЍG-Pp 1Б0@@i T0 Y?W@` @@@`"VT(@T(pG  Gh ` h`i V0@-@M P0 1 3/1 @ cR c B T 0E P,̠,ĠD 80 0 0 30` Ѝ0@^h( (DQ. 00 R. Bx@-d "@4  R  *4 8/ 8 x0 S\ R `0S Р@- d@ 4 *8/ 1iBxM Ѝ/;R! /Q/--M  Ѝ Ѝ/0  0cf <caA-@PMb  `Pp0 pp p[ \ ,0pp  pO R ,0pp  pC H ,0pp  p( P0@ 0 20p  B@RQ 1 ! \' +0̠ p`Ѝh0 S sD0<@ @0 f  }@-PR0 00//@-Mp @2g``PW0D P>S 0!3100 0gЍ>SH 0!3100#g00g00/-p@-Mf@P@U0 ` ` /Px0x 08 R;0Ѝp@Ѝ/0 a0( $ hn4lA-@PP`p< =U( X0ES! S0 +0E0VP00VP&2!0` `000+W -W =W00V-0`0=+00+000@00,0]( (0 d00 uT tp@-PP@D 4a `0RuSpWS4X0CS0 pP0R Q PSPQPQ  0   I0 0+S -Sp0$ b 0  0 7d tB spHO-TM0wSp _@@0`  YW 0(0f @(A f@T%x7(P00p0000TGP @ 0 @8$a0GS00 e00e@e@PTЍ+W = W0 -S0000 0` X B R  = GS/o"!"   ( P:0,Pe , e R, "( @0偑@P(  ( 0S# (p W:,Pep , e0S,0"@(p剑pGPp(pW X0[0p0 0I00(ppW ,Wp`uS(`! Y0`,Pke , de Rn, "0@(`剑`FP`(`  n`(=W +0G?oR20S$ Y,PAe `,e 9e0SC,0""(` @႑`FP`(`V 0[` 0I00X00F0(` 0 V:,Pe `,@ e0S,0""(` @႑`FP`(`0X 000($ KR; I?I00 KR<I d$ 0@($00S`d0"SE  V*(@ T:,Pd @, d0S,@(00CP@(@T| - ? 0+ 0 `0TЍ'p  001]!0 b1]!0 bl1Fsd00(0UpL 0{+l-L +B XR R  0+B -R +R XR 0 -R  X@P`Qpl0]h h0 9byT oP0P 0 /b< rT rv m$ mL kP kt$(0@-@PMP  0 @ p`Ѝ0$0: 0 b  jP 0 @-b/o`/00/00/00/ 00// /0/0/ 0 /0 // /A-@pe`S+PSU PU  0 P@P PPriaP X000p@000cP><|cP<Z8K`0p@-0P`@T ,@T0rS $Ppp@P0+Spp@ 0@-$M0P0200q 0Sw 0P 0Q 1 00S%Xp@5 P" X0rSE 0 0P1 x!00 P @00S7$Ѝ0@]$1$!$0  @6&b@X0 00S  b@P5s0 0P( 0P$Ѝ0h0d d0 `P0L L0 `~p0qqqqy e e0@-$MP !e 0Sl 0P0A 1 00S=.p@' P 0rS; 0 0PBd1X!00 P @00S-$Ѝ0$hb0 00S@ OZb@P0 0P|0P$Ѝ0` \0\  00`D @0@  0&` p cwh} c}}\@-PPXA M@I L1p0S+<1@T4 `0`S@' 0S0V0, 0S%Pa0S  ?p  Ѝ70@T0S p-a00X&L  0@ <0< 0 _ p L a{{G-`PHMP6 p00 0p@  p@ HЍ P 0 p p@ yHЍa0S @XH0>D D0 p_&B0P R@z `zO-P4MP@\p WvX0S8 `00 S 6 000 0?!S5 0 0 0;!WnW0j Yh X00U7:GS> G1@000`"  0 P(0@`0o,5`0$0XZ 0S>0`gW A,`0 fZVW ,P@(05#K 0T`X2@ 0 $ $Q T  S #.E!b)L@T(\/H0#"A $1?"!!#:  `V4Ѝ3 00 0;!n3 0 0?!g|30$0H\1Ld0L``00|20SpT,0 P@ `!`Y Q0V0 P ,@Pv P[$:6S T00U$0%%>!E!2c(\/H)L0TP%"1 #1O"QX0 "0 0 0$00?S%D PP@f`~S8 5HT1>O00` 0 0T &.60S 0 0P@0(0\10X00`d(0@t0P`d(0 Y  R3@< 0!0?O0Q쀟p@pP@0 WU X 0W 0 0P W 0 0X Wt0 0WX 0W@-@+h9 B]t\ B\\ Bd\\h\O-`QM@Mp R W T  DI X^ @P@\ [\ {\P }\U PE0]\\ \8(5PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S008( L0 SV 0F 0C0  X0 0 @ ]RR ]RR y| x0x d 0VX WeT FP0P d 0VY8 404 d 0VM ?PYYT ?YY >YDXp@-@PM`P( V1 0  0S0 030{S 0\ {\ 0 P Ѝp0}S0S Ѝp@zd `0` 0p VVD @0@ 0p VX 0 =XW =XWA-M@PMPp`  ; 00000 00< 0 ;S ^0 0 ލЍ@\0L  ^0 \^\0@^9ލЍ 0 | 02V >a>>>f>|AO-BMM 5 %005 u0 0p5 0040   +0 P 40 4<P P@\ P 0S p400#S \ P 0S 8d84`0`\ P 0S d4`0`\ P 0S 3 0   \ 0P 0S n30\ 0P 0S nd30\3PEX+0 ` ;<3P00\ @P 0S JPP[[ !LP200xS| "|2 0 4 30BލЍR@P\ QPx 0S \200#SL \ BP 0S $2$R0P\ 4P_ 0S 100xS0xS0S) 10 0sS?0wS<0!S 71Q0P \  0P 0S nd10\ 0P 0S n410(10P" 0 $ 0xS0S {00  00 0000~KP>L " " !Xxi(@`  P  xh999p@-d@@0S P Hp@P@P 4xP 9p8`:t p@-@P$ P0P 4P fPP"KP VPph`h`LPL p4 000 0 Md79 2 7|p@-@P$ P0P 4P ,PPJP Pph`h`PLӶp4 000 0 M|68 ,1$6p@-0\PP 4P p<`<`P@ॶp68( 8@-@@P 00@O-@P$M4 0 0S 0Su 9` P0 0p V0  ?  800 r0 ?R [RR *R0@ 3 l8000s0*S) .Z S /S"  /?PP$Ѝ[S8 \S  0R0@ 00?Sb S *S0@V0*SV0 ' *S0  0s0*S YP$Ѝ[RJZ /Zz 0 !S^S  V H   Ɵ  R 0@ 00 & r0]S1T -Rw ]X0@0S /SD .SDB 0S| = 0U/S:v\Rs  0@o/P R]S /S \S$ S\ -R7 @0XV @]R0^J p P0@  S ><@P RV@P 00 T+ 0-S T@ V R]R@0 @ `$ r R]R \R] SX00@00 P   R   U/R S /S T 0-S T  0R_S @0   @0nR@ @0]SN -R ]Jo0X@V R S0R H0^ pU[ZS 0^ p P0@  U,2|("(0 K:2{"0 K.Ro0 @  {! @@c 0-S T @ 0> 02`! @LS 0p0C00@P0V0   峠zZ1 0 Pd/Z  #   r R SR0 i / =:0]Se /Si \SD . 8., .@0P@-@ P M 0 Q 8Q n?o 2c,|,Xp@-@lPHP X HP T00pT 00pL 0 p, ,O-M"0  "  Hpc P   1 0230Zߍ PT 0 %p H  P7 R @;` 0  0P P& PP 0  pP 0 P0@T*p@ uK 0 pP eL - R  lO-M"0  "  όpc P   * (1 0230Zߍ PT 0 ᚹp H  P7 R @;` 0  0P iP& PP 0 ႹpP 0 gP0@T*p@ J 0 epP K - R   LO-M"0  "  2pc P   1 0230Zߍ PT 0 p H  P7 R @;` 0  0P P& PP 0 pP 0 ܸP0@T*p@ eJ 0 ڸpP UK - R  | ,p@-`P@P@ \PPpPXP p p@-`P@P@ PPpP?P p (p@-`P@P@ :PPpP&P p 0 00 嬷P-H- M0 S0 0 0 0 00 00\100M\   0S08 00 0 0 30KH Ѝ/-H- M0 S0 0 0 0 00 00\100M\  0S0 8 00 0 0 30KH Ѝ/4 -- M0 0'--M  --M  A-PPp`p V" Q @Q <PD@t0 0000AgL0H H0 :H400 00 1H0h !P!X !,0P R   0//M\\'\7 O-@P0LM0D00 8 P7f/0HA00 00 0S* R 0 :R|RF  @ ` [ 0 0TP PdDPwX00X0<: P $& X00X0$` xF @p$0<(0m p$000ep 5$ 0,  Zp 5$ 04 E @ P)l !`50 vP >p$04% ,00 $E$ @U80-  P0p<@`(p8408@$40<4 0p4 0p|4| 0pX4X 0p444 0p$P4 0p$T3 0p$ 303p$ * 333 3@a@0`0040 0,40 0,̠0 Ġ 04!!8..<""@ ' R 9 @0Ps@qT@  A@=@9@5@1@p㔐 (   p$   yp㜐 $ R , mp ,'Cp ap㠐  P . 10@Q0 P0` B\P"#$#< 00 1@>@t@p$005T0AW5V2H@00ap!0 0 D0 30LЍ 810p"  qCPX00X0!h0 0 CF2xM \  , p`<\$P4d~~~~h~<~}L}$({{0,z tp@-@P> 0S0 A0@0T9  T04 0R/Q T:\% 0 \/RT0C"/QT 0C: B0PU0P!Tl00p\@@PT F08@@0/S $@@@@zlzTz0x`A-M@PDA(qp0P: !0C`0 0 0    0 b0C S&0 p`G0 00S@ 0S 0SG0"S D8#Ѝ T1r0:rG00qv{p8 ' @-@P6 0S/ @@T3 0T/  0C/Q T% !@# *0P@/S  B3@T@!0 08F  Q B3@T@!@@4@0/S @{P-DM0  000Vp 804S DЍp@-`P+p P@4p V U p@p`rUP p` c`]V፳|P?o?o 0@-@c^?c(0C^! ^ P@`c5$pC&5'&`c 15D0c 00Q!  "0Q;:0 /0 @- / 0%D00D0;B 00@ 0/ E0 0%D00D1;B q1@ p0P/E0/! 0QPoo A-@@aT?a(AT$ T `Ppa6A6&pa376U8a0100S00#!Q00;:00 /0 @- /  0#D0  0;B 0/ AC0  +0#D0 Q1;B p0P/AC0 JQ@ @-Nq@ JF@ @-Cq J@ @- q J@ @-qPP `∲@-E00p@-@PP  p@s01 0 C@ ?0/R//R/?0S/R/P/R/p@-MPP`V @T x00DЍp :   j+p@`$ 㤳yyL 00 R /kx,@-E00 0S@x51Ed 2 Cr0b0aR0cR0A1R 00$I"I B``C/)P( L%@  @ "bQ0"G-@0D \ͬ ̬LP `L,@0L0D QW ^ࠓࠃ Yࠓ^ S\!:O-p(BP`> @7P PXY  P (@-P  1M@`00\ |p\ 00S30#^0#02S000R@0 t d0 0 2 30ߍpP @@ @q(@0$0 dO-P 00YP(<Ѝ0 0P( 00 0U 00S  SJ 0 @$`Ph08P `Cp @= P=6P p W R0 0 @$`P0 `Cp @= P!6P pW R0 (000@ 000@(Y(P(PzW0 GS ( ~ +Sy -S0 P000P児ಐ/P:U X P( .! @S \0cP$00 0(0v,50 P(]U0W,00h0p00:=0 P5P& p/=P 5PP 0(P 00 S7, Y2# 0@ /Y- 0@ 0 00; 00P(/,c0 ,>0dS,0v>C 0C,0P(  E Ϡl b0,0 Y0 00 000 7 ,l,,0 Yv>C 0C0P( 00 0,50 P(0P(PY%S 0,,  ,00C0P( 00 0Yp 0 0 S0P( 0 0 0Y 0L 0 089 00[P(Y{Y8 00JP(=0 P( Y0 0P( n1,,  Y,00C0P(m 00 0y0 0P(_ 00 0k,0 |,0$I"I/A!b!b0C 0P( F 0 Br0 Sf0(0P0Y08p7 00P(?c0 ,P0S,0P(E  E /"bd2#,0 0 0 0 000Y6 00P(Y0 ;0lP 00 S 00Y((P20 0P('(P000,c0 P( 00 000  R 0s @` 0 @00v 0PPII0K1c ` @aa B 0 0 B  004 %!E!/#bb K/) P L@!(,"@aR 3 : ' @aR4 # 3 P b4h$  Q0 00 00 0(0 51E2?3c#cK?)P( L%@#"(<2@bS3: 7 0@bS#3  3  0 "!00C0 0 0@MP, R0PS00=P,0YP @$`p(P 00 00YP @$`p(P  00 0 %!E!/0#bbK/) P L@"(@bQ: 7 0@bS0#03 X"  !1  B00DSd0,0տ4 00(00N~0 S&0̜ ̌ ̜@̌L@X_pO OO @D G@Tr 4 00N~ Q@(p0Pb 0(P0 0(PP @ ACLCq| \^JS S  00S3P0 z G/o("PzWw (PUSG ZSP @  PD00(00 0$0* H 'r0PE ,S#P ( P( P%!E"ad2c;S,0<2#TQ(P 厀Ḁ@CP(wMP P(P @{ @C>0P( $(0  @_ 0 @YYP(  00 0ehYP(  00 00@P0SM 00@I0S 0@B 8,00 0 0P , P(01(000C.$0y,a20a\Mc^ P#   0P , P(00(000C.$00 0S,#   0P , P d# (0(00c$0<0M0 00Ѝ|1A-0Q M@PHP PM Q%d1 P01$T G@@ Pp ʵ. R! v` PU  Ѝ0 P0  PgfF ` La `Ui?T 0 ЍX  0 01V?00b ܰ\ <`@@-0M@ 0P 00Ѝ@-0M@0P t00Ѝ@-P@h_p@-PT!pP10M `@00,00@ U5    P00Q Q Q ,H 0 0 ,0 30%0Ѝp ,H  ,H> 0 P0;L L0 <80:4 40 <}}T ( ٠p@-@PP U 0DPp P @pD07@ @0 <U(08$ $0 <d hl @G-pP`' X/ Y @8VP0PES  R D PEg$0V R  RS0@0D@ D0H@ @0 ^<X(0I$ $0 T<  hR@- 0BAs @ Q0C@R <@O-PP┡ Mp U WC 2@PI 3PI  2p`M 70101S Y3 Ѝ020P@2P- 0 0P t20 0  <0=   <l0Dh h0 ;E2=0080C4 40 ;l3zD  @-RQM @PЍTT =@ЍЍ= 00G-`-p!p1@ MP0M050F ?PQ IpI @\B^ X0p00tǨ0 O00 TVc5qύ@0ˠЍ (, @P . P |0 0 5 30ݍЍX0DT T0 F;I=00@D=00rxwv$ 00- $  M  Ѝ|vH--M  IЍ Ѝ/ -- M0 0 ЍЍ/O-@P−Mp ` X X00?0R.00P @ P 00 00P ! !  FX\3?OPD .VP WR V[XpPVppPW` @ `f0`0 +pPP `C@<<1 0 0:W`00 !1 00g0 Ѝ吷C0 P P00U0 Ѝ0 :`pPP V pPP `<0?8 80 j:du |hڤ `L@-@ M0(0S2 -0 (0p p1/`vqP0)  0 0 PUoR <0PUo/ ЍP`TP 0S  0CPo/$<00`P/@-P M/(0S: f-0 "(0p p1/`vq@0/  0 0 @ToR <0@To/1`V ЍP`T@ 0S  0C@o;T00/;00/p@-PPE 0eBS5 @Tp E2 Rp00P0 P 0S PcP0圶 00(嘶 00 唶0 S,P 4P 8P p@RL0MH H0 90Sp(0K$ $0 w9(  ̜p@-P$@@¦`Sp@軦Q@- @@ᴦ]S@讦dPp@-,PP᧦ hT@ᠦp0P@-pPQMPE 1 @ 0`00S P 0 XRp0pPPS8  5'  U80C0GS0S0\^*:ЍU  !P\^#Q.S*p 0A a 0C ƒ0F 0 8! ^#QN^^ N0 Qs0@n ʌ4  R  *4 8/N@ 0X\S 040:8 R РS /VjBx@-Pp`:L@L0@H@ఀ U   DŽk޴@-P`@:0 A-pP∆`@P( T0  r0 SSS<v S00 S 0060000005%0 C8T5%0 98%00  00X50000  ; 70Ls0 20-V00 ^V00;\ 40000 00C!00000LS0 100C0 0?V` 000 00000 \ \ 00y 040000  70Ls0 0 h", 3010P;\ cP3`b0001~dPk R SXd0\Q3 0100 M \; =\K \7 00C00L S h0100C09"000 0  Y 00Ls0f" 0W0Cs0_2 F0nR!  U50#\V00S003%V00S00&0F?o24 00=`Foob%d 00!00   00Ls0! 0W0Cs0 0 #\ 00 0P0h00L 0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP=cP$dP900Ls000Ls0 0<00rP00mk` `D pp H  Ƅ O-RM@p 8 0SA XPJ T P 0 0`0 @F-PC T@D 00X `R)R)V @F 00#800ЍU 00 }0 0/|60Sl h0h /0p6 R @T 0E00Ѝh800 š ߌT d$0  00  դA-@R`PPm /.#C=1"#BbQqU> 0S$ RT 10 R RO 2/!1U 0000' 1/0P p $@"0001003/0P!p0  $@*V00 00 R (^000P3/0P U  R  SV  0S=P00U DDpD88CA-@R`P Pm / "H0#BbQqU> 0S$ RT 10 R RO 2/!1U 0 000' 1/0P p $@W"00010 03/0P!p0  $@V00 00 R (ϰ00 0P3/0P U   R  SV  0SkP 00U BB4|ATAP\A-@P{ P0`Pw rpPg  00Rc</.#C="#2caqV8 X p&2PXU $00|1p00S !X1003/P00> 000$0$100S100S 3/  000``0S 000S 3/000(0P` p  0000S=ްP0000@0003/P 0@<??D?>D>A-@P{ P&0`Pw rp Pg  00Rc</ "H#2caqV8 X p1PXU $00|1p00S 2!X1003/P00> 000$0$100S100S 3/  000``0S 000S 3/000(㙯P` p  000$0SGP 0$000@0003/P 0==Dx<0<</\0p Pp 2 `I `\q @` /RR.\*  B R` `F D/00940 0<pf 0: S%  S/ L/o" R/\ @ DQ8 .PQ [0   YI/R W00Z0`# uᛡP.T  .   RV 30/\p0#0 @ /R0 [ 0/ލ Ѝ@  ᶯލ Ѝ.<04 [? 0/    P B4004>004004004?00400A-@P Q 2P`\Ppޮ@P #P`V u40"S `m400@p@- PHaM`=  -4QP00 P; 00^% 0@0 :^0@S \S 0@ S @ 0:S:^ ^000ЍpL0P <0 0  4 0 @S5<4L44p@-@P`P3 V( 0Pp:P@ R0R P:U P0@Sp P P@Rp:UR:Rp@0< <0 1(0$ $0 1d < d00/$p@-@PP" U+ PE0R R:Q|Q00Q0S"P0@|R  :RRpT P0P 0 1U4 000 0 1p |(( PO-M MP ($ 0 p800D40v 0S 0S 0S t4!S S`h`P PP6  㸬pP 00S RD P0 PD(P ` P@U"0 S* Z :S `\S S S 0T:H@DyP U@p+ 岟P `P0 SZj[0@0#QQ 9P6@P00S0 6 p0,P040(000= P 0:R~ p0Rt4@<0 0 G 0(P<4`PC pP> :00`00 [00S  eP@`  ջ 0 P= PMPv0Sጭ00aY@D*0 S :S `b[ ` @f `b 0:R& P0R 0E`F00S:S:00`0H F[0 D0 @S  O R0Cy `# pP 0H@D IpG᭬P @ p ,P pU  XD0A0$0p#3 0 D4 30ݍ ЍP@ ᄬPp2 00%@ ‫pP @T3@00S0,P`UA `P0U;S< 1@1@00"2 0 /0S"B2 0 /0Sv" 2 0 /0Smh" d2d  0/c 偞 }0@ᩬ0S> 0H.H0 N(4>0.00 E( !0A`0`0S0 "P; 0P0C0S 0000`0S00:P 0S0 00停0S0`000 0 "0P P0C0 SP 0`[00S`0`0Sʶ00S0Sp!p3`0 S ` 0xP 0P `0 0000W `pG00Pp0W0S`J0000P0`0S 00e{00S 0`0[RP0000'  0 P!P+" $P00S0`050停0SUPQ E!p,0^W000`p000`(0 (W- ,0&0P$0$ 0 ` @0-S ]S `/ S) p`0!0S<0Sp!p3P 0 09000 XPpG0SW ` ፤P `0C ( 0 Xp P p XPpG 8`Fp0V6` 0 m΍pC1W,p!pH0 +0BMS00 Ym0H0 00C0SZ000pWH\0XS 00 0, 0        H 00 0,0L0 P003 0B SB*n ,`唣X0,`007 F<0407 0080@PDPBQ + E M P^  AQP Q ` 00ERS Q!P 0 000 0XRe 000S >!P 00 040pW W"80Q QWWp5m00@)Up $ O_U$ oQ <`F@P Rp1*VV 00,0`pV_  0,H  l 00 400S H0S 0 0 0P(UpnNQphAQpc+ E* NU[ V0Ul IU} W@ @`h  ,000\l300YYl  m( $$( P: < @P sP& 0 0"S4 gPx 0 0PRS 0Sl  P HiU nU& D0U 0 SuP> X 00 0 U0=>0>,00S,\P( V  0@00LHLHr p , 04s 00 @]k 00 ;00C00S0 S0p0kX0  Rw `  R+ p V0 B0 # RP0 `pHp  RX 0H  R7  X B   H 00+ 0SP HW pA 0 `0 000,t+   l ( | <  4  } {HpQXL`P 0 p(` 0T000$0 P7 p0C $% 0 ۡp# P p1 ֡p ѡ0S (0PS0`0C00S 0S p١P0 0@00:qP (pY X 00 0r0SaP W( V0]Yz Qw P CPn0@(p04`0@p T t``/P `'P$00 @0P, @0P,`4` pP Pa P  P Px P 034#40 #00C. 00sW( pw Wx(,0\30LH0\-  `-p0S0`0 Y1 0 _P0` S0 B 00 RP  3YPL`p 0` 0x400 < R?o20S,Y' `pHp0 )H0PX B   H  0S~P H0 ` H00CPbU ̠P p0CA L$> ,0 0唠p0 P s ἠPY0`P pp0C00S>P WW ,0z/,0ZA-@P`p0 DP@-` MHP@p<0P 000-P ЍhA-@Q8R`Pv v $200S8 0P1S010r F00v`0P$ pW@0PD  PP^ 0 #00P0 0 C `C000l0 Q  Q*RQ1 #@0000 B`0MP%00P0s0 P +00 #B0T0`P P0 b" B0 "` z wDp@-@P 3~P p0@-P$L M`T 0S pW 0 7/@P Ѝ-$@ Ѝ$08 0 "0pX v0M 00 0Ѝ0A-P$LM`pT 0S $X  0 8/@P Ѝ#@ Ѝ( p$0$ 0 !0$ u0M0 00Ѝ0A-P$LM`pT 0S (X  0 8/@P Ѝ#@ Ѝ( y$0$ 0, !0( u  0M0 00Ѝ0A-P$LM`pT 0S 4X  0 8/@P Ѝ#@ Ѝ( $0$ 0D p!04 t(t0M0 00Ѝ$O-MPpD@@`V` T6 0US`$[G 0SD `VA 0 6/0S+ $l @V 0S HZ 0 :/@PЍ%#@Ѝ0$lV 0 0 !0H [0 0 !0h Jd0d 0h 0`D }@0@ \ 0  rL rpT rD r(@- @MsЍ 0@-P$L M`T 0S 8pW 0 7/@P Ѝ"@ Ѝ( $0$ 0 08p qP0M 00 0Ѝ 001/@-Pp`p"t@t0@p@ ĬU  @0 |ў$ ⱬጩ ~pD0O-$Mp03H0 00 0P0t 3ʿ0 00P`! B b06<  @BU^PE @ 0Q4BL3@0 MTT MT   ^DP!q!@2 Q   "  R  R  \00T3p00 01@000@0@PU*$Ѝ@2 0M  00P- S@0^^?0 0p0  P 0J ZS0 | 0J ZSx R @ \1 0000 $Ѝ0\  v  p0\  f  p0\  r  p0\  s  p0\ 00Cs0S00 p0 0p0\  a  p0\  b  p0\  t  px0\  n  pq0噜0PT 0 Dr RP0\  @p_  pl QA-@p`P ᖜP=0D! D?o2]R0S d0T"@=0 !1 U U 0 P0 A Ը TA-P@p`2P.T T ! DI632 0 A_T 80T"@%0 !1 (0D,TS O-`$(p 8SM PP 0p0D1070$0t1 0x10 ?o2V0S 0S W w@0P0  0P0 [00 #0@ S P|T- U T 0  1 #P00?{ PPc@T`P @  [TP 0@T0P00IC1S@1@! 0<0#`ⵚpPA 0  0<0S V <0 G0CPa  5* 00  R  5' 0(0  R 00 00 00 "00@\0000S \ PP@T`P450%00 @U5%0  UP* W4z$0  TPX4$0 4$0  0Sx4t$t0 ` T# `@T 0 p9/P00֚ԚҚК#3 0 D1 30 Sߍ@@e 0S`(O 0S,0  yVR U 0 0@04p 0`0 p0 $  A aɠq4ʌP   !PPPPU@ $P,P U]*   0@2!p*>) `. 00 0< p al (0~s(@  20,0&T0 0S0"7000PQOM{00, 0 R00(00S(0 00 00P4p 0S 0SV W|1x!x0 4p600IT1$ `@,@ | 0[P Y4*  (0`0S(0 DQ aP T `I 000p0,xT i h| hL h  gT g g gTTD d@L@- M@ (t@0@ 80 0P@ 0 30 Ѝx@- M@,  (@\00 @ 80 0P@ 0 30 Ѝ p@-@QM`P0  0 `PkЍp0@-@RMP0 0( PUЍ0-M0   EЍ-M $6Ѝ-M ($'Ѝ@- M@@  0 D 80 0P@ 0 30 Ѝ7t@- M@(   @00 D 80 0P@ 0 30 Ѝ H 0@-@QMP0 ]0$ PЍ00@-@RMP0 F0$  Ѝ0p@-@Q0MP0`0 .0$  `ЍpD-M4 0 xЍ -M  gЍ-M $  VЍt-$M  0 00$ЍO-MM9n S`< 9Ap P@0  @;p IBIT`p$p `T ?P 0 ST U  ܍Ѝ R U  rPP 00}h@-p@-PP@ D!!!!@I0P0 @p0y 0 { [@{A-`P@P( T1 $0S:0@@T(0  0 E R ( p0S$  0 0 Tt ?p0p 0 $0S%*( p0S$ Z\{ { Z0{z@-PPM@`q ,0PXPH00rPW0: S Se  SЍP P 9TP SpY`P@L0 ``\0@D`.S0800 !1 0< -` K0 0H #c K P'P P 0%,0 ฅp,00,0 P , 0  LmmX L|mdm0l/p@-PP5 0S %#L R6@T@͓L 0RǓ@T @TP 幓,0 ᴓ@p(~0yp@ uT P0P 0X @`dᓓV ` Jk<k@A-PP @TQ ,0,NQ Q% R ``@T qL0S 5S0T $4 0d ; BQR@' @D Q\ 5`V `HV`05,0 $ P ,0<,0@`V   <,0`&V`P@,0   bP@ 50 5$ @T 0   0S00 /\,0  C ^00  @Q"U2 0d Tm@֒L0s~ ,0 `L0SR 5 ,0(哅Pt(各H,0剅P00\p ,0/P W? `J 00 00@hS (P/ 05 PU,0 R<;p(6 505G,0 $0S005@=@n(;0S 3P +,0 p( 505Ra``]`(Y`V0 5$ P0 5$ IjjL GhDhH))Pp@-@P T UUp5 0 pH "D0D 0p ", (0( 0p  Dxe, DPeeA-PP`F L'p@,0 $5 S9 S@T @T V,0``<,0L0S00/S , @ h00 pp@ U00呄P, 1(0( 0| & Bccp@-@PPP 0P0S 0`00Sᗑp@c((((勑$0B 0 Tpc0 Bc8$1$0A-P (M`@P @Ppp 0 00@嫿 P& 00C S&0  p0 0 0 S0;1:(Ѝ 00?G0?GI "00(Ѝ0ۜ BX B B0M 00 0ЍXp@-@PP P PpPp0* 0 ~T @a|p@-@PP U p@'P0BL L0 U40C0 00 p@S @aHS @a p@-@PP U p@P0BL L0 U40C0 00 p@S8 @`S@ ?`O-PMp 0GW"S00` 0w@dP-TPh +T@`0? ǯ0 ! 0  P  Ϡ@00Ds Pa0DSW0DA0DS"70DWu Y :\ Q SP rP"000T; W0 0p 0 U00S 0q S 0F0 Ѝ0S U @0` 0B000S   Ѝp p㙉 㙙 㙉A㙙I XR 0AA B PR `@P0?L L0 QWppoW :@ =:H0M0 00Ѝ2|/@-LMpP`@$0  00KP LЍ`0 ̐LЍC-P!M1M `0p0猑0<07 @PW p1 0S *P(2   zP* sFR P $PPP) 0 0 < 30*ލЍ o9n5G㨀R 0 P P0n SP0S  u@rP~P|P((fꦻsP԰pp@-``@@p@  P@P pZ`V`p@-@P @(0F$ $0 ?@C 9Zx@-M@ Vp 0: S  p  HЍ%00ЍO-P-$@3,M00@ eP0pST1p{U00Sz00y Pe0P$0@P`0 U  0 *S 0 @Px `FP@`0   ᤁp P@PE0S8 PUS0  Y*0Pp R 0 U T 0G U@PP @Vh 0`0D00@ @$0,Ѝ0 ᇎ00 0? $00S$0p0P Q 000 ; #p t p @ 00 001[ 0 p0 0 0 S 0S[ lP p 0 S [ 3L0H H0 5 @ឌPP p1Q@ 5Vpp@-P  @T @T0 0pp@-@PP U  p@ *D0:@ @0 U(0;$ $0 U 4UU 4U/O-pP M@`0& X. @T fP @W P51 5*P @ 8/P  00 UWK:P PU@ ЍD0r@ @0 X(0s$ $0 T 3TT 3TO-PLMp@< [ TW< <000$0D P [ <0Sw 0WPD0`p00< 0G 000p 0 `;/PppYb* 0 h @( `P  R P`p,004P`Z ;/P R ,0V\P5P1@1*`Ip ;/P R <0  W@I 0@@ 0Y:W0@  Y:p I 0;/0P  <0  0I00 p' R` P0S <p00PZ0 ` P@000SCv 0 0` F Q0#03Q0SU (p, 04P8` Pp ;/ P0 P0R` pp`;/ PZ P W 0X$0 S 0 U 0 EU B  3  S0 0 SQ1:(p, 04P8`0S"*$Q R0B 0C0 0W00|@D 0pS+ 0Pi< 0 t`<0 <S  RLЍ <` UE W 0L0 0 Y ( 0  S``V 0`S`jp @@pPꊠ@ W[` ;/ PP @ pT00 510 *pp `;/ PPT: ` 0PX$0DSa0 U 0 EU B  3   S 0C 0 JU 0 0EU0C"030 00c   S &0 @PCUP00p 0;/0 P0UpJ* p a%;/ P`pZ P000 JU0 0EU0C"030 00c   R 0Q$ @0JS 0J 0Q $0S 0 Q 0A A $0` S 0JQ 0  A<0SD * `00 P`( <0  0Ip'0 0W  dPh `R^ '0 0 } x0  0[_t yp0p  0 UX &T0T 0 [00 )$J`J, (hJ (JI (II- M00) Ѝp@-@ PU 00S  R Q Qp#0P 0  P  pD0D 000Sp@-@(zP(zp0pp@-PPM`& @T @T T0 Q 0QP ``-0`P 0 RЍp0i 0 c F &Gp@-MP@_PUP`0S$00600 00   }P' p# PQ" 0 00CR0 000S 0S$0Ѝp"00`$0L0L 000Sp@-@(]zP(WzppA-p`@PP0 00S (AzP   (5z0S sP   0S `(z0S 00\p0@-@PMP # P  0P咊p@ @Ѝ00 SP(0<$ $0  , #`D``1@- (M0R0$00< 0SQR@ 0RSA!0 0 $0 305(Ѝ@@    (00 $\0R0$0L0S 0S ( !0$ R0 @P <0 0 $0 30(Ѝ@b, " "\p0PX@- D  R4   Bh0P@-X  S H@ D 0( @$ BDA-`PpP@p U! T 0 F0PU 000\ LL0?H H0 U00@, ,0  2 8A2 Ah000S x0m.!D900 /P0  \0\ 0 /[\\`\$ 0 0A-p`W$_ QNHO@A0?H8c` P@RX0X 0 0`a` P@@U `! [T[Z[|p@-PD@@ x0S,000P p@ xZlZZ<1A-0@Qp`P`FP | {x0lS AA0U0HU8!04 p000 0 [x?UU @P P0p0p@ e  B0B10U  ?ࠃࠓPT0YP P0 <` xZYZYZ8YpYY> >,X(1A-0@PppG: `< p@maH XD0D 0 , W(0( 0  l Dp@-PP@" T+ Pp `P 0S S^P p@^p0p@/L wH0H 0( NT, x(0( 0( C h 7 K0@Sp0 00q0 0 0 0P 0 0 1 30Fߍ Y:wp0SX 0S P 0 0ꩥ|{A-@ 0P`p`0  0P p@-MP`P@@P@T 0S  R0S @ P:PЍpP3PЍpp@-@P ppPPp0@ 0 H 0S/ 0CAA. q.S .R Q P-S Q P_S /@-0 S?RN0\L 0RF @PTN 0S`U DDpWe U_ ^" DPD`VQ S`. @@@0T)\ R /  R 0 0 0R0C?o20SJR 0\ 0R 006 S0 S 0R U. ^2 D0D@T 0U& ^ D`DPVS` D@D0T^U ^ D`DPVS 0R`V^0Sp@- Md0@0(  P 0R0 0S  R la  haR 0Sd 0S 00 Ѝp 0S S R, 0S 0S0S 0S/@- / 0 R /0S S/ 00S S/0S/ //0@-@P M 0S PP 0PE@0S0S 0S  Ѝ0$0n 0  ޼x@-pQM @`PQ Q Ѝ0SSp P*V0S" S  0`S Ѝ Ѝ00S S<0 vP 00 x,p@-PP`@ V T! 0pɣPpx t0t 0 MVX T0T 0 BT8 404 0 7   ܰ8dO-MpC80 @:0 0`ZP00  03/P 0&,@&<(0( 0 SS0040R0SQ  R@p$pV? ,PP:00(Yp0   C 0Z`Pf00  0 3/P] `>[@;[8[Z pM40S?&<(00S !T? p'[ $[![zo4 0 0DaZ@P200  @@ P) spP% $t0 D0R 4 4S|Z 4Sw 000p0 T &<(00Sb 0D'TS @PU0(pX,PC [u 80H cZC曟J` h@X Zt[. 0 0E   NP $Pr P0S S000 p0S+t[Wz 80LE0S6 Z00Z0020 0&<(00S4@ @PW 0 8(5$%0 %?R (0S` #0Ss`Z00@ $0R T? TThT @ @PW_(0S p<0\`C80D\K X<0 C ,0PB 0P,0(00(0700S@@Z@j@0zo4 0 0SY@P$00  03/P .X00pS  @a@ kXkPjlPX xx (  ̨\ ̀80.@RC@Pq"&<(0`| $0 `%t 0 0D M$0S 0 0D A0S 0 D 0580. aRC`@P3@0.%t` V@0 ?XPk0000S 0R $RZ $R 0p7O-SMP$0@4 00D10]q`P YqpP X8`0$ 00pS  0  PN 000 PPJ @@PX 0  ?Prr@|#t3 0 D1 30SߍY 00Y00 Q. 0 .Q0Q RS# d!"Ss** 0 Pwrur @S Rd!"Sf*.[ 0 PD < Pd!q 0 DDQ0000 0000 PzR0=S X0S# S S Q 0 Pe0s70SS0S X000000  Q000S0000 P?yX00 0 P5oX.[00 0 0sy dX00u 0 .0I0 }PPX000 DDQEX00Vq>X00Sal`L ǘDLO-@M Y 80 SS `PA 0P    0 S   > S S+04PTP 0   0 pPp 0  d1 pЍ 4P p6pWW00WP P P4P pP |qxaPp@`kT`m @p0 0 0 0  " $ & (    0 R 0 @P  0 P, P0+0  400  )0PqW`d @ LlpWU  0 0S ;! LN4O-p"`20020* 0 ؀x@☰06 ` &     " $ ( * , W 0S0S  ` 0 - "2 Mߍ踠P P0 RS S 0 0 0`P  = $@`00,0`(p@ p$Y i792 I52 0Y00 S   S  R  R Q\  ^ \Q/o" S R0S  0 PQ +0 0S Q0S %60P$0 ›PB $ 00 B  `B0PLY# $00X $C&  0`V 0 \ 9 00^ Q  P V \  R R   p* Y P$@`@ 0S   0?S CC" 0c6#PY @帐$@ x ^h \S㜐Q^@$T(p0S 0`$@$p,p T 0 d342 D52H 0SE0 S > S PR  PL @0 X0 0`P`&0ll'0d7f 0ZX @^_@' 0@S0 `X@T (PP@P 'n%nT(PY@T@$pTv W 00 0`P0 P`UVZ  h Ը\W V@`Pq @=P=댐 pW0|0E0 t0 0 $0( \phpy !$_P ]P60EL ,0L_P00E+,P|,0U SU S ^ ,@Q D 0@03 P,@ Q0 QW : ] @p0` 2$00G'0 0S  00kP@P P0U 0PkP0U k0(p`,P},@E~.j>  I L^P1x00x0 k̗@``$@P P0U00T0PykP`O-PLMc Yl ԱQ0 @P    C `P00PG 0pp R R R0 T@0P p R ((0( P00 V pW X 00  XppWV$@LЍTT kP0P 0". Y4 l000 0". Ͱ Ͱ̈́G-XM`@=~P pP@0 0     u 07~P 40S0- XЍ NP jZ  0~P j8<8 -P 4PPQ 0 HO-"M28B0 0,*7:N0j 0" 0# 0M : ! ,-$@ lȃ *, !9 )M  #8 " ۦN b.0,D*<?A0ꪂ 0! ,e64L0lȊ 0" 0#0D)O4  " *Db- ( ৃ㔋Ja 9p ,|Opp0ȁi 0[eF0#08p5``  p " l oHb-`` 0p!}doOa` ` p,meHȁ``0 0(p0#0OnoF5``  Dp " f,nOb-``  p!ccJa` `S7Oe0 004p 0#0 c= 5":-K    "  Bb+ P!0  P@0,0## +N@  0LЍ@-@P 3 E7FN, 0(Iv420A 0 0 -` G-PPp`5 W) 0!ӑ00@@i00"V>0: A0iS@I"p ` *80V@@p`F GH D0D 0 , (0( 0  @ ! 1 p@-`P0M@0 00' T0 P  !7R8 bx b(   0 0 0 30X Ѝp@f` \0\ 0 T@ <0< 0 ˑ, P,d @ xC-$ M 2"0 P00p  ` 0R @  0XS @@0 T $. 0N X!H1 0 0 30 ЍT  0 s0Aa0C80BS.R ^V* 00_RP 0FS0 S S^*0Xs000@^0 8< 4^*0 8<++*- MiP ЍDD!@- 0(M S $ A \/o"S R9 S Q R L 0 0 $0 30)(Ѝ@@    (  0$\ S $ L R \0  R ( $Q C Ӑ)8( \A-P!1`P rMp00109 UA @^X0pA00tAT0OU?2D 000TAV bP5  0 ypP& 0@cP 0 0 1 30 rߍ0<| |0 GUd0=` `0 =P -d00:P 00g'&x |H T00- $  M  Ѝ& -- M0 0x ЍЍ/-8 8- M0 0   gЍ Ѝ/%p@- MP|@`x0@t P`       @X@PU  Ѝp%PP L1! @-`0M000Vp P@ w  LVp rU@ 0 0 0 30'ЍdUPpW @@T PU 0SP@XTS00@겏$$4 0p@-P0@ 0 p0bc(0P_c(P,P[c 0t0PP 0P 00 0p88rP 00 0pp0 0@-@ 0 0 0  0 0 ơ 0 0 00@-P M @0c 00P 0 @?o 0 2c Ѝ0i2 00 0p@-@P 0U0 0pp@-@Pb0PPb(0Pb(P,PpO-p0Pe `DP^ @000 S S0 S S `3PPM 00I P[p5 $"@P 0P00S S S@ 0AS A Q@P$  P0S0000aP  aP@@PP O- M`p@,0(St: n(TY0 T0U 00SQ 0 RK@D @TPF 00SB0@D S@D P+ T0V  0@D !0@T0PG 00S#0A S0偠0* O#0S000  >0S% p@a0ppa(0pa(p,p@ ЍXaP  (,@(0  Ѝ0 00@- M@P   p P  Ѝ00 0 $$ 0 P Ѝ0@p 0$ $6 Ѝ0O-PTMf E,Pp@0@ ppbPe,``Pa 0 ppbPV,PPU 0@Q QG QR QD pp0U00S _P/ p 00 0@ ` R  R2 R[ R 0 @U ` 0 4a 0JX0M 0 TЍ   @ QA@0U  `     0  H @-@P @S( /$0$ 0( @S D`4S'QO-a, P`SPX<t^(09Y p:70@$0` $p3? W`(0,`2(-`P Y(0 # 3W, `0!(-0P QFf&``V0#03 U0S `V:PV Z3WW1!030#00_@000W` S81P3 P#S41PE2s2PEs>SPE g04 E0:0r ; 0Z= S81P3 P#S41PE2s2PEsSPE j 00 E080r 9 PEPE  0jU0 8PPEPE 0gU4 :P 080 4:0 (@-pMPp( @\Rp+ `0v00 @ PPu l0 0@P ЍP00@ЍRP / @-\(,@\ \  Q:^: A Ͽ|q<Ͽ10000$G-\MP @P 0( Y 40:p;`ȁ B$:9-)bH\91 垁a@8736`# \  0008` <9P00 @A4ƌ<ŠaЍ /r 0?s0q1 2/3?10 0 0@-S@ 3/@5RA-pd Q㹉7I@P-7I @P @D  T<Ͽ2/ p `6o`FLPV% L`B, `F Ef& BL&&"L`F, `F Bb& BLQ"L`F,`Fw&Tp}" @D  2/ 0t 2/P HPEV%ApG!pG Ev' BA'&"AG!@ B BA!" A@!@ 蹉 Q7IP' N ^<Ͽ2/  `@4O@DL@ F$L B, PB DF% BL$&"L@D, @D BB$ BLQ"L@D,@Dw$^p ^ ^ | x 1t 2/P^^1 ^- ^/  2/PTT @D 2/ P^ ^ ^ ^ T Pv` @D 2/  2/Pj    \ X { y yd@-@P  @J0/ 0 pr x10 @-0@0 0 0L#d.\ 0@0\ SC@ P p0  0C00 00L  00t@ 0 x xDO-pl PlL M$' u ldEa dP0Ve0 aQl \M@lN Ѝ w<2Ÿ0 A-P 0@ @ `0C0$@i 0@b `0C0 @E 0@> ` p0C0&.SI 000@000@ 0pp@xqE0Cp2Sp X 2S 000 @ @  @0 `00PU  0R408 00Xi`1S   ;`1S0  0 0 *PJ0 0 P7P P P$0 0 P0 0 P0 0 P0 0 P0 0 P`1SxYz < Pp0pW  0R 0hpW 0pW  0Rx 0hpWf 0pWa  0R0 ,0hppWGpWD 0 PS 00h`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P 0 k0p01 0`0p01 0U0p01 0Jxx1p0 @ZL (htЍ ~tЍ 0 10 0  0 0  00 x0  D p |x, xL0hH( @-p0AM M`@0 $0 40 0 (>PP0S B@ 80 0 4 30AލЍ.ꖄ <0,@- M@ p  Pp=`PP 0S <0000 Ѝ00S.S 0S Ѝ@x4p@-Pt AM `0 0 $ @P 4 ,0 0 4 30AލpH < p@-P@`Q  @Q cPV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P 0`!W00 Ѝp@-@MP`0S 0 @S 0S@V00ЍpO00@ 0PV00Ѝp0@- MP0@0@0@T  0U Ѝ0l0 0PU:H@@ Ѝ0840 P0@ Ѝ0 h4T<Qp@-`M x00<@nP 0PU  0VЍp_40P 0`Ѝp @@  0@- MPK0@0@=@T  0U Ѝ0p0 0PyU:L@@ Ѝ0<80 P@0h Ѝ0 40@- M@ Te  T T 1 D0R   T8 2@TP |QTP Ѝ0TM  T/  TJ DQ TP 3^41P( 0@+T T: QTP PTP PTP P TP PPPPPPPPPPPPPPPPPPxPPpPPhPP`PPXPP _l  Ht|p@-@YS( Pp| 0( d{0@- MPph0h@0@B>@T  0U Ѝ0O,0@ 0P Ѝ0 Mp@-@ML `P 0 Q@0P0<00 0. 0~T @D H000T H0 0 <0 30 @Ѝp@Ѝ/T.0 1H < O-MP`@PP  p0 Q ЍSp SRPP 0-S  0  +S 0XP 00C<,0d .S 0 @QT.‖ 㘐@@✒)  S #3Q#@ " 0!   R#S # 2R 0T#+<'(0+8 +)(0'<0'4 0)< p 0)4 000Rp 0T Q#@ "  S #3Q#@ " 0!   R#S # 2R 0T 0T  P#@ "  S #3P#@ " 0    R#S # 2R 0T0 0T 0N 00 000J00 0A O-@Q dM0 R & @\|)g/O2 0\0^mnb`AS0N0P0_>88H<Q¯a&sf~e~rHpl0W0E0T0=b0AE1D88H'ᓾ  La@L<@<d+b@ "gࣲ2X0+k ZX0 H Y J XL , @ 0P0( L 0 $ \ 40 T D0p < ` H EBZ qTY mTX iTdЍ0& @0 B\0@R@0@j x  0 0dЍ@ Y 0X zz8z\ \ [@-@P 0D .R S0@*ST .P@Q QA.@P@@$  0  0(  TyTyd@-$Mp`a_@]`  0v> 00  bPc$ЍyDC-`@ MPp耟@POP @U _P@Wy@ Ѝ @P@t0 0000  0P 0S0Y@OoB@# ڐu xxC-`@ MPp耟@Px@P @U _P@Wy@ Ѝ @P@t0 0000  0P w0S0Y@OoB@# |~H wlp@-@P00C0S S u P 0` Ppc`u0 0C0SpSr P 0 /b0@-M@  00000 !R !OPЍ0p@- @@0S#0@0Q R#   =0H04S iPpR  QR 8 @0Q     Hp@-@@P@0P`0pp 0,0p@X0Y HD D p@-` P@0pp0,p@C tHHA- @@P`p0p0 A- HC-P0 M`p0sp@ H0  D@ <8 Z@Ѝ 8 HxC-Pp0 M`p0Ip@ (0  @ Ѝ 8 H0 00/ ޘH0 00/ xH 0M 000Ѝ PHXA-pP0 M@P`0 p 0 pЍ H0M 000Ѝ ݼHxC-Pp0 M`p0p@ (0  @ Ѝ U8 ݌HC-Px0 M`p0p@ 40  0 @Ѝ 18 H<@- @  $M0 XЍ |HH0H 0p@-@0pP p@^ 8p 0H8- , M $ 4  Ѝ H R) p@-P`@V P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0 Mp@Sp` M0T 0C0 ЍL0H 0080p 07/0/ 0 ڼwvO-Mp`@PpM WC*00V>:Y ` <1 80 pp `P 0 p- 0 p& 0Z p `0 p F0?V0S0 0 Ѝh0 pp 000000Ѝ;Pv|vp:pu I,u:O-M 0 `?@ 0,0=L 0H 0(0=000$0 PX (0S@4 P=P 0D H 0 Y<p 040 0Hk=0P=<0 @PU *, ?p0 00X>0;/ 0`0PEHk=0P"P00 >`BP0d  0Pp 4 0#p WW; = G0R  p ( R 0S .S 0S 0S00S.S-= 0- R, @ C +A0Y 10"3" 00;A0000;A020 0;A====C; +A0Y!1 00=-0;A>A C0==C;u+W =00S\Ad 0@00UpP0 p  0 d E0 pt 0@DK$0T*P$pP Y dqDp(ppx @o@o\p`p4boH @$n8lt X`l >|ljkkjj,ihDhhh 9 9gTe 8` 7` 6 6lc|c|`l_|_l^]^]l]]][ Z\,[ZZ@YdY<Z8ZYY,KW(WX4WWV (V 'TySlSdRQdTDK S 0d 00 0 &pD0 C(0P 0DK$0T4*4P\L pP P 0(W?  R @0 Z$ 0d  0 p @T0=00!V5U5E?C0 SU!p@ !p=00SH 1 0d D;20X Pp0 p D0`(<@Cp8p 0 PCPv0 pn 0 P`2PeH=00S -h3 0! $PR-3 000d 030 !dp<=00Sk -3 0=@ 0 ^ 1@1@Dp( 0Y0 0Dh40 P@0 4p =00CV5U5E !?C0 Sx0  p?=00SQ 0d 0 50 ! p pW@ PD3 $ 0R7`@  7 9 Q=H0@ 0.% TP *, 50 00508/-0DW 0 0 HD $0 S@P(0 p @PD0Pp@C(< 8 0P pWP0 p 0 PpFPy0 pq 0DK$00CSj 70=00S 0 H[=0@ 0$gTp *, D7h0 00708/=P0@D pd @0H[070 !Xp1 $0DZ2*p@ 0 PZD W 0  8p p 0d @ 0 *p pG@P$ 0Z!p8@PD0 C@(0PP0 p PDK/ 0@/H/@ 7 =00P@ p9, x  009P 05/Pp/* *J@1#0 0DK0Xs !pD0 C(0`P, 0 p LzDKpPx/D[ d 0F 0 pu Pf/D[ 0d 4 0 pc S/P P/p M/;d 0pP 0 rpK H=00S \+0 S~00 =00S Kd 0@00 pP0 Kp$ 0 d 00D 0 :p  0 d 0 ,p P< 0DR  =00SH .@.P.P P0@@2 D;<0 `p0 p D0 C`(0pPHD0 C(0P 0D{$0PCUpQ@ @T 1 X2  0d n 0 p=00S .@. @@ >2 0DP Pp0 p} $0 Pu N0 @Dpi 0  Pb 0 DpX 0  @0PP 0 D;0lpE D0 C@(0p P;=00S$0 C|? 0=00SD0 C(0P 0D$0 S` C* *J 1#00 Sl!1pP 0 H=0p 0f"W@ *, ?0 P00t?05/ 0pGH;=0DpD!p 0 H=0p 08"W@ *, >0 P00>05/ 0pGH;=0Dp0W -> 0-t> 0$0 C\>0$0 CL>0P( 0 PD[$0U:=0-> 0P  pPWW m`P@ 0TE0 0pm 00d0@D0Ww0 p^-P  @PNTT }pP` 0VE0 0hpA 00f0`F0TK0 Zp2 >G-0`AV-:@p0T0'0 00 @T T P0S P UT0 $P" P @Y(00QA-Mvp$0P@S` 0(01$0,0v(`Ve0Sa(0S$P1,  0(0, V,400'PR,0,0 RMU,,  4TP(0T0(0 SP$PQ0(00,0Ѝ0F 8P%, (` , \:, 000\, :$( ,00(0 SP$PU 0"00(00QA-Mt`$0P@Sp 0(01$0,0w(pWc0S_(0S$P1,  0(0, W+<0<00*PN,0,0 RIU,, (0 Q0QQ(0 SP$PQ0(00,0Ѝ0G P$, (p , \: ,010\, :!( ,00(0 SP$PU 0"W00R(00G-PP@`pi V^ Tn܁  T 0  ^P^0^P0"!, < @D#Ì?0  0PT T 0 00 "!#2<W 0:T  0@ 0@ 0 =  =00P*PP000 0 |0x x0 d0` `0 TW P@ L `8H 88 7 7O-PR@pP Tv 0S7 " `RPP [B T Wa@ Z 0 00@=ZB lPM [ [T WE 0@0 0Z 0[9Yc T W0 0@ 1 0Yp 7:P$T W 0@ 2 0Yp 7:P[0* [ S 0S 00@ 0 T 03~ 0 T 0)rT W 0S S0S @=S0D Z@0@ 0T d 85p5L <5$ 44P 00/@pL00P 4/,/$/// {44|44t@-`MP pdR@TL0 < P@NA 2$4%A-pPxQ@`PQ TF 00S?00XS; 0ST.C+SQ0,! ` 0000s0`  0C` Q70V0Cs 00000   0 C R7 0 0C20L0?H H0 X40>0 00 O 4 2 (2 2dA-Pp@JU`, Tx0 @W``W 0 PE.pVp P7000 2000 S70Q00 V00 g0  0 1l1D/o////@-DM` @p0 0 < 2 -0 RP100000C0< ,0 0 <0 30DЍj (0 O-hhH Mz zJ0 - @P<%94BP  B,@h3"f'*g* J 1`JH*ZOWVoX= 0@Y$* 0 Sp: [ @B0?R0SJ  Ѝ  0 H|p# V0X[0S   000 00000S 0WYp@ D 0 Mp WV  0 MAp X <0e8 80 % Ѝ $ . |.A-`pP᫼0S- @T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@( 0 $0p@- M@P00 80p k$`p Io0 (0 0 8 30ލpi x0-@-@R M00  KPP * Ѝ@Ѝ/ D+ Ѝ@Ѝ/iPRp@- `@(PPqP0 ?p@j0_|00pPRp@- `@P]POP0 ?p@K0=Z00pp@-@Q `P=P/P0 ?p@%0:00pp@-P@0P  p@ p@p@-@P 0PS <0S P 00p00pQP@- 0R R  00p@-PP Q@ @Q Q Q AR00A32 00pP @pP Qp@-@P PP  U sX gV\0Sm\0S  ^ C/KC0CH ^0;R\G GZ <0jZ00S  {:S03V:gH P0P k6 C@X K0;R 80?G0 SQ {\0R 00 `8 ZP#t!tt@t tO K (C p V H ;R0;R 0S 0ES 0S: \$0Ÿl 0  0T 0lL0P0xo0@ S%Q%[  P  `  xKoᎰn /C0;B^L@rP L00CL0r /GPL00L00T   X5L!X &!G 1;B! @0;R  [??G Rq 5  U ER   L0B @   㒣# /K0 {gg a @  00S0S:0:g  آ A?5 T 8`@jP@, j@D@8  `e NWp 0S0  01` RL0 a00;R/pW 0 0L )@ @0@ J   S\0 %P dPR 5qPrT X05&X @ @BP+@   D ^ XPUJkd^ ^4^\K@d7TXXP P@@ [E0\00S0S[R V`poCtPrrr@r rD0S Gs a0;R Q [0 %x@fl  RmP&46\ X0%iX V(@R0~ S \\0  DX p @`V\0`poKSX0S R/G 80jR0Sk6`CX{F H sP tP`oKpD0S X0 /G jR?5?559P ,\00rX R0Sn?G0kSj0S0Sd sP\ sPX ZD0S0?G0= kS;7SPqqq@q qRSA\0S \? < DXr p@  3\@\n*D0\S 0?G0jS# k`Q \0 Y6C#::X00\0q??GR 0?G06X00\0\\0   @ 0M 00 0Ѝ3 p0A-@PU `T0Sp @ ƶP 0S U@Dp@-P@dP`P0 S :pSSp 0R:pp80e4 40 S$0f 0 K  p@-@P/`,V+(P0 $P5 `PVp 0P P   $$P V0 P pl Ch0h 0 T DP0P 0 < E808 0 p   t`0 00@-@PDQO-^ 4A`@Pp  0S 00CS 0 \V0 S  RYWppXpQpW\`\\U0 SP\p ߨQ@-P-r-0w00-0x000蠺 00蛺000S wS -S rS 0S /xS /  @-P@20 0n 0 P P//0S/ S S/0S/0S/@-@0@0T S R RT//PP/PQ/?SQ $0p 0 @-/  ܐ ,?SS $0p 0 @-߷/ D ?S S S`/Q/AQ/Q Q/?0 H0pD D0 @-鹷Q/?S0?/0?/ 0 ۬ HQP00 / /@-Թ 0  A-43P 0`0@Hpù P_弹0S趹P4Pp@-@P M` P0E S a Ѝ 圹 p_啹0S 0Z 0 ~ p@-@PpP Q 0S PP`40S[4p@*(A-@Pp X P@PE@X `qP`( $0$ 0 A` $O- M` V" p@IV PI @P0SV F! `F0 `1 Ѝ Ѝ 4` -\ /G 010C. *  /G   0RA-P(M`p |@ 0 @0@0 PP00a P@ 0 (Ѝ l 0?G0 5CS @/0cS#:3 3Q31:0CS! 2#0p@-@PP U Pp S 0\\0 0pD0L@ @0 tU(0M$ $0 j  O-PM`p 0FV"S00 0^ P@P-UP +UP0+ IJpe"<,@P00Es Qa0ESW0EA0ES70EVt \SQ "@0U2 V+ y yA ` 0T00S0 Sl 0J0 ЍS T P0 000 0S  Ѝr `00XS 00AA0C PSVr `Pr `0? 0 õe \0M0 00ЍS `xPO-PMp 0GW"S`@ VP-TPr +T [ ?0 0   0 000D  @PpQ 8 PQ  S  R/ " Q 00Bs ^ a0Bs0SW0BA0Bs0S(70BS%| [X  PQ  S  R " F"00?"0 00S \0F0 Ѝ[@`F ?0 0 ᆰ 00c 000D000S  Ѝ[@`h0TI W> p̜ ̌  ̜@̌L00D l0T00XS:@00D A Bs QR _`p!0T5 W p p3403O3C 0`@p> PP<1?8!80 00Dp > /00XS W#p0 0 0 00XS W ppp 00BA0C QSWpPpphp0 0> 0W 0@ p p0@ p `80M0 00Ѝ [L r  Q0?0S @-]-- Mv ЍЍ/G-P`pP WX 00`F !R !V6  P 0PE (7`V PUU@@=pPP X4 00ߩ   @@PE P00ϩ 000@00ĩT0BP P0 W80C4 40 ᬩ <@ A-P`ήH@H0@D@p @U  4U A Xˤp@-@Pz00C0S S u P 0` Pqpo@`u@-@P X 0`00@W06 0  ʘ- M0 / Ѝp@-PP@ T 0000 pD0M@ @0 eT(0N$ $0 [0 L $A-pP@`' T0 V9 0S 0SP0S0 000 R F``0Q00x 6t0t 0 TX aT0T 0 V8 b404 0  \0 < ȬO-p#@3OM PPd0 h`0410`10 V Vy Z.` 廤P $30 00 [ Q!.PQP\.Q a :!ᖤ!PZ [ 00:[.[<##O[0Q.SI Yg0IS00`0 0IZ 00 0W 2 0 P00 `` 0 0C SB: 0  `  0 +00n/00P!@1 0 41 30GOߍ:[ 0( @$000,0 00 0 `0P [ P00 ZU00;00 B0 ( 0*>4 <PPD U.Rz  :P nK[ Uh UT S M Q 4(`O-`PM@p  W0p0 W0^( 0c-P< 4P 000 00 @pGpP 00 0 "P > Q Q0 `@V 0H`V:`F0V:\`FW @p궲 p W`FF R.0 0 塳00@ߍ Q Q0 S S `   pPw ` Q PG ᚮPC  T:  @D -P  0@RP- #[{0fpp Y  `FX[  KqO `FW ] լ  Z Vw P `p ` RW R R RO T* PI p(z-@D Pm @P`V2 (P( !T;: `P  P  T014@1:x ^0 @ 00 0-C0 @0 @`j-2 0@0@0 P0 `@PDŽ4Ą XHll1@-`P0LM@0D00E DpP0S, @.0 P' U' qp0 0# 0 @P  s- 0 0 0 D0 30LЍ@Pppp [@ V-T@ <0< 0L TY L<[,`Z Kh |A-PPM@6 p`p@T( X pp00˫  0@P - 0 Ѝ|pp @ -T Ѝ^@P @, (0( 0\ YL 8O-UMMpjP, ``*0\: xU0爕0L50|5 0 ,0S 0 S00  :0$0(E+0P00 0 `@[S#`P 0,0)09 0 L5 30TUލЍ5  00dpP0 $03/P p[: !2320<0j 6P 0PP`P T0 00 0X 8H0R? @@0 0D T0L\ Wc*`P 0 C0 @PX0 $03/PP @ ` V/p( W4p"0S8<0S X 0S0S S 0,8P 0( 0S X H0S 0PɪP( 0`X*\0L0Q*@&H0`0L@H0 00S 0 8H0S 00 d L0 W 0H0C?oQ20SN pZOp [XPH`BP0 0 00PW ! R soQ \ V\pp0PX 50$0W  H0SX0 B@Gq 0SPSPڰP^!P"@Tp `0S 0 00`@D @PC0@P0C`@S:Dp `@垯+L0X` C0 0CS:启0X40 @0 ,@Pd0 v (0SA@ Z 00@SV@ 4p@<`@,PI0S 0H'XSB@PP 0P%,1#3 0l C,0S\#3 l 07R,0P08D000aR4 0 0pP0 8 (0ST00 D00R9*0P䫩P @`@天0 CR00PU 08@WPPpᐩ0`P CR00@Sš@P`@;$03/P ` 3T0(D 0T0@B<*0Pw  D00 0D0D*ѯ0 ,6PI0 jpP0 F (0SH0S 0P T D001Q=*00P009XL@p{ 0$% x,w p Nύ 0 00L@!?RHfS 0Pp`P@0\0P %x+TLPT V00(D@C 0T0)0P D00 8 I\ IL H L  h DA-@PMPF 0 S`06 S10p 0(PP 0  1 PP; 80 0P#P! 0 `*GV 00S S Ѝ0p)3Ѝ8 404 0 ) 0 hߔ3O-PPBM0M@040 0 00S0/ S 0 "2 0 4 30BލЍt` p @0vG#"0 7P@T*X $ R P 0     ! 7(@PG pPB 8 0 0@ߺPIp 000 00000 0`p)V@ 0@ @IP p00S 0  0@T/   0 ᆮ 0  ~D) 0 w 0 0 B`4)m 0 ef 00S S\ Z\aU =4 <Pޠ 4G-M`0p5@P0P0 V 0   0 pP4Ѝ 0 PP 0 0 H<tA-M`pP@P , 0P (   PЍ, P00ЍA-@P M`Pp@R UV'0S9 0S0S9 P`<8180(! P <Pp0P 00 ЍU U- / 0 0 Ѝ0S  0 00S000/S S 0S @P`8 404 0g0 3$` 7` (TO-DM@P @$0h 4400<00 (p& P P`6(0 `PP ᚘP ,0 0P0â RR RR$ 0 Q Q0 S S @ t @P $3` 0 00S S S@ 0Zi*@ Z@P 0S 00Q$0 0A@BA Y  9:I S4 ߫ 0 I0f Y$:  ϫ TIr 0FD@@ P`   H༫  Y>`CPU P`'' 0  0`!L1 0 <0 30GDЍ(&J P ` (P=ڜ P0 0 0  0奬 0 G` P`@ 000\'Z'  0 N' 0000W00 `S`P 6 3p@-M`@P 804 00  ɠaЍpAA@-M@ (9$  ЍA0AL@-MP`y @,pP0P0 D0) 8 00 @  P+Ѝ@@0@- MPP@T p00P   N T 9 @ Ѝ0$@T< 00@t@\@XA-@PaMP`O UW !0  p  ` 0S   0C \0".SAV 0@  Ѝ0 XR @  9S @ `F V0 QU4 8<00X0mT T0 pU<0n8 80 fS 0\ 44@  O-P#@Q3,M `00$00 UJ Pf PT`00:V  j Vl $#p @ P`@ P \ PUW @ pWpW P `$pVᰐGZ V 0FB S0 sZb 08rJ442p0< V VS / 0 !1 0 $0 30l,Ѝ!1 0 $0 30a,ЍO`:V@ ( ᦚP :W>U5 0S 0$ SP` Iqp 0< ᪨U V VH 0㟨VT0H 0 0 0H D0S@a$pm.W@`$pVP_QVj . H\ T -4 -P, $ Ψ@-P!@P 1,M `00$00& V.  p0 0 0  t3P*  0 0 $0 30,Ѝ: 0 X0hT T0 (V<0i8 80 SQ + *< h8 @O-tM`\%0QT5 @00l00 V P P/ / 0 %5 0 l0 307tЍTIt4Pp0 Tv T 0S4 0֧$4 0 ͧ  0 $   pP R@ LTT pRU P Q  R @R 0Pw Ru00 Y0S @\Tj<00@:0T0p0 0A Zj 0Sj* 0CR00c:Aq"2 0 l0 30  tЍOP@PUI*0: T00SG|"H0 q2P00[0S3@Tp 0Z00S RZ  @pT0zu YPo R 0S0 P @k P^0SD: 0 Y Y Y@0/Q 0 H P ᇢu8 @R0pHP쀟pP0 ݦV Tn T 0Ҧu>@0[' + əP%p 0;/pq 00P @ P R#00  0 0 0Ѝ\p ph P0 Q+ L WY  0ppTP 00 0 SM  0 00;/pq 00PQQ <PU;e0 z0p ;/yqP0 q 00 0PUßR <0PUß`X0p] Ri0T0dX0P\OS  00Q\ <P800CPU0&Z "   RPLP0Pe/ P0;/pqA 0000 P @ P "00 0Z 00 aP*0 S': PE u AJ 0C0U<PTP 0S  0CPß81G4!40 wAPU0 Z 0CJP &JPP @0P P"0000 000 0 I0 G00D0@ @0 40 $   ¨4  O-P,M`p@PP T 000S000Z00ɚ$0` 0PPW 000@P $ 0R00SQR+XP `  R! 0P 00  UPP`塚 [XhV,Ѝ C$ R_oR  B0 S $ PRPPU8 0B Q: `PP$ RPPURP%X00S PD00P \[ TP|[  0P \ `PdPU[ @Tp [H S$0 ` Pd z FP 0S   00S S0S S ^ S@@T0Q00S00؟i0\#00& ^@ [ @@ S@ S@0h< <0 0!0B| tp@-@PP` U 00 FGp 00p06| |0 Ud07` `0 0 @p0TS00 (, -M0 3/Ѝ/0@-@P MP) U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0@0< <0 (0$ $0 4  d0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H D0D 0 `, (0( 0 V D lp@-@PP" U 0S S S 0p@0/p0p@0/pH D0D 0 ), (0( 0  t 8p@-@PP" U 0S S S 0p@0/p0p@0/pH D0D 0$ , (0( 0$ D \0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H D0D 00 ಢ, (0( 00 ਢ D \0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H &D0D 0@ r, %(0( 0@ h D \0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H FD0D 0P 2, E(0( 0P ( hD \0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H eD0D 0\ , Y(0( 0\ D \0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H D0D 0l ಡ, a(0( 0l ਡ D \0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H iD0D 0| r, (0( 0| h D \0@-PP M@ T 00P00 Ѝ0L H0H 0 FT, q(0( 0 ; , $h0@-PP M@ T 00P00 Ѝ0L H0H 0 T, (0( 0  x  Lp0@-@P MP. U" 0S S S Ѝ00 0S0003/ Ѝ0003/P 00S00 Ѝ0H D0D 0 Ԡ, (0( 0 ʠ d <0@-@P MP* U 0S S S Ѝ0 0 03/ Ѝ0003/P 00 Ѝ0H D0D 0 , (0( 0 dL <A-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP *L0L 0 =4 #000 0 3 Z p ~HA-PPMp@`4 W= T& P R P P P @ЍPX 00@R X# ЍAt &0 0 ^0 0W _0 0ڟ  P` J0SP@88 }8 }L }| } p@-PP@ T  ;p@|L H0H 0 T, (0( 0 |4 |`A-PPp`@. X7 V@ T P  R 0 R 0\A/W 0A/ 0 0W 0 0MXd `0` 0BVD @0@ 07 {p {H {h zLXA-@PM0P` 0L U@ 0pS S P R`V V V ЍW ᛚ {0SP00Ѝ W`" e0SPV 0 0 ֞h /d0d 0 ̞  Pp,, yl yD yp@-@PP U (#p@~L ?H0H 0 ࠞU, (0( 0 x< xh0@-@P MP. U7 0S S S Ѝ00 03/P 003/P  Ѝ0 00 3/P 003/ Ѝ0L WH0H 0C/QU, (0( 0C/F wX w,0@-@P MP. U7 0S S S Ѝ00 03/P 003/P  Ѝ0 00 3/P 003/ Ѝ0L {H0H 0G/U, (0( 0G/ v uxXp@-@PP U p@WX T0T 0K/ݝU8 404 0K/ҝp@? u0 u\p@-@PP U p@~X T0T 0N/൝U8 404 0N/ઝp@f tP tD$p@-@PP U p@X T0T 0R/U8 404 0R/p@ tH tp@-@PP U p@.X T0T 0V/eU8 404 0V/Zp@ sP s|@-M@P0.S00Ѝ9@-M@jp  B0?R0S Ѝ(0$ $0 '0CЍH t`0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S 0.0 R0/0*S0.S S /0S  .SP\S  0S/!C "]P//]R0S! C//0 0 / H0 0 / 4// 40//0O-PMPx @% !E  0L \m 0S Xh@.  ^a @^f X\@\AP0SI <  cSB!  S   XH#S`Pp@@ P pG W`W0P@W ` FR@y P0S R*S@BT00S4"020 0 S 1.34:(00@ЍAR R !!  X@\ P\dp `!S" Cr ;"(  X 0@Q 0;S@S \S ! C]R X @D#!2br   D"2c" Ds0#10DX0@GRP T R Sp pg 't0`R0gpg '0!"@`E0Zꂝ00 q@\h oYO-@p$MxWP `d `XY @ppW P\W, .W 0E0CI XG0 R S.R@ pW0 C B5 X3R XPń, PEU)0S0P'pW [W# P @d0Q P @ 0Qp' P @pW(00$Ѝ] ،PX p GYN0xSK2  000 B @0XW  /RX ]R=Q P00   0 ]R' @R " XWSQ   Y I b"r RyA  RC .R p@WLd@㧜@ꤜ00Q   Y   " ^  @WX  P0R P@WX(@[p58:dX00P Å0\S X ńW PEUT0SPS0WX , m i0G-PPAQ@K*p`0S% RB @R0 0/ 0U9 0  ܠ 000s0 P00 p pS00@N0?V0Sx t0t 0.AS 0S!0ɑ 00U@(00  gO-`V MP3P#VP30 U0p\ @ W @RH R R4 Λ(00 ЍW@ Ġ[? A @ GRP@R\ 40S4  0@0[A[V[ 0 0. Y*@T*0P0 A\ R!"ɑ 40S4 00 el- M~ ЍO-pS$MP Y p 0 pS 0S0@^q @^` \kS0YH `  B@  p p@T @0S @SW pZ P*T @`T00 S Sh*p 0A>S] B PY^p0K X Q= (00H0S 0Q* 0F S0S 0 `  0AS"`!0@T`00\ߚ(00@$ЍAT0S@"@A@pZ\ ̙@0Ġ?  0^q0A>Sp0pS000^ 0AA^ AN[ ^( SQ0SP? Zp ?0.40@B0?Q0S J0 0S/rYp 00j00@G0?Q0S j|0| 0S/Qx V*p+Y P HP 8 404 Q/0<< a\@ `X `Hp@-P0 M `00 10009p !@p < 40 0 1 30ލp@AA @ A- `0M P@(q0 0 100p 0 p0 (0 0 1 30ލA 4Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ (000 R!  Q @-A?S SAQ  0SLB菙00芙(00N/G-p@`0TS%V WTP @0TS P?Y ^00Y(000QSp@-P@` XP`VP@  0R p/pA-APUQ?UU@A`pp W ڀ1AP(0000 ?00Q A@-?S SBR 0@S A00(00/-- Mt ЍЍ/@-M@ p TЍR/0-S0 \ S 0^C00O-P MPp 0EU"S~ `@NP-TR +T} Y @p]00D`" [*SP# K@00Ds P a0Ds0SW0DA0Ds0S70DS| Y[SP;+\W0S \0J0 ЍY@0Th UH4cp3cO P 00 AA0C RSnUPP\`?pa00D%00 0S   ЍY @~0T. U&l 00Dl@ Pp}0T00XS$@00D AAs PQ2Pp>ci p>cP0? 0 ?00DPp>cW00XS UPpb 0K00XS UpbPPp>c 0<U0@PP-@ p>cPE X0M0 00Ѝ XA-`(!$1PP rMp0010+ V3 @^X0pA00tA0O0 ?2@ 0TA0V PP'0 @ p00 1 30rߍT0FP P0 jV80G4 40 `> xF V4b Vx 00- $  M  Ѝ  -- M0 0 ЍЍ/-8 8- M0 0   Ѝ Ѝ/ `O-@SM ^ YXd 0pS000!R !3  ƈPP E``#Q9\*Q30A 0#1#2#4#8 V P:   0U A 00 pQPP 0@pQ 0S  Ѝ͖T000@0080@4 40 ๔꼖0000C SA-@`Ppc0 yPd$0M 000Ѝx P+,0 0p@-00Sl@@@p\P\\P@P@P   ۴p**| p@-P@e p@A-Pp`9p@p0@l@  U  5<0 E  Ay MkhA-P p@` F  |000 }@P p@-@P.Ppp@O-M8b8R`4BP@V pu r$pQ00mB 1PZ 0S` P U [0@Y P 0@[P  0` PV:Z 8aP`0pS PP @T P 0S 3/0S ֕0P@U:W @0@00*O Q00t@@_ЍXЍ0@0 0  و(Q' 4'P'$ , !1p@- BMa@0PD`040  D <Pd ! R ` 0! s PpA0@ P; P1 0S8!1 0 4 30>BލpXP V`P  6/P Q Q 0 0,0 00P :0 0 5 ` P 0S 3/ H000P "#<  }% T|| 00@-@P$MP U"  0P' 0 0   0/P $Ѝ0`0~\ \0 ฒUD0@ @0 ஒA$0Xz KzPT KzG-@PR  RK \10X"0S@ DqP@@p  #)0PS.0a0000S 000  000 000 t000G P00H D0D 0 AHzLzxzzyyyp, JyyA-`P8  0S@P$ 0P @S0pP0S PU @P @0U00 y\@ 0@ P 0 ,0, 0 ! HwwO-lMR0  04 吀0 R X $`000Sa# 0S00 #34  04 0#P Yژs@┳P3p 00V^ p p @QS  QN P0 Sh @p $ 3/0  0P@Yr@RPT00SS" 00C0T@lЍB@@@0|20\ 0 00SN  RH2( D0 (@ ,0 @p T0TP 0S 0 @@00D0000P 0 S PW @@z(0pS, @ , 0p R7 1S@X$1( 0 (@ ,0Z6 &0 0( 0S X b0 0( @lЍ a0 0( ܐ@X( ( ,0+ p , ~$@\ } |H |T { {$ Dts Dtts Dts4ŸC-`,2 M08@00051E@PrgQndea 0 0 30Ѝ51E$0@O,d,p$`d 7 0@ 0n)L4I2I00@P0D(P (P@H4(,@T8l0ԣ< ($@\N>?#cb m!"b[n!3: bQmn! 13c.c0 mA #c[ 3nA3: c2nASm1@  00C@aa0C0C Cr  \< @P0(DHd,T$@VR gR 0` `\0@ S 0WS0 `0R CL S`H kO 0@ `90 IISQ0C 0 B@2 <00P/A!b  fW0 `0R C W 0II Q B@ 0/C!b|; 00PEW0 `0R C W00 @`0Q @0:00P#W0 `0R C W0 @`~0Q @0d:00PW0 `0R C Wa0* *BQ@#/ b 2b90R0P   W0 `0R C WA0Q @0900PW~0 `0R Cw W)H0 @O`j0 l@`a9Q 0@0P  WR0 `0R CK S* *BQ0P /@ b bR  `( 0 xW10 `0R C* S Q0P @ ( 0 _W0 `0R C W'Q(0P 0 @ EW0 `0R C WUPUP Q0P @ ' 0 $W0 `0R C S 0Q @0600P W0 `0R C Sp0h @PX00\00`0 0d00 x00 |0 00$& W0 `0R C SF 0@L0@ S0ŘW0 `0R C} W/W@wt0 `0R Cn W 0051E@!2 Cd0bSӢ Rcӣ? ?"?CP0 4 0WF0 `0R C? S 0@h   phh0 S0R05`'0P @0 40bW0 `0R C S0 @`0P S@0030@W0 `0R C SW@\0 `0R C S00 @` 0@Sh @ :pq  pq 0ASJx" R-Q TRH0c((HQW3< < 200(",1 R$ ` QBP W0 `0R Cx S*0 @P`k0@S !WcG0`0QCZ P`VUyP 0@SNW  P   P W 0W `0QCBP60l @|`- A 8 > >> =>, < < << ;p : :t :$ 9 9,gRxNe4NdZd|cO 4X4.@.4.(.K /^0@ S( 1hW0 `0R C S0@S 1W0 `0R C W 0@|  f0LII< @P(D?HA1cd,0T$@Q%!E_d2dN`Re0eϠl 0 bSӢd Rcӣ? 1PR b0  W0 `0R C W:0Q2 00PWy0 `0R Cr W$o ! P/ "``&4 YA-MPp@`\40@0 p00@00p'T p`I0FЍC"00Ѝ(@- @MЍ dO- M`p@P&댠 P0 X X0 0p00 @ Ѝ @ Ѝ O- M`p@P눠 P0 T00 0p~@ Ѝی@ Ѝ Xp@-0L| ^ࠓ P0L|@ T.^T00p^p踌00pp@-@0M-S` +S`P0 P' 0.00:S V00c0Ѝp;0 P 0< 2#00:S0 P 0 00Ѝp@-@0JS( MS 00C S! m1 P 0/S <00 0 0P 0.S 0 |P 0.S 0 0m1o@0 e@- )P8 L5@0#(@c\3i*0Sn SW @: :B PT@ғ5?0c ScEPPgVfVF0rc?E1c_`GedP0pfV0@1 0II0CL``S0DB\BP< P`>#P@P Q\1 0\QTP@n 0@N@  ^0#@;\00L 0 @c\0#3S0@ 0 ) )404 0@-M(@0@0Ѝ (P0 0A-00S`P`0S@P ,0E Pp@ P b pL0l ]|190@-mL0l6\|@N<@h0P Q 0-S 0#-L ! b4 0-S0P0S00S0S0 ]0DO-PSb`51E0_: "   L c0 (: 6(QS X00[$ _0/+>P!0 Â!2c0Xÿ0+" ?00 #2>PV[ c0 (: 6S X00[$0/!+>0 (a o!2c0Xÿ0+"  ?00 #2>[?PEG' `@Gpm1%0 P:#0  ό"!/ U n13:$  p C0!".#2R> ' @0 2 30 #1d0TX04? B4sppp0 0/S [jsc0 (Q _y(: 6S X00[$0 +>!P2cX0;#0(PV[Pp`vc0 & S&: 6S V00Z$0 *>Â!2c`V0:#i0&bnu8?O0P PcR` PU0$I"IVY Ba!kC(1 ? 0c00(: 6S X00Y$0! )>0%!EÂ!2c0) XLß8\?H)" ?00 #2>r?D$0CI"I 00/A!b,!b S`0 B@ 3 1I!` 50.c((H`" <2c4 0S/  0` p0a8\?H)LN*" Q @ \ uO (@ό"! W/ }:&*V &R Z$/!* %!E!`& V 0#0 0 C2 Ό 02!>`V0`000 `000T@DPP0S`@( 0 @ 0$ <Ѝ& v )1 ?0c0W0):6S Y00X$0%(>!E!2c(\/H) L0Y("0 #2>D<0@400P` # ≑0 ]P 0U000 S?S00SX 00PN<h0(0s ?S00`Y PE0@- MH@P@00P UNLh@(@ Ѝ0 @@l@Ep O-P0M`@<SZ0PSЍ0S >S@0HSh0P0 T00g 0S0Ӄ!100 0[@zhphp@ 0 [ Kh :h0 0 0 01@T$ <T=0pS0S >S@p<S*S0S -S0 C R@0H9h @ bh&N lFhpFtF 0 0P@1@@0 @0*T@T -T00D S0@0ISi0S,S  ;S  RRh .Bl SJ ,S;SW00PP 0,SM@PG 0SDh lpbu( `,岷l6w60p&(,h"@t6<0 5Od)0 {,@P.OL P ' @$00 . /O4 Z pP [  R8 K    cR 5:0 cR$ 0#031d 40?0cX ؃@P$ p)<(,2L"@ ,!@0 ' @8 ! @< x$P  HPp@ @ P 4 L`PP0" 0bS005:80bS4 0#031< d0? 0 cR` c sP R 10L`1c00 P[ЄHP00t3 D p0X0=1@40)<2L80P8 5@<0(<2@@0<1@T0 7 0@\010@`00PPP0@ $@Hp @R + [ / c ^,  \!!_ / $ cZ .$   ࠳^A Q ! !c 0 ?0 c@Rp?0PU;( , 040#5#@ cRT05:\ cRX 0#031` d0Y  DlP 0Y  Y. 0S ؄DPP0%d0g.f>0 0N 0h 0妄@ 0@⟄ @M؃@P $ 0 ؄DPP0 B1R1ð1   @\O-M<00 S0 $ D / `P@L(H Ha<0/aQ(#x "xH q~~N`AN0S/"w ?'P P00 #1?B! 0/@Z0S< @# J"p J㩀A0S'"̃ ?,P P0 0 1>!0 , Z0S , * *B%/ b Rl\ Q S k'.+N Q( %@ (,"@ \/%O .+N0 ' @4 *)|\H rL$   `R @ $"@m#W` ף pC  @)n$A[ O@:0@P % Ό"" \4. $ 3 #!do  0Q S@o!S \ )|rLR(\/H .+N Q( %@ (,"@ \/%O$ .+N4 ' @8 P) 0   PHP@m H b"`%@g׳ pC   P*$ n%Q R _P:4 ` & Ό"" \8. 0 3 #!dO So!@ 0S D@ 0 !Rc0@D Sj !*Q &@RQ P Ϡ! . ERP,b)L PQ\H/b"l .  n kN.B!PpPp ᇒ ढ़ p Qs  ` p}C&R ^.U W P@v `3`#p^ 0@D S  P^(/O 000cP<S:(;Q00 @d<@PqP`P0T WU XV V0QP0T `? 00?0S PpTPV PT0PT` 0 4/P x0Yt Qp Ql, Q|h@ Qxd( QtD0@S QD! @Q!SH R0S `Vj 0SgJ1$F|epHh@AKqY 0 S0PSJ#=p 0 A0 S6 00 0-S 0T \P?? 00cS !0 <} 0 \ F<h0 0Q\p/@-(} 0 P/@-@@ @@ #O-MP@TR " " 8 RH[sa pX @PV20Q "P l  U4 ]PP@ uu=D0C0C P S\@0d@D/  @DcPt !10F?o 2@V0c0c80Ѝđ1 00@00Yp! pP \gP`8 RwP [ U Pa` `kiP ЍU}  pXP /Q/Q Q:Q  (g p`  4  @f{00gt mTW] X00hW x #, #ĸ$ " !T˜`A- @p`00S* PPV0080S 0 eU@ o0 @ |@PP rlp  D /|0| 00Q p@-dPP P@P 0 Tpp@{@p0  qhp (|0| 00P p@-dPP P@P 0 Tpp@{@p0  pp p@-PP  @`PPp{P`p@-@{P{Pp0 0 0A-P00S@@@ ADt`tt`0S@PPp@ P Z op,@ P p@-`L0MH@PD0@D0` PN<h0(0Ѝp 04p@-PMH@H0H@0`Dl0` PN<h0(0Ѝp H@-Pl0 Mh@`d0@DpQp0 P UNLh@(@ Ѝ@@l@ X\`@-` MPdd@d0d@0pD,p0 P UNLh@(@ Ѝ@@l@ H1!0p@-P00S2 @P/0 00`V  0`PT p ppD` `0 `P@z`P@ lp   < $p@-@PP L 0p@n44D$ $0 p@`< p8p@-@QP0 0P L 0p@M44D$ $0 p@?Ƽ pHɴP0 0np@-@P<P80 0Dz 0 p@# D 0@-DM@0D ` P0` 0 m 0$0 $ 400(0Q` 0\ (0Sp`DЍ $4Ȥh@-@ S\ BZS00cSyT 0 ̌ <1 ! L3/L2S @00P2S T? #3T #QP0P0@T@@P20CP2P2SU PaU Ѝ\00P2S `@T 0400P2SXXXXXdWWWXW V A-h!`d1M @P00100P0Q0S0 V8 T?p `0xq80|qs8O8T@D1@V  @@TAPP@PB0@ 0 0 1 30ލl0Ph h0 tVP0QL L0 tvT 0 # ^ ]8H$ 0- 0 M Ѝ ]  -<0< -0M$0 0 0zЍЍ/ \0--M0 lЍЍ/0 0p@-P@Xgj`00C`0Sp S u P X0` X PX^jpX\`u \H\0 X0`00C`0SppSr P X0X /X= [-404-0 M  X ЍЍ/ [<-4 4- M00 XЍ Ѝ/ ZG-@SpP^ 0S:X( (S Y" WH i0` V V,* 0up0J00=0PQ`"vT000@00 `pp`+0P/0`VpC0 00 i u0 0SJ 0 00i0Q 0 s0= 0 sI]pPX0T T0 s0 0Ci IJp͠ҼxҘ`--M  !Ѝ Ѝ/ -- M0 00 ЍЍ/@-PP$a$M@`< .pP* m@P' !D0P/S0p@0 0 0 0 00   $Ѝ:zu0000@$Ѝ0 j$Ѝ00>, ,0 \s X0,Д4@-@P  i 0SCi0; 0 >s$R'[@-qp@-@QPJ 00!R ! 00! \ uP 0A` / Q R'  R0  B  P R 0 U00SpfP#fP `fP0\0WX X0 r00A80<4 40 rt 00tά RC-` 'P(@ R0 ,°00` 0  a0R00SL PAD\`6 pgfF0V `1!  x0S<0V `1!s  x0S  p x0SB0V `1!U x0S,0V `1!FPNx0S0V `1!5 ?   x0S pT 0V `1!@@@#!  00B S0 ## 0B \00C$R x0S p% V0`1 !0 *R# 0B@ Q 00B S i  x0S  up q  x0S dp  ;  x0SV0V `1!x0S Gp 0V `1!xX0S0V `1!x0S0V `1!xM0S0V `1!rx0S  px/0S0V `1!Yx0S0V `1!L pu pn pgs R  0 0pZ  V@ `1- pJ pC  x0S p6 0V `1!  x0S0V `1! I x0S p J x0S0V `1! rpD kpp T  _p$ Xp QpI Jp)_ x0S0V `1!] x0S0V `1! , xt0S p 0V `1!pE x0S  p$R_0@' p7 x10S py 0V `1!Ax0Sj0V `1!4x0S pXx[0S pL@ x>0S p? 0V `1!  x 0S p* 0V `1! p P  pC p xpD qp P  0B Q^@   0B \0@$R8 x" R 0O0p V@ P  P  P  P  P  P  P  P }p0 S p  0V@`1!s P c$R@00 P X P S P N} Pz Ix Pu Ds Pp ?n Pk :i Pf 5d Pa 0_ P\ +Z PW &U PR !P PM K PH F PC A P> < P9 7 P4 2 P/ -,z P( & P# !x0S p 0V `1! P  P  P  P  P O-oM M@PH /P0? T0060 H0S 0T00!R !0{00d00 O 0SL   RR l D/0䰍@ 4 I/` H 00  00 <0(唰L h0\0$00@T! `%T @T0PFU|$0pJ0(Q0PPs$pT 0P`@ z0%1,0 `4 0EZS00 P aP   R00s H0S Pb?R`1R`O`.LQT m0NOHQPDH TL,\Dt/΍0@ˠ8DM`P$``P`$`0@ 0@00300Ep P7'00E S$U% ,pS1 U }UP /_000P(~0$0<0S <0删0@0S$00$00ZZ $,< 0 6 30'$oލ ЍU[ +^;  0lBU`W @@ b?`Qz80XD`%,\000$0Q00@0S0p0AZP\ I\00$0x@DTmL8 0`0  RO  , PBUdS@0$0000(@T0Su ^qaU`' < X0P D %1 00 S0 00p S1 P0 00 P000|0 `P 0BL00?V0X r %!S <0S 0P<0 0p|0 S-0z0r P ?0P08@z@ XDyP@0 `0SP01 808 P080S@ @T8` ^PP PEU000`0zPK` l`g @00*py ^W R 1P zr~0000`<0S ZP000PQP0U) 0S 0S@/n ~P@kT0  P 0@ 00 00@s`P<` /> PPkT 0py @0< T08 }8(f 00R`pzP0P0 0Sx0%1:04@Z  0SP00 RQzbO0 0d0 @`80 ?0pP0X`D`P000P @PK0`0 <00@`0S 0 10S 0S 0P0P0 p@P@@@@J P*U. 00E` S0 0 P1!00E S P@P@` l`00{00^p  0zS0 Pz0PS 0z0PJP@@ @TP00{0{0P SR\  0SLq0{0\0m @ <t0T @ $ ׄ $ 4 p D T θPp00E S   8(00B S$R0h S0P0 10  ,00 , P0,0S10c,0P@+` l`1 @00*pw ^ R 1P z|D`0 l`0p *C S !PH 0 S0z0<0V ] 00p0P0R00S 0 0pP  `S`-0z0o0 @\bOd` {Y`F08VdV @zV00 0XDS L0 0D0(10R0bB+ S- C S)!yھ/ BL ScS1e00P`EpBQ000@*Jo B0i   BfP z\00%\ Q`000$WD,AZ?ZP  pJZ Rp Q Z PJZ( 0\ 00S0(0DQQ<L`8@FT@T00QTBY~\8ZP8P   d0 bO R @  048 `FV`V ژ 0 `R0  pVpGWWf@(P``pGW 0R`0 S \Z000P00TڴP(p @DT 0R0 S 4Z000P@DT0 P\0@0[S0 p Z0p 00P(0K Z000P] R 8`QbOd@LQ00`@0 S Y000P( 0 Lp@Wh\00JI Z(P  0  P`@K[ RP ^  Y PuK[( 0@ ` \ 00zQ[%Q l` jV00p0S%(0Q8 d0zR @VSY ^Y@@P30 0(*P0 P0 S@0$0Uj@(p`PEU 0R`0 S )Y000P0S(0Q Y000P( L0`0C0 10@8Q00'S X@@Ph J?000 0 (  00 RX,       d 00  R  @Tm L < `, @{0\D00 0 R RbOd  d0 ! ,   c d`80`F0p90P PbS  0Nd``F800p000B%-P0 p 0 Ss xX000P KS0 p kX0p 00P>z0S 0z00Qp TX0P(%(p 0S p EX0P(p 2<00NS% `Uz2>0800@00` 0X@D0SR 0``S@@W%`o@(P``pGW 0P`0S X000PpGW0 \0p0   @  S 0 P1s 0P 0 0p  SP 0 01P Ϡ R0q-0z0 0SP @X  {@/ 8@ @X D`TPXQ X8 HJ@DQ0 0RD pBWpW ژ00QQW`A`VVڔp 0`P@pIY Rp Q [W P/IY(@0P `X ^0`0aS0 8W000P (0S+0(Yڴ@(pPIY 0RP0 S  W000P0V0P(v,<  0d,3<  0d<080S50(/S 0 P3 SP0000!1 P0?0<080\0@X0D0% \0bO{8\ ̬ 8PL̬L@Xppt@P$A0S!"<  ?   #b"|@@E@@@(A@ @Sȏ @0@XC0E @@PP S PX DD@PDPD@L LLl lLqp(qA0S!" ?0 0? "|&AS`.@bC0q@@#Pq \ 00_S0 D V0D 00P(0O )x9  0 c00CL0S0h(0g  00,0 { D  DbOd`0\ 0pP`F8j`0 @0pj ^? 0 z0 Rp4P @$@0 u ;` ^I 00 z1QP£ Ϡ %S}P0000 P0z`0 @0pFjc ^ 0 z0 RpP @0@bOS0 P 10s0s0100P 00000`    S 0  Q S 0 P1Ϡ 000S%QS0/(0n0  ; ^ 00 z1QP£ Ϡ \0S  B0S0S S0\`X?0<0@D@80`Uʌ50800`@ 0zX`X5080S0(0JS  P0000 P00 0S. 0sb L0 0{S0(0%1S 0I00$S0000(D Jo00 ER 0 *! 00Bh00?R0SZ 0h Sz`<0`@X@ 80?0 00eT0Px(L0R``S 0@XL0 0V(0T000P= ^d`0p`F8 }T000P P%P2l^t 0Pz P S0P00 0pP0p0Sp 0P SP00 01P$^ 0Sz`p^g 0Pz sP SS 0 P1sLR^2 0Sz`pP @TD000P p T0p 00P< 00 0L1080 LbO c8L`%N0S  , 0160001?2(+p SD0p 00P S  P0000 P00 0S000P ͼ ʹ ˄X@| 8H|`| 0 t,(DLlLP0 zRpP0@  0zSP0P0@ 0%10h0pp0t@Xd`8P`F0pS 1,0P`p x0D R``S 00C? 0@ 2S(0t@dAdaPp`(`@DT5 0R`0 S 6S000P 0P000 P0= o?0<0@X 80P`S( S000P l"P0 @ 0 %@=/> PPaT 02p@ $0@00P0 0z0RP00 P+P0PP0P0 0z0RP0(0 PP0P00P0j PD`\8P8 R !8 #D3 0 q`00CL0=P0P0<0kb 0 $ 0rSP00P0$000 LA Q@K 0zSP0P0 0zSP0P0A)P 00P 4@080fR 0P:(%5 D 0`@PP@PPD^v 0 z0R!wl&^S 0 z0R!T^ 00z` 0S  @^ 00z` 0S @SP 00P h J?0 0 ( AS@ 0P!c'@@` 0zSP0P0P0 zRpP0bP @SP PP S@(0P0PpP0 0zSP0P0&`'d7d 8 0_9 A'>7 0y_ BL 0?V0:  + @ SP000 P0$00 H00<p 0SP0 , P0 @ P0 zRpP0P P0ϠP ZP0 zRpP0 @P 0zS0ϠP <eP0PpP0tzP 0zS0ϠP f 0zSP0P09Q 0P @(m 0@00P`00E SAp 7'00A S$Q0 S< 1 0P`x0S$ P0prX` 0 $ 0 n SP000 P0$006S0P0`1`0  00 P0P H00pEp0pP@ H00p6 0SP0  P0 ꢐ@-` MHP@pJT<0P 000PGT Ѝ A-@P`p1T0 P2TO- M[T0p/ 430P   ЍO 1[D a `Y: 3D-@"M @Ϡ#90c 0Ѝ0@-@PMP  0  P p`Ѝ0(0;$ $0 "V  S _p p@-0@Q r P p0 S!P00pl PP    !V @0O-M`pD0@0DQ00P-5X# @0S Sl @   b 0P1 P  0 T@@  0  WS`r ЍW Qy @0Q AX00@P00  R 0`00QA@`VRTQap0 0 `b V 0 XT@P@0Q>W 000! @TQ0 0P@020g  000FW"000@000 @P 0Sd0T 02aPP @ 0"0! #000 @lb`@Pr 0Q/ R  B /A-`0@bSP'`B0@AS* R@D@D p  pUV W@0@0  `f2& @0@AS: : PPO-` -p̟ M 0  JP,0 l0x00Pt0-Q 000Q| 00A S040~ @ !0At@00A S TT!0 A0S`Ѝ 0S0 EQt 0l0S $@,(@Sc ?o280$0Q0$0吊Tg `` T ء T;* +0g 1S B0Z5YTӧ(0S (0SP( %0dS:l 1J 80(00dA1!  0 ` ` ء` ;P|000000XS) PtP0Q Qvx Qt000Sl00l0R  x lЍ ,t`0t00+S -S$0 0C ^0Stmt00S 1C\@bZC R2iSs xISp NS+<t@} P$ t 0000(S0l0s 0x 00Q Q \ , EQ00|0x t`l0|000(0`D`V0`S< T(1J V 1 ` ء10p Px |0p0|0 `LV |0 p0|0  A< RG Q0 `CV  `x Vp`v0p000400 S|  <00S-00<0000 $˷`00 (0, S@?@080 B $0S, Tp0L0HH@ 0P0_    !/Tx0 PT x0   !#Tp@| PD0P 0D X$ 0 @,0@0@ppC0D,@Q@D0C@p@T00S0S@DpGH,0SDQ(0SWX F 0P 0  @P 0S0S  t L0PppW 800 S `#g Z<00 S0l0 $px W@0 pGW;Q U Zup0P0L0p$ 0#Y00S|0D0cI hd PP dQWxz  ! xA Px 0S pG E VD0Zp |000C?o20S Kx i`+Z0S ( & $ " %&2ST# `HoC Z*0C/BS B 1J`1ZZ* 0oB`F`  0 a 0Tt0s0Swt00S n1CQ 0ESL k t`@, `f ` 21J V01  ءp &2S`! HC Z*0C/BS B 1J`1Z0ZjoF `F`N @ 0 a E / P M000t0QB P"000$00t00@@t00C QQt,t00C QQ0  ,S0,0  T@TPP@WT 0ӓ"<V |Ytp0Ct0(0C ^Z(0 >.t00C0N Q0(L\@H$Q@a@|nS x Px p00p0s 1J0@08 ,  B 1 l000  ء` NP !$Zj& @!oF`F@+P~  PZ' 0`P0IlUPx@  B\ 0S7 p $0 p 0R00| 0P 0*  P& M 0P0@ 0P0x? Px <0| 0C<0 B| x,00`iZ   Z80{S相I8 80S0P00P0P0吪00cP0相`a PP B\U<00 Sp  Bp 0+ q &$Tpl0P0l00S |0 0FD BH@> |0R! 00S S SD x0 0x000 0l  "!@Q*Q00  0c2300x S8 40S)0Sl0000l0+ @0l0AR"00$ PBx Pxb |0p0C|0F G600x0  0l0%R "000000S0  EQ [5 !0l0p 0P0I]0$0D0080 qpXXUX Ro0t 000x0Pl0x St`0`0$@a,08(0@0uAmdgC x<0| 0<0 | V $TppPIU5 xf Px |00C|0+Z{80S相I8 80pS 0P0  0,0lS@$@ @A(%00c80&00880J  0l000PW f$pW pG eP$Tpx <0p0C|0 oPxt@P t00Ct0 Pt00t00000x l06 !\ \  XXQʸtP@00C00,0 0( 0ES0,0)x000 0 00P0(\@ 0H `pP0f0H`P0`Q @Gt 0 , @ I `>3[( 0|10|000=&| 0 `0 #1J5S 080(!  l  ` ء` P 0@,0A\$Tp. 08pP00P005 `Z$Tpt 0S p x0  ~\ 0   B!0p| l0Z$TpjU!0l000 P<0SPU@P PP0000 0P0l0S$Tp!00l00S/0S+ Am  000x l/$Zj& P&oF`F[$0Tpx 00000|0P0l0U!07 l000#Y00Sax 00 Z^  0l00" Rz   l Px2  pP1PePYPp00p0!0l0k$Tp<00 lPS |0x 0Cp|0zx0! l  RW0S40040Q.|0 x 0Cp|00l0Px_0,064@- 00>G-` 0Q`%@PJ PpPa0Vs #8z *8 A"80A# F0V B E 3  ^ pG0 ^s#8ᲐB)80B#Y 0U 1 PP `P    !oN-@P@3ßO-0M@p 00S 21`C`0 000S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X  \50QR i T0#03\0SWe* G0V*0F@S F3 BS   3M0WQ 06S OW*@DPD@ Q0A Q0Q l l> U00XS Q0X j00Q )Q 0Ѝ<^0 n 2>000 )ARoᩒY 0v Q>0?0l 1 c0R:j O-MpD0 cJ:@`00S 000S 0P 0S EA R[* @E  \  P 0PS9 Y@@@Ѝ@0 R[Y Q 0APS10Z ^@0D0CSڣ0S|P [ GT p 0 pTD [@J S0T0 @  Tp BB! B:P DR0 SO@T]@DTDZ ` `Q ߰ AP[@100+S -SU  PV PT0 0@B\ @~s#,000 0L@BT @R0lYE^bP 0S 0 S S@0S 000 b@0 0yM"00Ff0 PV 0SP00S PE 9000PY@ ^@ %@B,`P D` 212 Qa`\000 0S@0T@DUQVD`` 2  PE1: @ @0T0- T@ T@00'@0PS YPEP RH 0 R Q 00PS00; 0@0@ELP 0 C0 Rb@Rp@DU 0S S SUU~ EPyLP@"00Ѝ^0E0 00`Sp Sj S6 `Pb@0@00 00V@ ![K`T0 Pe 0S500@ 0faF PeP\ 0  SSGL@"00ЍP20PS0 @_@0 Ѝ@0S@V 0S S S@@0S000L#@0S@0S a@00c@0@0S `T0J  RP!@I0@0A0 R@S 0 R S@߰ P[ B@10Q@0S80@0H R( Y0`'^ E  000@05@0S 0  BR "@q5P `@0S Y ^ 0`q0PS @ "P1 5@  P /A-@9>8C RP`.pn3 ^P W0@00 pU 0`PEPV 0 BP @` pTp  0 BP0U`@-M`p @0  B00C2S J@    B Ѝ@-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ I0"S1 1  !2R / 3RS/00 |0 c R\0a X0 c R80A 40 c R/XXX|A-R\0000 A1 !0T pa2!"`'  T2!L0R L,! T TL L\LR 0@-@MS: P @  0Q P@ЍA-P$aM 1`p0S3 U10AT !0S 000ǵ @T  0S00 0Ѝ 0 @0D1S@000埵0S 000喵 pD Yhp@-@P00p R pPQ`00App@D `w80 0QApp@k \pDX0  +0#10/sQ#8sQ#4  00/sQ #2#01  //1A-`P@100("@Up0p 0S1pP@P$pP    !Hl`hP081#3S412ss /"r3J / R//@-@P0@0O-0 MZ  @SpP; PaU* F B  H ^!*0I X0C0 0ZP`V 0600Y0ZP`T@T 06S @ ЍG-0PpR%Q@X A@iV&10SP`P\ 1q0i000S l1T @P4 P1 p@T `P@T10SgP@$ 000S 0*0%@T 0C  pP@d0iV0S 80 (0R0i HpD"G-P`塢0`@Tڃ0TP$ Zp  p AG0  i )  S2!:R0L0C`\0030 `0pG \ `&-0P1 0^$23\ *G-`@P0@DT1  0\E*32Q G*@@P`Pp @!Pq@0 0S 0S W 0G`WL3 PP`R@H0 0S03# R B B  02NS dP 0!0P` A-`@ApDP; P 0`0V @ *\ l0D1V %& 501 P%&0;BV `C5,5#11C,C-` MXP@P XzX0W6Y0 W 0 C~GpGp50cp0 Ѝ {0P c2# RW C>C0C01` Ѝ0S0/0 R /@-phaM@P`D ?P7PP5  pP/0 S Q8 gp! 0: S1{?P 0uPP@0 000  0 0 m Ѝ'G00Ѝ\PP0EL L0 EG00GO00 0P(Ip@-@P :00C0S0 P:pP0= 0 DtdHh@-@P 00C0S0 @ I0 0 DGp@-@PPD 0rS= wS+ aS3`0S  +S" e0Cs\S0 0S``p0S0S0S`0`SF 0 p` 0> 0 lDFFp@-@P8 0S> :P00 P! !' 0S 3/PP೼000P @ P :00 00`300aa9?`` 0p%7P008, ,0 #D&FP 00E@-@P 00!R !+P 0C 0; 0 D,Ed@-@P 0 0 S @J70; 0 CE$p@-@PQPU 100SD 0  [Y ;000S% 0'$0 3/0:s00P:p00P @ P 00< R 8000S80 0PsIn=6P00s0l Jh0h 0 C 0@0 00 p{E 000@00  pp<C-Ѝ/A Q@-@S S S 6@@0 @c 6@@0 @ eKE 0  6@@0 @s000 0 0000/4P@- 0At @(E41S~ C-P ! Mae `@`2/A/0@0 <pd APMOĀmpX@Q 0p=kPS`Q 0p2kPHQ 0p(kP> Q 0pkP4Q 0pkP*Q 0p kP Q 0pkP@Q 0pjP  T ЍDOppD, Ѝ/AQ@-P @41S } P hP0DA-4!@j `PP/1S 0L1aP@ZBPPPU!RMPP J!PRp @V KD`_oRFD`CD``p@-@P P(pPA-@`VP] VapPIPQ V0E ( Q Q Q Q Q Q'  Ǡ   Ǡ  V Ǡ Ǡ Ǡ   V CPDCPSSO-P M1 S|$aVp$q q(SSp A`TT X`F ( Pʀ ರ[ `(q0S 0jP@ A Ѝ C$oB/\$ (xp Ჰ[ AT 0x^`S0S ?^0C pF p(VK ($! @$A AT$(0[ `(0 A^& S :0  @P=C, \$M(!r8 V(, T1 0A(~[$7((~ Q 0 0A$` a@($AR儰0 @0(1P 0 pPZ $U :8:T d9l0 9O-,M  R0 1 p3/,0 (Q0 Px @P``^$`P 0BZB @P UpWW 0 r`PP @R㲀) PUJ[Jp p,Ѝ 0 PoPPu3  $`o$`P  0 H`P& @R㲀/P  P^ ^2 ^"  ^gP 0 mjP 0`00,Ѝ0  \j0 P0ᰰ[P U pLp  -gP(A DR 1V(Q`0  @@KoP 0@-@ 0! \ @"A,A00,1S@-@0 @ A00,1R@-@1  0@A,A ,!G-0⌕SM 9 Ppw`@PK WQ    AP 0 pAp0 ឯP  0p '0 X% PU" A/ Q.p APae`@Y @Zh4  !2/@P Op1`oApލ$ğ PP( Q)P 0a0D!NB1\ Q!X Q$W0 p$4q$壺P ``#\3\PXs`T @HC P `  ލA lAQxcA`V   08X0 D4P ! ?@ ?X Pn0^4P P3S@ S S0@a4`Y;P3f0U D H $`gPN 9J ؑ@-@ 13/, (Q0@-@Q /00 2? 0 O-SMf` $ ZpW 00>0S >,` P-P  J-`P ,pW! 010! 0p#=  . .Gb>O00000 0000-0%H00KP\0*X X0 ?<w?q尀 xh< 0(<&P'@-`@MpPQ -00U' `P$ 0S r?( 0p" 2 pЍ -Ѝ p-Ѝ=00p 2/QA-@ 0S0QSS<00<.8 4,Ġ00#8 0C SPQ8Q0R4 0R8R, 0 P4P( 0 P<0* u0 R} RS0CP s0P0S0BR0```&      0 ppR0 00  0 0 00 0 0  00  0  000  00 0S0C`s0`0S$0 A Q0P    P      Q80b4 40 : u0 R RB"$L"4 2/QA-@5 10CSP* u0Q QZ 0SQSS 00 . ,Ġ0QQSR SS< 0R8R,0 0 00  0 0 00 0 0  00  0  000  00 0S 0CP s0P0p`p&     0 pp0RUSB0B XSV 0CP s0P0``     0RRSB0B $80b4 40 9 u0Q Qq H00@-@P,MQ +00T2 2,*   *P( ! 2& 0!  " m   0 a+z+P 20 2,Ѝ0,Ѝ0;001bp@-P@Q E+00p C+p P P P {AxvCP`ppR2:@-rspq ppP/P/0 0 0P/Q' 0 A1Q-   " "        "0S/  O-RMPh @T Ru ?o 2`qWyAu R00Sz \ P023q0W0C 01S 0 1 0 1pW ` `  0 1 01  p Sp p{ Vx0S0`S 0`P @0!13ppGpZc 1 @ 0a`oobST 0 =0A0@Ѝ㾴@P 㹴Pc WpGqX0 0 @ 0 A@`0_PЍ001 0=0A0@0@_P 001\\Sj T p8`0 0 ?8D ~`P000 1L@ <0< 0'87jppx  A = 111Q/A-MAT= mPT9  pR7 X 0W" P 800AV R X 0 0!`P @V R X@VЍ0  000 0 1 01 0/p@-P^p U@ ˧p p9Pd9P@|!|1 @-CM0M@P0,40㍧P9 H10D!,`@  PA*_p  p@ sp#  (p U ቧp  0 0 ,4 30CލЍl,0PQ9 0PڥH9P@D9?00r g gO- `P@P` 0S7 2 >`0p! Q0C R  ( 3(PN 10CSp'*w0 p0C 0P&0 0Rᴀ  (`崀X 00p10CS`7*v0W 0b 0 60 R `崀 `u(V m(`崀 0R 'P 00<0b8 80 6 M(<O-pP,M`Q :(00 VV 06J  (07`F0V` 0FS|800@,Ѝ(0VQ ,0`1vY/ 01` 10`1 I0ⴐC 1' o'@P a`FV`:b㼦&  0  =6a 0`F `Vv6:v` 0b ` ,6밑1I0Yِ`1: 0 b61,0@1s0S 0 @0' '@P 10CS0:5b%0 5 @ ⴒ@P ܲ0 00(0 @ 0⸑0`(0r?H=_ 2  @Z  t'V 0 p@J 0S>  00]' &@P9 VS V1 VO (0{aV@ F'T@  &@P 10CS`*0Fs @崒0S 0S 0 I@T @崒(0KaVO, @b 1' &@P 0VSa V0F '@(0+1ḑ0CS㣠y7*z0YV; ` &V ^&@P  & & @I y洒=긑0 @(0崒6`FvVv @: 0 b5 @2b " 0 5, @崒{0Y3a V0F 1& &@P 1ᴐV0CS㣰y:1b|!|0 41崐ቐ  1! 0@& %@P\ ` ` =0Cs 0 7 0Fs2 10  崐C @1\& %@P8 10CS`:t0bp p0 4\0bX X0 48L T p  0 p@-@`PP q0 00(0`0Q0(0pO-p@` &P6LM 0Q0D00 &00 2^V  Z600%5 0 D0 30cLЍw0 R*R* p 0 0S0800$00 P<080 0Vk 1S6  >%P䑄/  0尡0! 00 B0R{?0尰ἰ:1S 0[S P 0 ἐᰰ0000S !%  P 0崐V` S0!1  BR,*0 P 20 2r(k iw0 Qx $`P_ 0 p O%R0CS㣰*{0Y* C 0@1! 0C s0! 11 0s0n(0  0RK 1S RQ  RYF  % 20 2JZ㪠o*zJ [i RPcM0V`尐00 2 i Sf $ p 0 0S0000,00(p4000(01 S0"1!{/010CSP *u00C S {?尐!0b 0 3a0`y漐ᰐ00400\0bX X0 2D0b@ @0 2 [0 ZLմ\\8O-(0Mp I @aP0`f0yPP P FPJ1ZpuP01a@0  Q1R@@10CS㣰N* 0Ks0S0Cs00  VrS10C1(0  0R/ Ѝ @Q! R b0(0 `p+ 0     PS ,p 0 0 "p1 S0C1ȁ,3b(#(0 J2T> Y3 0I 1p9P(00(0U QPEUP*0EY* 0p1%Pu YQEQPEUP*uP0EY Vp崑 (00(0B10CS0I*S @```0 `p崑P Q #PP  @PAP^(00 (0#0!0!0 "PPm 1P0CS㣠=* 0J1P(00  k#0b 0 1 0p1P(00(00b 0 1u00C SpQPEUP:x0bt t0 1u`0b\ \0 1 .#k`p Д0@dtp@-@PQQp "P 0 0 #Q {"P 0 0"ppO-,Pa V0Fi 1c"@P! `Vp0ഀ0 0 pr 10CS0*s0S0SS PP 1b!0 10p 0 Hx1FV㴠0pp1  0 S001Rpp10CS㣰5*0Ks0S  Cr 0 Sq060W10C1 " R `P 1 ! 1 JP k" e"(0b$ $0 0|O-pP$M@Q J"00 2T T 200$Ѝ(  @f ꘷0┧0 7 00 B `P[  R Yt@ Y*mP0 PcA 2@D @bT㴐:b 0 Z0Aᴐ@DT@* 0t@S @D0COo0B 0 kp= 0S0C@0  4P 10CS0P*s0SUP@ C!pP 10CS0*s0SG 1 ;10CS0@*s0S#P !m !hTy*t@T~P^ 20 2$Ѝ05b,%,0 /T !5b$0 / |!T` t!00 P-  0SH  @`tl S: `V R!q, W@ t@ @DXK C!q Ws 0G 1 P AᴀW@DT@:0b /3b#0 {/ ! ! pPRPp 83b4#40 ]/03b#0 S/8@W1 @0t@@C 1p 1 0@10@pC1  X @P Iy0  H P 0 o@T ( T"100}`   Po ,` 0R X  qV@D q0V# @0G 1 PO W R  B1T@Dr 0ⴠC 1 %!@D0Itsp0ⴠ1 加  10pk P& 10CS㣐:0b 0 .  S P H˸TH Ȁ$ǘ4 l@-@PM 0  0P Ѝ05 0 u.$ÌO-p"P2JM @P M`0040h VW00?$G?7O0S 0SNIPIT/ ( P M000P"H2 0 4 30Jލ Ѝ$ >X00 0UXS 0 I0;w0. T:+[) PK0/S  000P0: S 0000S0I S0?00(1X$!$0 -QPPV$ 4- 㔜p"/0SY 0C \0 RK Y P/00W ʝp wɝP /@ol C4 B˜tR Q0P:Q0Q:.@-@-@@ $ @ p@-@DPA#*P;$  p@Κ d @- M@0 @ RP 0S  Ѝச O-\MkeG@3PapdFxF`0P  $,4@< @PHy    (0@08`-CDLp PTp `` ` @$ . `&(dHnfhlȠ  "Pb* P0#p' `&PflP c:eZ @$``gz,dL`l̠ . "` n0#P%,\ p'< P| P, @$` ,.dH```eXlȠn `0#  p'`c: gz P% " ,e\`   "l̠fjb*   @$. 0#dLn p'\`& "<̠|,s$PP Tp(pP0, `0P4P8PP<` PP` P @P@DPHPPP 00p  $( y",`-"C0 4@8F00k0e4G0 0\Ѝ@- Rp 0 \MP@0`0T00  "P  00   1-@  X P0 0 T0 30 \Ѝ0 7,0, 0,G : :dTph1O-`0X!0M@ p 8`P}q   000 0 Щp. R+ X   h G  0 08 < 40 0 0 30Ѝ] 9 8p@-`pQMlPDٙf0S6 ę@P P"UЍ Ѝf0S! @p=#(p70 00 ap@  zp ሙTt@@ePU  @ⷘ Py\r@    $ 0A0O-PEdM@Z\"0!P2 `D ?&cp0$V0\00  Y Ti:Z0F0#Z*VI @`p @ p@p@P V@P0["Zc!1 0 \0 30\dЍt!p1p $ 0*@  +V? @ @A S 0 p +@ T [ @0p 0 $ 0* T:Z0F0Z 0 0$ *Z0F0ZV[p0@ 6h 5T<pHH2PO-M0H`(p000       *h2K[0 @0+;R bdbjcHd(b@ ` ` Q ;>"< @  0 \ P b\ı@'GP  \葐     v@P$F .+Z D Z00300F ^P  P0 0e @@ P0f000d | H0 0 0 30Ѝ%@?>= 38T d T 0 1h 00@- 4MP00,00! @wT d 0T T H0 0 ,0 304Ѝ0$ - 0 T 0(! Q$1 A-HM0@P0D00 p `DV( 0V p `3V 0V  1 h X0 0 D0 30 HЍ$ $ 귖 0 ވ D /T 0 C-P04M`0,00r&`@ pW:T p 0T [&T H0 0 ,0 304Ѝ$ zW . , .P 0 0@-,M0 P0$00e @T ` 0T P D0 0 $0 30,Ѝ0$ rL) - d - 0 @-pQ0,MP0$00 `4 @T 0T x l0 0 $0 30,ЍP L0L 0 ($ 7 -8 ۠ ,(A-@p0P A`q800P0P0 00S   L| P~00 0 00 0*S$1   @p P@  [0  P 0 0 0eZO-ء@pJZv*z0 ( P  aPz`F`0 VH*vP P Cx  P岁ᶁPa`F` VB*vPP0 0 000 0OVv`:*V 0  rPP:Vv` *V  00sPP:1 b0 0' b0 0 '1 b0 0'h bd0d 0'L0H H0 '(՘լ<\LO-1,MP0C0SP0ᰐ*1 0CS 0 0*0S& 4 P0$0040000@p`0Y P P0ES00 01 PPPYg00CV 0 @P`p`Uv`b*P 0u@S0SZ 000pVwp:@ P$@T*t@1@A(0  0R 1 S0"s0&1!V0C 01ő 0YP0 pP p0Ӂ0C00V*R p@PpP V@ Bt@Q 0Y100!00Sb*00CV^ YPU:H2D 0'01 P0P P Ps01 P PP iTP    r` @v`@pVt@@pTG*t0 Y!0s00s01,Ѝ   r    rpG P$wp@@TP: 0  0&F0 0  0& b0 0&l h0h  0&`@p#Xl҈p<XHXl C-Mp`@P& PP! 0!0 0r 0000 00!! 0 04000000z@PЍЍO-$M@HpPPP 0؁00岁S000 00 001 1ᰀ0CS`I*v0X< ؁:`PJ  0岁0Q !  F P 0 0L0 00'!&VԢ@P$Ѝ͢$Ѝ000100@P4 b000 0% d(8LO-\M`>0pᄀ@ P30$ SD0 (0 n@T X7*#1 0Cs011 " r S 0 x 0s 0@SD@ a,00Sp  p8 00`8,000F 1PR `V 0` 00Cv`cS00 p㰑1 0CS*0pS 00"@ `V@ 00 0 00CS00 !1  S0 pp  "VQ  IY㩐*y H≐ Pⲑ T PLH3/ 00W p0 01 , p pp 0#S10C s011   00000 0@00DpS, 0S 2 0 t  q ma0S @ P 3@,0p0 0 S@Dp  O K G\Ѝ3@S00 01040封HX㨀*00x4 1pC0wp0qqpఁHX㨀*0x03@S00 01040封HX؀*X 0 0 sP:400岁 H0x 岁ᴁqpGWp*W 0 0 sP:0 0_ @' IY㩐a*y0V* C`` F 1`0100mpN   @  g`V@Dp00 0 000  0 P 0 0 0 각HX㨀p*x戀1040G각HX㨀[*x戀1040a!b1 0# 2 03 e>S@ Z0 0t!bp1p 0#,X!bT1T 0#7fU@PdĴ|ČĠTdx,@ ŬŀO-M5p@0, 0弱 MPP a`FV`>*V6 Pp@`F``tpV P @ t@@ Pp 0(00 10@@Pp 0U @Et@ 0n0@|$bx0 " 00Ѝ 2 UQZP10CS@*t0UQ 00PЍ P @ ` a P Pa0 [0 t00C Q>a[ 0F 1P A0V@DT0@:2b"0 {" 2  P P 10CS@g*0D@  1^ PPG a0 [0 H@VTo a0[ P0F 1aP b1b!0 5"1PE@Du t@`@! @ 10` ?P 10CS@: CP1bL!L0 "@  =1b!0 !0@Jz0' 1 0`10`@C1 0P1@D Ut@0@CPE 10V!0 s00B!$84  dxt0,R0</ B$0A00 0P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P H  0( @ 0'" 8O-p 4M(@(2P$0 ``0p  pP`@0 0  0 R%f#"," 0#0 %0  d! "d! 0 X!p p\  P`@ 0 `.@X!.b!!     !  " !)! $   c! c!,    $(`,!A+ ;K[k{(b a`+; A4Ѝ$0G-~q@P` @g(XR @!$0刁@`F0$0 0(`0 0Op& ?V9@F(?@@ 0@ 0T  4$0<$0 00T 0?`@pV? @?V@F?@"@@<$00T 0?@@@?`V( x!"a0$00 0A-PP@ $p~)7 `!0(0 0`0$0d0W0D Qh A! 08R(@R )@ b (`8  )8 b (`R @-Q/ @-@-@P L Ό 0( @ 0  R @-+/ @-p@-PP X0@0m@`\  0P  P p 6O-M(P 0 PH,P$@P 0PaP0<@(P8@4P8 ,P]< 40< ``$pp@ 0( @@``0pp, $ǠɌP0  0 $)',.'.97) ";4 0#0 ", '  "(0/&!   " 0 0&Ϡ' ( +̠ Ì !   ,,  , $  04 $Q(< 3408~?80 0b@D 0     $ $0 0   @  1a1Q 1.0p@00?0#<&!0#@!i0f`& qyv0"#.-%. " W i g YP%a E80R ?pp@-PP X0@0k@`\  0P 'P p@R @-D/p@-@PP  E(0R p0@-<PM00 P:6@0;P5 zP DP5E@05P( 7P '7P 7P@0 00u P0H p H ߍ000 ߍ03P 3P  @Eˠ  @0H ˚p H\ ߍ0     P@0 00 P      3\ 0H  勚30pH         0 @ 0 @0 00Pg  n  k  v  s@0 00P; Kp@0 00P =<@0 00P /f  8e  5d  2c  /b  ,a  )`  4_  1H(PLW  HP h@0 00_P  EDCB <,+*)(&%RGFxLL4l8@0 00P1 L@0 00Pz }  |  {  z  y  x  w   ~s  {dnΠ@kik 0H Ϡ KpZ lY] 0H  ;pJ D/0Bi@?=;9̠7=@00S,/=+1  3@0 00P @0 00qP       @ P(G-8M_(P` p '8@W@V@U@T4 0S  P4 0S3 Q!-VL W0`b U pp P\K 0 020  @ ߈8Ѝ0SZ Qp 0 00 sd" P0w ! r R  #m:VW$ Upm P`10   0 0UU0  P R & U Pt\ P0 0VwW0 Up8 $1 P0`   } z00 R y0 P0SQ q0Sy Yb @aU^ PTh0P0 TP0P0  M 4 d 0 p L  Xx p@-50@T 03/@TזPP Җ00@T 03/@T\pÖH00@T 03/@T$p ( 8 t@-M@@P Ѝ 0   턗p P00A, ,0  DvDH-M\ 0ЍO-@R MpУ ഁP  `A80 S 0SJ: L 0 Z 0!80S7  Q@0 8 0 0 Ѝ 2 Z   00  0 0 0P 00   |P00 2   vP   oP  000 0@-RP M@PQ    s/r?  DP 1013/Ѝ00 0@-P U1!^ 0C B^ \ L0D0p@-0P`U 1!^ 0F BS @\ `fpUpG-`P @P0pS:ؑI Y `1`! p| 0 PU  @PݔpP pPO-Mq  PpG 0 PU @P U `1`!  <[  0PU0  ЍЍA-0P @O P 0 a`F E P @DpT  ,P/0@ 0A0S*Q:/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A R:'0 R:@- R:P1P P1P R*rP1)P ) B" P1)P ) B"@ : R0150 51) ) B" /R0q0`0q%0`%0q0`/\0q0`0q%0`%0q0` R: 0\6: R: B0@-#81 ,Ġ̌%T\$DL0P  R*0@ :#Ġ01̌  R* R: B0@-#81 ,ȠȌ%XX$HH0P  R*0@ :#Ƞ01Ȍ  R* R: B0@-#81 ,̠Č%\T$LD0P  R*0@ :#̠01Č  R*0@/p@-@Pp00Sp * *J1 '0` !  4^ <0PT@  RWY 00S <  Q(( Q BPS !SR0@T 000S  00@<Q 4Z ` [ TI 0S6 0 3 P0倰SmT0 c/`A SE !SR@T q000S $0S !,0` 0S 0@T 70倰S \c/ a R  P!SRPU >000S  ?00!SR@T +00 R 00"00#3 0 2 30ߍ\c/ ", p <Qg!SR@T 000S  f00@O\c/@0r@ %uX *` h(g"0`0S$X U`3(0*PWY``2{ 0<` %H:p-0 S (W(` `0ࠓࠃ\^\ S440000<0QS<0  TQ`0@ gP!SR@TJ `00E@ @` 7`H 0PP ` <@T@ @ b W @ !SR @T M000S  #@ ޼`  8 ۨ A-M`@P`@p`@00 0,00(000oPڀЍ 4-0  “ ƒp@-P@Q 0P !  2!0 2pp@`p@-@P` VP"p0-P@  P 0S RP0/OP *0?c0 ?oPP0/0/R00 B-~x` PP5y  R i  ` RPJPN P?e0 ?o60⃑ i`PI 0 08P?e0 ?oP 0C!P05H RJ@+ IP?e0 ?o5H0 SP RZ 0P@ 4 0S00Y+R03<PR#4@@PPrR PP @0!32P#4@@@ P5`P_eP _oA/(!(1@- 0MQ020# 0S0* /!PR*  R @ 1@t0Q R Q*Q  Rh `0 0 2 30ߍ@ 40 0 2 30ߍ@0 ꇻ ( /O-p?o,M2PP00# R00SHW=  0$00 R00    0SU 0SS0哨(g 0 00(S@C0 $P#  7/ P7/Pa 0S 0 00`PcPU0= E B R Q@F 呢"`B`FV `!VY*0SG* SG:P 0C\0 0000S0  RR㢀@($ 0 P   P7/ 0P 0?  ` @U) 7/PX X0  0R0X 00  0 @# 0P0 0 XP  S0PqX 0 00Pe" Q0P0 S*S: "X  QX E ^@F 呢"`B`FV `!VD  B.7/P  7/P} 0 S 0SR0#! 0 R 0S0S㣀0哨( 0 0S@㔣$ X B`S 0  1 ` 007/ P 7/P0H 0`7/ Px7/Pڅ0 `DP7/ P^7/P 7/P^P$0@ " Q0 @  7/P @0@0St,Ѝ P 0  BP 0 C06-! ^@F 呢"`B`FV `!V  B&a`V|7/PJ 7/PPB7/P 7/P~7/Pl  7/P d 7/Pk  7/PT 0 0 0哢$ T P`c⃰@ @Z* @  Tz@ 7/PrU U   0 Y00 #0Q0 @0m< <0 (0l$ $0 QP`y8xP<y- M00 Ѝ<R Q0P:Q0Q:F@- 4A-SMP@  $3/d p0 PQ0 0|4P4S  $3/000Ѝ00A-pd 4V:@T@T 0P0 S  00 S  0⠋@P0`0dp@A A-M`p z@P0: S({PP ˅P@ P 0 tdЍ<00PЍ $$4/p@-P$0r0" @`Pp$U04  0B0 0 1R  0 p %  00A (u 0 @-SAN 00S 0֋4O-S Mz@ApP`ᇁ0S*0S'  TP Y !P0 00 Q   0     Ѝ P>   0  PQ1 0{$R P0(D@p 00q000S0 0p  4 S  $3/ Ѝ i00 Ѝc00_O000Q 000A/0@-S@  R   0 80S3p@-P@T @T 0 cpp@T|P`p  0S S/P/O$(0c03?c00 R  0 !!!0 ?oP//@-@ MRpP:Q !SV@ЍA0 0` P FW @ЍT000@00O-PPp W 0S L K 0SH a@-[0T B,B R`  0S7*V5* 000&P<0@D0C0S T0@@T  T,0 1 !3/P0@D0C0S3PQQ    DR !,0 3/`Pʼ@00 "R( T `10`!P0VQlRO,0 3/`PX R 0@D0C0S T@ 0T   P @V `!  0 0C0   B R @ZT `@ 0`V:_0P 00``F0``G  0X0C00 00oP   0 0C0  ` 000YP nd0G` `0 WH0HD D0 00Z 00V#CllCplp@-PP& 0 `V @`0@D0T0@T` ,0 3/Pʼ0@00pD0Spp@/0Z 0 s "Bxkp@-PP00 %@t@ %p@\ 00, P(z @"zp 8pR0 q R/ S/p@-@PQP7 100S- 0 5   0 P @P 0 0$0 s0 00R 0   p0  0c0pk,0<( (0 p \  @i@-PP,qM`@p) V1 T9 p p {P0 :CRo  S L 0( 0R  ; 0 Ѝ;0t0p p0 VX0T T0 T<08 80 ?hh?hh?dh"2 @-@PRlM0P0d00< 0 C 00  `"T2 0 d0 30lЍ 0`0S& p͆0PQ !W P00^0pS pp=PP000!|1 0 = 0S$pt!@ _PC T10F LD10/R  0 p 00 2   0SQ ` 000p p00` ppt p0p 0 XP d=g(gL=\<0|ef(p@-@0MP#x00Ta%yV( 6y0T1S Otx0T1S(y0`y00U TX!\!R Ѝp@w\!y00Ѝp@w00U\!X \!X0 000S/ p0 0p@-0PUp@0w00TQx0`U TQUP wpX1P0X1x0T0`X1 ph0h 000S/@-@0w0 X10CX1S @wOT1x0 @w p0 000S/g p0 0 0S/p@-@0PwU00 \A\Q X! BX!R p@sw`x00OT!w00p@hw `p\ \0 -4M0 0,008 00 0 ,0 304Ѝ, p@-@QP  ,Dp@z09 0 8bO-M`P؃@D@ [Hp0VV^ U0DPW pT"S 00 @00`Ѝ0 00 0 0L0@ 0S 00 000S0S Q .[ 00SV00ЍW00 Q0![00S0S @ d0K` `0 q VH0MD D0 g "00@ "00 66-M000 0 0 000 0 mЍ hp@-@PP` 0S'U  ppwP%0T0?P0p0:0pl0Ch h0 ! T0AP P0  0S 40B0 00 "5_L_ 5_(_$5\^p@-@PMP`% 0S.U7 0  0 0p0ppq 0: p0pЍp@jw 0S$0 p̜ ̌  ̜@̌L00D l0T00XS:@00D A Bs QR _`p!0T5 W p p3403O3C 0`@p> PP<1?8!80 V00Dp > /00XS W#p0 0 0 00XS W ppp 00BA0C QSWpPpphp0 0> 0W 0@ p p0@ p T.H0M0 00Ѝ @-M0 @| x   ruP 8 ,0 0 0 30Ѝ8 `X 0@ S 4 0 /@- ,l0 S 0,/0@-0, 0D S8 0 / 0@-0 (+0 S 0,/0@-0+|0D S8 0  / 0@-0(p +(0 S 0, /0@-00\*0D S8 0 / 0@-0<G *0 S 0,/0@-0D3*40D S8 0 / 0@-0P <)0 S 0,/0@-0X )0D S8 0 / 0@-0d )<0 S 0,/0@-0l(0D S8 0 / 0@-0x (0 S 0,/0@-0(H0D S8 0  / 0@-0 P'0 S 0, /0@-0'0D S8 0 / 0@-0z 'P0 S 0, /0@-0f'0D S8 0 @/ 0@-0Q &0 S 0,@/0@-0=&\0D S8 0 / 0@-0( d&0 S 0,/0@-0%0D S8 0  / 0@-0 %d0 S 0, /0@-0%0@ S4 0 / 0@-0  $0 S 0,/0@-0$x0@ S4 0 / 0@-0B  $(0 S 0,/0@-0# @/ /H-M 0ЍA-`@Pp8#ApW 0P@-Ϡ0#M0S " ! Q@, Q! QЍ  0S RP/O0?c0 ?oP/ 0p@- M0P@000@`!!0@PP  EP< (0 0 0 30 ЍpY V 8A-Pp`@PR#W 5`SRQ Q` 0Bk ?o/o0CS 0c11@<)pGB< pG C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$FpGOƿ 0@-@P  0001 F</ RC/A 0\R#R! R/ 0RR! R/-M Ѝ)B C O`G$Cp$CpA$SAp$Spo$c`o$c`Ao$sA`o$s`_$P_$PA_$AP_$PO$#@O$#@AO$3A@O$3@?$C0?$C0A?$SA0?$S0/$c /$c A/$sA /$s $$@A$ A$$$A$A$`FpG`OpGO`pGOf 0 ///Q R Q/U/Q0 R Q/00/Q@- S@ 0S@ \ 0 000S0Q0@- @P' TS0 C0 ^@DP \T0L^ Q^P 00PPQPS @R S Q0 S00  / 00/U/S 00RQ0 0/ 0U0/Q0@-" S$ @P0C S@ PP QP @\ 0@0@UP0@Q0@- @P ST Q@DP  ST PUPQ P00S@Q R U// Q#/   //s R PS  00/ 00/U/ 00/SR Q 0 / 0U0/ 00/0/R - /p@-@RP` R V  U  R 0 p0 0 $$I\QRp@-`@P 0S0 000 0R 0 0p 0  0HHR0  S 0Q 00S00/ 00// Q#/Q- S$ PQ PP0C S00UPPQ- S0S P 0000S0| 0 @-M0@00000rprp00lp np4 ,0 0 0 30Ѝh x-RBMM č dd  @T   Pn2   (FhF'00 @-@-`x@t"Mlr MP p $( rN TG <<" P0R @$@$"P `0 t!1 0 $8 30jލ ЍBn!`@ 0p [ Bn0 B^tP.`!0 -~L100@A@ 0 0 B0 P \ AL+\ \^  \\\\\ꕨj1 l :E :E < 9%D 90 J0  0Q>: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-40P$<D%LT,\ Ġ.̌8 R*0 :Ġ.̌ R*A R: B0-80P$8H%HX,X Ƞ.Ȍ8 R*0 :Ƞ.Ȍ R*A R: B0-<0P$4L%D\,T ̠.Č8 R*0 :̠.Č R*A @0@->R0M@ 0 000P0 01200 :P0ЍN00l0@ @->S0M@   "00!,3,0 P0Ѝ*00@-@Tn@Tn0 00/ ,0,0-M 0 000 0HnЍ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/ hp@-@p@-0@ ,pPpP 0$S0  0 Q00R07 [S*0 R0Q 00CS0CL0 Z ˄0S*F 0 b 0p000p<00@T X0 0 P0  B0X0h`HP00p 000 0z  p   0p0lW 00p000p000p@000 4 0 0xp,000 X RX  0P @ `00 0 Q00R0 [* 00Zp˅ p*W 00G S p8(00G Sȏ0p<0+0p00 R Wp0|0p00w0 \ 0000X P0S P @`0pS 00M0  00000p;0;00<  0 c  a X+ @ #2>!  d 00 < 0 [04  5$ 0 00CS0C Z ˄0S*0S0  Z0S00 0SS0S   0  0X00 0 h   R 0 Q000P@` 00CS0C  ŷ0S  0  000 0 p 00CS0C 3 `@P [00K0 #3 0 0 30Ѝ       9 0000D0@@0 Z000 00  S*py0`00`@P0b( 0 0;@9 s0 !0,@* s0 0  |A@ 0 0@s00000 0@s0S 0 0Y 0 0  @   0pȏ0T0  0@c ~ (D22 s.. .lA-P@@ x0`pP@PU J0S 8/`PEX@upW$0: 0 pDt-tX- 0SS S  0R @-o/ 0R0@o/O-p !1CM M@`0Q0440^P X 0 0 44 30*Cލ Ѝ0`@ 4 @CP wp0 0@XnL+ h 0h/T o n n,pG-`0S+ S'QU$ pW!@0 S00#40S 0S0S0S& 6P# PY@ Q@0 0R!R  "$ R R Q O-0pBMMWH1 P`0 pW' 0 T[P@P U\\0[P7PD <0 0 4 30BލЍ귡 l kO-4!01 @ AMT M0040. 0Y+:0`Px0(S2 0pW!W@T [ [ 0 P pW $ 0  ZPH @0 0 4 30Aލ Ѝ0x0(Sc kd jxO-mMM?x /| 80060 [ !R & R0 ` 0  8 ?T@ X@0x 0|  0 P   R= R30uo@P【  pR PP p Ḑ hP R!Rs ;P P@[ 0S!  00 0[u`@PPP0S@ 0S 00 9 S 0S*ڌ-  T x- \ x X < l  Ra0d<0v?@L00H0< 0h S1S H 300S S00`01H 021帡ZY0P0|Sx0D0<00SsATp H0CPo L0PPPym 0;[D@   ֠P :@80P3P  < H0 < L 0H0 L Rd@0S  P0S(Q <00 x  R  P RT \{|`P@p*6X @00:/P +: 0 6 30UmލЍY <@PL0Py !fL0P0 u  8 : X0X L0x<000SK0`0LH0`Sd0c  3`@pPV000`G0`/:0(0 `$ 00 0D40,00 0 4000F00ePP+ U=00 0R0N `1  8 h9T0 X0@0aZ@0  0@0B (0$0 0SM0@ , ᐐ#/E)b,"dP 70S 3@10P t8' 0\@] 4 @0@0PD   R  0 0D 0P]P`1  8 7\0 X000 0 1 01 0@0D`0  @ qdP& 0 Pf `1 r 8 60 X0`O00 0 0`04PX80&H $X M1Q0 U 0pK10 O 0$0Wvo@PQ@   W 0 0000QP O u$0 vp01 000Py 8 L5@ X0Z0PP@0% dP0L J@H0P s8h$h 0@t0  (0l00@0s8$ 0\@]0$0Wʣ0+S .0CS P 0@@@0PkP41" Pn `1S 0    P 0P0@0w P@ P4`!!! Q0   38 @X0 Q Z0P R0 . qW `R@*`Px 0|@7/P   `V q8 H2@ X00`!8 2@XȀVS0 d01SH 3h0h00S S00 0`P1C [h0 \dPe0 h0cP101Dp@PDwWpP 0 Dpp 00 bDp0P00P 㸠D4 j j'|&', e,#`!$ D0D`HhD $DLT TP Br DR bP0l0P0@@ l06SV `lTW6Spm06s P0 D0P TP Br DR mbP0l0@0P r8! 0d@{0S\ 0RT 0`1 j 8 10 XP0&0R  &X q8H"H 0 @8 <2 X@0w&0R  ~ PD UP0Ssd=00]q8" 0c0pv6 G0r 0R D0 P T Br DR  R,#aPʉ60 P @ 00mcPhP 1011S1 00 8  440 X0(048 X@" X@0&0R  <0l0l008 4 X0000 0`0+S .0CSX@0P !q8,%, 0(@~0+ (0l00l0@0Px q8% 0@~k0l0 00h0 % `›8 6@ X~p$$&$ 08 ~ry wPu0@i ppp&p 08 ~\/ /M-   0 C R1#0e(6, Ѝ /M- 0S  R BC0S N  Ѝ /M 00S 0 0 0CSЍ/RЍ/0@-$MP@aP$Ѝ0 aP0/0$Ѝ000 $Ѝ00@-$MP@aP$Ѝ0 aP0/0$Ѝ000 $Ѝ0MϠ-    Ѝ/MbA-   1 ЍLa/O-#3CM MS4p0@`d04401P$D 0 D2$0(0,P0000 (0 } 0p ` P;QP0$d400? PI00<  !7 S    ,Z d4 0;0 P 00 00; PP5 P0. T @0104430CCލ ЍS  T 0S0Q( Q" Q yT      000 X|\TXTUT P$( NH   PC-PH AM@M`p0 4" R3 Q|0 @ `{ P,8ĝ0  0 0 4 30!AލЍR9 PP 0@ .R@@T  {@ @ |S꽙 L $ LH4 P $O-!1AM 堑M0  0 40Pi`pPLpPG `|PPB @ t+0;P7 0S4 `  0S+ 00@ pd/P00@S 0S0S 00@ K@ @_ @縫 ᴫD ,0 0 4 30AލЍE Kh KP p IO-p#3CM M`P0@X0,40\@`S0S`  .S@0SVI:TW d1#T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @( 4PPd!"" T00 0 00P00S !  @D DR0$0 0s< R80 wP0 1 00S|z0000   Rl@00S}0000  0s0S0S RvRQ I H O-p0\MP2@0`KT V 0&S:Š/OČUŒ0@0 p= 0 `& 0FS X0 F0 0QP0wpsORKR0崠SUPP@`HVT@@TV \Ѝ!0s 0  T=z0 `F 0S0  s RwR R0sR0SP` 0  P0`CVT@@  B RX00 B 09QP QQQ Q뺠V 00, ,0 `\Ѝ EDհC-@0 Mp`(P)@D T@;)Q?XpQ뵐0 " Q  @Q`D0000?U0S  ЍX&L H0H 0  Ѝ(`ԐG-@P p`㶒Ẃ- F0S@`@0WV!< kQ@gQ, @`DV00W0S ?V0*v`DGRQ0?U0S dX AT0T 0 8 =404  0`<\pD0O-䡐 MP0S5 @d @V$0QV@0\\"  p偣 ppQV@tp O-aM M;+@040; P0060N0xU =0H `fp01&, d!0q"d!. 0`151110zgPP 0πʏ 8 zp", d1 0d1tX PE `P Z`0H SDP_t p\ S S00 PPp0S SR#3:0 0CQS0 0CQS0000 0|9|KwP reGo 0a]e-oTFa.F 0 t",0o#G(p i$Pp/F$ v"e#G0 / X  +0g6P 2#S;S 0 S" 0 S} 0 S> 0 S 0$ S0 n?R00sS2 S S0 D( n9R2 S S 0S00 S S SS@@ `0 Z_A0(0P@00 0S? r5R2, S S800R00S 0@0 S S00 4PP0S S p50}_     06`0X)0G PhTP RdP ,0;TP ,0R@2,@P,0 @S(p 0d10d1 QX|᭥1|4Zp 0ό`0S W`0`HPDSHp .Sp0SWP`.pGWV0 <P ,% ,0%004 0 6 30'aލ Ѝ t3i ЍA@oP 0nP 0S@ @R nP  A0yd Ѝ0   md Ѝh0d d0 PP P  "h@*)Hh8ǐd`lD䴰0A-0PU" 7U"P7UP!q|@@``FbP $bP 0!E`$1(`P 02~P(\($O- F Mf@`0, S0 4 |xF pV@p$P0(R8 L600vW40g(1<0 6 B0R  6 0(< 1 c 0@0(@'p4< P( P} pqpt40Sg0S X 4 0Sn`6S 8% 4 0S$00S S 504 RU 4 ,00,000S4 ğ0 0  ( YA4*0210S Pq00 S^ X40( L40 0Sp 0408s1%40(8p(TpP4040^ 30( p Ѝ00R 0Q*# 08s|30!8(p04Q(A%0$1Ru8# $30<(!^ ^ w肟 S:p 0(" <!%p0(0P^4(20( t2 0(< `2 0(< L2 0(< 82 0(< $2 0(0 2 0  8 ( 0 0(0(1 0( 꼑 (0(10(0 R 00! 0x1x0 0d10Qp (4p ЍCp N>p 0x ^8snqpx2 Z 00K  mb' '\' T&& &<&%%%%t%$X$$h$ ##l#<"""""""l"H"$"!!!@ݠhܼL1O-0$M pW H*(1$Q0AP01o@0^O, 0 ^/@5> 00S@  @ 0~0 T0 00Z @ :P80 0 0Z@ R 0X $00 $Ѝ `pl((0 $0 @- oql p@-@@`V 0 CQpPa_P  `FP    p^_P 0`0ph@-@00 R \\  $0!0D0 0@  ( $ T@-@PL  0S  T0S@S_@S\P/0d 00 0Q,0/01P/0(00$ 0/p@-@P`H P (0S  1T  0"00`p`p@-`0P^@P  P ^P 00p/< A- @0S  P p00   ($ 8PP(p`P0<*O- 䊟4M,0Su 0 j*`_ p  5. *`* ^ ^  @ 0 ~ς Y  ` @[ @:T8 Y :RVZ 9 0  Ii@9`P00<0 00 A4 S  !$R> p`S=0 0,0Q090( RB 800 RA ( 0S  Q (0 (0$iHm@(pP 0t80 004 R BPȟ  B QP 8 pP0 0L( ( ' X 0 7P`0 p 0 0_4Ѝ70PP P |7@p0 00  X' 00D0DS:47B0P$700GP p@004L0 @ 0 0DQ0C$010,6P0$$ @(,TD* Q=([ A([ P` p4@V@A(@T0@ @  T 0Q,P @P$E ``@P, p  D]P ` BR\pA$lPp `,  P01#S0  D0@P@( 幛 py Pg 1(0@ 0SA1 @P1$  @T(00^00(40$@ ^P` p5 $0P000033000C?00ꬰ( 0 \ 0( 0P} K ,P$idC @(P0$0 1Q@50@P$ 1Q( @l!PL$00PQ0\@[ 20P$1Q,( "0pB@0 (lP  R'P( 01 (0 kPP$ P( 1QYP( $Q$JP` p$ @@l1l!0< ^ς~0S0 0@0P /000P! 5.0:[0 [00  0 PbD (tH X \D(Ѩx\88Lͼ( T<̈́@-@P00 R ^  !$0000 0@  ( $ 8p@-l@@`VpPPpC0U1pPEP1Sp  (0$ 0pQA-pAP@T`QV0Z@P 0 pPP``p`0 @DA-p`@mZPP T  000P   $@-@{@0/ 00(/ 000/ 004/ 00/ 00/ @00(/ 000/ t008/ `008/ LA-``PU 0AP ppU0AP[<0< 0 ,(0 4 tHO%OJO/@- M404 0 $0\ Ѝ | l@-@P "0`00@%05 0 VjT @-@Q 00 2 G 0 G-PXsM@p 0p T 0S0-00 00 0 0$00,PP 0` 2# "Z &= " 27  0 00 00pq{ X X 00@I Li < 2R"00@9Y 2: 2( MP)0] 2< 21 0010010 010 0100100x100P 0 R00   0TT 0 2 13/p ЍTi0-00ᥟPP ` 02 2z00@Z@P0SX 2: 2d  Pz 2 @0 28001,00 d48,IC-`@ MpPQ 000ES90 2 ] 0 R0S 2 %13/PP"?o2R03SH lP (0 $ (p 2 P7 ЍP Ѝ00P("- $X000X "R0#03(0 $X "X002S13/p  ЍR I@-`@ MpPQ k00U+0`V' 2S * 2 P13/PPF `P 0 p 2 P Ѝ > Ѝ00PO-1PMS0:00 X'*q`I`[ up@ p W  ' 0! PtZ 2< 2ЍЍXPЍO-MrX>*`00Q̱P@;p@ W0 [KPE XP$ 0̡1PE PU0 Y 2< 2Ѝ1PE P0 0 Pt YЍЍC-1` MS.:rBW R* U"R  R00U00SR 0  PpXB Ѝ 2< 2 Ѝ,XP ЍG-pMZ Rb* U 0S @ R0  D] P X‡Ѝ@ 2< 2ЍЍG-`pᴑ 0F PP IPuPi?0@ @S1Z01a@:z0S0Cs0  0S001R@10CS㣐4*y0/ 0 @00CSÐy0S Cr   0Vq00R!2 B!0C2ph0d d0 /P0L L0 &8 b404 0p@- @VP ` yPP p Pp@-`P@Q 00T T 00p(0 2Sp0Q 2S:AP$AP$00C$0 2:0 2pC-`P4M@Q ^00 Vv 2+ RJ 13/p* 0 00S" "0$ 0 004 p`0 9/P 9/P I0  ^ 4Ѝp$ 0 " rq0 gP 2: 24Ѝp`?(0 0,009/P SaP8 @0,0000P8ЍpTЍp/G-`0",2M MP0Yq0 00?w @^  0R1X< )5S0@ZV`0/ L,. l3.< 0DpF YPX!L1  0 0 30I؍ЍV90PJ8 ứ8000S ! 0E\$Q\(,̠0Z0  QR$ Cl࢟pp̝@0Ɲ@02O00` T tO-P ` R@P H1⫲0p1q  J08 10N`㴜0A0040O-Sp M@`0S0040000 P0$ 0D;!@ B  8[8M  ^ Q 0 Q0L SV 0\Q r  \  0S  0"  !2#$ S C$ U@  UU SROS5sPnUi 0 jPa 000@@ℐ 0000ಀX`PJH0㲀0@ ЍXD U$D\ PP1 PDD00CD0 0 10CRU y0慅 B Q"0sPP @0C 0$ 10C0S0i Q 0S0bQPQ Ѝ 1 D%00 0 0 t@0@ YPUڜ0Sʅ 0P! PDp0DPU P充HDAD$xxO-M@Pp `V 06Q 弰 [n*^᜜PP" @`V! ᆀQ0  VQ\ 0 [yPPЍ 0S `@0 00S#@P 0S 00 000S\ 0P00080080ЍO "0008(840PЍ 0H \ 00 1 0H s0ఀ0- X;:0H`s00" 0 ``` [:0K0ರ00ഀ  | qx0x 00 0X }T0T 0 0< u808 0 0 }p}hPl}@pD 0A-%> S0!`$P@  @00CQA$0@D3@N0qW T00@2!$!ApP W0 < 0|LHPO-? ptM@PWp0 ᄛ0P(0b 0 | P0 Z (wp0 000 00`0S5H@0@ p0 P H  yyj0 0I0 0Აᴀ @ Rڴ R  H@D S0I Pq  0pH 0CwpL0봀(00@` @r PX 0,00 $408*Y0v`G Vp  `!pG Iw0wp`0v`s00አGZp`01*0`岠00p00{PP~ Y```0S`00F2y"0 d02"v`0 Y0Y0``FVm*Xv`W ```2 0 0 00000``FVL*Xv`? Vp1p!w 0S Br p0 H0@ pp0`0v`s0p0pIW㳐`01 *0X`p00ഐ00 00PP @00S8`00FMЍЍ0 00 0 0 0 0e 0 00k 0 0#`t0t bp0 s\@Xs0rq\@`q8(qppG- p`@PSG 0 QkU@ TP3  X0SI0S Q 0Ӳ0R 00ô00R00As00 BY001!*r 00 000oUU800C80/㉐BY001*/XL H0H  090 0R㲐0CSnO-` @0T0 @@D(0t@S(P,0X\0P'  `JPP"  @0T @@D(0t@T0 0pW T P  06PPPA-`P0 @T@ Tp Q Q\᧗PTG-@`P 0S 0S  0Qᆗ@PS" 0 00ᲀ\S: 0 BS P= \0 jP  0 (!0S 1$!0$10 PVP 0 㾐@pᲀ 04p 0 S T10 B\ᾐrp 5P $1 (!0 $1Q00 O-\?  M0P`p0CS0@L P 'M \LP& 0 0  eP 0{ S0  Ѝ0 0S0P 0 0P000@- M@P p10 Ѝ0O-M@p 00 p`Hp` Α  PPK0SRD0Z 00@@   0 pWM0r pG W@s 0J*0@p@ 0000S 0C⸰ s0ppW㲀0=*0p00ഀPP D0ZPPЍ0 ^P f0 0t 0 0j0 pd }`0` 0\H D0D 0 R0gg|XgD` g<G-`"20M @0 0,00w?0Rpl2SL:0JSI oPPx 2Sk1! BRE:0CS㣠j*z0Y* C 0@ቐ @1p01 p@ 2 0 28!01 0 ,0 30C0Ѝ %P0 ZP崐 Z y0 pP202 Mp  0000`0p$ 0 "p R,0b( (0 w ƀ 0pdA-p@MP`Q 400 2   Q Y:1Q|l0" B11"0001 0 VA0 0PU: Q * 2 13/p1 \* 2<00?P#\0 : 2 E E0P VP V$P 0  $Ѝ,00Ѝ0PU Q:(0 $P0PU`PxIP  eJP 21 zJc@--M" #   M}<| @xP P0Sd000S 3/k d<=Ɯ 8 80 0(Q/$(0S/ r< HaP<<00 R/( 0S/ q @P`-AF hFF #x /! FD M)h1 J#F I H F\0khBF1F8FAG5  p-OFhFI RJ9F FBћKLh$4+n ! O@3  V0^ѐI B(Рb+I+GFF"FFFFF&F+FFFF05h>ZI0F XK0FbhWI*FF9hOFSH#`;h+GHv(dhFM;hOF#`O "Fkh;k`+(FAF *O(43 .0ѺYO 4+A4 .%  6I,HJFd0[1իZ !h.HB#`#`d0[?EE(F$O 4J#IHjd0^ 4#$ U0 &0F . .3,4+^ E0I @02F i x' o p oPl w4+. M 0- 0 s20^ 0?w.F@? +hY)`xK竉#`%8F"$-O$FhFF4FI F%FRD#J1FK8FtC[R(4G((;Яf" 7h(_H8 (S          q  O %x(e(X( d(#jKhO hI hB:V" -ђEђx ; `^Kh/,йи XI O %FO 5%ENOMO% |V#  PFXFGIRF % F0AI"F&)F"XFF(^IEH"mhpCOc")FR\9IZ `^FhpCOTpCO*j)I1H! pCO1 س_𰀳_(F*!O𙀳 Ol+Ё(F#j*?+ J)jH bhjPC'Ѻ)jH")FOCFȄ|:n#Ѣk?HSco@"-OFt]hF0jI Q VRgLhOhJAFHFE !kh#j)CaI^G8-(+.?GMS #&047h*OckDkE@րg#k+b#kcccl*AF@ t]O F "lU,ԢlU,ե Fh"m@C bF@F   ENEі@B*AF(Fxa `Z"j(*@BF~ @AQ&8`}I.  @J#ccV(?kIF5h( (FFcm+1hpH0pCO(FF5hak(F;h 1,(4l:h  (F228cm+YH)FlYXcm+SJ1hSH XFHcm+LKZF1hLHccqЖ8+mz0EF_аhD#3C2#3C2#3C2 #3 C 2 # [B ##[B##[B##[B#F` 8hAF  ckKEث~ (@^F@Esh(-hD#2B2+`#p( E(S("BIFH s( x(цIHKhK"}K""zK""xK"!3; ,hvI t! psI lrHFjIpHoH,bN)Rѱ\(U]K2+gJgI^HfI FTK" hxhB!Fh( F Qhx!+"RHh+CINHhx+ (IH*HHGH*2L1R2I>Hh@H(FX2+3K":I)H4'KQ3,"`#, XM1D< +.H.J#`l#1 F`M?XiiF(?QIH Z(OJ2+?uK"!X i) p'95B!04!\3! > oBYj oPS22˹ IHAHx F(2+?!K"` F@ J K I"HJIH p>B!\!XYF hF/! FD FoI(F(@mL'mJ1F(FxCPkK!hh)`i-! (***BBh:W"P+iF(F (@pC O@#`RI*F QJ1F(F80KKh*V#Qh r0z!F w(e(L(1P(2F(+гf8(S " !""!!!!"!!!!"!!!"%")gao#c`lg`j#'aa`e`c#a#a_'`]a[`Y= aa ki)hdIV#sfyh"iF(F (F(vpCO?WB F")FUC! iҴ-OFhFVI Q ^O C%FQJ9F@FzC NKhW#0c>D#nm(p(O еDM(h^F *h AI@F0FPZРF:I@F8I8F5IF@FO F 0)F (h F ( `!F#H#pBO~#/# 0)F F 0VO,)F F d(1h0h)F x0 i'-OFMhFXI PWM&WJAF FCTK , OI(a >i , qhX*@i( f(h(еEv(#k`a"###cE  =YFV% F(pCO V%@BPFxoF  )I , i"B0! L" O#"  < jF jF hBI ## ! L#p r(``Oܿ#c`fLI` PH>K!8  (ƀKh++%+(ЇKh+'JJ6 *~J! +рKh{# wK"!"yK`#xKhuK`sK"opKh+ qqK"`pKh +.#bKxdkHjI#FjJ(F F%F FdL hCh;C`+ "hhY` "^HphZ`+:#LK6 0kFKxSRH(f#NK"`?K0+c@Kh+_ K`c+ C-K60+9H4H?7K#L ` f#1i dSKF0+'H#X#x+x+# rM$U 4!,єI "I@0"Cx"C"Lp"C"C"C|NX"OlѠR"Ct@X-CFhlrI P8qNrK$`3h BX#mIHFFHFBiJAF(FB2h(,aI a+R#21112#22$TO!8h (:h PIl$$NI (KHtKI |(HHjHI r(EH`,У+h3*=M#3hq+F(@6I=عR*hh#x320[ FFF!F$#3I" F aH!F KI (H  i i '@ tB@th@t( w:3tgDhZ -OFhFLI PM8$FF&FFDx(`oSBSAk`K9FJ@F~CєK иѤ+6TлMЊI XR(%G((0H8 (S 44545454q4545454454O &h(d(f(#v(#nKh#O &O O #&FO33,FkhW)+=:!PFK~W)@#x;#+'UI FJMK`"1F@F$F(@NI .!PFn(HIPFZ0FCI FP0PFF F 0\ i"S<%P]WE3"Q oPjKq{x>|_HP_HPch;c`+ FF(F (0 % N-8u#hZ"`xch;c`+ F#hZ"`x. @F0OS00OS0AHAFI.5@F11+1[5H4H(?d0J.Hq%+I*H.ȭ)Il bU(?@F'F#.2`I@F(I #>.?e0F^FI2FHOrK  %")FFtH(u܃ o"Q"S<>|dm#"Q(Jh(KZ`#N$MV{H9FliF 3+n;+f+ I 4, mZe "p18"wp, oP o#-OFFFFF' AFJ FAђJ ,8l-ѥrQBQAIH" V?F-цJI t(c(S(P(_dE B n( t(#Fa(xJF&-d-!d-A R-S--Q-nI*F p-wr-Bl-",;X*HF2F8 # X*"D^IHF 0\I X*"4XIHF 0UIX*" $RI HF 0PIF("! X* ""YF,<N0FAI"F`&WJE&6BE;I HF 08IF6J6IF(F`X* 4IXF83IZF(FIF1J(FF(F,JIF *I@ J&IJF$I ,@𗀇F&X*HH!F FN^BZ if7'D~rDD{(D|D} L%(I F(F%KB.=s@3B0QF(FFNEW(O 0h IMFZFF*1F(F"PFFF(FIRFHRFFOsjarayi p-OF-FL#M222 23322O3 3 J9F0FC!ѨK"h 2vc2CCCC2M+:*@HZz(R(3(`/(WS8'(S CBBBBBBBBBBBBBCDEBBCCBFBBCBBBBBFD5BD!D)FBBF18( "$A8((S EMBBBCCBBC#kaQ###\ 4 "#IF20x ( II CKXa/#d2+# 2'#2##2#2#2;M$jh4U9Hf, c#2232#2.K/!@FF# ;0;<@F02< ?߮/!HFF#;0;#P2#H2"2*\+@\KZiH2BIl(|"Adr[Adem%"{x"0""}6"}2o22?+"\@3?!2JB\Ca T P O@F0LPFP<SFHF060<<2bS#l` QTCFq2(F1J?FrH2  ѸmKd2+ҮkHrhK1F D F\HF%AF"CCFE5 T [F8Fq0h@3B h 003B7/NKo(Oee1IJBsOc\2:?31*?ٮ+?֮!2)*̮)Ǯ)®ñF@2AD2BAH23H2*?Ev&Fv+Q2"C<O2b|i+x` ( xi?@+ I H J Hd!(@߀ Ir"{x oP"}PH{(ЀOkO &2FH2 Os"H#2F2?#"H##"#2F2H?(~# !F0F  2+Cb.?wK\ichF2+@rHxqH!O O ##FjHdH F(fK6!.!,߿$0c 03+ 2+@VH2O08$)COHNH(lMHLHc@F$HI(DgB@FF@D`F(@ۀIl y+c+P+VT+_,yKyIFyH d*Q"RUQR_QQQQQRQRqQRyRgQQRQS=QSERgiCa[iBaYHQF09iB iBiB?p:x*?::!8FFHI "+CH2F9Fz!9F$( 1F#h 8I e*` x 4In)Qxo)2*`#0J`0I(FFP-JHEiC(J(HD#0%K%JFHF ]$iI F(_I F(YI F(SI2F " ir p""|"rAq= T26'͹ dOc)F"F0FYCF*I"F )J*I 찹(F(M F0F3#X+FPFEF?q  I(FRF d0I"F(F F: D<`BI"F }a; 0!+I"FJUm- #F I *"@dz"Ade;Y-GFL FKN'KJ!F(FbC+G00DH'CKh ! (>I 0;I O =@HFy(m(P(f(n +R#UUUU UUUUUUUU #`#!3`1#"2p hT w"9F HTT -F(FPF EF"  i.'غKJ-OF F ` F8# # L&7F #$f00`J)F@FC;F00#H6&7FKh 0ch#0! (КI #hI I O EKh+ PF z(O(B(eF(P8*(S XW;W;W;W;Y W;W;Y=W;W;W;W;W;W;W;W;WX+XMXW;XW;W;W;W;W;W;XXW;XYW;W;W;W;W;W;YYY1#0PXIXF A0DTIXF(@CQI# b 0 #FKHJ*#II0XFd#0DIXFZ#0AI #ZFc g(!HIs@H@"HQ I H] Hb I HZK I3FUHh]l<"P"X I H7 H< I H4K I3F/HB]Fܸ"l ="tLI K(, (0I8I@ IF08@"ń0  u -G (dHcH(bHaH! (8D/! z[H |F!YH |XKYIVJXK( FWIWH` "h0 QHtHH! ^0 MHj LK"LN !LH$O O O '3`h+ I:FK!3'x i"wwwx"x6xfxF#F `h C& x3 QIhh+63.0IKh GK#B 22 32pA_FZ  8Ix h310[5I 0F GFF*?b.IF]2FKF!F8Fvi+?o8F 8;2BJE#pO*?7B!F8F(M 3?(*F8F0!H9F8F h#!F8F82FKF!F8F,x" wxx-O$ $ FFF'D@J1F(FCDѐKLh#0B@,0+;"0 --@V' qOaVF(𢀸@ǁ{IV'(@AF(FZBF@h+qI*FA(Ba8((> /27eK`DcKh x+PFD]I hFyDvRJSh3S`qDn#j#7iNI8FXLI8F0KI8F(@𛁰hAFr(@EIh_(@7hBI8FXph rh=I gOaq:FV2F 7Iq #3h0#F p(EW !0F|F'I l 0hAF8D0 0h8D35B%@@I3 QV'FF` XV'(`PV' I i*-"'Z%  (`(i04FHh|I8F"#`BF.h6OaqJFUF(?d#3:F00F#FF`V'FV'FPF(XFF(]I@Fh[I@F@ZI@FV' WIQIHFx (V'(?eiv XF()F POb P/!hF0F00DB(r# P3p!CF.6J0F6I0F0А#3)F3HF0#FRho V<9 %I0F:Fr00F(FF(DIZh '" w{߸y2 :fj$:H"PYi<4Zզ&H -лn-k"!VM|"![y4Os4NV#CV@F@0OHF0O6%4KV2*s@+O @YF@FxCFтIBF\VV0IBFT4+4FC4[K[z. 3#bQiK4 JeK)p CdI氨BFOaUF(`IBF FOa `W1FOc(HFV(TJTIV0VhpCONI$B!HI !FDI"CH 4 JF(F .K$Rh$|0H1F{0',J1I".H iIF~( IOr4 IF(  J "I C04$;#X4 3BH2h*$I# *B*#C%JIo""P*"@Rx (yvIHF,h#T4SpIHF"(oKoJpIqT4+kIHF(iK*"cKS#Bp  ^I۱a`[#JC" F1 D0@ځ[# QI#BF +CbA li FIF 0HHAFOYIFOpKF(BIJF JF!9JR#JC"D$*6HJF[FAFpOuyK4.M0$$4Tʱ+@)v%ERFy FZFHC"IiyF+F+O0$ܱ+Ob0$@ǀ0ò$_DHORL>h"7B>"PIdx"*HP Or 򄀰r 򁀰_r~OR0$B+0{ 4S$O0( 44#0444 0+ @4+#vJvIwH#@4,4K$4 *Կ,4"F1F@F wNЦBI Fkh+?  ,aXhF`=,@^J#Fd! la ,`(cVI ,bX OrObOb!OS$4304$4}JHObT4+*r0FfЯCHK \483Hg+KS @"3FTH0(RJWI"SH jQFp( JOr4QF|( v0CJ HI H C;`4+h4 BIIZC=IlR;K0J;I.N@*#Ia0*0 $Bp /I h0 $0(F0@# "I#2F+ciat(F9Fb01FHOQ FJFpIRFph*"̘@x"̝&@Idx"и$p 4y4+OHJF;F1FOs/y3XFJT t $/W*7F $$J4+NPFAF *F0F{kB(F vWERFYFy(F:FDB(I P?iyIFO#EzOc 4 ttIFOPEzOS*ЩF;F OFIFEztIFOPEz +q-O|MFFh"! FDJAF(FbC ѮKh=-@@85(S --5--E--Q--q-%y-------------------/K_--{-pKqIh s#$0ojKh`khKjIhcdKh* v]aHO2cK!h`0C@a`0MYKh#bIWKhbEUHOrXK!hh;PHO2TK!h^ c1KHO2PK!hT`c'FH"LK!hK8AHOrHK!h@`FJIFPF,CHh @  +H +z(uIC84(jP;&5:T[H_cShCC`"x ( XI 6hCc8;C8;whCNKh>oH\JK x#  DI8 RR; ?I"jx ( 7I< 7hCshCSh0I C@`-Kh@; hZChC{hCw8;C",xF ( IrOsBIhCUhCQ?zG{A@bMR`# # = b* i#HLe'hCC$ "xF( yI#"xC+ qIKoIhoJCcoH`# hiIhkJC jH`# hleK x+ ?m _IOe LXI-<;+BUI$GPQKFY` +F[ @08`( {:(; EIhHCBH2k<+D 02FH4DDHE0KBFU6?+223LB@ph_p'_rAـK)!rH`aQUR !" "(I0K0k K& "!(Ih@# "!K(5I w!j#@!!!#$#k o!0&#!!#`"# H3 "V(Iܻd &hkhIFHAKOq<(򵀻KAOq&.I Kk"k2F(1 k#kKf4aM'#f"%f*)F ~b<;B󊀤I  K0@Lz @:!:۔I @TVz @9!:I`"2BTڵO݂I`; ~KiKhyI`) HL T@I2"oI O \0CkIgJSiSSa+?6fIaI 6hPL^Kxp ` 8ؿ`8@țHI '; IF( {*F- Mh+HHF?I##p+tbh++HF1H1Hl!'I t;$JxO  ENh  AFF HFd2"B+?h?6C-A~8@@":#x"]| ##x#hh#""z#H"" p"  #0+@2B`2;›BKd#C  d2h?𳀚@񗀨hhOzr# FSCH Kp @@  Ճ ݄#D#Bh2!@3 C陓#2[Ev:ꈰH zF0F2Z+O(+Z; hSjHC;^'+PcK;+Dh 32]HDhUK0 h h3SsEbF”Fb  [0};hC DH;AFCH 'h?oꈰH zF0F' Bh  /K P / $Ha"K 0BEoxꈰH zF0FJ!hBDzHD 'hchB'9H7 Hh#ٰ"#f##A#@ o####;+Va  #2F9F(F(?ix)7  "$&(*,.024HL HHH鈯H@1F(F#0'ZHHHHHHHHHHHH#2F9F(F(?ЭH#2F9F(F(?ŭix) H(FHHHHH#2F9F(F(?ꈩH#2F9F(F(?H#2F9F(F(?􆭉H#2F9F(Fy(?{ix)ЂHwHjHh#2F9F(Ff(?h)y}Hg#2F9F(FZ(?\yH#2F9F(FO(?QtH#2F9F(FD(?FpH#2F9F(F9(?;kH#2F9F(F.(?0gH#2F9F(F#(?%bH#2F9F(F(?)x]H\h1F(Fc0+++w'ꈰH zF0FRIH27+њ  ./ :* D =HD ܩ o O   3 FF ##$$3$P$u$$$$$%%%"%;%U%g%%&%%%&&,&G&_&&x&&&&''','A'T''f  BF F/>+E(IJF@F@%Hz :U!HJFAF` 'HfD Yܪo SC  PHF h/F H3FS}[(FHFV)X/DDd((Y I~IF $I F(цK"@Z`d+ '*!$DtDOvKh "DdDD4D$D$O O XFG(FiI(F%)F F8cI .ѕ6F(GyphUKhb "!QHI'XI2F IJVN[h "!+OHIRI2FNHI-7OI+F2F I2MJNINHI#JJ#JIJHI(!FJ! F! B! >! :! 6! n08I8I2F!O0b0h+2H,1L!hFP'J?F(FI*I"FF  ( & !O020h+H .H)F FH0F6$U iLZо^k}4r(-OFMF"HKM(FHwhK(F+`;x-+04H7F88F0H/F! xV+8LFFO D+?S;pD>V?D;+Ѥ NF$3`+~r+YR+i+H t+x+ O V)ObHFQFЋS#+d0#BF;F  Ef ki+ Y!j)ILr:HIHHHHD jAICHCH#"kw2a  h0%1-?s FNFHmk(F#1FC(3CkC v"1F(FOv}%ˊ˘˦˷>-GFh F<pL')FJ0FA ѵKhBv H IF hD(DРb++R#ۑKh 6#$6#(6#,6#064v#6#86#<6#@6#D6#H6}$&B4&< C"<&,&28&rHr4&r<&Z0mKmJnH)FF`U#PgI(FHn(ZeK #D#xhaI(1^MOjO W(@E #+p#kpWHSMP&khCL`,FOHLHF(<h1!oF(f.@8CF@*?HG +x++ .F0F37HF(Fh !8Bak,Jhkxh320Z<#XCKX`P&BD#m 620 Ѹ:.(3xU#C<6+B46+@0&mMmK*FlK*FlI 1G hH6KfH O56By۾#"BpHF9FD0FNMTMKM,6{RHOr@aNI"0F+FKJQ!KH%JHV(FEH DH~<6+K46+P3K?M@6+C=KD&;JC+H&9JC+$&7JC+8&5JC+0&3JC+3J `$0H`6"F(F:,I*Fh G)2)F`(H`]K&MY`! ~O%+08 oPa~PL%%ђџо %+8+MmpsvЈzҏи𵓰FF&ODUJ9F(F^CRKh-@_H(%Рh + +R#y+++++++D4D4DD$D7Kh6K`4Kh4KZ`&W#p"1H9F8 !-K.J.H-O!8F*I:F $OOsD0d<09h $ P!(FBI nI"F(F(Hh+Izh(FI(I6!F6I#33B i'xr%+: ty߀ tC-GFh#FLMJ9F0FC,цKL1 1Ch$C!+@߀@# C@O,p%%aTFF(rI x(`(A(;M(Ua+R#11111111111111 h3`434434yHKIJZ`u+h#`131m@33@3g131a131[131U131OД *F)F#(F h@+IF "h (IP#&JF(FF8(FHh8 3x+AF0FG.?K.W AF>>"h"$+?K J`.%+'0 i0Sf>|%%+ o-CFFIFFPLJ9F0FZCbeiݱK R.@3B-@M#j+@Ia((t(<єKi JhaJ9F0F0BяKMh6.,iTI F(I F( O 玱+i{ BF|I}H|IBFzHt(o@(A83(S gggggggggggggggggggggggggggggg'g39?ggEIUY_eugz(Fci+BOsci+;#caci+4#ci+.#ci+(#ci+"#ci+ ##c`#a#a#ci+ @####`#`##bKh`ci+Osci+##i+ KIh a(#cb%0. i'-X  p:chh+&i--iI0FXgI0F0fI0F( -c.--Ѯ=-?ͮS% {-W)P h)F(MI*F 6B@-Ѐ-i#"jihj(cAF=H i##"jihR(zshW)W)cj+?S eW)Y`" <0&HP??!HDOBFH F<JHٲ2 C #B"F-`j(? iI F(I F(AF H-X ֘D^qցԲԮ-GMQLF F'PJ)F0FCNKhB$=O U/HF MR(f(O#4'*OaP (jI$d hKASJdK8(BHLM&`h$.dhFK  #FFRJHCF@;L#F"KJ0!\h00 0#</u(8F#C   .(_ (@1vhG!0IF:F,/I FF!KTC+I FF K"h(;'I FF0 K"T(X(/"H!F*!I F~(3K"h(-$Q%X2L&5? oP oh in,,4D+R#%%%%%%%%%%%%%%%S%%%%%u%% %G%%%%%%%%%%%%%=?I%k%%%%țȥAɭɷ%K"(HK"X(T(K",K"!FhK` #hx+?KIh ZK,B,,2,~|K",yyK"H(twKLwKhF F~hqK"L(cpLObrH!hoY? $hFmI"FFeK"P(KdKbLhigIp6(?dK8:\KhYK<(4WK"T("X(,UK "!FhjOK( #hx+?LKSIhHK"t(HK "!FhPBK( #hx+??KGIhn=KhDI "  F%P7Kh=IPFj`x+0K:Hh 5D-"(Fo0-HP 5Fg K",K"L(Kh#FK"`(d(K"L hkK( "hI Kh?)H mHKHhI*F%X'p%`l p|' o%9OL#H<<^(xr (@TDF(@𜀦K(*@€)@𤀢HUK &I "FI " F$H("FFHH JFHHJFHHJFHHJFHHJFHHJFH|HJFHtH}JFHl FFu I s=I o@!h0FF F5FKFOb'F Fx FLRh P|Px 0,8P+H,*LK",+$%XHR\htP޸~EY %dI-:F)F0F,8+I= ,8+О-CFhFLhIp1F(F#3jp2+Ā"l!򱀠I >- (;ћI $9(/(,qhHHv(3331FJ(FAѐKh/V#PJ+xh320((F (هI" Y07 s'O )FHOr=p? |K|J !4 3xI vI tI rI (F oI .p0mI!lHnlHkK(F4.hH4KfMi i dIFaI4+I\Mi(?Bl"!(EVM VI,rť 1#c1H=M  +h+9K9Ih$-(6H! (h(?? +Kh#c*Kh+!)HZ G . e F(N3h+(5`Kh+xc&99&[T9H9jT999&&\9&[T )i9&\H&a:&\|&\<-GFuLFh'2sI Eg`qJ1F(FC*oKbih:CV# 5Y(h(=U(@bK!hh`H^(^I Nu(`(G(DI(FE(;WIFFWH Na+R# mmmGUm]mmom׉mmmmm׏hC`h#s8K/Jh+Fc`#`t##aqĠO 0F)I@F0AFHFV$K 'h OhCsKJh+Fc`##H"Fz(?:H5#a2# H"Fj(?*H@Bid&|` i&lX o p'RPt-OFF Ip(ڠI xK,FĕLKH"!9+`0+ ii*ݭ0\0 I0 K I@th&&\ ptg]n' -O$FF&FSJ9F(FC-QKME..K0FC1(8,D FsFM  %EI F(6W) X0=W) >I Rg( u(G( `3x+@#x0x0F0.I2F " FFx+-'I $5K #H0M(F0I 4@F0I6PFZ0IP= (F HKJ(FF+F!F F"Fb i|i{[b'-O#lO$kJFOp;`FiKjM`jK`jK`jK`D]iK!FOrhL`&hֹfJ#fM$fH5eJ5eJ5#C(raIaH Fh0BhF(F4ahm(T D(@f(BC(EQISH p(Hr(OJIF@FC&C(WKH 4X pCO'+&s9CHF(;O F8{+ѸO9K"`95K6I`##`Ԡ/LO F|O FH'I"'HO l%L h]F h]#F^(>IHy&&&n& &&&8p&D&&& p`&<&&'}'&Dc(c!rHqI oI nI hYb@jHn@ # D1F@ D-F-( $##`(`V0F T  TfWH # T  .I T l.JO@FE E~(FE FE F@F EDH"!F #;`@K`" ?K`c:Kh)[ //(R5K" `13H  T !0FD1F( #XH#A#3B #2FAF #O3?F XF!FXFh.F|FF{U)DT)D  s um&D&&@&&) -OFͰhLFD&O3FF `AFJ8FAFњKhB!ݹN"HFFHړIJF pp-a-b=-   " 4z--4IoC"H## h"@3~K|IO3oB|H## h"*  sKh`6OF[ ( 7 8F1F@HpC_(##O gJ#aX)FabI0 ZRF(F 00P##bDF(qWI. 6ѹ3JFRIPFQI&FOI JFOq0F( "0FYF "FHF^(?IDs0F(:I 8I 9F0h0hph!phIF8F0hph+I+JKFF(?l(I PF(%I#IE)F^!FX#6IX# 'Jphk i%'"h` o@thhhv>|hhhhhhhiNii>I &O041F8FB,O  BF(h+ 4-IBFh+ 4)I #DBr#BFFU  F6"h+FOqB ##`{нB EFh+E 4K! 0FDsPFXFF -Ii:i,-O(-OFF3}  0LhI FHHj 3}I F(IHjH O(r!% F K!(FQ01K"h1O31}3l3,130(F5!F0 5! 0o OE5#FF811F@FKLJJCXT32(FD0B<1C3<17:@7L0 FQ\!`1:#FF F:F(@81@02BnK+!nJ F3 <1C3<10CE@ځ'dMV((M( 6(?(y4(O ]K'N8(S G]cif('j8(?g(?dS 1?:Kh01=@D+6Kh@2(L%E+0K''81%Cc81%e###81?H %O K'K'FCF! F:(381?9H#^ooncOrrs XPnn;sE l'lrll i)@H02B)F F:# FFV!:F(FCF! F:; шH3 4'0> #Y 8F5d0}I~H7 F7x1+@ F)F:DZDV F:MpDO F74 F5jKhBDA81@@,B")FX0@XIZH743<3)S,Stt.tDtStatqtt0tt LjUttuuN2V IV"LJJHLKKdXF7;0ѨIH!XF5p SOq;0ѢH7p"K60љIH7aa ( *<1Y\Cs<1`1 F7'x(=ьIHa`!R#70@`!HR#7E03\!xB0h *981IL  6 F5<1zH^j*`!xHR#  #j)[hx1Lx F2F7j1F F7<1Y F5x1h.@NJԋE3 /PNՎsJPWIC  67HF5)FXF9x1h-?έ+j;"LK!6Lmh 032FAFPF5z3j30F4`0F7Cvhx1h/:Fj"03[h*?!1K62`h0F`7xh.CWxaB`$H6381@C6r6@C=Hp|C681(h?oo ;+?oOu,u? PAjUuKu[uuusu I EAv o  Q/0@-0 ph P ^0 O@0 , 0 010ӬtphL/10!O-bM M b [ !b1 0 0 30^bݍ Ѝ"mZ `F\ t $ Hp; 00G0+x(`0( G080G p x8_S0 @G P0 0 00⫪ 0媪J )P x8`@##[*P 0P l840GU P 0P l840G;xҬd`JJ0ƒ S$*0@- R P@ 0\ R^ H00"@<0 0 0^ 00"@0/@-M   Ѝh  \/X-M 0 p 0 S 0*0 Ѝ0K/$/'/y*/*/*/&*/%*/*/*/*/*/*/:*/*/*/*/*/%*/_*/\*/;*/b~*/{*/x*/u*/cr*/2o*/l*/i*/9f*/c*/`*/8]*/Z*/W*/T*/Q*/ N*/K*/H*/0E*/QB*/?*/)<*/{9*/|6*/#3*/)0*/=-*/**/'*/"$*/!*/*/*/*/////^*/ */ */<*/*/*/*/*/*/`*/R*/2*/*/P*/*/*/*/*/*/*/*/1*/o*/i*/l*/t*/s*/r*/p*/j*/m*/*/Z*/ */!*/ **/ *Q/=*/*/*/(*/$  0*/ n*/*/ |*/y*/v*/s*/Kp*/+/jk*/Oh*/he*/ib*/v_*/\*/ Y*/V*/S*/P*/M*/J*/G*/D*/1/ ?*/<*/I9*/6*/3*/0*/-*/**/'*Q/"*/*/*/6*/*///*//7 */>*/ 4T*/@-@ῑ@*/*/*/*/xGxG^xGjxGNxGoxG'xGxGxGxGxGYxGxG9txGwxG!xG珁xG玨xG xGjxGp{xGDxGxGxGxG4xGYxGI|xGBxGxGKxGxGxG2xGVwxG\xGxGxG .9xGxGxGxGjxxGxGpxG;xG熇xGJxGCxGfxGxG~xGj xGxGj; *YxGy 0yxG#JxGxG7xGxGtmxGxGIxGxGJxGxGxGQxGxG9 xGxG-!xG-xGxGnxG.xGxGxG&ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRtunneldeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"0xaddress:%s: getifaddrs%s: ioctl SIOCGLIFADDR %s %s socketSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] vlanvalid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLANvlanif vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey *****%d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDrtsIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan resultsSSID%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSINTS:NRATECHAN%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfstmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:mfs-mfsWARNING: -G may create file systems which cause kernel panics formatsector sizesector size `%s' is not a power of 2.maximum extent sizeblocks per file in a cylinder groupfragment sizeunknown gname %sexpected files per directorybytes per inodefree space %number of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'file system sizeunknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%dstatvfs %s%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu, ...Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectorssectors/track%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %uFAT%u%s: can't write sector %u1601803203606407201200123214402880usage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d ./canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s/%s%s: name exceeds %d char %*ju / xitverbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s dirCannot find directory inode %ju named %s cannot create file: %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table open: %s cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s Checksum error %o, inode %ju file %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumes%s%dSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s char%s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160emptysystemwarning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s LEAFbad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s RSTTMP%s%ld%junot on ino listmktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d writeL%d %d I%d %d ioctlatalkchangeexpirehosthopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplstagproxyprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinleavemichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivaldeparturepid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorSO_RERRORCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u/%d%u.%u/%d%u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswdppriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponat:usage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSDevice%-*s %*s %*s %*s %8s %s PriorityCapacity%-*s %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s-f%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. %s aborted. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. ] Using %s mode to transfer files. changetype: unknown type %dbinaryasciitenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsSHELLCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueputGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufrcvbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sAIimageebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxypromptrpromptsslnoverifyaccountbellbyecdupdisconnecteditepsvepsv4epsv6featuresfgetformgateidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspagepassivepdirplspmlsdquoterecvregetremoptsrenameresetrestartrhelprstatusruniquesendportsitestructsuniquethrottletraceusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]:%u Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'URLInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s ) Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. %c%c%c421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkreceivedCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy cC%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgatehttpFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpgate-ftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpTERMdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %s-TBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymous@FTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled - %02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecall failedcan't open phone number fileunrecognizable host namemissing phone number call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo secondminutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonelinehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filebrdu%s: missing device spec%s: missing phone numberhdraectbdchfesprdletdvcmiepndiexpausage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.zeroone%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecremotescripttabexpandtabverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechoparhardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234RINGNO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru"%s" ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderr Terminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgidsetuid-i/bin/ksh/bin/cshmdnsdmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitGPTrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)noautoZeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesAllSomeokOnOffDelete?installreinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')cylsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **HostBase directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.FailedMountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)No free spaceInvalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelUUIDGPT TypeBootUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partitionad, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. # sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalogLC_CTYPE11.99.5evbarmxfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv7hfeb/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostcdn.NetBSD.orgpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv7hfeb/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X%s%s%s%s%s%s%s%s%s%s%s/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s log filecould not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig. net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostnamehostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)/dev/drvctlget-propertiesdrvctl-commanddevice-namedrvctl-argumentsdrvctl-errordrvctl-result-datadisk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)%s (%s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c-rprogress -f %s -b 1m dd bs=1m of=%sdkxbdcd*fd*udf%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001%s%c/sbin/mount -rt cd9660 /dev/%s /mnt2/dev/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspkgsrcpreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %scp %s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/dev/console/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbetcgamesgpufwmanhtmlrescueteststextxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s%s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub/boot./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.confusr/X11R6/lib/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%dK%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %sraid%dvnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2d/%s%*s %spartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c -n %s --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dvnddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (%s, %s) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullv7sysvv71kv8otherhpfsadoshfsfilecorentfsjfs2efsnilfsminixfs3vmkcorevmwresvvmresered/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal error%d%d%dWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitiontc/etc/group: /etc/master.passwd: (malloc) Error in munmap(): JjPUPuVvXZ ___ Begin malloc statistics ___ disabledAssertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumalphablankcntrldigitgraphlowerprintpunctupperxdigit%s%s%s 646towlowertowupperASCII/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbinA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number%m[:<:]][:>:]]NULSOHSTXETXEOTENQACKBELalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDELshut up gccSuccessYP FAKE error %d @  % i&=K*)- {p"0"6$9:%%>(B)E-yM.YL.YP1eV3\3b3h6r=x>YA,PT7VUZ%^egl pq Rq!q5q;qOqgqqeо ")2M@ 6 9->-D-KaPaUZ,qb&pushdnepopdne  " @@ $ @@* 0 IeP 8 > Y@@b )D Y@@J unblock and -DNO_CONV?`<0(pH100 0prtstatUsage: %s [-] [-ESsx] [-p string] [name] usage: %s [-fhiv] source target %s [-fiv] source ... directory -PRpv-PRp--mv/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverwrite %s? override %s%s%s/%s for %s? rename %s to %scan't remove %s%s => %s %llu/%llu bytes %d%% written %s: remove%s: error copying extended attributes%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)hifv%s: destination pathname too longusage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failedfts_read%s: is a directoryDISKLABELSECTORDISKLABELSECTOR in environmentDISKLABELOFFSETDISKLABELOFFSET in environmentchanging %s byteorder to %s%s: unknown machine typeline %d: too few fieldsline %d: syntax error%s: No disk label on disk; use "disklabel -I" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading mbr sector %uCan't read master boot record %uInvalid signature in mbr record %uInvalid extended chain %x <= %xattempting to write after failed readdisklabel write (sector %u) size %d faileddisklabel write (sector %u) size %d truncated to %d usage:%s %s %s %s line %d: invalid format\ :%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:sc#%u:nc#%u:%ssu#%u:%srm#%u:%sil#%u:%ssk#%u:%scs#%u:%shs#%u:%sts#%u:p%c#%u:o%c#%u:t%c=%s:t%c=unknown%u:b%c#%llu:f%c#%u:sector size %usectors/track %utracks/cylinder %ucylinders/unit %uwarning, revolutions/minute %uboot block size %uwarning, boot block size %% sector-size != 0super block size %uwarning, super block size %% sector-size != 0warning, number of partitions (%u) > MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted failed to read bootarea from sector %uread sector %u len %d looking for labelignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes no space in bootarea (sector %u) to create label# unknownline %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/tmp//usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderTMPDIR%s/%sEdDk.aXXXXXXEDITORmalloc-c/bin/shre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kvirt68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusunusedVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSRAIDccdjfsApple UFSvinumUDFSysVBFSEFSNiLFScgdMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedZFSSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)erayesAutomatically adjust partitions [%s]? Invalid answerreallocarr# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tableQrounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] Usage: %s device %s device command [arg [...]] Available commands: nonerwsave%s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s not %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s Wedge dk name too long; max %zd charactersqe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: getmediasize%s: getsectorsize%s: %llu bytes in %llu blocks of %u bytes %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. unknown command: %ssuccessfully scanned %s. strategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkgetgeometrykeeplabelyes | nomakewedgessetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVrootDRVLISTDEV: number of children grewfalseArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s' unknown command `%c'/%lu/%luDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d usage: %s [-aBFfgIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -g preserve existing GPT headers -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1read_disk(); secsize invalidprimaryCan't read %s partition table%s partition table invalid, no magic in sector %llddecimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] EOF gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. [n] write_disk(); wfd == -1Outside bounds of extended partitionNested extended partitions are not allowedOverlaps another extended partitionSector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionExtended partition outside main partitionThere cannot be 2 extended partitionsExtended partition busyMalloc failedDo you really want to delete all the extended partitions?secondarygiven GPT header location doesn't seem correctcan't delete %s GPT headerCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s Bad argument to the -s flag.%d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicInvalid sector size %zd0123FSafgiIluvA:b:c:E:r:s:w:z:Bootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %scannot open %s%s: fstat%s size (%ju) is not divisible by sector size (%d)%s: DIOCGDEFLABEL%s: DIOCGDINFOCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deleted/usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1reservedNEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Tablefatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console-sh/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEV%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node realpath `%s'getargsuniongetmntinfopuffs|%s on %s type %.*s: %s already mountedroupdatemount_puffsrumprump_%smount_%s-oexec:Cannot create pipeCannot open fd to mount programexec %s for %sexec %s for %s: %sstatvfs %s%s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llu, [%s: %s]nfsOnly one -t option may be specified.Aadfo:rwt:uvrqnoautofrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@cannot open `%s'/usr/sbinasynchronousautomountednfs4aclsposix1eaclsdiscardextattrhiddennoatimenocoredumpnodevnodevmtimenoexecnosuidrelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mapping/posix1e ACLSnon-reserved portsWebNFS exportslocalwith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsv7fsmsdoscd9660adosfilecoreext2fsntfsudfsysvbfsefsnilfszfsstrdupusage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 %s Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s %s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-I-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#x %2x Destination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%x%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%#llx -> %s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2xunlimited%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %s%s%s%lld.%9.9ld 0x%llx hw.ncpu%s%s%duser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s???%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXROOTANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstruct./createMust specify -w to create nodes value%s: already have %s for new node %s: missing value %s: '%s' is not a valid address boolquad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) destroyMust specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexNODESTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendormalloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't open %scan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular filegunzipgzcatusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREmoreVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue Cannot allocate memoryLESS_TERMCAP_%s$<liLESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000l LESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDticlcmsovbbc|^crsr[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USebcdicIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPnextwindowswindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE/dev/null.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) #[Press 'h' for instructions.]& There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%cSHELLlessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completedownexpandforw-completehomeinsertkill-lineabortliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdigitdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %s*s>rscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columns%d,%dheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: prompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadshifttildequotesmax-forw-scrollno-inittabshilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofdumbclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found/dev/ttyusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzip-dcexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe%3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%2d:%02d:%02d ETAKiBMiBGiBTiBPiBEiB.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interfaceSTOP%s: waiting for an %s addressexiting due to oneshottimed out%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dkillwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exitedIPv4IPv6/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %sgetifaddrs%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltuuidptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typebyteunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatestabletemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argumentoption requires an argument -- %s%s: embedded config too bigprofilearpingscriptreconfigurereleaseleasetimerebindpersistentinforminform6timeoutvsiovsio6waitipallowinterfacesrebootnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrbroadcastnolinknoipv4llrenewnooptionprintpidfilerequirestatictestdumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyanonymousrandomise_hwaddrdestinationfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0link#%dsa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueoldnew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessifflagsinterface_order(none)localhostlocalhost. embed index array uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address flag bitflags domain dname ascii raw binhex string uri rfc3361 rfc3442 request norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_%%%s/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULLlo0%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASbridgeepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseviaNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberfilenameserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanishedabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink  $6@LY_LY__p҄ҘEҩZҽ#  _^F<>3?FYPATH= :?tJf[HdOHsVJc`HmgHlu|r ݄݌pݖݞnݪHv ݲb    EOF reading here (<<) document 0^"'.5<AIQW\cgkrywKz$}-+?=@V@`blrehnabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'"P0*"P,12"P18"P8B"P0P?m"P0"P0"Pp0Y"PX0=4 <  )< W    8 t= !Fvlj`                  @9F99O'T!Z:Qbf݂:lr: T!)t zy~aa:=^ .D}kkٲz+> :Guy ;UQk%    "| * :0: (]0 /:ByJ/N9R/VY y]aD]flr/}#3#3233#, @@4=6>HPy X@^djrpv C$CC$C@@  D&@T. dv} @%-5@ @;@C@J@R@[@`@e@l@t@{ @y@@߈@ߐ@ߗߜߢߩ߱߷߽ @ @$/6<BHPU\cmsyKPܜܭܽ#6Xe݃ݟݲݽ ػm#NS'Q5;&Jػ #'+5;?GKQU`o{ X$+2;BKPU\emu{ކޚސޙޠީ޲޻ ػm#NS'Q5;&Jػ #'+5;?GKQU`o{ػm#NS'Q5;&Jػ #'+5;?GKQU`o{t-T{    ; ]m*>Si !#$&1234568 9 9 : '; A< _= w@ A B C D )E ?F TG TH TJ jL M N O P Q R S T U V )W C\ Ma hc rd e f g h i p qstu vw x - I Z        ' C c {     -Ebr+?Rat/?Z|||5Sn.do Mn[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]BB&.>FLT\bjpvzjZ4returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check returning to single-user after filesystem check  ffs_isblockffs_isfreeblockffs_clrblockffs_setblock||||        @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read0<uL@1xTn|X3}\@@w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1;<;X;`;t;;;;;<Uy`Ed@??p?~?????|Ðäø &.>FLT\bjpvzjZ4Bl@B3B<BXBkBBBBC C] C| C C CCD CD"DADTDDDDDE E& EB!#$ER&12EZ345Ev68E9E9E:E;E<E=E@FAFBFWCFDFEFFFGFHFJFLGMGNG OG0PG@QGRRGgSGTGUGVGWG\GaGcGdH.eHPfHdgHwhHwiHwpH~qstuHvwHxHHHII$I1IFIUIgIIIIIJJ1JKJiJ{JJJJJKK)K/KHKHKHKhKKKKKKKKL LL+L=LVNWLnLLLLLLMMMM M?M^MkMMMMMNN"N*N\NpNNNNO'O[O`OtOOOOPP(PKP^PqP}PPSYp@Rr5t@S3|@U(Հ@bՄWՐՔ@ՠHFS0eCYL UFS0eCY!haHdInotNeedEFIYY*s(ҺK>;YQn|n֏- q+YYQn|n֏- q+YYQn|n֏- q+ZZQn|n֏- q+Z!Z,Qn|n֏- q+Z:=Gry=iG}Z>ZIM;t?ZTZ_WmCĄ 3KOOZjZuyD¢<#*=(ZZYBbRuoqrZZРD3h&ZZ \M}-ZZޔM@jy֬Z[-ıܹчH[-ܹчH[&IZܹчHB[@I􍂱ܹчH[SI􍪱ܹчHZZ[^I2ܹчH[yLǠ6 %?a[['S@ۿ )Ѹ[[1*@ە )Ѹ[ޑ1ۏx )Ѹ[[.TSqHBo6֯i[[_լ@]/մbackupstore_gptstore_tblո@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercapsaaasetifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusTjFprintallmaindo_setifpreferencedo_setifcapsnizx3iyttt(`bdk tt(c@d `ZڈiCڰb,k(hVٔk(bHk+Hk#y(k*y(kIkTk_kkkw kkk@kkkk k0k@kkkkkl l l l@jFinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstnGnn]n$n,Tjnn, nn,`n4n<@n4n<nn,]n$media_statusmedia_constructormmlllmlllmlmۜnmnm۸nmll5 m5  paddr_match=y=S='=settunneloG(o@hprint_link_addressessetvlansetvlanifp&pnpZppnsetifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsvXv[v^vav݈v(vpvv(sss *(}ޠvvݤvE(s@vs *(vq`vssrrpp Аinvalid major numberinvalid minor numbertoo many fields for formatffs@HU ajv~l@ I )K^m s@@l-l'+1yy T2VyTyyy yy yzz @zzz z)z3z7z<zC bnorripbgensbextattbnojolietbnocasetransbrrcaseinsyy T2VyTyyy yy yz@V{C{Jz @{P@{Z{`yy T2VyTyyy yy yz{j {s@V{C{Z{P@{J{z @{yy T2VyTyyy yy yzz @yy T2VyTyyy yy yz@Vz @bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirroryy T2VyTyyy yy yz{Jz @z~~~ @ $(, @}}}2}}} }@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecvyy T2VyTyyy yy yzz @{Z{`HKbx#Yl!S%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS  -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit@KB\CkFwILNOWSabcef&hmiykmnorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:@@@h pp pp  ` @  $1м|^t0 Non-system disk Press any key to reboot KGC?;73/+DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY 8Pỵ +W͉ͱ#QUPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefFPFP*0 XXX,,x<<bitmask_print1\<1l=u1x1=u11=u1=u11=u11=u11>1?12?2=u2-27=u2J2OA2e9A9A23q2=u22=u22=u22=u22=u22C3=u23=u3%3-=u3E3L=u3k3o=u33=u33=u33=u34=u34-=u34H=u34_=u4w4|CC4=u44=u44?14884=u5 =u5=u5=ubitmask_scan0l[0011hw.disknamesjnrvz~***************************************************************************************************************************************************************************************************************************************NetBSD gzip 20260107  " $#!%Z^\`[_]aFF: SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. ]8;--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data;>|&\ OMU&h\e&r&z&<&a&&&&2&&&/&9&BBJ&W&n^e&Po&yB&$O&&&&&&&&22&;&7D&6N&DZ&Ck&Bv&D2&A&_&^collect2&.>FLT\bjpvzjZ4NAME=Jmount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds&.>FLT\bjpvzjZ4 edit_fs_type_ext "E ; @    9 / /1L e u edit_and_check_label &.>FLT\bjpvzjZ4disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijz S [ [ ] ZI ] X U \ V X U U f Zc `) YM W R W ] b di R R eQ V Vq V X Udisklabel_change_geom? ]D8Kouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default'''<'pm_from_pepm_whole_diskgpt_freegpt_create_newGp m I I   9  M f m I M e y  iBZZY Z>YZZ[[ Z:!1;X;;t; LOTYB\bjglpzfhZ4J[Z:gpt_get_part_devicegpt_get_part_alignmentDetails for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - HFS0eCYL UFS0eCY!haHdInotNeedEFIYY*s(ҺK>;YQn|n֏- q+YYQn|n֏- q+YYQn|n֏- q+ZZQn|n֏- q+Z!Z,Qn|n֏- q+Z:=Gry=iG}Z>ZIM;t?ZTZ_WmCĄ 3KOOZjZuyD¢<#*=(ZZYBbRuoqrZZРD3h&ZZ \M}-ZZޔM@jy֬Z[-ıܹчH[-ܹчH[&IZܹчHB[@I􍂱ܹчH[SI􍪱ܹчHZZ[^I2ܹчH[yLǠ6 %?a[['S@ۿ )Ѹ[[1*@ە )Ѹ[ޑ1ۏx )Ѹ[[.TSqHBo6֯i[[K øKI$ZuAIM , @Nmbr_get_generic_part_typembr_init_default_alignmentsmbr_create_new? LLt  U Q Q   9  a - #  C      ] f  # Q I )      *a *mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free***************************************************************************************************************************************************************************************************************************************;iiiiiicontrol_recvdatacontrol_handle_readcontrol_handle_datacontrol_handle_writecontrol_handle1control_startdhcpcd_readdumptimeoutdhcpcd_readdump0dhcpcd_readdump1dhcpcd_reportssiddhcpcd_readdump2v+v0dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_handlecarrierdhcpcd_prestartinterfacedhcpcd_signal_cbdhcpcd_fork_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2025 Roy Marplesmain duid_geteloop_event_addeloop_event_deleteeloop_q_timeout_addeloop_q_timeout_deleteeloop_exiteloop_entereloop_signal_set_cbeloop_signal_maskeloop_startif_discoversplitvadd_environparse_optionm>b~"c5 dIexf~)gxhxi;j~5k~=lmm~GncNo~Npeq]r~Ys~`~hty_u~p~u5v~{wsx~z~y~A~B~CwD~E~F~G~Hz5I~J~K~L M~N~O~P QST U*V4W>XHZk1W4`6is~|~}Y{ {%/<FWU^\dqz\w}}d~+default_configread_configrt_compare_proto ) ) { {rt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_recvrt  rt_buildrt_delete e esa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_init"03Zs[aktx~script_buftoenv~W~>^Rmake_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osif_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @DCHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpdhcp_bound+ dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa q q } } i iUVJqfg]UVNI%DE@<=85340.,*('c%$#P"#! BrBbFCV{SJ\B 0 0 0 1 1- 1E 1] 1u 12 1 1& 1BBBBB@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~5 w 9ksBos 2 @ &S,Q(O$cs_pathRXǪ bc_base_max bc_dim_max bc_scale_max bc_string_max coll_weights_max expr_nest_max  line_max  re_dup_max  posix2_version   posix2_c_bind  posix2_c_dev  posix2_char_term posix2_fort_dev posix2_fort_run posix2_localedef posix2_sw_dev posix2_upe stream_max tzname_max atexit_max!T!"#<#$%(%&p2 ' '&(\ B 1 (N x iRZJ}p] T,  !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 b28- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU JgPMmakech   #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDҵ;15MS7) t:h%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZHXo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;plpn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,2~nnw9kUnA n64UOKGC>:8.,11)15-1$1ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>c{LLLLLLLLLLLLLLLLLLLLLLLLLLLLL{LLLLLrLrLLL~bwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X `%K~"dM3mV" =|c}L4dKg8J9~"dM3mV" =|c}L4dKg8J9" C00*5J&(u~\l9jk j4`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  氒j%b}Dg׻jD~pd'MG T-06/{Z1i*lևM_zN7.N^NrB0* ,<C˦ǐ<Ԅ[S's4K| O݄aY,2Qh$A3}Q>R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9, ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5k   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc1:74_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove8_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n z__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   )'%] C A >\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname/$$$$)$$$-$+creatTLS allocation failed, terminating <R5xh<1  |4  ~R5KC5UCnn~;Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\ $u0LGGBBBBBBBBMa\aWRzupkfJunvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array_xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_rn E ip6_parsenumeric_filenoØstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi((!!((!!SPDGJM d'B@;__dn_count_labels'ZEiEA"^%v&&xA #е) charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl=aj54<Ҳ؉9I#ը32D=%[όh(doC4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatch vu^>&" p^Y/%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mn /usr/share/zoneinfo/Etc/UTC_strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf222222222IhII xXYIiIIIiyYY crK5HMMMMMMMMMi0Nt i/il3X[ 0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponent^gYce\Q_strndup_strdup_gethostname  !#&(*-/14}?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒ<Ҳ؉9I#ը32D=%[ό (doCCAy7FnM8O?ZwH02uOs<_fdopengetcgetc_unlocked __sflagsfclose__srgetlflush__srefillhash_seq__bt_openNEXTINDEX!#%')__get_bufnewbufaaNEXTINDEXNEXTINDEXNEXTINDEX_mkstemp__gettemp0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzVcrypto_prng_bufQcrypto_onetimestreamuޝ3r(Ѿ唵V dj٧IY:Jp,.*ap+ѿ#K`_arc4random_addrandomk_f[6W!x>bt_rrootNEXTINDEXbt_psplit__bt_splitNEXTINDEXj ggQR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqx6|0pY9 1hXdOj ggʧ;l٫Ak[~!yB/("q7D#e͵M;/ۥۼ9V[H8Y?O^mB[Epo$1N䲌U }r]t{oޱ;%5ti&iJG8O%Ƌյ$ we-,oY+uJtn\ܽAvڃS>QRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHO'$ ifc`DM}zGG2-lKD><%%%%%%%%%%%%<<<%%%%%%%%%%%%%%%%%%%%%%%%%_getpagesizeqsort_r__sfvwrite__sflush__swsetup*!*!__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setupzrnV444444444>> $i0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrE"+18 _nsaddsrctomap ]:[=             VFFFgj          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEX^u^didde1p(ht|       ,4<DHT ,4N@'`wH<PX\ d DP`\dh px  [                       ( <H x< w ~ , h_ *  L X: T  h  L  :  \Q   7< l` 0u       <m x  $ (, 0E ,4,8 h<h@ DH LP TX X\X` Xd X& l t x |     L .  Z   \             $ ( 0, 040< 0   $,0l9X xU           c c  x l hhk0j0''stngikjx{`{nmbryxxx|xdictD\0 _$''dkeyX |#@#Ddd tdataXPboolŔ4Ŝarayˠ(H&Lxdd \/00$000L0\0x000000011 1<1H 1\1h 11 1P 111122282D2h2tc2>>>>>>>>>>>?>D?>LT4? ??? =======>>>>> >$>0><>D>L>P4>\>`>h>lT>t>>>>????"????"BLBXB\B`BhBlBtB|BBBBBBBBBBBBBBBBBBBC<C CCC C$C(C,C0C4C8C<C@CDCHCPCXC`ChCpCxCCCCCCCCCCCCCCBLCCDD D D0D<DHDdDlDxDDDDDDDDEEE(E@EPEhEEEEEEF F F4FHF\FpFFFFFFFGG$G8GLG`GtGGGGGGHHH(H<HPHdHx(3\444P3332423,44P333246522225QSSSTT,TXTpTTTUU$UDU\U|SQ5Q5Q5S$SihSSSb8b@bPbXbdblbtbX`p\[D[H[T[X[x[|[[[[[[[[ [[ [ \\ \(\, \@\HP\\\p\t\\\\\\\\\\2\\\] \,][]_$] ]$]8]@]d]l]|]]]]] ]]!^^"^^ #^<^D$^L%^\a&`p^d'^^)^^*^^+^^,^^-^^.^_/__0__ 1_(_02_X_`3_h_t7__c________````$`@`H`l`t#^<`$`%^\`&``'^X(``)^`aa aaVbbbbabWYZZZ Z,Z<ZHZ\ZdZtZ|ZZZZZZ ZZ ZZ cc[[[ [([0[8a8a@a\adaxa|aab4aaaaaaaabbbSSSSSSm|m|SCNNNNNNNgTH˜Àwwwwwwwwwwwwxxxxxx x$x(x,x0x4x8x<x@xDxLxXx`x$xhxpxxxxxx_pxx?p?xcccccccccxxxU@yyy4yPy`yxyyyyyyzz,z@zLzdzpz|zzzzz{{{<{L{\{t{{D{{{||0|P|p|||||}}0}P}}}}}~~(~D~`~|~~~~(<L`t$<Xl4L\p,@ڬ dǬ lǬ t| |0vS8SpS{SSSyNNNcccccccccw w EX'~'} h`'}'ќjи ) w p( t 0y t'rt'} )ڬ' pX'} i ǬLH'}vVb(h(d tp@(ͰP i(Dx'h(d(˰iT$P(P'}'}(p&x'r w hd'}|'}K'} i'}''^'' t ht'rv( '}u' y'~ jc$L'r w'}'}'} v i(,'}%( w 'rO ' '}E0 q@t`x٨ w@ h r '}'}t oP'}xX'' txX wl wȄ tD !H]P̸.~ Zbejjncfuhklmoopppqru}t v wwxrx9zDz(BdCJ9OCPRSYTdVlVrXZZ   Z(ucu}Y})(mciY}%  /dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbin"D}-+?=###%%%}"J`"Jd߄aߎߖEVߜeߤFߩI i߳LlmCnfpbuD qs#/h v8VV;x"L@=d 2c3(54y6e#04E> 7k94A,43dm>u3I3MYJQHE;F;Fa;IO t;H;OaE)G0:Ei ... ... 6<0@0r12`3 =I=aBRzR~S:SaU=UcWXDXRXXRz\ ]_`PQMIEa+(`pAabCdhlNsuvW:w:zHPX`hj`քԼjנ]jVԼj ԼjZp1jVjVjp<$jddj$׌tj;״لjFPy c`(aPDgl(c̘pذ؄jL(Ĩ"بjSĨ"j}( Lpٰذ؄(P}hV(hVԴj(`bbz`bԴj(bzCbzԴj(C`ZCjdĨ"@b(bԴk7(`bԴ`Z(bzi( i}b,( b,%d ( d c( cmX۔Yl(ln(nen(ll( ll|(l|o@`Դn܌nԴn(np&ՠԼpn(pnAp( pZvd( Tvv݀ mv(v )v(v q`( q` Yv(vs( * ss( * sv( vv(}eKx"%x"%x#1y!y "jG"%y"%I*!3!y"ey"%y""y*"%y0"%y5"y:"%>  '@@yy T2VyTyyy yy yz@z @{Z...... ...... lost+foundAd.##.f0<ƀ Ɔ k `VƎ  C9 ˯ r ƖƜj b`PƦƬd `Zƶb, ƿ!"#,$%&'(W)*Ƹ+,-/112*33485<6% p1XI1 111 1&1,141;1A1G1P. (prog_root)`ڢ6ښ8:8@ڨ&HR\ht޸~]pڢozښoz$~} Y>[k|k ~z9%ixpy2{rv|.z}:o~9K{p) Fv0M_5 pE !P(q۰v-q3ޱ9]>5FL!TZ^|b{~{<up>djvpvv!~aMEY p{qbf"yyp;ڨp!zqn }fy {Uj}@$!6eą @@1B5<<V]d!^)<i&>'t'Up(]|$!C"A+"Ac%].66D%9_%9sx$ ?5#% & ErFP ca lls h & !"$'(+-.03569:=1> =1>=1> =1>'=1>3=1>;=1>G>N>X>_>g>p>w>~>w>>>>>>>>>>>>>>*><&.?=1?$=t?7=?c=?=?=?>w?@@ >@;>@W@w@>@@>@>@>@>XA!>gAl Tb   4z  * . ` d f o404?sz _###)#*######%%&&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&''' ' '('('L'L'N'N'S'U'W'W''''''+++P+P+U+U....////0000>0A00011/11111122 2G2PMN`|ף0RTfhk`oooop"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp|  ( ( ) )oK_pp0J#%')-Y[  : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----0*0-00ooprt} %&,,&-GQ).1256CCLL||װ /vz       8 : ? ?   $ 'FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB4@4@4G4Ujjk0k6oOoOoooo-0Fgi{тхыѪѭBD6;luuڄڄڛڟڡگ!#$&*06DJ d d d x x x  d"" x    e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<FFFF is a directory is not a regular file (use -f to see it)   (J5$JBJLJ\f`JhJt"J>5 JJJKbJ;J X7J J J J#J2J8K KK' K3(eTKEKQ!K]Kf9KxKQK&fK)KK5KeK:KM%KK6dmK4JK K+L ,L-L-.L@*LMLV?BLfEϣLm/Ly/L'LFIL IdJIKb III IfIIJ%IJ/l+ J J J J*WmkRkRkYcWbkCkc kG ky wb YMYrWca )X&\TTTb )P@&\XTUB )H&\\U4UYc )@&\UUUd )8&\xUU )8A&\VV#D )0(V8e )(&\VEV_Vsf ) &\PVVF )&\|VVg )&[WW4W_h )&\lWWi )&\d1WWXj (9X-X;J (!&\(XHXfk (H  (H-K (&\ X~XL (&\$XXm (&\XYYn ("&\`YY5YFo (1YfO (Yqp (H=P (Y|q (&\YYYr ("&\TYZZDs (!&\tZZS (x!&\DZZt (pQZT (hZu (`&\Z[[1V (X;w (P"&\0[G[i[x (H([[X (@A&\<[\y (8&\h\,\Cz (0&\L\d\y" ((A\~ ( !&\4\\? (9# (=\\ (A&\8]] (&\](]J '&\]l] '&\]] '(^ '&\^(^I '&\Y^m^^ '&\q^^ '&[__% '$&[_@_T '$&[_r_ '&[__ '!&[__ '!&[_` '!&[`'`Z '(a` '!&[`` '&[`` 'x&[aa( 'paI 'h&[aZa 'X&\aa '`&[aa 'Pb 'H!&\@b0bL '@&[bab '8&[bbc '0&[c*cUck '(&[c|cccdd dd-fd6bd?dTdcdrdGdddddddddde eee+e3e=QeCeIJyePe`ehemIe{eCeeee (eYg5eeeeffff)f6fDfPf\flfzJVf_fffUQf&] (press RETURN)778G ) ) )tags643{}abcdDgGhHilnNpPqrs tw xy !:#=&|&|`-e^H-i^C-k^UK A\ @u  @'%  @L @,lA @ Y  ?l[( ?l_} ?l >  >nF =t]|F =|t=~Q  =L  = <F <n~F ?[bmmmooyo]wvUmeSppoowwosmATm]4mDm)fm5[blmmw!ppqpYpAkppp%ep} jk_p=mYlBl SlMq!q eAGqqqqqmqQx5wmq9s+3ttttuEu5u%uutttlllluluuumuS?-lMlS&u'u(u)uvvQsv;v1%vv{vqvgv!v[kkkkkkll)[|WVt7  "#%%&E&'U'es'w'''''(()+>,,,J>?h?|???@hAAABMByBBBBCCC#C4CACmCyCD@EE(E5EaEEEFF8EGGH!HII[IIKLMMMMN&N>NfNOYOPPyP~PPPPQQQ0Q=QQQ_QnQ}QQQQQQQQR RR)R7RCROR]RtRRRRRSSSTTwTUUVWQWXeXYcYYZZ"Z*Z4Z>ZGZVZnZZZZ[[[&[2*[D[^[j[w[[[[[[[\\0\L\g\\\\jsjxjjjkk-kkl lYhlgllmKmmmmnnn8n?nMnZnbnunnnof]z~oooopp/pIpWphpspppOtppppqqtHtcttVvsv}v0vvvvvpvvvwwwHwwwwwwwxRRxrxxxy<y^yyyz0z5z;zz{|E||n,}}6}`}c}n}}}~@~o~g2$Io'DZo'Dhv"-?P_qx N# O]? O!7@ MQ MUA KB KC KD  LE  KF  KG Z KH f KI K#Y K K o% r rg g1u g1e v5u g?M\iw] \ E] \ Av5I 5 C8<@DHLPTX^ak  n  q t ȁ Ȅ Ȏ ȑ ȡȤȧȫȯȳȷȻȿC2 !" #$$%1&;'F(W)i*r+|,ɂ-ɉ-ɖ.ɝ.8/F/ R0 X1ɨ2ɬ3ɲ4ɷ5F6ɼ789:;<=>?@ [4\>\N]c^n^ʀ_ʋ_ʔ`ʡ{ʬ{ʿ|}}~ -dd-ddTdd:dd:dd p |@@`#####$$$$$%%% \%% && &('4'@'H(T(`(h)t))***+++,,,,--- -. .,.4/@/L/T6`;p;|00011<<==>>? 2 2 2 3 (3 43 <9 H7 T8 d: x4 4 4 5 5    !  "  #  $  %  &  '  (  ) ( * 4 . @ + L , X - ` / l 0 | 1  2  3  4  5  6  7  8  9  :  ;  <  =  > ( ? 4@  @@! L@" X@# d@$ p@% |@& @' @) @* @+ `& `' @, @- @. @/ @0 `( 0@1 <@2 L@3 \`) l@4 x@5 @6 @7 @8 @9 @: `* @; @< @= @> (@? 8`  H`! X`+ h`, x`" `# `- `$ `. `/ `% C CD DE E,F4F@cHcTdXddeeh#p#|&&0 (4@L\hl|  @@U   @@ @@ @(@4`<`HLT\dl t@x 33333333cc// /0/L/d3333<<<<<=UTC33xx   q  m   33(h339gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA j, j8 j, j  33UU33UU33UU oP k o l  p m pd oP'bdbbbbbP==bbbbx   @ 1@333333333333333333333333333333333333 33 33 t33 33?L?L( 0000000000000000 (3333W(3333?33 up ux u (root)`33CNNNNNNNgTH˜ÀÐO$Q(S,U0 w\7:79$788,883l3333934:5P55: 7T7: 46Service unavailable8SA4aeabi*7-A A   "D;L7x-oARZ>J4T`0_! CH$ D4Ap%<ɹ;;ٹ5i)R௭2R,O-66|XN:+eMb.|nv}yO˺hsFԑYfOͱVo={^7Y~j=>[֣|w2x^W=k>{frmm\{?8<&YkY7[s6:g y|gx'd^Mu[oNEݍz׿ }yۨ{QZ|:%b[לo߲V[揞_O\l1}!kG~_w_ws?EQ 1 Dso 747d ̼qpvp-M}qy!p[\+HU h8gl{x 6 j;#!r]x:F|f1ɠɇ&ndDJPj,r!, Ur>vU+rƌramdiskbin.debug|;.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf.gnu_debuglink / BHf*PtgtVtgt$bgggt00(yXXx w7 w7V(h7p758::MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5769 5803 6486 6774 7482 7538 7612 7708 7883 7906 7929 7935 7944 7966 7970 7974 7977 7980 8085 8288 8527 8968 9406 9441 9456 9468 9474 9486 9535 9555 9595 9612 9629 9644 9691 9729 9777 9859 9983 10119 10160 10198 10235 10270 10280 10329 10479 10485 10490 10494 10514 10624 10644 10650 10664 10676 10687 10724 10758 10782 10884 10921 10943 11042 11097 11155 11166 11182 11234 11402 11609 11780 11844 11896 12167 12716 13244 13675 14013 14346 14459 14474 14483 14643 14814 14964 15128 15151 15175 15190 15265 15405 15582 15737 15749 15829 15930 15976 16002 16072 16083 16092 16105 16131 16146 16162 16175 16230 16241 16256 16460 16693 16722 16737 16806 16880 16953 16983 17021 17075 17494 17520 17549 17653 17759 17944 18056 18171 18275 18962 19221 19361 19397 19567 19608 19744 19767 19804 19849 20100 20196 20250 20349 20360 20397 20434 20461 20470 20504 20511 20536 20563 20598 20612 20626 20655 20669 20686 20695 20717 20735 20752 20763 20782 20808 20826 20849 20866 20881 20896 20914 20941 20968 20990 21029 21047 21079 21307 21381 21424 21470 21617 21773 21817 22096 22123 22482 22666 22818 22999 23146 23304 23325 23373 23383 23391 23402 23413 23423 23430 23445 23457 23494 23524 23563 23616 23674 23695 23702 23721 23742 23749 23771 23793 23813 23835 23866 23903 23925 23939 23985 24014 24048 24088 24123 24151 24199 24208 24217 24222 24231 24240 24257 24261 24266 24272 24276 24314 24323 24350 24370 24393 24412 24439 24461 24493 24509 24514 24524 24547 24569 24586 24603 24616 24625 24634 24640 24667 24674 24698 24719 24743 24756 24775 24800 24823 24839 24845 24857 24887 24895 24935 24946 24957 24968 24985 25002 25016 25033 25249 25553 26001 26217 26481 26753 26805 26841 26877 26928 26945 26983 26997 27004 27021 27024 27029 27038 27050 27061 27070 27091 27133 27171 27187 27218 27243 27278 27334 27374 27395 27415 27456 27485 27533 27766 27801 28008 28027 28064 28125 28163 28202 28358 28373 28419 28467 28490 28526 28536 28546 28557 28562 28625 28673 28717 28778 28811 28912 28930 29069 29091 29214 29228 29238 29261 29366 29422 29538 29569 29574 29600 29639 29649 29692 29702 29718 29733 29751 29774 29804 29825 29851 30048 30091 30095 30101 30107 30112 30123 30137 30166 30198 30210 30257 30307 30347 30374 30390 30399 30442 30448 30456 30460 30480 30497 30509 30540 30796 30845 31421 31448 31480 31508 31560 31566 31572 31577 31598 31614 31636 31665 31806 31940 31953 32089 32091 32093 32095 32112 32125 32143 32170 32174 32180 32185 32193 32199 32239 32241 32251 32266 32283 32317 32349 32387 32416 32445 32467 32510 32536 32580 32716 32718 32798 32844 32892 32997 33099 33138 33205 33212 33273 33337 33341 33348 33470 33539 33827 33965 34106 34187 34234 34240 34263 34309 34312 34338 34381 34446 34508 34578 34646 34739 34958 34983 34987 35023 35041 35069 35111 35155 35219 35269 35345 35367 35419 35463 35502 35536 35566 35597 35622 35631 35643 35651 35662 35674 35693 35717 35766 35783 35807 35850 36172 36175 36189 36202 36214 36221 36232 36239 36246 36255 36265 36282 36298 36348 36356 36364 36374 36385 36403 36420 36441 36463 36472 36482 36509 36515 36525 36544 36560 36578 36598 36607 36618 36625 36642 36661 36682 36692 36709 36715 36731 36746 36761 36782 36804 36823 36833 36838 36843 36861 36880 36899 36905 36924 36944 36964 36982 36987 36993 37010 37026 37047 37060 37068 37088 37112 37129 37137 37148 37169 37175 37187 37209 37223 37232 37253 37271 37280 37314 37337 37364 37396 37419 37439 37450 37482 37498 37509 37522 37545 37567 38075 38105 38136 38164 38178 38379 38601 38768 38855 38872 38890 38907 38936 38983 38994 39013 39035 39114 39306 39334 39452 39474 39615 39634 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.5. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.5 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.5 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.5 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.5 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17262 17288 17310 17417 17524 17725 17798 17882 17982 18477 18715 18866 18900 19035 19079 19218 19259 19304 19351 19595 19728 19790 19884 19889 19923 19957 19972 20000 20033 20040 20065 20083 20109 20116 20131 20146 20166 20206 20223 20243 20264 20286 20301 20321 20343 20358 20371 20385 20397 20409 20423 20446 20469 20487 20530 20581 20618 20803 20866 20902 20951 21042 21172 21225 21485 21532 21893 22043 22212 22352 22472 22604 22644 22691 22701 22709 22719 22727 22738 22749 22763 22788 22829 22862 22895 22930 22984 23009 23028 23050 23055 23061 23090 23107 23134 23152 23173 23195 23214 23224 23254 23280 23307 23356 23384 23411 23464 23474 23484 23490 23500 23509 23529 23533 23538 23544 23548 23583 23592 23623 23640 23667 23688 23708 23727 23753 23766 23774 23790 23821 23852 23873 23899 23912 23920 23931 23937 23961 23971 23983 24001 24012 24032 24048 24074 24096 24112 24124 24144 24170 24176 24206 24220 24234 24257 24276 24295 24313 24331 24554 24860 25278 25479 25719 25903 25981 26036 26103 26143 26166 26200 26211 26219 26242 26245 26248 26254 26265 26277 26290 26320 26364 26377 26390 26427 26441 26452 26463 26474 26491 26502 26549 26572 26621 26862 26895 27150 27171 27204 27257 27283 27310 27466 27472 27515 27535 27554 27583 27590 27597 27604 27609 27658 27696 27730 27787 27815 27860 27877 27978 27983 28060 28074 28084 28108 28231 28312 28422 28450 28455 28471 28500 28508 28549 28556 28570 28583 28591 28610 28643 28663 28683 28899 28930 28935 28942 28949 28953 28967 28979 28994 29027 29040 29095 29153 29189 29207 29225 29243 29280 29286 29294 29298 29319 29336 29347 29369 29547 29591 30293 30317 30351 30370 30415 30422 30429 30433 30457 30468 30473 30536 30657 30780 30793 30927 30929 30931 30933 30943 30952 30965 30992 30996 31002 31007 31016 31021 31048 31050 31063 31075 31090 31118 31162 31209 31225 31247 31258 31291 31311 31360 31460 31462 31527 31576 31625 31729 31827 31868 31959 31966 32027 32091 32096 32102 32211 32270 32521 32662 32789 32857 32894 32901 32928 32974 32977 32998 33043 33094 33153 33222 33269 33374 33517 33542 33546 33580 33597 33621 33673 33724 33796 33862 33960 33977 34008 34044 34078 34102 34126 34159 34179 34189 34197 34205 34215 34226 34240 34266 34314 34337 34357 34398 34697 34700 34714 34726 34733 34752 34766 34773 34780 34789 34799 34816 34832 34880 34888 34896 34906 34917 34935 34952 34971 34991 34998 35015 35032 35039 35052 35087 35104 35123 35143 35153 35169 35182 35200 35220 35241 35251 35271 35291 35304 35323 35336 35360 35383 35396 35407 35412 35419 35437 35456 35475 35483 35502 35522 35547 35565 35572 35579 35592 35601 35622 35635 35643 35663 35691 35708 35714 35725 35756 35764 35777 35799 35821 35830 35851 35869 35876 35899 35918 35945 35963 35983 35996 36011 36032 36046 36053 36067 36082 36101 36646 36679 36707 36736 36744 36781 37093 37270 37347 37364 37382 37397 37419 37469 37479 37496 37518 37577 37735 37759 37889 37914 38040 38058 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.5. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.5 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.5 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.5 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.5. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.5Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.5Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.5. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.5 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.5 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.5 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.5Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16083 16113 16130 16238 16348 16488 16562 16638 16716 17208 17428 17539 17570 17697 17733 17861 17888 17928 17974 18190 18314 18382 18482 18487 18523 18559 18573 18596 18629 18633 18658 18677 18703 18708 18723 18738 18757 18782 18794 18816 18833 18846 18858 18876 18900 18915 18932 18945 18956 18967 18987 19016 19045 19069 19104 19139 19166 19353 19402 19434 19482 19579 19712 19758 19950 19980 20302 20431 20571 20711 20828 20963 21007 21050 21058 21068 21080 21092 21100 21111 21138 21172 21207 21238 21273 21309 21356 21376 21393 21411 21416 21423 21448 21464 21485 21502 21519 21537 21554 21567 21598 21623 21654 21685 21720 21747 21800 21810 21820 21826 21835 21843 21858 21862 21867 21873 21877 21912 21922 21951 21967 21993 22010 22029 22050 22066 22079 22084 22092 22107 22133 22152 22180 22198 22209 22215 22221 22242 22252 22263 22281 22303 22320 22333 22354 22374 22394 22405 22418 22440 22447 22472 22487 22507 22519 22536 22553 22573 22592 22769 23053 23363 23543 23754 23942 24008 24055 24110 24154 24174 24203 24215 24221 24237 24241 24245 24253 24263 24275 24290 24309 24345 24356 24367 24406 24418 24428 24438 24448 24464 24482 24531 24552 24597 24841 24867 25121 25136 25162 25219 25253 25288 25430 25447 25496 25517 25533 25562 25567 25572 25578 25583 25622 25657 25687 25742 25775 25821 25835 25914 25919 25973 25987 25997 26021 26107 26155 26261 26295 26302 26317 26344 26353 26392 26399 26421 26440 26456 26474 26506 26525 26542 26699 26730 26737 26746 26754 26761 26775 26793 26812 26822 26834 26875 26920 26949 26970 26993 27012 27050 27056 27064 27068 27089 27106 27115 27134 27280 27322 27832 27840 27864 27882 27926 27931 27936 27940 27971 27984 27993 28039 28165 28256 28268 28332 28334 28336 28338 28348 28362 28377 28404 28408 28414 28419 28428 28433 28460 28462 28477 28488 28503 28531 28575 28622 28638 28660 28671 28704 28724 28773 28873 28875 28943 28983 29028 29103 29169 29204 29285 29292 29353 29417 29424 29430 29529 29585 29861 29985 30096 30158 30196 30204 30226 30275 30278 30299 30344 30399 30458 30527 30574 30679 30822 30847 30851 30885 30901 30926 30974 31010 31071 31125 31206 31228 31267 31304 31336 31360 31387 31413 31427 31435 31445 31453 31467 31480 31492 31516 31557 31583 31600 31629 31953 31956 31970 31982 31988 32004 32016 32023 32030 32039 32049 32066 32082 32125 32133 32141 32151 32162 32180 32197 32210 32236 32243 32251 32268 32276 32293 32317 32336 32355 32374 32384 32395 32409 32427 32447 32467 32476 32499 32519 32530 32545 32557 32576 32595 32606 32616 32621 32627 32645 32664 32683 32690 32709 32729 32754 32771 32777 32785 32795 32807 32828 32844 32852 32872 32892 32914 32922 32933 32956 32963 32977 32999 33016 33025 33046 33064 33073 33104 33120 33147 33166 33186 33204 33225 33239 33259 33266 33285 33300 33319 33864 33897 33925 33954 33962 33999 34311 34488 34565 34582 34600 34615 34637 34687 34697 34714 34736 34795 34953 34977 35107 35132 35258 35276 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.5. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.5 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.5 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.5 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.5 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.5Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.5Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log run spool ... ... ... . .. lock . ..