'Vi&0;YNetBSD/earmv5 ramdisk 08&ԩi<  &ԩi pvt t&ԩi@@<@T 08&ԩi<  &ԩi pvt t&ԩi@@<@TU &ԩit`A&ԩi&ԩi&ԩi$h &ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA.&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩimDPU"&ԩi&ԩi&ԩi (08@HPX`hpx8$T&ԩi&ԩi&ԩiX`hpxN$ &ԩi&ԩi&ԩiK$/&ԩi&ԩi&ԩi (08M$,&ԩi&ԩi&ԩi@HPX`hpxFA&ԩi&ԩi&ԩiC&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi4!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi B!&ԩi&ԩi&ԩi B!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi"!&ԩi&ԩi&ԩi"!&ԩi&ԩi&ԩi"a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi?\!&ԩi&ԩi&ԩi>\!&ԩi&ԩi&ԩi=\!&ԩi&ԩi&ԩi<\!&ԩi&ԩi&ԩi;\!&ԩi&ԩi&ԩi:\!&ԩi&ԩi&ԩi9\!&ԩi&ԩi&ԩi8\!&ԩi&ԩi&ԩi?\!&ԩi&ԩi&ԩi>\!&ԩi&ԩi&ԩi=\!&ԩi&ԩi&ԩi<\!&ԩi&ԩi&ԩi;\!&ԩi&ԩi&ԩi:\!&ԩi&ԩi&ԩi9\!&ԩi&ԩi&ԩi8\!&ԩi&ԩi&ԩi:\!&ԩi&ԩi&ԩi7\!&ԩi&ԩi&ԩi6\!&ԩi&ԩi&ԩi5\!&ԩi&ԩi&ԩi4\!&ԩi&ԩi&ԩi3\!&ԩi&ԩi&ԩi2\!&ԩi&ԩi&ԩi1\!&ԩi&ԩi&ԩi0\!&ԩi&ԩi&ԩi7\!&ԩi&ԩi&ԩi6\!&ԩi&ԩi&ԩi5\!&ԩi&ԩi&ԩi4\!&ԩi&ԩi&ԩi3\!&ԩi&ԩi&ԩi2\!&ԩi&ԩi&ԩi1\!&ԩi&ԩi&ԩi0\!&ԩi&ԩi&ԩi2\!&ԩi&ԩi&ԩi/\!&ԩi&ԩi&ԩi.\!&ԩi&ԩi&ԩi-\!&ԩi&ԩi&ԩi,\!&ԩi&ԩi&ԩi+\!&ԩi&ԩi&ԩi*\!&ԩi&ԩi&ԩi)\!&ԩi&ԩi&ԩi(\!&ԩi&ԩi&ԩi/\!&ԩi&ԩi&ԩi.\!&ԩi&ԩi&ԩi-\!&ԩi&ԩi&ԩi,\!&ԩi&ԩi&ԩi+\!&ԩi&ԩi&ԩi*\!&ԩi&ԩi&ԩi)\!&ԩi&ԩi&ԩi(\!&ԩi&ԩi&ԩi*\!&ԩi&ԩi&ԩi'\!&ԩi&ԩi&ԩi&\!&ԩi&ԩi&ԩi%\!&ԩi&ԩi&ԩi$\!&ԩi&ԩi&ԩi#\!&ԩi&ԩi&ԩi"\!&ԩi&ԩi&ԩi!\!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi'\!&ԩi&ԩi&ԩi&\!&ԩi&ԩi&ԩi%\!&ԩi&ԩi&ԩi$\!&ԩi&ԩi&ԩi#\!&ԩi&ԩi&ԩi"\!&ԩi&ԩi&ԩi!\!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi"\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi \!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi\!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi$!&ԩi&ԩi&ԩi4!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi !&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi?\a&ԩi&ԩi&ԩi>\a&ԩi&ԩi&ԩi=\a&ԩi&ԩi&ԩi<\a&ԩi&ԩi&ԩi;\a&ԩi&ԩi&ԩi:\a&ԩi&ԩi&ԩi9\a&ԩi&ԩi&ԩi8\a&ԩi&ԩi&ԩi?\a&ԩi&ԩi&ԩi>\a&ԩi&ԩi&ԩi=\a&ԩi&ԩi&ԩi<\a&ԩi&ԩi&ԩi;\a&ԩi&ԩi&ԩi:\a&ԩi&ԩi&ԩi9\a&ԩi&ԩi&ԩi8\a&ԩi&ԩi&ԩi:\a&ԩi&ԩi&ԩi7\a&ԩi&ԩi&ԩi6\a&ԩi&ԩi&ԩi5\a&ԩi&ԩi&ԩi4\a&ԩi&ԩi&ԩi3\a&ԩi&ԩi&ԩi2\a&ԩi&ԩi&ԩi1\a&ԩi&ԩi&ԩi0\a&ԩi&ԩi&ԩi7\a&ԩi&ԩi&ԩi6\a&ԩi&ԩi&ԩi5\a&ԩi&ԩi&ԩi4\a&ԩi&ԩi&ԩi3\a&ԩi&ԩi&ԩi2\a&ԩi&ԩi&ԩi1\a&ԩi&ԩi&ԩi0\a&ԩi&ԩi&ԩi2\a&ԩi&ԩi&ԩi/\a&ԩi&ԩi&ԩi.\a&ԩi&ԩi&ԩi-\a&ԩi&ԩi&ԩi,\a&ԩi&ԩi&ԩi+\a&ԩi&ԩi&ԩi*\a&ԩi&ԩi&ԩi)\a&ԩi&ԩi&ԩi(\a&ԩi&ԩi&ԩi/\a&ԩi&ԩi&ԩi.\a&ԩi&ԩi&ԩi-\a&ԩi&ԩi&ԩi,\a&ԩi&ԩi&ԩi+\a&ԩi&ԩi&ԩi*\a&ԩi&ԩi&ԩi)\a&ԩi&ԩi&ԩi(\a&ԩi&ԩi&ԩi*\a&ԩi&ԩi&ԩi'\a&ԩi&ԩi&ԩi&\a&ԩi&ԩi&ԩi%\a&ԩi&ԩi&ԩi$\a&ԩi&ԩi&ԩi#\a&ԩi&ԩi&ԩi"\a&ԩi&ԩi&ԩi!\a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi'\a&ԩi&ԩi&ԩi&\a&ԩi&ԩi&ԩi%\a&ԩi&ԩi&ԩi$\a&ԩi&ԩi&ԩi#\a&ԩi&ԩi&ԩi"\a&ԩi&ԩi&ԩi!\a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi"\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi \a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\a&ԩi&ԩi&ԩi\ !&ԩi&ԩi&ԩii!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi B!&ԩi&ԩi&ԩi B!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩi!&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi a&ԩi&ԩi&ԩia&ԩi&ԩi&ԩia&ԩi&ԩi&ԩi&ԩi&ԩi&ԩibpf!&ԩi&ԩi&ԩi $&ԩi&ԩi&ԩi$&ԩi&ԩi&ԩi$>&ԩi&ԩi&ԩi$&ԩi&ԩi&ԩi$s&ԩi&ԩi&ԩi$&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩim &ԩi&ԩi&ԩi$&ԩi&ԩi&ԩi $&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩiA&ԩi&ԩi&ԩi7FY@xu \\>B[9֔8ro<ƙ[6VbZ\U 4'U}cѺ7YY' }f5wOuNx0 AM&?__i=R,pTZ;8WsMV.gOU]W:h^P%U:tm{-R8Gy/O0%(i?gH;}N`qTT~kq(2!NgfK@{5@BOT=o0\33-?D:mV` č@۽?X}Rx.<=+qF~lʢcSyTD1P"KV)i!)2 x8. nЏ}NscEKpb3(j5!"wbHÅP @lKH+eJBMyCVX9aGW :G%#q>g0R%t . ...profile bin dev etckernlibexec mnt mnt2 sbin sysinst sysinstmsgs.desysinstmsgs.essysinstmsgs.frsysinstmsgs.pl targetroot tmp usrvar# $NetBSD: dot.profile,v 1.4 2020/10/11 14:24:31 jmcneill Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=wsvt25 export TERM HOME=/ export HOME BLOCKSIZE=1k export BLOCKSIZE EDITOR=ed export EDITOR umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? mount -t tmpfs tmpfs /tmp mount -t tmpfs tmpfs /var mount -t tmpfs -o union tmpfs /etc mkdir -p /var/run /var/db # mount the ramdisk read write mount -u $ROOTDEV / grep() sed -n "/$1/p" if [ -x /sysinst ]; then # run the installation or upgrade script. sysinst || stty sane else echo "This image contains utilities which may be needed" echo "to get you out of a pinch." fi fi ELF(4XR"4 (z!z!0~!0%0%h( HH0~!0%0%NetBSDKwGPaXNetBSDearmv54p@-D0D 0@`Qp(@P`F`F&a03/T@p$$$A-`0`` 0PpU(pGpG@Pq`P03/T@0US ѱH$XH-x`Q MN h!h1 @`p0 0R0D1<  0S  /S 0S1Y Y9 T kPg0PUH2H0@3(1*03/T@ 0地0 [* PC PE%Q03/Zd 0 P0 0$ 0x$$d8$d%| @-l llPd@P LۻMz`POU $ѻP @ֱ؆& I P@-@⌱O-`@@R@<2tHM$H0pWr {P@tH$H( R  @P p0: S `0SЍ@P0`0x= 0S(0S  \P0S S0p WP 忺 0S;00 0 pP 0s 8#8T TD#P   PpW(&̎&{FP+&H0`  BR` pR RjX X/(&&@-0 댳؆& 000/&G-؀P x0M@ #' \0/`p ' 040.P0 Ѝ&Y@T%d؆&@-@ M00@  P 2 Ѝ苶A-` l1V0zP 0 u@P@TV oPC  W@@7NZ0S@ @0;0AP W 0XpBV Fp90-S XdHIp 4@0SV  W T%&O-5MpY xp `P` Ѝ  p` 0`$5XP0S 5%0 0 5X0S40S* D$尠D00CS0 5@ Pp  @YT `0 @00CS0X50 X0 p]n00p Op@300 GX80: Sx h+7p@ p Qt  X0 0, 03($0000x 00 Q00S> 0 0 ` dp2  p' 0Z 1(#00 H  0P \\QP 4 `+X"J 0R 0n0ZZ3r0S a P Y' p00 R0S ``0S  0 <(d P <`V k`0 ?oR20S 0  0 0R0P `P hhy`0S H,` P0Rt00!P &T%FP&& &&&؆&(&Y~&&&Ƕ9&,&0&0@-MM@P  8p  ;0U$C dP TT2ۍЍ08 SP ,(0P XT%&Q@-@ TmP DD,DP $ 0P@T%&Q@-@ XNP HH0"P $ 0P@T%&@- }0 .&؆&0$/'0$/P'@-( 묷@-# ·@- ٷ@- .x@-1   0 0 Ѝ'@-1   0 0 ЍP'@-1   0 0 Ѝ '@-1   0 0 Ѝ,H'@-0   0 0 Ѝ8@'@-0   000 ЍYP''<00/@-0   00 Ѝ䐣'OP'<00/@-0   00 Ѝ䐣'a' 0@- 00 $0P@JMЍrX%,0A-`M!A!qX0 p! R0B=0B  P0H 8 R8B 4!010,!0Ѝ&PP G=l0P   0S  0 pPN0P      0 3/R ! 7000<040LD0P'''@#=!hP'}$ ׸?0p@-|@PtP00 R 0p800 p0  B0Sqs T''P'0 0 0 /'P'@- 6 FP@-@- 4 FP@-@-80M@0(@3/P $ H08 : S( 0h 3/P   00 0Ѝ00 0 1/qp{0S 00FPm8@@-@c_PЍ@  6PЍp@-(`Vp80@  03/PPo8003/(Pp蛹@-@P`P 80 (0(3/@>{ P 8{PЍp@'O-3 PMP`(P,`B  0S9P06 0J S +X0\ 0 X0\ ! R(P0,`R!*0 A` 000+ xpt|  _  ЍOw0 P % pHp 81/qp4  ?P p 4 z0S4 tp0 0 0 0 "^0 0 0p0 t 0 p0t 0 %0 0 VU0 "SR x0| 0 x0| ~p0t 0 p0t wx0| 0 [Xx0| n 00 0S04L0004 8pX  FЍ@'mo P'ȹFPڹR/ R 0 0 /\\CC  B0R0012/P/  AA  AA  A A  A A  AA  AA  AA P AAC-lBM0 0  P0 0  0 ? Ÿ$  ( }/L/AN#b@ DSH n&}//C#bPoPQ`0!!!! d 4 !P`4s4 f" BXX P!d44|s4 S" B   !d44is4 @# B  d44Vs4 -/0s8p<@0! ]` d @449s4 Ѝ'/Mb'q ѺU@-@R!C- A `00P4 2#&P8P0 (1/qp$ r㬀pU Ѝ0S0C080 $0(3/P 0 `V`PE@K0  Y $  'FP'X%5@-TAM P04 00#!8 ( 01/qp$ 'P9 0080 0( 3/PЍ80 $0(3/PP`#U0:0p080l0( p 3/p #U0* ,0P/`RP `P'FPm@-@L M 0Q   0   ЍX'qbO-xM0@S M. 8S+ #='0|0S( 000| " ! !x00# #|0 h& \%ݍ Ѝ('|"c 0 X0 S 0E0 WS06  S  S $0S0 600000S60 060 00 6Rq R0r0C0C00Q0 0S. ,B< @D<68m$~0`P V$  ( ( ,0S 0 $0P000(0040 0S $Y# 5%u(0S%0 %00   0 5M,0S p5p%0 0hC`h~XʑH5%pW= ?W09*tr 0 Qqjr0 ($Gq``r0  =qp004 0 0000 0@$ (0<P@ 0@ p`|L#:r됶W㐚) ` ?W :$0吣(0c#` 0吃u'00S1 ,0S #$`V 0 !40S \ /\ * r0  p 0 q !5# k |0堲Ё$0Z`,03  !w0$ ( , n0  !g004 0| 0000@0 (0$ <\y1,0S 0`QP V0,ZVp- ?V0)*q 0 pq0 ($ypq0  op00,000 0, l;|q됸V㐩* ?V :pq$0V㐓(0吃# ?V :aq 2!  0 @<[  0p :X'e mֻ?`%rO[}l'= CH+*1] kr  @-pPP`@@ qP Ѝ`3MU@긽p@-XP8@T`@D p ~qP<opQ<PpX'A-AP 0P$ 0 0 SQ ( $0嵱P :vQh d=`P, R2DaDqU`0``0000Pv4 00CS000 Q   0,`0CS0000 (00p/U R u8 4D 0$00 0$ 谤' ؆&' 'T0 S 0SP/P/S/@- 谤' p@-XAXT0040S+@! PPP P`04 0PV R@40P 0PU4 ^*00" `0PEP P0P4  P U 4 P0CSR40PP 0 p谦''d%0' 'p@-pPG0`F [stlV000yPXfr}4 0i,K00C0Cf 00CS010:PU 0P1` 00CS0 )0 P U Rt0V004P!r8  $00C0S"10 U00CS000 U0P 0@ q | V 0 00 0 @00S 0S YI' '' ؆& '8'O-$RM` 0000100010S u@0Աq`0#0P 00)<0J?oT20ST SRP Z0S  RZ  @T  Z     0010S@@  0 1P000CS000 Ѝ S 0P  BR l  @0S Z0 0$ '8'0''4''؆& 'A-0P!S`GP@+qB 0-=LpP0!S VP q& 0HHH'<00S ,$0@0?$؆&'4'A-P@dp`T0S Pp$   ' ؆&O-`@ ؀P0S p0 T T R R u0p[P Ѝ PP P   P Pp@'0'8' 'A-p0`!SPP@~p 0b @ PP0!S P _pv 0HHaH&<00S ,UUpGPL?$؆&'?'O-@P b 00CS0'p0@g -pD 0 0`001 pTpP@0 pW2tQtTP0PP00Pp8 , 00CS010 6 u0P0CS0000 S0 0 @ X 000 0 T0 `0U0$0T p 0 (&''X؆&c''  '8''O-PpP0 SPEUP ЍE P 0C0 X2 Ub000Po h 00C0S 20  0 0CS0L200 \n Z0 P CPE P 000S S 2 `V% V000GP 3oJx t6p 00C00 0CS0@100 0nX 0PFHP0 0Z CPF V'P尀VP0PP00P n t pl 00C0m0 P0CS0<00jl00`6ꨦ' '' ؆& ''^G-P@`p P`T  0PSkP 0@^S00\P0S @\Z \v^P X0 @P*0P00ul%z&@10`! S:`Fp00  1S pba0S `10 BRpE` S`l   P 0a0CS00   ' ؆&x'( Q 0@30/@-I '`01S @-0@!S @cP /XP / '27@-A0 R!RUUʐ0\00埿P@h |xq00CS00+ 0 @ R,] R P Ѝ00!S KP n0 Sڰ 0R0CS0000 0 Q  vP   '& ؆&?A-O 0 P0,p W !GY\ϟYPPP0  nQ pQ lQ 0 S @ PP1S P PPP0 nR pR lR 00 S1S P P0PP[PP0 nR pR lR 00 S1S gP0 S00P0PP1S 2S 0Sڤ 000@ `PP 0 nR* pR# lR$ 00 S}1Pr PPPೀ0S!S 4 R0S 1Sm `P0PPPbM 010,0,0Z0S000@ PN 0!SPH :P00 nR pR lR 00 S*0S $ Q m0PP1S PP"G@oG`GooPbVWP 1019P P00 nR pR lR 00 S PP RPL nQ pQ lQ 0 S*0S  P0 PP RP, nQ pQ lQ 0 S20cS2 P0 PP RP P0  nQ pQ lQ 0 S1S @PPPP0 nR pR lR 00 Sx1So P k{P0PP PP` 0 nR pR lR 00 STY]P0PP PR0nQ pQ lQ 00 S 5 PP? = 0  P1p PP,0S `Vn0VkVpppVpW 0 nR pR lR 00 S1SP0PP P0nQ pQ lQ 00 S   0  d P0nQ pQ lQ 00 S   0   RP nQ pQ lQ 0 S2S060S$602P0 PP R l B R0" 0 S1S 2SqW P0000@ 0S0 0`PPz 0 nR- pR& lR' 00 S^1SU1S0!S O0S1S d PSS 0S0O 1MP0PPP` gRF  R 0 B R!e `<@p>e0"S:b(pR0 rR0 U0 SP0 R"R  " R0U0b0  `P00CS00 (P00PP2P02 ZP P 6巼0b200CS00U. !2R00 2#20# 02 0nS- pS" lS& @PP0 nR' pR lR! 00 S1S"!P20 2 2020P0PP P pIPP0SR `V0V pվʈ0 nR pR lR 00 SX1SO^P0PP RPӮ nQ pQ lQ 0 S:8P0 PP& '֒ -@x%t%Zn$' ؆& -''LX3'h%#!! QP000P0P@t Y`P 00 00 P0 nR, pR% lR& 00 S1S0!S N0S1Sy aWW  0 <P0S0P0PP1S 2SqXP R  l B R0"0 S06PP0010CSc Pd b@p c0"S4mPP00 nR pR lR 00 Sx|2 00S ;PPPP0  nQ pQ lQ 0 SZ0S cPP0S/PPW0 nR pR lR 00 S;P iv2S@ P0PP P/ -@- 00 ЍЍ/'$'-0^S0]S0]S S]S[S .0L0S>30  Q  ]Q RG-鐁`P@0 SS&tPD(!RGdadqU`0``0,0ϹP,bӼ( $ 00CS010 [S \S @@P`0 S @ 0(a0CS,0p00,a a L0 0@S G 0ꨦ'$'' ؆& 'A@8'p@-!0 P= P@01SE0p0 SS t`P@0P 00SP0P00 P0 h0T 0 0QɷP0)b@0 ,,(ꨦ'$'W ''' ؆&O-bB0  %R R 0R0H 00CS00r00 Q0&Qn0C0 RʴaqU`0``00P? 0A0CS0l10G 0P \QH 0 SP 010S lP/ 000S S)00 S [ U 000壸P a妻 t00CS0L00 0`00Pp8 Pꨦ'X'' '''(& ؆&0A-P0 0p@ W 0 `@P 0 R00R00 1BQEa@ @P@p:a0"S,"@gR000ꨦ'X'O-@SMpcȳ00 0GS TcsT`0``00Pa` \ X00C0+0&SK BR D R: Y J@p RP` 00C0S @Ѝh20   J  BR   0 \SH 1B\C00 BR?ˆr L\ DQ-WppB@ \ p 喷P `嘺D @<f00C0 AQ 0 T0 Tpppp  dPu p BR   @W0 `0CS0(00oq 0 bX'' ' ؆&O-M 0@P0P0s <40S 0 0 000 (0 pP ߍ0P0`#2Cij 00 S pSN(0Y01 Y  $ P$_T PL  B R+430 # V  BR 200S 0 0b ^ 0 0(PP.00Y0 Y L $ 婶P$  BR 200S 0 , ^ P0 (0 P'0 p1pG Y;xxZ oP@1Z_q0 ,](?00C0SuX   R    RP> 00CS000^`W 004 00S |xP00S 0  ^ 4 ^X 8'X'' ؆& 'k/O-pᬡA0M0CQ` 01 00C S00`NlЍ&  0P5 P!` 00000`P00CS000  D[  0S00CS0x00` P  P('4'','X' 'O-RB0M00bsp 0shЍؑ؁0S 1 0000 P@  0#⩟ɐ Y Fp10S P0p0000000CS0C01;  \" \   " L\ B  @      0C LN 0't%4'l'''' 'A- `P 0 0Cs 0x 0 p0 l   AC^  00@pT ŵ@ 0l'4't%0'G-@p0 PR` 0 P(S%0  d GP ·0 ,(叵l' ؆&@-u]0 p؆&O-eGM0PS@pM$Q403/P &0: Sp]00W +H P8:c]?0uP0: S 0S]P0: S 0S 0S 0/S&KP7P0p0o^XP- ̗MP 0#v PvO+G0P ]D#P]P 岵/JP/JP X0P+I [(H Z% U8.0. 0PT9.0. 0P @DP ^ PT1RP o R00S$ 0SS 0: SOPN 6  0[G=00 04K [G=00J0SP. Tq$NXG DX00CS0 Sp Pp  pYW 6tX0 X p00CS0;0 l0S 4P0SGݍЍ0c ?o250060 8x'""FPPuR i&؆&(&\\^W0\\ZWX X0p@-@P@@DDT ` U H H0Rp@\\DWppX 0Xp@-@P@@DDT ` U HH Qp@\\)WppX X0p@-0P0@44T ` U 8 80Rp@\\WppX 0Xp@-0P0@44T ` U 88 Qp@\\VppX X0p@-PPP@TTT ` U X X0Rp@\\VppX 0Xp@-PPP@TTT ` U XX Qp@\\VppX0X @-ppt t0\@ ^0@\\VX 0X@-pptt \@ ^ @\\V5S %R R S R SSh -^L^S R 0/0/0000꠪'O-QMTh @ `u @ 0@0 @0L0@@ @@D@H@,@0@<@@@4@8@5 SS$*\ 孕0 !00`V0S9 0 0刐0L0St 40D0800$0S00( ,00B?gT$ppT,0S d @?C000@$0D0p0H0D0pwT0$ppoT$0S00<00@0#0pp_T,0S  @?CZ㸰张 0x#ppIT 0\#ppAT0 \ 0C0CQ0B003/040 0S jYT R}S0~ 00 R0! 0L0S XP, x0|R0 D ,0 0\HD5H 5 <P !p \t @@  < * R(" $\  " & P 4 04080080 0Sb Q> 0 !XX0$0Q: 0 t!dd0(0$S[(S 0R  P 4P0@S0S00P00P00PP\0.S0S~ 0!0P$0 k0P(0 $ɳ (ij R P0廳ἱP000Ѝ蠪'4VUUUaH pG-@a!80S ).PP 0rpW G/<0SB|S/@P Y@.Y@Y0S5!0CS0\#$ 嘳  00L0S \0.S0S }0@0S40S t0#<0Y?o20S X (040꠪'ĘtƓ +4G-`}|1MP0DL0 ]P0S$00D0H0OP0pP㔔0$|p[|4T H0 `F0P 0 \;P )f84X0 s0X00 00dt |  P PRPS W+( ?R004(0x |0R S S S3 L0S3 T0Sx3 0Sl3Pd#Q`30V L 00Ѝ10@GS0L00P0 00H00P0L0 0T0X0s0X0 00P0L0T0H0~0 00P0L0T0H00X0t0P00L00T00P0L0 00\00`0c0`00\0^0d0[PPX0<0U080 PP0 D0h l0J0D0h0000000>;(00p$080p$0,p30$00,0.000@0(0 0%0p0"0t00D00h00x00|00000000 0D0@PX '00@`0S0\0S00S S S0 /0`0St0\0Sh0h0q'ht@|%͓ &ʀȪ'`T`%؆&lؖpD80p@-@PT @@\p' j 80p@-@PT @@\p' j -L0MSM\0 + RpW±0 ލЍ 00 >04@pl0l 0 0  L00S   FP4؆&R A' ''$0\ 0S 'R FP0L0S/0 0 0/@-00 SM    4 $;Dpp\hЍ\0\@ X0R@P0 B ?G; 0Ѝ@ꬪ''Ī'q_o̪'SFȪ'P `00CS`0p S00 P0S X0X /X(&: S@-  S  S/ I* S  S%|@=A-|1`@pTXPM !\8@T10S H10S. 00 00,10'p  @0 0 0) 0@0S00S 0: S@Ѝ0p 0R0| x0B?P 0T00S ꨪ''Ī'q_iD' '''̪'yȪ''s@- P@@P `PU00S @GT CЍp0t  Q \0 \@-U (P@$U '('p@-P@Tp0 0C0  $A @C-@4M03,30S`sV4Ѝ0 0C0v 0XPS !$a0S 20Sh  4 "; $p | EX0( `<T20S 0@4 00,20S  (0 : SF0( " 08"$410SP ;1!0 0P 10S10S : S0: S z`}T1 L1RD1 B? O 0 'Q vp , l\,00S 00S (''''Ī'q_iD'''' '''̪'yȪ'''1O-0S$0@010S 10S,0001!0 q0P0S ЍOPa0HQ 0P 0 `0SpQPPU% Ѝ  B 10`    0S[  L0  $R,   V ꨪ''Ī'''|%%('410G-S$0@010S 10S,0000 0 0P=0`VG^73pP儠UG k0 0C0 W bp0S$,  `YpP R`ꨪ''Ī'''|%0G-@0T$@0@SP 00S,000@p0`0夀S㤐@VG +0 0C0 W ,"p0 00 S p0S$,  Dp` ꨪ''Ī''|%@- M @ ᝬp ЍT P 0@  QQ  00DT P S  ꀆ&0p@-0PS``M@P NP PAⅩ@P4 U$P4ʫp 'FPC-CM@M `R RPȐ`T *F 0.pPPCߍw ? P@bRw0S ?@P?oP@t&@-oS k؆& 000/4'@-_S0 Z؆&-$M0P!00Q00! 00  "p$Ѝ "$ 0P 00t0 p0|t p\   HHЍ"$  ,0ɍ4'A;>FQ FPNZyO-L@PQM Pm S0Sq  嶫`P 0S P 妫 d00CS00 pp/`Ѝ0S qP XPh`P`(<1 04 Rt$tpxI 0) 0 p W 00CS0~ p pYW 0 P 0S  tXP `0: S P8X P `0: S&pP`  `P.c0S x P@ P [ ,LP 0˯S ,!00  1 0_! 0 p'Yp|Ī80H0 P 8岪x tP Q0S 奪`0;`0`P 嚪P Q0-S  卪PT`Ph0S  <#P`4'_؆&(&qQ k/FPY@dǶs@-@ `PBP]50P U'YW (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPЍpU \@KI0 P4 @g%v`cG-A~M0MSP 0p`E 0E}PYQd! 0`~܍Ѝ~,P GQ !0 0E~jP9Q ~,`P0Q ~,P0pE 0E~LPYp  Q \q/0 00E7PQ>$ /%m/_00CS0 0 /G-\D`HMp 0008T8$8t0000 00 $0S0V"4`0p Q 30Sa3PZPZP0#g/q000 0K|#SPP0`#S/V 00D30p Q   #6P0 0P0"4/V0020"PnP0"/2000HЍp(0: S P. S+@ {P00S`0:0 03V-V)V q 1X  ?I 3 0~\P F ;0L S0 00 0EqpP0S0 0V00 V V  1!00!0S ~<0~0VXHPQVS U ZI XPV P 0%X'('% %W(x'%%m8@''%}D00S/@-4@~M0S~, SP~܍X'%0@-p@$0l00S Ѝ00 0TE0Q O, B.qP%X'$L0@- R8-P 0 0 -X'DtX('vA-pP@` P@DTP`VA-pP@` P@DTP`Vp@-P@T0` Q@P 0 Q @;;S p@P00T@ O(0( -( r-%X''s@-R@T` V0a@$00 ?00S 0CS3P3N0 S9J-00@ЍpPڀ;;S" 00 0D0Q P?P00@00" N0S @@N0ES TT 0$0N0SN0S N0S N0S $0STڄ00Q Q`,T( H,N(00 <-$%X' X(xU`1 RS@-PQM R @!  BR0,ЍQ   RR  RQ     xP000S, @ 00pT0pS 0LCQo 0Gp T0CQ/X'%%m?G-P`0 P ,p@P"ڰAQ"CQ 0P P 0CQM@ ,ЍP P%X's@-|A`MPh1P0S2 S VPLD&,00ЍV0App0 xC0QM g, P0S(0S 0bCQ#M ) Pڐ0V 0? G l0 ` 0PM 0< 3,00%X'$'/mEO-rM,M R(`RX0E@FP0 0S 0 00 SJ'0S \  L";H2p00 F0(".0"(Tn" ?4܍,ЍT ܑ0S =! !!0` F 0S|1pt1 00F 04!0@!,14q0(`0娀01 (0JC0 00 $0 QF 0 l  0  `nF ET%؆&X'X( 'jutX(40'('j'%C-XRXb0TBS0000 Ѝ440 0 0S 2r0S 2 > 0S pP (0: S0 0w p10S10S P!P "0 0 0S(q< d 1 =00 0S000p000 S(00(000 P@0S 3000S 0OGP 0+0P0 E 0`=H%('X'DX(X(@X(LX(tX(x'%X(6X(= 'B'A-MM$ PK#*E yPK"*RB$0`SE 0`B0S2*pFP{ FPv 0 s S( -h)d)`2Dr00CSPP)H)D)@)<)8)P(FP0000) 1 `ލЍ)0S  R  sS SS YSP )yS|) qp)l)<)P,FP 0S8 4FP( E1P )0S({)WPP +&P0000)b)TX(Oi%X' Y(tX(%%%/Mr mo @X(#8V2 )xHb00@-@DpOp`%O-q\ Lt0S(P1`@PPP"@U(L0 R1V10S .)@DT  Au00d#0UPTP)PV0S p )@X`ꓢ" @2/PL0 !ᒣ#, 05%%('%)'}X(G-鈑0@`pP@FcU PppWP<(PЍPT10S (Pp@ 0$03/0PP " R T @ A/P 80| 3/PPPTT00S\ T(R <003/P 202X(('%0')'<b@-AMP/M/7@P+ p`pP/0P0 Uh0h (AލЍT0_"E/0P0 000 `(4'('00CS0 i0 /0O-S$M00`Y P$ЍP0,03/P00oT30 S,@C@s2PPPP 0030SY PV 20S ? P P x4 CSR ^P8 , P_I7"( H0/S6PB A.X m 10S  P0S !S 0l!202;/P K ,  41  0S a0S 11004 `]0D0 3/`( 0S 0S 0VP0x0CP0%P!P0403/OX(X(0'DX(X(TX(HX(0' 4'5'X(LX(('@X('@-@@PH( y'mB('#@-yp @@H d'@@-@9pH0 V'@Tp@-MPp@H0S  0C0H `p 0: S@S NS ЍpyH`C-M~pЍa0H03/P0 03/PplA]P@ 0AS0@0 a3/PE0 0P)3P/P &P0/SPA A-0 0006@ Ht &0(03/ XkI0 PX(0'4'5'&(&iTX(O-MpЍe0H03/P0 03/PaP㞠D50 S 05P G%&50SuJGBP 0(03/ V|P 0AS0@0 a3/P|4C003PP H4 CP(40S  P T 0 0  P 0R S = $ `0Sd003p0St00PUP pS`3`0Sd00/S7P@, A, S0 0  ZP0SW 0S = $ `0Sd002p0St000S "SD 0 l 4S P d20ShT20S Pl4S S1 0CS+0PS'ı U K0S! Q0S 100= $ `0Sd0P  x1 H^ X RP$PP ,1P]80 P Eg @ ;/0S0S P0S 000[\000*4S 0S 0X(W(%}X(0'TX('X(4'X(X('0''5'X(X(DX(LX(|X(%@X(G- R@p T T 0 $@H03/P0 03/P0SB0 X Pqa0 09p1MP \P: 0 P0(03/P@!P0 0 @0S 0 00OP@& sP0 0 p0 0S TP \0 CX APX(X(DX(X(0'@X(LX(6TX(tX('T0@-0S^PP 00H03/P@X(X(0O-M MT崐 $0q0 P`ewA-@(0S`pP匀QP 0$ 000 00/ 0$ 0S0(0Pb 0 '%X(dX(0C- 0 Ѝ0a 00CϠP 0P  0 pO0 ;A$W@ 1P 0PU@$ P@0 0$ U0 00CS p0 P S  00 UP@0'G-pP`pV 0BPiPPEUP@@  @`Fp'O-钽M00`0PQp@葟 0(P/Y0 0㤁$0T0 0 BR#- P U5T0+\1@00S0T0S 0 :4S  A 0!b ?T0 00 $0-PUP0 0Ѝ R 00Q0 \ 0 R   R\00@To 'X(G-A`#RPp㌡O0S5  Up 0) O@000SPER0 A 0P! 0p 0P0U00pPF0P0 000/`F p @00`00Q Q P0 S  PF'%dX(X(p@-0@0PpP E?0Pp@|'%A-`PlplU@0@DTj@P U@0 ?00`PE'%G-P`ကpU0@0@DTG@PğU 0@0 `?0@UP0 `'%O-pMM =@ P`?\1 0S P@:8$!5 U00 J(6 0 BR P#?U0  P0PU0o0PJS@8h @D 0RP J(L J@@80 `MߍX('% , Q/p@-JTUPP$@0P Pp#P@4$ 0 40pX{8W(0@-PM@ Ph00S Ѝ0 $ R\ 04 0R\ GX(0@-MP @PЍ000S0: Sx:P$PU ?0D rP 0H1?0 X(mo LX({0@-M@, 0000S# Q0S 10S P'0S% X0 ?A3c000S&!h0 ?A3c0 P r?0NS n?0X Ѝ0f?0< 0S p%%Mbp@-@P`P p 7P $00??0 pLX(@-!@&P 00+?0@ LX(;G-P0`/Sp/M/.@P7 &P. kp /00  P&  P!00S  P P0 DZx ЍX(G-@P 00/S $QP $00Q  GfSZP>0 0b`0S Xo렐p0 咹_ P>0S@$<lp@D0040 ;@qD8W(X X(LX(A-M`P@pP5(10S Ѝ 0RP  0RP 0: Sx9P PE>0 EPW #P 1> P W0 @X(mo 0@-:(4@: SM=0P - \ 00[ P0 p 0: S ,WЍ000  t):P/  0 fA-`QFZDT@P=0@!81P @$<sP10SP+(0 0 0 0 00! "4S `P=`0 R凕0p 40Ѝ(tS|(tHP 00 0XX(X(%%X8W(O-Z#Q30` @ (tJM Mp4#0CS0t3t8P d30S jP0: S X P E=Z Z30S 0 "q"pS/=0 "X 2P @$<P RPn (4`S42T88P PuPa< 0"0 + l0S10Sa 4m0C?o2 000! "2SJ>0@@z=0 C6z @$Jލ Ѝ  r p G@$<pm ?4S(4R0(4 \ QX00]0S0(4 00P 00 tX(X(X(oX(X(%=%/O-p@M 0W0DN 00S08 0<0 WPP0C080pG0S 0`S * 0R 08 0 x x.  P8 ><@0 X2@ @?1Q*/<@0 0嘠P /P` hyЍXX ᬑ & ` `@&Y(Y( Y(Y(Rs@-Ѝp@ 0@`P1Q;08  jP;0 >HW(&0@-@MPP00<00S  = J"Ѝ0HX(G-`QM MJP㠔@ Y #p RP 0p 0PP=! SR J(ݍ ЍPJ;8 ;= $HL0Q\ J(L0 0021QJn;8 PTUjA-QP 000p@T+`00CS0pT0 0S0T@ 0S@ 0 dP 0S@ @T@ S P LW(\%(& XW(0 0 S00@-@R00000S0@000S `噐P LWp 40PX(X(LW(X( HX(p@-PP 0S|9p `p@P` }4@P0/S000000f PR @@@pLW(h0 RX R  H R/< R/ $R/Q/ LW(X(X(X(`0@-0S }L0@0T R S$ 剶0@HX(LW( ؆&O-b@ 04MS0S zB>0PP p0 0p4Ѝ5h"0C S.0P20S 0X0(00!P0 000" "  0!$$! 0!㓽K X9($ * R=  R7  R$  R03 0T! $ 0J (!$$1$&5P7 R  R/  R $-0400S ̈́!!" # "040+04 rP90\ 00  0 0 XLW(" HX(Ca} tX(=p@-8M@  ٯD 0`P`\U`$ $ @ 0P8ЍpA-t1hM0@S T吵hЍA+`Z(="(<jp@1WpP0 0000p084 l40CSH$0"60"$^0( Y4 CR+x P*hЍB>'PGS+<  mtDX( q{ m/@-@XM="p:(⊓0 NXЍ 7@-@Pp -P Q Ѝ0 0  P Ѝ0@P0S :R Q/ 0B\/0@ P 0 0B \0@ AB\7@aB\/W@Q/Qq(0C\0S*/ \ 0W!0C0 0C S*CS*/ P@-*0S@L0 ? SR@C:@  ^:R \000C R00 S00 C@ T \A C@T2  0a0C R"  0C\0S*/ \ 02W"!0C0 0C S*CS*80P @-  r//X(A-@((PQ U?-QQpW ':WP`0 ?`S AuA00:S@0 R  0 `ꈝ-pW(&M؆&d/2s@- `.0P PQ10*@PЍp@P mR bR kR%$+ *R xR R wR!$/QP@P$+*$&0!SP@P0PA- 0SE`Pp 0P  T @R p00T0p0S ,'@P0=0'PP}xW(s@-@`P0l C300PЍp@00S S@@PP 0 @D 600xW(@-  Nۯ؆&0 Rr @-/%@-00N$(N N N؆&XG-p p[<@d\P*p`60, uZ/00 ` j O-lM/#_Pok@P$ `P0`p/刏0/ P0@  p?p/@p`?\?A0sQ S  R8?8/00 CRJU?zP<N>P ,c>@>0 -R.Q0 00 0|> t>t. l>h>d> >0SPp2 <>  = 0S > 0.0 .0-0==P====-000X=00j=@ T PPlT| -1 ! ` S=<-<@0=,=<PE < -<-<,<,<,<,x<,<{T< d<{_ Y P:4Co S Q  S  FP  ! C 0C0 0A0 B!"00@&J A-Q@pW :@ ; 00$0$0<0 0 0ݍЍp$m  Y(p@-@ PP hp@> @-0P-S0S' @P#! | 0N0p S0 `CP`P40T Ѝ@pP06I(&-@-0@P   姲RЍ@Ѝ/0Y(p@-@ATp@0 R PV\P ` `P`p0Y(-P@- 00|0 x0x 0 0 h@0S X\00L0L <匝 ,g$ \ Ѝ@ Ѝ/dX(X(DX(@X(؆&tX(p@-x@PlhPP XP p000S  pjL0Y(0X(s -P7@- 000@ 0 0 0 P0S xl\00l0l h5 XT={D 8)0 V\ Ѝ0@Ѝ/dX(X(DX(@X(&tX(؆&@-  ؆&0@-MM@P@Mߍ00/S#VPtVP p Tp  0RP 0RP Pmo 000/8Y(@-  М㦙؆&A-q`@ MT pphAPDI00CS0>}@ Pp< @Y@DOoB0S@ Ѝ0P: S (P 0S z X %[ 0 R@@op 0App Tz0 @00CS0440 8Y(؆&qQ (&O-PQAMS 00@<S =S 00@|S0 0@&S0 0@=S0   +R'0  -R(0 )%#$0 &$Z( Z( Z( Z(% 0@- Z(U0s@-0P`0W0`0@S P 0R@P@  P@0S00S 0ST P000 R  ЍpZ(4f(%u4] @-AL ^`X sr^0 \ 1#P? L 0l0̠?0 c0àΌ SQŒQQP0R0R0P0QPQP !굖 O-p`p됰P0@%Sq0V0&S T4e! a0 00 @ P@P@Z(@-0@!4Mp HT` 0 P@4Ѝ0@P S5WP@V P @0 F?P@$ P@⽖ ZUZ(p@-@P0)SpZ(O-@p`,MTP TS T( T) #T! @$TO "T 0@#SP  +,Ѝ'0DSYA `@V@@P'0ISV'Y00`0` H S T! z! 0  @@P! 0  @PV`'T@@`@P, @   Z( O-p`M8P젟찟l!@ h0 X@ 0DS'00S^^* PU @ 0 c 0DS00SY Ѝ` pUU Z(Ŗ C-锐p`  0BS0p0@SP! 0 00P@@@P@ ЍZ(G-`dP0@S! p0 00PP@Z(@-@MPC1`PLe 0P  IR NRpp V PpEp@@0PS@ $P1ЍZ(PG-P-PP* `0@䀟00 0R0Cp0W S `S0p 00 P11Sp0@0PH0@P 0,P@1q%% a(4f(=P@P/- 0/SSS00(Z(0@-@PMMMߍ00/S \p p  0RP 0RPmo p@-`\F0@P 50D0p@r0q00"SP Vpsz(Z(9p@-T` RpH0@Q 8 TPP  0pp@(Z(8%PG-pWR 0S)P qB000000000CS020S @T  |S p S\T/Ts424b0000@/Sp=FpPJ0S0/p0CS0pppW000000pA0P00 .q00/ lR `R00CS0<10S 00CS00W00 pR0S/S0@D00|0@:P  R*0000t/S0S (P 0/0CS0 pG0S 00CS000P0@M0@J0@(Z(HZ(DZ(MP% a(%2mo A-`p0@00]P 00CS000S W0P0CS0d00S H%@ HW 406 R0S 0OHZ(DZ(T%(Z( G-2M6r0@TPS@P 0.S00.S000/SS?X20PpTePZ( ,`V MPP ` .` EQ0E3rr@0-S0Sp1@T@dRP.4Pw $0S .pP  `P *r 0: S W p.pPX%P pW 0S S.pPЍ%~0S @T H1ؔ aB@WG8UG1F0S  1$ Iߍ0A 0 000 0@P00CS0 0@ 0 00x0 =00CS0 0S !GlGD0FX00S d@00S ^60S >0S$0S 00D0$ 01C 0>0S$0S h@T @ xPP H0E7S 'x0R8 @>0S900SE $.000a0,0(00 0p(0 p  =&0S(7S%00S 0 0S= 8  h=, ep@ P 0 d= K8 P= ,=, R , |,( $P000<=0S :U0 0P)@I.P  @J$ 0 $ R 0T@ =\<\|0<0EhPU p`P,lUI0l PUY00CS00 JE 0 ;+EBT 00CS00 4E 0@`P 00yF00CS00 E 0@fF @PT 00CS00 E 0pPF @P Z@P @P07:0P l PP@HPL: RP00P0$ 0P0S `-V`-V P0E R9pPP$0\0C$0 01 0 H$0SP   7S 0C8#8S0PP)SS @708#8SAP0 Q A!Q8 R 0 00 Q0 -PP -P R 0S0(0(00(00S  d8 @  (00(00@0700407<000L P7 7H 00R{0( =$0SP007dGQhH 0'000 000 x7 0p'0l'00$(0\7  10103/$0 6 gE(7(' 6 ' CL0S I8 6 6 @ R[ 4 0  V $Cp&@00CS0 hP60S ⲑP l60S%,0$S5H6$58 h0 J5,,0( 0000*,0( r"0\E$0(0S,$ L5 T50S O5,0S pst:%0 50S =0 @0 @P$ET'=0 0<0$0 0C0 000lD000d4 8\XkO00CS0440S ,P( T40SK)T0SXVO"I8 3 3 3 \ 4 032)ß00W:d3 0 0S '|0R#C#0 0 x3 BphI00S0T0N0"0C0000 OH8 2  t2  p2 \ 2 (Ÿ00 0X2 T0S8"00CS0 2 R   01D0S#mߍ910S r0(!SS}1 08 L0H@Is10@0@0S L1 @0S1 01$ @0S  1@0sD1 R#0S,1   B  @0S @0S7S@< 0 00S !9T@,0S0  <,0Sh@3 BD 0,0 0H 0g(8f(XZ(4g(4f(%c(HZ(Ag(0DSZ(4A- 1@PM`Rk01000  ;p !XZU p@@ Q X@T@Q@@ 08AS 00CS00 /@ 0* 00CS00 @ 0 ЍQ m@@U P000,K 00CS0T00S DS@Q@80 g(FP%HZ(DZ(p@-P@@Pp 0S%SpP @ꄣ p@-P8@Pp 0RPp@ - @0@ R0S P P\ 0h%Z(G-`P@唀0吐00|Up00CS0h00SG;0S0 S 0S00aPPpHZ(Z(h%DZ(A-p`P0@00 Q' Q:R @":QR!@P 0`EJ0@S`@?%R00S @$P`0W:SP0R@g('h%%A-`P倀000|Vp00CS0T00SA0Sp00/Ka@T`HZ(Z(DZ(0A-pPS R+!`a@T"W p000^0 @0 0 b00CS0H00S `P `@Z(HZ(DZ(p@-P$@Pp0P0@ @-L@000@00 `00CS000S@XHZ(Z(DZ(O-PM/`@ 0P @@@k (⸏P00š0 0S 0S 000V#   P@ =P @cPM R RA R 0S   0  003 0 03 Z0 R"00Ȳ0  *pP7Z { 2 @m 0|>00Ѝ H" R," R8pP B0000S R  pbQ  0X/R0XZp "P pP t"P R  R (P0 * R; R 60@@DL P R  UP@0000S R    BR 9D R5 H3 Pg($h%Z(%?$HZ(%-%2DZ(O-`Pp$M `x%@Pp2, 0S*[ 0 00P@0  p0Rp`#0`2|P& ZQD=01 =@$Ѝb@DT@ P  p R  U 01W VYXU' [1 00al 0aS v00@0S v P Y>W 00SY0 0 S0 P 0< S0XG 00yH 00CS0$00S Ѝ0@@Ѝ0HZ(%DZ(@-yP 0SHO-`pP@Md$P0cS @@ <>pP vPP VP@ 1 R8cS" %U<rP3KpPA U=< 4P4 <@<T 00S pB00CS00 (< 0 0@ T  Ѝ 0RTPU De<b<@X pP`100 0p  `F`l1VD0/PX81 0 000SZU0WE<lPU9<U~_/<UU Ut Ud;} 0[1 GR00#S00 B00S0p0 G0 B0,T,Ѝp U   p  R00SPhTs g([(%% a($c(` o 4f(O-0M P0 4帔0@0~Q 0 `p0 @Q Q#:Q =Q Q  Q@   4  BR  PP AA `3A PW 0S@ЍQ Q@Q =Rp `p(`` L  BR  wp w     BR u   u   BR   x ( R 0BQRQ B  W `   BR  vR v 0AS Q AQ~@P /  Q @S&~  ;@@ X  7@P  #  ~R =Q0S 00    @g(%[(%4f( a(t G-Pp`d1dAf0`S 0X00P0H1 0081 (pppV0 S000`0`0CS0!0 p0开@p   0    0  R 000p 0p %[(% a(%4f(0[( @-0n@l%O-TAT`0$M`FA8q00CS0@0 PP 0@I0E P0 0C0S0AP 70P0 R"Y 0CM0PEPE0000C0$Ѝ0000[(% a(4f(O-R`p@P[ 0 0000PPX P X 3 0 E0CP00S H D/'(04  @D,0,0D *[( a(%% T O-Pr0BS,`*@( ؂  R [ 0 0002``TP `? Tj T Y@0T: 0P[Z  R@0@Y0@FT: 0hPD BU# 2Q0 TQPR D2@Y@FT: HP7 DU0#0 2S 0TS0Q00R D2@ /PY 0S@@T:@PF0D0 0 C00PE0C0`FT00 0 D0C0CS@0 000000C00000000[( a(%C-PpM@`᠐B 0嘀00000p000CS00 p0@ @XЍ00p[(% a(%A-Pp@.A00CS00 :. 0 ` V.00CS00 #. 0 ` V`j.00CS00 . 0`p%@-!@-!00S/ Rl%T0QH0 0Scq o/P0//@[(l%0    B /@[(A-P夀0@000p `R$ #0 `0T @   0 0C  S000SAIHZ(l%@[(DZ(0A-P` @0p0W0 NP 0X S S0 000 00 0h0 $P   00T rO00CS0 00SAl%HZ(%@[(DZ(A-bB0 pWcr 0S 9-7-0S@0PP0/|P2b000r0S\00CS00  >0S 0X60#S | P  |Pl- 0 0p0P0 R R A   BR 0E0CS0000`0\00S B-H0,`8 Ql%@[(%%C%%`@-L@00CS00  bp00CS0@Y@[(@-T T@08      00000 0$00@[(l%A-P`@000g$ ^|V |`0Ph$p0PS  D0  0000CS0 00SAHZ(0&l%@[(DZ(@-4aM0p0P0!|@P }P(0: S$ 0#  |P  rP| 0 00  |d#T|L00CS0,00S ЍHZ(zDZ(A-h@Q0P0`0 PHpP<0`00CS000SAHZ(@[(l%DZ(p@-`P@00P0#P M 0S00M0X 0000CS0p$00Spp@r+l%HZ(@[(DZ(0/l%p@-@(`(P0SSSpl%L[(p@-P@0Spl%L[(p@-@Pp P0Ppx#0@pl% 0 R/t% @-@0@1^ `   VpPW  Q Q 00 r B"Q q A,PU 0  0 _(5rOt%A-R0S20SP`AT p !#zpp "#MP + 1N 5PpWA{p *{ 0P h'''{ qP e{p-O  {Mp, !O z P J{pO  aMpO "00a'^'['`_(a(t%j/%a(!E0S/p@-@PP1PL1D|P0a 0(00R 0S"00Df05#0s  0C?o2^0SPڜpP NLP p0S *00CS0p\00Spp@ Ao PQP_(m5rOHZ(DZ(p@-@\P0P00 QL@00CS0p00Spp@HZ(DZ(O-@pTM R0 TЍO*ؠZ* P`PZ   0SPs  0 S S S P R00S0S@TЍ0S|22 G! 0R+  p  !R-    x"f*   0P"[* 0sT ,M  * 00CS0)0 X )؀` 0S 00CS0)0 00CS0)0 | 00CS0)0` 0Z 0Zi)000u * #40  ) )P S#4M  0  l@ h  X)Ѐ 00Cs 00`Fj&#_(t%5rO-@- 0 S  .^\Q   @ S0C $00P0R0S O-PP10 0%SW P 0@S!!Q@ C$0S 0S  R-S %S +S @@1@YZT X@1 r9 002#00S 0S 0p?Sp  'P T"@` ] P P ` \0@00SJ R Q !" R @t%'_(7G- a 0S Qq0m0@S; @ (А0Sʬ00CS00 P( 0 )0 R  0 S0!(_(q00V00CS000S 0S @pWZ00萠}@ '0 Z IꙂ! P00 R @_(HZ(DZ(%A-`!@S1p@!P IS%Tp1@WV2 `1N0SN U 0S0P xP4wV 1PIpJ S#P#060S$ I#F#C#VF%C%U 0S nPPvv\^vP LLgWT 0 Va(00CS0H00S UP]t@ 4lqkHZ(DZ(P 000C S$Pppppz o:QX0 0@- ^ @P U@R000/%p@-`@`P6Nq0Spv@Tpjkjj@j 0P p@%`((MA-pP@QYQ3 @a聟0S 0 pW@A00CS00  0 @xa Q 0d!S \@TPDa0 R R  @TP@00CS00 R 0 Q P @1@ZT@Q@`Q uPAI`V0 8%H '%: 00\*P0@-%0S/p@-@PPEPp@;;A-@1SU`p@DPU 0@P00` PQ$c(O-@P0q儡0T`0SO  -R  RB -R0SC P0+R6 `:cP[ T00PoP0S P ` `T 0\rP  R dN\ cPTD0@@ ЍT0S ЍOz$c(@c( %P0A-B00`0Q 0S 00S0S006X pWTP PP6p60S0S60N0S60N0F0 0C?oR20S  0-S0F01Q0CPC0SQ 0S P0   000S 0 0^0 PA' R   R0 0$c(%Z(P0 h@-\@000D00S 00CS000S mHZ($c(DZ(000C S/ @-<P 0 $c(G-0p R` PU4\ 0S -R Q@ 0L?PC10@ !,aPP@ PY@b PPP-U0S 0@T0:SF 0R@1T0:Y " @P/@ P0 T 0:S  @P@?:\00|@Y00  T@0 0CC!0 4$@ Ѝp[D)0%qP@-HD0P  Q 000CJ Ѝb$c(4c( $0@-S Q*0S-QQ -Q^ R0 P :R0S0 ^ HPP0@:T  ($$c(G-dR@ 0S P@ -R\@@$0P 0S ^0-SL@T@E@D@0S 00?q `0@B0A00!FS:0P:0`0@#1P0 0V:0 000CS0 10S 3,3"@0S`p0C 0 XZ0Oa`F R 0 0CS0H00S @0S 9$c(HZ(DZ(p@-H@HP080Sp0u`0CS0` 800C80s% a( 0R @-@T 80  B   B /@-@0S@p@-P@0S0ڈ70@0 2B ! ! !!  !!p@-@8    @% 0S/xQS  00 S/00 0/0S/0/ 08 0/=P/P/0/ 0 0@-0<%p@-`R`@PHP "t0 0Ppd0 Pp0-S0S0 0pV ($00080@p`( `(%O-RM0p0ep R XT"T2Tb @L 0SRy RR00CS0`1``@t10`0@Ѝ\Y.R %1 P&  BR 000$p 0 S B R  Y000pZ@W@  BQ@ Y Y  YR  Q P Pp P  Q  R P000<00  Kp% %% a(%0@-0@M P R` @pG0 Ph h ">V0L U<0< 1 001 0 %  @-P@M&0 0P0Sp`@T*vpPT @Tc6PLP @0 MP2Ѝ@%%Pc(0>l000S p@-XP@T T D0T@p8040@p 0/%[(qRg(p%tg(@-0@Z[(p@-d@dP(\Pp% P 00008  P8  p@p%%A-$R0@T @ : R 0 @ q8 0 00CS0!0`)V#V V v vZ A L`p! 0F S0 V@0000 @\V. |V ;V&P @0 ;P @0 @0 Pp&P@0 @0w|P@0 @0@0@0p P  00P000S 0 ~%p%@[(D[( t G-pj0@0 T T+P,0S)㰀" 1PP @ ]qG@`P  0RYP `FFa@@T 0 % p@-`0$P P m 0R$, (@R   RPEPx    Q d 00000S@p 0 BRp@ c080@ p%j@-y0 000%@-@oP#p@- @fP P @0 000p` P #0`@`% O-鸑`P0 b P@BPp0 CR00 S 0@@0XX U @P@W W. V. 0@PpGW PV oVP 000 0V wT000Sc 000h000S@ % G-PJM05@0 0 05 P00U400D$0``P M 0S 5 $ 40  4 `$0000 `SYT4 ` 84$ 4$00CS0! 0S$@PUY3 0RPPS p.0SP Px ,30S ex3|@|3|0pT00 0S  0 `PPB P6 \P p(300p# PP0000 0 0 20 B#200#"U0S"P R \00\0@0 $P00CS0 P@0000 @("00CS0 0010DPt ;o@@k1000S M 10 A0 SFp!倁V@0  E0 0C08000&40 000CS010S)0@0 0 0 0 02 P B1 0R zz0u`@0PEPUZJߍ200CS0`bR \{00%00@S0p@4p W00C0t00j,`0@?o? @2;R0Sp |\P\Ppt ?Pp YW6;G S8 5:0 S`@0 W0C *0?0'3?pp000 S0 0C0~00@00C0p%W!*00'60'3?00 Q~  B  ?pAp000 S0@0C0~0@0•3W5*00'90'6?00 Q~  B  A0'3?00 Q~A• ?p Bp 000 S0@0C0~0@000C0w300'<0'9?00 Q~  B  A0'6?00 Q~A•  B 0'3?00  R~   B  W?p00'?0'0!Qp R00C0@R 1 00C0v001`@G0"0 !0`0C0w001 0`0C0v0(PB(P0@0C0y00 0"!0C"  0 0L$2  `!!J00pS 21 냐`00C0@50 0C0  00S 00C002  B )Pp( "1@0C8#8S10`0C0x0000C0p0 e00S210"QQ 21Sx0pW 0 l0 m00CS0<2pP0@D21S;0 0#<R00S2 0S+0@SP P1P0U1 UP>Y/UP2>P0 |P!000P$@C 0Ѝ@PB0 ,  s0P+ 0&P00 0<P_ >P &P 00p0pr0((0 @ -P 0(0  p 00@0F%p% % a(% ~ @[(D[() ERm`( `(& Pc( % 0{P B@ 80 } pL0 {Y0D 00 B #PD}P@ 0 0005 }P' @ 0  BR '~  =0 BR@ =0@[0%Yy :Y4 #Y5pt0@ 0 p0I Q  BR J[ 0 @ Rp 0 B p63Pr Pp@< [ B + R:p%pp02!R1S 0GS2@0 Wv /0W2 ` !j !v@R n@pYp K/o}Y" R 0#p0CS0p pP@'P023Qw0  00"0 `!1$0  0G-`̀0@T@@0PU @ 0S 0 0   B/o"W`0p 0S 0 s 0 0 0% @-,P0@-2aM0$ 0 10< 010@0-1|0000+ZPI@1| 1Q @@005x dr 0S $Q. 4QG Q ,4  8000<  ,000 0 0 _0 0 0 S00aߍ0  p0 `0 FH0 D0 H00SYS,0タ 0 V U0S00! 0 "1P @p+ 0*W00CS000S Ѝ@r T  0PNe+ 8XHZ( Z(6%% [ DZ(2Rp@-@`PP Vp @+ x޺VpPV VpV '+ 0P0 pppG-` PppW@p  O0ȐP0S TX  >G:  |40@ l.V  T(T 0S @V@ P%ߎqkR /J Vp@-P  @hVp R  _Vp d0 Rp  TVp MVp GVpEc(%p@-@PpD0 0RPPp03/5VPpc(O-@$M0@000`p@A p2@ 尲娒V 0S"2 0S2" $Ѝ@0Sp2 R@00CS 0SP P J* UPs'PP jT U0SX hPSUP0000 Sk\1 0R  UpP0C S *  O UPP 0S( UPP0 RPU U0 400CS0p00S ST0 00`Y0Sc(`(%%% `(HZ(%DZ(O-P0@ph#hcMdP P00L#1p-0U40@D[T$Sg 0Tq00 0`V_ %@`00S0SP0SU0SR0sS vS UP0+S -S P `  8Q (` R:  VP     )PT 0 @0SA0MЍUF ` p0      "TR 00 ) 婸r   %5S Tp( 0Tp0X0 N J 0D ꀝ-&- V `(`(A 3%eA-PQT 00CSPDq10SK R@ 0`0CS00 `01L00<S R 0qL0S 0CS>S RSxh R 00CS0N0 -  p2p@-@O0TP R R R& 1S# 0 :PpR!Q QT " "D0600S0T0S 00S0c(HZ(DZ(%@-@P @a'PxSPfj @-@P SP0  H pe(Qp@-@ 00CS00 P `d 5?U UH?Up!P0P0CS00 `FP/A-@|P|p0`00 T 0000CS0H00SA>0S 00S %@HZ(c(DZ(L P0  /Q Q0 S//c(@-b@0pSM10S 0SPP10SR WUOT T TP160SPPP0SP;x1N0l16 R6`! R20SPP0Q: (p3 0S$ UEop' W`RU2S0@D>T000 0 "00 RTPx0N R T  DR 60SЍQ Q2 1 @$ c(a(%8c( PO-@`PP pP  P0@DpSppTPA TP@DP:P5@<P, (4  @P@sSa0S 000$T $00CS030S 4@@T00PpӪTW00 T\W! @P@s 0E0`P 10STw@ T@@VPT @Pb1 R 00STV@ Tx@P@UT X@Q0S 00S 467@@TppYW `СȱPEPe ?P@1 z10S VP`0-S0S`TPhOCW W0S8 _90S4 0@ V0 S R0V00 ;`1 R #T` F00CS0400S VQ {%c(HZ(DZ(I / r % G-PPE o@0p` TUG0S 00S 0@0@000CS0 00S @c(c(HZ(DZ(p@-H@P02`S@20CSpV02pc(40T0P?o20S 0S//c(C-p@`1010r!Q0@S10C1 ЍqXPU X2 Pḷ#P 0S c(|Z(?0!!R/P/c(p@-8P\2Sp@\Bpc(0-MM01`"R !R X"R   1 1d"1!d2S ,NPl1, ,NP L!0,00N@P$1, c@T0dQ`0P, U @T 0S P<00CS0 ! P700 0$0(00D>S 00 &PQDP"!031c(|Z(JP  <0  40 Gߍ 0  0  gPd  xTs0 v0 t 0 8p B$`0 0@  0 t0  #l cZv t0 O D"0P 00t W 1|j  1v t  j 0et 0^p0P $0'S"SaX0S' L v t  q;0$ 0 $  0]'t 0V v t   0t 0NVBT0 Hˣg(%&mtv" d r &D\h(FP0C- 0`qMP` Pp 2@P 0 0p2@PC 0p W ) PuY <YỴP0P( 0ES ]P  00S00H l^YPH0?S0 -S00H0,Ѝd l 17@-0@0 0 X4TPQ P| , Ѝ0@400 4 P A-p:P0084\|@P3 0S0 =PP $\00 j`cVt1P 00 `8iVP&P 00 8P( i 0$00SЍlV P 0 0oVP 00 P i 0(0 Q 0SP00CSD i0 0 0S  w (w0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 /@0D 9K<@0(080$00= 0D00<00,0/+$@噳0@-0$ 0d8 Ѝ@-@4}000@-@4u000@-@(0(S00 0u?0,0Ѝ`t p@-@=PPʚ8Ț<ƚ@ĚGPD[`U\庚`, 8=`=V0,0p@-@4380,0@-@4)80,0&W3:? @-88@O3v&( R o8 ", 8 <  < D ,-D  , /(0S ]@-@8@0<<@00,0@-$ >P Z Ѝt@->PZnt '@->PZot 1p@-0MP`0@-S00(00P0 0  P0P 0( RT  0 0 S40('03/Ѝp$ :A-@`PpQP-U@QᖲP00  PᇲP0 -U  `0p@- P@@0P ,pT 80$P< D0TP$ <0<Ppꨧ @ D p@-$@P0S 6200Pph(Q+  0 BR@- 2 M| 0- BS^0@Q ^ 40 ? 0 C  / /p h(h(p@-hP@`V P52p艰`HV4-2,*2%20h(4iFPI O-M`pA PU \ 2TP D 2XP 0 1PW  1PU 1 P pT,0p zR S [ Z YXW0S@0S 0S<ST00?{[ZYXWP4T <@†{ RS [ZY XW :S 0S0S 0SlPT`7pPP X WUP$6TU P l1^R@ 0&T 0~S Tv[TqZ TlY TgX TbWp lT]0SX TTX@0S@ <TS 0S( $TN<S JTO[ TJZ TEY T@X T;W 7R@ 0T 0?S pddT7[T PT2Z@ <T-Y,(T(X T#W}T:SuT0S mT0SeT0S ]T  VT| xOxLT X\XETWH D>TU P,U$3TUPT;S < S@ SU@S@ S 3  T:v`XS&[& Z+Y0X5W:U?P(s0SSUA LtJ<S@T[ TZ TY TX TW TUp lT`jBPUdЍ0k0d$"w/ @T   Q ! h/0R녡t0 ! P\/ U ߺP pj {   %&,-34;<CDLMUV`hipqxy #") 2:9@AHIPQYZab@-ֳ /,؆&@-,0, Q 0 0 /,(h(j؆&s@-@`س000 #S@Pͳ0S  0V00S 0 VЍpFP0S/#Sp@-@,P$p0P 00p(h(̮@-PRP@ p`p 0R" Ѝ茳0"S0SO 00SS  00@O&@-TPL0 p@f0"SzVЍC8h(S@-TPL0 p@K0"S_VЍr8h(p@-h@P0S 0S 0SS <<U84  S (000P 0p8h(+;p@-Px@Q d%V<P L0   P    pp@ @@ 8h(0@-@PPM 0SLD00Ѝ000 0>P0 0 Th(O-Pp`HM 0S4f;$ ,  P 0S f ߍP? 0Q 0S F@q  R R@  R@[T WpU: 0S  @%9/PV?`08h(U;^@-q0S S S8 4 Ѝ S$ ЍFP~@7@-lP$ R\_U;@ H_ $0S p (WU KU Ѝ08h(0n(p@-@P 0Sp@0PS 0P0᥷00Sp @-P<@< <`0S*00 . @ ?؆&C-P`PM 0S00(p/p0 EP" /Q0`@ p0@5P T0p +PH$0@@ 00Ѝ Th(8h($A-@0P L- @R<2<1H#4-( ,-, -0 -8 -4 -#4R! -!4S -!4S |-!4S `-!4S Dz-h!P0S l(s-L!T0S T l-pHP8W ЍA0S. a``  0R- 0 M-0US !S|  !3 \@-0US83  0U $2- 0t--pPA&@ Xlsz<qBBOQ ^Q (G-Q| ,@QhP0QP 4QP<PQ(80S,00 80<0S804 <0P;wPP;pP1 QB"8f`8X0apSp R pV <0RXOP 00< S4EP0S9`(ϫQ 8(ȫQ 1@P0S0 BS `a 0h0S  0 S* 0Q*da 8Z*<[8h(XnO-;$M p*ebP 0$S  ߍS P@0T[D@P 00뉔 40ਛR YSA ("$0f0Qjf/ ,2!S1Q% RR  0ܡ!,21S 1b"!b$!R! R,"b"!4b4# 0C?o2S  0 |pp`1R8 R,2 @P0 000(4"48#8 R* 0S 0p` P 0S 0 pR1So   @*1S  f/ ᝮ01T T%H 0n(8h()VEW}}WEVQqj(&A-P@`#Pp %R 0R000005S P vL $0f0Q ,fR( 8h(0n(`h(p@-0@mP  P$p@|I0@-0S ,8h(@-P G `h(O-@:PMzM 00@ lP5 ` eP0P0 Ᏼ0SP :ܞP`( @00x0S``(`P+V0` 匙(`嬩 Y 9 0 ,00P,0S d h,02P P HHἂ$P,1 ݩPFV 0SZ 0 0,0P2 =@h`(b(P,00 xP ,00,0`V 0S,00b8P,00  @8, 1\ , r_P0 ,0S  S;ǑB0;\V0`(zP (/pP (tlg P0(`0,0P,0S ++RP0 0 *K P 0(`0,0uP,0T0 : P 0(`0,0dP,0`0 ) P 0(`0,0SP,0X0 D P 0(`0,0BP,0\0 P P 0 (`0,0+P,0d0 P  (`850,0P,07 lި P (`40,0P,07 {,ͨ P (`40,0P,07| j弨 P (`l40,0P,07k Y嫨 P 0(`0,0P,0x0Z Hl嚨 P 0(`0,0P,0|0I 7 `aF0 S0S  [0Y: Y0  0J 0B뼃(0bSTB  9(`H 2[9 嶲0S(I # \3  0 R M 0( 03000"0,0 0 0 ,0kP L@, 2![ 0ȰÕN 0 0, 0  (0 bS P  (0,S |D{@pݍЍ R $0y  QP$0 ܈P$00!CK " Ȱc 0R ( [ K0 S|1[ 0'0 R  (0 bS Px  (0,S # (0Sg b8h(6  :x+++b`h(Jhh(*xh(.E$15@JWbvTh( &ت s@-`0PU V  PD@P hЍp`PD!1 00C0@⢲V 07$00S D3@-00,%p@-@5S4 0PSP p@'Pp0S 5S 1S O|Pp5S T \Pp< HPp$(( PpN8h(`h(IZedArdAx7@-1AP(000(;_5 S* 5S( P0S 0S005S | Plh0hP &L5S Ѝ0< <mP0WEV8h(fdmd,%X`h(gd@-@P f/u@`h( 0 L,%,n(md0S/!  -3@-PT P 0S S@@ ^P@Ѝ0@ Ѝ/(&@-0@Qa7@`& & @4%)$"$@-t@t0MQh  `P0cS CS SS 4厱sS00ۍ00(.EH$X$0@-MM@` PP 00YSP ,lۍЍ0oP$$$ 0 Tn(&@-@M0 wP ,ۍ$@-@ 0@ 4j(&n(@-YMM@p p\YYލЍ<0< S <fEP10YS<0<0%rdA$$ %@-PM`pqW@(nWVXTXW`8eWXW i%Ѝ!%@-P0@ 0$S0S2 j0`Sp( TQBQC0AQ.R410S 8@0 ǣ 000! S0c0A R%% Ѝ8YW 0Z 0Y`(pLW 0Z \0Y P0 <0Y 00 $0Y 00(İ 5%D%@@-X@X0MQL  DP 0nS00 yS dۍ0(,3o%%P `00CS`0p S00 P0S X0X /XZ&(&C-` 0pP0YB@P L %pG^T@ U @ 0@H@mPF8p 0l QO V ;PU PP pXm Ѝ%p[&G-PMM`p$0@S0#!p- P 判P P%0 xp P  ``D(8p P  1W1q11&A-PM @:P X 2P 8D~  0`0PS p0"S U1r0%*Vc  0p0S Uwx00 "R00S p[DPdPd `尀pm(p0 8RD0Ѝ111 2$2>2V28(yd4p2C-p`@P Q |.DEPd@ R; s2p 0 D03/ ЍC&%28(FP 0@-  D8(4P7@- YP@TP DP804 (p Ѝ0o,38(wdP7@- 74P@, 'p Ѝ08(d@2@-镠(0   j3؆&O-$M@P` pHV0T00X$Ѝ = 'pC  P  'p 0 S T0✐@0S\xtZV XڦW 0  @D/4M :4Q sp@-@PF1P' 0P, 8>0P 8 FC0P 0PL0P  p@蟦up@ 0xq@dkp@ U@@刦Pptcidyarae4rbmngntsz 3 =PFP^40D S/ 3C5C$1 4! 8<0/@(0@-0A„QU0%Q ? /@.0@1 ^ L043c 0P0Q ? /@.3P0@1@ 2@D4P5H@@( 213/P/h(A-PT0p(,`೚@ᯚ,0T@@DA?@?@@@(?0@-0@0 (20,200P!P30@(> 0R//G-`0(,Bp PƘ Ev@PPW ,20CS(20CS G0@(55p@-@`42SM%^ u E 82<"@n 0(2,"gЍp@b`入<"82E@dS`x,"(20@HX"\4Ѝp@B@(%555&646>6^66657s@-P`۞  0SЍp00S@ʞ0"S1Ds@-$M❞@j00  0 0qm7؆&A-`P 0p @TʬA /,s 0d  ? Qqp  RЍA-$L`*$0S`@D@,} Ѝ%::@(A-0ppP@`ph!14P S H d" R S R 0 N3:U@(Q:p@-4@P0S,( 0B1p@(O-PTM0$ (00#,0x0@00030匠s4<000S: (2,3`a(0,8 0⊗80D$08 @?$0 0x$0  00 o@ D04B䂟d"P @$0( 04,0 .[ ` RL` $R0 S p200#1-R0" 4LDL`P@0}00P00S #~P  ~P  ~P$ "0L00 S? A0g2< tkE%KUP1"a?C$5\"0P@\2S@0x0@XRx0 X20P@x0 X20UP@x0 X20UP@`L`(0U,0000[ 00S (0 0,00 0h @$PTЍ P @A:@(%:((&_: &$ :fe::;-7@-@Yr00CS0 SP Pp pp@0 P00CS08S0 Y@o Ѝ0@Ѝ/(&(;_O-a0 p?Pp/B$0e@O 0啒qp Ѝ  R ЍOP"t`k"0S 0 |qp `BE,ඛ 7"0S %.;@(p@-@P2S 0p`n/(2垛1!41#41U &"U 80U p@@PC @?@Tp@((f(G-r@,5`P ?` VPpYTLE J$ ,U 0V!U ! [E@s_Ps MX2  I $! (! "4! 1"8",1!#$s_(P, "!"",!000@0 0 D 0H 0L0 04 8 < 0@v000@(%A-\P@PAds 2F t B B$00C0@(O-Q40 ЍQ^H DaXR XD 00!R 0:80Ԣ #ZppWPPUJ U @DQ ČUȌ̌X L X0P0Z 80S yq F;@(q;;O-P0p0Q`@07 0 $4 Q %C?C0V% 021S 02/ .0 1  Q 32 $450 (, T02Sx Y< ЍP P倰[R21 RS$ [0 0 2S Y P0>Y200p@`p0[ Y 0S S01S 2SLPD `b/ .040 81 < [S  R#ZY  0S^   BN R@1SO148<$o00C0@@PAy`d1S  P0 148<   00P2S. Y  a14a8a<0#d1a#h#!SR ⿺0P<=5=@(>=0@-Xa0 0LAP d2S8 P(q!p! 2SP0U0 $pt"U Rp\EU$pG0 00P d2SP P@7 Ѝ0P0!!1 %@(mdh(y==(=O-`MHLPrQPʬߍOڟ AʁDHLQP0@0PD5 040 l2P02!0 0@$0) 4\ 0?⛒q4"ROX2 PET-X )2Q Q64N 32S 2!1?  !<0 #9!1?  !< 0#,21SQh" R@ʉߍ@ dQS.2SbV #( ;pp  000" 0 p`!V0 002R`" p"`R\2("0Tt 04b1 RS  0020SR1!0|12S0\ 0"P8( tRp1%*>9>N>>B>??>==>>>U?j??5?T?]?<A-4RUP@P@WЍp(0PPPB1P@TaTaTS <ЍA 0 !14!8!< 1 11p 11!1<0  11 ?01!1<0d  1P 1@?0ЍA@(øq??? @@1@B@T@e@v@@O- 0 S 0(00 ,00(  ,  0 0x' 0PPU0@`  0W0S 8pP00W(0pS,0P0n 000 W 0S7X\"0SR ㈀ 00RX0pP0 0Pp4` 0S 00 0 00p+ GP2 S2S0 9 P 0` S ʼ6! R0T0P``!R (0 \ !Q(0T!X!\P!$(,Pl21S  "/0.0010U0 3`2044`5 8<0 U P`P H2(0L2,00800 S- 1S* ( T000P,  00ST0!14!8!<!14!8!<T(@,`)(,00\000T(p0 S( 21S$ / .0,40 81 <T ( S  PT 32 $45(, T\(00,0pP `0 0 000pS0 S00 000p 4P  HV[7 0pp  ᷓ0S (0S 0s X2 0 RS   0^04o$$00E#$0 #(#< 0'4 0'80'< 0 0` p90 @32Sc RU0cP[ 0 1<Ap 0PPl,2`0C 00PPa(2 00p `? 0PPUpp0`Fa ??`1`<A` 0PP?,2`0C 00PP4(2 00 0PP? (`Fa?`?``0SY 2SPU PUSJ041SL@(ø@@q(@F @0FP@ A0ACARAcAsAAC-8Bp42McS 妚P42Sx 0PFU42S 0S 叚P 42RSftP:傚42S]1!$1(1,ЍCL0S\ SHB` d0 4r兄W2S 0`p` ؀0ZP "PR S0SЍC6@ D0ЍCSP 0Ѝ@(Aߎh(AABAAAA00CS0rE@ T 00CS0hE P  @YT NTY@DOoB0 @0  0 0 S`(Y(&,3oYY&0@-M 03s0c00@St  o PP$ R!PP,& 00@   \  0PS U P `Ѝ0S H U0S\0S\  0/@ \0Sp 0@ 0 @vp 0S0Sz @g0So  @" u @0St] @D HP@ @0 @ `-0xP|"%   T`  ` P @| @x u 0 @``a UU Pb R``(l(d(Y|YYZ'ZIZkZZZZ [Z=[X[G-0@  0P Q< 0  PP,   0`P 8 GpЍ Q*l !URQ L l 0 p H0 0W40p P  0Q0   040 04!$0 !0  0( 1 0, X0`PX  P< 0SD00D0Dpp $0"X0(0R+* 0H0p,0#804 3 00 0p如00 QP    0P hP xyhpP1S1S1US1S 3S3S3US3S,  pP0p* p2 02 121300p0Z00 QP p }2   0Pp00S1<01@040  0640  QP   0PA0O A0  |hP 4$ 0R  eY><:X`V P0E܆ 06#++R`HX8 $0S,0,  RT0C࿆D0"P#10P  0QL \0  0P 00P00h00l0dd@[[[[[\3\O\T\Y\F RRaArrAaU|\\\\ ].]F]_]]]@-p@`P P00 P0ᇁ 00QP  Ѝ ]0P< !@ !0 P0i 00QP 4 &0P3\|\@-@L0 \:0\l00l0Ѝ |p00p0l0 \ \ P0 S |H |<00L 8  8 $P00f]4^G-Xp` P@P & Ѝ0!0 0XY D $X0 X0 P=^\^O-@,M0p@l@$0`P PprP$P @,Ѝ Έ 0 RLŸV^S PP8 PU @4p2 P ^ ^^^@ \ \\\P   @P@CL0!Sp sppP0 S 0 P p 0 r k 0L $ P 20 2 p(p," "  @ "  p@! P0@ S  2"!"0  0@po^^^_^^0P s s// / __RfO-`@PpMP0S Ѝ X  H r0A D00 s/ r qh \6P0p@P x q0 `  P 0 00 P 0 00 ` P s0 `P pP0 0 P`8P _F I_y____``e```R0/0@- PBU02S0P^0A-p`|P@P  PP P0S"R0R0`4^O- p`0P\PPX $P  qQ 0 @T 0Q\(2 R@0 PS C 0BXT" R t0D s   0 TX  R 0 0 p p*P YP  L BPTR2 Q PE`9a{aa`O-X`0pM@PPXЍ 㐇0Yl0L (2 R0 r00 PܑP" 0 STR rH 0/OP ᢇ  0L˜ Z,$ z ,(\  l  ,΂l0\ll 0\ll P 00Ql"! CClX 09#! 0 ~ QP 00  P=^aG-@`PpP0S00S <q.p@q8WO$0S  0S 0S,0( 0  P0S.P  SPpl Q P l0p<0P0Q*l0S 2Sp  lXP0P  RQ@0 P 0b5b;bF Nmb+:@-?`XPP@@\@#T@TpW @@T`Lp(O-P@H@M18p p00TP0S<0T D0S Ѝ1@ 00`0 D2# ᓲ0 0 0F} Q P & P0 W:0 0 03} Q P PLJ 0  P<0T 0qBp(bbO-M@L0Sp<`@DH S_P PJ_o VR 8 1 B0D 0 0 PwP AVPU0Ѝ 08 T:b#cbQcp( A-@/pp0%B?[`0S ᴀ0ES PC p@@0T?  C0p(0 PK %/p(O-` 1cMV, 01 SP0 S@0P`00D@H0(0$0@@hD0' R$ X0p1#r#400<< 0,40u|<04 QP cߍ0P@@`00D`H0(0$00 Cp`02#  ,; PW002800qL0pGL08 SD00S   80< 2800,0403|<04 QP (100  RR R0(10@H0L0 p0L0B = #lP1  (10(11  J  , @ 0B0 H0P 0H S1@0S  ZI@(1 0A@  0I0@;+  6P(10(1 0S[ 0@ D /oD000"s R$ (00P `, (0峄0000$0D0SD0! 0CD0 0D 㓲"X 0X  PP :X R: U$0`(00`P0 4o UA `i0D\Q U`V$  (   P`( P\0K/g0 x!Q0pq P b QQ0S*0hQh  0  U `$P(Pq000 0000 ,P `@P  Q .b A0 b @ @ bρ LG?@@0Cs PQ*V  04L |1r 8 <|1 0V4 8 <1 , uo000000U\`0& V0 0$  \T P0000T 0(00P0 00 ,@eV 0$ S1S IxQ1PP|!xR \`XP PPL0sPP|! 70I|1@|QUP0U* 0" 00 0x 1S \P@ 0I 0000@1hPP 1|!R `LPP 1b |10|1#40L0s_?00010I@P30 0Q 00RA U$0`(00`P91 S}RhP0S 0S \elKR P0S 02S 0S0S} 0\2SK\F|!+xQP qPP00@ s 3 |1P )DXP PPPPPPL0Is0PP@1>@<hOP0PU+ `|1VS /P@ |a``L0Is``@ !RP XPP0 1A@`PP\< K/\PP05}P(. 5P0h00h04U U0@IP0U* 0RPd01S\0!@P %4QP0%8%\0 P0PEd0U03:\@u8P P|!d1 Zb" :0 0|12P0P0(00`P#P,18 , 80PI 02S0P0 S0 ( U$00 `$0K000 000$000 ,@ D00S< 0,40y<04 QP80,R$0 PI p(bbXccc c4^p(ccc dd_mo d2%dbd9dQcdd e9ege~eeeeG- p@r W pP\aPP Pp $PK/㜁D08QP0Q:" 0PS00  Q puxPh`P 80"8 R 00 05 !$up(efCf`fffgfp@-@5%SQ%5 %SPQ %UU{yQQp  0 0Q0 Q 0p(A-lP`5p@ @ 0% Ņq@ŕ\p(O-POMphP) b5S5@ ET# |T 5d 50 ! S!$5"R$%P0S88 R}P @TEOߍdP  RR @`0d B2" 0w JQP d d0P Eh0K/0h0 ⣀0 @!,q(r0d  01܀  j   ≀,10,1#40L0sK?000/1001001#40>000310 00 000L0 Cnw(%,5QP Hd ,d0Pgp((jgKg&g7g[gH sg@-@ P }0 5p(0/(0/(0/(-@-  _ 孼S؆&G-P`pl@0S  0S X| U jTY0S \0S"@ ({WW-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rp@P=0D@rOP0: S0RP00 0PP P81: S P% S  R  rPPlZPPPU r PP$0@P( j WW(WWXFP@-/0P  0 00$Ѝ  x-X(Ck_->CBX?X\<\99>Z_9>:>CU_?n:>CFP_ 0? AC>G_}C>GB_mF>_EnF:_E~G6_ 0X J~XpV  $$((,S>,_}S>G_mF _HHLLPPTTXX\\O-@ ! 4"4!14"41 $$((,P,0`Pp0WС\5 S L5sT`0$ $ 0Q`V,czTvT`XrX\n\`k`dhdhehplalp^pt[txXxz^0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P"9<Q008u@5pp0L0p $(0Ss| w0  0S w < 000 S{:0 02P0 @S,00; ` 9: \08%@5  L0 $(0Sf ]t D$l20SV `~0 0 0 00@00$? 0| 60 P 0 7\U`  01S0 ,(00(!($ x(o?khnl$ h(h$ C  ] 0 t10P000 R0T A'' 0'? P<9P68  W2 t0 l1( @( & P#h&@$h((((%"h(6hBh(O-M`@ ) P0H: 0 0@40P$? 0 -62쒟2Q{ p q B("(sQ0< ,42嘢# 0JR xXpQ 04  0R  @PЍ( 0\1  0 4 Y: 10S<000D0` 2 `0 (0\ 1 010S 10S 0[` `$110010S Kp1p1000 : 68C80b((%((%(O-P`FM M X wu@: 0 p5 Rllh"0pSE H50S00  000S Fލ Ѝ }00 v1000D0zؤH0 T00X0400 4QpQ\t` % 0VPT"H.P 84 0T"0S" L0 00 0 HP #0000S |0  0v.P0K 0 : @ ~8C80  0 0S #"k  P0 !J.P РḒ L000Q0 H [ ~ 0<0X02  0G0  000 B00S,k(2jp0 0G 0Gh [ Y0# 00C 4 S 0040CpP!*|x1p 0pY 0Y0  k000C0 0 S Dq   0xs00 p   8C80X0000 0 c!0xs  0 00S m긫ogIh((Sh8(%Jhbh(lh(hhhhXh( i/24iKiC-@PN`HXpaY 10S t10S 00 0S P< ЍC)`@DT> 1 RP1H e0  P PN HM0S$00S T  0S b{0S G >@ ЍChX-P H0 ЍT(((^i8(%ogdiriiii( 0`( "4`#/p@-LP@08200@ 00 /0@0 \sp(00S4  /( 00S/( 00S/CU(P000R0SO-p42@ RPMhD R0R0aď080S  C/ S ! R 0C00 0@ἰ? 0m\5p!`S 0 000 ?@U (  R8 R  0}0\ P `0/0/0 0 gЍ  [ T R  P0U0 0<00N/(((iTiij6jP0O-@P:1 R0* 0됑吱0 `SxP p* 0 T C:\500 W00,"1p R 0 0 !Ž p 0W`0 C c00p0S   0 -0xp 0W T0  0W400,00S Ѝ([j@((T,((O-0p#M PQ P* PPW0k:8 `\5 00 `W 00O,"2@ R 0 0 !Ž @x 0 BW`0 C c00 d0@T CC cA30B$ 0 Q,040(0PÏP0 8%,10S 1 PpBU809 ԱPWE0 8|,80<01|!0<S0<0<0Ѝ U9  P\ESEES`fSU zS R T` R< 䰟(/? 0WTFEV  P Q RF 0X:P`0FQ   R@({j(T((((((G-1P 0p` V   00@ 0S 0 0 80PS `P` 8UH0ZP000PS l`4{mQ$,$ (,`(PP8(j@((j@-@8P 080@(G-衟0PSN 1p00 B?k PCP` 0@`8@Px1 ?V`10A0I00 00 0 V0 (pp1 p#",`(p ( W Vp`0PQ(d0S|P 1@0  XPP00Ϡ^P0d000 A((( (( ((jP0p@- P?@U800P 0 >!SRp( ( kp@-X`0SpL0LP0@1CA0Sig000pa ( (( 00 /,(O-H0MSP` M 003/ ލ Ѝ40 pPࣟ00 +0H00@0 t0 ¿ S 0V  0IU0X0t3!0S& d3Q2Qc +"0  10 Q 0Z0 02/+ 2R20t0S>W>000 Qo ! ZH"$0$w+P$"0 " R ! 0! t R1*01 Q5 1000S1H  B/oQ" RK X!B0P  +B<4(P: P R, P w 10S0Q 10S 03/     0P  0p`V W((((Pe k(Akeksk(0O-S0RMM 00#4@PU ( , : SRލЍt \`(5R<R XP  RSU 0 0 ,op0 PB?T @`@ 00S 03 00 XT8ő @5D0LT 0 a31 Q>P R. Pt!P!0  S D  XP   . 80< 0 @80< `hP0 P 0 #0 S00@ ` R Q\Q\y(q(q((w3q((Mq*q(00S4  /(00S0`( "4`#/( 00S/1H(O-M,M@U"\:[$0 : S`D[ ` prCP$ lCP 0 00 0؍,Ѝ0 `(XCP  LXRCP h0S  0  qP ;0S, "f : : z  [ 054%00! ?0S S :00/0S 0 S :V00#03*  R00S H:0S7  04 @2,:* 0S R 'P0@4`PƟ S9U)Q900Y0 B?JpQP"|90S  0|  0p 0 ( 0P080S, e-T  Z9Pp⬸ U0 00(p UxPP0X ZP (000@0PP 8LXHP"?$0 S7Q:80S6  V0;R01*h0S. 7('d0 ( #0 _P h70S  0` @@ (K60Sh0 0!60(%R/V+: <V3#\Q RmP   gPpQ^q U  #p# PE"\:U PpWh RTPp%Q_'qP tPE! p 10S0AR 0 # Z: 0S 1000S x50S 0S 0)  t ?'_ 0S 1000S 40S 0S    10S0ꊡ  0000 04 $0 S0 0  00 0 0B$000$0 #600S440S L4 PP e@pt|3S000Q 0pQLtQPXd00H00S1 0S \30S? \P  0MP 2 0 \00&&p2 0@S0:00~0S0840/<0a0#PQ8`

hO=\KP 0H0EP0`0Ad_Pp`1PU 0\485  @5D0L 0T b32 R (@ `0 O%Ϡ<#\ ğ Q  0  D ?0 b#3 0R< S< `3ē0S0x0@S =d0, /^ 0 ll`d30S9 X30S5 L0 S 3 S?X ਁႎ0 % s\@T`S  &T0 S\000 T @T`VT0? @`1 0p20兑A0Y 1XS  0<+ Ҹ0P0 " a000Y 0;* 0 0VT0Q@` @ T\@@`R0@3T5Q`1:@Q`$ 0@0ܺ 00  P h00VT 1PS P   0R`* A ya$((T(Pe(((`(((((+s؆&((U Ss(lss(sO-` @ 0Mp̰̐ 0 0  BRЍ PPU  RQ l @ p R RP Q @p((w 0`( "4`#/O-lMX a0PpX0L1L0H1H D1 0,0SlЍ0S @d0,`\0 `>00@ܰ 0D RpT0#::`P 00ASpQ 0 0S\tQ `0S @P{((((s؆&(( 0000@/00S4  /(00S0`( "4`#/( 00S/B(O-@:M`PV`@@ M :0S 0P *S *`0080< 0/[ y \P X P ) P9`0S 0S P)@ P00 (9 #R0p00S0100,0L(0 0 4"400< 000800$l 0P @ a ]`.0 @0C0O _000S0{ `\P0uF0 S$ 0S '00gP|7`} /00S0100,40K4'0 0 4"40'pc 0pp00ppP*0S  1P_ 0 0F`W%PS @  ` }F vF80< 0 80< 0@0C0Ɵ 0 00 0Q.*0S  P  0"pWWލ Ѝ0S 80< 080l5 0< S Xg0 00$000 *F^P 0S 80< 0804 0< S f`0 00$`S  B("( p F ᴠFP@080< 0 80< ,00C0 80R<.PSR$ .R $PPpP3P`080<4`3 R0 *3 009WP. 0 0qZ P0SLp0AS0S3 0020S40000(P x2 A#R0؀2 00 #R0uQ& t20Sh20S\ 0 P    P000 0 0 #R0 R  0|R>l!ly H10 S' Te#R0 !0S  0R ؀}P 1 000p0P``0P00C0ZBP;_ ((((mo Ztv(st2(ttst tttt*t( uu(u9uHu Ouu((Dt!  R1\ 10SK0T!  0d!S@1`0 ? U00 20 !찟00S0H0S 0 04040c/0 P0L 0 8 QT $  $ $ $  L32   ^[0 ؠ<0 1Pp?($(T`(((U Jw(((((00S0`( "4`#/(O-`lMX Yl2ll00,0SlЍ0S @d0,PU0 P000Pp1@ 01  0D R`T04:1AXpX\tX`Xd  X P @RE X %P 10S  0@P;P 00S  0kQ SR  00割 |EX!   T  L 0</X((mw؆&(( (ww(^iwwwO-dM`M@PQ0!n0 Y0t0$?0SX0S $5S0SVPWX0S $Yk S Y R㸮d>pW\ 0P%T਀X僀 H\X00!` 1B`01$dQd0,P0C00h01`l0R!B1d0-0CW P0=SLq QT00H   0S 0 $5> *?==0S  0 08S0 $5B111`R B- 10 0S  $~ꤜ0S%  0帐- 00$%BR0ө`S<B11@%L0 ᪰PP 0 A, PP 0S  x<P` *堐2?L<@<0S 0 02d0pA?P0x;3A?`0 =<0T0.L0X \;0WHQ RX0>F@ @0X8 84<ϠQ bz S R㴪,0 S[?^ @Q5P= :0S @0 # "@0A!" !@0 ! @ @0X ! ApP: @ @X0009\J*>P:D:0S 810 0؍ߍ0<00

! A"$5S8>R(0W8,(2W42,2<0002SV0@ x S0!!~ 4x0R\ /   B  R\ ?0  020C02`H0T SD0\ 0 2!΍0h0H0DlE "0AS0000 04"0C 00S\0X00!!!`V0: 0LphppPp P`lXX ুX姁0 8PP~,2!~00<0S. duQ0 ST0Tpp101"P Rh"!>2 ԐXdQpQ0 0 QNQ000$5S `0|63! 03080H ` H D /D V($((((xBh((U x6xxPxhxx|x((Rz(x؆&T(x ($(((y@y((8 ( dy(yy(((((y((7z`(yzQ 42!.0$00` S`0?00S00\04 @$5S|2! `0h ppWS $%S0! !42 D0D ,x  x |0  ("|H Hp L3t !n r! T0(2P3 !T0 R H  2 00000 D0NFP1  ;r2*;,2820S 0 0`20S QL 1P 0< ST0T STT1P FYP2 L _;0< ST0T STTS;p0 # 0030S}0 S\0P S\1P tBF+P 0P S\0 S\0+;H0# 07 ppS $S00S0`" S\0?0 0 S 0\00001D0p` 0Rp/d0W S`0?00 S`0?0001D0pR8 0 S 0\000S8D0;#H H Xp㵟Y8 0 S0\000S8D0l;#H H XG-P`@T(,PpK W @zzA-A0 5 P0#R%(r`! 10" q0SR 1)0ad0  a*t:t1h10S 0 00SP03Q0S4 '[@ 5*< 5O:000S 0 0@TP:UA5t0Up Pd0 0S L P<0 0S ((%z(((zzz( {0/(0/(0/(-@-  5 像)؆&G-P`pBT@0S  0S X| gU @T{Y0S 20SS@ k({WW-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  @-@M Mq` @PxPݍ Ѝ\!rpp@P=0D@rOP0: S0RP00 0PP P81: S P% S  R  rPPl0PPPU rPP$0@P( j WW(WWXFP@-w0P  0 00W$Ѝ  N-X(S>h p@!.0 \\L5SXPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//(O-|4MX hDhhdhP@quP:0 0p 0<&0&0P\7p0p 60pw>0 P0p$2S# *JP *JP *.nVXZ hY 4[ 0SW?관X V. 0_N  I <0\:P$ V( Q3C ?HPPe 2S|3%8 S20#"20$#20PA 2S@4$040404l`02P$V20A\2@02 I2C`*J `FbI 0| iHH  ?`0P TT#0`P\`Q=S/0P 5` ( 2RV0 S4S 9c 5*< 5^43 30S 0 0`20S 0P3 0 S` V 10S0d"S`` 0Hz2= C ,0"000 0t00C`r'? `0(" 0S sP@a 5*N> 0:#: 5 3d1} p10S 0 000S$OP0a0*31] 10S ~0 00<cQ/dP 0Tb<0*2d2= p20S e^0 0r0S0L%r0L%r0H00q" P 000cH00STNPc*2,3 830S 3,0T# 0 00L40q"  400cL00S&Pc*2330S  0# 0 0t4 R.0E q\ `PVR d0SPl4d*S2440S 0$ 0 0$d0Q,%R0%45 S R! p0040SPHu*#2X5d50S 0% 0 00u(0S xQ$ W0S< x 0(%0Sv4Pu*1 6S60S {t04& 0 08%<5HSR$ ) H00850<SNhPv*16%60S MF0& 0 0v@%D5LSR$  L00@50DS%9Ppw*1770S 0' 0 0 7 70Sx(w0S0Sp0L5sl0Sd `d(000 80L50P5?T5V> X5-0$0B0^ Ӏ1`@R$@@B!!@H0 000L 00*A1880S 0) 0 0d PWt P1RQڨ0QUڜ l 0 0S Pi*19k90S 0) 0 00S0 3 Q0S0QQ'` :0 0S| |Pdj*0t:9:0S aZ0* 0 0 Q0S Q0S  Q0S-(Q\KQK H R0P;0T  E~0 ppV aF!` . R  ` dQ0S72 ^Q0Sb]<Q| VQ0S PQ0S JQ0SH  8%L < @%DL<0,5S0SO p t,l000h<0,5<0(5H000/85L0<%0/@5D%4*F0<<0S 0, 0 0=0S (=0S(4M*(0D=P=0S 0dmh 0,= P: P5= 0S= @PL Z p I@TW.  @?00@1>0A@O@@̤P.P\7  H,@٠|>P* ^ P;0.00 0 S 1 >5> > 帠>p岠WP?ppX ? !00@DT@8 H4L0d Lc B b"30x@`P Y( 0S  8 H4L0d @ B b"30C60S  6p00_|Pp6{@ 4T6PH ,Y08& 5000(60S 1S DP 6 5 @{Q U @ 0`P@@  04 8 <%c#!$c4"t%S T50S \=XP 0 0 I ``0  0 04 8 0F M*/ `@0V @:@ p?0`F00@D@0+ B\ЍO3* j ( J2tJ\%2R/C-=@SM|QPG PV PV.*10S J10S0 L5as0倀Sp NC0S  00 X0S s 4C0S h ?># $ $0 \# 0$$ 48$( <@$ DL H$C0 5L5s0P500ߍTƆ(((0 \P/Q/ 0   Lq,PŒPŃ ,w)TPD40S/8$0G-0DP(4 40S1 40S- T0SC 3`3 30SA=S> 9S*B)3`30S 0P 0S`dSTShPsbPUU00Q AP 0S ??@<CAP`"hR0"00S8 lr003Pb0S* x90S* 0R0E>0*X4( 2p610S ^W0 00SIXP10S I 1TQ `1*(X1` H10S 1*0 0H10S <dI (1P 0*(0`00S 0t 000S d0P`] 0i 0xGu(((((((('(((((8(`((`E0(,(=[wZ (($(((ЇO-PPMLp8 R8B@0S 0(3 ?P00@TaVa` 0 SQɑY\  \P  ?` T ? v0 EA,",2 0Ri Si r0S 3S !02? 00S  00S`0 S  0`Up!Ϡ0008 L3R 25  B # R#  B ` 0Q" P*'0`00S ` ` `Ѝ 0_S  $  B$ $ R$  B  (((T$(`(((U Jw(((A-Pph0``ATR <@P<G0S @ M@1p0A(<0 0 1S01/ 0S00/(`0 5 /H0P 3S P 3S P///(^FPO-0(P,p0@4`8 P P0P \ 0 S   0 0 0  0P  0S L0 w0 0 00 0 0 (((Q 0`( "4`#/O-`@8 0P1 008Q ЍS@pd8Q Q 00$ 0pሀቐp̻  0` RP/! 0 P  C1  1 @-넻 0` xRo/ 10#/C!000P/@-눻 0` |R  /  /C! C!/! !/@-y댻 0` |R  /  /C! C!/! !/@-S됻 O-$5SX@  lPphU00 `1X 0000$ p  @R ![ 10 <T+EP 1C0 2 @ @Dό R&p@PP U P W@T @ Ѝ \00@0 0S0 B0G-`RM@Xr )PP dP`T `lP P9  ,p ?0S  Nߍ<0H(00,0 00004008004004 04$0D0(0P ϐW[  pU lp* `\吆` 8 #> 8Yl ,l  l l l 0,0yl0 ul `= Np 0`?`a8SPb 0  0**0P0 ) 0* (d@edA?zd@ň3WhzA-@Mp`;@@ lp@ݍ P@00@T00 ## O-`M$MpP`P"NX1 b: S/+0P  rR >00pPP W UP 0C P"V⭹HR V  V9PN P P W\1` 0`PIX1: S<V2"偹N rPpUPV9 >PW002`` 0!$d $PPx P5c>0S 3]`P S R SpP`-pP ``!\1 S R UPk`x!|0#PaY $PtRpUd( FLPP X ND% ܍$ЍIgggF F F@00S0`( "4`#/(G-pT1P0@0ʟ 0 " X 3#15`05à121 R0` !Ppp0a0!R00S! GD% 0%# 0!ZXl000Z T00!ǁ8P,0((((8(v( 00S/I(O-,Mp0`P@အ0V000,Ѝ00 ?U0$p$0 0000 P$0S a?600 0 P0 T0SpP8P|p(^F(_{*qR/CG-P `$ 0p@V` 0@`` V`@&!D( `G-@0 4Pp8 X00000`0 8#8$#48#8X00P a 00 "% ?Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@40P/ Q\/O-@Pp02#U 1!6 `R ` J U c9# S!V Q V3  P! I` P0 c9# S V!Q V3  P 0  P$ ` U 0 Ѝ見> J 0A-1àQ`P x0x xxD60Sp@@ P$` pFQL @ @PQ0࠱@見N } p@-@P40S:a80Sd0d dd60C800S   0,00PP80Sp0 a , 2 ,0S/`0@-0@  L>, 0,0080S 0  50@(2u ,0@-S ,0, ,,5@TP @K  O-dMPpU`@@ U0!@3 @#81S41@D2s2@Ds1@DS@D50  0 00P# U0#03?^[[UZ]@D `0P00@5Q 8O000 ᛏD 0XR @["!$"!L0<p(08p$0 0H(0 0 `,0`4  0 4$T5HP 00 0PT40  (00X"P  0IJ,05S00SUSP3S` 4$`UQ 06 008D040  T 0S ,( PQ S RPQs@ P&Zzd@xGR Y"ѐ 9OlO-P@p`,M$P"p)$0S0$020S($3pL P V 00B 0P0P 0 0K fP AP PP XpP$p,Ѝ`P 0`P ,0 ?o  0v0 00  0 ` p| 0Pqp Hp UMp`̑&ґT UG-@pPT!vp`:D10S:  p o09 6X $$ /@p+ P%W00S $$ /0p YPPU `fV rV GT P$$ / p$y&7Tph  @-  o A-@P`pP 40\ X媬T  @@夬 0U  A噬 Ak؆& (P/00#01"$#ꀿ O-P@U \  p耟蠟 U@00P`6 [ `` `7 V `V*!ƌʠ?,͇Q`V*  Q*`V*?!Ì?G- 0 @,a,q@P^ \ ^0᳀ 0S@ 0S@ 0S0@@0\# ?\CTムა :^ *$5@0C6;007;00@R0@U^(PO-0P$`q@P 0㘹z'0 0%Q P ᵇ@ Ѝ eP-@-0  Ѝ Ѝ/4A-0 P@$ 咁p'`0 0Z%QP Ѝ P404ʒA- R0Ѝ耟P@ jP0`p 0S 0SS0S$$7# BS 0S $ ( `  H P`$0 ( `ꈝ--@-00@=/T 0 Ѝ@ Ѝ/-@-P 4(倪 a 8Ѝ Ѝ/O-MP`7@PЍ & Pp zP 4S  0HT0Pp$#*Q$ P 0S 4S $PX 4P S $ ὆SpH0!!`000 0 0  @ 03P 000 00 0 0 "P p1 T`嘖&P$(0,p 0p$S4pS 0  p" | L0 `0p"Pb 00P0S5=)MqFPO-$M@ХpxPP? 2R 4S  00$Ѝ0 mQ Q0   RSRQ"  "S 0$c000 00 P 0P4S 0S,  0B0 000 P0 r0P0 <00SS PẐX   0 0`S4S 0$R V P0 RS 0  0000P\ H0H 0000 0   H;pFUՓ,6HO-P$M`ppHL>@PL.@P0C$4d%t(, 0840; оpd`c-0 S; `p 4044s p +pp -fp@ H4* R9 : S$$4SB. Vp $4Sc(d,T0 B. Cp (d,T0 $$0 &P0p % 0l?$tW|(d,T04$t0dT 0f& (d,T  0p"4S   0  0p4 $  | J΃p J\mk 0P PFp  0Pp P KP' 0" RpP5:$Ѝ0 S0gp 000$0. |,0S*+"i/` "xʔ֔d@d@5KȕՕ @-@P 4B BRP yp 84   Ѝ@Ѝd@4S@-@Pp P Pi4PS 4 虖ƖA- PpP0T@ `|0X0 v4 Fp( @p$$@-#3$ QEAS$0Ŷ 8#8"(Ѹ0 / 0T 00 /$4 0T0 / $4 0T0 /G-`P@Pp 0+PQ%&P㬐`0`00 00噧PU:Ѝ 1 00X0L@0`刧P1 00, PU\ Sq]؆&r C$$0A@-$P@- x`R@dЍpP P 4 R 0 ꈝ-O-Pp_o!R0`@tMR(0S00S "R0k U tЍP PU 0SGQD (0QS@!RS R7"R S R.A 40[ 1P#  7/p ' 7/p 40 P m0 $8N  %P P  P ėA-@pP`~P 5/p 4 5/p 4 jԗC-(00pS4P Ѝ$d@ 0 $  0d` 0#0  0 `WP ޗ+O- 0 0pPÄ@ᄐT  y%P Z @` 0 墄@ꈝ-V _p@-P@`0 健@Tp {O-Pp؀ $M`@0吰     Q  t0 p ` X0 T p`04S0 j f$Ѝ q'O-PQ@04p 00` ЍP P0S*  E  `P0       04 p p#p p04pp  dꐘژ0s@-S`@ Pb0 KRP: pЍp%   iQ000 BR00P0S ꈝ-s@-`V@PW)`l` b0 ?o2R0S F)0SB)00 Ѝp舝-@- iR sR aR p`  p@-P@`P (`Pp Pp舝-6p@-@T 40`PPpp舝-QiR@-- 0 aR bR LR( sR% tR@%P 0nP0S`00dp`(a0 0u-c p@-M`@P`ᦴP0 0͵0,0S  㮣ЍpqG-Q@PM Q  ЍA~␀ p$6`P p4hB~00 0 `PP Nꖙ<ЙO-$M@`HP ,`$ЍPP 0 0 0 $ Y># P0*^#Q P0 0?Y S0STP pY0 P pE00 PU 0pop $ ~P 000 00 ppP 4  &\$  0V,S( 0 `$4 80p| Ĕ$%!#,[PP T P R*L0Sh 0p_ L004 0 000 0PM 4$$  & 4  !4 "4 $@p7 6Tn5=00S 0@-@C^M E$E$$0  0-P-Ѝ0 @x("(!ᥢ"`#XT 80 f @嗢P8唢& ڛ4Rfpy0$ 8O-`DMPp4 %1币<0!zp 0S& ! R"!DЍLRR a0BSS0H10S  4""P $@P   :~@ }|P䰟 ~ T V0 K0@  T D@0  @P@pꨜ$ ̜&i-0Y8 (&QA-p`(P@Q}P0 p!`P @00 0$0@-@P$0S r~@o~O-20SK@0SD00h@ DP 0SD0SA \^<40$ 400#qpp, 804<0UP$ 0I,0 ( P bU@qU PH04 83pPTЍ0$$ $(`Vp0Y`0X0 0000 WX0 0 0S$ (0 [ Po$0 0(000qpp 0 QP Р 0Z%p , G(p p  $ ~& | ٣O-CLM` I@$P0$0\%FpP50S @-LЍqP sP @0p0$  0'qpp PP`0$0I$$.0P00P 0 0 0 00`0N0P(0  0 0(0 040>P 7P 4  0,0$000* & 4PS,00 VU$0StP0T ᒃ!088 X : U S  0  <0_P<0 (, S0 R S ,0, S00,0pU000U0   00R 0 00S[W0[ 4SX 4SU $0S  4pW4 P4\ ` 4 "$P0 0S 004 g< 4  !4 "$0 S40H0L p 401ST>0 S 0P 0T 00S!Q` V$NP$ a@ P PTpT T  0$ЍP` & iO-P$4TM⓲(0@xp  D2`@"@ |0P|`TЍ ŸV 0  ;`ꀠ @000 0 01R0 0|ͩP @P0| 0C`d!`10$0d1 @0B0P0@000S+0"+ /0YQ Y 0  0$ 员0P|  V# `F0,0( yw,0 Z 0( 00S$EK%U /0@P0@YT Y CNGqUC-\MP0  Rpx`| )X%0KP00͵@ @    0 04@P 0 ,吘0S 劘 F\Ѝq]@-0@ n00 0& 0 @ЍpP `00CS`0p S00 P0S X0X /X┙(&3S @-xMm0 $8|@7v@ T -vxЍ/fC-p2M`PqP0HЍC,0 0'($p XV pNI !80pp0 0 P  @08 0@XWF QX9T 3S   PPpt8m0 $ PΗ 0p UU Ѝ00  ppP嶗1S1StЍC觗2XQX  P垗 |pͦצrqE p@-@`MMPဗ } z4S tt0S do  , 00CS 0(!80)Z܍Ѝp!0O0 0 BP :0 P |-# BX$@P @s)7pFPAP̧O-YM MPi @($ $ $  " 4 $00 p30@0 00c0T   n l Z ֖   ]  0h# 0X#FFP 80 $嵖0Si3#Fy F?⨖F? 壖"埖0$ 0!  <#`6P( ⊖ 0"S $ 0 !h#d|[ 0000 P ,n m0 $8 0 b ^# f}!@h  @TYލ Ѝ F?dCH!0F p;  [ 000080 P |P3 0  0 RC2A0 A0A003#0#  0S 0CS 080T 0 P u0F `0fGNqxFPp~,(s(Uǧק-C-MMPp9@T XݍЍ0S@ `  6 廕 Pp 0$$ Pp 0$$0 r0  msP ,唕x 0 [l匕m0 $8P儕L傕#@  (FPp.̧ܧO-`0 p@lM"``  $f|pPZhPI46( sX%XPOJxU`U HU& WU( AU p2lЍaPEUP@@rp h@@@@ @`@LZP V`ҧ000#  0 w0SP Vx0 V0 VP0=0 @ @430 S;P4   0S$00. $P 0S0S \^0PU  { 40>S1># p  SP P `@(VJ?X?#P?U`1?`# X3V`3!劔!冔YPWU (00  P pq00  P Df Q: ,]   P  P X1  P UP1`P00 0   PUOH",( =ʀ(&ht@ <( &NF b0fx-p@-HM@P`4 h  1D0!{p T  P 00S  0 TiR TR LR a0BST plRs0BLHЍpT Lp ¨Ϩ&Ԥ i b0@-$M` 0 0@P!!BdW*0LpW00:#:90ꀜS؀ߩ)@-@PTM TЍ@P`4  0@L000 xp 00S! 0 PP 0 wUR LR 6paBQX031,oTЍ80pp p &d, -R@-@09 8@(R@-@0Q  $  P(O-@P5Me0%=xp50S ЍO!0oS004\`PS $$RX5X%XTCPA r@T4^PP8 fP* Ƒ@P& ]m%0$0CS0\P P4 DP o_P0Sa [pP xBPf`f HCP  4|CP  vCP  pCP  jCP  dCP  ^CP  XCP  RCP  LCP  FCP  l@CP YdP  IP ZPY DP @] xDP px[ PCPU Mf"80xx CP P R2".BP  pmdPk O[P  p $ 02#W: ,؀C$dP W  WЍPP W00 *9P\0P 0 [P0$$OP+ 0et [PP dZP (0PP@e,0 @P $0 a pQ4 p`BP 4PM0P 4 Pk  & P000 00[00|000 0S$000,0ZP LZ0P(0 cPP f`P f$:jPP094 BP 4` P `P @ [@Pt H U@Pn @0 SD00H0$ RL0, 0`` 0 qp< R$4,, 0qp$0` ᶘ$4P `$$嫘$4P` V :Z`P% 6ZP! ]x&h,ZP cP |e`P |e8&? ` 0qpt p ?P-8po  ?P   ?P  ?P   ?P  $ ?P  T ?P q< ?P  $ ?P q/  ?P r ?P 01S 0r/S㲰s?+(Ѳ Ѱ  ?P s/ ?Pz$$$4P(ubP d`P d$$`0 (qpS/ p0|< @Pk <pP < <(< @P[ <P n?PP  h?PJ L b?PD 8< @P $ <8 (?P4 8 Y* 0^i$ Bp $ Pp$4`  0qpt$ W$4 (0 88\008$0 0(0$0 00,0 40P0,` 0$00P00T0(0@ X<`0$$qp|$$@$4P0 00H00L0`$4+` 0_qpf$$$4P`5&, -9T*Opjʭ  F Ю9+=UKI'2?NWbo}gd5=¯0@-@M P    ݝ NQp< <\ 4mp$T0Ѝ0@ 'i@-SM@P, 0 T  \ $ d l 4 @pt H0P0X0`0h0p0x0x00p0`0h00`0 0X0D0P0L`0|`p D Sߍi@/i;!iG@-@    0`( "4`#Ѝ10S/p@-!MPM@P% PA. (01P A!kAxP 0`0?oS c` 06P ``(0 0A. 00P0P A >Av݋0 0A. 00Pl0P AX XA\ŋ0P 000H4庋ލЍp((qS7\cp~s@-6PP g P ` "`@TЍpc P  00SUV  =@N X0 R !!O-M@ Pxpp"(`P"    WP- ZWP:WpP Zpx WP Z \|<P 0"h 0R00  p!  c<Pr 0SohQl @ pal QZ! R R RZ  0PW l Z X寲X (s<㦲W 0j0S, @ h嵖P@ `寖pd HQ L 40R !ys01Sp0S 3/p\ U 8 X吖p \ [ 5@ `僖p ЍX J+ð˰q հFP 6A-pU@P@%VPPUa`P WyV P VPm`@aT @- =P Ѝ*A-MP p:<@P00p`ЍpP   ⃛0 p !0  y=ܰi@-@p @A-P`UpP00]YP@?0`Y   Fw A-P`UpP00?YP@:?0BY   FY @-( ;P00 Ѝ$p@-8M@ P|;P 1 ! Q UP Y0 Q0s0S00XPP  U@_Dp Y  X< PU`_V8Ѝp=G h Fi@-@BMM   1p 0S 7  /  0((@0S700$0/ 0d (Ӝ(@0S BލЍ<a@ Y@iDZܱp@-xM`UPP XP@ VP0P P X   ,pЍp臱u Fi@-@M   pЍi@-M @:PC0 | p  1Q0r R08C84 1p`Ѝ=G ` Diis@-`Pp@ @@x:P0 M C@Ph吰W P@ Lㇰ@TP 4 SeЍp舲G k Dð7@- P@?pT TgLkT P@00 << 0400T@ Ѝ0z հֲDðJ+7@- P@p\ \@0H3@>T P40 00 T@ Ѝ0 հ˰Dp@-M`%TP 0P0ЍpWP@Uxb@Pd 0 D-p<8 P@ PP di/@-$MpSP 00$ЍTW`^b@Pp 0 XpLȯP@ P`@ p$¯dv<Qij@-B Ѝq w@-000 0  PᲓp `b@P㓯| ` @塓pl P0 R00bS zRdBU r屇Pxi ³FPs@-@`2PP  5p ]n0۳p@-` MP@USP V Ѝp P%    SV  PS@^]Dꌷvi 0@-,M@ P8P0   p,Ѝ0 0R0s0S 0 $0VPP  (^S@&]DG fDp@-P1p@`@@RPH0H HH [VQ P Ѯcp D@-T @8P 00Ѝ  p  Fd FP@-@-M T@z8PD0D DDO 08 0{ p$%dЍe{ G Di1@-M T@Y8PD0D DD. 08 0Z p$dЍ#~ G Di?0-M $00D P  XЍi/@-@0WR P$0$ $$R@ֲ Dð00@ P/a CRWC/A CR=C/@- 00@- M@  0( 0 p Ѝij@-PM  X@@Bn 80傣P0 0 9ЍP@  0@p%@-p0p( 0`P/ R/%0 O-4M@@!2T0(  Dpď, P(0$`!pSp D@T PoS@ڐAP`@ ptpP`[T000 [ 5  R  P Q R. 0S $P\(P  1/P j@0S  ☐p "SR(0 SL廬\ 2/P W0p(ɚ;6eXO-MMPp  U p`%㘬  IpP$ 0Y00$0 O-  ⏐p b p ₐp Q T处 @_ K p$(Q 哄$_X@T ⿕X00@0 0VPzL @0I 0姕 ,0@4@?p 0^0Pd0o 0P 40,@0p<e 44S`(H0S !P31DH0S;I0S8Z`@T 0 3/@: " ␗M0S:00!  l"儗M0S Tj@8 b@03/@t J6I0J/ϏpNI0!S㱫a`"%J` 1 0 d1 T|p 1 d\!1 Hȃ`@#%Jp!1 @ t1 x!|1  eP@Th 03/@ 03/ݍЍ ƶԶTia~i}r%i8iLf~p(` +i:N 'ҸݸO-@PpP  p &T uN@sNPT!N`P \PPU D1O0S 3Y1Y7ÀW P.Z  P' 6P! K0S 0 L0S 0M0S 0 N0SO0`S PPV 㺂 `۳ Xp(*&@-,MP@xpP NP`( B p0S h㖪 H$4P00< <努0 $|,Ѝ蹰(8i(X 8@-P@X0 PhJG-@oNPP0 `@ Y㔀QpQPP  ̐pp H H@@@_@by} k 2l(s@-@{4N@P00ЍpQPQŠ@P <` ̐P^u 뭼(s@-@Q N@P|0| |{QPmQᜠ@P T` 壐P^u( iЍpýy} x l(A-@"MPP0 `@JQFJN@y} l(@-@ \z3PP0P PPOL 0 S@@00 >00ЍG l(#؆&ʼ0@-M@MPzMP uMPppMP d0P P P P 4P>p RЍ0ýb(7i7@-@Cd iP HwDPw P! (m Ѝ0h@FP V)J A-M`@PK bppP"(    ~ p% (( pl"x <@T h8P.`2PP' RU TE Ѝ0 P]@r\@PϨ $@ތp 娎u 0R l)㯀 㭀` TphQp R%PP߀ 㛀mIP;ЍAm]Q\ 0Q    1 0PP0 RSY尀宀$ g0` R P U 0pD` P깰p 8i(i6F PWkQ U 'qJ wPp@-P`@KP V  L`P dV`aV 00p~KTpSVA-@T 00`PpP0 p @-MPP00Ѝ`0 00p0@ 0 P  O0P 0 p 0 `P0G-@(P00`(  P1r0Pp*0X!U0"R0 "00"SЍf=0P 0 , \p 0 @0@-@P U@ /O-`@pP,(0V0S 8ZP$P$P 40S 04S 0S(0p(`8P0S$0(P,\O-M00q W$0200Ѝ`QB QE 00 1PP0P XU =0P ,,k<,p4@[T /@P00 D0800X5T (]( R R["00[P 000 ⴴPs0"CQn BQj Qf^ 4!<5Xpp'YPPX Ჰ  $P Mph[WF 0  Ep? 0STt 1PPX0!{8!100#R0S X0m8\@  0YPpG@T 0CS0 0 xC0X0^ :T 0CS00wRxC 0 aD\W@DAD\ 7@D@S 0@0@D@ T030ZCM@ZTh l ~JPFTU8 @ 0 0 0`0$V4]  A-X Pp@`P00U80P 0 p 0 `P0O-P`$M@ HpnX) P W0  {Pp` 0p0  0p@ u- uFP(p@-P M@` QP0 aPp@@R Ѝpi@-< @l&P$0$ $ ЍG C p@-< @V&P$0$ $ ЍtG O p0@-MP "M⢀@PۍЍ0@JR P P+7P@;RۍЍ0@I0S0S1iS+@-T @]&P@0@ @@>I xp 倜ЍG [ Ap:@-T @?&PM<0< <   ZpbЍ"x G e pVO-`MM@ 40P4 lPgE7E/P<7U'S$0`0@ 0 0 @`F( 0RtP~ 0S0'V 0l9 0d90\9\ 0X90T90P90L9Vt(@!!0 P j0 /C BRZ  0  00=C$0Cȟ"!0``F ^v `E0800IcCP S@BAp48 0`P0p t!0h@"0(0(0SD s0$ P0B'S$0؍Ѝ 0 0'S   BS>C0C'S Q:dǟ"!! CR   ##9C0C"!% <'Sǟ"!2.Bǟ>C"" Ɵ"!/B Q 0*Sy S &S  2S% Sq 0S R )Sj&0C'S000S 0 t6H t0@s0( 0 B( @ R p&S vsX>-s R 0 0esp0S \s0S p0 Os00C!੐YP0  @P?sp <9s0S $ZA 04 8 <$S5#s0S 0sfs 0p W&q0,00pJx [p4#,003c10S1ׇ!Dr~Z,0Sb   ~] ,0, r3pG    #P# P# ß P# rKt#S0S  r0S,  hr'SPr0S <r84 p W0W"    0pr WLr0S 0lrX{rp 0 t <X0 0J,0[P20, p'"R 1 !f ,, Ur1H    !P! P! P! p;rhK  IS !Sxtplhd`\XTPLH <i6zb QzL(( $ xqFPTqVP PxJ kRP ."'@p N}"' -0@-M TP`p@@ OЍ01 d @i 0 /%/-@-@ M,00(000 P  Ѝ@Ѝ/0@?o21  @@@@0 -@-  OPKP ЍЍ/@-@8PH} 0S/@-(-@-  /P+P ЍЍ/-@-  !PP ЍЍ/@-\00S 0  0000 0 FOpЍ(-@-@{Hw{q{p0|~pp Rdp@-pMPP2 P0S 0@P 0 0 00 0XOp DlP@@ ((@,P0P4P8PS00!031 0@-Mt 09N@P \ߗ _JLPP @ (@@ 0&NP 020Ѝ0%3(@-@ ((p  `   p}mz؆&lP@-d0 !X !T@0 60\ (0000/ Ph0h@-`  !TD0 60\ ,00 00/ P-P040#^4<\$0000/ PD0 40#\00Q 00/00 P-H 0:# ^4 0Q$0000/ P-H 09# ^4 0Q$0000/ P 4 <# \,4Q00/00 P@- 0:# ^ 0Q0P@d0 :0# TDD#^<0\ ,00$00 x @- 0 00lP Ѝ3%A-Pp`@WЍ P 3MP@ p7@-P@U0  (⯀KK Ѝ0A-0@nS0oSp@ pP`\MP/K0nS0oSLPPLPP'V@- 0 -ol؆&O-M M0 0D@00 l0up0S SH H 00,00 噑eg< 9J`p@-@PSP (发0/Sp)p@ )@-E kjAg؆&O-`@ Pp(, 000 唐唰00 Pp0@DTq oP0 PxP<Mx9 O4ꀝ-&- 2@-M@A>0 0D@00 l0wtp0S SH  H 00,00 fG 9J`p@-@PȦP (0/Sp(p@(@-  f؆&G-`0@P $p堐0 *Pp00@DT oP0 dHxPPΐ9x  fA+UGꈝ-&x 2@-MM0An H 0P0 $@sp 墐gf롲p@-@PXP (唐0/Sp(p@(@-J piFf؆&O-P@M P0`TrP"Op)@20 R. +x   &  x `!p0 *00)0 &0_ 3tpM <uPfPMP- 9P GP p1g@PUP|0 0|00|0|00|00|00pt`x0 swPdwPZ,0p0Y00t0V 0;;0x0UEb$00|00|000Ѝ舝-R&z~ 2-MMJNP0 @PG00 |0sp0 `巏0 0N/0 4 s}0@000ggelL d7@-@P UF0Lo SϜ 0 偏 Ѝ0@-@90P@@-@/;0P@ @-@ 'F0S 00S0?  UЍp@-@PP (O0/Sp&p@&@-7@-40 0,0,0(0(0$00 0hd :؆&q7@-P @EP00S\ 0   Ѝ0p@-@ PX0 0(pхPP(Pdp@C(O-@H p0H ($$e %!Np50pGWQ. 42@FP40S  4 40S 4 0<007a08:l$0000000Dv0@90;glP04P 0Ic0(80@008 0uPPu0       +  @   ' B 0# R #  # R" , @ ( "  )            Pu20  |Hu0$000 X>u0 000 44u0$800 *u0<:00  u08:00 u0@900  u0,000 u000000Eu0909R41r0$000 0 0t0,0w0 0x00007000+ 14  Ѝ4%%-&@ ((( 2R()` %C-RMMIN@XPpD`p`00EL H㈑p$|L0ppM0KS 04  R< pL04I0 Rp@ 04n/`  0 {HP 00 0,PE0P.0D `P! D4le 4$04 0404040 40$4 0(40,4`044<$@TeRݍЍ'$$b(ALp 'VFp@-@PῢP (0/Sp{$p@w$ R R @-ތ/@0@-@MP`p 0o000 pPPЍ0P0 0 0p0 _o0P ḃs@-`/P0@00 6oP0 PЍp 0`( "4`#/s@-@P`w0 0Pd00SPPP @Z@X 0dЍp(6 ](002P0/0@-@CMP( P41010 0000000 0P '>C< 8xd H00Cߍ0Cߍ0@o꠆> 4G-0@`p8Pp6 8Ġ#̌ Ƞ,Ƞ D4$03 00n4<40 8h0e,b<0(000pE040p<0< Dp PH00ЍpHPD PG d(4_d`J }O-$M@0 lA`Pp0 @T .V0<00$Ѝ 03/ Z0p IAP P @0 ` 婂0P":@ 0 `  p00P LH0@3/pnP$A 0P 0T@Pp 0 0  c꠆S C-MM`p/  P@1L#Pd8$#4d4# N41@D0@@ 0@00 0|@p+ߍPHڀ@Td8$#Td%4(C-P[ 4M@@0P` :0P`P"Y  00h 0 AP  H"0< 0``00S0 V0S`0000 }pp  iPPQ8#0!D0D00V 0 000  P0b"!4b4#P0P4Ѝ 000<0X(A(0@-M 00@08 P  嗊0K댏Ѝ@-Q wcM` ؆&O-`@M$  00p 0@"@0"@0 "Ip20Q0CS |2g@xP0p00@0p A! 0 qP4qP 3PP(0S R   ჏P  x  1g!! H PP0S R  _P   XP ♌p n+jmp t 0[4S08pS @p @Ѝ耝-&\ -l 26Bi0@-M MC^P80@0 0DP(00 0lp 喉 0 a a a(m50P( la,30P , Ta0Laލ Ѝ04a(a꺲 7@-@P @0Lo SϜ 0 H Ѝ0@-@x30P@@-@40P@ @-@ ?0S 00S0?  Ѝp@-@PڞP (0/Sp p@  0`( "4`#/ p@-4"4 04"4 04"4 04"4@0P $(0 $( XXddhhllppttp p@-4"4 04"4P0 @ JGDDD>@@8HH2LLPPTTXX\|`\ `kp` pg p@bp@-`@"QUpf@p@-@PpA-P@M4Q->C->CBX?X\<\99>9>:>C?n:>CF 0? AC>}C>GmFEnFE~G 0X J~XpV  $$((,S>,}S>GmFHHLLPPTTXX\\O-@ ! 4"4!14"41 $$((,P,0`Pp0WС\5 S L5sT`0$ $ 0Q`V,zTvT`XrX\n\`k`dhdhehplalp^pt[txXx0[ O`LIpp$5S\5 Sp`0SP%@ Sز ,*%TU 0`( "4`#/0+P0 C@ /p@-0@R M4 @8 P#` 1R  0  ?<#΋ 0`x 0`0 C c00 d0`c C ca0b0 0 0 x \41P0p$Ss $$TGQT`P@UKl  00 ЍO St hhȀ5 XȐP.U&P,p,((U TTt0p@-0`S[\@ L00S000000B0E0p(%|0P000/000/B10B1/101/ +\\ )؆&O-TUM p dϠ 0@ `Ì0 150S  C0 R0S@w`Ѝ 0 R` ` b42 R ( ,((U G` %m؆&O-MMO⾟D`, i%5_Q0uPSi`50epet%?D0Shh,/nD? 0?D4hPp؍ߍ 2@ŒD 0L 04;20d04 0{0  00@4T@:T @:T @9T @ 9T @8T @8T@@048#80ze0`p 0 40S7{ 3 0 000p0  8`  'Z X &Z0 ``ao,F Ϡ ß\ ^/F222902?"""0Pa 2@őD L 00 /4;2ed 0d0"0 0 o 0p,2 0r 0` 0W8 dp`xSi`10dd `&!""#0ODD@HL05? 0 04s0hl 0@DE0 L04;d00 0@ `4 0<22229$,4( 0 02?  0@ 0@Dő L0 0/4;$0 dd 0ldh 0@ `Ì0 1m%(,(A%%o ((TO-)MM00=0?0,8(0d x<pW:l< 0 ; U 0P@P`P  < P@ 0  ;pc 0  ;Ep@ ;T@  {7[P@ * p7P (`0S0,5 Sx0<0(500; 0,%S00T:P:Q04< XU 0Q WMz* 0 04 0A W? 040A W6 0 4Q W- 00 Q* W$ 00Q(t W 004 QT WH9 @00T 0D\3SB<9\CpWXp9X0SW X0SS0$50 40bH00aL00BϠ850A<ŀϠ@5Dŀ0\P00\T0R380^S`R0001tW @4pᴟ 0RD8 a 2! Q S,QdS18$Q<4R:UW  @(8\5?>C0P4p3x00084%$0<0D0t@偟0|00匐XL5P5G   ?O8`F  ?H  ?b pu 8pG!PE0/0!"0 p p4%p8$``05<4RpD`VH466 84<00x$0$ 08pS_PS @%`@0 ?@`0啿PP* ?@P`(6#R0:`@0- 00 0$5SPQ0&" 0P0 ?00 1>00S`0 c2# S,Z Q Z3?00 1>!00 ^  BB0:Pp0/2"0$ 0$ ?&Wp1Wp#T0p10G 0K  ?yPPB@TP` 0P똀 00B1  B1 R ` U"B !!0 R0CQE0E ?PL0 p߾똀 0 1 B0S0`0US0  B110S VVb @P`x1@ G084<ĔCPp0S84<Ą-0$5BPS,pQɑRB@L0 0 000020S|0p ?HL404P@0 @x1 pp'Feaq@00" Q4X}L1\5?>C0P奁%4tx0]0(0#T a2!, A3 31 0 @`0$(%%((7c(":({(%((( (^F>Q(((( ((&ht@&(9a%,((TT(U 04 p  0H$4  E$ ( B, @%LV.  R*h r <  X ! \ ! ?.@Xt@+@B@A.@B,-8 Hu ph @40K pI0 ,p B8d i A YZQ 0 .0 XZ R A  pW?΄$t<4Qï80P@D04 0H4(0Āp 2 R 5#< 523pr0S8z   3 00 d AQ\ a6Pa`,PXT `4뼐@ 롆 30@0P 8帜 0,kT 00 SP0\#P !0@P` @4`夾p0 Q0Dm&P0S:dD Rt7T TP0 똤@t j0JF 0rK0`0S 40S< 0 #(; N(0+V. $50S  ] 0=S,Q0S10$05H@ p _PP04SP0 0R0 S00C0> S< 0,00P0 F 0,0S8< p开8嘥ȿ+" < Q \%T`R 0  ᐡ, 400@(0 0 @DU, @4Aߛ6, @R40 `0```0T0(g 0 p7 I `0 P$5P'S`0 9pR8<00 t x00Sx0x 0\0  1`0  B1$%R' R0C00h0$l`0 R#00B1d0 R*0f%0U` p 0 0 0 (0 0C 0(0(0 S l8`R`  $%R0 l ! `8 p  R2dM 8RT T   9P%QXԐ R, d0 0   , "  8 @ q`Q +H0DH ,pP+H! H0H 0S ,00C."d\ ^  00 0?d B2 b<10 *2R$01=S,00CU 5q010T0010X0 004+8S\0?0  0  B  R\ ?0  ` 00C 0  80 C  0C1448000C ST00C@ p`48 QT* B!44 T: $5Sl0 @0h pp^:S $%S0! !L`$p$p(0W|0S ,4 S d,04  0,4 $[ 00`  Vj0S   0帀0 X#` x0} X\># P 0?d @ `0 <u (>\%R 4n0SPL Q``ƌ` $$S >`R`  $%R0l ! ` p   R2d ?RT T  (?P%QXԐ R( d0 0@ =  7(   8 @  x5R` /  `@$  $ ppS $S00S0@Pl倐HF~P00@a8p`0x1XᐤpYU0IX!@@dl00@0T: 5@$\4Q 0@08(0 / (0d0O@ 0NN nC 01p0Sڜ30S0 000S.P08CTC X3 RP0ł."\5(S 00 0 d 0/ @ `.3,00 $ P0000P0S 0,00C0S0 20S P0S AP\20S 0 4P00@Pl:h*0EXP20S EA C 10S303040404 0#pCVW*xV.PaV.GV0S  h10 PSX1\5=S,81?^ E?O0 0S 04 g dLĒH 0@ `Ì014 ,$0S0S 04 O d ,04 0[ 04[)ݍЍSngU ,(T(Q qW2(`%x((8 (G-`RM@Xr wPP dwP`T `P P9  ,[p c0S   -ߍ<0H(00,0 00004008004004 04$0D0(0P %W[  j[pU ld[p* `Jw\N` 8  8 ,I  E A = 0,070 3 ` [p 0`?`a8S~fPb 0  0**0P0a ⑾ 0* (d@edA?zd@ň3WhzA-@Mp`;@@ *ep@ݍ P@00@vYT00 ## p@-@P~P (v0/Sp:p@6R/GG-P `$ 0pᛷ@V` 0㔷@`` V`@&!D( `G-@0 4Pp X00000`0 8#8$#48#8X00P a 00 "% ?Ѝ :^FF^: p@-@P`    pp@-`@P ((UX0 c#!$c4"X0pA- P 0U$PP(,`0p4@*^ :^0 *^*X@O-4MX0p0\00``P0 0,Z , 0S P 0 umS2aSMS ASB0C0`b0CX S0SSU0@0 0DT dS$ 09R "P T 0U8$UQUDT P 0 sS@ @ @U00 @@@ X 00 p Pu0S00 0 004 00P4Ѝ%D g@-9( $_N/K؆&V$ 0@- @   D G-@0Pv t``PE0 00000BoH0UB?E ᴀ((P0  /PPP\!1cQ\\/p@-TPL`(FV@ d0 P 6V0@ \0<@p(0P  C @- t co`/ &s@-@PH` 008(V @ tЍph(( As@-PX00S@H0`ă5#040<(V @ tЍpd(h(( `h10 PS/C-TQ@@MPM`6`@f$a 1p P09 0 T:@6S0O@  DD6ۍЍC+ 0P \ 010 S a8!#4a4# 0^ P;0T 0+ۍЍd((h((l( G-DB` p&PP " 6t 0F040( 206# R 0 ! t0 60 0 !t0006&0>06 0  B 00C0( 6V0:`! `Vp 0$&0? 0(0 6 C c0 0 &$&?Ҵ0`L0V&S %0: S _0d  &ЍG(< (((@ %A-Xa00S FT:p&&PP  0 0A1S0Se( P @D A01 S  rs0S @2106&0;(0& 00C00&101 00C 00(E O-P`CM(H(W?O8fK  tP>U㰐Y   0@p00K @6 0k 6vppG  v|;K?od2 Ǡ R`$0000$r g2 WQ Q  B@ခ@ 00T P=p0 Q 3cQ010!$0B ᒩ , =0UC, 00 40 ,0P,00 4 L Q 0  0 p$ F 0圜,00 0  6 v< 0(0,(200UH,0000@\ P,   D`04 0H\ d0 $4LPuVV 0T0;0<X5A&<0Si XO%;PU P]  ͹0L VR0400& \p#  @ \ 110B0f0F0&aPeeC0CP!Pp\p :$P0  ` 0HZ0C `$00SG 0j 00S ,!*&A 7 (8 J) 0 ( "*J 6 !"0H& 0 09SPpD YH&X0S^d9 R0J0qL  X&' d  rP &X p \ ,p0&s0&$0#0  0vSsp0C 0 0 V0( " B("( 0& 0 `rT BR'0 Xx0Sw 0Sv00(8(@ p ^UPPYP 0R SIq So `P0S 嫿7L R d0 P# 0pDu'oru+U&0# 0H&哥*6 B6  0 2`D 64w0CU 00C0CS : B6! S/~`?0S0  C02#8&0Hx`0 0Z 0:Z0G:,u3006   0(01 0@ 0 K:U2  060 5&*t(6ZC:ؤ0USL0S d0 JP V8ڨ40S X-P6! !!0!!!0 S#$0 ᓲ"  $0d0$&S: 060& 0u0.9HH 0X5#0003 lHY0SMf`F`VI d30SA [HX H<3PUBL0S \08`0` ㊐ PP1 P# j36T6l0H0p0t0x0S086309Pp`Ho _` Gg jqX26SH0p0t0x0Sf&1 #?1#  0RP*d "y P0 l0KPPP!g 0v"`P!] "P  6p!dT!PU:< U+:0U: T$0 K$0 h℀%L0S^`UB: 6l(('p(Oh(z%%6(tx(%QNS(((`(/d(fL (&ht@&}aqQ W2A`*Z\ (%A%k R%((h(p0S :W": 0 H 6Pd 0P0 W %%* 哠 p001p1Po 1 !:P, `U&`81 6P!0U/0 h hmL0S `0  1#'$/%16RfH0lp0t0x0oR080&2l0P (@089 L2`ph2& 0h>0Df?o2U+ui&0#c6` c2H H0 HD\RCߍXFG-`RM@Xr nPP dLnP`T `P P9  ,WRp &0S  #ߍ<0H(00,0 00004008004004 04$0D0(0P PW[  -RpU l'Rp* ` n\` 8  8 ,      0,00  ` Qp 0`?`a8SA]Pb 0  0**0P0X T 0* (d@edA?zd@ň3WhzA-@Mp`;@@ [p@ݍ P@00@9PT00 ## @-`pi  @Pa00S0?0\ 0S 0 cmS\F\GL0 \ gL0 SDKT ЍE%KUJ%FZO%A_0 yt @-H D)F<<P4@0 ,PFU@B؆& A-p`P@P V0 myG-`RM@Xr UmPP dlP`T `BP P9  ,Qp 0S  z"ߍ<0H(00,0 00004008004004 04$0D0(0P W[  PpU lPp* `l\` 8 O 8 ,     0,00  `+ zPp 0`?`a8S[Pb 0  0**0P0/W  0* (d@edA?zd@ň3WhzA-@Mp`;@@ Zp@ݍ P@00@NT00 ## 0-<\   RS  0 S܍& 0 /)Q@-$ Q:);O-@M Mh 0Pd00h00X00|00p000 0\0$0l0(0t02000040<080H030<00404040F00G00H0040P0050%+<0p 0S00|0000000S00\?00H R00S <:t0S BPt/|0p 0l0- Sd0h 0>i/0*NpD @|0@ Sp001 DMP !p 0D@#qb@P\#NpD r}OP ( Tl0S 1 : S  R 5   Y`P`0z W`r`Foobr EPV   IP  DP@DH 3}pTrd0h 0 0d 0Dh0d0h QP  h0@ 0S@040x0 0P0T0@0`0,000$0 T0R0 T0R@00@00S@0S100 S0P00RS00 R0 R0S0P0z /д0P00a+a` pR  W 000SW 0`S`SV Z T @0S T0S2|0p 0?0 D0p| pcT *ppv @@0S ?X01?0#*@0bph T0S|*Yp_ TpZ 0dh[J U  U* >05[R[:\0Sd `!0SV PX` VU \0 0` V `DhIHP0 @$  0  , ` $ ( @ , T 0 P < x @ D04 0p`D&%Npe 2"okk`0dp?krp0ok|0k`p0 ደ0V0Q0S\xDU" U U T: U0S <(0S P0S0 0PPRD0(0 0S0S  T*,0 U00S,00,0<0S$ < 0Cx<0S* `t<0#SLn< $0R0$00S S \H0S H 0CH000 ,0R0,00 0S0`0 0R0 0R400 40R000X0S /X0PL04&+A `0PL0 LKpLroQM0P!* R8rl0S ݍ Ѝ0o ? C0 l0&3:pa`P flJ?C&9 0 S0|0| 0$02#ll0> U0000 0l 0H0 t30R08 0R000\0\0S0 U0@0$0Q #   t  004Q0tp0H0( S 040S d(0H H0 0p(0tn?0|$0X0S& U!0( R030"S 0R<00d h0 80< S Hp P < L((0<0 (0S U0( R00S~ $4 0$0 U000 @0,0 0#40*40`00 0 1@01T01P00 0$00(0x0,040303)00000 0(3 ?@1c4 04 v. 08#$0 #(#< 00&= ?Q p0QX0S000t0o0 00 R  PT p'?  D9Hp] P^ ( LP74 R ( 4R  R 0( S7071011l0( $R030#R03S 0$ |CൽQ`000S  0! UQ0R0( lR00S \G(0 00 25 010 0P B24 01(00(0S  PP 0`( "4`#/A-0 0P@:)؆&G-@P ` !>0P V0 0  PP G般pP`0( 0Pd0S 4d0 V )-s@-pP@ 0  N6X 0TT<LЍp P `>60 <)FP)@- 04$#$04GQ   < Ѝ EP@-$MP p y @1 00@ 0! 0<))<1 l<5\<5L<`APTV@D:$Ѝ<Ojvr(p@-8A0MP`  8 0 0 010R  4    "!0Ѝp@o<R  $    "!R  0S1$#$ 0("( 18#! 0Ѝp@E<0Ѝp) @-tFpc)P@- 0 R * 0 #  @0)P `00CS`0p S00 P0S X0X /X?=(&p@-`@P8!R#<10 <10 .810CS81V <1S 0 <1l0 hd`0Pp <10C <1$0 810S81)8&&؆& )O-@  07t1 t t*   <(8(P*@0C ~6K+ C | ?0#-S88<8xS`S?S DSg .@ Y 4 , 0BK+ 00CS00P)a0CS00   fPK 0@P: 0@0 |9 x90Sl9 00K )K @ Ӵ , @PK 0 $ PK. 7 K  ⶴ  #PK P 0K. 80  ✴ d @Puww D80S 7  ℴ   P]7'<07807407007,07(07$07 0707070707 070707076 T  `P-K PP 70Sh'0 0C!0R3 H70S0S K  @PPPh `'p$t0@Pp&  pt@@hP0X"T  0T\  |pW plS  0QSL0Q0P@}0 X\ D`X0D S@0S2 @DU1 PP PPK 0P@0 K. 6K>l%l 0 5@ट8@pP @ XHl 60S$0 0C!0R3 0S0S 0`0 P `0P c=0,C0 0 S;.0l0 5+ ;0  d0d0@  4ͧHS p 1 01 Q 1 \R \@?p@1cF0DH`X(p3 R  5  Z   t=Y   \0T0S 0D00D0. L0 SH00H0H P0S    sP0S* | 5  d aPcݍЍ 8    NPPA0S, P Ͳ  :P   -P ⴲ | !PP@d0S\X000+ ⛣rLD` j DX+*0**؆&R ۊ  a *\&h%q#&*՗Oc* Iy ! l,**gfff= L P mo 2i T MR  SJ       @-<00iS03S !t<KPo1** @-l@hr0\ 0 L @4 0   0 +5 = E N +@-`0@Px0 B0PU1 S2P T0p0S 0@ S<<  0,$pN4 ЍX&,**W $&\ C-PD1`0B8! Y!R!tM@p  10S *4 tЍ000iS00S 00S d `P 2W @ 0 i P %P000 p 0p3 W@000X&,**f &**\&{ `0@-@X0 B0@T1 S2@ 0P   0S X&,*G-lQ0S ``w @P 0S 48l4a4qP0 0@0C!R! 1S1 8Y TP`pȀА U0(@P 0E!0R30S u | X30S2 @TP`200 @$ *&  (*,* ** +O-0B$p 0Q0US `PP PP"2 @P0 D  0S= 0S: 0P5"  UE  (; V S 0S000C?oV20SP@Yw P`P30S  3x#0ES0000D30S ЍYN 0 X@00020S >P/0 2X0000  000S 0@@2 0 0@0010S P0 YQA 00 0X@^0000S X0000000S~ @0 0 n RT 0@s0S @ 0 @$ 0 r@WH00S 0 T,} D($24,*  * &  ؆&+ = Z +|  `1A-0S PP@`DqD T0 :41,a PU @T)$PWP@`0S 0D !0R3 P U 0S 0S  |1<P0S0S \0S < 1$s@*&  **+,*  0A-0S ]|P `p @T V @TL$@ 0S$p$00E`@*&$ +E O-!1 RR0夑S ,@P|q| 0P0: ЍS DP`P 0 <C O1000w PP@:SR  0:1 Q ]`P0pr0 000 w000**0*&^ 8* *   ؆&   2O-0S 0b0 N_#1P7pġP@*0pP00Y: P0 *@@ '8 W0: R0':,0 R S U :SR00W 030"S P 0000 S 0 SPhz \ X0000P@ Ѝ*& 8* *0*  ؆&C-MM@P Q0S @p T0:ۍЍ0S  0 BX000@T`PP@p0 , Y $  6000PU *&4  *% 0A-0S P`tp U0(o@TP` 0Q0F00S J@*&?  *X A-p`P@P /pEpDorP 0L0 0C?oR20S  P n ؆&  p@-/0@PΗ 0Pp SRp+@-8W 맳0S$0$ 0 0/{, *  ؆&A-`0p0O0000 SPڤ/0>+b P0 P<⇣P@O 0 0O0?+%+f&0@-@0 0!0@0Ѝs@-@P`P @TZ TTW/?0 00?+"+R  + 8ЍpF؆&$0L<S/ @-<P%+f&O-2@`VCM{ `qP@0DUCߍ貀TX B/̱0 S4((h ⴬j@0PS  b8"#4 b4#04!40010S 0S 0S0000崐{'{{g W:0000Y&*Ȑ0S 0 0S 0 000R*Q p`.0S H`X0S  ` *+8-+*&j~@-<D8p @,.PP80@0f& O-X3p0]MS DD:@c@C 800#0g-00RS #0\-)p"& gRPP "rUt.W 0"@-00RS[ 0"5-xph"lLgPP"L  Pp DDB@r<2P00SY : SVH`P ؀/0 +10L<aS$ آ< H @ 8( D `  P  \  `T  X  8P ,> .8!88hL/0>+b  P<P P c0?0H @P JhP)PD   -L P 9hPRP|]ߍ*&***f&L%+!?f&M j 8*+bxYt99t+؆&f &@-$@0 00: S8*G-@ q `0S+ 7P 00S *P0 S00P R HRڄ00S t^-  Y`xP 0 Y00:$00S $E- **؆& j G-AM`P@mpP00 040AލG/0 008/P1 00C 0  R+h X ,0 H 0 D jL %+mo 20؆&XA-MMp 00 0/R @`㜀GPP 0S P@ۍЍ D :B`D @P 0S ⨫P`%+ j p@-0@ @P P @p@-@06@ZO-3tM0 S ppl00RS\3 P3P#0LH+HC4#S<=88tЍO, d,$PL  @W   C,+?,p0@`00Y6آزL<` +L\0@ WI< h`VV#W@Pp ~L<0@'pi0PxSiScP 0'0@$ 000 f+L<0@ ``T|L QftЍ0 0C0\10S 0`S%0` S\5X5h0SS   3830dS X00`0\ d0P!c0 8+5*&***?f&f&؆&0%+***Dew*/ A-MpM`@PP 0ppJd!d5@P TTY+LMd < 0P+ۍЍ aD D< G5pPU44 U`k 4p0P )+6  x"+'0S 4p T0TP 8 + 8 [E؆& %+*8*1\@-3P@-L@4#S 0  50#S 0 @5f&0A-@P` 0 P0: 0lhp ?ؒ0@$a@00S$`V SR *f+* 0S 0 0/ R  /0S0 `0p@- P0@P*D` ?ធ0Pp UTp$/p *+0p@-P@ 0 P0: 0|Yx` ?z01S 0p@DI $ P\@P@ p$0 *+@-MPM@T 0``p/VVP   ZP @T@ۍЍVP @p@-/P6@P@p00/00@P 0S A-P/p\0@oC 0T@@DᡓZU pDP@D+G-pPᏧ`04PSps@P`0PP0C0 T`4 $D@+*G-頡FPTp AJ`Pt&0@(0C0V$Q@$0( 6S00v`PPEPP y2 @$@@(`/ᐚ 0`0 @ `P`S0P p0@0 P $C +*:\u@-@00$D +0@-S@ 0S 0S  0S 0 Pvs T` R 8dD0&F$ ЀP 0S00+p@-@`PP|D0S ? 0P0 @/Pᇦ~0P 0 00p O-2p0SlM ||x20SGh(PP P L(D0`000@(Q /*` R 0?*@aQf %1@ $10 %1 08`008<吜0@  p(hblЍ 0`0V@ 0 0/k 0` @T`$ 000 0 0($00S0,00S0(0 0S000$0S0400>@0 1S0 002@*&*L؆&9 *+***frC-20MS Yr 0P0 00;000Ѝ 1PP d `' X8 3P ۫4 $' $@0@D`P l1P « ' y11RQ rQS $0!SP P0hb$0 E1P \1L ! "H D10S0"(P 0 AD@(C@D\ ((00( CT( (0 P < "< 8 R"8 4 R"4 0 R"0 , R", tK R" *& *+mo ؆&#\K**m8*** 0`( "4`#//&y.'%%tU0@-0@MT[0Q@X0T L0LP H  'Ѝ0@Q@+I8*؆&0@-P '#8*؆&0@-Q 0@T0 R ||#0AS@ ЍH0 D2P֪( &`&0*+؆&h &m>A-D@p 0 0SP( ` `c `+OL0@-  Q0 0P ,0&# Ѝ+8*i؆&@-0xP 00S@%*S` z%P@` 40P , $  0&Ѝp+8*؆&0@-0@S 0$P B5/x00SP`P qpH0P@`Sj 0((@S&)# Ѝ*+*8*؆&p@-hPh@4S 0SP LL%H0P00080 4Sp.+8*=M *$+0s@-0@SP  40B3/p00S\0 /pH0P`@ 0((`%"Ѝp*+*8*\؆&p@-P,@P@p9P @ p@-X0XP0SpH`@P iP  "@p*h &+؆&A-P 1 a051q0S :p劙@P 00PUP'"ʤP%P 0%lt%PT 0H%000@A(c*+**(&0jN3 $%+C-paM! qX\ Xj% 0 00@! dX 0A0 \%08 !Q 讟 0"QN%/J%X. , FX ?% 0 00`  8X 1%8#`Rp000F"&%t F"%d00@ L)LЍ*&8*؆&*̧p*".KO-d@0EMSP8a  <<$0 @000T*0 ?o2Q03S 20S 2 T" $0S Eߍ0S{ 00p0"#0S 0"p! 0tP$V- V V: ]  B B B 0 0/"p0H0S  0彣P 0- 巣PO 0S; A7  B B B 0 0.!  B B B 0 0.@! V     V !p 00S S$0@^Y 2 0S  V     V p p ;\ L *&*gq h &r(< 0P/00S Y-h &+P O-5M M)$ `R P  50S@ލ Ѝ90dUY00@T  L500RSM <50SI,9S' 5 05%05# }EyNB _00 (4 S Bɴ@P$ʠc_B@9S4 B.|0T #Bhz@ T, V@30T 949m ~#0 w#ijB 0弰 B⊢Pq(4 S B? R  X3p H H#2\,R(@93B0 050Ȑ30s33P03Ȑs0 20S ) #\Ҿ00-40 S 0#|#R Q`SÝ\U J $ V4 "U  " 1 )a#0)90S 0)"(PU <10S1$10S 0 X `y 0W0) B?W00pBS @!W<1<0Ѽ "pWJBIBE`FVU //4S 04r*0 YB,I+M0**8*D؆&n*F^0H | 'z@h &**&6**rq 8*$+O-dCd5)SW0pW_`R00yu0SW  0PS9 S00P0S 0S 09 R ?oV20SJUMU5D R4 pGW`pVp``Ͻ\2 RD R: R; 4<Ľ820S>,P: %+ ᤋ909909 Ѝ0 ++"+R ! R  x!EUY0+5p`PlP d<!X (!`e v0S [ P !00 ?fqp V00S |X0S 906;#;S T%wE+X/+*h &*&؆&:8*Q*' *h0*8)+0O-'BM @R MxWtPP P P Bލ ЍDW0S870S ,,00P 70Si  "4h"42Յh҅004488<<HHLLὅẅ᷅xx|]|ច9^EᚅEᗅ:^EᓅE"4"42"4"42T%0A &&Z 0 0 8$$P30S` P [L 0  0#`0 0 0{20S  w20S620S l'J&P^u 0 g&g&Z 0 0 8g$d$20S 0 $m "`b0 0 01B&10S 403/  & & ~!P@Z00 0 X10S00S 0 0 8%%00S 0 %4\  03/Z 4   00%8*؆&*f&**+ 9\&L@Z8[[w+*/zq xY *#+\]+ + @-1M( 0  S != 1 1R 4S5 !4pq04'@0TaP/ P0S  R+* SR- P- !0 010000 QP 0PT 0$M "#P ЍPB0P;C0P|80S050 00K0 @ 0@0 08*8*T+ *f 9 K @-|cM0S llݶhChS0S YWP(0#0,, R0$ 2r 0500K Pr5"0C590C990C9000pPh|n x唶0S \2d"`2Q090 9@p`dP !W200 u00@020PS00C00@ Rp@T3 W+X( U U    ,  s 0. ]     c.0T HHp8(p Wꀆ&' `5+FPh5+I 0@-P03TM<0S @Q TЍ0@ 31Q0"0CS0"tGTЍ0@b h!0S SL 4  hX`"d0AS!0HN 0S0TЍ0@l$ = 7 3 /00P1P2P3P4P5PҖ0hP1 20345PfP# TЍ0@j@P=P(<P$; :9876 41jS$  $PPQ Q ( x]TЍ0`5+' ''T q'!(%!R!/(l A(z(>(K(X(f(:k(s(D.()(!)j-))!K)&!T)O-@`pR5O-\q 0M08@ D @CT Ѝ0ZЍOR`" 1!0  @@0Kp Y qPP  @@ 0 :p R Z ``0T 0CS08,$tB+B+z5!55560@-P@0,M 08PP 0 p,Ѝ0 P  /!! 0Q P0P~; 08Q( $5tB+P &H=PC6p@-`@0M 0(`` 0 p;Ѝp R  U/|P10 01SL0 D1S*NP !z$5tB+P &J P6O-DMhYp2 0S 0 000 (geP (P (0%"P`(` P@PDЍ`(P$PPv (  PP$0 XpDЍO(` 0v ( 0C$ S  .v%Pp㠱吡v00Y0S Y 0I00h!,,p1!0< 0( (`(Pv ( a (V((0$ 00 0 00 0 000  00 0$P 0 0$ 1SD"!!!! tB+X6$5 &`6C-M⬀p`` ([W0P0 0000 dPPQ ЍP@P- PP  PP 0pЍC 0R  6.0W400(00 P( 0SQP v0 Pp0!00(kP0Slp1SXE`D0S U 0: $6PX6$5tB+ &'6@-P@0,M0@PP0 7p,Ѝ R  -0 01Sx$7@P7 0/;` p7 0(;7 0"; 0$5tB+6O-lrMM 00`S@ UTPL c$P"-J@ $ Y:0@@  0Ep,oDٍЍP  p Y dT-@"QPX !4%*1 210T 1S1!T0 0*T 1!0 0*zP᷃0 D u u@ᧃ 0 D dtB+ !FPV66O-阋JM M`P@pዃ03<0元0`400c?c8000S0P0S@TK&1X0 + ;4 0@X蚟4S ЪU08 *0<: 00U0*:4 0@t:@#TRT 1S h  GRX:X1P W00  0 @( 03p0 ,s,s䩟 , s, s봩倀  , s, s넩  ,p s,p` sT  ,@ s,D0 s$  , s, s  ,s,sĨ  ,s,s딨  ,s,psd  ,P{s,h@ws4 , os,<ksX 0 (, ^s,Zs '4HQ /(, W`7$R [? 0WS; XQ;X PD0w4EH0 1HL00 1`00D0 pML0X 10@sX&4 0#Q0X00Cs 1SPlX0@s WG4 0BzWPE X.- XCS/H48pS ,r, 갠Z 0 R(0 R P P 0 0 0P3A8/ %00D0 Jލ ЍW@  RH 1 H0pH0S# 0 0 @3SoH   o8p$W"RY 0 00@0P0@3A4/4pGWpp 0 0 @3SP1R 0) 403001yP  0Cp 0040 [*Y 0 S P40Sr0 00   $ $  0`p`08ᛣ#0S P   B ( P R0X0,( 0P$0 ,( y$0H0 p0?  H0 p0.;㨀H0 H0ppH0 Sp HpP  H0p%W 0 0H0pH0pp Hp0pH@P0P p ppH0vp 0H lB+ &| qmo J &tB+`!6677VhP 0S 0S0 r0S  PFPBAgAHG+@-M @ PD$ۍ00 R   PFPHG+H- p3MM@PPYW3`8z|P $u|P L P 04d|P00 S 6P XP00 S * NP2  _t D`P` \2P T<|P ,pPP0 0U,00P` $0S嘻X J1!P J 5P 儻J1!@ Pp10S d 0{ 0p{PPPUX$ P᠀U 0 $V, )PnP`ZZE_oR 0PP|U  4S J P |,p- 0dTPA= FPAHG+A*AAf AA{ AAB؆&:BBZBO-@MM`;@.pp P @ p @0T @0Z:: 70S ލЍ0 0THPL `@P@(0HT*20Sa001!pZ0V90 ZVP Z.h@8{P0 @ZV㟹 0Z ;P lZ.M@ZoP Z.DZfP Z. |dedAHG+VBBQJ :B@-0`0 0,YPP e0@PL YP Ѝp@("P I Ѝp!Q 0 S C/p@-@PQyP`MyV pp@zpO-MH DP@0PL ЍBN`0P(40  40P00" 00S  804mU U U;`08H,0 yd6`08H,01`08H,00S`dp8U@,00@ 0S0R0S<0 0(06 P40`p 00(0Xj*0S` ?x7S00 7S00 7S0 d0 Sd707'07(070 d0V@40 @$@8@000Cs00;@0S 0TS$0[d 0Dt   0p p 0 ;h py h p#4B0`06F,0dnx(0B~S01(0,4PoH0S 0D SJ P?L0?X0<0S4 0S>` ?x d0(`p?o 0x0\0++ 0/ 5Y.E 0w 0 \ `80$ 080 00 0L00$0X0@ Bjp `5 0p0`hU p$?4 $;pG p E$?4 ;$x: p h0 (0td0009+`p5+ 0. $4-x00  0p ` ȟ 0w` 0w ,0`;0SR$0剤T 0[ჴ0S&  pdc 0p`h p $;p p 0@S$0 04$;x p x0p h``Ə 0Lw p0 Fw,0P0 0 @S$0 09w,000, | 80S$0T 0[4,00S@  p bh0 , p` pA 4pP$; p7 0S$0$ 04;x p*  $`p $$ 0. X1I-x0 0`!d0(X P $`p $$ 0- 0-- 0`S$0 ȯ 0v 0 v 0,vd0 (CD C[C}C Tɚ;,D5D D+DqD>DY@ID_dDnDDDDEE6E@-| TE؆&A-@p4S`  PT0DPEE$UX  xPV00 xP V0-04 P $3MDPE@DpG+ FPp@-P@Q0  0 pwP@ R 0S Ll#Pp 8Ng00 0, 0p$^# &v+E(#,E,,,E@-2800S ,0 0$p  >v+v+/K+G-XM0MS0 DpW,Q`@`$$Q0 jm+0A<P 0 0 YۍЍ0 000nS ?S aS ppS qS x0  <0 d050L00 8)w+w+Ev+E(&+E&lEF7FA-X`0S L00S 08P8@p0Pp00+v+w+w+@-@L0@T2@00Sl&,0, 0S00d&w+v+v+@#,L+C-RP`tM  4ş4@ !Q RP ğE R`S bu0t`FQ ğ;   T-P ׇ Ä CR ` 0S $ LGz 84\ P0@04ßQk [Q \Q< $Q  DR?` R @T$P \P" P!0 0^\0 1Np$@@$@ l  P\p\H 0P 0 P p00$0 R  "DQ"00" t 0Q "F0S 0QX ]Q \QQ0 00DS000S+e`tЍp1A$^? l0HQ pppDW\Q> $Q" 傀ಀ 0R㜁F p1 B!$Q, ltH R' DY  DR R DRڵQ 1 ~00,Q ]Q 0 $R p0 Q,Q ]Q B + 0R0F p1 B!$Qd lXH R_ pppDW{  DRw RQ =&&#,#,,,v+FPp@-@@P@T -|@| |P|`0Sh" `0 pXg@ P ,0< 8]$0@pp@ &Q v++(#,J ,GA-@P@p0S0P0`x0 R `C R0T @ 0S 4 P@` ,{+0w+ &9GP,EEP@-, 0 E(#,UGP@-, 0 9(#,{ P@-, 0 -(#,\GP@- , 0 0 (#,v+t,bGP@- , 0 0 (#,v+,GP@- m, 0 0 (#,v+,Gp@-PAM C0@ 000 0S0! *:P7 0S40=PP0 0T00aS` 0` 0R`T0 0 0@0S0@T@ @0 Q000S0&aAލpP, L0 P @4  9PGG<#,GG0#,,#,(#,GO-1M MP+ 84 1ݍ ЍP $9P @4@/ PZ30S cs؃ 4PPQ / 3P㜃堓0S0S `V~`30S5 0@P/ T30 083 0% (3($3Q0Q3@OoB0B &Q20S  2` 0gP0002`P0 0R R00 R K@P 42H"000 H 2 2QU2@OoB0% Qy10Su 1@#P0001@h, Jw 0 PA0S0X! ,`V pQ 0S 0S0 0@P+ 0! 0 00 00QQ0@OoB0p%Q|00S  d0@ 0P000<0@`(#,G+ K+v+v+0#,w+,#,<#,GGw+v+4#,GG-JMMPp 70@ 000 0S" 8P+ 0S(0<PP# T0  1 1 R0 0S0QW`3 t1 0Sh1h婏P* L1 @JލЍP @$! Y8PJW$Pw0S t@'00 R000S00 '|0p0P04qp P0ST00@G4#,,#,0#,,,v+H(#,GWP#,JH 0 0 0 0XP#,OHX3 0 0 0 0MP#,OHLG-KMMP* t2 KލЍP\"7P @<2@82000(rP 2 0S@2- P0 (qaЁ0S 0S 00 3@P -`1@0S p5PH1 \ 0PP 818!00,1 0,0S  P+ 0 0 000 T P _oR V&l0Q00S 0@0`P0 00`0@ \~(#,RH+P#,_H,,v+H K+v+v+ ,fH,#,4#,0#,OHLw+JHv+W@-PAMM V) 0 !@PP0 ` pF Ha p0 0pppp0+6P -AލЍ0S 0 `S(#,0v+HbHP#,OHL0P  /:P@-)0$ 00 i0(#,v+HHHPp@-o@P P `hP TP (pU ( P$0 0 =p:v+H0@- 0Hw+(#,P@-( $0 00S/0ҍ(#,0w+v+H0@- 0I{+(#,Pp@-0o0@PP  0S 0 娍0S P (0 0pP@`0P<)P 4P000 0D#,v+:@IPw+VIP4w+(#,I0@- Z 0lI0w+(#,0@- P 0yI{+(#,@-(@(0 E 00S 0 4w+I(#,D#,0@- 5 0Iw+(#,P00P0SA- %(0 !0ЍPAaq0S000+0S 0S1$000PPP00P ,_7`0H L0<\04A (#,8w+{+v+I:M+w+II0@- 0Jw+(#,0@- 0J,w+(#,P00P0Sp@- '0 0pP`P@YP# T0P 30P xl00?o2`SP@8 8 <00S000(#,v+:3J{+{+MJP00P0@-S k' 0 ЍP  =5P 0zPd00}S`00S T0Te0HhP 40 0, 0( 0(#,gJJ0w+v+xJJH, ,,0p@-PP00008@Ppp d*p@gP p@'2@0@ 0S 0t00#(#,{+Jv+ ,JJP00P0@-S & L0 ЍP 4 4P 0 P 0(#,GJH,@- P& @1 ЍpP,! 4P @1@*P0 P` /@P*0@0 S0 0S P xP l0 Q0S  L0@ 0mP000$0@(#,RH+ K+v+JH,w+@-Pu& 0 ЍP 0S t D4P 0S0T~P0@xP ,0 $ ,4P(#, KKKH,KC-`@ppPH_oR`nP=10S|1| ЍCGTPda8)& X1 ЍH5U@ 0 00 1"T:pX6(PPQ 0RPmpMy5|0@0 ^T |n0P``TT TU@T P7@P XP $0  ЍCR,,v+-K#K(#,L`KZK(KfK@-$MP% 2 $ЍPN0S!3P 0 1C,nP 00|S  7P yP 0tn@h1d@Y) PP @4QMoQP@- " $0 00S@=+(#,v+FMoQP@- " D0 <@0S l0S (#,v+@-0@-P000P0S s" L0 ЍP@ 42 @P@$ki rn(#,KMKp@- M PS" 1 ЍpP! %0P 0"p`1`U0S@1D0 0S 1(CP%P0 0S 0@T 0.%`AO@P i d@  U0@ Z0 @ 0@3/H0T 00S00%(#,Lv+TMiM|ML+ v+M+ @#,0@- 0M4#,(#,0@- 0M{+(#,PA-PPPPU㈀ !00P@lph0hPʆ00`0 @00YT,0P AY(#,0#,v+M#,#,7@-PA 0P00墆00 Ѝ0P!0P%0S0P 00^0@0S 0 S  @^@00+ThY0 S +<aY 0 1/P(#,,#,Mv+v+v+,,MP@-0oP P 00 0( 0$ 0(#,N0w+v+NOH, ,,P00P0Ss@-  0 Ѝp0` 0S P@P Ч0Q R   LF 0Ѝp@$Ѝp@9(#,,,v+HP#,O&OAOPp@- $0 p0@P0Pp(#,0w+qOA-P0 "0Ѝr0S2P70S10S 1岄@a0 ` W0封S Cb"c! !    c#A P0U0C00CS0<\# P?00CS0@8# P7 (!E-PS0#p00 P 0b" R  c&0P UR PE 00P0 0 Sp(0L0 0 S(#,|+v+vOw+OԐ+Ԑ+Ԁ+(&OOPP00P00@-SM  0 0Ѝ0Pl  ,P 0(qpP@ 0 $0$VU@00(#,Gv+:PP00P00@-SM 0 0Ѝ0P | ,P 0)qp L0@0P) 0, 0S 0000(#,Gv+CPP@- 0 P(#,IPNP@- (0@P0 @Lv+VPP00P0A-S쀟 00ЍP  U,P 0/`P PPP 0RPoe@le@@-p cV D+V 'V00(#,G`KQ P00P0O-SM  9 0 ЍP  ,P Q @P@ 0R@*e`-|0P 0 V0hph`h@Ѐ0000 0<0 8H(#,G`KD#,P#,0w+OHJHPp@- 0 0p`@PP xP hP@)p H H080 0-0@(#,Pv P{+{+v+PA-p`P@Pd0 A\P 00<-4 0 RU Av+P0w+P@- PP   R Ѝ@P   HR  @0S00 Ѝ@`p(#,PP &v+q0A-p`P0 AeP@PLp @AP 00 00(#,v+PPPp@-E H0 p@00Sp@000Q0$@$P0RPp(#,,,v+Q0w+5Q0@Sp@-% `0 pX00Sp@H0H10<@PP0,0Pp+(#,,,v+:Q0w+gQlQ @Rp@- h0 p` Rp@P0P  D@P0P ,Pp (#,,,v+tQ0w+QQO-MMPPQ  3 ٍЍPʴ#EE*P c@3pY 3  )eP`@)LT0p㓄( @0S (30@ @c0S000p`J2囁2`0S@$S \S0@0# 0!|"  0  @#"00B   BR 0 F )b]T0 [c`0S@iR0@S 0 F)bIT0Gc`P1N d1 0S x10SL1h`10S ,0700CS0.  E T0 03/00S 0S 000CS0 S0  )tSr00000h0 Y 0pS7 (#,OԐ+|+v+S+&v+TMiMv+M0w+v+w+@-@P 00P 00P00 -h0lM mX00S hH 0d P000p }w+v+Sv+N+-lMMT00S hD 0d P,00p ] v+6Sv+N+A-@P p0 0C0S13ib `.IP@ 0 B RQ@  0 0C0S13p@-`@P:qXP , 0S!PR x,p@l,*`(P %UXP00 0,]S!0RPSW7YSp@-@P K00PU b  gPp<00p@-`Pp@0P< 0A.0Sp h0 S̢ Ѝ00S 0C @P2{+dSP/0S/0@-@Q0%Q#0S P   R   07W0C2007W  B&G-pP(P SR@  GHPP0   >HPN0 0010S / WPe )`@WP 0PS $2` P):`WP P)P :qWPP000S`UK ⼠0S 00S1 @RđR0 d TGP0 0 U ))) 0 011 .Ѝ @Pi) `Q 0S000z) 0S S St0 0S 0`S@h)H0PU _),P}SSS{+SSSw+j w+q - BR0 R  P R O-@M M pPE$@mGP0DHLP0(,$00D (0p0,0DHL` 0 0S 0S X 0So@DDHL`0$(0 0,0`ލ ЍP0V0 0S ;S@P ` P PP @P4C $>000S V PU@ /SV@0S  1QP @0U0C?o20S b4pWp 00C00p0Tp pW DQpPpUP 0S Q0P00$ 0R 0600'fE+ PZ0<03 0 048)3 t30S6Zl# d[(@U0P0 $3@@P(:U0P@ 0 @D(0`0 @i0 `0PPy P00@tPS 6(P Y0@ 0'T00STeU 0S} W +XP+XKP+XGPXP+ vP0!0 4Pp80L YA+ P0dPE>0000:P1@@DcT@@/U0P  00+P 0DP 08 04@ 0R 0S10}S?}0S @0S 0S@0P/RP0Y8<00 @SWSST TT>T j w+^Tv+{+ w+ eTH,bHDw+w+_H`R(#,q#؆&T@w+O-jMMp@lTtQx|Vύ<84PLH0 !0PP0A6M0 0)p7 4A='H8:'(N0 0 )00 ZQ /x=0S-@=P R(  @+0 R`p_P;0Y 00|SU pL0Sx;0Gl ټYM X-= < T(! k,N;`0S00  U :* 0S 00S 0Pz 0Sw +&p]G`P` 0S :PPS]X :HND`PW Ώ`0SU 0S[ +0 0 P#P %SP  0h![/0d1`1\10A?W/p h10\1S 0S dAT! 0S @^P 0 .Wg0 0J⺜0S 00S P `f%dMMMύW0004!$ 8!e0 @!0R PP000b`800$10e/10]`P VLcc00 $P|P|0S0 $ܝki]U`P@Tt  p 0m_0pP7/iRP80S PPlm/Ż@P'TM @M00S $m?/  80S00?o 2#PP0 P60S P 0S%P 1S%h6hFpVX]P@3H)DrM<6046P 00@T a\ haP 00@T R\ YaP 00PR \P`xEtP<d|]'(P<60S)`@T+ V   %PT[_0 0 . 2 @R N_0"0C?o2? G_"0 "0Ao0 S ;S0 `ZP 0 R RT 0SD0S(0?0'"( ,0 R /  T @/!ᄗP 0r@"RD 0 #PP#PP0S0S80S#@P <厷(P000/R0HL0$/ 0 pwx'x\ XIpX\ d `^`Pd #P U   R90S 90S9yP $,P0S @DTp90S |Y~~0 0S( PZ0S= S E#[9 9`00S0T0S> sPr$J  $P@ D YPP Uc e`:0SeX: Q `* Q0: %U:# O :R.sr . 0A3/@Pp(;@8 @; R0 X;Qp;@+0 0 S %le#p a"t]!xY "0S,< 0R.MRqAo0S 張000S 嵵000S 宵000S 姵00jލЍ0S 03/0S 啵00s@- P@>P  >P0P MЍp嶒`P  =P 0 FUpEP Ѝp@s 0S S0S  =0PPSSSS[Q0@-Mh 00P P10S 0S00 0 Ѝ, qQa @T0 S 00S 0s 0 :LP 0 S000Bp@ T d9XP 0|S 00 0S00 0000{+v+ | N+{+@w+A-` M@p G000@00PV0P/S:S XV@P xG <@Gp$ (nG/@I@P/:IpP S@៴P  Ѝ@/000p0 @@PW@p00l0@@DcT@@0-0@0CcS1S@rR j sRS(#,PP00/@-j\ (0@  000_\@w+P+@-Y\ t0@ d00S X0 0Pp <0000S ;\@w+v+v+/P+@-2\@`00S T0 0Lp 8 10 10S \@v+v+/P+ h0@- pX00S L0 0Dp 00 101000w+v+v+/P++ -X0lM@ Kd @F80 0p b` w+[v+Q+@-0lM@.0 0 00 0rS sS ld dcFd X+FP0 0p 2,hd $w++P+H#,\ \>\v+Q+\@-`PP@ @0@s8#80U 0s8#8000@(B(2b! !-P VU 0A0T0Ѝp00CS0 S0 S 0 /O-TMxp|W00ʿ? p00p 0:C[0P`0V0W B@+0 @040SD H 8PZ0S= S DH0 S00 @P([0S [0#S [|0pS `1 R R 0Ha# LZtp uTЍ ? 000 $@0 fPPZ0S Z0#S@DT|0S ld@"\UL$0V 0 `{#M"00 "@BHw+v+O-PBM M`E`P$P QH?0a>0 PPP0p`5(p5P<$; P@+40S5V $ 0D  L0XD S00H00S+(E 0S 0 S     R  T!$PP$p 0 KK@P$p 0㼳tp8|# ap0pSS 00   00Bލ Ѝ@D3@30S VW@@c3! K2 0p mW T 20S 5V  R x" R " R W WSl2l <202fW D2000 !00D1#0U10S CdPRPU [ 1000P T)T0 0P0 0 PS@405U dU(T  P W-T 0S1  00 0B>V0`X@40S10S (3/1V 0    0QR\@\0 RZ P :/ 10 YS P 9/0F4P+ (#,{+|+0w+{+v+|+|+{+!m\@#,(,X&tw+-A-` @T ѓ 0 ЍAЍ/0p0$ P xpJ h0h >Toa0@S P 5/v|+\(#,P+ 7{+FMO-@FMs M` ( @W W W0$0`30(0$ 0H,@0S0P SX0 m 3 Fލ ЍR0 @,Q(hC2@@Ȳ@aGT  O 2 R 0 PD0P|2d GP `"`dEC LAC0S 00S , 0(d  PP d,@0S00?o2 2P/ lW0@6R6 D01@Bp  d 01 D0(66S0d00 0d0 A 0`PS ђP P 00S t0 |0'nP@0H @00,`@0?V+xw+\(#,(,0w+W v+;WMWV+\0|+L|+\]0O-GJMMsn0p얟VXv600S00p  9PX |6  t60 9PLmJލЍ860 0 0 097S 60SZ6co50S# 䵟0S5 Q U 5R "P 0S 500CS\5|:o00l=0S P97S( 5D 58%8p0SX0$000(00000 bPL 40000Z40܀C XSX P4`0(  $   dT C:P 4L!>\ 0h0d<` ((0#$0$c# $c4"($ <7 $ &R 3^0 R0S R3)0( 4008'P30S@97S00000 0S   0p{008'PP2 0 00 40I 0 gU pd 087NPDM 97R^ Ś 0S [R0sO0010S ;70:70?70>7='<@P0S,0 00 0<0 x1, EP!1 R  @ 0 0ZP 0S 0097S|0 L0S [[}X  S[00000IQP+$w+;0SV 080< @ d+ RD00S0H H0P n+ccn+@-P@PDP, $0R " n+Q dqr+0P @- Pp@T Wp`W VL\ P  R/ &G-@p`xMGT oTP ЍGFT8,,a,1 (!Q@ QP ЍG 8S 0S P pP  0 z@DTЍP 0 pX0   7 03/ 0  [Rn+,d4d &cddP8 $R!R(R3 R 8( 0 Q Q QG (-R ( R 8( "^'  ^ ,QQ(88S08 S08 ( ( !R0/\^^00^ "^0 00Q8/8S08 S08/n+D&p@-H0H@8D0 (8080$8P  Up$80+n++@-A(8S uc0 S B=0) P p p $8S 80pP\ UP 0S ,8S0Dc (8S 00CS0 0 0` 086 8$ 0`3/48S 0S 00CS0 S0  P0R H@ Ѝpn+s+(&dTMiMM|  | P/@-@P$@P  9fg@-@@0s,00p 0CoH&v+O-4$0 MM00* t 0 `$`V (0PZ`V=  4z@PW 00 !P4`X0 0PP@ ?![P@0H03 3#0  0#` `ij P P #Z300 0f|#`=Z 0f 0<#`< ,< 0f0 "v0` U  S  RS0"1 0;f#;Z0S;#;0d("?;#;0 #5;0?;#;0@#5;DE@"E0@S0Pa 1@V0\ 0`PV 1QR!0 P JP ! 0 !Z` "p!d Y` f 0,!`< < @f 0!  0$ @0S (P0S S d @ d0 S00p aMߍP@ %U[0DEN0w+4w+h#,.AHw+q H#,HgQ[gegjg8!ugX#,P#,ggg/v+@-IX0@ R0D00S 80 00p ,I@Hw+v+v+/-$M?0 0 $Ѝ0-4M 00 000fIP4ЍO-pQMFV(f "0`]H&0 0P00000 PU008 0R0PU005"R u0*P\0P 00$00S& (0s0S pP h@`50S` L%A`@5[06 5 { 0 >dXd@0f$4`4Z-JP BJZښ$$壢J $f x$2`0 `ğ R#3SPS04 1@($0f00` `V480PZ`V=  3A  0 h0 "H3PT0@` 0P "#M@`$5 T;&` # 3W  R@pd#K!$K @"% 0"j j2 @@V0Kh2p R0, d  0P0V00.*l"1\ ?\00H0@"P@@42 0@p (0S"%+0!O0U0!@(0@PSd!@p1 0p Qߍ 0 Vx ,t" 0"41PP 0P  `P< <p@f0 @ h#,P#,Hw+{+4w+x#, r1L#,FPX#,Y@g`#,QqT!g8!g.Aghgv+{+h/@~eg*hQ @-G@4G@p@-Bd00` pd00CS00mp ,P P00 @R0S"P7d`Qd00CS0*Wp "P \Pd00CS0Jp000S8A PA p0 0 `Vp0 c`Pd00CS0p 0@S P,P \Pd00CS0 p `V0 0 WBPp@#,L&Ph#,A-pp@`sP@ .6PP i@P PE 'P@OoB@#,O-(U0mMS pEPd F0S 嘟mߍ"0P.0͵164PPd(0P/S SUpF Pd4P PP P4$0CS0p- P P P0 PsdLAP P AP d0p P 0? l%h#dp P 0S d0p P0? p P 0S0S dg0 P P d00CS0p`2`] P Q82<0 0 dAQ 0p0 1@S P0S!   Cb"c!   c# 0`S<1Td00CS0p0 dL\0p 0 P`, ^0!S^0C0 hYP\\ yw+0#,ihqԐ+(,< !fyhhhv+ivO$i&Ԁ+Ԑ+piTiv+|+@-0 @0SP  &P  0 00@ x0 lҞP T0 LɞP 00 ,P 0 &igQ,,iJi00CS0 S0 S0 /1A-0aS0P0P3U %P 00.S Pl`1h4 \H%T1P@  D(%P00T,!,!,0 $1$ /U 0!0@p000 00000P0 0p0S000P0T h0h0 @U t0@P$0`\{+0w+qOi|+|+v+iiv+ ,$,UG,,G,,tw+ 5Qiip@-@P >0x 00p @0h hP0d Q0 P0P H0@D0@ 80@0S, 0p|+v+$, ,,{+~PPT{ h3P00+w+#,v+|{+ j FjTj0w+D#,4w+v+L(KX3(#,|+0yjA-Q0qS0`00@S Q`Ѝ0[P /3P }0 R 0000@ Pl00}S0s00T 0S$@,Z {+0w+,,v+jj|+&(#,O-쁟a0AS04M00qSP Q 1Z4ЍPF 2P0.0l2P00X<P" H@ >P$,!020$A$000 0@, A<P 0 ־@ ;P 0$0qp00P0}S0s00U 0S(@<dZ F{+0w+,,(#,v+jj|+jj|+;kNkfk02@- Psk(,kA-`P`p㼛 L@P  8@P $@㨛kkk@-@P , 0A- 0p0@S0`P0 P㬀"  2P 0S 0"S x0S R00`P"S0"S0 00,{+0w+(#,P ,|+0@-M M P , @6=Pۍ Ѝ0Ph媚4/S; @ =P;0@TP/Pmo lO-@pP`V1@@P`3:l<`Eg<0P԰ Y/  0k;T@1PSZ 0 10S 0gY0 R EL;0S*00 080 Ѝ`#,v+@-AP0@0 @p pP0 0SP0 0zA@Ѝv+ht@`#,P  R @- Rx000 0R/`0000/0S < S0C00S/ S/0C\w+Tw++lXw+`w+@-0 000 0S R 0Sh0000S b0C("( R@ S0 Ѝ &&@ !7@-@P0S 0t 0p0p\屙X@0S 00@ 0,p( Ѝ0@蟙 Ѝ0{+Ul{+rlC-@\ᄐpA`\P ^T1:00"\ \ L 9̠^@2\\WO-`p@A R %R Z0  0 @PcUF 0/U-UA%U  GR%0R0PMU30S2 2"0S0mPE_o C0RGQ .Q\P0mU nU|2G0Sx2l" 0 BQ P082 R 8cU.U00  0" R10S /S0S  0R 01B^ 0 BA R : ^^/XR \/ B/o" RQ00S 0GSE.U GT]*0SPY*0SPU*@P0LG RS QK 0TE*/0S@*<0 QS8*90S2*+0S-*> @ S'*000GS0P#0!v+(,,q, ,/A-p`P @ezP0  T  `00T  U90@ R   `FVp`00CS0 Xe PpTD000`000 T00ll(&lC-pP`$9@0尐T+W q 00@)ax0@P`0 \`}L00D P 0 Ѝ+?v+ll(&llv+v+O-M M@ P! 0<`0  83P`\ n.P #\) )30S) P Q PUP p ?0@00002F.E.P x"xF)>F@h妗ލ Ѝ pp04\ 0喗 p \⋗020(PS @ (0, 0/(0, pQ>0$S,F␡0I00S 0h$Q000SZ=9Q =*/?@#b!"/E Gp4>0S >0#S [>0AS  \0 0 PE0 P0]p 0S v>0s> 0 &ps0L\ |Pc><00 {+mkmCm{+MbWѲp@-@P;p@ p@-@`00CS0pP0 @ 7>0S0`00/>0#S V )>00p0 PA-p@`pP0 @ >0S0`00>0#S V >00p@-@PP`#9P 89Pp0Sp嗖p—4] xm@-@{P m@-uPm@-@up mP@-P n3n0@-PlMQ@00 00 T  40S P 00 P 0 0] 0 PrCcpWX 30S +7@(7@@` ( H' 'P Up`&P@ 0S @P@ 7 <  P@6 ;T0S @P@q6 ;0SHLw0 S8 0,0P 0 0XP0 2  1 PP 00 @T 6 ; P 0 0@T 6 ;P ޔlЍ`]DP@6 ;T1 1@T 0P 0`V7PP)j'000T0 0 0P@T|Q PjP{+fQ{+v+8w+KKKKKxn]n(&?0l(#,lnK,v+v+Ԑ+|+{W+v+v+ ,,7@-P# 1 Ѝ0Q0S 1 1xP !0 CRtA R Sd10R L1P 0S0aS(1 0MP 0S 10S 0 0A@ @&0 @0@&0 @&0 @&0 @& 0 00S 0S(#,v+(,nv+R8w+w+{+n w+0w+n{ ,,,n,,nt,p,+ ,,P,L, w+00S!@-@0M, : 0P0S8tv"@0Ѝ0@w+G-A-77 p( P@ BP >77Ѝ77X0/LA*%P t00O,Ooox&؆&7oo0s@-@ y1`8C8S P0S 1 i He@0 ~0nS (Ѝp3,x&qk3,/3,o@-PMP Te P H00S@0\A PЍ @FP,>o/,x&oo@-@80UT >6 w3,p pD0@-|AT 0S 71 0  mx&1,@07@-LAP/$0P00  Ѝ0x&` @-@0S S S 0 \R0 R \ @ RC-P@ M?0  ?0 p ?0p` @ヲQT@D0 @ЍC=s0 ,s@T*Qs00!&FPopG-AMMP`P0B  l2l h2 儼\2 X坼 0 04,Gq0qx&1,p@-P MP,P/o"P R0 ۍp@8St`j@P`ۍp@蛭T l! (B(R< < 5. ,(ۍpI4,q<),q0qx&qqq@-  I؆&:sO-P4M$`4~`=@PȔtȴ`0 `4$$婑p0Z$ dQ Y  Q|x$0l -P0\$\40X4Ly1@v14s1(p1 0$̬!PS pP QU Ut @DOo0B#10<13 B0lS010S P   Rpp`I ၪtS`S FS4 9S/S0Su(#a0CS00yES2/+PPS2P,Pu ,PZ x,PP[ W|2 @|,P[  dy,PW ,@PD D(2!00=2 1 0 060S1/ !P* T7%,00!0 0 㐡%0,P . D1 U hUP0 0  0 00C6&`@@@P 0 T0@0?o2/NPk0SPP54Ѝ04,D4,2,h.,&v&3,v/ 4,3,1,K vp.,v w&-8 5x&3,w؆&{sL !-u/v")vBvX _vv,w@-䔴|.,@-@M hA0 \0P0 0D0@10S 10 10S0S@ЍZP  00S30@P* 0 00S;0S .00|$P0P@0 S090q ,冷/pC |.,3,1,1,FP t A-U`V7P@@PtQp0Ph% /Q4 @y L!{pP@uDN8e0S+ (5  5@5 5 5 R- +4 400000@T ,P004@Ѝ0400/S@劶P w w w ͨPjHj@ 0S{Qt0S =|p=0#6|p;#s00S:  y`P`|` R  V \3Q 30S t: hxPX3c0S 2Q P *o2: @xP 2 : xP 2l!: xP 2 : xP 2 : xP t2!: xP T2h,!: xP 42L<r> 0u4Ѝ0/,x&@-`0S@ ݲPQ-0S 0000q20\ @/,xa s@-0Pl00@0`h R R  l R  R8v03/@ЍpQ Px&&/,FPA-$q`AQT 0SP @&(P0000(0P (P0 (P0 t(P  ddި\h0H@H  "  \ x&/,-5 8 x؆&L&1,00@-18C8S 0P /㌥x&5,(0@- ,@0 D3,H4,3,p@-`BM P9@0 S0`018C8ST01y0 坨0Pn00x0 BߍpB/ BR 000P y00013,x&X35,3, 0?o2 0/x&H-AM M++0r0+ +00000P0000@0 ٱPڶ0 ȑ ̱P0SS WS BS 0 +弱P  Tcp,0S  10 S0Y` y18C8S ؠ0S Q     |P Y 0@^S00CS00 S00 P0SK3,pS 1,H4,/,x&5,p@-PH@P@p&P P &P @x& 0/@-齱o/A-@PP p 00CS0 `V &PP_ZP0 P00XA1 0S P0000 !0S0R 00 pyt !yA-A`P0E!S qp$0!0P0CPSJ0`00CS`0p S X0 X 0P"SP, 㴧0SP`0P0CS`0p SX0 X ! cX!㙧[0 0P0 P$000P lPG0"S0T0Af18<0 0P0 5,(&| !&FPyr1@-0S S S \S ^S R@ B0 000 C@T0 0 B@T1 0 B\10 P P0 yA-x@%P0 =`P`jPP2 00pPF 0P 7V @P  @0S@0Sؼ000@%PP?2P PPP P 0!SP呥A 5,r1x& yp@-@MPP\1  C@P`u00u0ۍp0 P 0@ 0000S T`  !P00 f (dP{x&y02,yp@-`@;PP 0 7Up$ %PY@p 7@-@P W  R  @T| Ѝ0(R( dX0PP O<P K(P 1,zf@xt yt z5,0@-@M@$)0(@,0 0 R@P )Ѝ00,x0  PPP #P0S (00@SP` 5,x&1,@-層 (,5z5,@-@ {6 umP * 0P3P x判t冤h W X宮ǁ JܮЍ1,xt yt zzz {f@D{p@-0M`5PPT 1<18C8S |XxAx 0 9 0 嘁 <v4R,P( n,0F R" c _;P 71P` q0(0S q=R 00FS0x h P0Ѝp\XTP Dx&J{1,&V{r1\{a{5,z !j ;g{r{{{@-0 @61,r1-@-它a-@-妃0 R   ЍЍ/46,-@-c0 R   ЍЍ/46,A-ARp`P@1T ڭpPX`@DO-dM @P$}0P 0}0P0 0 &880 0(P400Pp`,@@0,@ T R3 U&T  ( 0 (d(0峭p ` Z0 000_o 0,@ @,@0RT ZPPU <v 04 JR (0 R 0S0b  0S dЍT 3 ` 0@D(0,@H00(0 RR `:0@D(0,@(0 R40@D(0,@x(0@Dp(0,@pWm( pG  (0@Dp(0,@`(0@D t(0,@XWT Q ( Q @D( ,@I F ( Q  p >W :80"(C-PP (- R 8 %Q  R P`(34c8@Ht  H  $P T0`000S(4( 08 40TU (0 $(,Q@D0T,@(0UT(0 $(,Qt0(00@DS,@T{{{ !{|46,"|<|W|]| !s|||||||}1}W}O-lM($Y|`V|PVPP*8@ 0f% x% 0<0d2d@0`2 @0P 00[E@P 8%@P nGpP@0S($"P @ j~h~ [lЍH<`@40S( ( Px  , >Gp, 0P¯4 0@P00@P<  B,$( p( ,0RQ @(S<`@ 0DP%<0%800%4000 0'<0'800'40\ 00  $P$@{ !&W|k}a }}}C-锑p0MS@0P tt,`0` 00qp@  ?sp _@`0 P0009 pppppW0@ @ Q@Op`6t0` }>N ?@d ࢠ00 S @. @ C< ⪡0ЍC0&}}} ~~&r A-MpᷬP`ЍAr}0@: SPPT@{`P00S 0 00hQTP1  p P PU0DsLS<(    D46,~"~3~O-0]M-SP MPP50S ]ލ ЍOv/f]ލ Ѝ@p ,P$ 00S0W0S %0S` zpP $ $@ptz0* R\ D RP ᙪPP,fu ᥪ` P ᝪW0v: S+ p{ z3 P@`P|3~  K`P pd ` 0 0L90 00c 0S0S`- EP``Sv `0S 0 3;P |V 3P `z{ R m8MRK pP Z ‫P w!1Z[  0 K.HYp`l: 0S'HQv00 0l!  P: b &# 0S- ȩpP  W ]ލ ЍO{P-Bǩ 0S©p{P P : R S00 R0S ᗩPPdST}46,&S~b~t~~{~ ~~~~9J s(&0 R R /0@-0S0R @ PaPLU APLU @P AC\ 0T00 0@-@P@@  wP JGP00S D00S  40 - G!hOXeH6,r,C,/&@-Hn*@-/zPp@-P@W}p 000/6,p@-@P0-S@@p GP0Tpp0p@-0@S`@MP0@ 4 eP@ЍpPU P w}0P0&6,DT @-@P @1000S@} 6,p@-@PPp00Spp@ 6,A- `pP@P000 PP0 0u" q@-@P P0P00S@ 6,p@-``MPU> 0S; WP2 @@?T/  ! `00@ C = @ F00 *S 0 000?0`?[XP10 FE>gP  `Ѝp跀Ԕ 0@-p098p QP@Aqp00P00S 0&)ņ(\^# ;#;0bQT |` 0X R p 009 00R0II( ,0@C, ,@-P X00S S 9(,0 @ T C,p0@-@TI0 qp0@ @}01pC, ,p0@-^ 9 @ 0@&)60 P@ ^@TC,0 R& 0@-00S0C(0,S0@ 0S!‚"\0PQU00000@/C,P0001S0 0/&7@-P R I00 0# Ѝ00R 0@!"0@@qp Ѝ0@i?C,F0@- 00qp Ѝ80098<@ q|/ 00\ /C,G-pP` @P"9  `0  P09   e 09 rPG6,C,@@A-p`VY@  @ @ 0 qP0 0z0 T 0 0q0@A/ C,6,0P /C,\ -P0S0@  / P2:1S0BS /C-@4QM@`@|0S1UA:ЍbS9 .S8 00C S 0  ?+OP >cS@U:>0@0CS000 000C/  0?NP @@@C,D,Vfp@-@P 0S`PpPQ KP@dPQVLK>i:P0S  p P&<&~A-PP`p@ 01S E*0S  R@ *Sn#0S 0Sn0*S0S sS0 dS0 k0C?o210@@ 0C^S0SP@u0C?o2C,@-XMqL&@DN@N<N8 NTr,3,!4!!!8!!PP 0"SU T 0S0C0 7/  OP 0mS 04,&H,&#P xM,s@-P@` 90 00 BЍpp@-@P` R p0S  ː`@)@-P`( @p0` G ЍxE,@-`@ (8R808Ѝ 8 0 CS  8 0C 8xE,M,p@-PQ@`0 0S S 0U P 0U 倐VpP0S l` v$0SpD8 lp@  p@cRp4,& ) $0 (((( 80( /xE,4,& 0( (( 0( /xE,4,&C-@ 㼀`p0S Ѝ @P0S 0S 0 ( ((087P 0 "PP 0D,xE,7@-D@P@ @00S Ѝ0 NPxE,@-PP@X9E`8 R8 R8S Ѝ 0p 8 0S087 80 8 00S087xE,7,0@-@M0 08S0Ѝ0S 0SP8 (0S`8p000 0C?VRh B(08 80C 8 0 CS 0`xE,7,@-P@`8000 00C?UR 0 R00C8HiЍp l 0P 0e0S 00xE,7,s@-@8 R 0S0` (0 RP 08 80 8680S Ѝp0CR80S 20S608xE,7,p@-p@XU P8PE`V` D0(  p8SopppxE,4,&080S/@-@xE,p@-D@0S PX. 8P 0( ppxE,4,&p@-|P`@v l0 R(0p0CR0R: $0( mp00xE,4,&7@-@T @P@P Ѝ0 AP 0P$ /xE,0S/0G-0PS`p@U @0 pP0@@@ X  P00OjMj @ P00r,P R/C,@-4@$P(0,0P  $8 xE,4,&O-6F0`SMPp(h- (R008(h8! 0S0S Ѝ0S08R00(h8PY08T0x88S08"VPWP $(̕?o02Q0 P`Pڐ%0@S0eP 048XЍO0480480488080 Szx0488S0S S 8S0S S 048804880S W048|048ЍO048ЍO048n0488S 0S S8Sb0S S_ig8SY0S SU048~Q04880 S80 SGrp80?08<0$48X5(pPWxpG(p V(PX  ` PP #kH80S 48PS8P i088  0Xt28Q V 0d48 #Dh  00 Q XPP@0SeVYP0SeVi0SM /Sr *S1 S S(P%UU!-0ES00E6;P 0Y 0S :G0 !W07S iS U U0`E.U V``dP eP PJ 0S`80S P0 BP tP :P 00`P iV0iS 0 T$$ 0STP0@_U0 ,0Sh U U L =UJ X P+U@  U !UQ0-UQ00  @0#0P2 P 0 a0CS00 0.P  00P 0Sa0@S @P000Sp NnXPh *1e`0,00@0S 0|* ,9P@ 0S=-P R+, a0ES000 P+P S+0 /2: !0*U @U !U<90S 97R0 <|90S07S ;07S 00#@)∆V /10@S0 @007S9 GP 0S S80S 7P X`30S780Sb`o#0CSUPڹL  ;P ((0FcS.000 e`c0 S '0!R0@*?070S p n/0 S |'0!R0&*?0 !R0 0! 70S!R0E !R0 0! 6 6!R0 0!x60S!R0!R0 0! !R0)?050S 50S z`|0 S 0k50S u0 S 0[  / 6P!teR00 !00B 0R eSd0C0<0S d 0!0<0*<(l%P0eP0^u\Q 0!t4 OL3EC@40S0S9} @ @4 D 3 H 3 P) q|3000!R0 0!L300@30| 00!R0 0!Q 0< `0000!R0 0!; ` `<0P0P0 0! P @+P P !R0100zs>Pu0P0 0!Pj !R00@00`M,6,6, ,L6,Ds,N,݈j !tM,Q qX6,)r,\,&&> !?s,r,r,FPPs,r,r, (`,&=G]xd6,ՈЉs,6,kRM $T6,0l,&!! 8N,r,7,O,@s,0P0 0!=`P SPj=qp 0 i0P0 0!=`P0P0 0!P$ ,81`P#P 0`0,`BPX(P 00,00  10SV! 0 fPP U U ?Vp!0> LS PP U U !0 CPP U U ;!~20S %/PPq U U.P7!0Pj#% (P0 0S ,#00S<30գ?00T ϠR0  B  3 B0 S #00S30գ?0/0  00 3 330S080>00S/D,@-@0 S!0O-S`PpM``@ pP Z:T008 "1 0T S@D0X0@D@Ѝ0  0480  @/o0"S R 0CS0 Q  S P R 0T@180 0P R* 0P0 ~  80 _P ` [0J0CD,O-pZX& RP @`P|` P [ ``F 0R@ 0R U *0@S0S  PpCp@-`R P@ ^0P @@@ 0ppG-@P `pM@00C  RT0Ѝ ` ?<P ?0 ?<P@7@-@PPe Ѝ00;SP0;S@@O@U AU \00SCBD00SBC0mS$00P# 0 r,6,N,p@-P\dpHPV@^8^LP gP @P%9 @@76@T AT T ep00SCBp00SBCp0!@00CQ#u 0 DPp@{T ^gP 0S0^  PA0dP fP pipr,6,N,@- @ @ N, @-p@+ N,E @-p@+N,e2G-pWPP{ P0`pЍ\@P 0pqp^ ċ܋?SZ ^0F0P 0S0MS0+S0GS 0US 0US0UES0UnS0UdS@0vS cS eS0@UxS 0@Ur0 #@U00Yrp*pT6,N,p@-p@`PP.;O,*;0XV@` `#;D Op *p N, 0  N, 0  N,7@-dP@ P%P 0S  P Ѝ0 N,Po/@- * ЍFPA-`QpP P P@P%U0P 0 P l @)]T @P 6/P]NJ׊@-~|0p p0h hhP 0X X@0L L8P0@4 4 ,&|.&ߊ< h .7AGC-P1M0SL @10SH 410SF Pp` Fi0@?oPU20S@ QPMe@KJЍPЍC 0@Sd@ 0DSd@ Td@ 0DSd@dT`P \PEU@@6,6,6,G-@`M0PSS00/ @ R S"\R" :R R DZ !Pp P 0H3/0S@00ЍX !P/@-陏p [' ):\Ѝ00S @  dt)\0PT T W' 88qp OFPr,V|O-@`JPPPPpᔠ唰0SWpV  S P0Fp@ U0 PPUP@ RpP SpPh,&i,&p@-@QP 0S R SppQ0 R*A QR 0S:/@ PRS:/p@-`< PPp@pWp@/ 0@-M * srp@  , PP  000Ѝ06,`N,400S/@-$@P P@r,6,@-@P  6,P/ @-p@&&0@-M@%P00S@(aP DP OP AP dP oPiႫ|0t00SЍ0 ڈ0LP 00qp00@S(6,Nj&IO-0M0S 0S Y0@S T z P 4X ЍQ y@o Pp 00s pPPP`\P# LP  pPPP 0S P``40SWPTPQ ((@'#PP3`00P0`0 tP0`0 .P X ' Z0 c4P% 20SP `EP   @( YP +Y |2 pd T2 :D2p@20WF0b,2P 0S eP (?P# " 1P %0S (. 1X EP D@P Pd1 ~YL10S Y 010 (0 $qp 000Sp 0 7P  0 R  [ R 0 0P: l X .6,6,(^s,`N,FPvp6,6,tt,r,\6,6,6,O,`,&r, ,T/&njP@- 0@6,00@-P &@`N,̌A-P`XpVYPU@JTZjP0 , 0 6,@-|P@ @0 6, 0 6, 0 6,p@-P@!@P Pp@5pp@-@`P(PpVU p@ Pp PpA-@Q`Pp ` YYUjG-@@` PР @PUЍppPX7EP X8p0SkЍG6,@-W0@0S @y6,0 R/%R %R0 sR0/@- @PP tN,2G-`d"d@p00CS0bPu U   0DIS  lZmX*p@P0 P00@- 0P@A-@0 0pR`@0S00 R0R@@0`P0S U  XP@00h,&i,&O-MpG`@ P!Q[ Z@P[@P) 00p00 0zЍPP P K PT VPAP YP00pWph,&i,&O@-@LpgPPP Ѝ@z@w@@J`H0H 0P0zW ω@W Ѝ0`f A-PPЍ0S `pN@K@@PVPP D00< 0`zW 7PuWF j H@-@@ A-p@`P@0S P@0S0# CV* UR@ R %S0P @# CV* WR   R %S8 P0 Y@6,6,C-EMPPEߍ@ 0@qp `,ᾄPڬ嬐P ` P:T0S EP @  X0pS`P  OP@D,s,A-kT1@0SFn <1RpP> (Fa1P|`y`v``PH0p000 0`00yVP@^pW XpVW P0SVЍ 4X~V@T6,_Vi,&h,&h+0A-0S@`*@P0L hy@p`PWV@TVRVT6,@-@@P ,P }o(^@-M@P Pۍ@ ۍ1O-0S# 10SPpP 0 `|R@0 -R` dCP PP @E#@ ЍP PP  0x U ` UV @T P uX%X⋃P $@T@P@T 000d0_@`<P(@ 0SUr,T6,^0A-`V8@Pt!pP0 PЍA"rPo`L@IF@@@0 `xyUwU@rUT ЍAЍT6,č-M P  @oЍ0@-@P0MSP  @EWW ]PX @Ѝ0@T@0: S *@&Ws,h/&x/&@-M@[P͡0 00Ѝ0@-M0P@ &Ph0 R\P0 R\ tu p0St00Ѝ06,hN,`N,/`@-@P P0@/R@-@ (0@0Th#@r,@-40 R\00S@@ xN,ds,h00S /pp@-qp @#qpP@ QPppC,@-P,#P3#0 R/  xN,O-q$M0S@nP`0S\0SO@bP`@@100CS cDP`@ 0S"P`vu00 @0 00R  0嘠嘐00 000k 0 0000000P0 000`0HP$Ѝr,r,7,6,4?,O,O-M<`p@P8@V t30Sh30`So`V D3``F`V`utV-$0S 300CS QP ""Ly"QP ""0S6 >`&+20"`Pp0X 0SJY/Y @ Po"V<"0 40 ut  20S1"0 000 f0 0 10S*P10S v1*qp@PZ "P"P41A}"P  "qp ,10S R"P ЍO0G0 0 ЍO-V utS 00St001 ?Q*)@P9ut`d6,0s,Xs,r,/&X6,xN,r,pr,&r,C,xr, 00  0 'P*Ѝ=ЍO# <O-P@4M(0X0 ,0ut@A P4Ѝ40SU400 ?QW('@PPp8d00 0Zp P7af  ` 賟V0,@ Qp` P P@Pᨣv V}- `-V@P,0S1 h3Z1 @P(L30pW0# 0$ `P" R $0 S S` P P  `VʏZ:P `@T_@P[ |20S  P0 Y (0 S  %PO 20S 0 @ 1 R00 SA> P Pe p 4ЍO V  P0$ 0PB R \A0 Pp``@P41`!Z 0 0@P_ V V@P P P P Pv@Put 0l 0@P_|l00S V V0 0 0S X@Pe`0 xr,Z =R+ =R-b [ =R<Z +Z -Z0Q =Z0 QP0QQ0QCo0S) 0 S(#S 0BS 0R\S 000S@  RG = Z* P+R( PE0P-!$,P3% R R R000#=R00S 0=S P,0E0P0 S0PS   Y PdP P P 0S 0P ./&N,y@&(&0 #)2qY$0 RP  /N,0 14/N,0 Q/P/2&@-d04 ,    00X?,P?,`?,L?,G-P㌐剀H@HPT`ppP JT J * ! % J J @`匀N,A-8p@0PS` 0P0aP N,@-@$ 0 @zN,P 0 R   /r,p00S/p@-`@mPPPpP 0S8@pPp  s,N,T@-,@FP00$?Pl0 01  -;D0'<'8&4&0&00訒N,ʒLO,XO,dO,pO,|O,P/0/N,0p@-@00P0 0R 0.PPPPPPPPPQQPQ&H&D&@&<&Pp P0 Q00N,LO,XO,dO,pO,|O,C-餁P0@SpM`"p`xx!0 0 0S[0@ 0 1 @P(a00CS9 `PU: 0 Ѝ 0P  Uqr   Q   R l@S `P 0R } yP,tP(s,r,r,r,N,&&r,,0P$0 00S000/r,r,(s,r,p@-H@P0S0000p01S 0F&PN,LO,Pp@-`0 p@XX10S P@@p(1@0PSP5P/`P0@@S  1CP0 1C"@P 0S000|  0p  0d  0@@Pq 1CP D,N,\?,T?,d?,H?,O-`CM00dwvP1S0& 1S8 : 0C# RfY) Q 000 00P20S P wv  1PS  ps000ap1U 0S Q 0 S1C10510S)X4 1R.sr0nS`/ S`0F[/ 1R0Ѝ  ` 0rP  00KY1 0[0 `0S% U "% 0R 0Q0tP 0C001萄 S vI  0N,r,O,s,7,LO,r,A-p00PS` HP ` P 80@0@D@ 0@0TЍs,N,7,p@-P@z 0p@2A-`p@@PGE$1S 0P $@@O,7@-8PPU Ѝ0@@ @ Ѝ0s,0 (! ,!/N,0(! ,! /N,P 0@-P/N,P @-@P$0P/N,P @-a0000/0@-S@ Q) 0S \Q@AOoB@0Sh Q S Q000S0000PiF!p@-`@P 0Sp(P pG-lp0dES`P01SP001000PW PP- U p P Ѝ010S00# pP0EF0q# 0d` F$ F#M 1R P@#1 PR0(d0 d0 0  0U*P0C0#0F001VX3 R 3PR 0 ЍG0SS QQ C0  0ЍGRP*pRS 0 0AP 0S0C 07` 100P0C000jPPUF` 0Q 00t0 PQ_VP P0SPPA0SV_0Sh HPd m 0 ЍG*_V` P V10S t! RS 0  m_PP P P0 -PPP0  B01S0R4ABb@D pP@DT0CR0S*A8A@DwP  0 )0S pAs,N,XO,dO,LO,PO,N,r,Ps,D,r,2&Q O,EA-A`pP V P = CP  V10S ! 00|QS 00 0S$ 8QQ 0XP< R0$1a 0S0S >00S$1R0$aʈGPt` Fy F)00z$<0u0$10P0 0S $N,|r,Ps,Q,D,O,@-(@0S =\00N,G-APpP 0P0U0S = CW`dq, `0S( 0 0S0@000Պ0 0C0S [10S0 0S N G7 GjY 0 0R  7x00S U d00SX00S D00SX    N,7,r,r,r,4?,8?,s,<-0 R!  ^ !0N,04/N,0 R 00S P@0~0/0P 0/\!4 0 / B  0/N,r, 0 /N,qp/G-p`@P6pP 儐u U 0  0W 00V@00CScP P 0P@PN, ,PG-P0P`JPpЀ@ 0@D P V 000U00C0C0y Tʌ'P 0 BJ 0 Q@ @D 0@DSBN, ,G-p`P@0@@0W  S #R0C00C0Ѝ RP   C 0 rpGA-0PP@q1`EP q 0P 10N,G-1@l`Pp0XXqp00 R00STDP 0pT@7,6,N,p@-@ppP P0S0Dp 0P2&@-p 02&80P/ R/0 0S 0 /Q,00 0S/$0$ R Q,(s,N,A-X@ 0S0dS 0p(0,`P` p U` 0Q,X0QH0H 0.4 00/ 0 08R,Q,8b,A-P@T  ^#0pP4 044 R@0pW T 4` 0P ^@Q 0࠱`@ 0Q,qpO-PP10SPU @PP0⼡p`@` V  RXWA  0 V 0 0PW @SU)PA `Y0 0 w W`@TP0 00  0` qp )@P|PAp ` W0 0K0  0`qp @TP(s,Q, ,P0G-`p|PU0  SXW@ U W0S P)9P @P P`@V0 0 0 0@00qp0SP`Ph`@W 00 0@00qp0SP`V@Q, ,G-`P@8pတtu00V00S 0SP@`P@tu TUP6,G-@Pq0p`Ptt80@ p 00 0`Pqp080衎Q, ,800S/,00/PP//r,r,00CS0 S0 SNe0 /O-0P-SP   ~ 3T! imnp\nPn@P0S,@ 0S 0S%@T Ck@s  40  p%L!! /N,C-`Hqp p_qp@@PPW.Y T0 0 Ѝqpp 0  0a0@S@-TA0@S<0'@ Ѝ'P( #P   8k,q,q,C.Pp@-9 $P" 'P= P !srp p^P 0 &- &P b?06 pPtd0`@P\0 L0Af&P,@me006pZ6,8k,h6,q,G-@`pdP4T#0 5T Ta0'0000aP0 ?@6T P'08k,@-o0@-MPh@P  ( srfЍ08!P >0 00&6,8k,@-HP!sr@H 0! 0&8k,@-> sr @@@60P&6 >0606Ѝ8k,6,G-6@PP`j>T6k.sq 00P6 >06PU p>P0PPЁ  G P 8k,6,s,@-P ,0 0R  6,gl0@-0`  ^ @^TSa04S '005S #6,8k,0@- @P 0QA 6R 008k,G-pP@P Pq`P/>`,>p6W @8k,00S/A- M`p5b@qpp6W @ Ѝ 0 PU}P4@P P0 br, 8k,@-  0mS Ѝ 0 Q0 ?@P 0 S# @ PPP0`0 S  Q0 R pV`PPp =pX006,17@-PU0P( P@ P<0 Ѝ000S@PP =P0=3 Ѝ0@`H00S< Ѝ0@ 0 0$0 T6,6,&œ 0 6,<07@- R P(0(@?@0 Ѝ08@&6,@Bs,@-P M# @0.S 00S Ѝ 0S 00 00S000b @ ` `P0@ 0R 00@0@$8@&s,&HO<07@- R P(0(@?@.0 Ѝ04@&7,@Br,@-P M# @0.S {00S Ѝ 0S 00 00S000 @ ` _hP0@ 0R 00@0@$M4@&ur,H@-@PUP  @ Ѝ@-@PP  @ Ѝ0Sp@- Sp00S p@t l0p`zP p@qpP@ 0p@ T6,$r,s,P07@- S Sl0 Ѝ0zXP@T0PP -<U@ Ѝ0@$<0 00g p@&t@&BP/L0@-0@S 00 $0$ @tr,6,pr, j P7@-) 0!0PmS MS hS@P =S@P @sS wSx@PPX@P;u Ѝ04@P,0  0 10 `@&\@&,d@&Ts,FP0/0f s,P/ZP @P//@-@Q|A pla@0TxSPLH~D|@z<x8v@y@&QUWnѕ)gЖ@--0@dS!@S1 CR&0C  R 0Q0 . Ѝ@A C#R k C Q 0Ѝ        @\P @nF!r,yF!CO-P8M`00P@*0 S  0  ? 0p00C/  0?pT*000C SX E0!R1PT*0@ S 0,S U<04 P0EPE1!0C 0UЍO,3&3&@-PMP M 0@ݍ Ѝ@` @<0Spu0 = x@ݍ ЍU X=b H=P0SX(<3&]O,3&sFPVphP@-  0S 0 0ЍP  R lЍX 0L H 0<0408000000000i,&h,&@-PM 0  0 x0 [ @ld P 0S>000D ;0Ѝ,0P wr,r,P @P/i 0 /ɗh6,P/00Sr,0/@-@0SIr,0/@-,@0S0 0C00Ѝr,ڗ0/@-,@0S0 0100Ѝr,0/400S/(00S/@-qp@r,6,P@- 00@ ^S00S00 Ѝ0 0@&6p@-P0M % @!`P@@0,S  i0S 0 ,R 0p 0Y0SX 0Ѝp40@0000$ \ @r,r,+Ph_0@-PMO  AQA0S1Ѝ0RS'DSSS 0e C R E C R   C R S -S 1 CR 0CrSdSWS ^S wS     0  E000 0 FK N R WR Q S-00 0  F!F!F!r,800S ,00S 0P// s,r,r,$0P/0 0 0C/s,6,r,A-PU  @Ѝ`p@UP|`V 00S0\V0S 0S`@W P `@$V00͘r,@-0S0*00 0[( Ѝ *  [ r,@-Q00P 0R  Ѝ@- :Jr,P/0S/P 0  // oP@-/᱓ 0LP/ r, 0@-L   Ѝ r,͘A-`@Px0-S0p00Cp S  P T00W`O-P$M cLP 00S S03/0L0$ЍeL0 @Pp88 0 R @@-PJ &$PP 0@093@!+P0P0h0 P @0+S9P 7c79P/P0z@ pZ)EaD[@T>0S.nP0S -P00 0 +P0P0PXD   0 p0 @ =RP    B  Xp00aK[0(!00CpS0 0U?o 200@S 3/T_U 0 [ 0S00S000 RL@<0 0 R 0eP.00S  r,tr,6,W-F!@-@PM @PU`p0@ tUЍU  i  B U R{  0L"00CS0U0S U3/U@`y 0 MV00SYS_U 0  1 U# U U 0?o20 0 ?o2P0U U U W0 0S00P0S00 0P W 0  0S00S000ESU U U I 0S0mPS000 00SD000V S꿙ΙF!N,1Up@-P`@ᗺ000C S0 ` 0 B ^ ST00p pS 00 000S/P/Hs,tr,@-XP H0H@ 0S0S  0  03/$@ptr,3& 80S/S/ 0CS/$3&O-@pM,Q0S [; 0S0 0 Ѝ`V$P  0P  AAQ-P $YQY0 {0@@Oop B0 0S `0 0S Wp0p3&@-PP0衬<@&/@-0M@20S4P 2     c2 0S@ 10@@0Ѝ0! R0< "$01 S 10S 10S|1 \11S(  c2 P!2 R@ ~$10P@ 000 0 R  Rb0 @000S T0 0S T \0!PL 1 10S 1m0Ss 0#So @hs,ls,, ,0R,r,<@&C,0@&r,@-tls,@- 5 Ѝ@-P 7`@@@kp0 `W Ѝ4@-@6P  (7豬xt,G- @$p`P 0(S%0  P@@@0^3#@- d 0 Ѝ,7@-P@2"@? Ѝ0@B@-<0?B3c/ ( 0 0 6bЍMb@B40@-0@@T bP  0 @@&t,N,@-@0@@@&0$R/ $嗾t,p@-& ЍO軴U 0qp  L 0ZqpV Q P _@ Ѝ&C,&N,6,p@-P@T 40@@@ @p `+}+@글,Ѐ,p@-PH@U p@\Qp@(0?o2(0글,,p@-P@ỹ p0 0P !U@p,O-M,0`70( @40pqD780<087 @ 70S 70/S 0Ï0@{t (0, Prs007S(00(00 0,00 `$0000|60(0, rs  T0000S (0S0 00000S0S$Ѝ00C000 L0H " 00 000zy+  0Sqpڵqp0S`+00 00S0 @ y40S PIUPe U 0< 2Pm40S 4L H@0|4Px4U 'VPR `400PP40S <400S0R0S P 4L0SP```P L0He3PPU7  T  qp R#T0'`L0 `    h  D0NPD0 T 0P@TX\P!* * P ` @ PUaP 0 00`hP0p`PL0 $P  000 0`0 L0$00CS$0P20S r000 0`0 L0p408 CPPI h0S8 Z5 ` p J!` 0C Q00_0p 0S0' 0P a 00o0 0S0YPPYP(1Up1) )0S0$0`P0S 0S < @B X0C  BSp aoZ0Yp0pP07,6,s,r,r, ,(s,r,,r,Ps,|r,s,,xr,O,N,p@-P@ḷ  04 P !U0p P$@,p@-P@ᠷ  0LP 0 Up PS @P@,p@-`@V000P0S0 r| 00^0tu00 U 0S! 0P tu !R0(PpVp00@00S 0Sp(0(0Sp pr,&&Ѐ,xr,,p@-P`uU 0S0P@T 0P@|0 pP(@S0 00000@pp@(0P00글,N,@-0PP踀,O-P3@أ0 404M`p 0P 0 X0`Sp$$P4Ѝ0  $$X0X8< rq ut00T00S04\0`ut 200@_ut$0  sy00 $0Y0 @$Put00V 0S 0$0(00X0 0$000 P#srJ RD R 0E0P 00@PP; 0 <qp@PN ` p%ut \0@P$100@_V `p000/V0V`p ` p @ P0X0  8< Z000rq0S Z0 YP 0  %qp`p000 040*글,20SX` 1``FoZ@P 0 @PX SiX1)`R@Put0`V@PP@ 0S 00SL YJhG qp QP 0S 00S3 글,8xr,r,\s,6,s,W@-($ 00000S@[ ,hs,@-($ 00000S@J ,hs,㞪@-閯8, 000O00S@3< ,hs,@-@P x0x0SdP@< T6, 4 1A-@TPP0 0멮vᾫ#US~㰫߮ 0@ P`p 0RW 0` ?00_ 80 ,00SA , N,7,6,6,r,G-pl0P` ` @ P 0S 0S S~,A-` pP@>v'0Up0P /g'p@-HP@T 80   p 0 X%V%T%h@&,O-0bAM MwIpD%W 0A 0 PP Ã0S0000Aލ Ѝ0!S  OPA>004S S S X0PS  0 QP04 E0S  HH P? 0 ^R0 P\ S$R 0C 0M0`0000 \P0C R 0 Ch@&0,O-pQpPpMW M ۍ Ѝ@`S`ETpL3LC  DsD4c \PU Y< 3T W/P2@DhPppC@ @= @@ 0 p&W o$x V@ i$T<"0S000P ;04P S@ 2 Pp 0S 1T WP 000000@ 000S @0\0 0@ 0S @00 0Q @ Q0 @0S 00@ 0 S 0 S 0 S  P ? U0`00002,h@&(& ,&iLI!x00@-@PP |P lP \P kQP}Qh@&@-@PAP P@ꜭO-x1M0S" @`0 ЍO`Pp000 0 Ppxy@`Ѝ00S 000S  0P @`;@ ͧ0 00A0 (# &# 0S, ,­(s,s,0@- LLPR^0S @T 0 B,h@&0@- LLPR^0S @T 0L B,h@&0/,0/,00S ;/,@-OP PPPPj@-0,//@-L@I 'p0 PS0PЍ,\ QR0* /QS QQ*/0000/@-@P "000000/0S0C 0//0@-  0#3@PP @0@0@- 0@SPR? P צۦ`Q  S<"` PЍpA-`pP@T@  G-P`"F$@p(, =QP 0$ GdFP@P7P/P?/80@SQ 0@/a0@SQW@Q7@A-@`pR  ?P P@PT*?P #SPs@-0 00Pa0C`@S0 PЍp  000@@0 0 0 0 0 0\I!A-^\^1!0 l ^Q1!0 [\=[^Z ^\00]QQ$ ]Q0\[Q`.FQ5 `@p 0]QV 0@Q0 0 @\\@0[T T nT  \TR  @0\00X,P,Э8p@-0Pt @R RP D D <@D@ p@輮 @&X,P,ZC-1`pMQp@P0x `0Y 0 E,PH D1@<1`0 $k\Y R T R 0 0P@ 0  [R .0B0S83 0  00]RT[T@ 0QT 0QST[@[T0Q[S@(0 R Ѝ0,P,X,w,00@-M M00P/S $S+ +S00+ 0 0 9S#\S @P0 0 k0IS@P \00ۍ Ѝ00@00 S00@X,P,O-@T Ѝ0tS bS rS aS @{S000pW` Gp 0S0QU 0VCP0 0 PUP @0@ p0 0kb`P ,,X,P,خO-peM?Mo0 P\W ?/0 j00 ϟ0S?/0 |0^0T/L? 0XjS ^@/?0 j Q0S 00@00000S 00@0p00pS 0S @P#S ;S 0@0 P00TP  Pn 0S @,S|P0S 00@P  0S  00@aW=-0 (Q@pQ< @;Q }Q 0,< 0XP @\P 0h,`< 0CPU P@00,(< 0L5H < <P  <<0 \\^ ^00\ APP00v0I S mP0S 00@TP;0S004+4`Lp i:*0 0S 00@l0S 00@`00P0S 00@|Q0S P @0SP X 1@( u9)0 |RP0U 0 Px9x)0 P\XX898)0 Z$ M0P8(0 TJ4%]P M0!0 < 8 SR$0 (   8%00H 0$0 PP R00C0 0C S000lX,X< P07'0 8\RH [IQ␸0S <<00S ,l< 7P00A i 080 [%] 0  0S 00@\0gSk a9SX0SvS S 0&6 0[08 9R/RR0C8 &R* P 808z\R \ 00BQ0 S 5%0 T S00( 0  \ R5%0 n ;Sf IS00pS wS, iSY 5%0 R00vY. E^'0"S Y4$0 5K  0S 00@<<0 [  RR < S 4$0  ^04 0S $Jp 9  U@P M[ 0S @;S ABg0110P\SS434#0 %MD  P2"0 < @P 0S 00@0@ H,pgh2h"0 0H p Y (2("0 20S%000 S90S 0Sw @;Se }S 1!0 <v)  9099090H 0 p000 XH 0S  p UPQ$00P0PT0, PP (00S(0 #R nR0V ,0 0200#0$0,0$0uy( T0R #R nR   RpG QT000(0V0(00P R R0   $QT0P $w (0V0(0 00  T0(0V0(0(,0FPŏ\,z@-|@X0  0S 0S00CS0eyp Xߋ0  (,O-$DMX0`SpM00S 0S e3#X0X0\030 `00d0弓XSXP 00CS0 -yp X始X  'pP0 V0 X PލЍP2 xp0S CI0'HP 0HP p4S 2I ;0p0p4S \PP xP 00\0GP|p0`0d0S00d0000S 00Sj IP0  e0 2 01d00S +咬+Z P0 d+0ℬ+0J‬IgIJg 0l!< P*H\PP >x<=P\c ( p$ G\0p !G 0`PS(0x0=PX30F00,p0\`0P l000S SP@  0  l8(00(03(,(&{,,,FP̴ִL0@-@P ydP@-@@fP jdp@-@PPp0 ^d@-T`@PP * 0'p0 ' Ѝ蘛,@-`MQqM0S000@03 0@0S + 0 d 0 0S S ` 0l=@P *0 n< Ppw 000ڍЍ蜛,,,40@-@P  Ptc `p\0 P `P 30P S x c Ѝ蜛,$G-pA嘁0 0`PU , R:(,>0(0 &U# \U   0 R`Z &R\RP` , R:(,0(0P    "pr P qu PE ,  R:(,0(0    0 ꜛ,&A-@P p0R`*W00 ڥ 0P P 0O-p/MlO0 0`PЍ080D?PU 0PH0 \ 0y Py P\^ R2 0S >00C S0 0S4 0  P0 R h>0R*SL>0@o(P0 00H0P 0S40P 0 R =0R=0 0S= 0RR0S0S4 0 S8=0@oP 0-=0C>S00L0 R: L  0` p``c0800400S|<p<8 00 X\04 0]<0S  +H0SP80S4PU 0`  EP0800A E4 ۤ0T P !0 x 004 0t 0 `` 0D; 40,{0 0;0R( <0p 墡0P 0S P 0 FP2S 0 @➽`0S0`V: $  00@ \:@;0S Ⱦ 00a  @0-P y0 @0k [0`V: e$ `0 0C0 P 0`V:T K `  0咮[ p [P 0`V:2`8K8 u:0 aV :! ` 0 0d:0 SX88 00 @h04 0W<0S P708060 P+80S'g04 01<0S  Y80S04p  Gկ`P <0 00F pp40< ( 0<0S 9V 0400<068 00 V04 0<0S !L0 R: L } 0` pc00p[ R  Q 6 D60<`4000  P 04`Z Z Z000 G 0Z0 00 V~ Z0 0RP  0d @0   PQC p0V `XOd@0p0<@p<(0000S \t04 0^<0S p P[ 80SX0sFL$LBp@0 0R`Q0 0  0p V0`0  `?0P  0 RS0 0 p0V R`0 0 !PP04 0B4 0P xBP"0 000S 00P80S0s"Bp 4 0WB40P (PBP P R0Lv(`pL<(p<80S4X ! 0`Rl0004 0V*0000pW p0 1 W0 d;0H ! R0吘P0 pW*0$ ("1 0X`xp@0`0h<@h`<x0h0G0 0O8@P,,̛, ,I!,@,/,&A&ʀht@kBX,H, FPqt&,<0 0R0((Q 0{Q   ,q,p@-@P`Tp0wS {S sS 0p AP 0 D_0`@p AP `FPG-`pUP|PU00^01@ R  "PVAGWp0!p!Q <0A\S00 0  ^0 0 00 00 00:Q 0Sp0S X00 0p00 0V 0S`: \pP 000BS ,s(J!zp@-P0`@T P ᎶP, 0S)00 00C?o2S Ppx0 0S00\0 0S00@0 0S00$0 0S00@,-J!- 0@-MMP@@P  P;^ @p43^+ @ P@ۍЍ0FPH0  BR R R7 /(&؆&@00CS0 S0 / t7(&@-,A0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0@i$,0-01S ^00oS^ P0\ S0S Q0S R P0S0S0 00Q R  Й-$,0@-  `Ğ\ @ T\    %R    $,Й-p@-TA0 5S <0S -00$!<屠Pa0U&!0! R8  (P  垠0  ,P  啠0  4PP 剫p@܊00\P -P @ y00, sP$$SpЙ-( ,|,؆&-p@-@0` 2T  5tRd ldP`PT p ፩P000STb @(&؆&$,@-@P ;P>@P @0?SP@ ≩p Ѝ/㖦P@YQP 0S SD 4e0Sa00v\c ̵@-5 [512؆&@-0@<TQ T00 G50001S R0Slp@TX` T@0$ @H4+5T(8  @,"5$,NxNU؆&Й-\hq@- 51=؆&7@-@P  M0S 0@T 00 Ѝ00"S sr@-@(P  p [Ѝ脷<0A-@X`c# ^p "RG ^<0c#N R 2A& 0p02#L @ "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L  "L / 0p02#L "L / 0p02#L "L /0S00//00//H0H 0p@-P@!@R0 U0 ,0P01p,-`,01//00/00/00/00/00/ 0  /,l 0  /,G 00/V00/00/00/ኺ00/00/ @-@%,00/@-@ - 0  /,V 0  /, 0  /,/00/00/00/00/00/00/(00/500/?00/I00/[00/h00/s00/r00/}00/-00/: 00/x00/\ 00/G 00/ᇸsO/gb@-0  0Ѝ@-@ +@-  x-r0@-%R  +@-  x-k @- 0 - - @- ,(0@-% R  -  @-萸 @- 0,, M@-, @-  , (0@-% R y, < @-  p,< @-  g, < C@-^,< @-  V,  @-  M,  q@-D, e@-<h, e@-46, e@-,, @-  $,  @-   ,  @-  , @- 0,, @-  , @-  ,  C@-, @-  , 0$S00 @-, @-@DQP d 0  ) q 0@-0 |1-,- p@-@-@7@-@0@-@600@-,!>Q,- 00@-,!@3Q,-00@-,!)Q,-00@-,!Q,-@-2@-2@-2@-2x@-詸@-跸@-Ÿ@-  0@- [d,@-2@-R@-E@-@-ap@-P AN @H4S8E4Cp Ed  AdQQ @-PPL04S@*<(  *d &d&- -QQ @-PPL04S@ <   d  d,,QQ @-PPL04S@<  c c,,QQ@-<<P d(0  ) -'-q@-<<P d(m0  ) ,,q@-<<P d(V0 j ) ,,q@-$@*P 廅,-A-\`)qW H5@P |A姅0 aP,-N00/00/00//A-P@`000 #1pS02 1(S%0rpt10#1Ux  Ua wRbFW80S  3/1SAtL0Lp( S0F`O oGոQ Q 1O-0@QMJPPPP%Pp 2 0  0ڢ`V  0 F  FpVp 0S01 p~v! 0S`@`F|R@!ġ0C!\5\6\00 Q0S3 10 \(0 `00L1 S1S  0o! I10 CЍO=S B/(B(!  20S 2 00 ڸp@-@` P  0p@OE0@-@Q10%R   @ M 倭P \03S l{ d` \ \ T0 XJ!, , ,,) ,,0@-@Q50%R   @ <P x03S 7 xt p pl lh00S  0 aJ! -  , -) '-&-,,0@-@ Q80 S00 @L C   P `03S  xt p pl lh00S  iJ!, , ,, ,,) ,,,,0p@-PQ+0%R   p@  x/ @h♬P 3S/ @< ,A. psJ! x-r)  T0Q@ @8 8C0 , ,( (/xJ! , , ,, ,\0QH H@0 4 4000S  /}J!,,,,H0Q4 4C( $ $ /J!6,,, ,`0QL LhD D@ @C8 4 40 0/J!h,,, ,, ,H0Q4 4BC( $ $ /J!, ,, ,Q Q Q/ &   , , x-iQ Q Q/   h,,x-r///00/////////////00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/00/ @-@0@,@-@0@,0S00/ C@-, C@-, C@-, @-  z,  @-  q,  @-  h,  @-  _, @-  V, @-  M, @-  D, @-  ;,@-.0,@-.0, @-  " ,  @-  ,  e@-h, q@-,+@-  x-rA-T`)qW @W1@P |Ag0 !,-NA-@PP 0S a`t/P  .`1S0rOP a/P 0p RB .`@-@PE P x i0 0|} i000A-@`\@*T<0p " RG\<0c#N R 2A& @-@Q@-@R@-@S@-  m'؆&p@-@0S*eCP) \-^HP w SLZj|P+r,rC@ ?P < 0@ S< 00ppp舝,\-A&O-,M@0P0 T; R0AT 011!0 S01  R 01 AP5^P },0S  R3/00S 3/[1P PP Q0P 0 0S^`|: p` 00 1`@S0` $0P$0pᮧ$0P``Pp1U00$0PeUP0S$008C80ᨹ B@S SBڰDP@_@8C80$S@ S}^ 1  pP$ )0 `p B BR V` Z `1Z0ZX^ 0 0000)|&0 "P P ?V`y 0CÐ   S CUPPEPE_P 0 wP &^ 0 0@0 PAP Ji1  0 v | Q l7 w3XXW`UXPP000;tۄ!?@  S0010 SZSQ 1S b !ġ1S 0C" !8C8R11$PU-eppp0 tvP uH|va `P 0PSY 2C p5i0 i a<W P ,500xP0 qP- >P( dP& <PV 400C`F V$P SuP4P 0CP  @@PPt4P P0S 400C`.]{k1SR !0C B/!?1fC]1NSAPN P 0^A88#8xP  R11@(zP`PxP@a@1S020,(PJ @$3@P, #0@S002P0CP?P <P>P P2P 0PWvP tpP1aB P utz1S'ʰ1 B P uezP 00P1 RE40S 3/Pe PP e P,ЍPR0v r\ 0SpW 0j 3/pd P 0`B P au e ` ze00x00AJ!0 b02P y00P000,`ze ꈝ,gD؆&ڹ`-&J!\-S&RJ!J! 001/ም,P0 R0//ም,O-p`*@PP [ ! S0P @ Ѝ000 1\$<0P0 00U040080 0<0<1@0q00D0`80H0, 40L0$0 0P(P1  @ꈝ,IP/D0 R/0@-A1 P e@< 㧩ꈝ,O-hBp0 %W`D5g0p 000w Ѝ0P@P 0S 00@ ['0 0 HnP kW0S eW000 00 `[0S .nP QW000 [0S nP BW ?W0 00U P0IS0SPPn0 00n0S  nt ?C S WPU  lj0Y!0C0S( 23PP PEWꜝ,&VUUU @O-$MH0[S0P 0L`Dp> F0Y0 0S 0g ӔgϣPmm m@` 0p@0@0000. 0ESET0D0T00Ө?0S0 CR C 0DS0  0BgmX 2 g 0  BT P0{ P>  PN P P!VUA`E Dt@DP`4f f f@`"PD P AP;  KR !   ` D0L0@0!P`1 V0p00@  ``5Zx`F`FV0p00@  DPE!@DU`E¨` Y @ @T`— R   BU00000S 000 0 0$ЍO-0Y S ꜝ,H kR17 &؆&A-pP`Pp `l@l@0T `P@ P P0000蜝,@-P@p 000T0* .p@Ѝp0 00㱞 0l` 0@ 㑎.@t 0 P  X&,4h0p@-P@XP0Ps H` R :޵P 0S@@Q@puX&,@-@?0000蜝,00jꜝ,0Djꜝ,-@-@000  Ѝ@ Ѝ/-@-00 ! Ѝ Ѝ/-@-  ЍЍ/@-@@FP@-@FP@-pP@`M,0 0( 0 00`Ѝ@- ЍqO- M P`@pk@kUjT0 0`P 0#D0PSY 0SV L00SRDˡPPL00PT^y@DO@W ;p PSWpV`KЦo`0 S`K0 p@PE@0 :PT0 0P00L0D 0H0T >Z  q aTvaaЍ00D R00S 0S kL0X3#PpwqP 0 dq똰hEEcc >70 EGpp`P`OEE`ccꜝ,<`-@-,, ($ *Ѝq@-P@`$0 0  0 00`Ѝp@- Ѝq@-pP@`M,0 0x( 0 00`Ѝ@- Ѝq-@-00a  >Ѝ Ѝ/qp@-Pj@jp蜝,@-7@- @嶉-A0$WPU ,%  #嗘]00h@PU %T "凘r]00000S$$奾 Ѝ0,, ,, ,؆&, O-LCM@"PP`@ n&@ "K坖Pp  cP6]Cߍp@T Z ‚0P0X Y X" @=R@8@4i0 050 ؆& 6J!, 1@-n0C-MM 0p@v`P0 ᾅPP* P 傂P 0S0 0J   HPPzP 0 Q00S0P}ۍЍ0G0P 0 @0 0@, j ,00S/ 0P [N@-,,@-T师P ,P <,@("Pq@ j C-@M @孤0S0{$P,  ⠤+0S#{P  f0Sl Y0] H)PeA@PaDt'$Dc*A^&'ЍP@R<}P'P'20S @`P'.Ap 0$!Pq<k} X  $P 0)AT PsP AP p%PP 0e+Q !Sp 07'SpT+pAW3Npp0W3:X# @PQ  R@4Q p0Q  R@@P`Vp003/P,00  h0S  R l 410!8pd,,-,FP@-MM+@(⤏+(lB+(⛏B+b(?PލЍB?P 0 T @@@@@ @@@@.&B(>;1 9S 8-MM+ g+L /+ _+0' ?P  >ۍЍ;1 9S 0@-@M T1@@"#P @  P A0$*!PRU)QX&Ѝ0RL00S 3/P 0$003/0$M*bi@P3P/[P+W@P'[@P# 0P{ k@;{  0S 0_ Z'P 0@P4o0m%()*00d,,-bB1 M1 `-\-@-@M Ң0@@>"#P* <@2  OP 00*!R00$Q )@P  0S 0` a'P%()Ѝd,,-O-`M  0 0X#*0S ` 0 SS 0qp0 S00C `@b0 S:͞PP@ B pQ %S0S iSc %S, dS 0T PsS(200P 0 倠ಠ@ZR  @P %Q0@ 0S0 aRT @R$R0PPR@  T 00S  0! SD 0 @S$SS0P @U: R R 00 R @ 0QR\P 0S  S t00@Qb0cR^ 0 3/PW Ѝ 0 种&7@-@ PU ! M ~iY00 Ѝ0llP X; L 5 fϢ( 0$[(,, LX1 h1 s1 1 J p@-@Q`T8080P00S0S   0p@5,,47@-@ [PU  +Y00 Ѝ0PP | d00S zL 0H[q0 ,tJ,, X31 1 ,J 1 ؆&s@-8Q`@R9iV2z T_cy_cu I_c5c _5ze 0 Ak@Pxx4P ??K^N^ 5yЍp\-FP؆&1 O-Mp@`  0$ p 5U  )0S  $)P Ra'  )0S  p$(lP [\P VvpPT Pe|'z'  a'?(bR p'0B? $0P$*P XPP X00|峜Pl宜P ; @  H; :0S :'P : (0#0Cy3$"0ߍ3b3 l3< 0~"!031<0`0<0&2  00 ,\<0(    \00&P+00  @~?"!!0# & PM  XT $ | T2P ||D0S$@0 }&U0 ,"QS &$&1P t 1 1T0V$2q@T ̠ @~?0XC D&0@0S@ @  0R0SQ Y.0S  3P 0 e](xu0  PS $2,b&ptbt-2 f@,,N3 02 q#?2 ,B2 2 2 T2 ,y2 ^2 e2 700@-,M 0000P00 000 0 00\PPP@P DD@0Q ,,Ѝ0@-X{ b&؆&2 , -O-iMs?!0Z''P 00iߍOЍ/Px.`P<1P 0!00*`P z[p P@& [P%pT00Z%fVU0P 00GSW 010#S 00PpP@ P+0,,M!2 2 -O-p0MT@X   p$p `V  @P'U` {PPFP@P BH E0PU m0'SP0U*S / ᏌP0 0syX/0 0P 0@ 0 0H0 ~PX1Z H vܤp`PUQR( w&2S022SP0220C2  S |S`` Tv$00 00( 0`0VPMUStR PPV   0%S @S B* B⿝ 0.S 0 0P1Zp@P^ 0A0 0DS $R5]fSv00 (u@0 0 (mPRbSbq0S  [V0A 0E?oX20S d~[`${[)`bvV @ x 60S. ,b@⒀d[sv00CS0000ZUQ0S X$0S  `v5&SeVvWU _?[_X P9[GvQoSG0ЍO Ѝ/2 3 3 Q ht@\-(&3 /0@-CMl8PP 0S .Q%@P 4Cߍ0 P ĝ,Þ,G-p@ 圀PB`AT:00Y W ,/Y 000 P EQ 0 @&!3 A-`Pp $p@ ᮜ ,p坈 %P#@Ÿ,A-PᏗ@⌗opl ⅈ0S DQ0Q.S$P @$ $> :ĝ,mo Þ,p@-M 48PLP K  X 8PLP = J $p@ ( K ; $PI#U |@ &  *dP 0``0 &@PЍp  P!i¡,%i,Ÿ,8i(,VO-NMX6Q H DD'`ێ,Pz0尪S  W:-8 4e0 w=C$ C/}  M00|=0夽pQ>e0 P400廖0 (P40  U Ur0YR? ;/ 0Fvp @*<: R0 :P'P P 0X60,09Pt<xI0.\̟   0/P `0< B 0 0u`````ZP00ۮtl= 2D00lq0,ݍ<Ѝ>0a X: t婗pP  `壗P pP;{ 1sS1lS+2 0P%QP D_P;▗pP`~, *0x*0wo~P\8 0\8WV*0yU l*0z\*0}\8@*0|~(:( R0U:$ R *  Q9ɟP \ɟW弩^ D9   +X9 @H- A|)0p 0HATup p=SrL9)10@@ KP 0H0 H0AL7 7 7 8 ,8 78 ,$,F8 f8 ~8 8 8 9 8 8 P 01/4M!qC-鿏`@(MP{P3S0 p 0p :00 0p@0p00~/00 P 0P/S/00 0 /S 0/0 P0%R  @ 0  p@ߍ) 9 '9 /9 @-p`CM|@'PlP#`0R\PP @ W<0080 `0(*PCߍ) q<9 ,,@9  -@-@ @,@-0  0Q P @0@ 28 0/P $  Ѝ, ,,R 0@-0@XMPA0  0@) P x x0 t0Ep@1P0/Q   LL |1 0/R@, ,@rЍ0ĝ, ,,,,R ,@-M@DA[PⓓP    0 D00Sލ\0\ \P L0 (0< 60, 1,A,,,, ,W9 ,9 @-bCMX6S 0P \8lP9XT20S H1\6S 81020"(#2PPr [10 b_:4S / WT\@aU B10 I:4!SO *00 0 B>x;||1@P) )1l 1\.T+D(0S 4!4!,!,0S    /N eP\6S U N*Cߍ 0 Bĝ,Io 9 N-7 4 Ÿ,9 L,9 Ƀ9 ~4 ԡ,9 X39 9 4 4 Þ,: ¡,': s +: ,8: n: : 9 K: W: @-@T^ S C @TR \00S0 @B_TQ "#0  @ ! 0  @  0  @ S00\RQ @  Q  G-P`phM 0S%hЍ0L0 3/@P 0 @P  Q 1/P @ @@0ᄠ80:/P 0 083/P@@ 0\ P0//!01000/ 00#0//O-ap$MPA@T f ӑP00 ` 0S 0S0S$ЍP P00 S ⿑S, R ,0S R : 8 80R:P3#///A-@M`M p" *0P p) Xd5\\ SS=S 8 d3R 0 ,0 ڍЍTT>; R; A-`QM p@ ⩜P PP "PЍXPTP0 phP@$U@@T @ @h?0 @wP`; G n; pG-Pp 0@0M'"pPP "`0 R PЍ 0L03/P 0 T놁0 ND @!$0S P @= @9``,z; p@-P`o0@0S 0p@(4A-0Mq!P0`L0 3/P< 0t@T 4/@0@P0  0 0t$0S $0 T \ 0S0C,L 8(Ѝ`,; Q H 2FP0S/p@-P@I 0000p@8O-p@P|M Y0P,0+`", P|Ѝ` 0S0 !X V 0S0L0H 3/P X0p``P 1,0000U00 0P1 00 0<00000pP ,0<<0@Do@0S P 0@  !D00 0S0 !Z Q 0S0 L0H 43/P4 X0 0 0괯  @-Y P 0P 0Pp PQ` QTPQH "P <080P/,/(//lM!+:p@-8@Q0@P@DPp 4Ppb&p@-P@P  ~ ~00ppX3@-  b&@- x b&G-@PMP N/ ~0 0 0S1 0S XP a,P ލ 0S 0S1S P %P @l0 1h0$1d0(1`0,1% 1S nP >4%0`>@ppԐ* :`8$  ?$0?uX 4` 0S 3Si dt W S0`0? ,`p䀍0.P 0S0)#0C?o27 #3RR  0"R6p7 'Sn`F0'Sn`pF0'S``Vn`F0(P~ 0C QX > 00B,04!  `<#>0"`ZPTP P ,04! |~<#`njd2P  @000@A00"p Q0N?P0S Jp ᫑ ⧑KR ⢑0p0K?(0811n$10 100 h<@qx1rP0p( {1S%4` ␠0!] 0AX 0S,0! <#@ 0@ ,0! @<#0h ` G ; 44444}D5$,QNEFXq; )5; &; 'Q`; @-PM`p PP 0p @P  hPP 0pPH 4P 7/P:ЍM!Q @-0 0P Ѝܴ @-0 0PЍp O-aM,MQ0`aݍ,Ѝ@|`IPh DPP - T>pP, U@"8T+"~| b+bv|`ᨋP@``V#aV+"f|+ba|~,P 0 R@3 PUFh0$P 00S 3/p0$QCbbn`Eo`YG_FPEP 0000!8PP 00S 3/p003/pNo\RP 00 QUi $P 00S 3/p $QUZ ` p0 `` pxb.;8/ 0 ``px`;".6/0S. N  { |0 x0~`PU  b +`P"  <UP,+"{b%+K "`P XP# SP NP IP DP ?P VxT {  {` (F~P= j N!U ,-V,; VFP-UA= M; 00A-p$0p@` P C 01/@P00pЍpP@00003/003/$Am; O-`UM MM.x0Pec._ QeH,GEzh8b4T@[@,0p%SppW 0,0,Uݍ ЍU  n? h4F>D 7 \4040@P#`ύ֯Nx 54, Q~W <S D7h4F>D0C2$7\41 [ V?h4F>D0C26A\40 40 000000000 00p@ 0 x0}<55ps 1yt0 00 00000 0p@ 0< 5 5s qଔT1 @t00, nE "z5@0\qW 42XL1຀`0pNόjppr຀qh p\  t00$? 000/0,0S00Ӥ?'N?,$"@`pT0 ,0S E 0S N?,$"@P4pWD4 0}10  A 5z "0z ,z,1p0!,1 101$14141(8H!L1 1$!0L1H!,[6$ 1(1\),0q, 1401$141(>8@ $$pP  ~ ^zWx !Hp#*0$100$4; Pp2P p> C  L $10=0$107P00: 0 l0G5  5Sp Ph $003/$`PK `qH!> ,! 5$F0@>S  GPjPA u;?S= $10>C418<10S2 @+` 0bVQ!!10Fb/_0,1014181>C0(1}1S0}1$1S ` E@d,\-(&D ZFPb&,-,,h,q,/< _PP$030/0@o//BO-@P MMAD0*!Rp0)Q`U0 $0 M   P a Pp ,P*l'0`$0 3 L$PZ(pP 44\,: ܍Ѝp 4B|0Spp0 @0 4p0SW00l , Ri  000x;8,9/PV 0  x8;,;/ 0 x8;,9/T08SS "0CS0S "S S/ Pp  R <pWP00P0)l2YP0 U @6' 'pP 0s r&P }d0S !88 Qd0S !8\0 PS !|8`0S !r8X0Sl! hSd! 80\ EړL0@ DQ\0S ` R  !8R8 œ Q ⿓Q{⹓PuⳓPoX0 SPecpQWpph  c,-< G f< j X < PM!{ d,< = < = = = }—f %= < >= D= < B W= < li= < u= }= < = < i< < < O-eM0M*Q8U"pU|&hh'@J&\u XQ X A&0 80T mQ 嚤ލЍ4 )qWd nP7 FP' P  @yP' @ pH0X l40هP40 Z P U Z@D`@ 9 p PU   S0SA   0S # 0P000P FeP14s10H#5:h#h `%\%X%0S H%D%@ B}upp80P0 0 ,0ST0 S00 P0p800SS0 4 0  0x;8.:/P>0400ST0LL S>@ S?00$ <03P<0PL!@  PP ,0$  40( P8 S-  S `0$z PL P00(5S0+4^cv14  y0 S r0 n%%Ȱ0,-= LBX,= = > ,> qu> Q> 6,A? Z? t? ? ? M? ? ? ? ? @ ~4 = _M!l j = = = = = = = = ? B G = > > > ? u= O-@BMTMh Pp ` T@PpT0$(PpppPP@BލЍ䓟+%C3ܣ0@ !%3# $04@(8 %3P@@00<DT@0\ uP `m%430$3 04 `$2 $02(408@00S0 KP C$댲夒  6p20$8@`2@DDAT L2L"LL囈#P 82 4%PI(2  *20)ATp !0 bP&!$0 U@0S   E#P 0Sp C0@ 4 000@0x; 89/P1  X%P !F-%@P 0  o @$$0 {@H``AW=@N!@ u= V@ 2dG /@ A@ G@ Y@ m@ m۶@ N!@ ,= ,-FPX q0bBX0p@-`M2 R !,^RЍ0P @40 PP@xp0 ;87/P  APB$,$, $0@-@"!P(@$,@-$@2S &02$,O- @P@Bw`P@   PP@ }@p0Ec#రPU* ЍI eP  eP @BI    R0S p&V@-@00 TP Q P 0wЍĪ O-`JMM ВPp3 G/P)NU\baG2Pg PXa EGIXK 刄P 0 000!K00P T"XT1P T2X"TPZNT"R0 0XPY 0G,001P 01P01P00 0A00000P lP,P 0S9 0S)XJݍЍQUP 0X$1QQP SU T"P 0 003/PT2X"S0 S(0S 0SX(0S003/PT2X"SP,h  d& 0S/p@-@P`!a(0S  R 0Q003/@Qp@@-@`pP4M0S4Ѝ0 0L03/P 00@ 0pP180/C-PpMM`0 PPpx@; 9/PލЍ0 PPxP;A.5/P A> o@ 0@o/b0 !!/(,10/ip@-@4P0 `r1111p(,O-P@p`ԐԠ԰0/ C !  !0  P͆00S  0 0S 0P1SR0B 0 0`p@P X 00,0` 00000 Ѝ(, 0@-P@M/.⚆1, 00 0d0@00 0T0@@@@1 0 000@qP,Oߍ0 (,O-Pp@`4M 0SpfP `Ppp 0S00V0#S 4Ѝ0 L03/`P0 L03/P)   Q 0S  )r P00P0 $04@H008p0`S,000TT0 0X0$0\0(0`0,0d0pA- 0R 0  DQHa@1QRpB   !LAPAPq0 \A0Q     TTAU @@(, A O-PBpXQMU<2PX\1S2\U \QUЍ0C`1`1Sa`嬀001PS \1 X!X1! 0`1Vle.0X`0 T1tX " \P6 \ ! 000: S.X1 2 \1`0 0X1`fP 0 S 0.S Xqh p ` XXP6^ SX1, 2 $ e q(,d& T | ` j p@-MM`&iP oۍЍpb P@P+q P*+hp P*+p P* PF ⰾP= j ?p@-&M@(bI`P5 Rh<0 0M P (c5(c 9ho] < @P   ލpaA b ,,N!D O-@MP! c0  G 0Cp`娢Y  pP 0 0 P0S ߍP W%]P0P0 a0CS0S p  `x Vp08Sڠ0S`p R SX0  0 a00 E p 0X1U0ů0 0s [+ ,pB Y 0 @00t00 00S 0 aP0[h!R@PO O0㏐ 0S* ?0!CVa0 ,-LA X d@edA,O WA (,@- D@01SP@ 0S 0   (, @- @-G- T1  D1D1@,$  @)DA -?@-P @ 偊 R ,A'0$@jЍ0@ Ѝ/A A @-0  0 P L0L L@ b0< <@[0 $@Ѝ, ,R ,,-3M M TFP0  4P  o3ݍ Ѝ j -3M M FP3ݍ Ѝ j 00@-M  0P 0S@Ѝ0d0d d@P T0TP P00H H0PD@00( (0P,h,,A ,,,A C ,,,@-0  0 P <08 0440z000 0 sЍ,A ,,,,0 0!S//4, 00/ P /4, 0( 0S0 10 1/5,(,11<0@ Q !@-0 " !/(,0 10 1/(,@-M/., 0l0d 060 P000@ 0@,ߍd& (,0D D /Q/QQ Q/(,d&@-@0@ 0 0B\PЍB @- @0S00,B 0@-pAMJhPN @sm  fP<04Px9/r0Aߍ0,B (,(B ;B t-@-P@ 0P  Ѝ,-@-   Ѝ Ѝ/-@-\0X0@P D  9Ѝ@Ѝ/X3DB QB ~4 -@-\0X0@P D  8Ѝ@Ѝ/X3mB ~B ~4 B DB @-,P P @B B B @-@{P@ P^o@-4@W}P 0 P 7 ,, ,@-4@C}P 0 P 7 ,,,QA-@@1@#PP1P#T|p|` _P (B(ADahe >>66YAY\- ,7@-@0P @ԁ 0 Ѝ0B ؆&B 0@-EM|P@ dl qP0000U ($$0x:@lEߍ0t- (,F@-hM`A BlA{@1^y P0x $!z 1<'0 00`00 0H0 0 00 00 000``PPpR02W'Ux:` JDX (k(O(Jߍ"C (,t-J 0X 7C d&^C ,B @-@P !0`RxzW|P PP xZP`h 1  T 101K@0Pڭ@T 5X Ѝ(,3 0d&@-@<c'0@- 0~ Ѝ0@- 0t Ѝ@-0@M 0 0 0000 0]Ѝp@-P<@0/SpQ {Pp@d&@-0P  ,,G- M@p`P- 0 &P(0 PP0P00P p @0PP0PySa00ͅ0݅ 000͕0ͅ ЍuC Gq,J ,xC ,,C fO-4MP z$4p@apTPj $%pp`V40S` 'yppG WU \1\!\\}0,  ` ($0(7, 0VRR  S  R$0 0y(0@C@J$o@,0!00 0 @  ((,0 VSS00P0#02S `F ~ 0p Qy(Pp$o`4ЍC N! C G-p`@PPU  ePP 7/G11PG- M$oAP`pP Ѝ0 0 @`0 VSSXP$ ro-@- 00Ѝ Ѝ/d -@- 00Ѝ Ѝ/d A-`@PMMP\' ``ep@ F43T0(3T$$c3TA&  0So 0CS+PDS0)  0 0S9 0S r0S 0S QN@P% 0 `z0 P@oH2@P 000C?o270 o0`(D0SލЍ!7S zP1Q! @F?0@Fod!H1Py0  0M(S' \ 0S 0S| q0Sx 0Su QN@WP  0 0 @P_F? Q. QFNnZD oq'D D iD x-OD D h,,D R D ,d&m) q<9 tD ,,D J J -MM P  P  ۍЍD -MM P  P  ۍЍD 7@-bP% P^P %P0| S0P @FP O0@TTr Ѝ0(N!mo D x0|+R/ @-d|+\0XT0PL0HD0@<08|40(,E P-E | -'E T-x -\ p-[ -P@-@ |z:@0U ,p@-@PM H(@|000H ,0@@04P,PB4hPp0: S HxP mh ih܍p,n| 8j|Q @PT@Pڤa^ <KPT8|1|!||h{x8<DQi P1 08808PP  Q gP00S nz < R t00 00000 00l0p@ m(Dt(0Q!,,,,, 1E N!'C X 6,,,D O- 0CMSP0q `@g0!`60`SPW!0007 @ @3/@P CߍW! 000|Z 0S.X 0 '@mT W  00 0 / 0S l00S \  P0W0 ! !  000,,O9 X-BE jE FPE ,E (,7@-PQ@0 SS 80 000] Ѝ02S  E E j O-,UMP$0 4Q 8 /{#ß0/S_P3s0ЃC0`/Va3 P QAMU@xc A@ dPKMP <8,@1 Uy `7P1P$ 0RP P \^ 0 10S 0S7 0 1S30S OPpG % 2 gC0S 00a 90 0a 0R R` 10 1000p]R `01S RB  0 P a0S  /SPR Uߍ` 1 05UX U@P@T TpC ,E X-d&(,E -F dF F F j F F F F 4G `-\-,E E D p@-Ph`@TUapUP`P  pll&FPG-pMMPp p@ < D⠁P P0P   .PڍЍ D⅁P D}PIP &`P IP1d~0PPx1 0 ,P0st vP 0=Sp  ; ဵPS1Q1W  P P P\pP 9 PPDB FP3FG ^G OHL 20p@-4 P@Oy0 Pp@@-G-P@p4 pHL048  5p0(0,(, 00 0(pP23U 40p0P<0SPP0 M T00SI0Sj00p0q  0 0 000000  \0 0 00000PX 00808/p0 PpQXQ Q(00,0p 04 80' \`\p a X0S l^ 0$0p0 0(00,0  04 800p 90,`,cH ,H qH C-dF`0pSPlM^H@o0S 8o0 S 0o0S)o0Sk"o0SGo0SHo0SI o0SJo0SP|o0Sauo0Sno0S000$ R$000 "0& W40SV4 QQ00Q00Q00S 4 lЍCn( ;o0SWB@4W?048P Q Q  0 \3003 0n0 <lЍ3003 0n0300 0$h3 0n0 0LS(0p`@ f0  SH0pP0`@SH0pP0`@SH0\000 SH0`000S"H0d0S hP`@,0 <"0 P0  R>0 H0L0 H0L0 H0L0 H0L0 H0L0 lH0L0  TH0L0@ <H0L0E $lЍC}!SH0000%0PpG0  d 9/ 000(00 ,4 9 Pa g qH N!H ,`,H " " " M H N 7 H H H H I I I I 'I ,I T6 C- pQ0@PE0EM (000S 0CSEߍh0 3/``d0 9/0 00(0 0``0 0pp07/0@-EM0@P 03/P 08 00 @@003/Eߍ0@-`,MHP ^@0 0 0PP@o00 RS THP pW oP00H P00P0,Ѝ @T@0/W  /0 0Hg^H P00&p@- MP@D0 L ` 0  040PP`#H0Dd ЍpH G-%(MH@PV X PDP`8 ,VV !R "2 Vr PpP`"pVp$UpWb$U  0 !q0 00% 00 0 0000M0ppppPP 5&(Ѝ$ N!5I TO!@I X# C-40PS,MJ S S S ,!S SB @P? `q`n`X 0/,) e&000 00 000 0 00 0 0M`P j80S<,Ѝ u|& I hP!l@I ) 0; r, j @-@P0kgP/UYP0S0 j O-pMCP TUtX4{ 00 rs> ,b0  * 0, P  1@0 B )R RHPQ0R r Q0CFS0TR000US0a0Ѝ@0  llGPT00U00Ha@0 \%41R7 (R3 !R/ R-R H ` ` 0R 0R`[XoFT00U00V We @GP0 /S`Sp`` [XtT00U0,`0P! ,#Zg,-J #,qT8 T, 8T,, j O-0MS@pأЍ`  W0@ 0 P0S% cS2 %MS) CS, GS R 0dP PSS! +0C?oW20S 000 00SmS sS gSR 0R RO-OM M400 00 P00 <0 0PP0@@00P(0 P 0H03/00040 00!6 0R 0  0(3/ 0P`` S08 `&a0T&XU\a`0$08000,00$0& ph0J(`HpD0WX0h05R0lp0h X `pV Sh O`U Th GPUh AVU 00 0<PTq}{0P`000@ S40dP0O>0=C0H0<0000D0 004c$xdUT0 R  Pp0 000H0P0 F0PT0S Cx}eP 0S80Q00`Q0S 0L0 aA3/P 0P P  2/``dF X!ZpBP0?cUP 0 Z [ Q P<0 S@0 D  R8X# a`0"$0$0,0(0,0$0!$0倒 DA 0ec 0xl80  0Xc 08+ 0OcȐ 0 !x0h00l01 0Ht0p^+D3T+ /TL L0` S*pV 0 TpU 00 0dTp0 <TpP0+,0$ Q00Q03S (0A"PLvp 0 & PE00`P3/ A0``PQ5VP04PTO(M Oލ Ѝ 0 Z C 0 [ ? Z 8`,6J ;J @J ,FJ aYJ Q ոVJ IJ @-@! 0$   0 P0S 0$  0"O-Mp@( P,`|1/0@T0P5@PZ@TP0 0zb p0sbpW U T 0gbY00 @$P $ W<000$08<8p 0` S04 $ia0$LL0d00h04O0l0d X pW Pd OpQܿd IWJ 0 P o p3$ 0 X0 0\p0p00@0800<0#0p{WP0, R)  Tn0 0@0pT0 F0pTP0P ZpcPPS $Ѝ LI0 PnT0 0S! 0S4 `Q00Q0S 0L0 aA3/Pb  0开0S S 0%PTLup; 0U%PJ003/%B0K0 p01( 0R, Q ( , W (p,  R\ 0Wp(0S,0 0>900p3/ 0pXc0%WQXcpE0 Z0 0噳+Dyp >apW000 0Cpÿ D03apWP埿0W000 000W 000$0=`,a6J ;J ,VJ YJ Q 0@-@M0@L0 3/P" ! !WQ 0 0 SS@Ѝp@-`MMMP;` @P f R MލЍp{dЀ@-@P HvbP 8qbP (lbo j 20 `J p@-0@ 8M! 0`P@@ 0 P8ЍpIbPUJ0 00  0 {P@oC-X1M MPN @a0P *1SE$A T )1S ݍ Ѝ Q 0 1/PPP@pG 0S0 L03/P ,0X0uP  0  x;H 8/P H{@,- ,@-0P  q,@-0 /PR ЍP/R0 R/R  |0R J (,@-@@@-@@ iJ @-PP@if@`P  jWp0S  WT h{ T @LMP  0G+9f@ Ѝ,zJ ,J ؆&@-@ @0nJ @-@P@@-M@  P  P <Q܍J 0@-MP@~  Px  P 0TsP <0ߍ0J @-@_@A-pP_`r@P P  d$0! 0PP ᳽Ѝ0$D J ,p@-@P4Sp@Tp$ @Pp嘽Dp ,J G-pt`DTP `PP@ 0 0PP$0R04r ,J A-TP4SA p`4,@ 4 0P P D ,p@-@4S04pTU TU Tp`040 4<0 44 ,J p@-@P0 p@ FPp@-@P@ opJ    @- @- @-  0P/ ,0@-PM  0xPPp 固@  0PPPf@ P,P0Ѝ0@ԼP!K (K 4,@-@A-aJ?pW;$AT"0 (PPЍ @> C  01/@P  0Q$AHL Q>0 R 0S }P P 0$003/$q,-#0pQ@-s #"T R0//s@-(@T@ЍpH塻0P坻0 w003/@P/@-tMO`P @P0 p@@(P  90@Tp@tЍT0 @T|0t dl0l p `P L `@塻㟵,P 0 l^TP P UT@ 9:DB H H0J L ,)L "L 0L FP1A-1@P%`p1P!P0P0P`P`P0  @*T 00Yg,9:UL KL mL L L p@-0M02000`00P0@P @T 1X 1TO/11 0hPO/11 Ѝp7 L ;R 0@- P ,@-CM` P@`P p0 0`0SO/11 Cߍ5Skx xl lcPX \\TZ0S  <S41, 1,L , -L M M 6M SM M;價Jp@-P@S1 1  pt-1p@-P`@P0 p@tM p@-P@_P PN/1 1 pM Vp@-P@1G1(1 P1 1 pM V@-4@M C-@aM.pT`TV PS2PPG aߍP s}P D"P080E0("GlP  ",?2X , [ 0i, [ IXN?1L0 0!,P P|1|10 tAPplaU U UeP10$0PU@8!88`A,ppP0S S  @_ 0` 0P@'P0@8 .C8 0 0 & F 0  000 p ᠵ@,~cd,5M M M ,?N = N 9:l&`,t-,, -`-\-~ Kp~ A-P$pP@P a-@T E ?nP( 0 2P  0@R P [@ᒸoЍW\\Xx P< 0 _mN L,}N 0O @O H N N N &O h//O-0p4@T Ѝ@T@T( ^& @` PT[Z [СQ UZ@P@ @T@D @B@PB0"/ -O-$6#Sp 0 RP` ;#S0Rp0 d00\ `0h0x00XL P$`P`t0 (04Hⰲ000 00 00p;Q!P @-`X0Sg0 W\0@Sh0 `0Si0t d0Sjl0X h0SkT0< pP S 0&á Ѝ@P R!O XP qP P P O-MpD001PUЍ` ؠذPE0S Y0@  0 0 p1/Q S@@@  Q  Q @ 0 @0R0 0p1/P @ -Q!A-Pp@`0S P8p0 S7/P 0403/P 0D03/P0403/A-e"@P`p1S 3/`V@Td0@@ T0P0S@000S4000S(0000AKR! - -Q!8W!^!p@-@4`4P0Sp@;10S 3/@ - -0 0#0/0@0/p@-@8Pq, 00080sp `^/ 4R R0 0`40$ Rp `083/<0 0"0P000`0X0S 3/ P0001S01 0S0P000 T 00//00/00/00/10/Q@-@@@ 0A0003/P@  @FPC-B`0SPEM;0ݮZQ0pSծRQ0 Stͮ JQ0S ƮCQ0S@忮 % 0 F   0  0d 0q✥p`ڨ@0,0p ` 㐤80$4@`!0 `40 000 f0,0 p&N0$100\$10ܧ\0d00h00`@ pl0[O00S< p0 PÁt ,l3 000000 000 0 080p#p` 3d,0hl0S> S@; SN`p%P H3/P 0p0072 |000L0p 3/P x0| 0 00S 00CS`p 0SV 0CP2Q gЍOP+00SZ 3/@@OoBS R@0&0010@!Rx!@!x@|@pPpt@刡t0S|0X*@0P PQ 0!Y@x 0T:x0S@ ̤彧t@OoB@|0xT:@,-aR R!"R d,,t Rq08Ȧ ئ - udI ,yR >O-S[?UM8 ,0044@`D LpP GPz Uߍ<0P00 P Pk30 40S 0RB 80S8(1SI 1<00H ,HLAP4#0? 4 (#H@; $M}z 0@P⛩P/@T "2B 00!P0S 3/Pt20 SU@0%0cD0`t T2RI1@Y,N @=,H! L@H@<#`P`T@)P ` H@ H,H,00 0040僤 @Ш H   , Ũ H, ⼨ὦzH40P1:1!L @0 000000 0000 00]p` D9D0S#0 5Q7[T Y ዦቦᇦ0兦v Ꭳ~ - -qR noR R!"R G-/0@JMM`0$PP+9P& 0S" 0`"`U!p/w;P T` H 0@T* /R  PHN@m+8 P:=N?0 `HNP+0: S pW.N>00ꨠ t!PJ>0@0/Sr0@! + 8 SP`+8 P*P 0/S`0oo`bS GpG0&000 SV+t]8 P*+W8 P*PM@M@`JލЍmo R J j @-*@-M @PЍ(0  \@P Q P hf0S:$c(#"c  8#8S G-`'PPp X`p,@P%Ѝ0S @ pHP0 \ SpL P Xp0 @姭 LyS R R A-tM `PXP HP4+7S@P@0 z@ ;1@P+J7zJ.0]r+J7xkJ.0LNLcP GPP|<Z, >PPso+J7K0J..PPc_+J7; JB`3 PPLH+Jt7l$pd0\!0J>P 0.P UT ލP@[+JG7JPPp0J.լ@+37 ʬP h lJ>ìPT R R R R R S R 2S _S >S QS = ^S oS nS n&R +R S S nJ &S /00/00/00/00/0@-0@4M#|0$P 0EP\ /P0T0670 Pa @P 64Ѝ0`,a,,O-AMAd2 ,000PB,0 0000/ 80s0`0P, p $  ?(0 $0K 0s$00 0$h5 S` @@`|@0S 80< 03/P0p80<P Ѝpv'80s @0D 0 0Q:8`0S0L0` $3/P$ & [P T0T2y@&T"@(R@@,0S:0兡(0$"PFP@0@00 +0@080s=0 0@( Y 'W|Ѝ#_!@&(00\1 0C`!00 XTy@!0(P R P@ 60! 0 h0 @,0 400t0S00XTP00P0 P@ 0(l @h  w@8q 3/P`,:T gDT PT H 3T AT IT 0@-)M@G0p \*4 +ߠ@,ܠP0 &*ҠP -ˠ 0 F  .0 0Ѝ0!0P80 S+P ,㥠P 4 c /,S!_T h,A-@  "(0MH( 0PlQ2d2 5  L! D!@`  p0.  0@ ,HS!,-X,U! j E O-`M,p@0 40PVY ppPT Pp0Z:`PU`Jh?ERUA X?X/XXB00#h R 0  80s0`F`pHU p Ch0S 00  80spHY pPp Ch0l0 0L03/, 00Y:pPplp010P80<>ЍOp0H03/,0$$ (08RPP0$P(<00WS:< R4*p,0, 0$` 0S `0S< $`Sp $ PR( P`$ (0=PU` P0 Sc@D S \0S 0 `p8P0VU:00S40000040,0(pWs08`<00< R:pp8`/p< p 00<<* `8q ,0,( 0L03/0 0000 0V `V0$0( 0S ` $ (0N=`V`P p0k  008,0,p(p<0yS 0| 1/0 0P SR 0 ሰ 08;/`0P}0H03/0@08P0D00Z|*p 0 `<080sb00_ <0 0SY04 @0SD0  0 H3/PB $ <0 %P 0 0X 80T,3/00T00X0 0\0$0`0(0d0,0003/p 0 L03/00 00008@`0[ `0  < V00 400P0 00 Q40 pp<0Pp80s00  h0S l Y* 0L03/Pt !0 儐X09/Pj 0$!000400$00(0 00 0S(0  0 H3/P- X$ 0 03/p<  0L03/0p Pp$0P( 0S pP$ (0$< W00 40! 0$!000400$00(0 0$0 c(0## < 0  00 H3/P<00`0<0l0 S04$( $ 0S(0  0 H3/P+ $ %P 0 0X 0T80,3/00T00X0 0\0$0`0(0d0,0T0Sv ,0Ss P0 P  R0P0k 0$!000400$00(0 0$0 c(0## < 0  00 H3/PP80s0 00- Q ( 0 S% 0 Si$ , 80X T3/00T00X0 0\0 $0`0(0d0,00Sy 3/p]p0`0W:0p Sm:Pp`,0 0Ul:8峙P  0$ 0S0p0$ p  Spj`P 80 p0R:pYP Y:PpW00 U0#S p`ЍL0 3/P@D0 RP RP 0 L03/040T0S ,0S P0 P  R0P0ꌀ 8/ #"08,00,L0 3/P 00p开8S  8y\ X W08P@DH0Pe00   8 rp0ip` p!8p 40U 00 0S 0P*p ` @`80s0 L0 3/P 08400H0, 00,0+$0T00X0pPGm۶tT U!]T , 00 80sh p ?P8p@-@P(Mo(0S~(`,`W0 00P0F0 P P`0(PZP,(嘘(P(Ѝp000.,囕(匘0,`(P\- T R,O-X`M)1$qS W W(!0 "@PЍ0 p0> C 0 1/pP0$q Q 0 > 1/@P@p 0X: @1XS<1@1\1(HL1X\1Pp ,P!#08@ 0 '81 0 ' +0 W %&, T0P80000, 0 0B0>80000  0'}\嘗0.0H*H0P00T00LP (X0>W0 000p8500 %  % %P,  (P 0 %<  5 000000 000 000cpp S<5P,0;ᨔXpW* 0GS(> $P A$ 00S H @3/4pGWp@ 0L0 3/P 00S 0Sp003/0pH03/ 0! P7/P%$%$)@0 QIYb @J@DpH L0 YZ03/ 0 0JQ  01/ 0S 2"<$Є  0<P 0h Hp0  @D@0 ᄀX60X< Ply,0S$:pP p@H0 0H008L0P 3/P p0`0 0`0080P 8/00@D@H,pP 0,QQTQ@Dp pT Q  Q0p p@08L0P 3/P `00`00p80P 7/00P  P 0000000 0P 000f,-d,qp408 - udI S!T V!T j 0@-@P`4M#}p@0S $ 0dL03/P `80< 0 80 < 8PUV`4Ѝ R00S 0 //O-@0SpP 0< #80 s#   ` 002<  Ԡ`0SQ,  R) 0 0#Q! Q0 2<<{# 8 0 r  1# 000 S   I$ 1 SR08C81/h,!0 /h,p@-@$P x1SP 003/p@蚕x1痕P$ 0SO-@0`PKMM~p⻞G0DI;0S K2 @,0B< ,0崋 0 < o=(05#ਫ KP@T80U 00 0 00000@00萍 @@@@0IpK܍ЍIS+R*<o=(02#8 ;c&@@D u-O-`0@PMM,0h1h0p 0S (0 S> 9 H; 00 0 <0.%"@~40kP`0V,p0U 0000000 0 00000000p 0崑p`ލЍG⌎,0S*< !,00+C#X0S000C0C0000S0 0,0B$Ph,D u@-@-;0  !<$10(10,1P001.@-@;0 0! 0O-4M\T`Xhp(0P  啒"\ @,@;/,P R7P TPpK M;p WpF2 C; 0" 00 0(0 0 0!`l](04ЍO/Po4Ѝ[;0p@-@Q*P儓 0 P}40 Ppw <0dp@PTn80 P@h,0 Pb00 pV!'T )T *+p@-PBM `@P &2 V`PC 0P: Bߍp`/P00S)0`$40Pp`80PS<80  4X0S0!Ӷ@$  0 P\0 `0S ⽶ @`d0Ph0S ⭶@l0S ⣶@p0SH ♶@T`͒t0P^"V!9U :U ;=>?U (U ApBCEp@-`M<P@᱒  +& 1U%P0DPK0 @0S  %  %8PU@呒 0 #P剒 01܍p(0S p A@h,0S H 7@D00S , -@$^/V!Q /U p12(U 30p@-M01P@Q#L  % %0`N 0S (0S l %  ~%,`V D܍p4)  % k%0`N 0S (0S  _%  [%,`VP $0P 0 P0 Pt0 P`0 PL0 P 0 4V!H Q FP,U    C-`RGMP@8 C"Y0S0 `F` xG0p⇞ 0S a$ L]$`,p WV o$ $/` q0`0"  "ᶑߍ@ 0  0S    `PV 1 `S pא 0  0N 0S @0S @ ߍCh<0040!00x@0Fo$ 0DL03/00 M0S !0^{D` 0S # (#8`Y0,p x Q0X 8 < RFO    / 0@ /5@_ 0  l R0^| 0  >V!MU ^U U(*W Q H iU &FPoU }U wU .Q @-x @7+0 @0p0Kd @GU @-D @7000(0,00006d @2ꐯU @-hQ`0@sKMP!   0o1!S=0EKߍ0 00@ @@0-P(@UTpp (`0 ᐳ0  0`0`pEPED00H0P30L00@P00000T0D0 30S D00D0 p@ 23"b"`"0  3}/T2 0"S0C 1šWߍ 30 p2 0@00 0)1S080.0$X80p$P! 0 S L0X 3/P h W pW 00$%1/pt0S _PWC0A00M  000C3 0" $!  8 0L0X 3/P ht0S 0_Sʚ  03 0" 0 0p@080 0S,h,U x --, 8R IT-V!V!-P-V!\5E K60S/O-@pMU䅟 MPi 00x Rp#R0`ZadD80  @Q D0 \PU L PPC 8%8z % t`V800(0S$$Bc00,0S$֮$BV0000S$ɮt$BI0+ 0 `0B/P `ὠx 00 0; Q <0Sn0y0!#墮#B"00 0=,0#Sn0y0⒮#B0 00;8 R3#0のT#B00 0=<0X#Sn0y0q#B( K 0 R #b"B 0 R "T"Bx 06#0= 0S"D`"Bx 00 0=$0Sd"3"B0 00=(0S,"$!Bx 06#0=00S!!Bx 00 0=40S!\!B0 00=80Sx! !Btx 06#0;! I1P/S L(0(0 00e0SvU (4* 1*0S `P 㽐00!15:%  ᱐P r Q 0, ($!d $ ➐P` 00 8a4Q101V| --,R q0W j QS ]W W 0S@0@-S@00 0S/-# O-P2EM 2@T P0 x2P l|1S$ $P| 003/P ,2P $  Eߍ$0 R P 01/0P 003/P A10SW PaPD  <0 040000,00800 pP@2@0S- $P* 0 x0D 0T-#$-X | - $-; P--CX A-$0M^@ QP`p@0 L03/P 0 @p$ 0S0Ѝ 0Q@#*11P0\  R'l1@h1@T@0SP-D1@1^0P@@T  @T6 @pW3dpW0V82# @  R @ RD RV @  @H0 pW P^ TXV ,0"0P0 0R,0Ό R8<0T-$-P--x --\0p@-T00P DPPp0AS@  1SAv,,-,0@-P$4M0@L0 3/P T  0P  0S4Ѝ00^@ ^T 0SR2" -l0\ Q0/\P ^U Q0000@- -0O-`GMMzl7\2@(T H2V 00 0 0000000P@@@@ 0@E[p@a< (a+(G܍Ѝ$1SpA0L08 3/P `7Z Z ZT7S p$ 0ST7S8 P P C  01/P ,00 H$L Q>,-80S @-0 &/3 W!m ]Y G-`@Pጐ匠X0r2 S80S00 00 S80S0|1 P%S$1S00 0VUp@-8M`@8  n'T P $Q呿$00S U 0 |1 08ЍpsP BP P Q G P . w P h,A-M|P8 *'U`ЍFP $A003/0 R   01/`P 003/@P$a0H03/0 `p&XDD2 08 8/PD> 0!! 7#`  0 3/P"#"#00 03/p p0` L03/o Ⱥ` 0SWp`?`B414!44%0<0S P L3/0L00 3/P @0D t0Rxp`0L00 3/P @0D t0R 4 d00`RP  v00`p 0Sv 0 |1 0@V!3 W! ]Y h,G-`RM@Xr  PP dP`T `SP P9  ,差p '0S  /ߍ<0H(00,0 00004008004004 04$0D0(0P xW[  卮pU l凮p* `m\qn` 8 & 8:T ,lT  hT dT `T 0,0ZT0 VT `% /p 0`?`a8SڡPb 0  0**0P0  0* (d@edA?zd@ň3WhzA-@Mp`;@@ Mp@ݍ P@00@ᙬT00 ##  /O-4MFpT(t$ ,`&X\pAT  00 YY 0 0<R. R 0Xpp @P R$ P#2Q4ЍS0< 0 Y+Q X( Q   0T pTp 0pWW 0 0Y084p<  ,(W \^ Z9 RR  Z$ 0 Y000 00TpTp 0pWW  00 R R\p\ ؀0@-4MP!! 0  P PP@4Ѝ0 00P/S0D0SD/0- 0S^0$^ (H P@  @ \@0P00@0/A-` R0 >h!V000㛓#000X  "  ,y( [: 4{T  hP ؀!\R 00  0Sx 0  0<0< H0S< < 0 W!Y yd|d&e{dЀZ Y!Y X U < 0$\ (00t S S  S00/Q 0P/0S 0S P//!R@-404 44 R )r0@/Z Z!Y 80R*@-0M@"P0 0! 0! P0Ѝ/00S/x,rp@-,P@0S0S< 04 px,@-@0Sx,A-pP@0ST 0S` @ P<0@P`V@x,s@-S@P ' `P Ѝp8xP ~n`P (PP )P` [P UP(  MP` D tCPhpZPP 0SP` P 3P @0`0@02Z 9Z ?Z EZ MZ SZ ZZ 'PT\0(Ѝ!SQ0P a`1/T 00`\ O-DM  0000 00 0 zp  00 4`Ro04`800,00  (0$ fp ,08<\@?! ( _5#ZP0$P00p/2#<*_.0 RP80 \X : PTuU G" ?P1 0@LH0 R p ? 0 /G$'@ T R`@`000 00  0 p 0S #"01# 0?04 SQYL0 V`00P0pYkXUDЍ,-/C-`@40M` }p\ X \^ PRPR VS  RQ \R  0    pЍO- ] ]!\ @-P Q@0p@-tP@0S0S 0DHSTPSD  p# @0p,8-08S^5/8--06- p@-@ 0(  P0R0PS 00Sj SppG-P`NM@< ЀuMᠠ`0|  ` ~000 ;PP <媚p:Nލ6 Y ydG-xM` @pᜐ堠SP! |!0@P 0S PU 0 R<D1D!DD00S 00" !P@&P0 0S0L0H 3/P HL 0RPPT $0RP0 0   x@ 04/@xЍY Y ZL   YZ( ( $] _! \ X U < O-p@PBM M`/0;P( H0P@0P0iP) Y  $;$  i P!14"S5 0S~to@ nU01U01Bލ Ѝ Gh0P0  i?XY$0 0I0,j?X Y 0oS 1 SR 1S  RS1S1S p2?R0_Q   @0 0@QD 0H 0L0@!1F41Q 04 8 <" 0P *@@Q Q' Q0PUTi 0"0S0S0@0hP P `@@=02s 2 02@F @DURX A- 0MHL`Pp h1h!hhPh@P( T00۫ 0R`0 !?020!20Y 02p 04 pi0Ѝ 0S" $0Q00 L03/P Q 0L Q 0 SD S003/ \ _!\ >8-P/@-\ @  0 2BS02D0C@AuOvO0w.#8\0 A- P\\0@@ \ 8\ @T h@ `Č `Ȍ `̌b` ` p SČpȌ`! 2/ ``~``a0q1P *ip`T8tBpP08} ^\ 0Sp`82S04@11111111108 l2~`S@P0  P0c0@SP0 0HL R   ? P ?M/Z[d0P `@10d ἐ 09/0P@\Ѝp,-G-p0@P8HL041` \ S ^ ?Y R  0\ X0?Pࠡ࠱000^ 0 G/,->0@-@0M 410810!a0 P0u0 0Ha0 J0PU ! 5/'Ѝ0,-E @- Hv@ @- @ 0  =q1_ ؆&@-@@0s$,00p b0Coto&Ta--$M?0 0 _$Ѝ0-4M 00 000 P4ЍO-pQMFf$ "0Pݐ%0 0`000 00 `V0(08 0R(0`V0(0"R 0*`Lş(`0 0 0$04U0S $0s 0SQߍ$0S {pP @c40SP $A⒄P4[06 倰 4h  0 뽸dXd@0eH$qD4P$4Z-JP JZښ $$壢J #e #2UP0 ß R#3SPS0 10@#0e:00P PU480PZPU= > @3忹 ᜰ 0 0 !2@T0@P 09P !᡹˰@P$5 T;%P # 3W  R@pdh"K! $K @"% 0L"j 2 @ U0)1p R0, d  0P0U 00 *!"%+0!o(0V0!ḃ@$0@PSdp!寃@h1 0p 9 0 U ,!0 0,!hԷ0PP40P  元`ᓢP<&<pዢ@f0 q@t kha-`a-Ha-xa-Pa-r1@a-FP8a-Y@gXa-Qq_!gg.Aghh/Ta-@~eg*hQ @-V@XR@SRG-@  H700pP ąP:`X:00X0 #Pn @-P@`pP0S -S :S S  000`  0  0P0 ЍU0S T  aP&p@-@P៍p  `ᓍ@ᫍU700@pp@-P 4`ልp@  ^Pᔍ@p@-M@ Ԏp $ ЍG-`p@T2 P  uP0IPE lPP& PE0P @ R R0 RR00#R0;R0S Q \Q  "Q0# #QS0 @-3M M Qp 3ݍ Ѝ j p@-P R`@0 @ H0 00S Y UP3PE ЍpA-@Pp p`" j 0W0 |0WxX Uh0X`0 P U <0H  0h08 Ѝ P 0ăqe` ` mo ` @-`0tM0F?oP2p @p  ڍpὌ@ p h2Sp L0V#4 - tЍh"pp@-P@@ՍpPppp@-@0  ~0 S " 0PUPUp@^0S   0 0S ^^0S   0 0S ^^A-p@PMU `0S@PE7  <0Pz00ۍXp700S @ Q@BPE@C0 00 pLT0S P0#S @UX `!` ` ` @-M@ H ދp8lۍP  `!p@-d1`0SM LLЍp@@>  <P  0 !   ∋p0 S 09S .Ѝp0 S   000 00P0 PS @ d0 g pDLf  Ѝp@p` `!`!` a p@-@$`PW[Pp0 @ `P0 002 0pp@-SP@`xM  :j0 0]p@) Kp$  Ep ?p  9p  P  H0  p(0xЍpt '`!` a 0 0 s@->@P`<p @ p0 p`` P0)p @ 40 pЍp a!a p@-@PqP  ފ01CpP`qpI ˊ0#1/pp@-pM0 p @ ᰊpᯊ@pЍO-QMM700ۍЍ   Z  @`V T@pP` @-`R00 ЍPp@0STg[@PT  Q*R@00 S   0 0S0 S *[P `z\x\  00000`0 @@P0   @-@@~ 0a!L1p@-S@T1S"d1S,RU6lRUppbV7l@\lbp1C;\L10CL1SP4\0P11C.\T10CT1SX'\0X11C!\d10Cd1Sh\0h1Z2,P0C2bV \bMp2,P0Cp27@-@0 PP$ H1 0D1<1@8 0@    (    )      C A Ѝ0@5 Ѝ0Q@-@  w  b~P p 00`_ Ѝ@ Q @ 00M pЍ@J Ѝ` Ga!a Q@-@  G  NP p 00/ Ѝ@ 1S70|[+YP| 01@ 40 pЍ@ Ѝ` Xa!ta @-t0M0@Q0$)p Ѝ  ia!a 081/@-@dr&P0S  P 0800L0S S@ Y&Ga =a j{@-p@\M Q t0  -p\ЍOa 0@-800@@? P@-@p t10cSt14 Ѝ@ @d 0 ЍWa Q7@-@  ,, _ Bp w P弈 Ѝ0@ P 11P,|1@ R  |%_AQP |`00CS`0 XL@ T0Bp 0< Ѝ0@? X0 X Ѝ0` {a!&(&a p@-PDHp44p@ @ p p@LN3 ma p@-P@ ` 08 l, S=U\% 0X 0 008 , 81pp@v }a 5ua p@-`<1P:<1x1S0p0@Tp 0S   ʌ0@-@T 0S @C-p`,X0$:0P   1000  qH,`Q 0a(!"4a4# 0 F0 >Q & P X  h080dP040 Ѝ 0b"!4b4# 0S %/0p@-8P`J040 :04G@ PpP  Pp%pp@-8a? $0080S  p, A p p@+b!@-@@O-M`80pRP@T/Ѝ gP R+W& 080 C F"0   ]0800 >X  R @8 FX 0    8b C-`HaM0@  ЍPPe p0 P  , kpnP1 P P2 P7 PlP@ P8!887@p$R! ,Q0S000 0P 00  ` xD!\10B0H1x@l l<xI JPʍDb!` bc Dc Rc c Zc b b a-c c $c ,c 3c R>  **X 5 0S 1@0 S   000x1  @  0SP P 0;0 S   0c d db! d "d 0A-M P0 0E0@!0Eap 00`+`pQwd07S `0 S X `0E 0\!`1  `Px1  ލ ' R PpP0 S   x0 pP 0PPUUxx x x1p  P  0S 0 0P{b!6d Ed d  Q@-@  ll3*p07S@\0 S 0VS0S@l` b!A-`R@p@M PP U 700 @ЍASP"R 0S 0 'r>XU$  *P 0S <0 *R p \ <0H <V>P  *@ЍA@Ѝb!4d d d O-P@$MpP  P 00A $ЍOPw P000 P`PP`VQ`P    0PEPE 00[PPIcTPPP P003#[p`r 8118100x1pW* ☁Px1pF 81181kP NP00 6PP4PPUPpP xP 0: 0 nP P ` 0S 0 0p  P YY p 000 0S 0 0pW81181$Ѝ  P YY  op 00W0 0 0 :0C WUx1  05  R @ [ P W @(0Ƞ0 0 0  UB U  0HȠ0UB 66 0S W xx0P 0S "``W`ʁ*`0 xxe e e 'e 7e @e &d!Ue 5@->@T( 4"4p P`0$"@4"4 0W SL L0 b"!4b4# 0 @> *>0@D Ѝ耼p@-p1PSM"`! $@P T 0p1!V R 0S X\mvPP Df@tAtЍpp>0S O0x1@T l1S E  @>0S@ 8`l1S   {0 @ SPP 0  @  B.(0#p ,l1S l l FPc!m [m 4m m 0 R/ 1/a-/A-@P 1 !  8SXpR0 qP 0`0SW000S \ \ 0 S   00S000@00P10 paU0OPm c!Gm m 0P@-p0p ppq 00P R 0 U  m !c!m p@-@`TP\@@^0S\*\@\0 0SZ0 5Pk9 <R0p@-`M@P㶀 p(0l``FSЍ R*p 0  B\ L *R B  ʚ;G-PP $L1L!LLqY@10!<`41Vp(@ 1!0 S0 R S,   @T0@T 0 S4  0(p `Q ,00@,@O@P0S 0S0 @@m 4c!m m ʚ;n @-@^C00 Ѝ ^   ʚ;@-0 Ѝ@-@P`pW,p0 000"#l ЍMb@Bp@-P(0 PUPUR PU PTP,PP@PP4PP4\pQ@ m Hc!m P)@-0 0PT0/m _c!m P@-0 0T0/m jc!m //P@-(0( ((@008< D0m vc!m @-,MP` e1U0@0$00 p0p@000 0<0S %~p,Ѝ8010C>S00@( ( 03(00@000 0<0S80 Tp @Xm c!Ym @-XO@P ?pFP@0  0  (0,  0004 P0-s@-@T0P0Ѝp@Ѝ/ r P @/op" R 0Q000p }00C0PPU 0`0HP0HPLPU0 P(P0P0V00 S   0O0 S ,  0O0 S 4  0O@-@@OC-@PM pb堂T0SY 00C01@0S D3/\2\"\\(PU0S Pf0S R=0 S ,  003/00400P4P+!0 P0V0U0S/ L0 S* HP% HLH0 R |Q    00   CCU 0 HN0SP(p]0S} Y`ЍT0u0S 0S   ,! Q 03/PEU[ YWa-m c!m @-8 0(@ ]2p@ t@Ѝ؆&A-`M4PspM C~0 qp@ |@ۍЍ4F P P  ӣ#P@@#C 0 ,$@4   Q|o&؆&-@-   Ѝ Ѝ/@-MMP`@p0  qP 0pۍЍ4-@-   Ѝ Ѝ/-@-  ЍЍ/-@-  ЍЍ/-@-  ЍЍ/-@-  l ЍЍ/-@-  ЍЍ/-@-  V ЍЍ/-@-  ЍЍ/-@-  @ ЍЍ/0/|o& 0p/P|o&@-M M t {p P@;00 dSV <00@ۍ Ѝ$P0p 4Nd|o&FP0/|o&@-$@@NP4 @HP|o&p@-dP@k; P24  PP   3PT V00pp|o&؆&(P@-@Ps9>=@M@-@ p !|p !|p`@-q@ {01p {01@ |p@-PM@` l  \0 T|p 1@ R! 0 p`Ѝpii$0 /L0s P/P  //@->P\MU{V0P0\ЍUr700@ p`R0 PU B0>000 <0  ,> F PP> *M n @-@T=@Q/@-@T>@0P/- R 0 R00^ PG-`P M0(0S @ P P P:`P 0!00 0   08S0 00 Ѝ080 00S # `pP `Py0P 0iS.S  `Pi04S 040:S&0@-@PDM QP@T 00p@DЍ0U  P @0S@-`Pp@MTЍ 0S P 0S0pQ   <@P @-^000Q/Px1P/$0/@-@M    0 g{pЍ~iO-YM `F/@H9X0IpPpYߍ0pL 0S 0S PP@ Y ,P @T0SL0 P 0@S0@S@@T1S X1 FPAT1S@\1S`1 8P5\1 S S R@L1SP1 'P&L1PC_oSRPU@(P04S 0s0P?AB@@$P00SLQU DJPPdh1 P Pd1UP H@ `  0[$0D  H `0 S _9X001H \0zp X0 RB000S0 15S4 S  CR.T X L@@RS! y R02 > 0*%81 000S p S 0 S `@@0?H0`p 0P0H0}>H0 @4000L0PPPc!XFn rn in @n A-p X`0P M0 @R  RT T 1 # 0@ @ QPUx!@T00 Ѝ R @yx-Ȁ 5S @00 50A % 1@ A  + A+": A !9 R50,@-`pf@P@ Ѝ ܢ0PXVJTJp Q,*P EPPd!'@-`RpP$M 0S0U00$Ѝ/@P 0 00 0  0S dU 6PP, T/00DU 7n n O-`@0p"S0W"SpG` Y PP u700 ЍTUYP T000졟0W YT X0#0%*T X3#: 0\S^0PxSmS0S< bS ST Tn C R T0 `T 00T 0T 0000 0    00 PP 0S& T  WK0 `P0A\0SP0S  @KT PT0Pc!&P /0 S S /S/P0/S S S/0/O-M %PPЍO=`P ||ЍOI@Y@S   pWIPP  ‡P 0QA00Ѝ=0@S. P( 0S @PH@`@G0P 0 @ 0 0 @ @d!n p@-@P H` 0SPH$` PP(0S $H0(0$0p,` P,` PO-@/4M10C`pXPSs00pHU- 9`Pp $<P@ P7 7  '$ !/P`0@T\0S @U0 @5 0H050U+ H0xt>0P HH0 E@PA t014ЍEP 0 1pA 0S cP"H01@U  CUH070 0  pX P! .R@  0R77@0U   0pP  H RU H0@1S׉@H000zU  P0H0p ,0 00 0 M,0S< _ czU ,0!00 0 i,0 S J Uw <1D80w40b儒000 0 PPP00 0 P  p@0  @P 4 UI <180w40b儒0p00 0 PP00 0 P  0@H0:0H P0<0UH# 0S /$`P /`P00 V /0P0 Q00<0000H060U ,0 00 0 $M,0HST  Ah 0A  ap$  P 4@AK0  U uU ,P 0SU0 pH0 50f h050,0 % 00 0 k,00,pY4$ UPPeUʩ700 50 $ 5'@p 0 *  0 |p P H0@40U 0S 4S 04S0:006S 06S090PU, ,0 00 0 lL,0HS <U H0P SPH0;00H090U `  l`,pP C`P 0%i C FH0Q7;0UlQ ;P0l1 x4P0l1 `-P0l1 P pE0PHp1tH000~U10H 2x P0H 2p P 0H 2h P PH Z H000TH020OU D 0pP(_ H0 S;70<H0207H0602H0;0-H080(UV <1#8b0w4儒00 0 P000 0 P0P0P@U2 <18∂04gr000 0 P00 0 PP00 0 wPp@0  @U =PH <p LPWH0p000 SP0<00 1P WH p P  !PWHp   \P  HP  4P   PWH  BlxPP ~ ($upo 00vc!o xo&N3 Eo Ro oo :}o o o o o o p ?/p cp .t p u p -p p p p p p p p p q q q q %q ?q Hq Rq Wq fq sq q q q q r 5r Rr er vr r Xr | r r Ir r { { @2s Ms hs | Vs { { { { { { { { { { { { /r | | s d!fs s s s 1 s s s ,p 00pP $ ( H,8  ~P B QP*WH\ B $p pP (( ( H$8  MP  B \ P  pPW ,0 00 0D I,0HSz  P /o"Bj ($}P/P0H (00Pq 7$ ! (0'0L ($_Pc/P0H  (0PS 7$ ! (0 '0.U\ H0(X U X"H020H0 000P1H000H000 H0 00H0 00(07600R 2  *450S00T01=5 =50H0U <10(@0P@470'lP 70SxhU H$CP$U 81 800 (0 00 0 !I(0`S, 6`( "4`4# ,,0H0800 PP0 0 P 0 0 H010{H010vH000qH050lH050gH000bH,';,\UZH090TAK3O0\ U0` 0z ZAAKοOAK OAKҿO"Ug \0@T$(@ <`P  ,00H,0 S$0PP4  pP0:0PP  ,00uH,XCP PpP`=*PCP`PpPh ,CPPpPP j \CPPpP f sCPPpP l eCP`, _CPi& YCPl   : {l?o2= ( tW8  @>CPb T8CP`Y p ^+CPc %CP  CP` CP` CP` CP ` CP@` CPh BPd 0BPe DBPe l \BPe pBPl BPg BPg BPlw BPlq BP f Wv ZP0$, əPP"( CAPP0P0BpPb 0pP  R  R 0,PS0P , S%00 0$0(00XH`  p @  dZ`0P ʎJZ\0PZ ZUl HP70P7H0"800H080H07 00H070~U ,6P0h2vh2S H000kH070fU p`P 00w`lHpP؀G P PVGD P P:1Ȁ06H0401H030,H, 4,&H020!UO D0 spH` /H000H000 H0@00U2 ,0 00 0 rF,0HS U ,0 00 0 ]F,0HS zU ,0 00 0 HF,0HS0 e Zs s t O-pУ@`P8 P @P `nV<1T ЍOR$ RZ4 ,0840 ЍOM Ѝd!o O-S$M`04 @ 0QpP  8Ȑ̀ ⨠娰<1H0  00vGp0`   h    P` U (   $Ѝ&Ue Te d!-A-PQH 1pS`01S`5x1hS`8  ??$?0g47S90|?8g<7S:8v?@gD7S;@p?HgL7S<Hj?(h?Ae?d? 1`P]?[?1`PT?X  cP T0 ST47,`0C47<7,`0C<7yD7,`0CD7rL7,`0CL7O-MDM`P 0=P<exP E3&7 E000 0000 0P70P7H H0E00 0:00 30000% Op l +8 0 E 0D0 E+ 0 P#Z 1@@\0Y,=P0047`(xP3 @5:_ ؍DЍDP iPA0 D  D 0 0 DDP078247024,0<'哸 R28>@,0D'哸 R,@y>0H'87l"L'<7@7D7p"H7L708 p0  l@0S R R P\R @0@ R #P0 00 v?op200p0S0p@0p DD{P 0 0# 200dDP P0( % 4J P9P4 Z#d h⁖pP"($$0@0S 0 S S0P\S 00@ :0p  VPphqdPd p < P 0S P  P 0S P Ppp0 0# Pu Xs0D00D00 0  0g0 S E:$ E000Xk!l!a-@ k!m!Mt 4xo /it 0Q//Q *///G-p000@0P `P Y 0 0 `R:S@C@3@D"X HGU( IGWA-TpW0 T`@V0 L0LS @sP X X| |00 S HH0P 0RS w k!w Dw p@-P @Pp.<@-p@-@Pp PPpT0 p@1@-0@IT 0@0T0S@-0 r &x Ul!w T0A-p `R0080810@: PP?1W U t0  t0 (p@q0S hpf0S @p? @U4 C.P P @$T T0Rt0t 0SqPt0 t0 88fPT0$0x x0R T^@RP0S @@x 9x Qx `x Ix ox A-`P Pc_ @T T0pS @p@-Q Mz0 T0S0 PU|0h xPc_`@P 0 @ ]  Ѝpx bl!w &x ~x x G-Pp0M $    =P 7@81A0 81P(P  0Ѝ |B @T|   T0 R0 0800, P T8p 0SS90SSPT0c | `P 7 R|0   P @T T0R88xPY0Sx x0R b& ]T .00XXWPR YP T T0R88FPq3p 0VS tc_ @TG 0`SS-90SS)%PT00S8 00 H*: S R   p 0S 0S W@OT 00,F @Pll!k!|l!x x x x l!Q00@-@1LS? @q@dR@l̠ BR00 1BS@P@-;000 0G0S t/00x l!x P@-Q000 020S _/00x l!x P@-}H0H H0S SoD/00x l!x P@-D0D D0S Sp(/00x l!x P@-H0H H0S S,0@o /00x l!x  ^p@-@Q0 RP_0 0`S0 SQ 0` [p@p0 p@W0 p@(y l!{x y @.0P@-x0x xxQih0X  P R !P BR #@Ƽ@(y l!x 4y p@-PP M0 j0S@T 0d($"4d4#@c@Ood@T $S 0@0 Ѝp~/0h`Q .0000P 0 x l!x a-@y 'A-0S00@Pd` pW I/0000Pp 0 a-Xy m!nx P@-808 88Qv(0 !>000x m!x ry @-@Ql[ m!y C-`TM@ P `jip) 0 i ````i1pWp0`V& i 0 0 f@ MiT  @TЍ00C>S00`"P!@03@000C>S00p"P!@03@0c!b!b!c!-3@- P pp@Ѝ0@ Ѝ/@pp@-@RP`@p0Sp  ppy A-0Pp`@S:0SS 0  RS* R0 ?`V1S* ҏP a 0@DpR: Q y Pm!y y O-ATP` M zy7C@PA(@081 Z  xp 00SPȀ MP HP CP >P 9P x4P h/pPpZ P Ep @61@ R ,;p 0;1#3G0800 00%%)p L0S% S% p H p P p $  p q| pw P0S t0$0Q0 p 4 pe x0Sz 811L10x1[sZp M Pw p@ LP 00Dd hp0  Tp* %P %P0 x1`2@ p X00SXppW0h 1SP^p@$P# |p cep upp$Lx lp~ 0S P fQ [ T  Zp  r"Zp!P| Pw Pr Pm  P P X00S 0Sa!Za!Wpb%P `V%R_ pZw0Sc   pl 0!lpTdpQ0SS   < upW 08!pCNpPH 1 R=Z  P; ЍZ p prxm!z z Ga j{=a b z d ua (z m!5z Az z 3 b Rz _z kz yz z z ll!z z z z y z z z FPQ z z :S p@-P@pp p@yRRA-P`@@pL0s  S  U@ p@@@dW0S R H R U p=a z j{Q p@-P0U@S 00p @P@q@T:p/z &@-P`1pSMAT  p@lbЍ TPЍ@!R 0$ 0 0 p@ @@aV 0 !p@/`P _p0S lt00#40  LLD SP 6 0 (m!z { m!48{ Nm!{ -{ A-PP 0S @0p 0S @@W00 S U   ^ @ .S0.S?0_S-S```&00  @R+"0T0 0D0& @- @0P P T00Q  3DP `00CS`0p S00 P0S X0X /XpX(&p@-h1@SPvPPE @p y0.SSPP XP HP 4P 0  .PPIU{ p@-@P'Uc 0 V0 tV0 dV0  TV0H/@,8)0& (#@        V0  V0  V0 V0 V Np@t IP{ .r H{ { { { { { { { { { { { { | | | X| & 0(HLǒ -\ lp Q^ ,\ ,@-QMM@pP*_p000 UQލЍA. !. d0h Up`0SPE@E p 0S:0@0De j "| (| O-,MTPpP+ t`  @P20S  P@ P@,P$ X P$0X4200,Ѝ P,P, R P,PE0S X R0 6l2|0 0 0 8$ R, R P 0 0 l8$ R R ,PX!@P !!!'7| >| P/ P/Q0@-0@0Pb^ .^^Q\0Q CL \0@0Q C B\  00/O-P@`MpUQ:T 0T00D0S00V`F@@V00ЍPW"0$?S 0[ PW RPPUT  P70 0 .0 I@0 0IU:D X0 0 `TT  DSPO-@p0` 1! Y*QP T V700 Ѝ%P@`Fp  v00T V 00  P     @3 \Eo   ' U/U$@\U0 T VPPT V\%0P00PP`F@pT V P`Fp&m!G-RMMPLp`Hp< @>pE Up V=,p |>4 TpTG    0 pIp P; IiP 4I/   ,RލЍ   20V002 0@I p  @pP0P@T*p0S4 p` @T* T 0 Tp @ p    Ho0X$#$("( HkTpn @   H\0Xd$#$(B(   HO04!c#!$c$" KTpN @@  H< 0b"!4b$#  H/L   .0I/UP+ \I/"Tp% 0S @00SP%@Tp00FP6  —H pdA- @pTPM ЍR` R 00P0S 0 -0 0t0#0Q0 3$ 0V 0  0R\| B| O-4MX@p 0S\`d` (0S:0 p20"4ЍO6 0  ,   xp0,0 ,0SPCD  ,<cp 0"00,h/4ЍP V0 000!0   0,pGp000P!d `F,P 0 S(0SVP$ (0S(00` 0$ ;/P $P(0 S0 0`F0$00 (000$ ;/(0SP, $0R00,  (0S ,  09,Pm!w| | y | | | p@-P@`P 0S P$`(0Sp,` P,` P  0]0@-MMP+ p P0@ۍЍ0;0 C@P S,P @- PΠ R00\L  ^@-Q00P`PV0 V=`V xЍp@@T   |0x@ `DPЍp`Vx1@P g0>0S *yP PU@P PPK`H/0P@-000 00 Q$0  @9| Xw!| +} A-` (M(00>0@SP  0'0x B0dpp 0t0 0 01 0 0S0S|0@0|0 0  X00Qx0 xPT (Ѝ0 8 0=0S 0xPT2; A-`|VPPFPP2X@p`Ex,P x倂|"x20 V0  X|20|2@-`@MpP! G (C (3X( 8p\PU@ Ty700@Ѝ si///0@-M @ d*PPЍ0 3"Qp 000)00'\p0000@ 0\plp 00 " 0 \p< ~p l} bw!7} E} X} p@-QUp@p Z,0x1p@,@->`GMV 0P0Gߍ@PF/ 9  0坿l0 p 1`0 DF?\P> *0 F?\ ii@-@MP4@ $P P@Ѝtw!Q@-<0< <<0SSP`///v} w!| $0 /Lp/@-Q @ ?t0@0Q00@-P@,M(  =  - P[p 0 00S p,Ѝ08i(p@-@MP  `    (P[PЍp:iO-PQMM<3<#<<T0S(3#pW3#@H`"0J01801\0t0 P00K`T0`V3P `0P0T00T0 P T0X00T00T0PT0 0T0VP00P0YP0 < 0| P0 x ;P0R h0x 0h00|0P00`T0 0FT0T(@)@@F@  弱 T0R  B  @ Y@ T1F0FᶰF @T0  YI @T0 0F0FᶰF @T0  XP UPPEPP@ D$("(Yp`ݍЍ  ;  YI @x w!| &x ~x  C-`p"0M` 0$`  0,pP @T@+Ѝ`Y*PPA   0,p=0 S '+@ ``T*x0V*-00+T00V:0 (P|P@ ( ៸Y 0@Pw!@-`@DM pP@    ᡽!> U 134  R2$ $@0 #DЍUi@i@-|@QM  00p |2 0"x2YЍ@-]MM`@FP#\Xp PP VR 000S0S S SS wR0S H^pVPS CQRS 0  Vxp@P V$0 Bp 0S$H`    hYp 5 $ L %80Su S S00,0S  R000@0S  R00@ H @ 0 Hڼ!>50H \0SYp\"0S 01S hhQc0 0 000 0 0p`URZ1S SN F F]ލЍRIx@P= @0 3P0 0- H)@ YTY$0S! HM PPN0 0~Qii@w!} @-40 000 0+Ѝw!2S/2S00/@-@@V002@-S0@0 @@V0002S 坭/w!A-PM`p (P-P((@P. 0LL`0Wp0 ,!UL WpPX0Sp }Xp PU0S p W.)@! (( cXp | P\Xp 7/PP QXp &P Ѝ@} } qB@} lBpBfB@O-@p`0M00PU  V0S2P    P崡 00S U 1!Z0P00 0 P0 PPP0PU:000000x Ѝ@-  W ЍgBp@-0M2S`P@x (VP@0 \(W00ލp@ w!B@-P`2@Sp0$M  0*00s4%40 0 0p`U$Ѝ@-@V I(@F(@-@pp uWp`~B 0`( "4`#/R0@-00@ ^ 0 # R0 0P0p@-^@P T00p``0@D^"000œ\p@Tp0,QRO-M@@00`1Q V00ЍP0p Q :8Q@SI 딂\> \ plP p,lP U  Z4\[Wpp\X @ Q*S0C 0 &P 0 B0  0 S2X00cSc@-@ 000P 0S00 Ѝ@-@ 000nP 0S `Ѝ@-@ 000YP  R L Ѝ@-@\0S \0\0@-@`q0`T0`0@-@08$@0p@-800@P >Q &T0x1 RpR 0S TT0Q  ꭢT0800 >0S  p@~ A-p`KP%P@00<000S@ (0? @0K0cScO-@IMpḀȐup0< JIߍ0RS*R? ?0 000K C[%PP d0S  GRW ( Q  R (Qh 0 0000200> 0BS0 *|0 370 RS00 T' $0K0 `C7`0$0Q  DPW WdP h  Q x'$/ F X7 FQ @Hp$Q DQW R <0S @FT60 0 <% @W 0FS80 0 @0だ G 32:0 0d 5S 0 FS+00 %A C 50@W 00  0FSw20 0 @8 R  FRh3    0FSY 700 0 @2,0" R07,04'R SI T F P41(1"<1815%#8108ZW (1S 0 F0S"=00(  (100@0S W0 2S 0 FS <0 0 " | 20@W0081 0 Z00 FR P0@  } 2S P 0 FSQ0Y0 0 2 0000Y00 @  @W 00  ^00FSt0p0p@x 6S 0`FS^00 &A  60@yW,=(, "  P W: ART ,00,S P R:(, "   PW: ART^ ,000D0C0W00FSP90 00 0C4 <1@ 4S Y 0 FS8M00 $A  40@B?S7= B?S7q 00PD0 KS:KUKe 0 S0P0"1N 50F R 0   ~ @> 008  ^$Z X~ '~ cSc25O~ j~ 7@-P\ R&@P\W0S x0x08  Ѝ0PP @ 40p s&~ x!4a A-PR1!@ `#P0 pC R0 00 R0 6 30 0 0P0 0:0 00P00;0 00P0060 00yP00ЍP 0000000 00]p0 00Qp0 00~ x!~ C-@PTM b"P@, 000`0001iH00 P00 븀x0`  (z#0(10< P !P( # @ B  ) 0ta !P( ``(1 ( f0(t!p`0+"70 (P 0 >``` P( `"(1* (> >Qߍ 0*  Ga x!~ ~ 0@-p M$M0i0PS`r 1 !p Pp@ 0S i p ۍ$Ѝi@ U0 Pp 8QQ050 00bpPz P(j ~ (&$4  x!" @- 0080@P PU@ 0S@ X `P@Ѝp 00O-IM PpPHLL `PR J2 @P0!IߍO{"0,0u"600 0400` 0 p00,0 PS2 V30a2@0 0 ,0T>`0 xP >0 Px `VT` 0X`0T>0 4`M>P: x!@? O b G-@pPQP,b,`2S#PU`,@ ,x^EYP`WE, Q 0S ,9$IE DP,`0x!w o RC-00`p@PT:p T  X ⢑00U *"0 p Ѝ0R0   @N>0 DEp  A> Ep@w I p@-RMM000PS`B S@ 00 0qpۍЍpp p p `F Dk>, jEp VFP@- 81S Q S0 00 0LPЍ R <0# DPD3O-04MS@ h@@ `0P 0_0 o0 00 0 P 3 00 y0 P3 0 0S0@0k00T0{ @P0t 00 0 `Pk 0 $ ( eXcpP  ,$(,8#P`@ X0⣡  Q*"00pP 0$00S $0 hj   ,(xt$j(g,8dP@ 0 Sh0` 0h0  0304Ѝ 00 !0 pPz @ uZt $m ,i,0pS :P@,0$S  S St 0P !R "Rp( $(,8~P@  q O-P0M040@`0 `2##`pp#`W9 pW6l0S,0S`,0r0v 2S`,080w0v 847S`,0lr0v p"Rr0,p802 Sp0,0g47S l< 0t pߍ0$000 `2$Pp$`  `$Q< 0  p $`w 0 p 00 `2(0p 4< 0 p((< 0t p#0z0,L04l0 440pl#0k@0"04,0 40p]g`]d`da`k,0 !P !904ǜ R6, `"N`P, 00`1,0,0G0 ` 0 lX00, }R0S 0,00P 0H ` `  0,M,p1S  ,0 !P !`" P ,0 0H0`0  0*p,`      @ p@-PUp@0L0pp@- P# M*p 0` 0 ` 0@MpL@ Ѝp ` 0Mp )X` 0Mp  e00; U100|Mp@-p@`PV8!(0-080000&0S  0R  Kdp`H Ѝ@ @ ,0p Ѝ@ Ѝx!8a O-`@p 0帀SP$H` B000 0 0 `00`0 0 Р0 `  $: 00003H081x HA ЍO8<0 $: 000t3@00Sd3H0p84$: @vP0 080S#%s 3u 840S'0s 2u40S,d0S) $0P%h0"x: 001S:r p2u 8dP8 S0r 82u 4,A$T: 00#H0S0SU h R 0R<0S 0S11H000s8040 P14 \P18 VPl10 P804 T00@0S0i $0.0 0p ̀h`0 9 P0 /0S00Hh S P 0dh0 ЍO Ѝ* I z P m t | ??7 T d h a [ b A-@PT 0S0A `hp` |  S 0i0/mP 0S <0S $9  d .p0  p pp0H00p 00p0   00 0$0 F#5 FAd0h0꿁 O-R@`pP\M$!P X0 #3P 0 RT000 p` hPP0 fL0S0 0@S@0#/L0} ๘?I00P X0 R2 R 0PUVqrq T0d0S  $h P $[ <Y y' `20X200(4"<10,00000<00@0,0D00 <$P(P Q48`LPPPTPH0Ip_ pX 0 0PPN   0h 0|1&h00(4"<8#8 10 E0046@0`08d#l `P00 0\ 0k`v w04S 1S0810 p _ X @0 \Ѝ7S ف x!߁ zD CDC- U b >  @-`@pP`0 h0X $7S R @`0]0 < ` %8 0 Ѝ@$0  g ف  p@-P@ $ \0 00L0p@ꭂ  p@-PUp00CSp@0@ <$7  (00+0L0p@͂  }Tp@-P `@p800  B\000D 0<0L00p@8 %  SA-P`@ 0h 0R0 P3 m081HAp` P08!(0 AP     Ph0h hh 0d 0 P0 $A# U ^ @y! ~ h00h0 C-p@ PR0  R $ RP508Ȁ `07  ,i@0S PP  P0 b lH81 0S; 0 S<$v5  F0 <`0  @ R 0P ЍG 0PS 0 PD0A 0 00 0SЍGЍLy!Ha cSc #b " >  0p@-800@P  D h00h00L0p@ TiX b \/0S/0> d0S  0R/9. /b O-0M0000PS`@pTQ 0 ЍOu> R*TP 0S 07S ǚ ǚY  S4  X!  Q 0 S:500 0p00 0  ЍOY Y 0 0Cs0'0S0 S0L0 x p    0P 0 0 (F0SY0A060@ 600 0Ip0 0  `P  %0 S 081\ni@D6P UP0S0 0<S<0P0Ѝ 0    0|P 0Y6S700S00 l00 0P Rl532Y@0KSK?3@%05<:0 Y0S0  d P   [ iL0 x4 @0S Y0 % 2)  Br  Br0 0 $ 0P 0   0 :Y 5 0  |3@S R@00 $0DѽY<0<0818 ?  ; 0 P0P4 000Р 00 0 0P00S* >P *   p坽 @ 0|ЍO6600 0<P0 ,0S * hP  pn`81 R000H 0 000 `0`o0g\0S   0\!0YP 0 8 R @1ЍOOY 0 ^Y 0 .0Sh00 00 P0PY0 "2 x ЍO ؄   " : - ) = g b z ߅ r Xy!z  υ p@-@l PT~2 0 Lp@x`D N\P d  p@s`$8 O-`Pp 0x1@TT 0S R T0S> R *ęP  0 D@g O-,M@`P Q0 ,ЍO%`F 2VWP0@SS 0SP0t#tx'xVI:PQUE0VB:  k"4"48#8S50V2:1 S/ 0 0P!' P0S 0`00a0<10  &  !P 1  0,Ѝ G 0  B6hy! p@-` MQP\@M  0000x p 0S TH  ۍЍp 0X`V \@T` ty!$4A- p`@PpApPUv1 0 HAp0S 0A\0S 0Ay!Ɔ G-0 ;M0MNp`p Dd`8k0 P480EL80H8$0ED80@X@8<8  XX:W0` 0E 03Bp "ݍ0Ѝ`y!`   p@-@PT ge c(a_@x1S0pSq @$B02p B02G022p R Rp07@-PX0B @P 0S40>8 Q0'Q'+  A R "'     0  Ѝ0@8}GPh@Kji 00 d@ 0 Ѝ0zD p@-@P0( Uph0Spp@.O-P`@T Q Pd0S  0 H0pd0 ЍP0AQ 0S 0P Y0  08p|0#  帐81- 8 0 $ 0R0hd`h08 R0, 00C0 },0800<0  P`00 g0 00S $0 pWp:#<0 2 0 0 R0H0@SS 00ppW\0H0H_t   p>00 b . I ,0`( "4`4#S /0 @Rp@- 00p0`PQPE@ `ʹ @d@$,b pP/<0`( "4`43Z!R 2S///P/P/Q 0\R/ 0\/P/-000P b8"#4b4# 0Sx1@-@T P@x10S/ R0 " /Px10S/ R0 " /PP/h0SdP//0 SRQ oRQ /Q P/Ph0h   RQ P/@0 RP/R/@o//cScC-`x1TM@T. 0S pW$ P p ;PP@0Sh0S d0S4$|Vd0 0S PPTЍ|0d 0|00 00d0 00090R P]  PU9$0 00 PP 00d8dX#v ϟPP |0d 0|0XxKU" 8ZPPP ᬸk| ⡟Pep{0S 5P 80 P  IU` P < 0$Q S "  Q  oPp h  5< 0V  h/pP: t0<0t00 00 80dxQY X ;P YU{ *pP HȐY $0% h  5< 0  $0<0|ll! y!*  އ p@-PP1! Gp`01S 0S ޸0S ڸ0S  c0 @T 0Q0 PSP 0U d0S0h0d0p@ry y! * 4p@-@T P>P@0+py!G-Pp`P@Ѝ0E @P00 4@P 0P000000 000-20  U3$00 pPP,0 LpL0S p0 0CP  0@R 0 0000@@y!w ˰E d @-@T PQ0 8 00*:SR h0S dP KH` ЍA$`  Pdp (0Q,0Q  D `P }800000( ,0?PԷ0S  0h dW $0Q 0h0d`0SH4v 0S/0S/   O-MPH0<`R8 0@xP00ЍpP P0 U@ UP R R R0 P 0S8Y0000000Cs p@UЍOC4 @PЍO p    @@0 0+0 (2 Sy!w 0S/G-P@M T 0p `xN>00 0@0 0 @e@ЍP/@-@TP@0 S   0p@-@PPP 000p蔰 P߶ 00p0000 S0 @00:S 0S @\S000@:S @a-&0@-P:P@A0 P\:R \:\P@\\ @R0/s& 0@-@AP:\|\00\0S^ 0N:PP |P P O-CM M 0d4 !Sp$  SO0E`VK `0P0E@ PPP 00pCލ Ѝ@@1;04pW p40(0= P 0 `R0 :R `d4@0  0(880P4 PF0 {0S ; p PP ;000P p 0S#0 0 0㶫p8`@Z + 8;0P R 0;0SF ޵@ ڵ@ ;0P 0O008`0 SWC p@DW:SY @\Sp S Spp00T:C P@D  0SQ c;Np0P0@ 0 Y@S 0#SS `P@@0x[ P:0p0e= p0 R0 :R0 0KI 00S B:S:0 00IS! PBP[0i P0@DJ`F @ 0S ;9 I 002  @ ` P D,0  ,0@PE P0S :$ D0A00T*0 PP 0P:SVra-s&= @-0  0 Ѝ@-(@ P k0 0a-0C-BMM00pS 0S`! \0S)  R&    RA^0C R[ ~0Pv Ps @ Mk Q00P ލЍ ~0P P 0@P2k0 PP U L0P   BQ00 ,à :Q#Q\Q 0R\S0 R\R  :R0 00 S0 R  0 A0SPZ\R    B{:R|R  a-&) p@-@PDp@NG-`= @P@ d Pi; 00@^S0S:SQ @0 R0FAd7 P= \S@0S:S: 0C\ 00C Z @ 00CY0TS @ ASBC\ 00bC ^\ 00:0 0 0Pd 0:SS0AR0@A P Pd py!y!A-p= `P@ d^ PPd0`F 00@0S @Ad P Pd0 :RRAS@A P @-@# P 00S 00XS @00A ^a0ASW0AA0AS70A\2" 0@-4@0P /Pa-0 G-A0SRPp`ʏ PU00Ѝ P00CS0j Pp0 Y( MP z, vP HP00SW  R00S 047σ,P R   S@T PR   R a-e-5a-@0@-0S |P cPa-i-@-@ZP08Ga-p@-P@PPp;iPpa-@-@EP Q 0@87ST a-i-p@-@ PS P@p p@-@P * 0@87ST a-i-O-pWP`@P @ ЍZ K P 冭PT  RT@ Z //////O-8r@00SRP`  4PU00 Ѝ  P00CS0h Pp0 0 ð heZ .PD [8 WP )P00SX00 S CP P00S  4P .P x(P \"P DP ,P$ :吡Pi-5?0@-4@0P -Pi-0 X0@-0S ;@@0@00DIP0DЍPi-Pi-@-@`0P0`Sp 0.P PP Ѝi-@-@P08Di-p@-P@PPpgPpi-A- P@`pPЍ0 (0P84SUP @i-@-$ 000B;P ЍPi-A- P@`plPЍ0 (0P84SUP @i-@-$ 000B;P ЍPi-@    /0A-P<<`0@ J0p0D0& SQv 0@/0PA/A/O-@PD_pDpG``b0Y:0z  Z# 0@@DE 0DA\0:Z: [=0 S: p `$ Ѝ `pTm-A-@`Pp0 6* 6$ 5A 50@-0A^ 0 n /o$P b2 0.0AT doP$ n  N$ A000R00@-`pTM00`< @Pەp TT0 67p%@ Z<0@404 4/,00S 0TЍs&/Ј Tm-A-`@ 0s P060p0pGWp0P6P @P @pT 0@@PP @Tm-p@-@P?@0 ?@0R:@@pP pTm-p@-QM$0Sp A1` 6/`1!6/& %R1 0Q! P` 6/* |)Rt10p(Qh! d'P\X\`P6/ ,`0 ,6/ `0 6/ 0`0 6/ 4`|0| 6/ `yX0 6/ Pp40 5/ 0@ |4/ЍpTm-s&q /KR = X3N3' k n@1 2# @ G V e v Ps O-Q<08@0(00IPS @tU`,@48pT:(㔉)<0( T:(㔉)p@0(pT!: Ѝ  7030I/@`(4)008p D!0 `@4<08p4  b "0 0 `0@80@嬮000 4/0SD0 uTm-Lz!\z!s&q p@-@0`,0DPSp1S~@Tm-0D0P/Tm-G-4DAMHPMU0`00000P0P, p0,0z0@00`o`ⴓSLXo Xw +4pn A>004@ppG0SkXh$0`S D(4ß0 R 40<L>T @C 0 B3^00@  C310X  2` 3 d ! \C 2h00C0'0hS8 0 p0 003\\\4`D| <S ,`9PPDpAލЍ尐pP 5P 00PpWA C9RQ 0000&000%0}0L 0 R0Cu0s0Sp00$0k00S0Ce0cL 0 BR^0 0S0CX 0VL 0 BRQ00'0L00(0G00)0B00*0=000 0六d0d :/1, !VjP 0H0Tm-z!s&̉ 4Glz!m-m-݉ #9 0H0S/Tm-0P /Tm-@-DAP|0`SDM)0S&40S S f40P 0P@ DЍ !4pW*P 0 000ے0pP4p?@ t`0pX0 T7/0S 0SP 0 P0DЍ@趒Tm-m-s&/Ј G-\qPL @0P12C001b5R 0 0&0S  3h0S*0s0PE`1``d0 R1 *! q ` `  !`` 0R00l0S0PS &0S,P O,@GITm--!\  0L0#0Tm-@-p0M  L0@31 ^AP 0C! 0ЍlΑTm- @-L 0 0@11D ^Q       Tm-A-Db@0Mu L0 @2# p PW%cP_  Bc p\  Z$0 HD@,X#10000 2R01   000 S" V00 S O ЍA X 1(4/00~X1威0 ᪦SV Q`ЍQ0S ⏑ЍA艑`\c  Z㨪 l%@l %0S Z 喪 b0@0Tm-Lz!A-Q`0MS 00S` @P9 0s$@Ѝ ᾑpW   @嶑Ց0p0|0S0S a@PpH2p00FV@@?2P 00T l@ڐp`W 0S:S* 0~ 坑0p0ppTm-m-O-`LqL1P0SU$,@T,P@P6 h0d 0B1 `P 1ؐh L0C R P!050%Pd @T: Y 忐0 p[L0CY1T*Q@@Tm-G-qT0So:\0`S& 2 c@Oo @d(0d$0P0@U1 0S. 0 P B N %Q * RG  ᝩ0B408@S 1:X 0@D8C 003 c0?o< @@D@  ʐPP  PNPP 0 @ S :    b01"!00000P00,0PTm-s&A-p0@@ `P PP0`0P P@l%Q *0S  *Tm-$00S:@-@@RTm-@-PP` U(0SP@P )@T \0@,T0T 4/G 00'0S 0 (( @ 0ЍpTm-s&q" O-$MPpPdE00U0SPc )Z@ <3@434 4/W(0Sp0eWD@XU0XU5 0PPW00 # 30+*[@C@dQR: =LzP5 KL ` $ J2 10X0D30 2%Q a*0S ^Z^1)Z @\ 1@坩1 ꆁ`K K:1X0<0< J 0 @D@ T1 L0 43   @[ [@K@@d PP P0P0 K D K0@D   %Q   0@P0'0S 0 P0p&/$Ѝ*0S  Tm-s&qO m-@-M@pP,aD(0SWTP )@T: 0@0 4/0#880 ΰP0Up@P  ϧ'0S 0 |( @.Ѝr@P %Q|0S0S P 00Tm-s&q O-@QpP$M(0S@ P wP'0S  p@P.$ЍW !0`TM\0T*P* 0`0  `?oo 0c `S PP T 1b*ᱧ@4 T!P030#P0S X $200301S%T#2QZ FD*0T00S<PP 00PPP0 0#  0|0S0S @ Pp壍<勎`0<0 0 !.pP PP% 0   D  ԍ%T#2QZ J*0T00S  DUKP )PU @0@<0< 4/PP 004Tm-s&m-q @-L0@'0S 0 00 0-T Ѝ@ЍTm-H////s&/s&000/&000/&000 /&000/&000/&000/&000/&000 /&000 /&000@/&000/&000 /&Q P00Q////////0P/ R//A-`Pp@0 P @U*0Q R* /0/t&} }0 0CS0 S P#0 /p@-P@,`VPp@ Tp{!0A S010//{!0P/!R/P/P/Qa/P/0000 /&P/ 0S S//0R/0000/&000/܍&7@-@PD@P 40R0PP˦0 " Ѝ0qH = ؆&PQ 0S///s&03P  /q^0 ACP 0AB0P CoSPS//O-MX@ @ЍO-SQ`pu rTp 04S`\kP0@`S@T~WlЍ_U` 㚔!``PE`0r>T 04SJ:`\H㌱  T  QX ( Q     Z P   /T0`[?oT20S@ @ @0R @T`0-@0S S @0V @ X 1@@V X* 00`00P 0!!00S00/hc"؍& 00S00/7"& ///@-@H6@P ¥( ! @K؆&-@-   Ѝ Ѝ/ -@-  ЍЍ/ -@-  ЍЍ/ ///@-  Ѝ@-  Ѝ0-@-   ЍЍ/ //////P/ @-P 0A Y00ЍQ@P K@p@-0P `| @P  \*. Q  Rp R  (  p 0 B &m-qA-P @`p>3S SVS" S1 S. S, S js&3 S S S 3:s"WpV`p@D>sqp>3S S "S @p0@- 00 } Ѝ0S/1>3 !/0S 000/m-0S*p@- @PU P p Pp/0S/p@-0P @R`*0 PQp0Pp0S/@-@0 0C0 0  (  ( 0 S/! ^R/@-@0 0 0  $  $ A-P0S@`$0aH U ( U ( S 01 BpC B!0`A-PRp `@{P 0!1000A-@P`p쁟0 SV1 V00W W0Sc0P 0 B 0  BV  B* "M A! AC`0 F  B8  B "/ A & `PpG  B0Z  Bv`FPpGo`FPA!A-a@0PS0<R&*1 21<0S 0R ,0PP0S*!!! 0R ,00S(!!!,p (S0PA , (0 ,Pt&&܍&A-`P P0PS\ ]\ xp@BX T 0| XPPps&0@-S@* Q 0S0000 [Q.Q000 S:0S008000R .R ]R00m-< 08 C800/`Q'Q!//&0sA-0p0@P`M⤂ p00p00pS 3/0 S*tuPD Q3 R6 \RA |R>0S 3/ 0S  0R0S00t0SN u P0( S,* R)\\&|\#00 |R 0S |0 3/000Q R R0SS*|\0 Q QQ S: 0S   B 0  BЍ 0S 0 c 0000  B 0B B0m0 "0 00 0Wm-p@-P@0`RP@@p Tp!Q 010//!,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0P`t&&܍&O-P 0R@pM X՜ P&  <Μ P 000Ѝ 0@   RPP ЍO 0 PS@ F 0 00<00S*^Q0R08 ]R00-R @@g Q* ]R -RS\V0]Sj-R0 Sc:0S006000S80S 00000 |0 hS ,FhVKX ,0Sq40Sn$0Sk<0Sh(0pwd  0(` pc 0@`F p@ ʟUh 00C0c-R [RS :R =R} 0S: N .S0,S0`0`0-S]S0S0`0`40\ 0 IY0 S:0`S0`00S00``E0 ⲟ0I{P  0 (S0<B(R$ QP    tP  $0  0$ 峠S0tS0`0`0-S]S0`S0`0=  0 S:0`S0`00S0 -RZ QW]QT -Z00  YI 0S. Y0`S 0`00S0<Y00 Z0S  Z4 0PP  .  uI400!0ⱐᲠ40  7P0S 00100  *P  %P (B(N [ 0]SS0<V*0P80 P <0S P pH00勰P00 0  EB#ЍORW =RT ]RQR :R ]R001֋ ݋ t&m-&&܍&p@- 0@0 (M! 00 x l0R 0`0]00000P0 `P(Ѝp(Ѝp@&&܍&A-0@``Pp\U [U_0V:0dS0`000 4\U=*Ux .U; 0Sf0 `S xAPu 844U\ 0CUUt0SU 0`B }t  t 0D OU &83U F 0  , 0000h308@0S* *Q2  0  B  BA   B0|  B5Ѝ 0  0S 0S 00t200}PT\QR {RO00j0PS;* ,R8 Q 6 2000/ UU0 R  !   h0 S*R\Q}Q00 S*0R S\Q }Q 0<00S 00$Eo/JU @0` V1@`(p 0 S *R \R0)S ) \a V 1L  0 S *R \R )R003 0S00000+m-)>{^ ]&@-0@``P?Q $0A  R % S 0^Q [Q \Q 0S Ѝ{Q |Q720V:0S00500 @0` V1@`(P ?0 S*0)S  ) V 1L  ,0 Sf:0S00l4000 S**@?PQ{PR ($  "!,Q 0S 00300\0 0S 00300?P  *P 0 B-  B   B0!  B0Sw* *B?RP {Rp Qm 3000f b 0)Sa  0  $  $  0  (  (   0   000p0<20to kmi0V:0aS0`000<Q >Q x`$P |O &   B 0  B  BZ  B. "Q A% l0 `S0* ,R-  0000< V0 R   0 S*}Q00A R 0}Q 6000S 00!m-&^ ]0S G- `M pQpG DpL/@P 6W:| ЍP;PP P $PPxP @,P 0uPP6|    $ ( , 0P4 8 < @ D 0 t000L R:0S005000 S8:   0A0LP0S 00,50000Y`  p0 P>3S! 1Ss Sp S <0RpQ00< 0 g  SV S<0RpQp< 000p000Q S S SS7 S S3 *S >SQP>3S S& "S 00 0\ S:0_0PS, 0E10S*P8H@00CU00C0 RB  \ U B!U  1 EU, X 0C^ဗ!1LX0RU!U!  R0>P P PS 00 00H0@0 @000 0 R00d000bM 80S@ 0Q10CRZ/TUUxtԍ,tm-Ee,1p@-0@S0<QP: 1,0R04S"`$0V):8p1P8 S50#p(00<^ 00^ 0S8opU 0! R R0 0wP`t&&܍&0p@-0PSQ@ʡ@80P p<0S P pH0@0@P(00Ppp@t&&܍&O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(   uP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ &b O-Pp`0,@Q V >\# (\ \Y \F \Q `P \Y \[ P >\^ \ \J \04\ \ \9 "\\ \I \ 0K \ &\{.\' *\ \08#8S \ {N ^0s 0@0s08#8S{0[00>@4N5>5. P`F`FV00@>N>0> \0C~>!0>#0 R@u @O-4M0\0, 0(0 000@$002   0 X = Q  0 R  R  PZ$P  (    R    ``S  R  Uj k V pw p (B( _U RQ v   _V R up  (B(   _U R w v  _V RQ ppX u0^ v  (B(    _U_V QO  X 0FPyu  p $ V    upv  w( ppu  v X pX qX0wo u`  _VX 3"  Q$,ZS (  `X M 0P#v  _PU PRPU00000S 0R0 4Ѝw_Uw^RwOu2&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 YS  D>31># R 0800@ 0 ~Y_  DS S- S* S( @` PS 0 b800@ 0 YY  DSU S S 0>#0FϠ2@P0  =P0  0P P 0,VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0 PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  xpP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ &b O-pP,@ W`> ^* +^` ^i ^O ^a pP ^o ^Y  3P A^x ^ ^` ^07^ ^0* ^G "^ ^l ^ R m ^0 &^y$.^03 *^ ^ ("(R0 ^ y  ȠLȠ \0 00 r0     0s08#8Sy0 ("(RY 0>00 E0  ?oR20SpG pGP t0 00> 0 0 0i 000>301> \00 0>000 1>3 SLO-u!&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 ~YS  D>31># R 0k800@ 0 bY_  DS S- S* S( @` PS 0 F800@ 0 =Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-u!&O-pP`M80U:Ѝ0!>3S S8 S6>S1 0 800@ 0 ~YS  D>31># R 0k800@ 0 bY_  DS S- S* S( @` PS 0 F800@ 0 =Y  DSU S S 0>#0FϠ2@P0  !P0  0P P 0VP 0P   W` 0 PE >#P   0T 0  0Q>SP!>#"RPEP0>#2  F O-P@pMDT0@ #W # 2RS T| z>#R  Ry R R Rg 0pR0R T` 0 PfY Rl & R *R` &R0SM 0000_Q0SB 0S00 0S9*0T _0S 0R0S.Ra R 0R  _ R Q R) TQo_RQ_ B00/o00"P _Q0R TЍ0@P T @00S00 0S000S00u 0S*0S0T S00S 00SP4 000_\0S 0S00M 0S *0T _0S 0R0S \0 o_\P0S00S* T00000_R0X0 S  _0S 0R0S0p>3p1># R{0G0 a>#RO R[ R] R" `R Rj R 0 >c0D2H0‚0@0 00PC0A@?>c pr6 pRHHd\.H A T0(  ziP!0a !R@ pH0 0@000}P >cp0 A|0 !RJvH A @ >3  0GbP 0G>#`H0 00@TP01!># R 0 p`>c`1>3"S`F >3b2 ؀ D H0 0@000,P00 \ &b O-lM`-PQ0n @-Qi   e        Q 0#R`S- 0pp WG,[ 4\ 8^| <HZ01S 0s x[BoPR 0C1!S 0E0p [Z 0000 ,@4H80gPZ VD0Se 4P,0@P4  004P HP lЍ,0@ 0S%00D ;0$0 0D0,MP5DQ/*0 G00, pPD% 0 00, P@@0HP 0000 0D0,H0SVPHDpp`V 8 D0pG0C0V?4p 0 ,0@p@0P\ 2 V0AAS/ 0pp W ,Q 4^n 80S$0j <HZ01S 0s xQBo \R $0C1!S 00p Q 0 000,@4H80: 0; $ $ 20f< ; Q0@-M@(,4`0  P#U `0`/"`o R?#0.o^,AU-00ĵЍpFW`&0@-(M B (@{Ѝ0lQ0@-M@(,0  P#U` `0`/"`o R?#0.o^,AVU-00ĵЍpFW`& 0G-M@0p`W PV P%Y P.X PmZ PNx P4 qW Pf  }q xqV+  qq lqY  eqt `qX5Z! L Uq< Pq ЍYXZ-  ?q :q  1q ,q Ѝ #q qZVY  PЍG 9 9 9 |9 t9 L9 L9 9 $9 8 8 |8 8 D8 L8 O-PQ0 M0R0p`TT00 0 ξ@P @0S nSc a0CS0PL PF  ЍzPzZ V000U000iPLZ V070U070@XPZ| V000U000GPZ V000U000ZW V080U0800oS )PU000V000~0@DP 0P  PiZL V080U080]P~ P PSZ8 V000U000@U080V0807U000V000.U070V070%U000V000 ЍU080V080U000V000ࣀPZw ZpP XP 7 ܤ47 47 6 6 `6 P6 5 5 X5 l5 <5 4 5 3 3 3 0A-`M 0 P!!0@H@>SHPPP PPP8`"`!P03 pP0  p, 0 p@ p@   p@@@d0 PP0 P P`Ѝ00@O-1MM @PDP  8 "( p C. ` pX @D;@8 (70Sl pp  ` ᰑ 00㨱$ !`%0m p@ t0!0   P P o 0S R001ݍЍ蟄0S 0K0S Rr  P: p 0H 8D<4! @ P0 0f0Z  030h,R < 1ݍЍ p\2 (2 FtH1 \1 \1 L1 gt0@-P@M 0  PNp hp@ P  $ Ѝ00 0 Ѝ0@A-@@0s/ c PP0P 0:p` `' ` 0`0pp X`p `` 0`0 00ꠁypC-@PCM1 /sP3   pPB `  @000 t2 @ @P0F0 @F~x0S VS00 SCލpt@@0S@\0\ 0P@0  P@1:?00@ꩃ00@wd- l- p@-QMP4@SMZ TE /qsPB QP0s+ ~P  QaP 0`c9pO @ 0@2yqpF @ p? ۍЍp,0si/ 0p0! +m.@0 P@0 : P@1:A?00@p 0440#S5p@ +00'@$@hww~v %@8~Dv+ + @-rP`O-$(X,p.S`P@+Wu00Sb [0 0gP: $" 2Q > !4"0x"3S20*rW00Sa [0 0f P : )" 2Q >@AQ!Ou0 {0Qq w{` f P : 4#0"Q . ![0 0fP:t' 00{S' w{Q e 0fP:  4#0"Q .@AQ!O[0 0~f P :[y'@w{ 0nfPy:0 )Z@0S20n2" U%> "Ww{T Qf P \:4# IT0S20R2">" R01Q"Oi 0S20XC"""""""""""p@-@M@ AP, `~0P 0PQS[01S 0S 1=S 0S1,! R 0S[z 8<01S 0S A!,! R04 S:t000Dpx |0`lx0p40|0pt 00 0V\0P0%` 0LQ0 =!01?, S(00c!1$0 %X=A03Q F< @@IP ( 01CAF,  /PT$ 0P  [ `0% [ Po$0SP %0#Ѝ00Z`F* 0C!R Q!,! R4 @Rt000Dp|0x `x0p40|0pt00F ;`0V1000QP0% * {˟ ,!\x ^4 S*P00T;$ 01P `% \ ,\Vt000Dpx |0@x p4 | pt0@0 P0@ $000L;0,^0w <P0r  0=R@m%0@Dh0H(00(0000,00,0> F 38<PKR Q F"x&000 P 0S; F%0S 2  Q\(8s< F`%d  0 Q0*0^*r@s!FP&T8@<0 @0D 0 0h$% 0S 000000(00(0,00,0(00(0$Q0PS (R" :"  R#Ό01"?!x"0$00$0 00 00000S <\ H@NTLX \ h@0Dh 0RLQh$hs` &0Ph 0v> 0`0?d000P0?T0080?<00@0?D00H0?L00/X00\ 0 00#JP0L dS<0 `0d $F%#F#"F$!F$ %/(0S  R $ R$ %R  :6$4&60%E!$0/!!> |5 Ã111N`ş P ?$LUE ?H /$ R  " RL@\P E%/L@< 0H 08#1 _LA%:6$4&60$$$0$΃4HP#111L4 U >.0tT0.ό#! 0 0PL0LHP 00UP00 0T 0#0v #$0S"x$0S"x0$0 Pl3@h0P :($^0<P0 0=RH H %0h00c @D00?v"%:600$$0Ϡ! $>0H!!!0C" RH 0H  Ό l" U`? PŸ 0/  "1? A  L L H0U 0\ 004 $ P1@0P 8:P03 0<R.$0h00c 00uL!%:600$$0Ϡ! ($>0H!!!0C" RH 0H  Ό " U?  0/  "1? A  L L H U0 \0#ԊqlȈЈX<""""l'.%Q(\)\²0  0C0  BQ $0 h00$% 0dR@  T \PPQ&P@T8<x  \0 Q00000SPT8< b F ] 0 F!W 0 !Q0S(0Si P1@0P _:c 0u00%:6  00$ 0Ϡ! "$>0!!!0C 0 \ H @"UL? ,d 0/  "1? A  L L 0UH  R0# F# #$02p rp t t   0 RN  0 & F%F000 P 0S %F000 P 0S!F% &( $@R00<\=QHPNUL0X\m@ D@h0 000$00$0 P#R R  \Q% 8&<q0dP(00 00@ % :60 0!$Ϡ0! !>H%0!!!0C h% Pp5!" ?.Q!QT$ @00 #0BL00 h00%H100 B00 00SD ^0  $0h0 C0000S3 ^ 0@D h0 B(\0 $0h0 ps; 0B &R" 5 O-Mp@$=z04l09z0W`0 T& 0 2c1  嘀?0<WPP/ 0v> 0`0?d000P0?T0 04 80?<0 00$$%"P˟$@ 0000  000T ;0h0PL 0TP dP= P> $`Pj0Sg Rdʰ R `ʸ R \ 0 0` 0`@Sd ?O$@T+ET0}N0`@d0y0@pD 000000 0G0v^D\Pp \ PE pϠ \PH0P0l0X00 I0h0 pptx|PWxSR0S S00h-@|0Ux0Yt0Zp0Wl0 Rh0 R{t ZZ8P0>C 0C0p00@t0` VPw x0S Jy0ptp000@48 h000lP ' 8 PXv> 00!0#/!! !.w/ B 0Sǟ, ǟ|?'P PȎ00#1?\v.C BAQS| \xt Ptx 0 qpp I 0qp ` V@P 0 ?oR20Sx0 0ߍ 0x0h0qp@ 0V Q" 10!R@-NS* h0 P0,Pb000 `0  ZR 0`S 00@ x0h@ Sxx0S0 !0V0ZS 0#dh `90hP0? T000h80? <0'0h@0? D00hH0? L0X$`\TZP M`-xT00*x0S@T0ßs"bW2):##c2S#x0S, \TP)g<8PP  hß嘀dT0CL30@>w0h00p `0@4P8P ? /' Rß&0Q 0Y/0 #10">/ 0C!a 0C0 0"#0R"P#. W#0,npW10' #ΌQà3\!=30S C! B^ D 0  Euqp> @ (p?Ow#00w0S @㼠0h0%@qw00@ ߍ輠Z) ZZʒ 0 ]w Q 0  s!P OwT00Lw0S10'` #ΌQ0"c01 2c1@Tÿc0wT00LXl)\P(\ ףvɻ %I$@-@] LDpTat X00 R 0 R 0Q/  /  L  DQ 0@-0P S@@H  ^0 S  Q 0#0S0 0/|Lp ` H  Q j.0 0#  Q/K00Ɠ\ 0@-pPo> 0@" \ 0 /pKA-@P `p@P0% P @PPA-\@`@P pjNP0& P @PPpJA-\@`@DP pH@P0& P @PPJO-P M pP9 谟P n`P P @ % hP @P0S  Ѝz T W o  [0p0StI A-pPQ `@Q 1P 0@DDB(000S  PM 0 A PЍ00@-@?PM 0 A PЍ00-,M 0 LPЍ --`0$ S   0/ 00FFp@-P^U@pgs? $0$`0 6/pPF$ p@-P]U@pOs? $0$`0 6/pE @-* @P 0003/E @- @P 0003/dE p@-P?oU20S@p00 03/ Ed p@-P`UV00P00S@p  P05/D p@-P?oU20S@p00 03/@D p@-P`m @Ppr$0$ @0p@/C p@-P@P p 0 0 03/pC -@- M  xp@(0(003/ Ѝ@ Ѝ/LCD @-xp@0003/C O-`,M$ ХP @(g$0Sp,ЍnrХH0$00<00 P@rХH0$00<00 P@ $0( 0C\ 0 CR$ *#0$00S3 5$07$050$0(0,0!PpO-@Y PDM@p, fo@ [a P @O [ [8$0P$ 0@Y Q< `@@ QQ3 Q0 S0A1@ 8 ,0R h S,3 5407,050,00 00 Q, P0Ç0,  0, 0 Qa@Q8,0P p S>3 57,05  50Q,0g 0 CQ * 0CQ,*# 0 ,0 0,0S3 57,05 50S 5,07,05 50S,0YR#00C RL00C F5$0qS<3 57,058`0,0= A/of[" R  :AoF[P  f[ AA0@ \Qop,0 S#3 57,05 50,0 QS 57,05 50S,0 R#00C R00CP,@DЍQj p`0t FQ)Q* AR bQY fQ ?R0@SP p b7rp@S B:p: C cs3<2080 S ,0 S,3 5407,05 50,0FQ0 00,S Q 507,50 , 0 5SQ= 305 7,5 0 ,Mb@0f`N2$0?Qa R^  2! a, A0! @ `3 8 Q,Q<3 57,5 5,8Q,  P,  , Q0@ `0 _P$ P! QP3 ``` VRQI[  R `S` 0P0`\ P\=Q,0 S 57,05 50,000 R,0 Q ,0 0,0 R0`S<3 57,05 50,00804Q,3 547,5 5,y ?R0@S@`0%#jo%#jx"^%ju00@-MB0@Ѝ0p@-`PM0@ 0 4/ЍpG-PRM\  `UpP*/a@^P D1000< pp Ѝ80S  1 000< ppn0S Ѝ贠 n0S 0 < @x0000< @ ppn0Sn00n00 < x T @-$$@M ЍĐO-EM MaX@P+p `E'Y [0P@)T 0 [0P@T 0 T0EAP X XUEލ ЍMn00Eލ ЍFn00  @-@` pMPViP* /L[ 0R rR  P   P @0CЍP  rR 0rST 0 @0 Ѝ@wn 0 t $ D A-`@ p 0P/S /[P @0 Sp 0 S S lp@-IMM@`PP p 0: S X0 0tp IލЍpmO00@IލЍpm00 p@-IMM@`PP p 0: S X0 0Ip IލЍpmO00@IލЍp|m006 0@-@PM 0 A PЍ0P 80Q 0 08080//p@-@P PP`  3PP u ^P  p@*1PPp--00 M (0  ЍЍ/,DP --M  Ѝ Ѝ// -@-M O<@P@ 00  0Ѝ@Ѝ/ꨊD0-@- M@OP  Ѝ@Ѝ/O-q`Pp,M;  PR $ Ppp @P$j0 PY P@ 0 @YP N ,Ѝ000:Q!0P00,ЍT0p@-@P(M & (Ѝp0 00 금Dp@-`@PNpp p@p@-P000 0 (M` l& (Ѝp\Dp@-@@ @  `  @PNpp p@k Dp@-(M@PrNp B& 8 [(Ѝp@-@PP P  ,M` @XNp (& A,ЍlDC-PP,M/  @` p`FV`R V @`0 @T $N ,Ѝ00 0:2 0,ЍT0p@-@P(M % (Ѝp0 00 Dp@-`@PMpp p@p@-P000 0 (M` % (Ѝp脅Dp@-@@ @  `  @PMpp p@w4Dp@-(M@PMp % 8 g(Ѝp@-@PP P  ,M` @Mp r% M,Ѝ蔄D P $ Q80 @-8M80@08 Ѝ880/LL0000 0<Q 80880Ѝ/4lP/0@-@0@0 M0S 0000 X0 x0PP 4 d00B/P00 Ѝ0@MP,<`,((D  O-3M0PP 0 @0 `0Dp@ P P00U pp0 0C% Z 2ATT00  RF LD@D T]:[ 2 0000~`K L0 V0 W8 \2ATT 0`Fs 0Ry L 0 J 0 BD0SH L0Ѝ0 V  0 / L ` 0 $0pHX;0S2 0 Lv 0 B @ 0 B  B}L`FtY  0 B  BmL 0 z bL 0 0S 0 B00Ѝ 0 ]ꄂ 00 ~Dp@-@P3Lppp@ 0RS00 /p@-@<0<00P  @Lppp@ \~D808 00 Q0R00 /~Dp@-@`PKpT T   p@pp@-@P\ \  ` @KpTT  p@ph}DO-!PP Mn 10, 0D`S1H0?a0P^1!p !q1 W0C@(t  ,0@@KDAA|` Bp2  W R ? P QQ Wt ,0 000IC11{00Q0 0, Ѝ000=|0 00wzD@-@0@ 000 @T 0AP80@080z@-@P "AP80@0800-M  Ѝ0-M  ЍO-ϟiM PȡЁqal QP@ P? `K͌U PD? K͌T P? F͌(Z P> F͌(1S Pl> C͌ X sP$> JB͌8W aP= ̌V OP= ^B͌`d=@ 0S078H H0P `P P  P P Pt P T P0 Pp( qP P`P (aP Px PP'( tQ780D0x100C40S000C,0h0Hp0L`P$$0PQ ,0 p0`@ , V @  f`W/0!1AQ 0 0 @T @vT, V   @@dqXhP 0Z  Piߍ P 1 S  ,00 0! 1S 0D 0| 0?p00AP,,0`L0!!\V, @  B  (8<`@ [$ 00A00@S9 00a1 P Ua PU, [000 P,0匠0Zp(0p1P0@`@P㏼P`  V 0@0@S P8<`@P$04 0R$0'HpL`P1L0Ϳ0P@@X1(@P0ſ0P0$001T0徿0PPP1 PX0嶿0P0000寿0P0, 0pBPBHPP@ 0T8`<@OH U,` p@PW 0g1pV@10P00 00Z00 mZ,0W0 P ܰa[@@PP  Z @pV @@ PT 0P@ UT0@0p8`<T4 ! , <B B P $@0p8`0[T0, q 0q00` p @@HP\V 0f1`W10 @ 0 0 P00U00 PU,0 V0 @ PqY0P@ 㐻PP  U `W @@HP\@4P,00 0 ,0H0 V 1封0D|Af>p`FR ( `d( d( d ( d(  d(( Jd5( dB( ^dO,0$ 1@*,  BU00p@8`< ?,   , 0 H T0封.1D|Q>p@T[1 0p8`< T P 10 0R_ (0Sk ,0P0 PXC h!(0SY L0!11 @ T p @ T,00 0 @,0 PCT0p8`<,04 10 ,0 H0T0 就!D|=p@!(0R1P@PB㓺0P@ T  0PyT0P0,0ST,0 00C, P P0 X" 0 0 B00 S: 0T 0 q!1 @Tq` @奼T,000 @,0,0Q@ 0@1>PpP`7 Pp- W  `P P$0SC ,04 1@X h!$0S5 P0!11 ` V  `YV,0 0@ 0 `Tq$0W1`V W  0 0P`0p08`< 0,0 SV,0 00C @,p0 [# 0 0 B0!0@SA 0X 0a!D 1 P U a PU,000 P,0|!0RP0P1`@㜹0P` V  0 @ 30 0R80000S y 0p8`<^p!* p!:! f0p Q R 81 R 0SЍQ @0 0 0TEl0T0ЍSd<0l 0̃ S/O-D@p`ጤM[ +v(p( $W*0CS0S< 3,(1P 40/ $ % 0:ԓxs̃H pß8|.l``(XrPhÃPH弁@x840,( @2101: R 0S 18p10S pWЍQ h2 0 0nDPr'>ppGl`( )](@ T (0Ѝ>㠶rp<㛶^㘶v㕶8#㒶:㏶0'㌶#㉶0z# 0儶H#ぶp-~-{`_x|uorporlyizf{c@|`h}]`a@R $ T!@+!,%!-!.%#0#%of&i`"%{j%k %l%m<%nq%t$%u4%v,%w%x~#p#rd"ye"z|,<l00p@-0['N( \(0S(@pTO-8g887M`  `P `0ǟJҭp 7 000 S00U0S}Yp  @00  4` S 0 `0 40 s 00bR$ 4S4 0((&00 Ѝ$0 s 00bRS4 0㋰ ?<21 R R3 $ ` r  aR$ $ Q ph0  T5 U0pS p ! @00 4 ` $R{  40 0 ;0P $Q B q/ 0 ;0 Ap4 S S040ST 004 0r0  cR$GU  p p P p0np P 440 s 00bR4 44300fS t30l3#`e pS 83003#`V p 30 B  `40q0cR 4S02$00$0C?o r  aR$2#\ p SW p  0 s 00bR40 ; 0⠴p P `R pa 40 s 00bR4 4$R40 s 00bR40  ;0 ~p E  `Q q 4 00 0q0cR  0 ` Ѝ 100 ?c p; 000 ?c pv/` 0 `00! 0K 4 00 40 s 00bR 44 `xL@$ALQd( p@-P@,0 0 PSZ TT TpO-T4P@P0DM 8 `$Qq  :Q#R3Z 300S 80JP0@P@P@x@-@\UP `VUP SP10S. ,P: 0@S0S0[S0mS S@ 0S 1 CR'0@S ;S 00C S00 0@S0@S mS 0C;S P   0@S;Co 같 O-0`fS`PpMHvpJP T0 pr(ʍ"(0 I"Rp (0$00 03SL<PK {TB<P r 0XSڄ%$ xT 0l50 d5"004S03P00S5 p0S2 4S, 4S 0d%V、匑Tp"2 2Pm 4p2Z& LQU# P P 倎P @=oH5S4S 4S0?o2 *04Ytx2 PtX  XTP3Zx2  OTPx2?;~0x2V  ETPx278x23X|2 PV t3|2gЍ0 D p$l h $ <%$(LXi TP Y TP Z# TPp2?;~0p2|20P?0 r("(0%H"Rpp2ZPT :xp@-0 0P@ :QQ à Ãp #Pp% :ep@-0 0@ :QQ σ #p P` :Qp@-@0@P:#R   #Rp @8 %8 "R--  p #P`p:pp8 :p<D@-<@<0@00:3S 00  @-8@80@00:3S000 @-0 0@:#R&#R) -̌“ ƒ$@ $ "p" #ƒGP`]:#Rp@-@0@P:#R(#R+ P- ","" "- $ $X R p # P`p :#Rphp@-PPP/ 0@` :QQ" “Tƒld l p #P`p :Qpph0 0 D0 0 D@-@ MZ)AqQp* c0 0 `000050 00508003 Ѝ 0< 503 ЍL L0 0`0` Vj#cP`<0 0 000:P/@-0 000dX0X 00:3S 0@-p  7CP`/8\0\ 00 :3S 0-p @- P`/$0$ 000:#Rs/d$0$ 000:#Ru/0000 000:#R s30/(0( 000:#Ru30/0 000:/p@-P0P`@0M0 0s p 0S|000 SC q R 0:#Ѝp R 40,00 3/ЍpPht@0A- R BP0@SMt QP 0S `^ 1 P00p 1p0 Q61 1`p0V0S  l100V0S  034p PB 03, p F/$%ЍP  QÁP 0:|   000 00M0 ` 0@M00``Dht@0DP@-,@@0SzM00 @-$@@0SkM00@-X@M@ 0S Ѝ< 000 00M0 0Ѝ診,@-h@M@ 0SЍ M 0R  (00 Ѝ M <@-LBL2@P$MQ :cVW0r3p pA0Scqp 0SQ1p0SB *0  B0*1`00|PN 1@ 300 R 8 D 300 X30>0 g :3,p 4 KP`$Ѝ0`00|P @  M 0R` 00 `L00T @8 300 L t\lܷ0pC- M P  S L`v<0`00:3S V f Ѝp   0 000:3S/C X0X 00:3S 03@-p @P`/t @-@0@ 00 03, p P` @-<0< 00034p @P`0@-PPP M* 0Q0@00xP 00 02000*C= Ѝ0|P H00 020000*= Ѝ0`l/0@- 0 @P0:R M# P P&tP 000 20= Ѝ0`P D000,PP Ѝ0|l0 000:!-Q0 S0 0 Qp@-@Pp80pPU,LQ (0 P0C0S0 U@Tpf#80pP 0S,01///A-PPM Q@`Q00?`FV`V` ,p(L 0@VЍA-PPM Q@`Q00?`FV`V` ,p(L 0@oVЍP/\ 0,  B0/\//A-`MVP@,p(L 0@CTЍA-`MVP@,p(L 0@)TЍ@-PP M+ Q@7`pV00Ӣ?0`FV`V` W ,1( @Q Q( Q Q V Ѝ,@ 0(@T0 p@-PU,NQ Q@(`@0@@`` \0C 0 S0Up(,  0 R S0/0@-P0PU,LQ (@0 P0C0S0 U^00@-P0\0P#, 0 BP 0 PU0,LQ (@0 P0C0S0 U0\0O-#4R lMVCT_ ,PA^@8 =$^8R@ 0000@0pP 0-,Pp4S-`@PP3@ 0 00p) ,4, [ 0  C 0 R lЍB0  *9lЍOV0O-:$M$pdZ0  r$ CPUw P0p 0 p Ƣ Vp(:0PSH8 0  ,@P$Ѝ0SI S5 SpV  bHp0004S$ЍOAp @0S S SpU 0 Hp`Fp@0SF0Vᨀ *HVp P @FXp  &Hp`FVᦀ* P@Xp P @0S SVp @Vᦀ:Xp PQO-PM 4 3`S,[*Y= @00! 0@ @00@ BTP/ { @p ` fPPE @0S 0  Ⴁ`PЍ` D  P 4A " 2Ѝ @0 t P0  0 /x404 000S :P /<0<0 0 0S :P /404 000S :P /`<0<0 0 0S :P /404 000S :P /-DD 0\ ʌP 0 ~@-|0| 00@T 0J#4R B0pQ 7@.P v @0808 000S :P [/D0D 000SP:P4@//\000 000S :P /L0L 000S :P @-p @k/A-0 00pW* Z3$SP! #R`@4Sp`3@Tv A{B0tQ  7A6.h-0    p000 000S :P Z/TO-00 0 MX% p `P 0 <p @-P  0 P0p@ 0 5@ n Ѝ@P  P /p@-JP }3S P`4`O30PVI  0s3 S 0P 2 $R 0X0S 0D3 20X #$04p03pp0Hp@-jP 93S @P4P 30@Sp@A-`Pf JSU?sW<  @P3$S3 SW*0N, SsH0S0 WP3PSSpP4Szpp3PUp,0\4000?a000401C0010L10|1spp@-@P PX0:"C0T0XppG- ؀\/P@p  `፟P LTL VW PT VW  P000S;0 x0 0 |O-($Z Ap`P5P@8P ( DT29P* T /P 0 D @00 D0WXT P  RX8 @(  !E@0|d @-?C0 @   @ (( D  |TA- Q@PP% pW# 0 0S0ȝ,Ɲ000 R   R   R  P F屝ᯝ4嫝`T `TX *P Q Sp  QW02p@-`P X0@:R0T!RS   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @  @!R@  @   (!R 1S   08!R 1S [P00SpX@ '(@ 8Q0@0ppp@-Xa@P`Q X0P:20T1S/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  \00S P000080S@078@0p apH0H 000S P@ ?# Q@ 080//DD(0( 00Q0/D(0( 00Q0t/Dp@-P0P0 0@R` <@Rp@-P@00S ^ p@&< p@O-pU,  pW$  0$ 0 00 0(p PEU` 0 兘P@@p  p> Ѝ-,0 (0 M0 ЍdD- M0 ЍC-@P M(p, P00S 2`0 GR 0 O@0L"Lb ``8 Ø 0( 0Q 0P00D 0G?o P20Sp0q1QH``00CQ000 Ѝ0`00SZ00&0   0T S00% , W10X0PXpq T0pGR Wڠ`P`W 0  pP Ѝ80  080 000 S0CpCꞡPvp@-`@PU!pp 0p@- M Ѝp@-@T T  M` @P4!p 0 ЍpDl l0 00S X  8Q Q @ ,@ /&R//|DH H0 00S 4  !R@ ,@ //D`0P0 T 0008!R !R @0<@0/6S//<0P0 0 0001S@0<@0//0l0l 000S X *" (Q Q @ ,@ /&R//D$0$ 000S @ /hDP X0:20(!R !R @0<@0/6S//0P @ /A-p@Pp" 80  P` Pf  _ D000T $000S0H0H 0 ?o20QQP T//D000 00 0RPT00/DA-`@P`$ 80 ! QP}p~ P eS  800PU  000S0l0 00D?o20SRPT //0PPT00/,0, 0000P/P/4,0, 0000P/P/O-h3@P0Y Q T# PU D#00SPH00SPQpP0GP0HS``HpHW, 0 ^  1  !!`<pGPI@Yep0S a[0q SV,0 0D |000 P0pP`a`0IS`IX`a,1 \  0  !!<pW`YHp0Sa>0 S;,0 0D | 0 00P0qpI PX 00C '0HSP 1TX[00CS``[TY0IS`YPY0 0CPY|0 008Dp@-@PpP`0P0C(, ,1C B00R00@UpP 0S 0@//P 0S 0@//P/P/P/P /P/P/(!O-PP , 10, 0DS 1H`?c``  AAp0@!qW#갑@W0 8 0| 0p@ P@ 0@0 0CX*0 00D\000S  Q R P (!00//sps( \/Q,0,  R/1S \/\/1S \@/O-A1@ 0QM5 P`p, @p 0S# Ï#SÏH000C  ```P 00(00(00S0000C00T0 03/p 0PS@  Ѝrxr0q(0A-S$'p`P4@(0PS@Q Qa ppQ p 0P(0@Spp(0S/p@-`@0P (0@SpP0@-0^ @ 0 Q@R0pO-`@ MP VT``D0S  00C(00@00 T0@ 0 S `&, 0 S@p @ RᴀD`Dpw `| p Ѝ@0 S RR Ѝ,P d,0ݑ0P 00X p  ``F , B,(`aaA0  T p0D`4ᲑP  Fp`,004@ 0T` p0Dt@U   PB  0SQ 0 0PC 0$ 0\R <@U 0 BQ 0C R G-l@P 0Sp: P PR E PPQPEPUP ` `R F `0`S W0` XP0`F`V` pW 1 $p00SC 807`PL! R@! P( 4! R# $! R  R 000S1Q0/P00` 0S0  0V(W ѳ`F`V`XP0U0P`W`V``0 @p 0 $p0PEPUP 괿D0PQ8 0 /$ $\/ P/ PQA-a@`؜1Pp0$ TY 10 0 QT$ D 0R U ESpL @10 0 QT$ D 0R U EAp: w0 0D  Q SC$ 0R U E+p$ 0$@ P0*@0B0TP @T 80@Tp` 0Q̼D0PQp@-P0P`0*Â$ @P uT00PU pp 0QP- 0S* 0@- \&@T!\8x ƌ8 t @,0A0@PU 0P0U00 S0/0?o2?=XA-$@0S00â?P4 0\/@0 T`A pB 0S%0^! 0S0X K"@0 0 0 9@U/P 80Q@0@08080//A-P  0 BS0@( p`0,,0A0C1!0 0o0`S@( 8XE?*00@-B  80 P R00 8 $ P R  R0 00S00!R0$R0 R d1S0800800080$RQO- M4|ڌ`ᨍ@Pu 0㈰(᠍Pp,q ᵎPP0` Y4& 80!S0` ``pX08 0 T``0a$ <@0H0|0L P08 4!\08 `0d0h0l0p0 ЍP4- bP' 0*Q- Q80 SpG V P  PʪP Ѝ ቏ᇏᅏ჏@ Ѝ{ A-0QM@PP(C p`QAR   B P1 \.X) P$,P@PP H0 DH00R00D p0$`P!b@0SЍPЍ脴@-M @ 0Ѝ@-M @ 0Ѝ- M ЍO-M@ā` HP`JU@p_WNVPED  0  PI xL1D00S*Y p$`(D0p0S0`@0,0U00 D0U@pC@`C0Y Ѝ00H00H0t  P PEP` V IIP ЍP @ꬲ|$00@-0@P0M t  l 0 B/o 0"00  lPP :Ѝ0PЍ0̰D@-44@M00 MЍ(QP-D00M  ( @05ЍدP8 /00@-MN 0N00 P@ 0 0E DЍ0QPO-4ŸDM PPhlpt@x` RK SL0[ B\ 0CQ@A PDPU A@A\UQA PNPU[[H p @D11A0100!0lp,00@0@0-*@0l @ V 0 000@ [@:  P Q [@* p0pW  DЍ 0Q0 AAO-DM(0X0lP,004 S80 S 0( S@@S@00CS@@h T4 L,  p04@^00^0\00S@80<80808080PX8EXC8U\PEA8pp00 8 P(@T ^F00AQ< ,0 (0h&h08C8S1 ,, P (@^ @@P8Ph4P XEXJ^ Nh4P.P XEXJDN^( n@@D ^, 1 00UC@0<0ppp8`! 0!1` A S `1 0C8#820C8#8S弱 80tD 0S 1P 0xX0EX UJGx08`, 0(0\,0!0 8C8  S^LPKL00D  @HDHT ,0Q0 (00S-L00S? ( R, LP S800,0 11$00Q$0 0\ 0(0AQ 0 , S(0 0 00,1$00 04 S 80p0L|@0H00D00jp 0SL01H@804 0,0000^,04 0Y0Y 00S0`S0F0Q804 0,00 1 1 01IY0Cڸ@LHPQP YqH @ R T0 00P P 00 SPS P*0 R00S 00P ɟ`V0 0CSp SqUp9 0 AS0 S P0P ` P R  0R  `:,00SO@ Q0C0G 0 S00( 0S(00000 0 S(00 R0 000:3s P  RP   L000Sl9, 0@000h0S(00S8000S3 80 :8, 0`V 00Pm0 0CS<0 HD_(D<0NN Œ Č Ȍ N LL\oɟ`VWY8 T0V T@00D R 0 R PPZ~ ! YR  uY $Rj  0E0 p0b   0E  @000$R , 7@  `@000!R 7x; 8000Vy00C000C0'd6, 00SA0X *1h"0 @, T60H 0  8 0P4, e `p$t00S000 @0p 1P11qWl5l%ll0 +@00 00S  05# X0:h280V @ 50S 0S4, 0pQ0A0 0C0 ꔄ 10#0 SPP 1 11RY@ڐ RRQs 0    k,Q Q !PB#`F p0p`P@ !?3 pGWaFP `/p @ 0  L H P 0P0P00 XX0P0P0Q^O L00S6(080 | 800  L,820 p`dЍ80EL008 0080@080* R d1SdЍ( 0 0: x \X1, `p0, Q0A0Պ8! ,\PY @@YP 5P0@, QeJ   8@,@ APX@T `P `pИCB0 |;P YX r:9110|/ /lPT` P @ p0 `, APYD PDI  P! Y   @@T`Q00 BCP`P P8p0 CQN @p0 0 0@4$<0S P 0,0[1,01`w @@[`o P  XPn0$00S00 $X0@ p4<PLPA\L0(0 0R( , p0 `, Jz @Z0,  \F `0x8 0'00@ 0Cz(@ 0 0800  x 0XPx    0Q0000 CP4`0X0H080 0DP# @P 80@0PL Z J D| p~Pc d1S` , 4@  TP:X X@ P T@DT H HH E@F0 0: 80R0,`0C 0B0X00@P `0 40 0E00 PU U R0 R  X R RR)0SC 0 R$  9, @` 0  `l@0 0p0 `_00P g 0@` 00 B0[ P0 PB00 p 0 P6+ 40U( R X R$R`V] 0` 0 0 |:, @p@0 0`qUH%RPP p RM $R $R X  ôQ R9 L5S<  (;, @` J0  `@0 0p=0 `00P  -0@` 00 B0 !P0v  Q0@00` 0  @000P  T P$ , x<@ 000 @000P" , <0 0 0 C R! U p=, @@0 0p1S U `=, @`@0 0PL5S 0 0RU p=, @@0 0Lp0 0 0 7@000@, ,>@ 0`C000` !@000tW ' u 0 U@`= 0 0LeP4Pj @00 pVU zʕH%Rn0 @@TI 0$ppP@<@U; <PP$p`@0 0H`)UpH50S0X0S* 0 0 0 0, @p@0 0H` U~0 0 0 @000jP$pPdYlP%p@-P@PPM0 0`0 R    80x t00 0 000P 0 Ѝp80 D000 0 B/ 0C?0Ѝpw0 00vDC-鬐M@P 048! \` d0hlp`PpPc80  D000 0 B0C 0/? 0ЍЍv@-@P @T(!G-PP 7 1D00SHp0?sppS/, ` !a@aT:#80|0`p @V0 S00? Q R!R0 S  u0 00tD 0R" 0R0 0#0  -QR ^ Q QR 0P //op@-PP0 @ @T $U0` VP `4Vp`|0P 0@PUpT` @T @pp  ! !@-@P@T R/A-p0,SP` @T @~T0`SP R0Q/ C0A "" Q/p@-`Q'P@0N "" ^ "" T \ 0L "" Q\PV@pp@-@@@0S DP$00C$0K(O-:z0M*p$P( ,pP \*00\c S@@s  nRXan HR @@j`40IS0c0@T ^OoB@TP AA  RT0)\ 0  |  bR\ \)` R&L) R! CP'$I@, 4R S[80S 0P0$ 0B$0X @C, 4R CPg S ^\ l( 00Q L80, 0@4(0RK0$$H 0@0( $P)0S700S00l0S$ 0 S! , 40R$0l P, 0S ]0P0$@P$T70 R(,Ѝ 470( V$(00 SBGg@`9 & (00 S4$&P0C (00xP0S  !P$00C$0(@p&  d60,@(@0 R 50,60, 40RofF`@ 0 0, $P,04 CS (@Rf 0 KRbڰ5%0  p p @p% 0(`Z 6q`nR `F(%` V ,00P0S 0P0$ 0B$0X@@aV  @ Q[Q $ 0(@0C,00 K[Z pH40,0@$!,1010zd4`000 P ^$ $@$#@ P(@h0 Rv ,,Zq  P+ x# E l# (@$@ ?#R W( , #\ $6 (@  P 00(@$ R  P $@@ lP " 20,  , l40 S \ ( H20$ ,B@0S 0P0$ 0B$0 $ 00P0 ! 뼱 00(`V7ڨA@ 10(`0 V0|!0`Fx P(`0S  0P0$ 0B$0@,0%A@0S 0P0$ 0B$0 @,0(p('h'&H,&&%%%%$$$$ $##0@#<##!!!H! |  XO-lsl3phC@00 S M ´400040,c`(,P Zm34@3`0T&#0C S402PK袟  <0@DS(00S00lP 0S 20 0 204@,P0T0hP \RP0 @P 0( 0CS P 20 0 P1040 ,( Ѝ00S00h0S00~1 0T0 @P,P  >@1(`0 R*T$ !P0 0 @T 0 R 0 P$ 0 0 00 lP @T00,P 00( p0  04@SSCPE@D4@P,L 00SL004Pe0 hl |,@0@- ,(4 00h@-  ,(4 004O-x1x!0 p *⨒YX!X P!0P[& Z( 0S!`,ppGP@0   R     P0 P00P0`SYPU0,@a@DSQa@U S@00 0 Q  ST 0\a0 00 08QD0S0l%R h%R /!R!RtP/P//_ 0 000 0P/,_G-MuPp/ 5` 80s2  S̠\D Pr HR!1S45@050 50 `\Pᴖ 40 00P 40 0z40 0:p@00@00l%R h%R 0ʀl2 0h"T0s# 20T0$,,h"h"+h"h"+h"h"*h" h"*h"@h")h"h")h" h28h20SJ\Q*gnSt@ Q _SP9 Q ZmSV2 Q iSPV+ Q `jS`" Q _SP Q kS` Q[PS 0Y[=20  0SP R!=-pRt000 0S@"R 42U8,Ÿ= @0A00+ 2bA`PU" 0S 100S H0 0YH0 ,N 0Q  Y-PUЍY 0   0 0 00R0  00!R 0ʀl2 00 !R 0ʀl2%R t5S 0ʀl2Sp Sn Sl Sj Sh Sf STc^,`l\\1P0PP PKPK 8 QD\B@- 00ʃlœ\ 1:t“ '@T tƒ'> 'tƒ A\ B\ ^tƒ    //Y,#$$1P0= 00` P7ʀ :l“3\0 /@ P0000CS000000000000000000/W#"@-@P@M&\\ Y #3t P P 00 %000 0pЍ|Vl`P -P\P Y͌# /U@-00  |00S d d0 8=0!D00 R 8U,  @-$!$1 00ʃlœ\   R  ,Ǡ 0:'.t00 R@\ A\  T,  0 000:h/4Sp@-@0@`P0M*l"R R &Ѝp`   P H00 040@ 00 @ &ЍpSlx02C-00$RSP@ M "2` @  "0S 1#{0 Q  l"R R, !`@ '( v@ Ѝ1=00QM0SJ\1`20l L10 0J0剑Q:20h1=00Q!0S0`20 00 0*0剑Q:20t 00 00`0`U0!Q 00`I0!Q 0 @Rl0 000/Op@-x0x 000@00CS0 S 0 S P00pКP0O0p@-0CS@0 S 0 S P00pᲚP0p@-,0, 000Pv@pNp@-Pv@p0 000S  @-@J Q P\,Q    @/|ND0P JP\@-\,AP /P/0S/p@-    A BJR@Q`,PTa@@@AR  Rp0O-3$MC0PP`@ V ~vpP 0h#0C S-000$Ѝp T0 S80   2 0@a @D BT p`$ЍIɟ,0  1A!R 1A0 CQc(^01H1H1PWZ0!! ! :  J T0@ 0?Z 0q$P@ `rP@+  T  @ PW(0p SCIWC00 (0C\00Cb$Ѝ\ X@ @  D0|0bp H0@D002 T `V `tV ``  @~L0 00HDp@-@Pppp@p@-@80800P  @ppp@HDO-P6lM0@P,0 f Q 0peu`P~] Pq0P0W W   0<0P 0R 080P 0@SF00800`P0S 0P 0 0PEPUR 080 00PS0P<0; 00 5 000p`P0 @R <0T R8 . 0<00800C?80uP0`FtPY00` t, d480pP pK 080 `0p`8ppP P08 E<,QpQpP Qձ4pp( X< R!! B qH" RW`!: pGUH0< S8 8 (P4`< @p$0,0 1400H0@0 @0 0DPU<$0 (Q00C 0 Ss 0( 0C04 Q00SP{ 80 0C bt2, 8 P cI000 0P8p0m08 o800C?80AtP0pGS00C0`FU4tP00C00p000P0 0PS08 F!q Xj 0 0H000尡H XD0|0prlЍ80< p` 0<0T pR0`<0 yPo 0<rlЍ`r@Hj0 00 [ADp@-`@Ppp p@M K00 CpADp@-@Pppp@ 6p@-@@ @  `  @Ppp p@ ADp@-@<0<00P  @ppp@ @Dp@-00P 0`@0000 0PP`U1000C1.V P*U /UpR00ppP00 0PEP```@O-ܑMS D@HP 0T p `@ 0Z  A 4/ 0[ 8 $[0<SD0.S00#10> P0 0@0 0}00 P  0G8#8 S R0 0?P4/ZXЍ0G\  8#8 S R@0p0ipP4/pWT? | Q# @-@ RM !R "R pPĜ\  00@`Ѝ/0Q # @-  MS S PpP$R ,@6Ѝ/<@-0@,M @Ѝ@-@044M0 @ Ѝ;0@- RP\\0N ^\1   %@@ _ ,\'\ { X"LB!!N0 ("!! L}0 0% !  <{  \@@ RA 0BP8dP P @@  T0 B! { c\ "0  '  0  o %X  +p {o\\:\   `;QO-$M n/ 0 w0`f S` 0S0\S 0 Sa0 000`8tp@-P0P`@0MS SP!  00 0Pl 0 Q00Q H  8 x0 Ѝp02DA-@0MS0D0@!0@P0S?  0 "!~r!!`"bNL LL 0 0210B qP `0 pW$P@WP 0fSPЍЍ 0Ѝ1NgA-@0MS0D0@!0@p0SE ) 0 "!^RRN  L !0 120B QP `0 pW$P@TP 0nSpPЍ"0ЍЍ0kLX>G-`0MS00! 0@0S[  0 6"`1` I $L0!b!bI4ቐ გ1c1cL0 0Ã#3cl 10B qP P)0< X" pW $@r0sSP @WXV @T oPvPPЍЍ/-?L*S0 O-TM_lIkPPPQ ,$  ^0 : 0 @P= 5e000` 0: @P 0S  R 0Z I #Z =Z =ZP  00pP0 p WZp  0 0X*Shl0P0 0S0, 0  MZP  /oY P -m0q,0@  0P! l3$ 112cAP3112c B L0L(s0'pr!qpC 0>P q 0 p@B `@, Hp@W 0S  n = 0PP  n @WP00TЍ   0  "$p΀‚ €䡟‚ N G !1 qrpB PqJ  @:pZ  0 `1$  0K $$N04!b1c $!b1c 0N Kϊ 00  0ɉ)1i1c1⃐BP㉑ 0tS0cS0Spp@ < pPVY Gl00v (NgkL>-?L*St A-P`p0\ %\0@pS sS lS P0\UUW &000@1CP0PCV` 1E!00O-̟qM PQ P` 00S040 p$  l@H Z 1  RS GZ P P 4 Z %Z%Z400 R,:@jP 400@,%,d+P p` L˟,@ 0:ZAZ JQ 0JPPp0-00 >Z A0J =R* =S00C?QRp  Wp1PW -.R0 XZD cJQ  Rp PA0JlRpY PA0Ja0J Rr11OSu@00qߍI@[/hP 00040hP, 000#pRp  Pp1l X   QU PEQQQ W! 3400`P, U*R 0 p 40P040 P PPp1  \1SF 0C111SC Z0! J 2 ( R'Z OP0S'Sl 0S'S'SPPAT 0DS11a h7@D!&J0AqVZ ຠ `OT` a 1l!01ATf @DAAAa0J RA0JS3J Aؕ 0000 0 B10 OQ4 }RRT0  R}R}RP!RV 1h BY!r  P`!`1,` Q*P  0;p^ 40040i10J Rd1lp1OS!!0l1PUAT @D`1AP OT0a11@A?0Sl00l0 0St00t030S&   ?R ;R P0S %S0 01S3 0C11AT0 400 Q,,*P  4 @ , 40,0PPp1AA0JS30J1OS!l!011@00@`hPu 400`,Vp p2h Pi 400p, 000S   ?R ;RH eRQ` P0S %S0 0AT @D1A !OT= `V }```&``VP``P``ü`@oobP``V ``@Q ANQ AAT @D1!ZAo!᪢Vp p2HhP 400p,PY.00!J)o0 0媢"0`0001&J0GZ @pn0`0 0000,0 0|@V``pS@`V`pN@`fpJ@opF`@pBoo@bp=&'x T V8-- M0 0 ЍЍ/--M0 0Ѝ Ѝ/-- M0 0 ЍЍ/00/ᘻA-PQp@M 0S XA RgP `V 0v0) V T~ 00 %PP0T0h 00ЍT & 0 0 R T tTpnRP0S T`8 ^ up 0S R 8(C8B((0 000ST00P i 8 C8(0P i 8 C80T!T@4r ht pt s 0t ht@s s lr xr r 0R @-ME0@S  ЍA-pP P U)  @`TV 0PS |@P0Du V  P oO-PRM pQ 00Ѝ@ `Pc % RPc LPd `%F0 ES  fP  P p } 0PPPu0PS  P  j0PS  P  _0Sq W0S O0PS G뼐Y$ P *g$%eP !ePeP $뼰 0$[PP "  [ $@P   8C(CnR  sR fRR0S  V R00000@H$H TP 0:   0S 0C8#80 P p0x    0 Y V P`Y 00pa  뼠PZi    㼰  8C8PR 0VJ *ZPK   PU; o`嫲     PEX%XU !  z X `* p  `0 00e  R0V00i0S00  S  0/V  R000V2f  dP$' < 0(C-pQ@!P`M0  P !000S< @ЍiPP  p 0p  R 0S 0KP@ P@" @Ѝ   0 wP  LPP+ P*'PP004$k O-M Mp:S$0S:S@ 0PS:S``E[ P!*   `0  kP 0P:S ۍ Ѝ@ۍ ЍC-pP,Ÿ,MM @`t!P9 0/SI cP 0]eX PJ ]ZP 0 ۍЍCt0P d!  AP"0 @ۍЍCy,0P 0S/S #pP ~ eX0 ۍЍC0  PۍЍ p 0adYW L0L 0 $ۍЍ404 0 $|4i h h h h 8h `g h4g G-p`@P  X0@dT  NP @\PPP P @T  @0G d -@-@ M 00 Ѝ@ Ѝ/G Ѝ@ Ѝ/@-@ddd@dd d0d@dp@- 0@SM 0   Ѝp0`P0 0~  00v ` o 0 Ѝp 0p@-PS@:pS hcP!paC- P@U M p`ᤐ0fV@@PU  A  0W nV sV 6  PU  0@* 00 Ѝ R@@@G- P@UM( `pfS@PU  @ 2붠P 8C80  0@nS sS  @PU@@@ 00 Ѝ 0S00@PA-P% Ppp R,R    0S,S@Bxca`P     `00pp@(c l C-p M@`PP(:NpWa*nUB sUc fUH0D Y2R4 @bP( H0D@ p H0@0 H0} H0nUp@0 H PY sU> fU' L00L0 Ѝ @EP Ѝ@P ` 0S0080W <08 H0@ HL00L008 z400H0@ 40 0, H0@04 H00$ H04 0H0L00L0 @H0R ,0 0 H00H040, R0 0 H00H0Q ` ` O-0@M0`[  Z p p(080H0q`P; P  ` 0 0 0 ἀ [0   0 p Z0 0   0 0 0 @ 0@Ѝ0@-1!000 @S0 0S0:PA_oRQ@ \T  0S0Q@000@T0\SET00 0S00S00A-`p PPU@M"R& MaP !0P ᴀ7 00V0  p,    0 0 0ЍPЍ_ p   O-`0@ 4M 0 #P papZ6 P P`0P  0apP|@P P@@`Pa 4Ѝ a a0, Y 0(0$0,0& PP@,p , PAR   0S00UPu Y  T㼂 P" }a L@PX@ H D L F ,p P$fU6  0 P- X;  lBHDXDnUDH sU  ]"0 S  Q ,@F   P+a 4Ѝ : B P$a$aa@RX X A-Pp ``V@M(R, `P$ A0` ඀ 000P00 0 0 0 0ЍPЍ~^@-0P pW@` MR _P 0 `0  00P 00 0 ЍP ЍQ^0O-LM<  <T*, , 0@P |P0`|0zPP  p00CYP]V <PD89P\P<_PP @ @P  W 0V 0,P ) p 0100#$0490400 0Iye 0s 0P^ ,P  0S $ .S  ROSF = P# @P[ shFhv 0n  P DaD0 0SP P) 0 % 0S v0 & 000  00 n0TP_WPLЍ0TS 0  0 000S (0(W8 (^8 0S! @0@S' Hx00 0 0f0 Pm[J (p`@V 0 Vp 0P: '\VQ,W%U^VP< P@U P0%0HS y  0iP (p20 FQ4E F/R)  p`V@ V,h%`  @ ` @ ,%,  / P P``P p`(\8 e@T@@B`  <4X Y10 0IP%P0 80g80P p `P P P P P P P 0 80A80P P?U P#v 0 S00Pp@` 0AP, 0  80W80V0@A T@@p`I 0 0 0000000s0P (p[@ Hx` hFhv8 @0n FPF 0S00 AP<8qPRVp 0P8p 00 (p$_P00kP hFhv0 0@s 0 P0PM 0  0 B -^LЍ 0 z t00|0 i%d < c p %0Q |P P N 4N @M M M M L P/^$P00//P0@-MP0 0^S!1l!1"b2cNL 0@@0$@B!A@C0PЍ0赁Ng P0`0K?//hp@-MPi0 0nPcl b N00PEK 28@0$AB@C1dPЍpkL>$0P00?//|p@-M`-0 P0ec`E $`L0b!b4!b E|@R1c1c@L?MD@D 0P0@$$C!d!b8A@C1{PЍp-?L*Sp@-0P0M`2R@P 0Ѝps^, 0 0S Q20ЍpG- 1 !0 qP P@3 04 S0`0`2,0PP00|Q``  VPeȄ`EQ  V|0`0ȇ`H00@-@P \\\ \$\,\\,00!R  !蠥 001/h001P//P\ @- M`p P0P0@0Ps ᠈P 0ᱫP Ѝ 0@P ЍpC-@P,MA!LnL`HDp@\ X" >>"d!00,ЍP] P =0 00X0BP P> ~P - 0X 0 0"P 0cP0T=0 00ẴX  P 0cP0=0X 0 04"P<<"Pz 0cP0jʨ<0X 0 0X"pPo 0cP0[d 0X"  ^PQ cPs   `=峳X`pV";" 0Px>P; e0cP0ʤ 0X"  V0cP0p;0X 0"(;"P D0cP0,;0X 0":" P 20cP00:0X 0":"P  cPʤX  0"P6 0cP0(`:0 00Ⴊ Pp;9X"x P 0cP0:0 00سXP P& 0cP0Cʰ90 00óXg P 0cP0@`90X 01"8"P? 0cP090X 0"8"P 0cP080X 0"l8"nP 0cP0ʔ80X 0z"<8"\Pm 0cP0P80 00X" JP q0cP0 80 00X" 8P _0cP0c70X 0Q"L7"&P M0cP0Tʄ70xXB 0 P( <0cP0D70X 0"6"P *0cP070X 0v"x6"P8 0cP0ʼ60X 0q"H6"P 0cP0x60X 0"6"P 0cP04460 00X"o P  0cP050 00X"X Pn 0cP0`ʬ50U 0 01X"M P 0cP0\50X 0"4"P' 0cP050X 0"t4"pPU 0cP040X 0",4"^P 0cP0ʐ40X 0"3"LPq s0cP0L40 00X" :P a0cP0b40 00X" (P O0cP0p30 0 02X P :0cP0Ut30X 0F"2"P0 (cP!AM(X d P 0cP0"20X 0" 2"P 0cP0&ʠ 0X" ; P 0cP0\20 00X" P 0cP020X 0"H1"PB 0cP010 00X"8 P  0X")!00x10p10 0X"!00@10x 1X""0010} 80X""0000PptG G F PF GE E PE D ?D ? X? ? = = T= = = < < ; T; H< : : x: 8: 9 9 9 L9 L9 7 7 7 6 \7 @7 l6 5 7 6 6 5 6 x6 5 6 H5 4 5 4 5 4 4 p4 4 84 ,4 3 (3 2 3 2 2 03 \2 $2 02 ! @-DT2 1 ?\, h, , 0- , - , , + $+ 4, x* ( P0X"m"0010t 0X]!00T10\10p P00X"9J"0010$1010 (1X"(7"001010M10 d1X"%$!0020 20 1X"!00P20X20: 1X")"0020}20 02X"!002020 2X"O!00{30A 2X"x"00n030j830@ 0OX!00X|30 03X""00K30 30s1X!00:30 0X:!00'XC!00 $4" 0㔦PXs"00  0Xc!004040 4X"S"0050 4X"F!00850@50H50PX @5X"-!0050%"00 !00"00Pܕ܅1!% !00"00 60"00!00|!00"00"00}"00x"00s"00n"00i!00dP!00[@0W BḂP  T7冮@P 0BP t7"0S)!0090SZ !0010S| !00)0S} !00!0S~ !000S w!000SF o!00 0S g!000S? _"000S W!000S O"000S G!000SP ?!000S 7!00PU 0S )!000S !"000S !000Sd !000Sn !000S "000S !000S% !000S !000S !00{0SY !00s0S !00k0S !00c0S "00[0SY "00S0S  !00K0S !00C0Sm !00;+ R;0="000"00+"00&"00!"00}"00x"00s"00 n"00i"00d"00l 0P <"` 0P~"<"z< 0 0K< @@ 0 >/=4 0 054=T 0 0,X= @@ 0 = 0 0y= 0 0 x= 0 0w=0 0v>$0 0@> @@\0 D3D00 !00j30 02 @@{0 e20 020 0p20 0L2d0 0(2D0 002$0 0e10 0v!0010 0u010 0le`1 @@|0 _,1 @@ L0 R#000 0IZ00 0@00 0700 0.h00 0%ND00 0% 0p0 0\+ (* x* @+ T+ * ) ( @) <* ) @) 4( ) ) ' ( ' h' ( 4' & A-t ANL\0@Po\.DQ 00P \QHTL a`0 ራ 0ᒫ3\ \/ ANN1 0QU^46 0b0#6(7(0Ta` Z 0d A0OT/2G-0@P Q0BA N `@ƌό@0pG/p0PϠ B`@T 0 P\Q \2 0C@PU 0. R\B\A ! QI%RL:  H  b3Ό2@XX 0ߪ 0HP t` 0Ū 0"P tP`P@P056 0ʪ 0᭪ 0ᶪ 0uYn?P 0S $0S 0S P? @4@P//A-P08pP`' , R0( 4", 0R40G@BT@! V @D 8,0400G ,04 00 @(0( 4/P840,0S00 40Q 0 @-P0 R 0 I H SpTP @$ < @ ˁ4?0P R $ R  R S /0?00T?0$ R&4000  0`@<>0U 0PEd@T$0S`0  0@`=0U 0PEd@T$0S  &$   0   0c 0t @$ `Rx`L=0Us 0PEd@Tf8?N?P?5?| J?M?  H?A?L?    :?;?0p0P0?0X00 p0tP 40040 @v 450050f8 0X⽿p0P0tp0 (0$P$(01 80080D80080 0cSR: @3 0@l0'L9@0C(@ ` \ p T d \ h zP 900900S909Bp@-@ PP80S ($03/$0(3/00pPA-@`PP@p0 QR 408 B4 08@V000PA-@`PpP 0R| S  P00S  6 30S  00>?R?P 0S $0S 0S P ?,B4 BR/  $0 /C-T#T3 0 M000P@P`^-@\3 R < 00 2#  00S "$< @0 P0cA Q # 2RN  S=P0Sd2 R @< 00 \2#p0@< l0^ppW} H Q0c& R#2Q3 S"Q0S Q*0 P  Q*0P  Q:0pSp R0*Q  R*0Q  R:0l00p0C0l0pSp)x0 00 0P,04K0p0 p0 0 0 30 Ѝl0Spp l0@@@ `pS???P 0S $0S 0S P?,A4 BR/ Q /@o/A?A-pW_P 0!(`3/@P\ 8X9  ( 0(3/PM 8 k8!gP S>0Rp*p  BS>00p0 (08#U8@oRS B P T X B T p 0Bp8 9p 5P S>0Rp*pS. 0A p oR$0(3/P 0S $0S 0S P ?,B4 BR/ :+/P 0S $0S  R 0P0?0@@/O-M@ @PᬰCX 0C00$P $p`0 sRpW-0p  p0 Ѝ0` Q`V00p<J\S20b608#8P0X 0 C∀0S 0X\!\ ! 10T2 0# T 0SЍ0W0T0S Ѝ0D?o 240%R00S0000020(0@0,000@(,04@080 00 0 00C$0 B T@[ q W3> BI  p Wۄ2  B37RL q`36 B Jq`36 BA@g @PKU 2@EAa P%A0@  2 `"<0@ 4ЍP [P1:  XT@p`0 pW`6@^ B37[`pNV*jkV`HV$+ `\``\pWLNW\NW`Np\ \2Wۅ  >`V7*pG(p\ p`$p`p`(p$p$p@ V(`$` PI:`@`````^Lp\`@\k \c$`\``$(@$$, V,(`@  %$(@$$, VpLF$(0$00W\(0`@]m Q??? d -LD, qR0N80#8\0@qR0@80#8\0O-,Pl0AOE@DS8@$M@AO<00x00@@D@^00S| Pt0`"!!^!@p4 0TT* RR 0 P^ ^ ^YY  0PU<PU=PU>PU?PU@PUAP0UAPR@oPP 0CX20;(8ӗ1Ӆ1&=ftPxl0PAPEN NxtP0NPWNl0:8HPXT!D`4PᵀH@ᰀ00SxAPP`l h\0S8 B05l0\000S l`IP0` R P lp#p  G R ` h0S:l R1#P0 6SH \0P8 Bl0\00PЍl08  : RƃPƃPƃ !hP\0P8 Bl0\000SЍ蜆O-xj P,M`t \l 80H00XT0#D04@@QH0  ,0BA?C0CP`PƙYp00B8#( ƙ#<0ƙ@30 B0(1I>RX30;"8ӗ1Ӆ1&=  `tQL \ R㠆l@80X`TptR` l H 06#0H0Xl \0P8 B El0\000S,Ѝ806&6 &!9096tl L Qtl \e 1t0 S` R S; SY`l r *l `m 0D 0 4 @0 0A$H0   @`@ Pl @!0P PH0P `   @P$ll R1#\ Q \P80 B0 l0\0n0P,Ѝ\P80 B0 l0\0[00S,Ѝ O- ,0IY!Q@o00`MPp ؄0 `C S 0U000u p 0 0 0B 00%C00 A #4 0BV U`1\08  <\0 0  PE B    \0UWp$6 *0R1 B3:\0l``F0SP!P1UP! U:Spp  W  B0p  0 `VP ,8 ^K ƋA, l&\ `VPl& RƋ5X(0p'<` `FV*\,^zWp!Wf\, 6 Q* 0Ƌ51C(LS0!S 1 R4\  U  RqЍWD\\l <A Q  Bl &R &l Q8&pG &l, A Q l S`1 `!U00  SR#000僀8 0\00\08Ѝ<` `FV:8 i, lBP l\8 LNl \S&lR && R, p`Ƌp  SR# S`1 `!P 0S $0S 0S P0*S9S/qSZSE0C0// [0C0 / S/@O-MPpQs@`Vo V\ t0Si0,0SC0p0t0S(Pl8P pLpXTD@4H0P  ;. 0`RH0`0t0l t0SPl  l \ 6tx`hp`ЍVL0D 0C`B `,0l`\`fpG0*S tX  0 ,00W:A-@P 0S $0S PfpP `l0t,@0S@1VTU@80C opp@-@P$ 0S! $0S A`PP`0 S0c``,0S `  *00 00(0Yp`p900p@-P@P pP,0L D0<00 B@C 0X 0 00 00l@00\@|0:t@ Fx`h@H@p_@-@P 0S $0S P0 Rp@-@P 0S $0S PP Q000U0:60ppG-@P( 0S% $0S" PQP`0&0R:pk6 @cT@ĠL #0 6KPUXPPp@-@P P 0S $0S `P0`P|0pp01A-!4`TTpBCPE0 R R R0 PR\ \:0S@U!1!v!w|l R ^  RX  `\h$X  `\h, RO- M`,0P 0Qp 0@S QW0ϟ S  R| Ro  R( (pQyWd R B‡RP^.SnQXt0S 0Sr RV R <.0 103/0@SPn Pf Wo0S S00_0 00#400 03 0  0#400  0 ~0S0c0?o20 Ѝ0Sy<00000! S *SK0Sq00Q 0S0@SP Wm WxL0S0(0 Ѝ0 0&S+Bql0S<  B0#2 2c0# 0l0Sc q000 R09S ES IS [SH gS0, Z 0S0,W @; R.D0Sa ! P B X:H  PE[ 0 X0 9* PH 0 ,0 SR0 B00SS@ ӇS   00#  #800#"0    ,0 S R 0 0I000S&  0 0S0  0S,0SQ:z R-,0S  R0 0[00$0S,   0$ 0S0  0S,0SQ:M R X0t0 0 0  R ,0P0S0PUP$ ^01 R \01200 00 0#400 00 00 S0 S00ӈ R01 00 00S 0 0 0#40,0S0 0E00L6P0t,0S*  R0 B000, g00R  0Q00SZ 000#400q000SB*0 B000 B00,R 50 00+Zt 6l8&`6&6 &!909&tl0I0Qtl0" Yt0SW :W㴖y 6S \0l S 8 B0 l0\0000S\ R8 C0o l0\000SꄣZt0(l 8`R B  ^H 6ƅ6ƅ6ƅ!909&6Rt0l 0C t0l SJt0 SW S Sl 8`g00&0 N W 0S~[0 B00O ^ ^  [ [  [ [ [ [ [ KoP᫲[@ `S`1`05:P0@&ƅ&0 !ƅ0 01I>  0001&=  &6`Rt0l 0C `t0l u\0S8 B0 l0\0R00S8#  #800#"0 PoH[B 0 0 0 0 0 S0 S00ӈ R01q 00  R000 0 0%*W6: &R \ R80l0 C 0 B 0<L0DC0C t0S*l0\06x\0l S 8 B0 l0\000S10e\ R80l0 C  A-`pPTq@PB Q00V0SI0S: (0sT Q 1@0@!A00000 |0 `bp( 0S*t l00\ R$6S S L D0 BC @060@D0 0!1 0Rpp(JXIp@-@2PP'0`Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qVP0pPO- M8\04< `08^1S00PP 0 0pS{ $0Ss wpVjV`F0HSs0FSRo WmZkFoY㫲[dV @!( `4/@Pi * @ !2) X  P "L  BT  A0`, `4 ( P6/ `,8(6/ `L@(6/jD 0(3/68 R! ( @ R% D PR! 00C60p删$0 ЍO{v `fp00$0`(0 } Ѝ8 80  000&T[ -M 0 0 AЍA-PBU_8 `vl! 0(3/@PR P!@k 0 ,(P3/ 0 ,8(3/ 0 L@(3/z 0D (3/080P. @ R+ D SR% , 8 @, @@ ;L DD 6&!10 0C006& 0&;> 0$0;/~O-Q M Rp 0 R 0#01,#0Pp0` 0  0 + P%*0 @)0 @$0 q0B0PQ1;`,:(9p'463041 R P%BQ` 01 0 0# Q#4,!!01\!#00#0#\#4!  01Q #0P%0%x 0S,!R4@0HSPS aS,d&P%PN&, QS,T% S%, QS,T% S%, QS,T% ^%,00B0 R | 0 0#01 R,# ЍL0#20S!B2PpvP~|||l|@| |8{A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&z A-PR` p㴀@Pp  !1   0" C  .P p18   0" C !&y p@-@P Pt`t`@P  !1Ē   0" C  @pPpx p@-@P Pt`t`@P  !1Ē   0" C  @pPpDx 0@-1@4P 0,C @$!0 G-Rx 'xh Q ROSRCW-o`V @0@0\\\0 p\ \  0p0\0p\ 0\p0\0p\ 0\p0\0\ p\ 0 0p0\\0p00 R7Ǡ7 lŒcVV-2P0 pGN0 P"R 0pQ1W1|G#7&c2pG0N 1pW|GpG|1^NNPV=F10C=@  L 0R`RPR0`P0 `R0` PR0P `R0` PR0P `R0`PR0P`R0`PR0P`R0`PR0P`R0`PRpRP00p 0Q0@  0C 00 pQ80'7b"c2pGNq'R'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/qR'@-7Fc20B c!'b "0C0,  LA P A@<R,C,0 BR,B B/q/ U/0S0`0//8 246@-S k>@@0 #400k.06S0k. ς 1O- p:PTU$0!`Q U @0ς!\KU` ẠZ 1 @1:  V:0Q=0^  pQ Q Z @ O-pj P`50 0  0p0S01YQ ⵏ 0100W0Y0[ B   װ 0Z.061#60S\+ ೎LY LQ LG⋰@ 0p@Q0C Y> 00A@N0 \0000C01 LQ @00^ 0P 00U00S@ T R 802^02N00 R0@ T<ЍW@  |xP 01LY 1R 6 G2#6pP^p N00=C-@TppR!ಐ0N+m^\dT( Y!. Q =^0p R. \HANpR 5 ^0@ Tp5  \ ʰ Q ^0 Q ^0 Rp^0@Q^0p ^0@ Tp@@  @O-鲠MZPPRt0+!  k ^pZ ἖` S 1>@i0nh S&hU0N P` `P`,ĠƘ lTLh&h἖0@0lih S&h 0P``0P`#406L0cTCh&hN\.ƈ0̆@ Ƞ,ȠPP0@#4PP 0Ƙ0l^h&hLW`ƈ7 W0@Q `W Q^kp`徐v0`i7W8`I#8 pp00p0#40v0gQ8#8p\0v`pV0@S `Vp0@T PpW Y0*`p ^F @0@Pc UYX%X@ 0P`P0CP`P%TPV0PeTEH$H S6L3@P8#8k`0`0@0P#4``06W@c\Ġ 0C6D0@Qi `V pm 0@P9`d8 V#8 @`0@D0`0#406@0cUS8#8 TFS LDPH$Hk>`@`@@P.``W@n\Ġ N 0@Q$ `W*0@S P palh&h`@ p0T0 V4 p@` 0@SЍ༖ N.CkΈ0W@6 N.4kΈ@W0Fv P p'0@S P p0@S  Pp0T 0W `@ 0 OO-ʀ6MS 4004`003k^0 0300300 A @b98 T#8@p000@p#406 B 0c^&6S0@ 编0$` pḀn98 Z#8 0N 00#4 060cX8#8qX tq@DH$Hph>W8#8挥pH000p#4060cTC8#8 BR@@@CqԕrԅAqಀph>8Y#8H000#4060cWs8#8 p0@sWz `D B("(>@g8T#8?@000@#406pGp0cR#6 Sv\kN&0Pn28R#8  P`0`00 @#4PP0&N0bQ8#8 k0&Ѝ 0&0p0v, xvhvXvLv@v00@-(  ;0,8+J &̀+k. $ˀ0G. 0S0 0xS0 0LS0I0&&&&#A-Pk΁@`&8#8 R   pp "$ &bS0  Bk>& 0  8#̠  4##<V0 0 p000*60@-S S00k@@6 0C60k>@PP@@!PPƂ00@-k6 S#("(00@P P 0 #4@@06 c\  ("( 0Ck΁ S 600@PP  0@@@#406 0CS6 S00k.@@6 0C60 k>@PP@ @"$PP Ɓ0O-0 QR@ M[, R 0,p&]&P+(+0N  q/ ! RH@P jƖ  \& R Q3 "[&kΆ 0("(1 Q8#8000#400aR#8#8 A+ QB Ƞ(,Ƞ!k>0#400a\38#8 A Ƞ,Ƞ18 Q#8k000#40缦0j\38#8 J Z㼦@ Ƞ,Ƞ!k>0#40缦0j\3! JDM⼦k> / ! Z! ! 缦jR!! J^ἦ 2 / Ml  \ P+R +R ,RE R  Q ,\3 "[R&k R0f 2 8#8000 #40&0bP8#8 Bdk0&N.V 0G. 0R0 0xS0   0LSI>X&&&& Ѝ R3 "&][Pj 0 ЍOj @!:!<18#8!28#8 mDk\i:Ɠ0@-PV Ɠ!DPV @Ɠ@QF !6@o0ƓAƃDQ  !I.Ì!ܕ"܅&  dg0S A-P p@0 C`0@\TUT @&P D&/@- MP`p\*@P @   \p P , @P  Ѝ 0@0 Ѝ0@00@,T  Ѝp@-P+*@P @h@p 00p@-@*0P 0W000 00p@-MP`*@P @ @B0 0[p y,@Ѝp0@p,T ~@Ѝp0p@-S P@0 C`^0@w[Tf 0 p`&0P@p%yara0p@-S P@0 C`90@R[TA 0 p;&0P@p}%tcid0S p@-`@0 CP0@-[T @pp/0S p@-P@0 C`0@[T &,0P@pB%p/yara0S p@-P@0 C`0@ZT %,0P@p%p/tcid0@- M@ Zp  P Ѝ0 Ѝ00 0 Ѝ00@- M@ Zp  < P Ѝ0 Ѝ00 0 Ѝ0yara0@- M@ Zp  < uP Ѝ0 Ѝ00 0 Ѝ0tcid- M Ѝ- M} Ѝtcidp@-@Pl%0PPptcidp@-@P`%$0P p|00ploobp@-P`A@P  0@$p@-@`@ @-@Z@ @-@T@ @-@N@ @-@H@6 @-@B@E @-@<@b @-@6@{ @-@0@ @-@*@ @-@$@ @-@@ @-@@ @-@@@-@ @ @-@@3@-@@L@-@@c@-@@z@-@@p@-P` @P  >0@$pp@-P` @P  ,0@#pp@-P`t @P  0@#pp@-P`b @P  0@#pp@-P0`PN @P  0@#pp@-P`< @P  0@#pp@-P`* @P  0@#pp@-P` @P  0@#pp@-P` @P  0@s#pp@-P0`P @P  0@_#pp@-P` @P  0@M#pp@-P` @P  t0@;#pp@-P` @P  b0@)#pp@-P` @P  P0@#pp@-P0`P @P  <0@#pp@-P` @P  *0@"pp@-P` @P  0@"pp@-P`x @P  0@"pp@-P`f @P  0@"pp@-P0`PR @P  0@"pp@-Px@V#(0P p:0P 0pgntsp@-P`@P  0@"pp@-P`@P  0@s"pp@-`PC@!#<P pP U patadp@-P`@@P  0@I"pp@-P`O@P  p0@7"pA-P@"X0P pw&`P  P `(gntsp@-P@"(0P p0P 0pgntsp@-P`7@P  /0@!pp@-P`+@P  0@!p@-@R 0@!p@-@ P"$0P p00ploobp@-P`k@P   0@!pp@-P[@P  0@!p@-@| @ @-@v @ @-@p @ @-@j @4 @-@d @Q @-@^ @` @-@X @} @-@R @ @-@L @ @-@F @ @-@@ @ @-@: @ @-@4 @ @-@. @" @-@( @; @-@" @N @-@ @g @-@ @~ @-@ @ @-@ @ p@-P`@P  % 0@ !pp@-P@P ` 0@!pp@-P`@P   0@ pp@-P@P > 0@ pp@-P`o@P  0@ pp@-P^@P  0@ pp@-P`M@P  0@ pp@-P<@P 0@ pp@-P0`P)@P  0@ pp@-P0P@P 0@ pp@-P`@P  w0@r pp@-P@P 0@b pp@-P`@P  U0@P pp@-P@P 0@@ pp@-P`@P  30@. pp@-P@P n0@ pp@-P`@P  0@ pp@-P@P L0@pp@-P0`P{@P  0@pp@-P0Ph@P &0@pp@-P`o@P  0@p p@-P]@P 0@pp@-P`L@P  0@p p@-P:@P 0@pp@-P`)@P  0@~p p@-P@P 0@mpp@-P`@P  `0@[p p@-P@P 0@Jpp@-P0`P@P  ;0@6pp@-P0P@P t0@$pp@-P`@P  0@p p@-P@P Q0@pp@-P`@P  0@p p@-P@P .0@pp@-P`w@P  0@p p@-Pe@P  0@pp@-P`T@P  0@p p@-PB@P 0@pp@-P0`P/@P  0@pp@-P0P@P 0@rpp@-PD@!(0P p0P 0pgntsp@-P`@P  T0@Opp@-P@P 0@@pp@-P`u@P  40@/pp@-Pe@P p0@ pp@-`P@<P p`P U Npatadp@-P`@P  0@pp@-P`@P  0@pp@-P@P $0@pp@-P@P 0@pA-P@sX0P Lp"`P  cP `K$gntsp@-Px@U(0P p90P 0pgntsp@-P`@P  0@pp@-P@P 0@tpp@-P`@P  h0@cpp@-P@P 0@Tp@-@Q 0@J@-@R E0@@p@-@0 P ##p@PP#0S #p#0@-$@@"\P 0R @-P Q o//L @ P 0 t@-0 gi TKi @-P Q @@ @0@ f0 R( (0( g0 I Ki Xi Ji 4i 0S p@-\@`@@ PsPpP p@ A-P`pi# @P  {`P ppw"ʰP` nn"U @#e"##,Tlp@-P @` PpcP p@]@- @P $ 60 0 0 @A-pP @P"  #0 0 0 P} `P  ` P0 000 ,0< @̠<P p0S !S$0-S-P00S00PP -P 0-P P 0>P 000/SR `,`0 S S0p p S :S 0 S S0GU0 RzP0/S7 0(00>S: SA 0S p03  0B0SR 0 S S6 S4 /S 0 S S,/S >S S`FVx0Su `Vp0(00>Spj 0  $ 00 0 ؾ S =SB0"SP0SM   0"R "R R@C$ >R;0@ "@ G-MX@`pI P dV W$ P[ <PT &P@ aR lR gR' qR uR oR  tR ;R"@ tRT Ѝ mR8 pR oR sR ;R'@ tR ;R>@P P"Pp \P@ V   WP UP PS00S@Ѝ pR ;R@ uR [RD\ BR  ;R<@{  @!1 0 "R /R 0iP 0 +("( R:Y ~ Y +     SP40 Re \Rb  uR^ :P X +  PS6I0     0 # <  P,!*-"-  ƠP  * --  (  " "0  ~@> = O-`Ÿ M @ 0D0S<_SS @S  0>S 0 T  @P (0SP  R @5 ЍT T$ @SPV` iP @P ` ^Pl0S  0S; ; ; : s 9 DO-PMȟ`@PM ,DpPD $FpF 0F fppSp>0 PᎤ0P0Du%    `p EЍ00 P0hp``E`ЍpD`Ao/A-PP UP`p @3@P@@+@P p420,p0P4080<0꼍@-@  r@-(@@ ◣pDᅹ₹@-@@ O-4@T p`, oP @@D¤@`T P礀Qㅑ@0@ @@0 PZ PZ P<6 P6  @-R 0P< P 4Q ,  D D0D )0 ˻, ,0, (0 » 5 5 5 l5 p@-@M4 00R1SP,0SFR 1`V. P` 0 0DP 40, 0C40P& `ЍpS( RwЍpЍp 0 Z0D xp p0p l0D o\ \0\ c0D fD D0D @0D ]4 D4 T5 4 yD5 3 h4 3 iA-P`,p1@P W 0 !u,@0`\,@0`C-`0@SPpMF  PB00Ѝ!0 sP ,0SU !0 hP ,0S(0S00  0FP 0S>0S0"S:0:S 10}S "S000"S 8P  2P @` 0 @cP , ,0, (0\ ⮺2 q p  x2 1 0p@-S `  Q P@0@p 0  0 ∺0 0 0S 40 00$ $0$ @-0 rx1 ,0 4 @-R 0, B4 P @ @ @0@ <0 W, ,0, (0 NPD1 / ,0 / O-80M@ Ѝ@p`% PP @ ` @ЍĒ l ⇡PP0 004QY z 4 ,R\ 牱Q1v  ] P 0YIV  B B!С,0 P 04 `<0 04 <0 RP,UM<U7U+Y& 唡 @8 P 6 3PP( . .0,S<SS= cP+ @ <0P0`<04 y<p !|,0P [YP |,\x x0x t0F/ℹd d0d W0,{L L0L 0 rpj̴ԃ \, t, 2 (. P, - ,, p@-@PPK0S L  Q <0 0 p@< 0  0K/Eܲ + x+ p@-@P 0`0VPP p p0 0  0@S0<  0pPp( (0( $0K/h$,L * * O-0@SP MR z`40SM x `6P@ ЍP pP 00S 0q 2 00PX 0S. @0R* P# [` P 0P 0S P'c X D` ЍOkP 0  03/P  40R 1#PP 0 0U/₸- 00C 0P `@zh h0h d0U/iT T0T 0]/`t` ( 4& l( X) ( t) ' d@-@⢠0,S<SS_ 0  0 4}( 4' PG-V Pp0`WSW@6 404 S @  S3 F000,0 100,0$ 100,0, P  ?o @ 2\0S0S P@P :  404 SS@  @D D0D @0c/ʷ0 000 ,0c/h' % !' h% 7G-PS @- Y`' T 1p 0R   004 00R% NP 0S 0 GSd d0d `0i/|0,S0 000 ,0F/k(& T$ 1$ $ G-PP' 0 0R"pB4`P 4 R @,0儡ᄑ1  ,04 儑@ 0T:804 80$`0P 0  Q@-P80080/,p@-@P80080p@p@-@P 80 0R@ pP4@p贩p@-@P \0 0R@ pP`00S@#:p@dp@-@P@pA-PP 0 0R4p`40S @40S ,0 P@1 `A-@P 0`0VpP0S {P @T @ @0@ 0]/⌶@@t$" A-PP /o0`0"Q@@T @0R pY H@P @T N@ 0  0]/R`<!  0P \@- ^ 400\@/ 0  0F/3렦  0 0P o@-x@ T\ @\400\@/ 0  0F/  0  @-PP M @1 0R Ѝ`@80  Ѝ@ P 4 0R S!*,\&0 B!p@崝400C40<00<0I G h h0h d0s/T T0T P0s/⸵@ @0@ <0s/⯵x  h u  D v   w P/?o0 2 R0S/0@ S/0P -?o82 ^0S 0 S$ /ᠣP/0 0@0R/TP/0 0@0R/( P -/o<0"0@0^ R  R /f A-`P @PpP (0Sp 0P  pA`0 `FO-0S@9 0@S7  `P P. X8qPp@= P 7 P 1 P HXPU0UU !B< #1 0@?,B PO 0 s0 մX% XP0@#r 1 ,@0`p@-00P4Q8 @Q t4 <0,04Q<0pPp 0 0P x p o@-P MU3 0`Sp@$  FPT00 Ѝ 0 +P ,0S @t 0 @eP  Ѝ 0]S$ $0$ 0` ⩯ ` P X Rp@-@P 0`0VPP p p0 0 0@S0<  0pPp( (0( $0 yԌD P  w0G-S@PK TpU 40SF   P@G ~P P 00S 0>]P7 0 03/P0  40R 1#`P' `P 00C 0@P  @ꀐ  pG \ \0\ 0 8 808 0    H  40S 0C40/ 0  @-0 X \ L 0p@-S `  Q P@0@p 0  0 ŮЉ   ip@-@P 0`0VP0S R <0 0 p@D D0D @0 ❮0 000 ,0 ┮@0  (    wG-S )X@ `V 0P 0R 00p ]U` WV 0S  Gq@ @0@ <0F/T0,ST (  A-PP 0 0R'4pP 40S @,0a, 40a@T:8 408 pX@-P80080p@-@P 80 0R@ pP0@p蜆p@-@P 80 0R@ pP4@pLp@-@P \0 0R@ pP`00S@#:p@p@-@P%@pp@-@P80080p@p@-@P8@@@pp@-@P 0 0RP`40S ,0AT p@p@ 0  0O/⇭  aA-@P 0P 0R@ p``8040S ,0X <0, 0Q<0@I@=@D D0D @0S/I0 000 ,0S/@L    p@-@P H0 0R@ pP`@p$A-PP1 0R@`4P%80,0!qW% P P ,0P < 0@ 40< AiAD D0D 0W/, ,0, (0W/جĂ@ p8 0P -?o82 ^0S 0 Sd/ခp@-`P pP@cP (0S p@  ! Ȁ0 //@-!WP0 p0 08 4O-IMP  @T p `0 R 2/0W\ P Y  9/0  p?PV @T!1 0 Q003/Y@ 9/T VT T @T@" 000Q 1/0V' P70S+ 03/P. Y 9/V@T 0 0(  0 0 Iߍ 0 0(  0 0( Y 9/Z 0 03/X X0X 0( ߫p dh \D l8 @  ( P0/O-@MM(p aT 000 0\0+`P$  T%0 `P4 0@ 4/@P`P@003/0 `iPMߍT00 0 P 0 $ \00 Mߍ0 000 ,0H a R00 # 0/0/@-@@kA-pP`PM1 @T. 0@0W   WO 0 /R C 0CW /RW  W0 0 B/Q P!0C@T@! M0@ 0.0 0 0 S* ;{p@  2U ,0P2.4@$Pۍ?00@ۍ S02p G3PE3H3p 2p 0P@2 p@-R 0@S PR :   Pp0P  , 0`0` `90 ࣪L0L L:0 808 8;0 p4< DX $X p@-@Q PPpQpA-0MSz@`PA7 Q <Q& >Q &Q a`Q PЍP QЍ|a&`Q ~PPa&`Q rPPU q/UpU"0E'S0rP\\P WP PU /U\U fPnPtPbPUx 0  ,' QQ 3P0 000 0 `(H X| | 0S p@-P@ P@p 0Sp/p@-@QP Q PpQp@ 0p@-S8@PPU Q PpQp<`PpPQ P QV P Q P Qp@> 0 0@ } #0p@-S+@PPU Q PpQp<Pp/P PQ P Qp@> 0 Q0` @ 0p@-SG@`PU Q Q aP<\Pp PU Q PP QPU Q CP QpPQ 6P Q/.P p@>( 0 0| \ |\cA-PP` Qpp0` XpWV@PR  PK <V`p p0 8/PP`<``Q P P 0S (P P 0SPP P P P 0 P q|pp@-P@PP Q "Pᝪ0@똪@p zy011/A-\@`pP \1S 0 €  P 1P1 `p P 0808 8A0 -$0$ $B0 % ,@x @-@^ P ^%QRS  T00%NQRS"  TŒ 00 0 Z0  tG-@R0(M0QP P 0 ` p Pt p `_0T?o20S00(Ѝp`0 p@- @PM`00ר0 0Ѩ0 0˨0   Q Ѝp 0@-@P M0ᵨ Ⱘ ⫨0     P  Ѝ0p@-@ P0Ml,`.4l4#0厨 4 40ᆨ 4 40~0   Q Ѝp 0@-P@ M0gxl,.l! ^ 4!40W0  ,  P Ѝ0p@-@PP`(M/ 0S, R00$P (Ѝp0-S0 0 0 0 0 0 0 0 0 0 0"Z P0V00(Ѝp@ R 0S V00@-@ 㯧T00@-@.p00T0/0/0/20/@-@T @-@T000 000S/@-㟨yt000 000S/@-㏨pyt000 000S/@-0yt000 000S/@-oxt000 000S/@-_xt000 000S/@-Opxt000 000S/@-?0xt000 000S/@-/wt000 000S/@-wt000 000S/@-pwt @- @?^ʎ0 !00@S  \pt ? ? lR! 0^ < 0  0^ \#4x4@4 0 01/3001/30 01 /30S@-@1/00/p@-P0P0 0@0PS` Y-Ppħp㙧ut/-000 000S-/@-㇧-Put@- 000 000S/@-tutAo//0@-p@P M 4 P. Ѝ0 0 ;0 zvt4 @-p@M L .P pЍ(0( (;0 ]wt@$ P0@-pP@ M T T T K 0 Ѝ04 @n. Ѝ0 0 :0 4t4 p@-@ @ $V. 0 80 ^t ( p@-@PP (P$Pp0 70 H pp@-@PP (Pp0 70 ` Lp@-@PP $Pp0 70 $ (@-@P  Y.<+ < 00 ;0 Ť8 @-@P ( 0 70 ത( @-@P $ 0 70 ࢤ$L R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@ؤ P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@PZ80 0 @  0""048# /UUUU3333  גt-p@-PQ@v : Sl G Sd0 c Sp0  S?0c0 r-w-!- R00M >Rx  -   r-w-\  Q7 &Qx-,1r-@w- T$ T T-x0   p Ss0  Sw0 S?0l0Q s! R0s  t0T0SS   S?0b0A0a0-0$0$ $90   pO-8AP@:  dpPA PA  ỈpP% 00f` 0@T' P0=S AP` AT BX ! hBD0D D>0 ࿢ 꼤00j$ط \G-XX"X2XBM 0 P@@D H0PLi X`P ㌠吠唠嘠圠刀{pm pp tpb  P *p[ X0p 0S0R00000048<-0 . .0-8180 00@000*@-T  #P0S pp@ ) % ) Ѝ*oЍ @,0@ 0    $$$iTO-PMp 0GW"S00`0v@ƜP-TPg +T@`0@ ǿ 0   0  P p  !ʎ @00D \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`ꋣ00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 ^SW p pqW ꙙ` 00 0M0Ѝ2c/O-PMp 0GW"S00`0v@P-TPg +T@`0@ ǿ 0  4 0 - P p  !ʎ @00D \a0DSW0DA0DS"70DUr X : QP   S  R  "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`껢00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 SW p pqW ꙙ0 00 0M0Ѝ2\`/O-M8@<ЍP@0P@ 0Y( @P@ PU P 0 0  2  { @Pt@P@h0h h0 ༖P0 0ൖj2,;P*`:P T d)T0ķȯ - MA ЍA-xx1 0!M@P0<80P`I p4 81p4ȇPP ! 1 0 <8 30:!ݍ0 +  0 Pp忒PP@T Cn` 0P8T圇PဓP @T@ᇒ儒404 440 =18p8X A-!1 0!M@P0<80`b QPP 14^P?p4 d1pR P30P0 $ ( ,  0 0 ppTPP!@T Cn` 0P8T1PP @T@0S  ' p0 0 <8 30!ݍ`00PH H0H D0 ຕo147H5dP O-ğFM MPQdč@`ᐴt嘤 T V [ ZX ( 0H0;d 0?P0S  0HPW 0 P(00){P 0$PxPs$$Wj ,Pj(, {P $W ,  c T#L3 0 d4 30Fލ Ѝ( 0tP3YPTPs / >P @@W  G0Sv ST2" @0 9tt 9X0T /P(( #"2  0ݔTC!1  0ҔV:!1  0ǔ[1!1 _ 0༔'!0  H90$0Sd / ÃP!P  0  39(1(! @0 '9 *A 1 *.0 "53`  |X ,4 8y t z܁ X{ <0  ܀ x p d| \@-``1 0M`P000@P:  T p T0U0P @$@P@ 0 0 0 30+Ѝ/000U00000ᫀP 4"48#80P P0P 0( 0@@/|/.~ Ĩ @-@P @  0  ~0< Г~ 8O-,,ǟ GM Mtčĝ ĝP $ 0 $0S 0Se 0Sn 0SU IPC@P80X D,0( /p= `ph6P000p Ip@! C EPgD끕00S" }0@=S`T`V`W`V Zf`Ppj0#S: PU (@000C00V0 @p0 00 <5卄P%G@( 0 Pp0 00 4yP 4 6 $ $ 0S000C00  0pP40 0pP$h`0 ᯎ ᨎ0X0H@45PP0H0 Pڶ5 ,0pC 0PU 0Pq0Se Sc P| SPu LPn E _P4 R1(B"2 0 t4 30Gލ Ѝ0@堔"0  ($@t  0400 40 S  $P 0pW 064 ( 0   4`姃P P{ P!1 H 0Kx!x1x 0H A0ST!T1T H 058!818 0H +$0St!1 H 0j0S $00p--l-H(()̣@w xw 8Ƞw lw p W' 0 ᲎   0HP @T@T 0 pPP 0Ѝ @Px x0x t 0ˍ` `0`  0V@ @0@ < 0ඍ|e p^e Ȏe ,]- $M!Π00  0 (0 0 0 30$Ѝ<)- $M!Π00  0 (0 0 0 30$Ѝ)tG-p PP`  B 0000 C Ra CRE@0@Y)00 C Ra CRA CRS:Y 00C QaCQWCP00C PUaCQWCQACQ7CMS00 D0C?o2R0SX ? R0T*@D T T-@A CRSb @ A BR0G?oD2Z0S\  Z?0X*Y 00A Pa0ASW0AA0AS70AQ P,1,!,0 Ό00C P 0 T:aCQW0CACQ70CS 0  }0ୌ   DACQ7Cz|0| | C0 D@`S| P[@0@ @`0 ܎tb `,a ܍a |da P G-t1@0P?  @RP>T !6*P0 4T8 $ <0 (Ѝ( (0( B0 ⣋T] ȐLp@-`P@P0M! T* U3 ,0 0(00$00 00P0 $>P+! 0" 00Ѝp 0 0 lTt t0t 0 aUT T0T 0 VV 0 |] ] ȉl\ 0@\ |O-0"02 0TMP0L00`w Vk 0  00 0 0 !8 A PPP @p1000 p<@P< 0+S+0S((P,00$00 0(P 0$X,$,0SpC 0 0 L0 30*TЍ0 =P hPTCь00h h0h Y0@ ŠL L0L X0@ ช}m& ̈Ĉ lZ ĆDZ O-!1 0pIM010MWW PPN @`p ~0 `@P; 0+S+0S( P  0 JP  Z0SUB 0 0 1 30Iߍ P zPBH00< <0< 0P 9% HX 0/T0@- 0 0MPP000@' T  ᭐0MP ""  0S0 0p d0 0 0 30Ѝ0!@P000 040 %X 0pW 4@-!1 FM0 M@P0d40p/ ` PPd@"+o P ċ0@뿋 @Rh \0 0 d4 30Fލ Ѝ4 404 N0 T%H@V @-0 0dM@P0\00p` Pᰏ ʏTX P0 0 \0 30 dЍ0 000 h0( k %lpU `(::@-<@<M@ v0 Ѝ,0`( "4`3Z1S //0@- 0 0M@P000P' U  0 @  "" 0S0(0p d0 0 0 30Ѝ0)PP000 0F0 $hT S ؀G- M砐 p@ U$e_PH0S W0Ep +@P2  kPUo0 ;u0 UB n@P  XU0PUo00@w봊@  n 0 0 4 30܍褊0Pb럊TP  0TQRp xP|`A$;$P( 0- M Ѝ@-0 0dM@P0\00p`    #X P0 0 \0 30 dЍ0 000 0 O$P4Q }~O-/? 0M@Q000 0S @ T:TX a! pP.b"? a. *b i!*DPP\@]!  "P dX$%T\dT%``.lČfH&bȌ̌$DLfD$Li.`  i,-a.d`ia` hh(&d@plhphd&%gX'%T\gT%$l͌hx(b!aA"8'tp @|ht'aA$i) `&@(l"<t``i(aa.%jh*M`&dlQ l jd&Px "lQ%P d  ' ix) l!!'t| it' "(] n(|d!. i)dd!"*hH($Di*LhD$ + e.  '0,k+.-ak.eq! `&p*eq'4͌epiX)b!} %Tl\iT%, ( ,(o&@$O$,`ba,H@匀@`@ba& g,`hH($D !LhD$,++ ,+0 ,+...$吠bj*. j."$ " (,+ , $ , 4P%++H (" m_%_%`,P gQ PO$O$gQ%f P $@ gA ,$@..@].paf!O͌@f.e! OfA O@lea,`?ea&e1ꯠP* )!P@,`(o)_(0P(P*** P!!! n,pyM !`nQ 0 P%P  =d ]n,c1d#!.. 0. .4 $͌e# dq .O,p/$/"p/"  O$O$4 O$l @eq,O@p'?p(aA,}e1@$n_@a1. P0#0_% ,, _%_% M_% $Pg._aQ)0_% !/!,_%_%_%(PX=dAg$_P*㝉cQ$魊i P%藟 ៉gw Pc.p )O $ 'O$'O$w( O$],@jA.cq@$@ ?'?#$ 0/# 0''坉?'eQ0jq%?0 p'p?j1i%诊_o%o&o&  M}$`.dA_%i1$0#_%` 0ฦ_%PogQ$iaP%Po&,((=o&(no&o& g. o`(]O ca.午gA`&eQcq%`Op'@@ p c1 /'/"./", ... 0 ' ''mMh%uf! h!f10/  Pd1f1d! 0]?h1`$d `10f0.,,4..-. $(`e`e d@Ϡ0,`!! ,,4=,be bχM` cbceP ,pdcd b/p"++0/"/"/"`( d`! c?  #`!o!`$`?#?#`͌?#n0`n1 -0dlAnA0lO=`A`bAlAbOnA4`O.O$$@..@ p.cAbAca`OlAϠ`,(@))@ , ,aAcA paq,pOmbAp`AaA`! O}cA0P fA`Af10OaA_!-_% 0_%4,P(P!!!$PgA0fAgO`A @O   ,= bgb돉fcbca`ꏉ g`acaqpP菉b /c!0O$0O$㟠?')?# )*0 P*?#''' P)m)?0`1ϋa1` 0P捈fa0忋`!&a "= - 堰 h&⿋` !c1h#  p( ⿋ ⿠o+,PP o&o&$``ꯂ_ +o `b1# yZnܼbTkl> Tklk@> (k0 0#+⯊< +/ L 뿉⟉h⏠ 0()t )O/ 匐 a(⟉ =bb!! " `!-!c1` `#P b1#0# 0a=bAb!!`! "!  Q @-c1(O`A`# b1# 0# 0a=bpb!!`!!$@ " -`c1`#b1# 0# 0 abb!!( "L@= `!-!菄c1``# ͌8<@plDPbb!# "0X"0`2 0 0 30Ѝ2"0 0SY2"0 P?@-@P 0PP PLL   004 404 0 o#EgܺvT2= kjG-PPp`8 W, 1 00.!0% "0 ? 0% 0?S@@i O0iS@I"p ` *0V@@p`F G8H H0H 0 ), ,0, 0 < Xii< i|ip@-!1 0MPP0 00@A TJ R00 113R0 0~? S ``4` 0~? S |U PE0"0 1<3R0 |0 0 0 30Ѝpd d0d `0( TH H0H D0( ංkpmNSvmz靠e `c{&D`l̠daˌni "mn `ak  `H8古n` md d8@,b3De (nIp M@gy荠k{n`[n@`dk&@ lK@$@dJbhKPP%X @m3k`@ j+NNNbP[lT0Pick ci!0c0k @$ Pl @DPH`K `ˌ*d @Pꭠh jˌkg+" dP,i+0 iˌf;# 0͠T0+>C3C7Ch; . 0cPP T2gˌ a " 0g;a HPpᄢf b;,0 b;#f `@P娢makl; 0 l;#a 4PТab`;&0 `;#bLP n P*e Phe C3C7Cn;`+AmAhkAh*jhL堅b*l+`$l`.Xzmv逈eehPd" zTd,mXv\ȠP`ˌ`[Xg;n@0lb . b ` d 4@n[,`(@P%Pl@e\b[b+D@0#el@ 0+NDCDGDaK$@lK @$@MnK`+% " b*l+Lbˌ(e$, ˠ`ˌ<f;+@@@n a, j ` d" )i8e[eP0+H╃H⫇Hj0#0c9g;.Pdc`cb,* \ꭠ+K╳K⫷KgHp +~G芠sGfwGfk.c;ndKal%! h`abahk(e+$ " 0$0# 0Hpb-=l+`;d !l{ ``&` e `a{"p'd pyb ddK+ ja\0j`$ ! bbˌ a+h+  8q8pPwu su` 0` (`ju0PPnP#P^uZu` 0`(`QuP PP @ dDuAulЍlЍ'^[(0( (H0 x`0@BS @@- M`Ztqt1pP@P`@@T 0Q !P Ѝ$ ZP @ Ѝ@ ZP"0S- -S?@0 0000 P " U RP +R@@D!0DSX ZP0S +S!@?@!@@|?{HX ?P L0P00 1 R/@P/!R/(0 @>R0 00//|@-Mp @y`P`W P0D>S 0!3100 0yЍ>SD 0!3100y00y00,/-p@-MyP@U@0 ` ` Px0x 08 R;0Ѝp@Ѝ/0 a0z( ( L<\ xA-@PP`p; =U( X0ES  S0+0E0VpP00Vp&2!0` 0`00+XPp -X =X00-0V0`0+00+0`0p@00000 0]0 :w00 :H :p@-PP@F 8a `0RuSpWS6X0CS0p à 0R Q PSPQPQ  0    X0 0+S -Sp0( (0( b0 v I@ 99O-0 xSpTM 0@@ 0`004080<0Y Q0(0x @(Rx@T%|7(P0p00000TG @ @D 0 a0GS00x00x0@}x@PTЍ+W = W0 -S0000 0` X B R = G/oS"!"   ( P:0,P_x ,Wx R, ("@P0 @(偑  ( 0S# (p W:,P0 rT0P R\@& &O-P4M@P\pu WiX0S- `00 S 5/000 00!S5+0 0 00!WaW0] Y[ X00Ud5S`500 0 0 0@0` P(0`0p5`0$0X`m 0S30`hW ,A 0`mVW@P ,(05#[0P` X $ 2P0 8%*&  # #. BPU 3ß2#0!/#1##ʂ0#  0Q`V4Ѝ3+00 00!o3/0 00!hh30$0H\.d0La#0L0|2pST0, P `@!lP 0`V ^ @P,x ^}[`"$:600%$0D"%>!!!0C,"0T$P%"A0$AO#QX00 0 0$00?S%4P!( `1T101! T$?01>! R01"_0`A(0 x10X00`d(00@t`dP(0 _l  R1 AP5Q4 0A`X0 0A$0PE `0P 0  `4`4 0 9@ 0p 0 8@ 0yp`X 0 GzG0PQ(\)\|$ M"SQK\! !  ! O-PP@` Mo Tw V p0 8T:R P- Ÿ P2 1L PPq@pQ @T*RP P 1L P R 0Q_ SQ Ѝl P @@0 L0\? 0 \ @ p R@p\ p W R:\#Yp 0 0 oT0 0 oV0 0 ovp,@ \?[*!]- x xP Pp@-@PP U p@IX X0X 0 oU8 808 40 op@I Nl hEG-P@U T^ Pp ppq W00"1gP: ~Pc 0Sb 0 R 0C ` PP0 XA V  00S0 0 Q 0  ! 00S3*_oRe`V&P( U  !o 0 0 oTt t0t p0 o\ \0\ G 0 o q00P p x\ $PA-1 M0M@P040`P$ QE U9  00S0 0@ $03/H!@1 0 4 30GۍЍQq1p$p 0nV U$ 0 G0 n 0 0$ n 0 0$ n0 x0np p0p H0$ n< H̙ dC  E DP DO-ƟMM tMPč pTDe0e XB 0SK VT 㰰QpUd0U@@ R R 50B?o2 000RU$00 S0E0@v0S0000SfV L0+0Z 0@ 03/[o 0@ 0000,00G(0 03/P    0S00* z 0.S  Z0S0 Wy:0S 0S  ,P80: S $ wP (0JQ/03 10J10 00@P~000$0 000S  0P*80: S&V 00S 0  000S0 P@T  00S0o04/P/ 0,0" $2 MލЍ  0.S0Sm 0.S|i0S  0@ 0L  2/0S0?  000.SP _ P 0 @JP? @ n  2/0@I(100+$0 00 `P0!1 4 0mp0o R 0F0D!D1D 0, m0S ! 1  , 0lV!1 , 0l 0 , 0l0~$ &QIn0/ 0 @0 03/0snFlF0n(*pP /` T0 $ D DO-ßKM MPčp`Pؔܤ; WD UM YV \] /\@ @ 0\/\0 V'"2 0 4 30KލЍRb/\;/00P/\V\- pp"p2p @ 0\lWP"P2P L@ 0QlU4"424 0@ 0FlY"2 @ 0;l@Pp P:P 0   R  T 0T/S 0: S+ S 0 0 0 0 PX# +00S0 0@ (03/0S0: ST/03 301 1:d R0P娰0P H 0k0G 0 km/0 0ᲰD4 x lmL @n `o SLO-şM5$M 0`P000P 3 QE @0~S<   pH 0S/S;RR 0B0 4ZS 0H*0; 4P4S 0 0CPR3 IR*0S0;R) 0X @H p S    န値倴*S1 00@0S ?S! [S!^H QM00 S@000XS 0H , R @ 0< 0@Ⲑ 0R  R QR Რ@  P+W@PU P#<3 0 0 30ۍ$Ѝ@\0 D SP 0]S2!^0m 0]S  000-S]Q 0]S  0@< 0T20u  0BW 0R S0BW 0R S@d 0 Q{  001A0 ZY0 [0!^0  @E  p4x0O0P H *; aP =0$10QqAp@P0 cjU 0X \j 0 0P Rj 0 0X Ij0 0Bj0\X =j@1@/0?**[-]! \ | pX LxO-`QM@pM R W T   DkI^ @P}\ @\ [\ {\PU PE0]\\ \8(/PPލЍ ]RRRF 0@Q`0,^* [^ ]RR6R` T: `{^0 }^S0CV  B0S00 8(N 0SV 0F0C  0j0 0 @ ]RR ]RR x| |0| xd 0xiX WdX X0X Fd 0kiX< <0< 8d 0aiL  x p@-@P`PM( V1 0  0 S 30{S 0\ {\ P 0 Ѝp0}S0S Ѝp@rd d0d 0p iVD D0D 0p ik 0 4| pA-MMp@PP` ; 000000,  0 +R0 0S0 0 ލЍ \R@ @R@ )\ L 0 R ލЍ$ $0$ | 0h\@ p@-`P Pp@0T1@D 0CPP @T*000p 0  0 h\ T0S$ -*S ?0C\S0P0S Q 0S 0 0/ 0p@-0@ TpP"TC ^ (a`00 0DS'000@T7 "T- 0 P \T0"S0@T&0@00 CR S 00p@T "T P 0#00p P@.T \00p p@-$!$Q$1 P0 QMMR050 H 0 0 5 30.QލЍp , @ ` 0 ?p x @EO0 \PD04 P 0h\~Q~, tP5C-0$eP`M 500S xE@ p#S"i0 岳P$ 0S %P @ 0Svi0SЍt `p  0@S0 0 40  0Sx t倄倔p 0fS0fS 00#3R0 4$ 0000@SV 0oS 0oS0nS 00#3R0 # 000 ;dP 00#3R0 p# 000 &dP 00#3R0 # 000 dP( 00#3R05 " 000 0#S 20@ R@@XP00Ѝ0 S S\ cP 00#3R0 " 0@00q  cP  cP2 00#3R0) ! 0 00T 00#3R0 ! 000ElP X)0@S0 @  cP =QAX 0P0 0 xcP=Q 0 @00 "X 0P0 0`P} A0$00 0Ap P2g<000S[ ?fU] \'P7 0 0 30Ѝ `s?0l0` Ⰸ{pp  PWpJ 0BQ #S P BQ #S Q BQ #S V BQ #S S BQ #S R BQ #S! I BQ #S# H BQ #S" G BQ #S: L BQ #SR M BQ #SH N BQ #S> O BQ #S7 D BQ #S  E BQ #S F BQ #R 0S:U 0p0S8 Rh BD{P `0000  00  T$   440000   $   30000S0 @  # 00   pW p[ pf000=@yf@W 0\ rf000S jf0 0ybfY 0  [ Yf000@Rf@00fp00,(@ ((@(@00,0sX [  ͻPk~0Sz[u+d1!_0 dHf00e  ppe pw0`00X0`0 0SCQ Tqp wY*0p0^0 e0SY00Q pp0S03  ZpE`00C0'  Np9pQpNpKn[> 4pDkp.pkAuuttT @l>X x0ˠ- M0 Ѝp@-`@`MQ P0ˠ 0P ЍpF0> A-P@P`@p)0S |@@^ R"@`c@AP00d0@ ==@ @- 00 =p@-`MP[G@P 0SL0! V ! U@Ѝp t0P  R 0QPG B&R 4$( RS% S @  S& J S E S  A0  A6 A|p 0 dX A; T<<0 $d4` p4H(0O-00% BMM $ %u  %p 000 0000+ 0回P 40 4XOP P@\ P 0S p400#S \ P 0S 848d0``\ zP 0S 4d0``\ kP 0S 30   \ \0P 0S p30\ O0P 0S pd30\3PE0 +LND3D0 0P`\ 4@P 0S <]PP[[ ^P200xS| "l2 0 4 30BލЍR@P\ Px 0S \200#SL \ P 0S $2$R0P\ P_ 0S 100xS0xS0S) 10 0sS?0wS<0!S 71Q0P \ 0P 0S 9pd10\ 0P 0S ,p410(10P" 0 $0xS0S {00  00 0000 ^P g: :99 x9h <9988P$8Hdȸ 7h7X 47746 6\6L6dl5555pp@-d@@0S P Hp@P@P 4P Ip44$p@-@P$ 0PP 4P PP]P SPph`h`PLp4 404 0 ``d4H4H\t p@-@P$ 0PP 4P PPt]P Pph`h`ZPLp4 404 0 &`|3`3`tس 40p@-\PP 4P qp<`<`-P@ൺp2Զ@-@@P{00$2O-<$M@P  0S Zp 9P0 p` 0 0V;  8000?Q WQN *Q0@0 t8000*S' .Q S /S#! /QPP$Ѝ[S5 \S" 0S@0?Sc S *S0@V0*SV0 ' *S0  0*S [P$Ѝ[QLX /X| 0!S^SV J  Ɵ  P 000@ 0]S2^ -Px 0]S00S /SD .SDB 0S} = 0U/S:w\Qu 0@q/P P]S /S \S$ S] -P7 0QV]P 0ZJ q  0@PR ?=@P PV@S 00P, 0-S PVP]P0 l P]P \P^ S0S00@00  $ P   R   U/R S /S P 0-S P0Q^S@0@00oQ@ 0]SM-P ]Ho0⪢XV@T S0TG 0Z q S[XQ 0Z q  0@PW828"80{ &^0S;2"|0 ^2Qm0 @xPb 0-S P0;0/d Q@KS pP@J0V0  ! @T0 0 P`/T @0 ! @@T S0T0d /O40]Sc /Sg \S4^T\ d` 8@0P@-@ P _ 0 Q 4Ql?o2cp@-@lPZP XZP T00pT 00p__ 0 pO-0Ÿ M pc P   - +10 230Zߍ ɴPT 0 p H  㻴P 7 R @; 0`  0P P& PP 0 pP 0 qP0@T*p@ ] 0 opP ^ - R  SXSO-0Ÿ M <pc P   奶 ᣶10 230Zߍ APT 0 p H  3P 7 R @; 0`  0P ᕵP& PP 0 pP 0 P0@T*p@ k] 0 pP Y^ - R   Q8QO-0Ÿ M pc P    10 230Zߍ 平PT 0 p H  㫳P 7 R @; 0`  0P  P& PP 0 vpP 0 [P0@T*p@ \ 0 YpP ] - R  { |OOp@-X@0`P@ \P0S SP 0p8 p@-X@0`P@ P0S SP 0pС p@-X@0`P@ 8P0S SP 0ph 0 00 (0L-H- M 0 S 0  00\100M0 R0    R 8 00 0 0 30KH Ѝ/KhK-H- M 0 S 0  00\100M0 R0    R  {8 00 0 0 30KH Ѝ/KxJ -- M0 0(--M  x--M  A-pPPp` V" Q @Q yPD@t0 0000AiL0L L0 Z404 40 Z0I4  0P R   0//`O-<'<7 0 0S0 .T0@0T9  T04 0R/Q T:\% 0 \/RT0C"0C/QT :0 BPU0P!T0l0p`@@PX LY0<@@0/S (@@ @@P8@A-M@PS(q0Pp: !0C `0 00    0 b0C S&0`Z0 0ᐔ0pS@ 0S 0SY0"S $7# Ѝ T1r0:Y00?T˓ @-@P1 0S* S@T. 0T)  /Q0C T !@# *0P@/S |0 B@T@!l0 0X  T @@4@0@/S00@-@PDM  @000p 800S DЍ0p@-`P/=p P@p V U p@p`UP  p` V(00 Q?o?o 0C-@c^?c ^' ^ `pCc&Pc2680E270G2&1H01./ "(0C0 /0: Q?o?o 0@ c5RA-?c"6R2 7R Pcp0E7`G 0E1C f<68<70< 01>?0#ό Ό C+ C+0c̠0: /07 Ϡ? 0S! Q/o/o @bPG-?b P) P @pBb&`b4')3V4( X4G1Y 010.? "1?1>( B24 5 /00@ Ϡ P! 0Soo C-@@a5T?a"6T3 7T `a2V7pX F3Q g>>> 36 / "A11 A>+@A4+a21/4 6:  / 0Q!*?B0CS?S3S4 cC0 0c11/C.B0B#B# b0/// Q":::CA@- @@Q?Q$&3Q&40a0Aa223 C$LC>CC.#@C$#0c0## P ೠ;0 SJ?Q Qa01!/ B //-C C0c0,PP `n@-W00p@-@PP  p@$Y 0 10 U| p@-P@` 8Ppp@-P@ 8Ppp@-P@`D 8Ppbp@-@PP pP PppC-PMP`V @T |00XVЍp :  <p@`$ tTx 00 R ;,@-cW00 0S@do0#/"b0!s!!@ 00lRR0c0A1R 0< 0 B``C/  "bQ0"Q$I)\P ףA-P0E \`dp0LPSa0@E: T@@ X@TS^!:O-p(PB`qP@ 67P PXY  P A-1 0M0201 0@`0pS 00S \P#P3.000R`0@ t d0 0 2 30ߍOPP @@ @0(@$0Y 11l0O-ϟ 0 0XP(<Ѝ 0 P(000U00S SD 0$`Ph08P p`C PO Pb6P p W R0 0$`0P 0p`C PO PF6P pW R0 (000@ 000@(X(PD(PzW0  GS( y +St -S 00 00$P P䅐ಐ P:U X$P( 2c2c2,S \0c$00P 0(0w 50 ,P(^U0W0,0i0pPO0  P5P1 pOP  5PP% 0(P 0  R9,0X0!0 B 1X/0 00|; 0  0P(10 ,0 c0,? 0PS,0(111v>C 0C,0    /"b!!A0,0 X0 0000 0 : ,0 :,,0 v>C 0CXP0( 000 50 ,P(0PX%S(P 0 ,, ,0 0CP0(000Xp 0  0P S(B 0 00X0 009 0  0[P(X}XD9\0   0JP( =0 P( X 0P( 8 ,, ,0 0CXP0(o000{ 0 P(a000m 0, },0P!/A!b!b0C P0( I 0 B0 SW0(0S0X0;7 0 0P(B c0 ,R 0PS(, 6 0t0?2c11!, 0 0 0000 X780   0P(X ;0 mP 0 0 S0 (0X(P3 0  P(((P000 c0 ,P(00000  R 0s @`0PPv0 P@ ` @a0Ka1c B  B0   0000 P /#b!!"A @@şK/"8bP 3:,bQ # 3 P b4$  Q000000%0 1?3c112B x$xK?##p$cR3:d$cR#300T$0010 !00C0 00@ZP7 R0PR00J0PX$`p(P*0000PX$`p(P000,P 4 /#b!!0"A ((K/" bQ:3bS0#03   1 01 B00DRd , 40 00N(00 S!0r @WPO"  IPH 0 40N Q @(P0Pv 0(P00(PP @ ACLC  \^JS S 0 0#3P0 z G/o"(PzW (PUSX ZSP  @ 0!P ( 0$0A010PE0,P ( $P( PT!/"b!C;R, a2ba12/ Q\Ql'p@n$IP)\(\ ףz z y x @TQ(tP ⎀Ḁ@CP(fMP P(P @j @0C2c2c2P$00( (0  @c 0 @]XP( 000 SlXP( 0000@>0S; 00@70S 0@0 㸁,0 0P P(00, 0C$0(~,B2000c^\0M0c$P   0P  P(00 , 0C$00(0W    0P ,  "P ( (0 b$ @00 0M0Ѝ A-1@0QPHP P MO Q&T10 P1%@4p\@@ . R ! vΌ @p `FU! Ѝ0 P0  @@a Lp ` $U,QT 0 ЍD %P Q00r pr *$ԡȡgfffܡP@-0M@ 0P 00Ѝ@-0M@+0P v00Ѝ@-P@jp@-LL1 00Mp0,00`@P= U2    P00Q Q Q  0 0 ,0 30#0Ѝp  |P 0 \0\ \;0 ND0D D:0 NI t,pt,t,o po p@-@PP U 0DPp P @pD0D D70 nNU(0( (80 dN0n 48n G-pP`' X/ Y JV @P0PES  R  D50PEV R  RS0@0D@ D0D DH0 (NX(0( (I0 NTm \`m 4R@- 0BAs @Q 0CR N@O-阡PP p MU WC W3@PI }4PI  3p`M I4101S Ys4 Ѝ0x30P@_3P- 0 0P :30 0  N= 0  Nl0l lD0 M 3O00808 8C0 M34hk k TRQ@-M #@PЍTT O@Ѝ㊦ЍwO 00O-]M 瘡Mpō @pG p1PR pJ @PCP`0 80xQ|Qy8Oⵦ80`TQ>C=6 sA$`040P1@P@P x0 0 5 30]ލЍ\0\ \D0 MO00@ O0048i h0   M Ѝ~\--M  $Ѝ Ѝ/ -- M0 0 ЍЍ/O-锒@P p`M X X00?B%@00P @ P 00 00 P! !  E1XPG  @VP WU V[XPVppPpW` C 0`f`0 )pP `PFPPP1 0 0zLW`!00!1 00>B ЍY0XP C0PP00 )B Ѝ0 NL`pPP V pP `P@0@ @?0 4Lb\Pg Ddp$f @-@ MA(0S2 ~?0 `0( `1/qpPp0)  0 0 PUR <0PUA ЍPPTp 0S  0CPAM00PpA@-P MA(0S: 6?0 "p0( p1/qp@`0/  0 0 @ToR <0@ToA1`V ЍP@T` 0S  0C@oMT00jAM00cAp@-PPE 4A0S5 @Tp1 Rp00P0 m P 0S P0c 0c0(^ 0P0 Y0 ST,P P4P L8P Hp@ET0T T0M LK0Sp000 0K0 @KeEb ē\b p@-@$PPpTp@iܮ@- @@bT@\꤮p@-,PPU U@Npp@-a@P`ME P 10p00S `  0 XR` ` 0@@S8  V8 CR 1!0A0 S0Q^*:ЍV   "Q @^ #R.S*@A a  00C0 F0 J "^ #RN^^ N0 0Q@ D` 4  R  *4 8/H 0X\S 040:8 R РS /\ }xB@-@`PFLLpL0ppD尀 fT  ? ⍇3(l@-P`@JL0 A-逆pP`@P( T0  0 SSS0 S00 S 0050000005%0 JT5%0 I|%0 0  00L50000  8 70L0 20-V00 ^V00;\ 40000 00B0!0000LS 0100C0 0?V`000 00000 \ \ 00y $40000  70L0 0 h", 3010P;\ cP3`b0001dP0j R SXc\Q t30100 M \; =\H \7 00C00 LR0h0100C09" 0 0  Y 00L0f" 0W0C0_2 F0nR! \0F?o2%500%0F?o2300&0F?o24 00=`Foob%d 00!0 0   00L0! 0W0C0 0 #\ 0 0 00Pk 00L0 0000 0 0 0 0 0 0\ 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0dP@cP'dP<00L000L00<00uP00pt^ ^ ,,x^ \ \ 8\ TZ O-`RM@p , [5 X PI 0 0X P@0 `D-PFV0F7 `  [ 0U, 00 0 }/0QH[ 0 /0FH 0@SS0T 0 0@D0 T0 E0 Ѝ1J00Ѝ S (J00NX W LW ` 0  00~  꼍A-R@P0`Sn !"#b! DQqU> 0S$ RT 10 R RO 2/!1 00U00' 1/0P p $@40081003/0P !p0 $@ 0V0 00 R (OP000P3/0P! U  R  SV  0STGP000U />3Xܡ$\t=A- R@P 0`Sm !#b!b DQqU> 0S$ RT 10 R RO 2/!1 0 0U00' 1/0P p $@300810 03/0P !p0 $@ #0V0 00 R (㽞P00 0P3/0P! U   R  SV  0S㵟P00 0U hpP,tA-@P| PB`Px rpPh  00^c<!"#b!0CaqV8 X pCPXU $001p00S ]3\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(P` p  0000St%P0000H0003/P 0/>3pPp=A-@P{ PA`Pw rp Pg  00^c<!#b!b0CaqV8 X pUCPXU $001p00S 2\1003/P00> 000$0(100S100S 3/! 000``0S 000S 3/000(ゝP` p  000$0S㌞P0 $000D0003/P 0 |4h HSR: G-P0`00Sp 3/0Y @IOP T 00 00 Y @IOP z T P00 D0D 0 p`P/,,SR; G-P0`00Sp 3/00 Y @IP E T 00 00  Y @IP 2 T P00 D0D 0 p` P$/ȗx O-PPM M Q \ /\E P@P:p/\ p P/ `K`\n @ /RR.\)  B R/0  D0E  I p c 0: S#  S/ L/o" R/\  @ DQ6 .PQ X0  [K/Ra0W0]0娐 !uWP-W  [@   RY  E0/\0#p0 @/R0 X0/ ލ Ѝ @ oލ Ѝ.00vF X 0/ ?    PFbF00 \F>00WF00RF00MF?00HF00A-@P Q P`\PDp@P P`V *F0"S "F00@p@-La P`M=  ?00QP0媛P ; 00\% 0@0 :\0@S \S 0@ S @ 0:S:\ \000ЍpL0P  800  E 0 @p@-@P`P3 V( 0Pp:P @R0R P:U P0@Sp P P@Rp:UR:Rp@0@ @0 C(0( (0 ~C{H {mG {00/(p@-@PP" U+ 0PER R:Q|Q00Q0S"P0@|R  :RRpT T0T P0 BCU8 808 0 7CpF lzF izO-ȟ M MDčpĝP$ 0v 0S 0S 0S t4!S Sdh`P @P5  㠚pP 00S RD@ 0 @:D@ ` @PT"0 S* Z :S `\S S S 0U:HޛPPE TpP+ iP`0@ SZj0[P0#QQ 8P6@00PS0 006 p0040(0,@= P :S~ 0pS t40@0 0(<QP<4` GC pP> :00`00 [00S  `U@P  W 0 ` PPu0S?00`YPE*0 S :S `b[ ` Pf `b :S& 0@S  0D`F00S:S:00` F0H[0 E0)  ) 0 PCy `#00p@ H PEIpGP P p ,@ pT  E0AX0$0p#3 0 D4 30ݍ Ѝ@ @PpÛC 00&P ipP 嵝`3P00PS0,@`TB 娛`@0T<S= C0@嚛C@00"2 0 A0S"2 0B A0Sv"2 0 A0Smt"t2t p 0wAc 8 40@\0S> 0 `$rp@-PP`@M V T 0 @ Ѝpx x0x 0( @VX X0X 0( @T8 808 0( @< bp< php< ^0S00S\S00 RAP| 0S7\S5 00S1 :S000 0 S4So A 00S :S|S@0@ A@0S'!1 0 8 30Y ލ Ѝ  @P 00 C \10 Y P 4@P @ @@$QP P 7 @ 10   0ǽP 5 0 04 ? 0 04 ?0 0qP\  @Y3llH8dTܿ(bT8 Dll,8 | 0 0L >Tox x0x t0L >ep pup@ 005 |4 L,hT4 Zh(4 hgA-PP@`I TR V; = PPf d@Ph 0:SSpppdQ0:SS   \0@@AdYPJ pd@ A\@ATp)FPp@4 0 0X $> 0 0X >T 0 0X > 0 F0X >pP @@@? 002 J4f$\2 X f"02 fe#2 $fep@-`PP@4 U= T& # P? 00S 00XS@<,00A  RaPAUA0AW0AS70A^p| |0| x0d =d d0d `0d =UH H0H D0d =p0 dLdst0 $V$dqH0 dcrO- AM MPßP3 0@P0(0 0`p 0S3 "90/44 M/PP9 P0D 8T 쒟  0a?00CS0   0:S 84SoE?0SA?00T"<2 0 (0 30 K(!P( 0B.K:SS00 B0$ 8T S#䡟 440<4 0 S BKJ ; /04$ (4I> <4 0'$CPtB>K0C 04 8 0S:SZD H R0 0  Q!000AM04@@0= 0:S > 00UiPe0 E0 <I0 :SS008$ 0:SS00g@ x@~/ ccd0c) bC0O|- `a'@-0 00 -H-M0 S0 00 0 0 0@  00^100M0 R@0    R L00 !@ 00 0 0 30KH Ѝ/ 4@-I0 @ @0<__O-@`,M$xxPKd20 R\ 00@`pR 0 IP Z p -P p J / J PP0 S#: =% U10 r 1$4S1$ !@00P ۸P0S "<100S (!0 0 $0 306 ,Ѝ U r :pP Р rP 5SX0(, VT00#    8PP O(P0SL\|s\^X^Dh) ˠ@-(@M@@0?PЍ@-Q@0M 0    ",  0$0(0T L=P0 0# 00Ѝ ?=0Ѝ0-$M  00 0P$Ѝ0-$M  00 0P$Ѝ0 -M 00 0 Ѝ  0/O-@@ sMPPp`0 V8 @X0^00pAtA70Oq PP0P >TAC60 0$00 @6 t0 0 1 30sߍX0X XG0 :V<0< <H0 :D d=% 0Z4Z% Z0   M ЍtO-ϟ MPÍp0_ Wg 000!R !X P  ]5P4%X 00S)00 R .> 0 3 30 ߍ`. 0zS 000P0C0 pXgP o@0 0 5P 0C PSRP =- 0 >:W=- 0 4:a`0`F p0p0S8@0 4P, 0P0CS0 0000偼0S0p0@0 0 4P0 0C P0 SP 00 pg0p0SP 0Sb0 0_00S 0p000Sp000b  0 P\PY+PS  PO00SVp!p3`0 S` 0"P P` 00 000020p0S 00hʠ@0^T@pp,(0?:TIP 0', 0$ 0 0$`-Q\ ]QP0 ` Q: @$00!0SVp!p3@`0 0d:P000 P& 0  B00  `J:0 ⼓p PTPpG@0SW `P 0@0080偼0S %P -00SH0p00p0S00 P 08pG0Wep8pFWp!>᠈ m@(0H0p0 +0BMS00 [m0H0 00CS0c000pWH&\0XS 00 0 (1 0        0H0 0(0L0 P00-0F SJ*N0 `p(@嚒0V '  0 '(0 4 8@` p>(00S @P V ,$00SPV`@ T@0  R  R=  0 BV0 5 RP/0pH  Ry @0H  R'  `V B   H 00 0SP HX A 0p0 0000P00nLH!HHQD@$@h$ ;0% WW% W! N  4  DQO| \ X F  Ed `pG00P0W0S`J 0000P T0$@p@00Lp00 0P00( 9 P6 0  B0 0  y7 0p P p/ p 0S $0 PS0pS`F V  P0 0@00WJP ($@X T 0@0 0[0S9P [($@  0(oK00>4m009V~*$  ]R R@Pp00@0 0oP00s$  ($ n4X  @YP0 0PP 00p,004@bP P P P P] P 3#0 5000C ,0O[ 0$@(j ` @vV @ ](0\0LH0\ ,P-@0 `@V`p ,X@0Vp@H0 B0PH0 B   H `V  0SmP H0 p H00CP hX0p05Lp0@P0 00 0?oV20SX 00 0 0p B0V 0[ R4PU0 /P N Տ P 0  B0?0C  6. 0(  兏p0 P s ˏPX P`Fp0S P [[ (0 {1(0 SA-@P`p*0 0@*@-@`P MDp*@0p0 000@* Ѝ|A-DR@QP`x v ,200S8 f*0P1S010t G000P`$ pW@0PD ᕍPP` 0 500P0 0 C `C000>*0  Q  Q*RQ3 <00@8 0 B`0*'P&00P0 ݋P 0 ?B 0#A #@ #T0T T`0 (4} B0 ))`(<@# @p@-@P) L0@)p@-0P$L`T M 0S pW  07/@P Ѝ5@ Ѝ$0$ $08 30p? T>00 0M0ЍA-0P$L`TpM 0S (X 0 8/@P Ѝ}5@ Ѝ( (0( 0y, n30( =p=00 0M0ЍA-0P$L`TpM 0S 4X 0 8/@P ЍD5@ Ѝ( (0( 0D 5304 0=<00 0M0Ѝ,O-MD`PpZ@@` T6 0US``$ZG 0SD [A 0 `;/0S+ @$lV 0S H[ 0 ;/@PЍ4@Ѝ0$lV 0 0 20H 0 0[ 20h h0h 0Jh 20D D0D }\ 02T `<;$ <; ;: L;T;@-$$@M sЍ@-0P$L`T M 0S 8pW  07/@P Ѝ~4@ Ѝ( (0( 0 o208p ;t90 00M 0Ѝ@-@`pP94tt0l尀 YT  2@0 O$[$ FЧ(8'Eq0O-ğ$M `H0 P 0P 0u pP3ʿ00000! B b09<Bp  UQPE @ 04BL3@0S0 MTT  MT  ^DQ #2!Q   "  R  R  \000!#300@ 00@00 @0`PU*$Ѝ@0 0M  0P-0 S^^?0@0 0`0  P 0J ZS0 { 0J ZSw R @ \1 0000 $Ѝ0\  v  `0\  f  `0\  r  `0\  s  `\00 00 00C0S ``0\  a  `0\  b  `0\  t  `y0\  n  `r0vP0U 0 D RQ0\  @`b4, qA- Q@Pp`! {P=0D?o! D2]R0S =h0$"0@ !1 0 V V 0+ P0 An n A-P@p`P.T T t0! D32 0 A_T %<0$"0@ !1 (0D,TSI6Ln O-@@ȟ SMD(ȟPP x`pt  ?o2V0S Y W w@^0P0  V0P0 [00 p1# 0 S@ PC1T- U T 0 1 #P00? PPk@T`P @  "1TP 0@T0P00HC1S@1@! <,` pPJ 0 (010S V <0 G0CPap1  * 60 0  Rp1  ' 50 0  Rp1 00p1 00p1 00p1 "00p1@\00p100Sp1 \ OP@T`|P454%40 /@L5%0 / 㢈P* N4$z0 / 0TPP{4$0 /4$0 /Y4$0 / p T$ `p@T 0p 9/P100ᒉ吉厉匉$3 0 D1 30 Sߍ@@u0`S$O 0S,0  80VR U 0004p@p`00 0 (  @ `ɠ8ʌ `pPQ^_A (, ^]*  P2 0*A5)q @. 00 (0<Ӊp %ax ~$0~s$@ 20 ,0/T 0 0S0"700 0P   {00, 0R 00$00S$0000P04p0S 0SV W1!0 .4p000Id1 @`,@(c(0 [PY4*( / $0`0S$0 DQ  HP T`I0 000p0l댡l P1 d11 81t1| 00@ 00 00 p0ܜ,- X-L@-@ M(0|0x000000@  @ 80P @0 0 30 Ѝ"뜘X@-@ M,0 0(00x0 00000 @@ 80P @0 0 30 Ѝp@-@QM`P0 )0 `aЍp0@-@RMP0 )0( PKЍ0@-@M 0 00 :Ѝ-M $+Ѝ-M $(Ѝ@-@ M00000h0 @ D 80P @0 0 30 Ѝs?@-@ M(0  0 0   @D <0P @0 0 30 ЍD`? 0@-@QMP0 0)0 Ѝ0>0@-@RMP0 )0$ PЍ08>0p@-@QMP0`0 )0  `~Ѝp=-M00  mЍ=-M( \ЍT=-M $$LЍ = 0-$M  0廴$ЍP;, ,0, (0| j&,,0  1p@-P@PP 0P0S 0`00S?p@((((3$0$ $B0 9&wt  A-10 0PS`@(M @Ppp 00 @0 P% 0 0CS&0 p0 0 0 4 5;1(Ѝ 0@0<0'" 0$ (Ѝ08w ` D 0 00M 0Ѝup@-@PP P PpPp0 *0 %&< p@-@PP U p@"P0P PB0 %U404 4C0 %p@"  $ x p@-@PP U p@"P0P PB0 %U404 4C0 z%p@"T ( O-PMp 0GW"S00`0v@& P-TPg +T@`0@ ǿ 0  d  0 ]  P p  !ʎ @00D \a0DSW0DA0DS"70DUr X : QP   S  R ' "000T7 W. 0 p0R00S 0pS 0F0 Ѝ0S R 0@0`&00 R0  Ѝ p p᠀堐 XR A B0A PR @ 0`X0X X?0 $SW p pqW ꙙH 00 0M0Ѝ2q/@-@0LM`Pp@0 P LЍ`0 LЍC-1 M0M`00<0pP|t@P U d1 0S |P(0 } &P( 1R P$P PP( 0 0 < 30)ލЍ0 娀R 0 P P0nS6&P0S  ~~-&@P)&P'&P(`}(~Կ&PpLptnfsouniop@-`T@Ὣp@  P@P p&0P«%Pp`@-@P @(0( (F0 #@ @-M @ p 0: S  Ꮻp  GЍ%00ЍO-3$@,M00 p@ +P"+R%1``kX00Sv00u e0$0P@P0 U 0 * |@P 0 Hv P@ 0N Pp P@PE%0S6 PUR0  Z*0P` R   U T 0F U@zPP @Xl 00D0@0 p$0@,Ѝ0 1}00 0$00S$0`0zP V 0! Ъpp % ` @ 10 001[!  `00 0 0 S [  + P `0 0 S 0S 0 [ |L0L L0 "yzPP @ `$m p@-P | @T @|T0 0pp@-@PP U   p@D0D D:0 "U(0( (;0 "(  /O-pP M@`0& X. @T Pf W P5@1 P1 5* P  8/P  00[W@D:P PU ЍD0D DD0 b"X,0, ,,0 X", 0r4 sO-PLMP@< [ TUC <000D $0yP [ <0S 0pD0U00p000E< 0 0 00 p ;/P ```Y`* 0 ᄀ h @( p RPpp,004PZp ;/P  R ,0WB^P5P1@1*pIp ;/P  R <0 @I 0 @V@ 0Y:V0@  Y: p I0;/P0  <0 0I 00 `& R p0 S <`0 P00 Up `@ppP 000 C Sx 00`  F \0#03\0SU (, 0p4P8`p p ;/ P0 p0RP `pP ;/ PZ V 0W$0 S 0 X 0 H BX 3  S0 0 SQ1: (,0p4P8`0S$*$Q R0B0C0 0Y00|P@pD 0 S, 0Pe 0 <l00 `<0<S! zLЍ p@cH H0H X0 Q, ,0, W0 G꜊ Pt |p@-PP@" T+ Pp bP 0S S`P p@`p0p@/L L0L w0( T, ,0, x0( ꘉ l p@-@PP U p@ bL L0L g0< U, ,0, h0<  |Ԉ P0@-PP@ M T# `P Ѝ0cbP 0Sl00 cP P0P 0L T0 000 0L $  dp@-PP@! T* 0 Q p>`P #bP 4`P  /`P p@)`L L0L 0\ mT, ,0, 0\ b  \G-PP@J T  R# R `V$ V  0Lhhqh pl 0P< R R4 0 00 0 `V000 0`V 0| 0 F0R%  0 0 0 I0l  0l ` 00 00 0000 0LTL Ժ% d T  @- / 0SAS/0-$(0@# A  A A A0/p@-PQ@`2 V' T ^ 0S^  S 0RR00p@@Tp@0@ @;0 (0( (:0 yꐸ ḑă @C- MpPÍ`@PL TA A< YP7  Y` 0S d!\1 0 3 30Nߍ(#@- R? R0 ! ( p0S /% 0p 0 0 0 0 0     RP  R0ꨫ4 (d Զ@ ضO-|IMxğ,M IM$J͍$@@P p`WP W0  $4 I0$ 0 30Iݍ,Ѝ0 SJ=00SX302 20 ? J=00岰h} 4#+4J8#8  ᑌ H J- 0S >UV0  SV S RNJ=001:02 00嚏000H0 ,0TP @,VU  W3 0S_0S  0S0s S0S RJ= 0 J=00[WK O<  xXP_  0SJ hf1a! 4a4#Q #< <0J8 0J=00x 0 Po J- 0SJ=  0rS SwJ͍0 ~%l! 00S_LP P P J=00W0  XPJ͍TP z d |O-88ğ M@pQ `@$0 0CPS0#3 0 0 30Ѝ#3 0 0 300 HD@pЍOWXc 4"4 8 P# #8lpPT0S RK 4"4$!$("( "8#8 DSPT7VT00QWX00 R0SX 0Sd S2YP00SL"0 (T@@O 00QWX00VT;|! 0 X: pYp 1嘡嘱 P0 pY 0@D    T00? 4!0 ݊piT 1i #Y8p0萟蠟PP0 p   T00?pW 0@D D ொP^T[pB\  ࢊx`T| `P@,O-p 0 IM8 P@`p/  P PW  PWD  0@S000h &h0aa00  0 P 0 0 1 30!Iߍ Z C0VX 0S NP 0 10ۨA-@P`p 0 { 0P Bp@-MP`P@@P@T 0S  R0S P>@PЍpP6PЍpp@-@P PuX%Xp0 @0 괅\u 0S/. AA0C.S .R Q P-S Q P_S /@-0 S@RO 0RM 0^G @PTO 0S`V DDp Wf U` \# DPD`VR S`/ @@@0T*R^00^00S 0 0 0R0C?o20SJR 0R 0^ 006 S0S0^ U. \2 D0D@T 0U& \ D`DPVS` D@D0T\U \ D`DPVS 0R`V\0S0p@-d M."@0' P  0R0 0S  R la  haR 0Sd .P 00 Ѝp  0S S0S,  R R R  R/@- / 0 S /0S S/ 00S S/0S/ //0@-@P M 0S PP 0 PF@ 0S0S 0S  Ѝ0$0$ $n0 o `p @-pQM @Q`P Q Ѝ0SSp P*(4"<8#8V R" R  `0S Ѝ Ѝ00S S<0 P 0  Ltp@-PP`@ V T! 0pPpx x0x t0 V\ \0\ X0 T@ @0@ <0 Pn D$n $m }O-ŸM2pC P 0 0`D\P0 $03/P 0P&<00&,SS00 80R0S_ Y0S@p(p$&$(V"(I :0@D@ 04,Uq*0 C 0\`Pg0  $03/P_ P]]Z]`W]Vp `M80S?&<00S ![?G]` D]A]6Pz00 \0P4   P P, _0P( d&D04D0Q d $RpX $Rk 4 40 [ &<00 So 0K'[SP00S04,X0@N pW} 5p`000H00P0hP0$,`aZ: `p``p ,055U 0$  `  RP $8$#,(@0"(@0S S000 0SaZ[w 0LE0S3 \00\00H40$0&<00S1 @aPPW  (5$%0 5s{ ,0Sp #0S~au\00@ (0R q[? [[^[ @/PPWU,0S <0pC 0D\A [<0 C00P: 0P00,00,0-0@@T@.\@@^@0d2z0 0h[PP0 $03/P X00 S  P@ 0RC.P@$&<0P9 6!(0%P pc!1 0D (0Sh!h1h 0`D 0SH!H1H DD 0 0,aRC`P.@%@0.?cp W0@3 WD0%[PD0v4 4 R  Q QX Q 0i^ h^ 08^ ^ В] O-@ğ SMDP0'^`P #^pP $0  088X0`00pS0  PO 000 CPK @@PX 0  2PA`?`@#|3 0 D1 30SߍY 00>[00 Q0 0 .Q0Q RS% d! St*+ 0 P ` ` @S Rd! Sf*.[ 0 P< D lPdq 0 DDQ0000 0000 Px0=S Z0S# S S Q 0 Pc0s70SS0S Z000000  Q000S0000 P=ʊZ00 0 P3ʀZ0.[0 0 0sx uZ00t 0 .0G0 oPaZ000 DDQVZ00U)a_OZ00RX HrP O-`@VpPM 43 0 S_ p`PL 00P0T0X0\0`0d0h00000 00000PSC S$ S0 0% 0#04pTp0  0Ppp0000 0000 d1S KЍ 04p#ጀ대<X8Y00YP P P 04p#`p P p08 P 0  `0 S< 0081 0T0 0 @P  0 p8 P!004000 0P^0S 0 S00d1SlXI   00SU O-Ÿ @00@$0` pY i;92 I520Y0 0 S   S  R  R Q\}  ^ \/oQ" S R0S  0PQ -0 0S Q0S %0P 0 ̞P:  0 B   (DP(BY 0( P p0`4P8p`P,@<Y 0S@TF 0S[ 0S S 00SL P(0 0= RBP R? R<0S0S `;0S%PU@;35 }\ ^  ;00U Q  P \ ^  R R  - p& Y ` P 0S   0?S C" 0c6#PY  ^i #\S㔐Q^'@ pTp0S 0`@ p$p T d;42 D52H 0SE0 S > S PR  PO 0@P0 0`P`&0e/0 8(0 @YPa(0@ S0`P@T $PP@P [[T$PY@T@ pTu W 0/0P` 0 PU`VX ^ZPS 䇟PpH0!L0 0PPHP$p]PPPB }[0S: 0S u[ 0`@ X'X7X Ty/0uQRSP㔐  P   P \?oR20S b R㔐P NP\IR PLV `$p(,PP00 00SqP@T0 (6$p0(,PpP S 00 0 P@T 0S00S`;`9  0 xP pY 0P- 0P R 00S R00W  yP5 0iPY 00S)$S㔐R0S x$x4x 0p}/ 00n,@ p0`4P ZRSQ \`@ T# P@P ZZTS㔐b ``wZ@ 0 P 0  0P ` @P aZ_ZY@0#030 ,,0a ` `S_] PAZ`00WP 0 PP[PP HpW0!@%`!!:PW@P  H HF4H`L WP @L@*`@ Z0"(` `$ P,W 0@VP` @ f xhP1x00x0 Y`@`@HP0U00L0P YP`O-PLM` Zi  @㰱q p  PP0 0 R0PF ``0S S S T@BP `0S `(0 ( (`.P00 U `V Y 00  Y``VU$@LЍTT T0T P0".Z8 808 40".t]p]< rqk < qql G-XMp@=wP `P@ 800  &0 GwP 40S0- XЍ PP PX  0 *wP ?X8 8(Pğ  $,4P$ʃ @ ! " xDb(@@ #! P\D@@0,0#P0@Dc>@ @",$P$Dʃ@@ ! "0P Db(@@ #!@ @",PCʃ@@ ! " P Cb(@@ #!,PC@@0,0#0hCc>@`" `& `jDPDC@P! P%@P,#eX @# @$@#D  , $0l̈́ 0 ! ba` ` " X`"0  0#0 e0@ጒ@$ @|ŸdM   " b0T"0  0#0 X0 ,,  b(Ņ` ` "  bMD`!0  0#0ck0 ̑!  Q<P0 P0#0Q5 PP "@ b-@@@P4d , l˂ Da @`` " (p,P! P%  PpLЍxjVp $ν|*ƇGF0FؘiD\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ@-@P 0D DD@  00,0, ,0 ꉫ#EgܺvT2LD+ aG-PPp`6 W* 0!ᣑ000? 0"@@i>V0: =0iS@I"p ` *40V@@p`F GH H0H 0 |, ,0, 0 r* ``* C`p@- ! 1 0MPP0 00@( T1 `  !? 7R8 bx b$   0 0 0 30X Ѝp@` `0` 0 -T@ @0@ 0 "ה * ) Bx_`) AL_C-<"<2 0 M000$2$"00 @00$ p P`0R   0XS 00 Q .. 0N l!\1 0 0 30 ЍQ  Aa 000C 80BS.R ^U* 00kRP 0ES0 S S^*0W 0n(."4n4#00 00@^0 8< 4^*0 8<- McP Ѝp@-D!D1 @0(MT0$00B  `RP?o2T0S8 0T0R0S A 0 0 $0 30((Ѝp (0!@$R0@0T$0B0S \@0S ( !0$ R0Dؓ@4& % A- rM`PpP: UB @X0^00pAtA3Q0OoQ01 000TAΌ LOP5  0 {pP& 0@PP 0 0 1 30 rߍ0 <0 Uh0h h=0 P Q00 0P0kܾB,1d$ 0ZM<$ Z0   M Ѝ -- M0 0x ЍЍ/--0 M0( 0 hЍ Ѝ/᤼p@- MP@*0x x` 0 l0  `@P@X@-0@/T  Ѝpp0(@-HH1 0M` !000Jp @P   hp ~@ 0 0 0 30'Ѝ~PpW @@T PU 0S?P@aT\00@긒Ļi< 0p@-P0@ 0 p0P(0PP(P,PP 0t0PP 09P 00 0p88tP 00 0ppV>V 0@-@ 0 0 0 0 0 7 0 00@- 0 MP @0P 00P 0 B?o20c Ѝ03 00 0p@-@P 0U0 0pp@-@PlP0PPhP(0PeP(P,PpO-p0Pj `Pc 0@00 S S0 S S tPR 00q(4P"<8#8U 05 (P@P 0P00S S S@ 0AS A@PQ% 0 PS0Q0000'OP  NPP 0@@PP ;Tx:P:G-@ 0PpM,0(Sy:  (T] 0 T0T 00SP 0 RJ@D@T0`E   RA 0@D@D0`0S* T0U 0 1  @D@T`H 00S#0A S0偠0  :0S000   )0S% 0p@pO0pplO(0piO(p,pw@ЍNP  (,@n(~  Ѝ00@- 0@P M   p P  Ѝ0 0 0$ $ 0P Ѝ08p 0$  $ 0 1 Ѝ0O-PTMe pE,P@ @0 ppPPd,L`P` 0 pp|PPU,PPU0 @\ \G \Q \C pp 0U00S LP. p0 0 0@ ` R  R2 R[ R 0 @U 0 `N 0JX0L 0 TЍ @\L@ 0U  0⼰P  0 ` ` z{00@Ѝ{1z / p@-\ ,@\ \ Q :\ :ApJ00pE00C-P$0@SMJ  0( U4p9:`I;$88 IG863>0Gp@71@- P0 P  000<890 A><à 0 00 AЍ00 01 0 0 0@-S@ 3/@KO-M@Y Qs` 0  @ AA! B B&"@@" AA! B B""@@a AAu! B L B \ᧇ" 00\|3 L0 1 00p0`0`Ff& G B$"HHࢆ(0F0C(6# B B("HA!0C0C1# B B%"AA!0 Ѝ ZTr `  x  Ps 0 pm 0 J0 E! G B$"0C0C6#AA#! B B("0C0C2#AAa! B Bu"0C0C Z㧇# 0Z" Z Z 0 0 0 08 0 p3 0`\\ 1L0 10`ZZ- Z) Z+ 0  p 0`p0L0 1 0p0`fZd Z Z Z0d0`YHp`F8p`0|0x0t0l0hy7 @-@P @ L0 /0 8 >p@-1!00 P@0 00D@1011.T 0@\0 S@ ? P p0  00C1000L   00LDLꔡ ʚ;8 A-`MPpM&laapGQQNHH0   @ N 05 Ѝ Q=@-2"00 P0p 0C0@@@m 0@@@f 0C0 @@@@E 0@@@> `0@C0a`.SM @000@000@ 0@E0C2Sp 2S 000 @ @  @0`00n l afAdaDn l lA`00@  0@A00  0@@0000@00 @ @@`i긟  O-``!TP@@R@@<ǟ MM|č ǟT ਄L<7!G0P40 0 0&6 0 P@ < 0D00U0006h0H0p0,0 0  YP00T00S <0`1  D0PU 0P 0U V HKmV0h0S 䵟 ,0U?p5P00P 0U7 W,0?p50= 0Q8 Wd0 m@V,0? )R 04p$UpP   BP*4 .,4 p0T4P p04 p08p4@p8 00SHP `F0P40[(0 $3 0 |4 30ݍЍ_3P `0^0S 00T00S <0`1   Jp l40S T#2 0 |4 304ݍЍOiHp$P,0!?0"( ulUX" 8 " \```PT@X`l@F`DV?xT 04  S D$#$*D(H"($H3 Z 8El pJ  J=l T0 P82L p 0J00 .JX+ T@F0 `D VT@X\``ꌱ0   Zl0  0 @10d` `ppG  pGkT0 d`0L p 0K00 .K+ TʴI k=}̜G94Bt08P8E77p7L76T6656655Da4`4@443O-tM@@ `NVPPh0 0PPp 0  0`14S, ἴᾤ0  (6< 0 V 1P806< 0B>PU  0R40008 ^k`1S   ;`1S0 O0  0PJ0  0P7P  PP$0  0}P0  0qP0  0eP0  0YP0 0NP`1SxYz < Pg0ppW  0R 0jVpW 0pW  0Rx 0jCpWf 0pWa  0R0 ,0j0pWGpWD 0 PS00 j`1S   0 ` 0 `@0 `0 `, 000 0I tЍ   Y _2P  02001p 0'001p 0001p 0xt1p 0[,CHL .jtЍ tЍ 0 #10 0  0 0  00 x0 ДDL222dP00/x/xd-8- -,,D-|-\-<--,,,,@-@`00AMM0 400p00 ?PP0S mD 80 0 4 30AލЍ.(S댍 0,@-@ M pp P?`P7P 0S@  Ѝ00S.S 0S Ѝp@-|0|AMPt 0 ` $ 0 @P 8 00 0 4 30Aލp؋p@-P@Q`  @Q ePV 00pV00p@-@ M`pPU 0PU  0\W 00 Ѝ_00P0 `W00 ЍH(p@-@MP`0S 0 @S 0S@V00ЍpO00@0 PV00Ѝp'0@- MPg0@0@0@T  0U Ѝ0p0 0PU:L@@ Ѝ0<00@,0 0P Ѝ0L0'0((&p@-Q`M x00<@,P 0PU  0VЍp_40P 0`cЍp @@t~,&~p@-MP 0@0@=@T  0UЍpt0 0P>U:P@@Ѝp <```@,00P,Ѝp}%%&T%0@-@ M Te  T T 1 D0R  T8 2@TP |QTP Ѝ0TM  T/  TJ DQ TP 3^41P( 0@T T: QTP PTP PTP P TP PPPPPPPPPPPPPPPPPPxPPpPPhPP`PPXPP D&8&p&&%&%x%%%%%%%%$$%P%%0%@-@E( zP<8 0( f0@- MP+h0h@0@B>@T  0U Ѝ0O,0@ 0P_ Ѝ0\z #"Mp@-@ML 0 Q0P0<00P@ ` 0. 0@T @D D000T H0 0 <0 30 @Ѝp@Ѝ/.0 T2T#O-PM`@PP p0 ܣQ  ЍSq SRPP -R0  0+R0  0h30P0 00 B10 11 .R 000 @T@0✑)SQ 0R#300@0SQ #3 00R0#03!3 T$ +<0+80+40'<0'4 0)< 0)400 '( )( p 0R0p T000@0SP 0R#300@0SP #3 00R0#03!3 T   T000@0S\ 0Q#300@0S\ #3 00Q0#03 3 T   00 Q 0N0000J00 0 0 >,O-Q0 dM R Č  $Ȍ (̌ 0 00pp< pp_p  cPc$ЍC-@P@ `p MPOP @U aP@W  Ѝ @XPt0 0000 0 P"@0S0Toᨂ#ohzlC-@P@ `p MPx@P @U WaP@W  Ѝ @Pt0 0000 0 P!@0S0Toᨂ#n4 Py\p@-@P600CS0 S  P `0 P-pd`0 0CS0S P 0 /d@-M@0  0000 !R !h0@Ѝ@-0@S@#0@0Q R#  004S 0@R Q R 8 @0Q    vHp@-DPD0P`@0pp 00p@,X0-uH(p@-@ @ `@0Ppp0p@,uHA-DD p@0P`p0 ALuHC-P0 `0pMrp@ H 0D @ <8 X@Ѝc:tHC-tPp0 `0p MHp@ ( 0  @ ЍA:HtH0 00/sH0 00/sH 0 00M0ЍsHA-TT p@P`M p 0 ЍTsH0 00M0ЍArHC-tPp0 `0p Mp@ ( 0  @ Ѝ9rHC-|Px0 `0pMp@ 4 00  @Ѝ94rH0@-P@000 00M 0 0eЍ0qHp@-D0D 0@0pP p@9pTqH((  M  0 ЍpH0x R) p@-P`@V 3P 0S.S  0@S \S 0SBp0S @Dp DU!B2p/@-P0pSp@ M` \0T  0C0 ЍH0H0 p<0<07/0< 0 oO-Mp`@PpM WC*00V>:Y ` <1 p0 p, `P 0 p- 0 p 0% Z ` p0 p F0?V0S0 0 Ѝl0 op 000000Ѝ0`LP dO-MX@ @D 0 ~p_ $0S`p\ 0 qpR 0 0`pJ  ;00(0#8 0;00.0 .00R0  0 AIp* 0 Y0D:08H+@B0?R0Sh*h:h  d0T  @ 0ZD : TN 0 RP@*9 0 0 30_ ݍ Ѝ= 00H0<0@00 0 p@ 00 0'p,h) 7` H =< 0@ 0 p0000< 040 B~P0H8 @I0? R0S(8 0T &=<00Se 6@0D;8d 0 P`0 p < 040P` BFPH=<00S 5000Yd 00D7 00 pa =<00PC  7 `P V ʈwVp{ @P 0T00 E`pA 00d0V0@D^ l0 Rp2<0P`40p@C 0P`P"0 9p 0 P`PY=<00S |5@P50`@DK<6d 0 `PR0 p P*=<00C50BE0@d 0 07p0 p 000d D; 0$0 p 150d  0 p `VD S @TP0d 0 00  p 0SDK =0003S 0 p DPUD t dtddp`0X1 0E@HS 0P@0 PjK 0 D 0}p^ =-00< 0 SZ 0 PN=<00 C30=+L0X 10"3`# 00;L0==0;L020 200;L000300;L0<=0;L0L10 0;L 0 0p 0D 0 SSrp@`T P 0d U`  R @ X$ 0d  G0 p @T 0=+L0X 10"3! 00;L0==0;L020 200;L0L00 0h!;L>L C+A0X 10"3A C0;uiiHt 48 @Epd  L %T  *  4   <  h P \ , ==( ==== 'h0<\VUUU|\Px PD"p`T x ض H =000+SI =<00SI@0@d 0 0z`P0 3p  0 d j0 %p 0@T0DKI*xQ `pPTDK> 0d 0 0L0  p  < 040 BP0DK 0T*P rp\^ `P倐P 0$VQ  R @0 Y$ ]0d   0 p @T0-< 2!?C0 Sh0 p@ 0 p=<00SH 2p0D;3d 0 P`0 pl <040@C 0 P`%P^0 upV 0 P`PMH=<00S =<0X40 0 P9=<040$0d 040 0 Bpk"=<00S| =<040v=@  <<0 ~ 2@}2@000<`DL5( 0Y P@0 p -< 5B !?C0 S0 p(=<00Sb 0d 050 / 0 p `VPpD6 1RG@0`P $0@@@@;= 0Hp 0d& WP *( |60@@6 04/$0pG= 0p0VHD 0 S@P0 p @P<0P`40p@C 0 P`4Pm0 pe 0 P`#P\0 spT 0DK 00CSw 70=<00S0 H[= @ 00%kT` *0(<(` p0p8 T07/=@D @P 0`0H[08d 0 w 0 2p 0YD2*`@xp0p DPY V 0  p `0d  @I 0 p `F@P 0 Y 0 p@P< 040@P BP 0 p PDK-1 0@)1H&1D  8 = 00@P ( |:| 0P: 05/P`10@DK1p*0Y~ 0 p~p< 040p B9Pr( 0 pj HkDK`0PD[ d 0 0 spT 0PD[ 0d  0 apB 0P 00 @0<d 0 @P 0 Hp) Hq=<00S\,0 S00=<00S L0@d 0 0h `P0 !p 0p00d D; 0U 0 p  0 d G 0 p P= 0DR =<00SP D0@A0P>0PP0@D;=@2 0 `p0 p < 040`p BrPH 0  4 < 0 BdP0Dk 0PCUx@pQ@T 1 W2 *0d  0 px=<00S /@/p?@@2 0D P`0 xpY 0  PQ O@0 DdpE 0  P> 0 DSp4 0  0P@, 0D; 0@p! < 040@` BP_=<00S 0 C? 0j=<00S 0  4 < 0 BP0D 0 S</ C 100 S{0 p,0 H{= ` 00# VP *0(. @0> 04/0-p`F H{D`X0 p0 H{= ` 00d#VP *0(-  @0= 04/0-p`F H{D`-0 = R =<0=0=<0t=0 0 Cd=0 0 CT=0P$ 0 PU0D[:=<0}=<0=0P  `P&VV |p@P 0T00 EbpC 00d0V0@Dn0 Tp4P<  @PNTTo (|p`P 0V00 E6p 00f0T0`F]B0 (p;d 0 `^ 0 p U tk`PUDK  0d 0 0F  0 p=<00S=<0:05O.j0`pD{P 0 p :d P0  P 0 p  0 p \ 0 p .P` 0 Dp = 0H{` PPV *0()  09 l09/=p`F `H{ `p 00 `po l 0 pg -PD 0 D ypZ =H{ ` 0PPPV *0(( 08 p09/=p`F `H{ `p 00 `p0 0 Gp( -PX0 D :p =H{ ` 0^PPV *0(' 07 t09/=`F ``pPH{ 0 0PBp 0 p b-0l@DK @ 0p =Hk P 0@PU *0(& p06 t07/p=`PE PHkP` 0 0p 0 Pp 0 pS0 HK= ` 00P!V*( 5 0`6 06/0 HK= ` 003!V*( 50`5 06/0 }pU] 0 Ch50`0 opO ,0D(5d 0 0 [p;0 Rp3  PDK 0 Po0 Bp# 0@dDK<0`PC@p0 1p  040@pP 0DK 0S 0 pDt,` @DKNSd P0 Jp0 p ],@DK80d  60 p C,0D;L3d 0 $0 p < 040p B}PD  0PC 2gP`&P rp@P 0T0 0 Ep 00d0V0@D 0 pH2H"0 <0 p| rp@ 0@Y0Dg:P  $@PYTT qp`P 0V0 0 EvpW 00f0T0`F 0 fpFVH0 [p;(0 Rp3 qp10 ,pHXD0lhx8<4 |((*||HX$L||H8P TXX VL0 p l0d 0 )  0 p 0 p ppi 0C00T0 p0 p qpxV(0 pqTT0 pt0 p qp=<0!1 0+J X0X! ##1 0  +J X-- +J XX" !"  +J XX  #  +J X,- +J XX! "  +J X 00 ;J0Zp; PUD '@- R  MAL  ,@0@(@@; Ĝ0 Ѝ踋MM$000 1 2Ѝ/A-PS`1p@@W0 V:0 $4"48#80@PU )Pi(0@0T0T0@DT0S,0, ,l0 QP@, @G-0pW9:P0 @4$#4T0/` 0 4$#40 @T"0 T4$#400S X0T0 $( ,0 P0@ (00A-QMp$0PS@` 0! $, (0v(`V|0Sx(0S0! , $P, (0V3100)Pi,0 \, d0U4#4 00,004#40,T(0P0T(0 S0P$00Q (0, Ѝ 0FP5, (` , Q/:04800XS: 0ST.C+SQ/+` 0000  0C Q7ࠃ0ࠓ0CQ 00000  0C Q700C20L0L L?0 404 4>0 ' P $`p A-Pp@LU`. T @0 x0W``W0 .pPEVp P7000 2000 S70Q00 V00 0  g 0T //o/|////H1@-` @0 0DM0<000p2 020 RP=-00000C0< 00 0 <0 30DЍl$l#O-h2hrP0੒ 0 M 'r DrgqC8(00B刀B$ C@$AR i!dP @`3@CG*TNXWnY1Z$* @ 0 Sp: [ @B0?R0SJ  Ѝ @ 0 Hzp# W0Y[0S    00000000SW 0 Wp@@ 0 DLp XW  0 M?p Y L0L Le0  Ѝ @: %I$"T؋ A-`pP:0S-@ T 0D0@D0C .R T  S\RT  S0C\R@D @0.  0 @@Z( 0 p@-M P@ ȍp k`\ p Jo4 (0 0 8 30ލpk@0-@- M0@R0  MPP * Ѝ@Ѝ/ N, Ѝ@Ѝ/kPRp@- `@PPP0 ?p@X00pPRp@- `@oPPP0 ?p@X00pp@-@Q `OPPP0 ?p@X00pp@-P@XP p@ p@ p@-@P 0PS <0S GP \00p00pQP@- 0R R  m00p@-PP Q@ @Q Q Q ARt032 U00p P !@pP Qp@-@P PP  U 40,E0S &00p UPpp@-@P] T 0 4. kl\ ʠ5 6 0p0O-MP0@)p讟> 0S @P00 00. L0P-Q000Q0 0 00A SG ` @ a0`A L @00A S,TT Љ0A=01 0Q- pQ# P  ( EQG 0 0@@0SЍ0S0 EQI@(L0L00+S -Sp! 0 C R0SL'L00S 1 CR  R #^iSM *ISJ NSL@ xP L00(S t00XS PLP0Q Q0 0r@n} T0Tpp(0$0@<01$C Z}0 0S%$0S| $0S0$ %0cS0`S%0 $a@V@L 0f0$ pC 0pS R 0S00 0W0pMWW'r" 0 +  0pWS \刁5A\ :L*0Sh&BS5\l :%h PPP 0S \:%PYW US Q"00 RL000S 1Ѝ( T0K@Xpp$0| XRdLT 0Ru 00L0 0R 0l10BS ER0 0 ' L000L0Q P00p0L00@@ 0 0000 vP $0( S B  ?R    < (08m@P@07A0C3@0 U  0``R 0RK`FPES[\$0SVU UPV P娃PQ 0  0勃 0S P  v X7@PvPU&6A vP 0S \ 070jS k&0B0X&!~[ 0> \PXq ~Pxv t rpP   ! l0d PP P d lR0(0`C 0(`S 0 B  B PPR6ag0@0ms0S 1%(0^ L 0C10 L 0B QQL0 (L00C Q4Q0o (pP(h Ta@`T Љ T\@T ㉐0 CL00C [!L 00 B0C [@P\$W knS PW P坁 P, v Pր, P kpPpj(߁pPPY  u\` 1@P,`-uPu [X0S46S p3uP# d3}0 !1040, Pc2`VC <0jV00S "2tP P3{[1@D0Dk6PCX 0}%}@28 0S  R |z 0}X00 0@P!=1tP PRP NL J 1!e} 1k} 0[!H1040 0R ER  R 6p40 l@00 0lP0x LT q0@ S 0S}  0S 0% 00C?o20 0^ 1 0 !}W X!#N l0#!ID H|A5?w Խx|dt N?55?P9?q TL@tP L0p0CL0tPL00XL0` h0%N56BXE\0A#|%| 0Q56Ut 0% 0# 1!LP00B(0 0@a`] ER@(B`y 0@P\eP 00S0 Sy@PApg0GruW0j0 08 ||pq p0S% H0$^LR EQ@ `L` `@( 2sP"2sP 2%Sv,0Ss 0%P dPR 5&tP~0T X95F\@~!$m 0@( #1 0 |W ~ 0S \3!:k cR R4R 76K0cXp\0\ 0dP 0Sg0X0d0 `S80S 0SU V@TP~~ ~~ ~ 0SI 4 {40SA<J 0 %Q4! 5# 85!@l LoPrp0l 46%x5\ [0n S ^X0 X 0j{VX0@SUN\ 46SI60jS\9k&PBX 0g{X00\ 46S`60kS0S0S Pq P\ u 0S60T kSR7S P~~ ~ ~ ~n P P@(W 0S \ 870jSS7X0S ^5 E X" 0{ 0% 0cP6 X02X0 0XS 70jS# k`Q ^ ge6C#: :X \0^X0 qP8R 006\00X0 (0 00M 0Ѝ@ Q":?C0CS S $4c&&0C0c2///A-P@U `y0pS @ P 0S U@Dp@-P@dP`P0 S :pSSp 0R:pp808 8e0 _$0$ $f0 W됭l hl A-P`/@,T*(P/ $P4 pPW 0P P B $$P W 0 P l l0l C0 T T0T D0 < <0< E0 hk ԬDk Ь` k Ь<0 0=@-@PDQO-^ `Pp  A@ 0S 00CS 0\V0 S  RYWppXpQpW\`\\U0 SP\p4j Q@-P0-r-w0-0x000 00000S wS -S rS  0S /xS  / p@-^ PB2 pw 0 pP P//0S/ S S/0S/0S/@-@ 0@0T S R RT/ ?/PP/=?0PQ/?SQ $0$ $p@-0 /ܨ(g  ??SS $0$ $p@-0 /ጨf ?S S S`/Q/AQ/Q Q/?0 H0H Hp@-0 Q/?S0?/0?/@f QP0 ?0/@- 0  p@-nP 0P0(@` P_a0Sp0@ @`p@-@P`M P0ES  aЍp  P7a0S 0 0 Z0 ꐦd p@-@PpP Q 0S Pd 0PS^ p@[ A-PPp X P@PEX `P@`( (0( 0 H`c O-` MV " p@IV P^P @0SV F!Э0 `F`1 Ѝ Ѝ  ` - ^ x 010C. *  $    b A-RP`p(M @x 0 @0@0 P0 P0sc P@ 0 (Ѝa a  T00 5CS /0cS#:3 3Q31:0CS! 2#0p@-@PP U Pp S 0\\0 0pD0D DL0 |U(0( (M0 r{` {` lO-PM`p 0FV"S00 0\ P @P-UN +UP0+ p{"@0 P00E Qa0ESW0EA0ES70EVt PSQ '@0U0 V)  `0q 0T00S0 S` 0J0 ЍS T 0P 00 0R0  Ѝr `00XS 0A0C0A PSVr `Pr ` 0 ?0 gꙙb] b00 0M0ЍT QO-PMp 0GW"S`@ vP-TPs +T [ ?0 00 00DP p P:Q PS \1 !ʎ\ @00D ^ a0D0SW0DA0D0S)70DS&| [YQ PS \!K"00D"00 0S \0F0 Ѝ[@`K ?0 0㥿  0㞿0b 000D00 R0  Ѝ[@`f0TK W@0 p 0 00Dl0T00XS>@ 00DA B QR cp >` R0T3 W  0p| px 0@`> p PPL1L!L?0 0p 0>00D+00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pe0p 0> 0W 0@ p p0@ p 4333333^Y 00 0M0ЍD  | 0 Q?0S @-_-- Mv ЍЍ/G-PP`P VX 00 !PER !U6@  PG0 6PU pWW@+|Pp X4 00  @@pG  p00ڸ  0@0 0ϸT0T TB0 V808 8C0 ᷸tkV H^V A-@PH`H0``@p @T  U A (Dip@-@Pᅸ00CS0 S  P `0 P|p9A`@-@P c 0`00@b0 60 \U \- M ? # Ѝ0@- 0 0 MPP000@ T#   q "0 0 0  f| t0 0 0 30 Ѝ0T0T TT0 MT<0< <<0 C]`  tp(T MXpT hNA-pP@`' T0 V9 0S 0S 0P Q 00 00 R` FQ`00x x0x 60 TX X0X T0 V< <0< 80 S \R h0aR HbO-ß OM4`tPP `p@dh V Vv Z.` 垳P 30 00 [ .Q Q\.Q a :0 {P 0X [ 00:[.[#4N[0Q.SH Yf0IS00_00 I Z  0V W P00 0 ` `0 0C SA: `0  `0  +00N/00P!@1 0 41 30GOߍ:[ 000$0( @,0 000 `0P  P00 ZX0000 0 ( 0 A<4 tPPG U.R{  :ܲP o\    |d H4O X`BO-`PM@  0X0 X0^( 0vP> 5000 00 P @ p  P 0 "00P > R  R 0 @`V  pWI1:pG`W:\pG`R C0  ` Z`pG@ R t 0 0 00@ߍ R R0 S S  ƭ P| ` Q PD ጽP@ !T: pg P@D X0P@- #[0k0 Z  ?[` pG Ka  2 pG  Vb һXV P 0(P ` `p R R R RT T * ZP  RPD(P@D PV p@`V2  P' T <:`P P !T014@1:r 0 @ 0ÿ0 0@ 0 @ 0 @0`pP_, 0@ 0@ 0  PP P 0 `@dda J xwh^@-pp10LM`P0D00@G Lp0PS- @.0 P( U( qp0 0 0  38P 0 G  0 0 0 D0 30LЍ7Ptpp P@ )T@ @0@ <0L +Z dh G |\A-PP@M8 q`p@T* X pp00庺 0 7P0   0 Ѝpp @T Ѝ7P @, ,0, (0\ ׾tDt\F ,[ O-ʟ UMMLōlz|ŝ`PpxU別( 0 (0S 0 S00X :0$0(I0P,0  0 @[ S#p`P ,0)09 0 L5 30XUލЍ5 0 0P0 $03/P @[:0CoᨂS  Rm  P0 `PPP0,W4'4p8#8X 05400 0 T0R?HDL@08< `\ T^*`P0 C 0``PS0 $03/PK @ Y) p@ T`0@W4<0S 0 S  R08P0 0S!0S H0S0P容P0X`*\0L 0R *p  H0`0LpH0 00S 0 84H0S 0, d0L P0QH RXK p p XPH `BZO[P0 0 0PV ! R  ȠLȠoQ \ V SppQPW  WX0 B@GAq 0SPSPڰP^!P"@Qp`0S 0 ,0`@D @PC0@P0CS`@:Dp` @nWL0X C0 0CS`:`040$0S?0 @0r@Pe0 v VB@X00`VX @`0@``(PK S  C'SRE 0PH 0`D0%P `h2#3 0l (0SV#3 l 0L(0P04D0,0[?R0 0 @P0 8 VT D0,1Q:*,pP䒸P P`P勸0` CR00V 84,p@PPpv0`P@ CR00T@hP`@7$03/P `u/,0D(`C 0T00Pu  , D00D0D뛾 0(?7PG0 @P0 D VH0S0P T D0,1Q<*,0P,0 XLp@}( 0% xy   N^81p.` V `phfv 0  0`!L1 0 <0 30GDЍ(rPPE pP =PCk P0 0 0  0t 0 Mp `pP0 00*( 0 0 000&00pTp` IHH( p@-M`@P ),0,0   0hЍp@-M@ $$ 9 ЍL\@-MP` @pP0P0 ɠ@0@ 0   @0PЍ0@-P MP@T 0t  P00 000 P 9 @ Ѝ0@T 00x`A-a@P`PM^ Uf !0  `p0S  H  0C QA0 .SQV 0  @Ѝ0 XR   9S 4 @ `F V 0  RU 8 <04 c#!$c4" 0Ch0h hm0 1UL0L Ln0 ' @S H, nG, nO-ß3 0,M@Q0$00`P RN Pj PX0`:V000 0m Vo 0 8ß0 P @`0  ȩP ^ PUY @ZpWP p$`WJ(4"<00S W0G@ S0 sP f HrHH2pJ04 ⯷V VV / 0 "1 0 $0 30p,Ѝ!1 0 $0 30e,ЍO`:V@ p bP :ZBU8 0S 0$ S$!, `P$$q$ p 0I4 `U V V 0@ UOT00@ L 0 0@ C=0S@\p$`j `0.Vp$`WP\RWhȾ + * lF ܼ Dt) klD( XD$k@-1 0,M@P0$00`P& V.  0 0 0 p 3P* ᦣ 0 0 $0 30,Ѝ 0 X0X Xh0 ݶV<0< <i0 ӶRк TjH B' iB|' iO-ddş tMQl@p 0 R P P/ / 0 %5 0 l0 307tЍTd4P`I0 ☶Tx T 0S4 0$4 0  0$40(,04801@ R@0`S U P Q 0S0@S Pt0Su00 Y0S @\T<0000j:000@T `0= Zf 0Sf* 0CR00_:΢o"2 0 l0 30 tЍOP@PUE*0: T00S Ct"H 0 2[P3@T` 0Z00S RZ  @T0`zu YPs S 0 S P0@o Pb0SF:· 0 Y Y Y@L!0Q 0  HP Wy8 @R0P`P`0H ┵W Tr T0 ≵uA0< P@0 j0| : J0@

P 0 Q+ L WZ p  0>P 00 0 SM  00 0;/qp 00PPßQ <PU;0 {p0 ;/qpP0 r 00 0PUßR <0PUß`X0pZ Rg00bX0PZLS  00Q] <P800CPU0&Z   "  RPPL0i?  P;/qp> 0P000P @ P I00 0 PZ 00 VmP'0S$: I y AJ0C09PPT 0S  0CPß@1@!@G0 'APU0 Z 0CJ P'JPP @0P 0000 00ө0 0 0ũ 0 彩H0H H0 0Գ <<# _^8 T^(^ ]O-P,MPp@P` T 000S000Z00偩$0 0PP`W0 00 @P $ 0R00SQR+X` P  0P 0噴0  VP`PX [XhU,Ѝ CRoo$ b  B0 S $ `R``V8 PB0S0: `P`$ R``VR`%X00S P0D0P \[ TP|[  0P \ PPdP^[ CTs[H U $P` Pc z P 0S   00S S0S S ^ S@@T000S00垮i0\#00% ^@ [ @@ S@ U@0@ @h0 Ͳ0器 0B Yp@-@PP` U 00F Gp 00p0 60 ॲUd0d d70 0 0@p蔴0TS004 YY XY -M0 3/Ѝ/0@-@PP M) U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0@0@ @0 L(0( (0 CX PXl> ,X0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H 0 , ,0, 0  WTW l=,Wp@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0 ֱ, ,0, 0 ̱ VxV <PVp@-@PP" U 0S S S 0p@0/p0p@0/pH H0H 0$ , ,0, 0$  UU ;tU0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D00 _0 000 ,00 U UT :tT0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0@ 0 000 ,0@  TS& 9lS%0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0P ۰0 000 ,0P Ѱ 5RF 8dRE0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0\ 0 000 Y0\  RQe 7\Q0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0l X0 000 a0l N QP 6XP0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H i0| , ,0, (0| (P|O 5TO0@-PP@ M T 00~P00 Ѝ0L L0L H0 T0 000 q0 ߯( 5N X&N0@-PP@ M T 00P00 Ѝ0L L0L H0 ༯T0 000 ,0 ౯p P4ND %M0@-@PP M. U" 0S S S Ѝ00 0S0 02/ Ѝ0003/P 00S00 Ѝ0H H0H D0 u0 000 ,0 kT +L, 3L0@-@PP M* U 0S S S Ѝ0 00 3/ Ѝ0003/P 00 Ѝ0H H0H D0 30 000 0 )L lJK $ 2KA-PP`@7 T- V= 0ppgS S&0  03/P" W 0 A 0/0 03/P W 0 A0/CoP P0P L0 ۮ8 808 #0 Ѯ| P 0J* "dJA-PPp@`M4 W= T& {P R P P P @ЍPX 00@R X# ЍAs 0 & 0 0  0W 0  0w -P` I0@SPU@@  JPI d/(I^\ IH_ /p@-@PP U  ;p@zL L0L H0 9U0 000 ,0 .d D.H8 HGA-PPp@`. X7 W@ T P  R 0 R 0\A/V 0A/ 0  0 0  0Xl l0l h 0ۭWP P0P  0Э@ GF ,F pGF TG`F0A-@PMP` 0L U@ 0pS S  pP R`V V V ЍW J s0SP00Ѝ W`" ]0SPVh 0 0 ll l0l /0 b Pp 000 ED *D *p@-@PP U p@T }P P0P L0 5U4 404 0 *(#T 4*C?( DC0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0C/U0 000 0C/׬ (BW C|B0@-@PP M0 U9 0S S S Ѝ00 03/P 003/P  0 Ѝ0 00 3/P 003/ Ѝ0L L0L H0G/U0 000 0G/ '`A{ TB4Ap@-@PP U p@QX X0X 0K/jU8 808 40K/_p@9( '@ A@p@-@PP U p@zX X0X T0N/AU< <0< 80N/6p@b d&$@X A@p@-@PP U p@X X0X 0R/U8 808 40R/ p@ %|? `@X?p@-@PP U p@'X X0X T0V/U< <0< 80V/p@8 %> ?>@-M@*P0.S00ЍM@-M@~p  B0?R0S Ѝ(0( (0 ஫0CЍ? ?0S.G .S > -.\6 AAQ00C S;R .R0P S.S AAQ0B Q)S .S 0SQ0B ^-R 0S .00 R0/0*S0.S S /0S  .SP\S  0S/!C]P "//]R0S! C//+&0 0 / H0 00/̊ L0 4# /0 48Sc B P_^p0Q ^ QC y(00H0S 0Q* 0F S0S 0 `  0AS^01"0!0\Yp 00M(00@$ЍAT{0S"@@A@pZ <@0Ġ?  0^0A>Sp0pS 000^ 0AA^ AN[ ^( SQ0SP9 Zp? 0.$ @C /Q R 0 0R/ި00@G0?Q0S 0 0R/Ȧ~ Vs*p*Y P HP @ @0@ <-0೦< ,H,J <,+j ++p@- M P0 `003p @ !p < 40 0 1 30ލp@4By x A-P 0 0M `0 10@0 (qp 0 p0 (0 0 1 30ލ BLx w Q:/R/0S/S:00/ @-R@3 *0\ @^ ^ ^  Q0S0QA\ &(000 R!  Q 0 ARL ?R@- RQ0A  RL ?R00C(00/C/A-@P`TP% UVT RP @TP 0?Sp ɧ00ħ(00QSp@-`@P &P@`VP  0R p/pA-PAUQ?UU@A`pp W ڀ1AP聧(00|00x?00Q @-A?SSRB 0@S A]00X(00/-- Mu ЍЍ/@-M@ 5.p T ЍR/0S0 \ R 0S0000/O-P MPp 0EU"S} `@ӟP-TR +T} Y Apj`00D" [*SP# K@00D P a0D0SW0DA0D0S70DS| Y[SP;+Ǧ¦0S \0J0 ЍY@0Tg UGp Pa 0A0C0B QSnUPP8j`@pa00Dꑦ0 0R0   ЍY @~0T- U% Pp8a00D~0T00XS$@ 00DAA PQ2Pp>cj p>cP0 ?0 U@Pp>c00DX00XS UPpb 0L00XS UpbPPp>c 0=U0@PP.@ p>cP433  000 0M0Ѝo A-00 rMPPp`, V4 @X0^00pAtA00Ol `p00TAΌ 00`L PP'0 @t0 0 1 30rߍX0X XF0 ֣V<0< <G0 ̣?n n X ( ` 0   M Ѝhm  -- M0 0 ЍЍ/--0 M0( 0 Ѝ Ѝ/l O-@SM \ YXb 0pS000!R !01 ;PP E`#3`7P*Q30A 0#1#2#4#8 qP 8   [ U 0C  pSR\P0 0@pQ 0S  Ѝ:T 0 @00808 8@0 )) 0 0D A-@`Ppݘ0 {0@ݘ$0$ 0 M Ѝj Pp@-0 000St@@@pdddPP@P@P 0000 0\j ttpPp@-P@Ϥ p@A-@`Pᤤppp0php  T  5<0 ດ  A |i (H3LIA-pP@`  @ >000@P p@-@P婟Ppp@$O-DbDR`MP w+$Bp@w r@0p RD 00nx 1P[ 0S` P U [@0Z P 10@[+P & 0`V P:Z P8a`0pS PP @T P 0S  3/0S >0PU@:W 0@@00fZ Q|00t@@/ЍX*Ѝ0@0 0,h Ld ȷ@-@!BM1M 0pPG040@@@ @@=aP`d ! R !`0@  P0pA@ P< T1 0༑ PA-0 000SP``0S@P 1`Pp@ P = tDp 190@-mΠ0l6@NaG` 12<"&.2db `3c@Ez:E.€Q_uk9"mnףp= ף` Sc$IųQ\(\ Q(\)\ؤ c 0o0 ):60 0($0(>! 0)Q` _P!!!0C0 YÏ(" ?00 #2>PVX c 0A ):60 0($0(>! 0!‚!!!0C00!)aYoÏ(" ?00 #2>[?@G'PE@Gp1#! +" 10Q,U#1 ?0 25:$20 #4"".<2Q  3 #L201d0T\`"2? B4sppp0/SX0 is c 0ב"):60 0($0"(>!!!0C"0Y)Q_("Z0%R^PVXPo`v c 0㯑0#&: 600+$0+.P3&1110Bh#`V :+"#2 >t3P0 PcRP@ U0#V B!a!b0CX0 c 0u$):60 0($0!(>@$ 0‚!!!0C0`$)YÏt4(" ?00 #2>0r/D B  1?A1c 1c0R@ 0B05@ @ 502c,%2c2A@" "b1C S/  0@ p0\\%\;#吅  00u!ό#1 W?0|:5&  +4Ϡ! 5+111A V 1# 00! C2 ! 02">"`V0`000&  0@00TPP@D0S0@@ @$ 0Ѝ& vc 0 Ố'):60 0($0'(>!!!0C4'0Y<)("0,".L<0@0P<0000' 0 P<0@0P T 0 O-`@PpM 0S*  U 0%-> ZPl>Ÿ !"⑳<0  0  S 0 P00^Ӗ00;0 S! 01P0 U 0~? UP6౟ !"; 0U 0  R!h&0pP l6m&N0R'  Z0S  X*n a\Z R `S{ʟ  VP@@%.[y(  W.y5:IP % ^, Ό3# qdO0RS@@yWEVPP ` @E`E`ȟ(ȟ垫 ,`&AO᠘.hY11:hhH.B Nxh, ΌpT3# d S 0@W `P(H@1S\` VPE 0":60 0 0Ϡ!  >00C 0R d?#0Ϡ 0,ό~(C1   ၢᡍ   ǟ 0R0 pƟ ' ^, Όp3p#p q\ ` V PE   Uʬ6 00cPS;Q$0(080` Pp@`PL40#XTu YW W0d#Qp? 00?0S 8@<W 80<8p< 0 5/PS `0Z\ Q@X Q<T Q8P Q4L Q0 p0`S P Q% Q!S, Rfl0Sc pW 0 S J1F P,Pex`0S  BrI00Ѝ#XTxt[ @<8@8 <0RxSR SR W@ 0wYW? pW<8ph ` 0W#@ 0_ER$(0<;0Q$00(0;0050S<  80< $0(80 cQ< 00 4$ #3@`TFJ#M @A 0S2 0N080+ 0i+P0P0姮`Eo Z*Z:Z$4Z4*Z\4$*Z#Z1 "*Z$!ZZ$ ! *ZZ *Z Z$Č*ZZ *ZJZ$Z`*Z *Z$ Z*Z D*Z$ JZ 1\RI}QG*1YE @ $"@ @$$  `,@T7^F 0FA0  9 0PS-`Y00æ0@T |)d9 F0 0 30FFۍߍ0/S ;0BQ 0R/S  7P I@J00b0@TT PS PRQ  3 `4p@$OD(,00U; 0\ 4 Q"<$1^p) ⁑YN R`!X0@( $ \͌Tv Q0\ \0$0\4 \$!?8:Z Sc0I08*S R^ R^P 8ZCPQ L|p@W P 0NE+C;E?.h @a0X`@@X ࠋP0X0 @0PW a0兡`P  pxP0/SV0/SSSP(0/Su JF̋h R Q R RRRpRRQ BN  h$0!N$0 ph    Q$( (P ` PJh@,00(0S- 0\ 4 Q"<$1pYPV QZ$`P @ P0\ \04 \$0\$!? JZ (P,00 $ P F̋S n"1 R 0oS0" !0S  0G0B 02' 0SHK01 R p 0Si !0Sp R_@2dz01S oPW@0W-0 S -<=0- @0 R s Q t̔<\07 0 A+- h@0PbTb``U0SZ0@?`c0SP⅑QPYP }SCPPA@QM0`0 RW@ 0# C !p@pP  /B 00Nh 0 0P0W @0|Y TB(<02$ ' 4@ 0h (4 hhNO-0|M<SP 0@S >S 0S >S`@0FS@|ЍS*S0S -S0 C R0`@0FSHpP Z 0S10ƒ 0 "hh0唍 [001 OX10\1 001[ <[!0S0S >S@p0H 0 b9N h&lpt hc*[[ -[00K S@JQ@Q,Q ;Q^HNL d ;Q,Qc QvH^(- P m6Ship@019mo\@ pKpPhiRp@L)kahptulg.N   @h@@  @ P 1 0 0U1  0EP00P ,R d0(0P R0HLu`hlpgtl& $` ,`䴟䄟 $ p"$bQ.:bQ # 3!d "b"ba/ ppcW Y0[Q 0`K @L rP  Q3K p`,#0 胟 p,`bP # 3!d "b"b#/ cP`cs \pP 0P 4L#+"@bP*<#8# !c  p R ,`0 ՙ 0p4`<@ p `@D,8@Z"28#!BcRf:"cR0#03D 1d "b"b#ZTV 0@S 0*dŸ Ytc, Q  \Gce Q!Q*S ?0101c0 p/ 00c@`(0X$ 1$ (, ! 00!Z Z Y,0p4`8<@@ f. g,0p4`8<@p HQ B°! 0p`, $@ )\(\ ף{ ~ 3P} A-pQ@Z 0Sl00 01ɀN  hh6l6M`P-`P 0:S  ^P `VpFPU N hv0PPT`VNLg@_ `S T 0:S*S+0C013ZS@Sa0CS`P y @-88@@ P@ dx p0 00P/ t,0, 000S  / tг P/ ꤳ P/@-@@ @y@vꄳ @-\F ! L3/L2S @00P2S T/0#03T0#S0 P0P@T@@P20CP2P2SU PU Ѝ\00P2S `@T 0400P2Spd@4P A-`0P0Q0\\ MS@P1 V9 T@p`0 80xq|q8OT@D @@`@p8P1TA`NPP60@ 0 0 1 30ލp0p pP0 5VT0T TQ0 ++T 0 `  Ġ<^ Ԡ{^ -(0( 00M 00Ѝ  --8M$ 00  0 0 0wЍЍ/ 0--M0 iЍЍ/p@-0 0@PXx`00CS`0p S  P `X0 X PXxpXZ` (\0\ 0 `00CS`0pS P X0X /X;t (--00 M (0 X ЍЍ/ (--4 M0( 0 XЍ Ѝ/ (G-@SpP] 0S:X' (S" WH 3x0` V V,* e0p0J0`;PQ`UT 0 @00 `pp`N;P/0`Vp C000 x 80 0SJ 0 00w0 Q0 0 =0 I~PX0X X0 0 0Cw I~hY ZY xlY @--M  Ѝ Ѝ/ -- M0 0 ЍЍ/@-aPP`@M8  :pP& k@P#  z 0P S 0p@ 0$  0, 0 (0 0 Ѝt 뱃0000@Ѝ 0yЍ808 8>0 8HĚW ̚@-@P Lw 0#C@Pw0 ;0 utX\W hRi@-(p@-@QPJ 00!R ! 00! \ P 0B RQ`' Q0AP R 0 U00SpuP#tP `tP0 \0\ \0 W! 00B808 8<0  00hV <VU A- R` P$@ R0 0,°0` 0  a0R00SH PA@\`2 0[1!@  x0S< 0[1!r@  x0S p x0SB 0[1!T x0S, 0[1!EKPKNx0S 0[1!4 @?   x0S pT 0[1!@@@J@@#J!@ @@ 00B S01 00B 0B P$R x0S p% [1 0!0 *R# 0B Qp 00B S@ i  x0S  p q  x0S np  ;  x0SV 0[1!x0S Qp  0[1!xX0S 0[1!x0S 0[1!~xM0S 0[1!qx0S px/0S 0[1!Xx0S 0[1!K pu pn pgs R  0p 0Z  [p 1- pJ pC  x0S p6  0[1!  x0S 0[1! I x0S p J x0S 0[1! |pD uppW  ip$ bp [pI Tp)_ x0S 0[1!] x0S 0[1! , xt0S (p 0[1!oE x0S p$R_0p' p7 x10S py  0[1!@x0Sj 0[1!3x0S pXx[0S pL@ x>0S p?  0[1!  x 0S p*  0[1! pP & pC p pD {pP  0B Q^p 0B 0B P$R8 x" R 0Yp0 [1pP P P P P P P P q0 S  p  0[1p!sP $Rp00P P P }Pz xPu sPp ~nPk yiPf tdPa o_P\ jZPW eUPR `PPM [KPH VFPC QAP> L<P9 G7P4 B2P/ =-R R P( 6&P# 1!x0S p  0[1!P  P P P P O-@ϟoM M0Pƍ0PD L@ D0S 0P00!R !0s00d00 O 0SL   RR l D 0  , H /ܰ 0 G/@$匰` 00040h0\0 00@T `%T @T0PFU~ 0pJ0(0QPPu pT 0 @P `r01(0`0 0EZS00PjoPO   R00s D0S[ P`p=*X1RRXOX>TQ.`C4|ˠ0N@QPDD D,PTD0l(8 00E S0`0 P! 00E S P@r0PS 0r0P@PP00s0s0 PSR\  0SL0s0\0P00E S pp qp00B S$R0Y S,L0 1,  (0, ( L0(0S0c(0@0, SL 0L Sx01:`0r PZ 0SP00RQ0r0M0pd`@P,_XpTp8p@pQP)P @r A D`S-0`r0 @0\M sdpX`pGWdWF 0 rWPP@X0T080@0/S[ H008 @0 10R+ S0bB- C S!!!/.(BcS0C0P0`00pBEQ0@*n0 B1x   B0 `bS00dp`Fdp`,pG,0BpGQ 0^r0P Q0` 0 0Y ( BZZ~ڌ0$  JZ   R Q  i P JZ$0(% 0  \0 S0@0$@ R| R4 Hp8 @GT@T ڐ 0 R`@0 ;8TJZ1\8 Y`    d 0RM@ 0 pGWpW ڐ 0 R`p0 0WHXXڠf$p``@HX   0R`0 S h0P000TC8$ ⌀@DT   0R0 S _h0P00@DT 0'0 P @ 0;S0 Bh0P000$-7h0P00=  R pMqdppP@qH00Q@`0 S  h0P000$ HLXmhP00- Rڌ  ` K[0Q0S g0P00`K[0$ 0^ 0rQjQS$0ld0VrR 0 X0WPP@T080@0?S] gP@@(08 ( $PBU0Uj$p`@PEU   0R`0 S rg0P00PEU0p+0 PP0 dS7<0 0cS$0 \ Ng0P00H0$ 0C`0 ;0@P0`02S| -gP@@0h 0> 00$ (  0 R ,0     d 0   0 R |@T H  4 p=S0 f0P00|r0Sv 0rQ00f0Pg$-0  P0 S f0P00& NS f0PD$~400NS `Ur Tn`0P@p0X@T@8@>@0S80Sp0pS@ @  X%ڼn$p``@HX 0\`0S uf0P00HX 0P0P0  \ 0  SL0, L0Ϡ 0S-0qr00@S࠳ D P@  Rk ,0P 0P0ITX  䯟/s@  XP@@P@T 8pUT`U@ PEI@D0Q 0T8 BXX ڐ0Q@0SXppAWW 0ጀp`P@JZ   R Q e P ]JZ$@0P` pT 0^p0_S0 e0P0090$S*0$Z^ڸ-$ @⌀JZS   0R@0 S e0P00 0ue0P$u-=   0%s$,<   0sl`S0$3R ,0P S ,!0\, 0 P  0_S0 +e0P000$Q@4`X0T0@0_+;  0 rx00CH00\vMyo\ P{8 @TX@ `""   . B Q/P;2#0/0 0 !.BϠ # *@ Qʯ  A0F,PPF# 8 `P QP Y <"N8" P8@N@8@ @ `N BP(Q B IQ/2#΂0/ 00, $!L Q. ! A0  @8PϠPB!.#uS0Y0$00 <,00s<<M,dp\ ,`PpG`, @0Ij ^f ,  r0R/ @PgS00$* (   S ,8+5 ^ 0, Sr  "@SL0 00,pL0+<;9 ^ ,0r 0S ϠP0@SL , 0101,0p0L ,0MF  % R ,0PϠ 000SQ`5, @0j ^ ,  r0R@ P\0S 8  B0S0S S0\8 TXp@4`_@@K`U0f`p0P@0rXT8if`S00$e` jS   L0 00 ,pL0S+ |0s H00S00$p1S{ 000QG0$O@ 00 ER0 nn"!  00Bh00?R0SK 0h Srpr@p4`_X@T@8@P:c0P$80SpH0pS0@H00$0 c0P00 c0P00 SL,01L , ^z 0S r`F @P; ^ ,0r 0S Ϡ^j 0S r`@R ,P ^> 0, Sr S* , ,p@0l P{R ,0P1 fb0P00 9b@0P00` 000 0a` P% p ,! EQ0#^0  M50 c`!39owb@0P00 S   L0 00 ,pL0`b0P00 010h0X@Tdp@,pGS  1(0P`p @ x0 bRppS 00C?0@S%$0u\ \ hZ  ;a a3laX | `h`x̤ZxZ T \V  K J  L Q8QDP hPO 'MP ML000L0t@d@|pp$p⌀@DT4   0Rp0 S  a0P00j 0080@4`X0T0_jL000L0PS a0P00 I!0  P@0 D|@? PPip P0p@ 0@00/L0P00L0L ,p0L UL000 0L *L0 00rRL0 m0PL0 00rRL0 ^L0PL0'PXP8p\V`!#3 0 ox00CH0L0LFv040p 0 0 SL0,L0 00, H 8 BR @›ac@`L0 Rr L08L0 Rr L0/a 0P $H<$<4< @D 0nSj , ,p1^( ,0r`0S@ X^t  ,R! r0g^Y  ,R! r0ZR4 ,P1^ ,0r`0S @)h > 00$ @@L0P L0jQL0,p@L00gL0 R rL0L0 Rr L0@X PL0 Rr L0@h&h6h 8 0*nSR$|@0dL0 R rL0WL0PL0jy&6  0 nx B0?V0H0D 0p 0SL0 ( L0L0 RrL0@ @ SL0,L0 0, 0 @` 0P $|@ L0 Rr ϠL0L0 Rr ϠL0L0PϠL0% @_4ML0 RrL0@\L0,p @ L00L0 RrL0@L0PL0xL0 RrL0@ 0@00F0X0T00S* P,pP`00E SJpqp00A S$Q0!S- 10P` ] SL0,L0 0, 0yKo 0 0 '0D 0p>S,L0`1 `0,, L00D 0p( 0SL0  L0 p,Pɟ@-@`P MDpb@0p0 000@b Ѝ訒 A-@P`pb0 0@bO- M4P@`p08<P  ЍO3 0:ɳa 0@a ! 0uP]0ST 0S0000 #P )JPT  46OD5@DX 6 L>H.H>D.D>r`p0.0> 0f`p 0P  02PKPE@E[ @0=1 P^ 0KD0&=010x=, 0  ` 0ЍOh@@C>0 SA. @0c 0c6"ё0@DX06A0D0 0S0e0$00$0 0[$0 0C$00H00k@00@COo0B SL@S0C0 < B0@R  0H 0 00@000C?o200YU 00eD 0H$$0 H0d080 0\00S400P(0Z  40S00R  x Q  RP ) S0S[a$0 SR&@0S @ P6 0@0p$`I PP. H0S@0 0R0L %  0`S'$0`0$00` 0|0d080S\0400d00d0 Pk0(0(Ѝ0P(0 @T[0 0\ P04 X0S@CN 0@6@dP$` PpP@ VU@0S\ @H pP PP *0$`@0$@ p ,00 ЍOh0d0[X9 0 1+b@!%V 9p 1`@P 0`pD0S 8bP K 08 40@S UA 40|`0Fl8`01CbP1 0'd\  &%(@0PP`p0Pm`Pd`Ѕh Zj 7 7`p 0 0 000 0PT 0$ 0P dPT\`pwSd@T[6x0P0408 S00Ӣ?1  40S2 6 0P(10(@0YW(0T" 0$  0| 06_@ UA 6e 0`pP 1P 310 0(@ 0 (, Q0@Ѝ 5@k01 I$B`p <5P <@`p @P 00$ ` $ 0 0$0S 0SD0S40S@0S VH0SV00 `@Pr 00S0 0 0S0@ T  R 000S(0V?t 40( S 0@0 PF W > pP> P8 000 00i `{P& 0S$]0$$0{ $0S  Rv 0070S;V 04 S` p0@ s0R \\48L20"7`CPPZ$PW PK @0S\ R\040`(@4 P` 00S0S[ V`0S S P P(T~  0t9S 00@00C040S _PP10(@0W PP @0 0R0L 03H001n `Pd ?aCoc?`(?yPD? 'lC ?@:?@$@ 0P(e@`00PTP@# X0p`1P 0 0`pP e0PP 0%P`#%P00[0?0Sx0P0$ @R00P B0A`p$ 0$ @R00P B@D0A$ 0%0`$@@0a[<0`Z R0Z @0SJ |0 4018 P 2pPS@P   ! hPG @PZ(0@DT Pt9U P|PP0( 0$ V$ + 000SK0S 9Y @` pW VW  40S \0Sr K<3| `pF 0t3 \0@`0 UAx0P01 a (@4 ZC  3`p O  0 0`p%P `pI0PP 0PP B10(@0;d0S x0P0D|01Po @qP0 S  0S& S  0 `pP `P  |BgW1 c.P p0S046S01::S $00$0 00 00H0@hTd`[کd| V0E0SQP@Q0a Q^ Q TZ0P P09Y ` p 1@ P0S 0S? S040 S @P @VI 0Q 0Q@ T40S `@ p0S0SdP0@S00$`@0$@@(  0S0SN0` pWf 00S0S0@QPQ0Q0( 00S0H046S0H001::S $00$0 00 00H0100@e0 S`| p|( `0 pc0S0SS(0RP0S 0S S0Z  pP \ R\040k0@90`( p0@00C04 \040D1( n00C04 P\0S9 3 09Y @V `1 p$`@ p(0`@ p`(0 p 0d \08 40O$@- M@P`^g p ]fUT 0S*`P  Mf@Ggp Ѝ0 @@?f:gp Ѝ$S 2gT@p.g@D !460/\ /460/P@-@00 R@cP@Rp@-P`0@0R@*R0Pp@ R 0 R Vp@ 0@!O-0@ MSX@DPa`101 0daYq`":0 6  R0 R0 W *00S 00CX:X@D* R @  $P  00S 0S W0*!1R 0CX:X@D* R @` Ѝ@- `pP0M 0,@.0L10le `T 0      9f)f

 @\ @7 Ta@`T ЉQQ@T ㉐U0C00C Z 00L0C Z@P!8 0 R8  b8 nS s1 8 @0 0C10 k 0T"0 0 $0bPh0D0046,q56,0!z0 G pG@jP T 1@PPl Vo 0 x00`#$P4  B\=(0Sb 00 0R0 (0g DV瞯P X0 0C BX0 0(0 1@PVD@!@1" M`P d`3 0# 0T$\J T0S 0 x0 1KPAa?SP@PP B\nX0D S  B Rꨀ 0Pt  0L$ Pk 0x 000(0S 0$ 0 d}0 R# 00S[ SU SF n000 $0000 "AQ!*k^000  0c230(0 S0A PQ80Q00004 @00_"00-@BPP& 0P0C0 Kh0(00 00 z_"000$ 0000S0 EQ) ^< !00 0 x0|4`#$00000T0_ Z0$ 0000P0 S0pp0 @0 b0@T 4080;\X0 0 X0 [ 0@KT8 ZP 00C0.*P D@` 0# 0T$\ T0S 0x0 0008 0@0 BS0@4 @00cT00(0hT0 000000 0$0eP j0@T @DP0  X0吰0C01PUPO 000,D@mP 0`0C0dP0$ 0000000 00 !| | | |Q 0ESz0(0@.P0C0@0 0@a`B 0D  $  P e^"0 0x(\ 8 g0x0$# 0x0$#Q` @;`0 `  @ @(=[" 9R 4 0a,06D0`T"4 5\ 0T"0 0 $0P? ( 0#P 0 x0x0`00cx0  0@(@ 0 D0 CfPd" 400C1 0  0PTx0 0 x0%0D05`P$DR!0000V0j (0S 0   ~\0w (!D0 00C 0zV0a!0Z0(0D @X0S@TP  P(@`@ 0$ 00 0S0S AT00 (000D00P00x46|56,0!z< G pG0x07Z! 6 (0  # [  R  U VZ 00L 0g 3 S 000A P  @1[@d@P000!00+X0D 匠S 0  0C吰0D!000 R0SP00P0000  0C吰0bPj @ O-@ 0Q@P MPP,`PO  0p$Q@  "($(!(  X"8H XA3pIqW K "8 80W#8S 0Y 0  0 Ѝ@P   ! [/``O-3ß0 M00@Sp 21``C000 0S  0S  S0SB00XS 0Q P@  Q RWU\Q\WI:Q0 X \ 50QR j T0#03\0SWf*0 GV*0F@S3 F B S   3Z0WR 06S PW*@DPD@ Q0B Q0Q l  l>U00XS Q0X j00Q )Q  0Ѝ;^0  n2>000 )AoR㩒Y 0u Q=0>0l1 c, 0# Q:idH O-M<0p 凳HJH:@`00S 000S 0@0S DA R[ % PD  \  P 0PS8 ZPP@Ѝ P0Q[V R 0 BPS10W ^P0E0CSڣ0S| P [ TU 0  UE\ PN Q UP   U 0CC10B>P0DS0 SE@TS@DTDX`  `R ߰ BP[10P0+S -S0P: P80 0@B\ P~sPP0 PBU0L[0lZD^ PdP [ 0 S S80S 000 0 b@0Z"00IZP0D^0[ @0 QL 0S@00S P3 4^E *@C b`P `D21 2 Q\` 00 00S@0T@DUQV`Db  218 PE v @0T0 T1 T@00@0PS  Z @D@ R, 0 R Q 00PS00= 0P0@E TP 0 C0 RZ@Rh@DU 0S{ S SUUv EPq YP@"00ЍSn Sh S4 `Pb@00@0 0) 0V@ !XT 0 PeS5 0 0@0saF PeP\  0 S S T Y@"00Ѝ@?0PS- P l@0 Ѝ80S@V 0S S S@80S000L080S80S  0h800c8080S `T0D  RP!@0@0  B0 QP[ 0Q SP߰ P[A1P0[80S@[- Z0`, D^  000P0E80S }0  BR "@w0P03880S P `Z ^  0`p 1P50PSP P LD A-P@p` P  0 P  0 PA-P@p` P  0y P  0r P@-00訰0 00/9 @A-@< RP`pn3 ^ P 0 W@0 p0U0`PEPV 0 B P @` pT  0 Bz Pp0U`98C- M W @PR 0  C 0C2SzP 0 Ѝ6c @-@0AC^ 0S R@-@A0B@SA *@QAAT D B @ V0"S1 1  !2R / 3RS/0 |0|0 c Ra X0X0 c RA 4040 c R/h2<22A-@T0000bQ1 !0U2. n" p(  U2.0D10C#0R!0 0U U0D1 0CC!S R 0 @-P@M: Q @ 0 R Q N @ЍO-1!0 M000000 !1 0 0 30WЍ`pD00@0P(@0 `as -W0< @( R  00     W| U@_P_0TD00D0 0D00D00D0HJ 70  000 @4 d14 /\1A-0@`T@p Tp P. Tpp8#8S!Q*' q/ q90R0 SP aT@X@@@  000COPX@ TppPZCW@00?2  000a/.A-P0 Qp0e S W`TUU WS\0 P@ WPUP  @P@?00@-tQ@AT# SQ ^& RT50d035DPP2 0 QAR0@LR0 ^ Q(0@&Q Q0/#0@T $%R 0@ U/02U0A Q "0Nt@D23  0R020N 0p@-ˠ Q @NT#S0^8 ^RR:10@op^0 \# QT=0d035DPP!PBU3@!A1#T2D1$!$L ! A"Np@\U /Bp@T  $%R# p@Rp^ !Lt@D2   QAU@DP PE 0@ pAR@D P ?`+HO-8`4! Q [P@p M7 ^ [ R&B *p  ЍT>WP 0 [ 0:^ [>  0 R&B*`PVP3 "[0   Ѝ$>' G- PXl X` PC Xa`  P)2Q>Ϡ8 qD ?qV   @)pYP X Y  0  $Šˌ '5  ?@pY 0 X``@pW]VVA? pAAG pa2GA n2.! N3!3 aX(|'G-pDR凄!#ࠋ A Zb @Ġ)Q" Y A= b?ZN j? 2 B> Pb0502 0j 0J66j 0P 0 GH% Y# Q0I4 2 Q Q%0/Q  G2 0 0 10 I?z? J :> Pj<5<: 0b 0B88    2 0G-逓Š ˌ!Z #j pEAŠ"ˌW Š9 Uj U`P \0W: Z0:30Ao U^ VA(0UP Z@T6\ 0D:p `Sp241"#<  N2!@NE4!n<>"G V;4A?WN`F?` F62 f<26 0g<ǠÌ 0G>Ì Z>GT T`#0p!`3p3810 Z@ S0:\ 0* `p 8 4 G U( APF?w.?0 @2 `:1:%0 0e# 0E4#4E \1P@(` Z@0p0 \@ S0P(:0Pp 00P`\A@0p(o?Se? A! a< ! c<àŒ! E>Œ Z>C0pV#xP/P / /BR01S041 #<120A#a/ᘚ P/R30!#11SP41#<120A#a$00 0A#a8P / /BR00QϠT1!020- C 0c2C>`0/ᨙP P03 !0##1RD$1",!020 C cA.c00 //,p@-K@T0TUo JP& 3V @DOoUB@dp~TTQ03@d5 L  000V`pp@  000pp@-@;0$SM% SR # 0 Ġ,̠ 0C,0cΠ!= ЍR h0h 0S 4#6>ЍȠ\03:045S 긗?S/ . ?S/  %1+ p@-R@;0 ? S5 RTJ JP 3H: 4Q P  BB bS^7 ;Q039:0!00C0cAT  p@0 QABAR^   pT C/o^" R p@20[p p 0T;!0ˠSA- P   \ \ RL0R 7QR^\RB AA!@L,lS^ 3Q031:0!00C0c @C0$qaVp }@~@5? 0\S00 AfQ3:0p$0   0 P /45S @o/0  p0d 0S \0P 0S //Q @-P00 00 ?S/P 3# /R /45S @-45S /00 00 ?S/P 3# /R //45S @-W45S p@-$$!!:S$&O3S%C>c0&0T @c PC22 Q 2pQ,pa1^ Qp  000pPS \  000p0C?oP20Sd p0@-0!*P M!: %+ %U  C!A Ѝ0@` O Ѝ0P0P 0S % Ѝ04>70 -Ϡ M\Ϡ Ѝ Ѝ-Ϡ M\Ϡ { Ѝ ЍG-鸒!__%!J #  Z Tp`8 0O} @JOo\B@Tj GqP0 #* @@8S*p@@4q#<p100 @CĠ+C+0ct0Ì@dZ0V R0`! #* `8SQ:P#<1` ` F:+F1+`f2fj Š'ˌejህ0 auP6`Ǧ0!03\ 3 0 Q @DA 0DG^ ʯ X00 \ 0p#*0 ^0`#:4`(O-d!D㣏MfF㡏(!# Y YP00 T4 @ Ѝ` Y@ ЍO0 T0#: 4#<100 CI+CA+0cY2Ci\ e kuEJaU AQ 0L22*0 /30 W Q0P0Q\`0 R 3#0 \IP0 # 0!K* 03 0Q @*Ā ~  Wp`\p`Wp pp3p#^3#\` \`Vp R0P 3# `p ЍOm0H 0(P 0! #* 0(R#*0 $1Ѝ2p``R0 #* 8S6*0V 0#:$",!E0 0 C+Cba+c0a"e"kuJUa AQ 0c 0C*W0 #0!*W00#!-*%! # QP   00 / @- \ llQ  QP/> 4>70@-! # Ϡ\Q^ ^0030# P  00  h @-! # Ϡ\QP P03# ^   00  : 2A-(a(1`pP0MS3 U10AT !0S 000ʤ %@T  0S00 0Ѝ  @00D1S@000墤0S 000噤 t h 0p@-@P0p R pPQ`00App@0D `z80 0QApp@n th0  ,0#10/!Q#8Q#4  00/Q #2#01  //30A-`p@P p1,0@U00p 0Sp1P@P#pP   ! Kk`gP0301#S412ss /"r3J / R//@-@P0@0O-0Z  @ S MpP; PaU* F B  -K  ^ !*0I0C X00 ZP`V 060Y00ZP`T@T 06S @ ЍG-聟0PpS%Q@Y A@iV'10SQ`P] 00001010i0S p1U @P4 P1 p@T `P@T10SfP@$ 000S 0+0&@T 0C  pP@h0iV0S <0 ,0R0i d tq0hG-`0b@TP塢ڃ0TP$ Zp  ZJ p0   a!  \2)R0L`0C\0030 `-pG \ `#-0P!1^$23\ *G-0@`@DTP  !1QF*32\ I*@@P`P @P @pq0 0S 0S W 0G`WL3 ``PQ@! H 00P0S 3 # Q0 A B  02NS bP 0 00P` A-P@Q`pE9 ` P0 T @*R0 b3ΠŒ2 ET* 2> P08 T `6 # 502,130?C-` MpP@P А'V`0Y 0 CII5` Ѝ s P `!300SY 0C@@1` Ѝ0S0/0 R /@-dap`@PMB L1P5PP3  pP-0S  Q6 p 0: S/1P  8#800@ 0$  0,  0( 0 0Ѝ9J00Ѝ<0T0T TE0 &H&J00"JO00P 8HHn{p@-@P =00CS00 P=pP0 =0 Ghr{h@-@P 00CS00 @ 0  I0 Gzqp@-@PPD 0rS= wS+ aS3`0S  +S" e0C\S00S``p0S0S0S`0`SI 0 p` 0 >0 GDzȴlyдp@-@P8 0S> 9= P00P! !' 0S 3/PP೼000P @ P J00 00`C00aa=d0`` 0p5:P404 480 7G7I 0P0|oTx̳@-@P 00!R !+P 0C 0 ;0 Gnw`@-@P 0 0 S @d:0 ;0 Fntw p@-Q@PPP 100S3 0 VT 4000S8 0"$0 3/0P:06p00P @ P 00< R 800p/0PrLm :P00;l l0l J0 F  0@000 pH 0 @00H <um-Ѝ/@-^@S S S  `0@ } D0@ VhcH 0  0@ 6@000 0 0000/<P@- 0At @?H41S O- @fQM  Q 5/p0 `( "Tl @`t&`p p \ P P pd` X |< $p4  P` tP(  `!p%(),$-P,0d t415 T9 8 ċ<=0  "#&'*x+|./` 2`03X6`\7:`;Ȍ̌`><`?`  +dl+kh+&dlk&@kh+&dlk&D kh+&dlk&H$kh+&dlk&L(kh+&dlk&P,kh+&dlk&jh*T&li)j&+dXi*h(\g'+d)lh*gt&`dp0ex%j*(n.jd+)h`l'n&lx,p eT('lP`X d%xl( `+ẗ|x|FGEPKJ`DIpŐlĀH`ĐŀPt l [`0 `pA/`47pd APpM_ĀmXQ 0pmPSQ 0pmPHQ 0pmP> Q 0pmP4Q 0p}mP*Q 0psmP Q 0pimPPQ 0p^mP YQߍFOFp,qQߍ/aQ@-P @41S  P aP0FA-4!@ pPP/1S 0L1p @P!i;PPPUQPMoP YPQp $OW [Fp_oRVFpSFpp@-@P 0@6@A-@`P] VapPPQ V 0E( Q Q Q Q Q Q'  Ǡ    Ǡ   V Ǡ Ǡ Ǡ  V E0@BE@SSO-P M1 Sz$aVp$q( qSSp A`TR X`D (1 Sʃ ರ[ `0(q^ 0 P@  Ѝ Co$B/\" (tr ₰^ Q `VH$8 S pVpGp@(VK (1 A$T$$(0 [ `(0 A^& S :0  B @PME@@,A \$Q(!r8 V(, T00100, 2C(1[$;((~ Q ذ0 0 C $A !`($aT夰0 C0(S 0 sP\ [ px`$aSdh\,hģdz$zgO-,M0 0 S ! rp2/0, (Q0 Py @`P@P\&$P 0  CZC 0@PUpWW 0 `PQ 0@SPPU2J[Ipp,Ѝ 0 qPPu2  $`5rP$`  0 j`P% 0@SP㲀0C  P\ \1 \"  iP  0 lPp@`@@,Ѝ 0 lP@ @ †Ằ[ PಐU 0I   iP(A0DS V(Q  0qP 0 @-@ ! \ @$D,D00,1S@-@0@ C00,1R@-@1  @0C,C ,!O-`ᴙ0S ]M> pPw@P Uq  @| CP 0  p4 < pɟ00 8p4  DSB@ OB PXP 4V P0pS40X W!3^ XL ^^@4 >P3 uD H 0$ jP 02 KA<,0(  QPV\^ HP  0p pt 0} V( 0S% A/ 1++< *0)4 p)<(0<( '4 '<.0<. ,4 ,<0 4< < 0 4< $0 #<$* <($0 4< (, 4< ,0 4< 04 4< 804#<8 <80< 4<< < <080  80    0   8|  4p p ̇$  x $ (p < ,Ġ( 0$8 ,  p0̇(,044 4x 8 8<0 @ 4<|8*8p | *̇ <0@)t )  p' pK0  | 嶀S(tpN ) ) x 岰+, t, SZ,CC r AZ2X pG^ز  9/@P OPBP]ߍŸ 0( P p1DN90  !NVr QU0 aPP$4Q$oPd q!Qq@A0 ` 0 `]ߍA AQsA R2 < p 800p4  DL@@ H@A001 Z ڂA A@Pp{APmvAPsAPcg0akA@fA@\ Ta`  / /F[?O00000 0000.0$P00JPh0h h0d ;=w?q尀 <80b1P*@-@`pQPM .00U' `P$ 0S r?(p0 $# 2 pЍ .Ѝp .Ѝ>00p 2/A-Q@M .$4,.,80!<004.T"48<08#80CSP!4< Ġ!l 4 ̌8 0<04 80<"04"80< 0*0(S"( SR~  B("(p`p0#$ 0F0VP   = 0   '  P       P  0    V/ 000   0 0   0 0   00   00 0ЍR 0B8#8` `0#0BR0PP      VЍ<0< <0 b; 0(0S"( S8|HK 2/QA-@6 10CSP* 8 R#8 RZ ,$ 4,,,80 @T @崒(0TXX @,  1' c'@P 0YSY0I '@ ' ' @ ⴒZ @I )ᴒ S(010C S)ᣠ** 8#8YX-  'X !'@P 긑0(0 @崒 +H)X) @: 0 b5 @$2$"$b0 5 @崒, 1' &@Pw Y10C S)ᣠ"* 8#8YY0I1ᴐቐ  10@! Z' &@PP  8$1$!$b0 50C 0) ( 0H)"0!10@崐 *' &@P! 10CS㣀:t0t tb0 l5\0\ \b0 c5\9pttl8s7,s`o`3poTnT2dnm1mtmt1mp@-@`PP 80 00(0`00Q(0pO-H@DƟP LMQDp` &00 2eV  "700%5 0 D0 30jLЍ0w R*R* Fp 0$00 <0@<0 050 0S PVk 1S6 &P䑄/  0尡0 0!00 BR{?ⰰ0弰:1S 0[S [P 0 ᰰ0000S !_& @ P 0崐V` S0! 10CS,*0 P 20 2p(i g0w Qv %`P] 0 p &P BR㢰* 8#8Y* C00C 1! 0C8 !#(!!#Ȇ 00(0  0RL 1S RR  RYG  % 20 2 JZ㪠r* *J [f P`N0V㰐0`0 2 f Sc % Dp 0,00 4000S0(p0000(01 S0"1!{/010CSP"*8#80C S {?尐!0 b0 3]0 )ἐᰐ0`0500\0\ \b0 3D0D Db0 3_\  g+ gf*ff*fO-(0pM O @aP0fl0PP P FP0 1X*%8J1Z!a@%X0 R 0 1Q@@10CS㣰Q* 0K8#8S0C8#80 V!S10C1(0  0R/ Ѝ@ Q! R b0 `(0p+ 0  KPT  p 0 0 p1 S0C1ȁ434#4b0 3T? Y4 0I 1pP(00(0V QPEUP*0EY*0 p1|Pv YQFQPEUP*X%XPEY Vp崑 (00(0;10CS0I*S ```@0 `p崑P Q #PP @ PA=P_(00 (0J$0!0!0 #PPl 1P0CS㣠>*0J 1P(00  +$0 b0 w20 1pP(00(00 X%Xb0 PE_2 UnQPEUP:x0x xb0 P2s`0` `b0 G2 #jd (da%aha%xa(a@%8aa%ap@-@PQQp E#P 0 0#Q 8#P 0 0#ppO-P,a V0Fp  1 #@P" `Vp0ഀ0 0 opw 10CS08#8*S0SZ P2P 1!b0 1  H x1 Fp(8V㴠(1!p 0 R 0 1Spp10CS㣰7*0K8#8S  C("( 0 S0081#810W10C1 ># R ZP  0! 0 P%# #(0( (b0 k1(_@#8_]!]O-Pp@Q$M #00 2T T Q300$Ѝ(  @l 007崷崧0 0 `Pc  R a8#8Y* P 0Pj1 "0C @iT㴐: 0 b18#8Y:Aᴐ@DT@* 0H$H @DOoS0CB0  0Yp@ 0S0C@0  P 10CS0T*8#8SXP@ !pP 10CS0*8#8SI 1 '1@0CS0 *8#8S$P _"e Z"`Tx*H$HT|PU 20 2$Ѝ050%0b0 0T :"5%b0 0 -"T` %"0 0 P$  0SF @倔`S= 0S 0 "q, W@  @@DVN !q Wv 0G 1d!P A`W@DT@:#b0 403#b0 +0 ! ! ?!pPR Pr D3D#D0b 00(3(#(b0 08@W1@ H$H @01` 1 0@1@`01! !P@ Hx0  !  P 0 k@T )u!T#100u`  h! I Ph ,` 0R X T!qV@F M!q0V$ @0G 1 PG WR  B1 * 崠T0@D1 &!0I@D*0tp崠1 加1 0p !  P 10CS㣐:0 b0 ^/  ! v P\\  0X0 0UXS 00; Iw0. T:+[) P0K/S  0ʷ0P00: S 0000S0I S0?00(1(!(X0 .QP PV# 4- Bp!00SY  \0 RK Y [ Pz000W ჷp x₷P h0@om G< p SR Q0P:Q0Q:P/@-@-@@ႇ $ @ |F p@-@P#*P$ | p@7cE 0@-@T M 000 @偉P 0S  ЍC|E O-@0dM\`P T0 `. \$.\p @p.\0  (0.\` D`.\ ,.\ 0.\@ H@.\ 4. \8.\ <. \P LP.`` ( \40 0  0< ,@8p$0P` " P% 0#0b0ea8` . p'gH, alngx+b(*gLb0`l$`&eX)0n, fe l c8(쬊cfj!g|*g̉b,, bH ,l*l$gx" fb(*錈gl* e\(e!c<+ci eX(eni!c8+bLc fj$n Yc ` WV p 0V  I 8h X0 0 D0 30 HЍ$ )$ $؆ t5 05 C- 0 04MP`0,00&`@ pW:T p 0T &T H0 0 ,0 304Ѝ$ ӂI딅 4  0@- 0 ,M0 0$00~ @ P T ` 0T P D0 0 $0 30,Ѝ0$ ꥂ뤄 P3 L @- 0 0,MPQ0$00` M p@ T 0T x l0 0 $0 30,ЍP P0P 0 2)$ ~j 2 <>=A-@P` A!8M11!X 0 P 0p0S   L Ƞ,Ƞ P00  000 0ЍS)!1 0C8##Ȅ00P ` 0  ) P 0 0 0pw[O-qpGW@|*8#811 PaP`Fp`5 VO*X%XPpCx0'0岑ᶑ PaP`F ` VG*X%X'X00 000 0 O4Vh&h=*V 00("(RP:Vh&h *V  8#8SP:1 0 b 0]( 0 0b S(1 0 b 0H(h h0h b 0>(L0L LL0 5(y8X9l989D999888:H:O-,M01P0CSPᰐ0/*A0@D8@8 08#8T0-*0S> H$H0Dp@`04 00 04 00$PY P P0ES(0001P0P0PYo0V 0@  `PhU&hj*P 0H$HS0SZ 000pxV'x:@@T$P*8#8!01(0  0R 1 S0"8!#8!1!V 0 0C01ő YP0P 0Ӂ 0C008V*0S 0P0@Ps V@ HB$HQ01Y00 0(0"(Sm*0Vj YPU:|2| 0Z'01 P0P P P j01P0 P0P `TP   Ƞ,Ƞ` @ h0&h@HV$H@TN*8#8 Y !08#808 #81,Ѝ   Ƞ,Ƞ   Ƞ,ȠpGx'x@@T$P=: 0  0&30 0  0& 0 b 0&t t0t  0&`0pxY 56lH35<3443H324C-Mp` @P&  PP!  00 000 0` Ƞ,Ƞ0@@!! 0 040000 00_@PЍЍO-M@ p8PPO 01 0 0 0رR 0ⲱ 0 1`0CS㣰H* 8#8V: ر `PH 01 00 00Q00岱000 bP 0 0<0 00 !p3'Vp@PЍpЍ 0p!0@P4 404 b 0 & 0$0O-\M`0儀pS:@0< Pတ(0$  n@T XM*1 #0C8 #  a#Ȅ 0  0| 0<S@@ a,^p  8 008,000F 1Pc `V 0`h0 &h0CcS00 p㰑1 0CS&*0S 00$ (0pO `VO 00 0 00CS001!R p0p  0  00!0VS00 IY㩐* )ቐ1 0 0TPLH0PH2/  Wp 00 1p0 pp,0 !0 B(S"8110  p"      0<00@pS- 0S 2  0 O   a0S @ M3@ 00 , 0 S<@p    \Ѝ3<S00 01040封HX㨀 *004 1pCx0'x(0qqᰁpHX㨀*0(03<S00 01040封H⨀X(*X 0 08#8S:00H 4(0 岁ᴁqpGpWx'x*W 0 08#8S:00T#(" IY㩐i* 8#8V * ("( B``F  001`013p@   @  Z`V<@p "  p D.%D EP 0 0 0각HX㨀r*(ሀ10406각HX㨀\*(ሀ1040R!1 b 0# 2  03 -(=@N00t!t1t b 0#X!X1X b 0#*X1X!Xb0 8";  91!b0 &"0PK{0) 1 0p1pP01 0P0@D1 H$H @U0PE10Z!08#80 !x%4D$""t!t!    R0</ B$0A000P/ R/0P/ R/0P/ R/ R :0 RP! @ P/LA 0 RP! @/000/ @-@P , "@ (Y" 0"|O-@2 (P0 $Mp\0$ 0 @`0 @` pP y"l(,"$l$"0 g  Z  &e .e  x10\0@0 ` pP 0 1 cIC$A$ 00#l!!00%b !b  A@YIH$*E$00@0 000000 00 0 0 00 000 000 00$Ѝ0 0G-1?p@P` @g(X, ! 0P0 0$0@`F0($0`7#?V@F?p@pp+ 0$ <@P U 0$ ?@PP?`V (! 0$ a0 0$ ?V@F?@(p@ ! 0$ <@P U 0$ ?`@?V PC-@PP M) $ap:?`V&7 )4!`0(0 `x!W``paa8!#4a4# 0e!Y@h  ЍC! 08R(@R )`@ b!(`8  )`8 b (`R @-G/ @-@-@P 0 )!@ ( 0"R @-(/w @-@-@P 4@  ! P 0$$O-,6TM0^_~?40H0800؁p @P,0,$4 (8 H`D <P0`<p P 0`p 0, $0@0,`P p @P`p(0 8 l00$Ǡ$97Ɍ,%%97.0$ 0;4,; 4.0*0&.0"0( 0'   "0, Ϡ'& .*̠Ì !  ,  , 00$0 40(0[0340~?00<@ P0    ,   @0 !1P"0?0#`%o#,.0#.,',YW) " g Y i WP&  B+7/P  7/Py 0 S 0SN 0#10S0S0壀S0嘣# 0 0 X BuPS0P1 0 07/`P  7/P0H 07/`P w7/Pڅ0`DP 7/P ]7/P 7/P]P$0@ "! R0 B  7/P P0P0Sz,Ѝ! ^ @E"PBPEUP!U  B%QPU P 0 "P 0 C07/PH 7/PP@7/P 7/P7/Pm  7/P e0@S@4 ' 7/Pf  7/PO0 00@哩)YP `c⃰Z}* P  Ut@P 7/PlY Y   0 T0 0#0Q0 @0@ @m0 (0( (l0 ꜳdآ|-0 M0 ЍR Q0P:Q0Q:-k@-酫A- 4PS@M  $3/0dp 6 QP00 h4P4S  $3/000Ѝ00A- 4dpV:@T@T 0P0 S  00 S  0-h@P0`0dp@A A-`M pᄘ@P0: SthPP ˅P@ P 0 tdЍ900PЍ( $$4/p@-P$0r0" @`Pp$U04  0B0  0R 1 00 0 p  0% 0A ( 0@-SN 00AS 0hO-4 MS|@Ap⇁0PS`*0S'  TP [ !P0 00 Q   0     Ѝ P@ 0  QP300 g$R P1)A00@000dS0  pq0Vp 0  $6/ Ѝ c00 Ѝ]00YO000Q 000A/0@-S@  R   0 1h0S,hp@-@PT @T 0 `pp@TەP`p  0S S/P/$(0#   @// / ////@-P0S`@M:Q !S@Ѝ0 0p P Gl @ЍT 0 @00O-PP X 0S L K 0SH p@ap-[0T B,B R`  0S7*V5* 000&P<0@D0CS0 T0@p@pT T 1 ! ,03/P00CS@D03PQQ    D R ! ,03/`Pʼ@00 "R( T`1 `! 00PVQlRO ,03/`PY R 00CS@D0 T@0Tp   P @V`!  0 0C0   BR @pZT `@ 0`V:f0P 00``F0``G  0Y0C00 00oP   0 0C0 `  000YP nd0d dG0 XH0H HH0 00Z 00V|p@-PP& 0 `V 0@0@DT`0@T`  ,03/Pʼ0@00pD0Spp@/0 Z0 l P0p@-PP0 (@`v )p@S 0@0, Pf b@fp  R0  R/ S/p@-Q@PP9 100S 0  R 0   p-  0R00  0 0c0&0 P @P e0 0 $0 ,0, ,<0 p0 <H @-4aPP`p@M* W2 T: p   P0:*C/o" R  S L 0( 0R  ; 0 Ѝ;0t0t t0 WX0X X0 T<0< <0 <,8<$ܑC-"2 R0lM@PP0d00= 0 C 00  d"X2 0 d0 30lЍ ~0`0S' pb0PT ! WP00a0pS p =PP000!1 |0 3 0Sx!$p@  PE T10F LD10/R 0 p 00 0SP ` 000p p00` ppl l0l  0 PP~ꏦ t 0 hlhЏ`p@-@0MPd00TaeV( e0T1S OQd0T1Se0`d 00UTX!\!R Ѝp@c\!d00Ѝp@c00UX\! X\!0 000S/ tp@-0 00PUp@0c00TQdU0` TQUP cpX1P0X1d0T0`X1h th0h 000S/@-@0c0X10CSX1 @cT1Oc0@yc t0 000S/gP t0 000S/p@-P@0`cU0 \AQ\ X10CSX1 p@Pc`id0T1Oc0p@Ec( t-X X0 04M 0,008 00 0 ,0 304Ѝ䢥| T p@-@QP  p@$ 0 90 t,@TO-M8@@ 00DA B QR cp >` R0T3 W  0p| px 0@`> p PPL1L!L?0 C 0p 0>00D+00XS W#0p 0 000XS W pp p 0A0C0B QSWpP pe0p 0> 0W 0@ p p0@ p 4333333l00 0M0Ѝ< 0@-PPM @0  [P 8 ,0 0 0 30Ѝ0xt9   D0 S4 0 /@-\ ~0 S 0,/00@-d~H0 S8 0 / 00@- ~0 S 0,/00@-}H0 S8 0  / 00(@-p l}0 S 0, /000@-\}H0 S8 0 / 00<@-Gt |0 S 0,/00D@-3x|H0 S8 0 / 00P@- $|0 S 0,/00X@- {H0 S8 0 / 00d@-, {0 S 0,/00l@-0{H0 S8 0 / 00x@- z0 S 0,/00@-zH0 S8 0  / 00@- 8z0 S 0, /00@-yH0 S8 0 / 00@-z@ y0 S 0, /00@-fDyH0 S8 0 @/ 00@-Q x0 S 0,@/00@-=xH0 S8 0 / 00@-( Lx0 S 0,/00@-wH0 S8 0  / 00@-T w0 S 0, /00@-XwD0 S4 0 / 00@- w0 S 0,/00@-vD0 S4 0 / 00B@- Tlv0 S 0,/00@- v @/ /H-M 0ЍA-`p@P0 8#@T0P@@-M/"O R ?#0!PO$T P!Ѝ  0S RP/0    P/p@- MP 0 0000`@`0@PP  7P< (0 0 0 30 Ѝp轟8  A-QPp@` S V '"RSQ P_ 0Cj ?o/o0CS 00cÎ10VS& /o?o BR Z 0b0Î01pϠT\ ^ R0V0 BV  T$ 0d0?oc008/ooAq!  R! b0r8·V pV000e0?o0c80@b>08Qm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 0@-@P  000D$ / RC/A 0\R#R! R/ 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/ 0 ///Q R Q/U/Q0 R Q/00/Q- S 0S  P0 000S00@-Q @% TS 0 C0 P @D^TPPU0N QP Q  00S @R S Q0 S 00 /0 0/U/S 0 0R0Q0 /0 U0/Q@-# S% @P0C S@  PQP @ ^  0@@U0@ @-Q@ S^ QNP  S^ PU@Q @0SQ RU // Q#/  //s R PS 0 0/0 0/U/0 0/SR  Q 0/0 U0/0 0/0/R  -/p@-@RP` R V  U  R 0 p0 0 eo̪QRp@-`P@ 0S0 0 0R0  0p 0   0: 448A0Q": Q:Q / Q / /2Q0$//Q00$0̅/ b0R0$A0̄Q*Q/0Q0$0̅/@- R :(2 R: R :@-PPPP R*rP(P( B"@ P(P( R"* : R0404(( B" R000$0$0ф0l\000$0$0ф0 R: \6 R: B0-.40P<$DL%T \,Ġ̌8 R*0 :.Ġ̌ R*A R: B0-.80P8$HH%X X,ȠȌ8 R*0 :.ȠȌ R*A R: B0-.<0P4$LD%\ T,̠Č8 R*0 :.̠Č R*A0@-0M 0 0000@>S@P  !0#00  9P0ЍL00@0 @-0M 0 000@>S@ "0!,03,0  P0Ѝ)00@-@`@`0 00/ 0-$0$0 0M 0UЍ -- M0 0 ЍЍ/4 40 00S 0M00Ѝ/d t@-@p@-0@ ,p_pPR0Ppt`//////D //1O-0pPW`,M  n1 0 0  (05/,Ѝss@PM 0S XXX S0 S0S3*0! 00S S( S000S  0S S * RpC 0QW 002 00 0 0 00t0t t0 T0X0X X0 Js@@<t`hc8b//O-̟ M00P0Q0S Y [00< 0 0 0<00$00%SSppSN  0Dp HZR X ; 0 `P,0 ,@ S     Q  R0 [ ʄPU* R [ Ԅ ʄ`V* 0BS0C [ ʄ0S*0 H0 H R D  _  \ rSd{- R@0%%%!:0Z0Ņ% 0C` RZ%pȅP  dV0  d/*00  D@D P `pnpk@ph 0  `0P0 ,@, m *XM 0 H R 0R0100 H R ?H|DP @T S 0 P0  BS0P cP0 `C> p(x $ pSPSP` p@0  0P  Q ; Z* 0[ʅ Q  BR B0 [ʄ R*  0E >   0lX pp|      Sp!\{0S P`@0 0P  Q Z 5 4p w,   Sx@ 0  d0R\ @RC0?T0S PA`B 0(Sf      +  epb R  \{Y ,~  , * S ǣp@ "".!d  b,  d  S       R&0 P0000pBP`00@  BR B R& R+ Z  04444 00u  BR B  [ʄ R* R[ [ R   RR R k      w  BR B8`0P0@00 Z0J0(#2 0 0 30Ѝ     0  D @A |4     [  z 0 R~*-P0D4  B @.  + @ ("(  "@ (B(pp-\A@ @("( p   ^w 0  0!Y 0  0'@%   $ 0  ? pT0 0 B걕pV@ bba[P$P \X~W̐V|WA-@P@ `t0pP@PU J0S 8/`PEuX@pW$0$ $:0 xU 0SS S  0R @-o/ 0R0@o/O-((@CM Mp4čP`0@  0 @0 44 30+Cލ Ѝ 00 00p0 `0pP Ut0t  0phwL+  T 0T/  (DEG-0pS+ S'QU$ X!`@0S  0 0#S0S 0S0S0S(  :P# `VP@ Q@0 R!R  "R0 R R QO-BM MdQčH!d2 hԀ&h Pp 0`V' 0  LP@P UMM0 ZPm(PH <0 0 4 30BލЍe@ l O-\\AM @ MTč9 0Y4:0px0(S`; 0 T#T4"4X8%X#8U"U0 0@T jMgM  0 zP PU p   0LPL @0 0 4 30Aލ Ѝ0x0(S  O-M Mtϟ0 p  [ !R & R( ` 0  0 ?@@X@0 +0p tv  0 H  . R< R30` တuP @R @P p ᰐGP R!RC+P `XP00S 0 0 0[ Pp@uopp0S 0PS 00 9 S 0S)< d l-  L `- T p P Ra0@0040v?D0\84 0` S1S @ 300S S00X01@ 021帡ZU0H0tSp0<0400SlATi @0CPh D0PPPyf 0;S<@  |P} [@Y0PTP y 4 @0 4 D 0 D @0R\80S d H0S"Q 5<00 p  R  H *X{t`pP|@600P @:/P|+: 0 6 30Vݍ ЍY 4@PD0Py !D0P0 w  0 ; X0d D04000SR0X0S@0`S\0c  s`@V  0p`G0?`<0$0 P 60(`,0/ 00 ,   F F~PP1 UC(0 0R0O `1  0 90 X0L80Z   80080M$0 0 0 SP@0b0!0t刐?A9c!~P b0S ^@\0P oRȟ00( @ Ut  ,80P80D Q"  (<  0 0P bR`1  0 70TX0 800 00  1 01: 080<`0  0}P'  0 Pa`1 q 0 70X0 80_0 M 00 Xd6&Pa0&0@ @ XsV1a 00 0V$00I@0 ] 0T(0P0 `@vQP  Š20[000Q` ]0 0 v(0 01$000Pv 0 d5@X0 0HP80* 8}P 0D p@n0P Qğ00l$ @h gs0 (0d0080jQğ00$ @ Ps0S0(0ʡ;0+S .0CS43P10 @}+@ P %@#0PoP AQPRr ; `1S 0    R - 0H080{|P8R4`!!! Q0   30 @| X0Q F0H R4 2 qW *`dRP|@0p t@7/P`V q0 \2@X0 0`!0$2 @XrUS0 \01S@ 3`0`00S S000`P1B `0 }P00 `C|P101<0@PD {IhP p0< 00 {<00P00P 㸠D6ꌿ | `PKȺ tC8XP~D~$B}|xpxxLxwx4ww wvvvttltHt$t4tHts(PsXs TP B("(R D {P0d0P0@@ 7d06SV 0`jH6pSo06(H0"( D0P TP B("(R D {P0d0@0P OL00! @ q{0S\ 0RT 0`1 f 0 10XP0 &0R  T O00X" @\ q0 82 X@0&0R  z PD H0Sm=00YO00#  qa0|p r6 G(0"(0R D0 P T B("(R D  R,#{PʇUN0@ 0|P`P k1011S1 600 0 3$0 X05+0 4H@X@0" +&0R  t<0d0d000 x4 X00000b0+S .0CSX@0P  O00$% @( p0+ (0d00d0@0P~ Nt00% @ pq0d000 `0  fl05 @XpN 00 & $ ptP0 @k Nd00l& p p^/0-@P@0/M-  0 08 R1#0e(6,0Ѝ/ɚ;M- 0 0S R B 0S N 0Ѝ/ʚ;M 0 0S 0 0 0CSЍ/RЍ/0@-$MP@{P$Ѝ0 {P 0"c110$Ѝ000$Ѝ00@-$MP@zP$Ѝ0 zP 0"c110$Ѝ000$Ѝ0M0- 2a@@0Ѝ/M0-  0/@A#b@0 Ѝ/MbO-@$$ß CMM,čßS1 PXd ,p0$P0000 0  o 0p q P;QP0p\400? PI0D0< !7 S000 $\40 ; P0 0000 ; PPa P0. >F x`10,430OCލЍS  *F 0S0Q4 Q. Q( F     { 4.48#804"4 $,$p8(#8"(bnEEE게눥 q@>$@ @ģ ooToC-LLPAM M č@`p04" R3 1n 0@` m P,8ĝ0  0 0 4 30!AލЍRg PP 0@ .R` @@H mD D mER0 n# ,: nmO-AM⨑ M  čRypPLp PG `nPPB t @+0-P7 0S4 `  0S+ 00@ p P00@S 0S0S 00@ @K @ K @縨 ᴨD ,0 0 4 30AލЍً봠  pmd%, O-ß CMM`,čPp@X\ @D0Sa  .S@0SVJ:TX d10T*0 ` D DR\ 0$00 0@@0S .S 0P0=S 1S St Su @0T$0[0 Pz8"02 0 ,4 30CލЍ0R.ST@ 0 @1( PPd!  T00 0 00P00S !  @D DR0$0 0s<  VD80 uP0 1 00S|z0000   Rl@00S}0000 v 0s0S0S DvD؞ \ O-p0ß\M P@`iT V  0 #à  #4 :4 4U@ 0W 0 P 0FSX0 0 0 F CP0x 'xCC0SUPPn   B RX00 0 BBP CCC PHCUTѺ7L10-, 0  k0 `F 0S0   C C C0 C0S   <PHUT0XU d0d d0 n\Ѝ<P0\ЍPHUT D fxe(eC-@0 M`P(p1@D T@C)JC0W BC0 ( 8C 5C @4"40(4"< U @D0T00S  Ѝ\P P0P L0  Ѝ0@`d'cd,dG-@P` p崒Ḃ. F0S@`A0WV!= B@B @,0G?o`D2V0S ?V0*G `DB0?U0S dAX X0X T0 < <0< 8 0`0c%bbA%bb=(0`( "4`43Z1S//O-0P䡐 M0S5 @@d@t@`p S S0  P&  P0 PI  P00^ 0  SR 0  SRS ЍmPd1 00d1 Hj]P0 j  NP  GP060 >P0 lj /P  (P090\ Tj000<Mji0:0   P  P090090| P010r  P020h  0P0Z^ d@?P 1? # H 0 2M$ 0P0ZC @x?P 1? # G 0 (32 P+ @ P010  P010bbb3hbapaa2a2,a`0```(118`L_t_`_@_@-@HMuxu% 0`p @  | 0 xa 0uxHЍЀ p@-AMT )u 0P00 ``*00 0#Ru 0 0Ѝp@@8@- 0 A0|MT0t00& t0p`0# P0 8 @ 80 0 t0 30|Ѝ@@ꐇ묎  \A-@Ps 1!01n0SPpuOp sp0PSp@-Q@U x3s|p E01P E01000pbsctVx[sP //4<P //|[A-pP@>WP``UW@0SP  oP j PO-@;_M M0*0: 0P0507@0VU 0 B01-`, 05p d!  d!. 0`1q1110CPP{  π0ʏy p d10 d1 P% `P aF`0DPS_H L p\ S S00 PpP0S SR#3:0 0CQS0 0CQS000008hP ~?080}o 0p+0P'P 1#S;S 0x(S# 0l(So 0`(S> 0T(S 0H(S0 88R00sS1 S S0 (   7R1 S S0S00 S S SS@@ `0 E_A0P@00Q"0A'A+S? P7R1 S S00 R00S 0P0 S S00 @"@0S S 50 p@ @@@@@00@00806uO 0 0GPd4P R`P 0 4P 0R@lL@L0d!S 0 0 2d1p% Qq|1 |$sp @ όx0`0S W`0`SHPDHp .Sp0SWP`.pGWV0 0jP $ +0$00t4 0 5 30_ލ Ѝ4 Rq W W Z|$( 0$00,` `X  V V` VV00;V0SJ`V 4 @0p ;V  00@`V  TPP 0 0UP 8 Q$h!DP ``V;V d#0 00@`V;V  0 01P 8 Zl`(,`| 2R1 S S0Sq00 S S SS@@f `P D _AP@`0DPSH  \ S S00 QP0S R:0 SQ 0 SQ0000049}_/P.P `D0!x3!|3p dDPVDQ La`(fQ4I`- P 8 Qh!- qPC-k`P@9pZ 2 = PT ԋ `:YYp; domasearnamesortoptionHXinp7erVUT\ list|Xch Q(QQp@- 1 P@hlHM QP T 000HЍpp Qx#r cqV p 0 xP00qPT $000HЍpȉA-P RP@p0`  R  @P  R0`\ R 0 0O-0PQMp 0 P4P0f0P0 `?0P0 0@($      -P bPX" RM  0!#X㴠`Fg 0PP P ibP R X@00^PU% 0  0 `F@YP) $@  Q PX `F #Z 8Y 0 oA00`Qߍ @$ 0P PEQ*0$ 01!0 `\  ߟ ` 0 Q0 :0 AQ1 :PACⴐ RC PZPK $  Y  /TP P K) ( p  #0 IQX P p Z p  原X  0 @ 0 ~0 0 @wt 0 p<0  K@-<0< 0@P @:$ 0 0dz + @-$0$ 0@PL00y 00/D+ @-@P @$00d+ T@-@P+00p@-@PP  P  0 p 0  |0 P DHp@-@PPM/ 0 ` 000dPP0 P  ?,P  0 ЍpЍp  0 Ѝp( (0( $0$ J(* lHP $>P 0!E`1$(`P 02~P,''~ O-Ff@0 MS`, 0 4 t& $0( \F\V@PR8 H601vW00g(1<06 B0R  50(< 앟ş 1 c0@8'0p(4 < P 0(0 P| tup40Sg0S X 4 0SnX6S 8% 4 0S$up00S S 504 RU 4 ,00,000S4ğ0 ( 0XA4*0210S P10q S^ X40( L40 0Sp 04041%40(8(UkP0440^ 30( p ЍqR 0Q*# 043p040(P8p!@(%0%1Ru4#! 30<)!^ ^ ćrp S:p 0("< !0(0% P^4)20(  p20(<  \20(<  H20(< 420(< 20(0 208  (0쑟 0(0( 10( 꼑 (0(10(0 R 00! 0x1x0 0 d10~Cp (4p ЍBp N=p 0y^4nqp2  Z 00K ;@X~t (~`\D}}}}||||XCD|{{{4{@zxz8z zTyyyyhyPy8yyxxxxx@?> >0!O-01M0 X B* 1 a001Q0,0`P ^/?^_ +~0 0@S@ 00T 00}O R :R,000P R 0Y $00 Ѝ(w v@-$0 0fa<^k (P6A-@@`V 0 CQPqX<P pG P;P 0`0u;@-@00 R \\  $0!0D0 0@ ($ Ttt@-@PL  0S  T0S@<<@0V FA0D  0 \   Ƞ!,Ƞ0R000 00@ @@T*80`F0C@J`80000 Y 4)GG$ $0$  0LTG-M( y\X`PpL \;S<03%R @@zz0 L l3< 081p P4,0SJ 2 R ,  0#, ##$\A A0AW@U00X0;(0H8#80ᴀЍ\009\S <0 PJ,0S0S !Q #$ 000#$ P0A 0S$S8#8 C( 0"( 0 0 0 Xx0pT@0@yN@0@P P0P 0H 0O00D461Sp@-@M P/aP8 \,0(0S8ЍpZ1Ѝp/G-4Ÿ`0 MMqŸY w @P^ 1 R2X< *5S0@ZZZ0 Ϡ B Ό b3Ό2 0I0pE YO\!L1 0  0 30H؍ЍU80`J8 ᷨ8000S   "4<Ġ"< ̌Q0 Z "Q Cteppꍜ@0⇜@0O00r; ; O- P `d.@P H1嫲p0q1 u Jq08 10000N`ⴜAO-40@S`p M0S0040000 PD 0$B1;0C10 X0 M ^ Q Q  0@0 SX!B! 0PR|   R 0S  "  0!2#$ S C$ U @ UX SRR0S5X%XpUk 0 (Pc 000@@℠0ᄐ000ಀXb0HPIᲀ0@ ЍX D $ U D \ RP1 PD D00CD0 0 10CR[  B Q" 8#8ᅅ0X%XP!@ 0C 0$ 10C0S  0"e Q 0S 0^JPM ЍX1 Q]004!414 , 0@0B YPU1 3]000S 0Pⅅ!D PD 8#81 ]00PU PHD充AD<1 ]y00x p  @O-@P`Up M0^000Xg*0QC P @PU \000U00SP ^' PЍ`0SP0@ 00S"w@P 0S00 000Sb 0 P00080080ЍO誕 0008(8⒚40PЍ0@0 00^00` 0500C8#800僼 0S<:00C8#800v0  PP X0:0 H0ಀ0 0 ` `x x0x 0 p0 \ \0\ X0 0D D0D 0 <0 ` Pq4$} (u 0A-% !@ ::`0$0CQ @A3@D$0@N0qPW T002!@$!A覛pP 0  < 0HW0O- @ƟtMTP @p*0P(0u 0 " P4 m (H0$H 000 00P000SFH00@0 ` 0\ D@ ) ฻  I Ა@ `Rڴ R  D@D 0I ȠP,Ƞ  BHL  (@(04P`@AH$HQ 0,0080X0$0<00CS@H$H@0S*<0A0A8#8 @YᲀT0@:0@I@00ഐ0, 噙0P,0 R 80S* 80 <0,080 RD*Q^P0@00Q0 00 RPP ` s000@H$HQ<08#80 ᳠Z100S B CX TP\E0S$0Q0 00 R 0P 0R 0 $0: 000 P1Q0b80S 880,0`00 0 0 0P)d0S 0% `P0U$0 h0`S,0 80q0B8#8 Y0@2:0 I 0( Pഐ0004 000tЍ( 0,0 800<0S80SㄠB,0x800 <0H\ \0\ 0UL 0< <0< 0X 0O- @\T @0`S0P p@D%P , W+P( [  8#8R40  < 0(10S0 1$10$10 0S0lP 0 P0S 0\P  00S 1$10$1_00O-MYP@000X00 ``FV*:S 1 !* `p pGx'x  0 F pF000H00 B 00p0@000 ``FVB*hY&hK V `!0p pGx'x ๹0I`h&h08#8አG0Zp01`*0ಠ0`0p00EPP Y```0S0`0F2"0y 02"0 hY0&h0``FVt*hX&h] xxx2 0 0 00000``FVR*hX&hD Vp1p!8#8 R0C8#8p  ` `Fh&h@0Hpx'x08#8ቐF0Y`01p *0ಐ0X0`0p0 00PP @00S+0`0FAЍЍ0 Y00 0 O0 0 F0 0e =00 0k 20`t0t tb0 'txL<$Tt\0@8 ( G-p`P@ S  R0 U@ xT8 P X0SL0SQ 0R0Ӳ00ô00 00A8#8R0 BY001 *("(00 000EUU800C80| 剐BY001*d 0P P0P  0D 0R0ಐ0CSؾO- R P0@ B( * R(-W ᕮ0P P I$ c@P! 0R  B( *Z`pV Z@  pP@@p@-P@ 0^\ ^ P0Q$ Pp\ p pG-@` 0PS 0S  0 Q@PS" 00S ᲀ\: 0 BS P> 0 \P   00(!S$! 10$1P0 ӕP @p0弐ᲀ 0p 0 S z10 B\x ἐᲕ'xP  $1 0$1(!00O- @T @0`0CS0P@D p M!P ) N(P' 0 0  dP 8#8R0 , Ѝ0 0S0fP 0 0Ph000@- M@ P p10 Ѝ0O-@pM 0 0p`Hpb 1 P PM0STD0Z 00 @ @ 0 pWO0 @  pG W0K*0@p 0@000S p0C8p#8W㲀Ḱ0=*0p00ᴀJPP D0ZPPЍ0 ֔P 0  0 0  00 pl l0l h 0T T0T 0L 0lf|DDL },G-Ÿw?`0 0MR,@pq2SP:0JSM  P P崀2Spp1!pp BRJ:0CS㣠o* 8#8X * 8#80C 00C1!0C8 !# 刀#(  20 2  2H@ PPxPePXP dP0 02@00t0!C!-\\ R0C0<20pW WT  R/ Y  BpPPXPPqT! BT`P "  ㌡PP* âP 0SQ tpYPdqPTp`@ 8 p%,1 B R 0S V X S 0S X  R 7/P  R z%$ & c$ & \ZYEq,%Ր -& @kt,Z FP4O-yMPR%0`Hx00 00 (.p8`K[( 0RJ Sp 00 0 TovPePRPGP@Of0@S(H0@ SaP0000 0`0 00 `00``0 0`0` 00 `0$``(`,`S7 0S 0SVR0`RK4[R q'̶ P M6pP/W  0 10S Sp0S &0S0@0@P0P/S R 0: S00! [sRn0: S 00000#/W00S %n0S0(00S00JpW   20P0J `50 0"^0P @/P05 %0CS0$ `% 6 2 `pCPP0S n0Ss 00   B R\ L` V `,Q' /0 典 P@0`40  P0` J/R  S/R/  # C  R:  `  $ t3 0S S/R$ 0\SR& HR0sX/ HL!R\0X\!R\ $X00: S % C C `R0: S P1: S  : S!  Sm  Se K S^ S L0S !BMPL,0SJ ! .FE0(尥 0Z lZ80 S801!Q pQPP1: S 00Z0S 80X!0CS!80T1T!TKPR X0P .0S !;M0S !Mߟ^C[ (0S0S 0 0 yQp!mq& }& L%T%< 4+tH2jk/8& 6- ?8FPO-@PPX#D&,p<868V@,FMP60Pf{N0S0 /m POP :N4P0805HP40]NP0%/(0@NPP8mP0X T5T%HPOP8P H04 0, %43/00P08004 lnN4q 0P01QNPP (JNP 0 P0 EP@0D 0 PP0; S @,0(D 2#!H8 01/0TP0P( P,)2PP P0Ds帓0 CS 01#SMP0 0( ,S* B-"!0 0 8N8PU H003/pb0SDfH0803/p(^PP  h`0ld 0 GS * X  0 $03/0  0-Q3  R H!O0  0 -1/ !P0 0 0 0 `0d 0 `0d P0$ ,!M 0,ذܠ0Z[   P  00h0 l 0 h0l   000 RkN0 0013/s SM S>MXP\`0O ( q(0, PU`00 XP\`> ;Aq&L @'{X%'5P'FP@'a'l p P'y4hO-MMN!?Gw '*p 0 Q 0  pH0(0`7G@-Pn0@00$0<00D00000$0100000$000,00$0;0H00L00$060(00P00 00T00080S P5kPU R0nR oR0P<0,`P  P8k`P,ٷPPP{ C@RN , 0|5 PxbPpda4 1SzH0S?80S<@0S9 P0SP ^bP4PD0S 0$z, +gp P44X(D`尠XV 0PU 0040D0S NލЍS ,0SP sP 娠=`0@0S0H0S 0  FQP P 3R㓵( F |P3m W` sA0Z ⁣P l3  \IP TT 0<40`FP [NPP PPPT0S0: SPPPP4 01! P4L  0R p 0TP0 T0StH R 0 T0SH"DpPP4T0S 2YX 8SU # WpVJ  ."  ."  $."  (,." 0 4   8<  @ D  H L  3]P P  MP40SP8`qX'-px Խ #؆&& R ܾ2FPOTgs@-0D%P000T00Sr0C?o21$(p0 1000C00S8 000-S30 2R(0pP EP SP '0 ,MB#?sP xP  4 3" 3" 3" 3!00000C0WP#xI@P ThdbT(cQJUPL 32S ,#,B Q 2 0S 000S 0']P 0TPչPC000!S 0 {0S <h000S 㹹P<b4A0K A1S bVQgbឹP2S 1"A:Ua`0:EQPQ100S S xb!0`0001cX@P\] Pt dWPo  3lPn 2S 0"r r r2SAFbPPR2Sw |0"PDP( T0"p(LA< <GA '& ؆&-LT(c' $' `L'FP&+^(&@-@MP`/8P@@D@P8B8r',"r'p 20 ER!JpshwPePLP= PP0; FP [gf0@ S00!J'p|1Q=0 q E - P. R1 R3 R 0!BSQ/ KP*0: S&00 g000 0 0 0 0  Q g=  K@P0: SpGP f@x' q&FPmo 00$CP@T 20p/SX/ᕰP"0 S:L p`  Eppq4'9&4>A-`P@MID4 0嘌 gJP  I ]JP  I SJP  uI IJP  kIPhƥd3P0\3P P$P@3( 0P+( P3( P7( P;( P?P ( PP( P vP8$@Ѝ(P (PP"㌡(0S (P(0S (P(0S (P(0S (Pq0S SHP|!0S0S yp T9`PLa @1R`:PU 0E /R P(ܠPU  x00,0/00'0 0CS0dzP0$0v00S tpe{0s00f|}|y@X(؆&PTX(PM!%mo A g'F p'p@-@PsHr`LP PP `t $ph00SV{P.e P $壳 0@:q;M&&(&O-MP&`Y(FP0@-TM ㇿ 70 $ |EFPF@GU0F0T000D 0EP00ՓCoP3 CP 30S S S" 30S!  R h#6 R L#!SRL3"F $3! ,3 003 3  2620S (x 2 20S 0S'002@T$-P0"@Y|B00CS00 M 0 @ /0S60016 R0S 10S<0PT<-0 01 10SQ 10SM(t1`1PNP10S L10S h1 \1 u0S 160S 4]@ 1 @F01b0(  0S0F0S 00q0S0S 00;@|P@]Tod`(q%@Z(|Z(8c(Z(HZ(DZ(T -%%74f(p%/`50C S?0 0S ($ p+ p0 R qX  Pp P    3/P00 S $ p |p[p000S W5q(h( %& - ʪ t4h(Zk4FP O-M M`pIlI ^^H5 00 5I5005H9 00EP @P 舟PQ Q _A0@6S0Y S~x(pQ `QX 0,(LȟS SS 8v_05505 00505057 yP sP 7 ꐷ kp20"S lE_H Yp 0"S  Hp0"S P 06^_p 0z05000001 00 00g0e0c ^< ^  ^ QS00 00055UU ~ 4Y5S50`FV%R" 2) 0%0;MpPp%5S 0BP80: S0558%0IS00YV05A Vr$4P$040l69p`PpPP mA`$iB|%hq\D00000 0@PP#2 @tA$ApAAPc`0 0S #P]p@Uc)0#S  @&B 3?0E?o2?  @ `V<(7PPf/帹 `|qV /PPAhF6催00CS0 qP Pp PNU0 P00CS0q0 V0S:00S:02V511S)1S  PdPh!iB%tV6P 8gq P! P0V08 iP$]0`FV|P@]P  f/t %T  \ P8h(t ?]{-+; $,%&j(0 R FPL`h((&{ V`(10&mdLxh(P@-ʝ 0P @`P@pz5 p`00CS`0 P6@T ЍX0 X @8( (&&O-dM@` $Ⲹ P 0t̄4 $0Pp0$p@DTlUU!Z rUdU `0?p0@$@\tPcPSP PP d @" nP tP0 aPP dU4 RU SU" QU040  \pUY [/lUT    $=L$ @p< dЍ $/$ @p\ 8"8 @p( 8" 8Y  H T@DPP`p | q`TE\8 w@pLP4"4!( "0x X!  P Q !)\;0P0'\TK 0@Sa4|^4N x08RP8 p=0PU ,8 4 P P P0ZS `V   40P`||Q-w4&45~D4D4{D44|D(44444}D55)5<5i5FP j 5؆&yaratcidO-0`pOaMП22242222322$ .pj>"42`FS 20000b2@_S Rd2SVV10 dbV% ``L0p L pP  ``L0ppd2S PQ?PX0: S0d2232d2o``SmX}0 P=IPpm$0S, e( zPRP3P/PQS@'P<1@P A@P<P00j0000|\ ,2 ,00SP LZ<P0d2M042J02G02D02A02>@[ @3Taߍ02/202+02;/PᐧP000S p$ 0 0[ / ~PP000S p 0$0U /lP000S p耝Z0*2Z000 0B BhP 000S 3 S;3l*00DZ 0\ jhP 000SX"\2R$RX2Y/ %P PM>PX0: S T: PP "/P  *0  唽P|p X:{\10  [ *<[ !14(S<̲03U8  8803N(88 P 0@C LR\ 2SY 2S, 0sUa k<pgd2SL =pV X!\1 C\1X! 0 \(02T7,2P702 S,2 S(2?S ?\8 ,"#3P40(02%*90L0 08 <04p8 LP<0PELP00 H0D @p' H0DL804 05P@0+ ^0 \  ` v !p  ZY1d2S+(1\ [tPPL00<08 4Up 40 S8 *"<02#L SpW U[#010R,b(H"L2R0;\2QP 01 SRC !R QR<Q9Q6S 148<0   0\00R00 !14!8!<Wp@(̲ WC&vCX(C -nB4 BBL(BB(BBR P(<FPBC(U-C?CCCC D(]D`(rdADxD%E F6Fh((dFFGDE8ENEfE EE(&(_EGF@G_GS 2"0g 2pSB`P 0$    02S2 첕[/0@t@2S?P"  /`p0 0?`8@+P P1! [!0T2<<23S 2AS``屺2S 8$)0 妺P IP `p+0!` 00"4,00!` 0,"X? 0,! 0 0("( P iᜭ`gbp0@T5 @ET @@谝` \000S&TV"0  g0sKP .y || /d#\P+ `V2.TS .O"20"0]pP0jPk *h-0O-EM MP 00P00`P蔟PP@ 0$p0040pV4$" ލ ЍyPcP PP! TP& /P4 LLT/*,@$d0@S0000000 )0 00000K0S : pP1V00[  =P0SH R) Q(nQoQ0 )#0MPPu "00"@P' P" P  UU.;P )Dp@.P FD"D9PBv80R9!00 YpWH ` j=P/ ᶟPZ1!-Z4P@PO?oZ20S@ O `@T  j=`PDj/UP 09p.  (8>04P(`CQښ. .a0C 2 0SU븻(-V&ȹ kV؆&ܸ л(UVȻ(Խ%Vq(-UVVػ(zd@(VJ FPedAVVWAWG-p@`㤁Q!up$Vㄑ 0S 0S l`d10pWA 㑱P <匱0S $冱pW%ZЍyPmPPP fP " n0@ S000000000000000`;0V 0i1PPi A#P=#P s7Xꈝ-`(YY&X YO-(4M$$` 8P! 7P70pCࣟ00PPP#p4W00S 0S 0S Pp3 a X( 0S00P H0S 4,WPY30S ЍzPOPBP FPG gG2P@*P00 cP2 ]P2000b 0 QGhx,0X 0FP00 8?P00 0 c6GP}x000t00q00n0 mG1 P :S00000X000T00Q000M000IpG00000A000=P;0S\JP\U 0qP\ `IP\FZ b6FZ(4(-(pp&(( +;v+pRpOpUpfp %pppYO-@Mp@@6R,圫P1WpG10-svPlP+HP1 TPH g7p0` 0&U D D0`Z J  6qp` ?0S KS4m@ Pက $p R 0S00!S0  4 00Q40 ;P000S L 0, @HnPH>600-S 0`0@0( 0P@]`PЍ@}0 0<b P@ݯ000 R0Sk3<0 @ `#  XG B R. 0<00@ R T 0 00S00 RR R@u0DKT$0o R" 0:E%KU0<0 iR BR0<0 BR0<00ST  RH" :J%FZ R  :O%A_U@*DP t*I531@˅p $0S) 0@  200S0Q@$0SD0S(00(0 @`0P@ `$`(`$0S (,$TUT[D0$ 1ă00S00l?;;0 4;$#(Ć,4 03/p V `p Lᢂ\ p '& 3{ &܍& ?-G\値%@-44O,U$0$00K Ѝ]%`(dO-@P8M -`$@倭 F8 ({v`^ 席p 峭p Q5 R|, 0H L,P00P(\80`厭pXHP U5(EVIPHPUpP5 $h$p(5O005SO .5+) 0 0$00 00 0  FPPP$pQ|塭PzZ `Z NZ4 AZ% CZpD pRi,a J0R WZ00!0 0 裟 آ0DS ,K0L0J0ꠓO005N03Y YH0CM0H0500!0 0 0 媢0@S QI02Ypk0zZ0gkZLZc2mJ Z^ PㄒWꬒUUm㘣PH0SI0SO005SR L㈣PN  ♬p8 0S  0C !P i@P!O@Ap``᧭p!A {P|!; _Pd! 0S1H!U3/ (8d8 bPP`PxQ&0P$1$!$ @R #d( ]p PP 0  (M( Fp%p(%%*(h%B@%& g%%0 -[%lJ %}*Dֹ i iui m@-鶢P (P~@嘢 (@-HHn@t<<m,0400i{ Ѝ䀢 %( (@-HHT@Z<<S,0400Oa Ѝf%4(<(@@-t@t 9h0(,5 ;(90H28@-@040,0>83Ѝ@AL(%G-`M2PTGPN03P0 Op) P 3\!3@P L3H2HP8"0 8288@m 3 HDxp HQ #3P  @ p1a 00 @ p0 @  x080<0@0D00 0000P0 0 080$@P @ 81 HL@P@T@X@\@HP  H111 0400,0@@,0( 00P|p PPUPh0PP 0/`ЍM 2D ILVMd/%$.-4-H-(O-`pPH6MDF(` 0 0&:p$6U K V0S`@@0VoP 0SЍuPfPFP RPZ 5g@PP0P 0 hN0#S P` $k$0`0S  $_$0`0S2P N0#S (bP $D$0(0S x $8$0(0S|00y0P |P&q &q & T&` @s0KSq0l1Pj1 C@Q 0cR pR bRJ 4NJK[g0Y`[0J^00I?oP2000 U.Ux U,P 88 0,3/8 RPSX 1@&10S_ 0P|0 0C?oR20SV X_٪00 0$,0$00S 0U00S 0 0S0P000010S޵1 0S 0ӥP0 0  Q00s  h1000T,0 0081P0S& SR 0@0@0 #  R S 0P(0s  v0p c10S >0 003-&( @FPM&:`O-P@`p'M M⌦$PP|& p-p6pp0@DT00S 0C 0T T!q5@Py XG bPA/p`.0S  fAP+ a@P5P5pP50S $zPX `LT|P %000P00pP P P"BP YPpԤP P( L}p q4P\q/L00 000#0 00$00 0bP@(DPPcL (P(OY@X 78b1 PҵP(!h˵P( MF`P@ p q0P@ 0(`p` qC4P 00 00$0 00 @PFP FPFP FP @PAP <<P 07P!<g@/PY vP( M@p` kP( +▓ /Pm``።V!:r0 0.p` `!`/P.0SDࠟ00 000$00 0 0P0@(p /po.m.W0Pa0SJ(S'- 29S!S8 1Z/Y E`P'ݍ Ѝ &(JAV --U= FP ((zd@h(edAp@-P@.p@-P@.ᴹp@-P@.7@-鹺p@-P@.᛻p@-P@.pp@-P@.p0O-nM M800h`4PX\P 0H~0 P 4QPF  >R~p>(0$  t p@5= 10>0S=D$R$r R  $t}Bt $J⭦<$.m`|0A: x0@ <$0( (0JG.p00 J`PEB@D4T@@0$0<@P < $P 6 y t<  d<$$r $pL ֢P ,<$0 00 L 0 z0=0(00 L0, l;0@q J; ;$h0 00 0  S\;Z0!00 d0 | E$; L0(00 ,0*H 7:$>0!00 0  ):(00!00 0  |:,"0(00 0  D:0`:@0:0S lP p: 000 X 4!00 0 0 :0!00 0  :0!00 0  D940c 00 L0  D: 0!00 0 X 888Ĩ@0S C.0$ R1PIC1P0@4 ޡP@ 8(I\8@(СPD40 ɡPD40D4  H h0P(0u `800 1 1 8]48Cd7@JP00\7 000  ᇳOL7 G: P=P/ 8P hI0S 0T470 04001<4 4*8X!  PEU UYx V 0.` 0 PS 4S<4Y1 H4L$0 V'-pi?HL4P80ԕS $E~G?ሟGHtLW0.= 0 $?ypp5WLHt4SH$L4R0 %+pP  V-p  4S@  0pP  =H  7PP;l%%7PP\%\V,p (:: S4%8) $RW+@P %46@pP$  廠섟P0HpWZc$R0 >$0@0p!$Tk = x,0圠P,0 r0 4P ⛠P$803m`Tk 40S0X44S.=0@+R$)SR' (8 # *~vPb 0T40SkP 3X#0S T4Sh\P`3 c(8p+"ŸR H$L4P*`(Hpp 0 L4H/0#! 0ZpL2 C  H$0- ;gp~|z 0P0 X  㝣!L4HϠ0#q4S 0 ) ?W p0$$4RT SQ  W   0B*p 0 pWS  S!0$Qg +S0$0 Q$ Qr*8+ fP9X+-Q :$4*041$4+iT4S# *d0,"|)z)x)v)PC*\4$8: H4d4: x0<$+0@ 0*p`^|ȞP Z +⶞P⽞PM  <Top  T< = 0+- , O-0pMI Mi4, (pP_8`4pGs04WZ h  YaB 4S<44S $$4R0`\((p L h`*p 4 4 SP,0S x0$壜 t$W0 0N 0$嗜pW$ t1SE $$4P>*`FZU CUʠl7DPEUPPbPEUUPP6 ('8#80( R&0C Rn ("(E044s04b0 00 l0 6T0(00 4V0,`0@E H0 00  0 50*00 +0 )0*00 +00!00  00c 00 |0 @50!00 L 0,00 1 1 s40(40S`E00; \$30P0D$UEhd)p 4S 'PP$p$<`P#X  L(@@P@4(0(00`V Z<0 00p"#7$p = 0%P0 r0 4)P $P #0E3}p$p4S80S4l 1S !1B0"H 0S8P (3"$b1p1   $Ĕ!<#WpX2   D$ dpX]P xc 4 $$s(4S 0H?W  | $tR $4'S  4%X0; 4 $$ W  0&p0DpWX0:S Q4S  0 Ϛ  '0S Z '!!໚՛X0⫱ΛX+`( - &(Mr %5Y RuXaVe( 1< `# GO-GM MP`h Ⱏ0t@$$Sp40PEPEUq@@5P3nD0403003a3(3 p0,0p0T3000D30804<3<#  3@ 3D 2H2"20L02"wd2l"oDl2L"g{$T2 _p0V0 (2UWi2 Mp0X01!CW 1;`Op0x0p0d1 G'p㸐%7  %qp+0 S ' D 0Z ,C0S0SPT0 A/P 0$ 0 0 @xx9@P C Gލ Ѝ &-Y -9JYha VyO-`PMD \`[P&DOP8B &P%p_%%p `Pp%@` .DpRĎ 048 P  Z .>> Z %P t>FP %Pd<;Sڦ%PL #QG $F 06O >@ON PX( { =0 2S1<+02D0WC=0S D=C@4P 09 0| ``0P 00R0S DAB 0;8;08; 00<ppGx`#<`00S 0,FP  ,<!.u8P:P :2@0SUȌp Upp̌ ňppPt  JA 0@ @ 9 0PUP 0C S0400000,00(00$00 0000000000 0000000 0O0p  Rn PPKlWo q8;  00 |\0$ph8; 00 D\0$p4~8; 00 \0$pp8; 00 \0$pb pW  |0 x;0 E y;z+媜0;0; ; '0cy;0z;(0x;P+D@⒜P \0f$P;"0#10@00 0p[`QHf  p   p 0A$P[0S PP [04$PX 0  00 86'$P,d 0 Vpp6&$Pp5% $!2P(10[[[[,Q0Q4QE 0@PPPP㧜*<;SdE#>؀C 0 5PoD@PJ P4M 0L 0L 0$胟N# 0~5POD@XPI 3fM 0L 0L`"2Rz 0CPt ' 4$44@PCPt40S 0 _8' s@P 0CP@P 0CP D2 h0弖)"pt00 e"@+lY@0W0 00D4Pt3 VppW & P 2F#P0:CS0 >#PD 2$ 0%bB  LN`p l2L@P 0[CLPZA@P 0K 0@PHCP D 0ACP 1 KRK  h!@,T 0S ]I0㈠d0d000p+t!pP0S H<8凍)){Gz??C_eA& -0`RMb@AIf$)[)@)@)q)&K|P))O()>L&)-C6?)~([8~A`)$@)@@؆&0)x)P)G8&")&)|izB R  )Nbz.@eb s 8Qg-`?)G)VU[C"t;@000aV WL0 0  d|0d"R!RT 0 Q @ PG1@S4 2R`2嶰0C(4"<8#8[1LR?L0 d0ᢏ0 d2$2    pp0xt|0?lxt 0J#J 0IJIᰒ BP # !BP #! 4+4#0à3D0h2 0h22d0D#Wp! gأ0$#$@0(00"(D02 0BS@ (SH; B 0;pD0S?0#3!(0H0C8C8S!/< 0 0H 8(#8<"( 0 DX4币  x⃙vx5s 0#;    0; 4 0W؃0$#$@0(00D0"(qpd4 U T J[vP@0V/W q@ 0RZWأ0$#$@0(00D0"(<4u%0 H0D h0Xp4_<\H&0CS00 P 6Q20C 0#!50 #0pD0 0 Pk 40 Pb X7Q0l|0 vPD 0$#$0(#"(!0 bP/ 0 XP% 0 OP Q Q TXp\n 0 =P| r0 3P 0 *P 0 !P 0 P 0 P  0 P @ 0 P d iX9 02 .0SD S`& Ss W ؃0$#$@0(00D0"(p B SHZFWH `K F ` P , J:Z0H(`F`J 0XHZFW&:;Z  tPW   ḫ  ⥗W( p JZ X Wh ;O-M`P_@0-S@ᥓP- @3 pģ#p*30SP a`F0P[:PQ9 JKP9 fD \;4rP@ 3C d0@S Lp@20SK@HGG 0̑ 0h|eX `';Y'2`P1P`4b 2 R * C0 S  U+ 0 /!x0!00rWWfc`]Z Wsp8 0ip0S hW,h` Wp0SG뗗PF0pt@@ 0: Vt$lh`{0*f &FPQ n0q1  /lJ EO-PAM M@`z뼦P yP60V00-S% @P PY:@ p0K0\Z `F0S0`@DDA@Du%p ,0S@bLP53 Q  嶐P -00 `@Z-00  D0B5S0 00S 9P90 04P 90000|400 |4 0S d9 L4 00 8P ~  v300S Pl0$0g0(0d0,0at0C?o#2p R0S0$0P tPX*w0H@DT43a00@`FrS= RS iS1 4tS xS%3㨢в+ 0p 0@00@00S K 0Y,0S 8< Q (0 B/S ͭH(0S ­ 0@U~0S (0S |嬭1 0t0\S @X坭T(0S 4哭 0@*;LZZ:Pp+<V 0 p|PUV8  * 1ID-f~$+X&X3&#؆&Jd&h%(&smo 6$O-PLM'P N n.p=,# PER a0:  @@0SC~8vPcPSP TP LP d0@S00D003030800H00 30$30(30,30<00",0/0@)0,0p qW3S)P  @ Px< P/P LЍO3S 00p,04 8<@ 0RWS[Z0DSPQL  0gS @{$;0 0EY0P aR @L0Y S 70-S00 @ 3R: "0 0|: ` P0 0\:0 0H:43043{0830<3@30@3ppzzyyx||{U ,0U ,0U ,0U ,0U ,0 0 0U ,0L00L0U ,U S S0X0X(0CS00 PD#8 D#<#  P Q0P0083 '00b0 X0X 0W@0W0W0W0,0  ,0 P PiH0Sx'xx]0>@PH0ST'THQ02 ,0XS`X `43 S`p噓/MaWF cW1 gW0Bp㋓03S\0S^ 0gS$ H0S!~YP 0x&x  00S_ XZWZV 0S00  r,J0H4F8D<B@@D>WLЍ0000H3p0P xH30`p@D30& 4 004 SSCP 0C00 ,0  4    0R:400,R0t ,0 0Rp B p x<0S $3S 4p0 00 R  B   0x< Q $0Q p0 40 R  B   0x< Q $0Q p0 80 R  B   0hx< Q $0Qn p0 @0 R  B   0Px< Q $0Q\ p0  <0 R  B   08x< Q $0QJ p<0pGSz $3S0S .D0S\ @p7h07S d,00'c<sr=MS H f B x <  6  0 Wڀp*0S 00S 0S  Q 0   wtpW *a 8 30(#0<  `5+ b!&N3 ;} n*q* +)+ 4 &5+5+ 5+5+5+5+5+5+4] ** c **6+v0 f +5+x6+)A+N+\+j+{++)w;G-PXMpPHh  4DP b0@SS0p80 6`( pT80U ʩ0$60(60,6006046060860<60@60D60H6$&R 4&<  <&,&R 8&R 4&R <&R 06h'SddQaDPA07C P zP W0S  fP 0000P6T&0 @@ ,PV*P061 l(VUtpXC 0+Sp@(86 000(<00 0/15T& P 0p00 :XP00G00Xpጊ h5@P 00 B00C2#S0d0P0 00 B00C2#d v>C 0C0 0@0 B "00P 0P0A1#10C0 0P0A00C1# 0 0P0A00C1#0  00 B00C2#0Eqp(4 0P 0PQT331JZp=V 'v`2o`F#P0 0SU030#:U 5%$Pܖ+P p = XP&T6K/r043PvTS0 0 S5# G@*a SPEQX!EK/r0Pa 0 0<6SR46SR 0&2RRPT2 01da|咖6S l卖P W0`W  0〉P `,6S m/`P v0PQ! V` *`X<6S:46S: l1Q0@6D&S1 0 00Rt!  H&hRd! $&RX! 8&RL! 0&@RP .P0S #P|W o5P \20 0000 p!2&-H &VJ QB+FPUyt 2Ct 220G-pHM`0 BR"%p 2B1 pGS 1S 0$  !RS@# P+PTAP<$1xP`PAP MP F!a0@S0 00 04044041! 00101@30@3101101101101ДY 000 0rHЍP q PP  e10S  p20 f`PDPW a W WpGW R $Sw ,0< sW ptB+-;&;F!P &U0FPxB+&C-Mp`3PPEUx%ap5U@U`F V/@T tP dP  aP tP(5 R ,%  PV 0S A@D  P`V    tP@PA@3PzP0S<0S000S00S00S00S00S 000#pPU 3 `V= V30SU7 0S4000000S@0000000 0 3v 0Ss<0Sn00Si2oP0$0:^0S 0SX`V UURpZP `UP hPPC UB U US@2PEUOPPUI Q FPB  0 U2 @U U70000  b . U,>*PJE!0000 0 O P   Y $0S  p xqp@*5O@T 6 0"600"$0$P @·P xɇPhBHG+H!&*A-B؆&BC= |!FPkCC1CDCTC= ACC-@PpMa M!p10S QฑPE R ލ ЍRP fP74pF]P` h/WOJ EP1 JMP/0: S2  S)J .P0 JN@n` 04S00`M!0S phJ PJ @PJ0@pG+uE&FPE\ExEC-PGMM }x*0lL$d0 XPq0P& S",0 hf`dP8Tu H]P 8h(m(TP 8T(X(c _P 8h(a40EDS00 T8(| 88X(T( $8,8 x8P 00S~ T8X -7, ,, ,q 7,m 7H(i7\7LL` h7L(\W+Ku PU:?@ 0 7P(J7WLp嶅P|78?X7 6<(: 6T( X(4,7 O6P 00S' 6  t6t(6 :T6P 00S 6 6p P tt68PLP080xP 0S06X PU 8 p <+ d5, T5L(5UL0`0 ,5`(d( 5UH5P D 5?Q<GލЍ\5` T0!0D@< 110101$1EYA?=(7#2RQkp`d Pa Q18C8S yXO`q́X  lQ00S AZ P +`3P?o20S R=?o20 P P lZ18C8S 0! S׍S 0RX  \AY=`S 0 0000 lY18C8S K`Zx/,Yyxxx&& y2,1yK v w&7yl&-x&>yOy0,0,$ xxFP܍&qr1o@-@`P7P l1 hq`!cpT10SAG41P? ba1)P  P 0 nPbP 9P0P   c0@ S0VP  00@0 P0  @0  00 _na0S46, !& ! ؆&&A-`4C0P@00$ 0#P0 0p廁P00z>aبemĔWvMW冉威P0r0l0"SP DU 0+0C0SPP \p<ჁPPE P 0S帀ӀP10局̀P1 0Q FU 0S㽩뺄P‚㯄5PEl10S `10PL;HQcܷ0S,1,3P#P 7UbOPaqp 000000S嬪 ㅩtfxnPP`0S PPt00S8H6,tr,xQ (6,Ls,?r,p@&is,x,Ds,s,O-`pPLB D@`4"p(2 0 qQ pPpGefuP`P GP IP EP e0 `a0@S0000P0#X00@T,`P@@#3p=30HXB+[p B0S hcg@P j~@TP D3D @ -R R -R iQeRQiR kR eR" ""sPPPEP IPF -PF -2Q@"P00p2p\2`L20P^U0S ?SPP20`^V0S ?S``10@^T~0S{ ?S@@w1100ljhꐱ<00 (0\  `0` !1R, S` \0  0Z$, ,A8`P  ,3Y  0SI   <S`0S   Rڰ1\0 1 x0x7$,Ӷ-&R&ͶHA&A&A&4J!-Й-ht@P,؆&(.3gtO-@Pp`LM @"#p1 UV! Pp &gP uP GP `0S@0000T PUP   p  !&Pڻ0P 0S U& p U  p T ? p V p|p&PU D TePL@@H 0% ꈝ-&FPVmo ׷V0O-@|M0t5t%@p5P@h5b `5p@T5b/ՁDEDeX04%`5,%,E5(%(50`0eP]  šP P @mmPC DP3 fP5 CP6 妚pP7 rP|$@pO*h( P00: S0S00+4\PP, pbP 00SW p 3 3 C3`00`ᴓ崳p=ZWpP  2xS+F,F0@ KLPP D +`P Z`uM 7LZ{ 0@00P@UP@`P EV ((P,@44`(PV,@0h((P,@404`V(P,@@((P,@4`(V(P# 0 0S0 0 0 0 0 p  W-0@P > 8100#$1"1_PY 0Q WT) 0 Ѝp^`,,l,,,,J!6, -,,,c ؆& - >- . . . ,,8- -d,—f\- ,. i m i ,mo . Tl ,,,O-poM0 @e 8@0 @$pPU4 W]Y 0pP 0  P(0: S ) 0T0Z0S㸠f Y XчPz @PD   P _x [x P8 Pd@Pq 4pUaUbPEUPzU" v!0 l 0`= 00 0<3 1 $ 0+w300s@q pT 0!0 02QX 000sX%X pP00 0P* {Pt%dPPh!!g A 1B !0#XU0!S#P #z Iv  VP"   0P0S v |ꛀ0S v`0 0/X0 I`p 0 0  Q   S  R#4p UP`i0S T fv  KV9@p8a-_!_ &FP_ 0_ _ _ _ -r_ &ht@` x` /` D` ` c ` 0d` V` 0O-PMp00@|Y{Pp hS{P\\yX垆ߍ(@*.~9&,?PX1$?/0201 2211$R("T122p\}pU}p^M}&[0n0Z00 h.0`>p:0Pn0C 0 0R080 h崉0 l10 B1!1pq0 ႘PPZh0[ = 0ZoR =-00+0 80 =0YSVPMP 6P@ ?P7 4PD@=N@PfP j@P=P=0X1hh<bhVPļ0V30 [0000z00u0 ؅Po`lXi 0pWP 0P 必0$P^ 帅0 Rთ0 PP  0p2 垅84'000`1Zyp`` 埈ˉ1SUP 5 ᎚$z:0P @@ @0 Tp  lp o(  0 R 0P819:\*`1d L Wp,< R[P-$ (010S  0^xP` 0Y) Y)  +t)0 |`0~0` !M ~ t9t@待΅p$T  X 0S` ( #PO m~0S oZo F0080`8"/0  Ty 0 2s$8"/0 Fy2sc!"# 0 0T1Y 6T@pyXu$0 T1I 5T@p p ,ap P 000Rl)坄T忆0@00 P  ,0 @40 wpP F $ $# 43}Op y+)p彆 4@峂p8岆!R`14`11P0d$}!^P0!硆00!R00SRd1q{`1Z  R! Q01Y; KⓇ`1 M{1pW4180; X >< 490Ӆ(0{(1PU 0S 2PlP 0S  { 0S .yp R080SX R   (001@0 S   0q`VTaZх0@0@sp`hGdmC00 e e e b!i i i xo& Ue Te d!&qi /c a!!a!-c 'c ?c i i b!l ` @ j j j ăemo d b!j 4j kj j j Pj l j j j j j j k $k Jk ak k a lk (1wk k k e He e k k `k k */4T*/@-@x@*/*/*/*/ps_strings missing %juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pidjanuarygmtmidnightyeara.m.pmp.m.dstmnnoonmiddayiqvwututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidletomorrowyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11acMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames failed%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresvzfs%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMinitscrUTF-8Inkey wstate screwed - exiting!!!xxdumbESCDELAYTABSIZECould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey: Cannot allocate new keymapInkey state screwed - exiting!!!csp != &blank/usr/src/lib/libcurses/refresh.cunknownbel^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNS%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME%s/.terminfo/usr/share/misc/terminfoansivt100vt220wsvt25xterm,v3%s: %s: unknown capability%s: %s: cap name is too long_ti_getnamepromote numno separator found: %s%s: description too long: %s%s: name too long%s: alias too long: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: not a number%s: %s: number %ld out of rangeacosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfsqrtsqrtfsqrtlfmodfmodffmodlremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrt: DOMAIN error fmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error unknown header flags setunknown compression methodincorrect header checkinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkinvalid bit length repeat1.3.1need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionps->ps_un.psu_immutable != ((void *)0)/usr/src/common/lib/libprop/prop_string.cps1->ps_un.psu_immutable != ((void *)0)ps2->ps_un.psu_immutable != ((void *)0)str != ((void *)0)fmt != ((void *)0)src != ((void *)0)%llu0x%llxctx->poec_format == PROP_FORMAT_XML || ctx->poec_format == PROP_FORMAT_JSON/usr/src/common/lib/libprop/prop_number.c%llirpn == pnintegerarray!((*cp) == '\0')/usr/src/common/lib/libprop/prop_intern.cctx->poic_format == PROP_FORMAT_XML || ctx->poic_format == PROP_FORMAT_JSON?xml !DOCTYPE plist %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctl SIOCGLIFADDRSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfaces%s: getvlanvlantagSIOCSETVLAN vlan: %d parent: %s -vlanifVLAN tagNONEWEP40WEP104TKIPAES-CCMPAES-OCBSIOCG80211POWERpowersave/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY%s: BSSID too longmalformed BSSID: %sSIOCS80211BSSID [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211CHANNELSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS ??? TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM CFPARMSunable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPA: or @ speccan't get net id for host "%s": %shw.physmem64can't get "hw.physmem64"usage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2, 2ea => FFSv2 with extattrs-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). setblock bad fs_fragshift %d first cylinder group ran out of spaceisblock bad fs_fragshift %d internal error: can't find block in cyl 0illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblockusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir %s: bad %s%s: not supported yet %susage: %s [ -options ] special [disktype] where the options are: -%c %s create sizevolume IDsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorsreserved sectors%sr%sOffset in deviceBootstrap fileCreate fileFAT type (12, 16, or 32)Volume IDVolume LabelDon't create file system, print params onlyBytes per sectorSectors per FATBlock sizeSectors per clusterDirectory entriesStandard format floppies (160,180,320,360,640,720,1200,1232,1440,2880)Drive headsInfo sectorBackup sectorMedia descriptorNumber of FATsHidden sectorsReserved sectorsFile System sizeSectors per track%s: no default %s%s: illegal %sCannot specify both block size and sectors per cluster%s: bad OEM stringcreate (-C) is incompatible with -Nfailed to create %sfailed to set file sizewarning, %s is not a character devicecannot seek to %jd%s: unknown standard formatCan't get disk size for `%s'"*+,./:;<=>?[\]|%s: bad volume labelCannot specify info sector with FAT%uCannot specify backup sector with FAT%uCannot specify directory entries with FAT32%d: bad FAT typebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %ublock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectors (need %d have %d)too many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) MBR type: %d bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=NO NAME%s: writing sector %u of %u (%u%%) %s: can't read sector %u%s: can't write sector %u180320360640720123214402880usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP%s (%s)0.0.0.0 Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %s~SIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot()usage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d canonname: not enough buffer space %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char %*ju / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10ju %s %s: not on the tape ./%juMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %ju) not found on tape [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %ju: bad first %s: not found on tape expected next file %ju, got %ju unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %ju %s: cannot write directory databaseor set environment variable TMPDIRTry making space in %s, %s %s to an alternate location with more disk space.bad seek pointer to rst_seekdir %d Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) Extract directories from tape %s/rstdir%jd%s/rstdir%jd-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%jd%s/rstmode%jd-XXXXXXno memory for directory table opendirfile: %s Root directory is not on tape error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %zu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s %s: cannot read modefile.Mode, owner, and times not set. Not all external attributes set. %s: cannot seek in modefile.Not all directory cannot find directory inode %ju extended attributes for Cannot restore %s%s Cannot find directory inode %ju named %s write error extracting inode %ju, name %s read: %s addino: out of range %ju duplicate inumcannot find entry in parent listdeleteino: out of range %ju deleteino: %ju not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %ju file %s unallocated block in symbolic link %s Cannot have multiple dumps on pipe input ioctl MTFSF: %s overrun attribute buffer symbolic link name: %s->%s%s; too long %d of extended attributesCannot extract %zu bytes %s for inode %ju, name %s seek error extracting inode %ju, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %ju, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileremainder extattr_set_fdextattr_set_linkextattr_set_fileacl_set_fdacl_set_link_npacl_set_fileSet attributes for %s: %scorrupted %s, (%d bytes), %s (set using %s)posix1e.acl_accessposix1e.acl_default (unable to set)Changing volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %ju continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %juFile continuation header, ino %juEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d skipping to next header resync restore, skipped %ld blocks ran off end of tape not at beginning of a file skipping %d junk block(s) Missing address (header) block for %s at %d blocks getfile: lost data: %s %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%jumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d ioctlatalkexpirehopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmplsprefixlen is not supported with af %d%s: bad value%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflow sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) writing to routing socket: %swrite to routing socket, got %d for rlen%-20.20s botched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsEncapInternetAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecUsage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck set -- %s && . /etc/rc.shutdown About to run shutdown hooks... Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslip%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]0x%0*x0x%0*llx%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)regcomp: %s: %sregexec: %s: %s%s: this type is unknown to this program ...(%zu more bytes)%s: !returned size wrong!tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed %lld.%9.9ld 0x%llx hw.ncpuuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu %d = %llu%.2f %.2f %.2f Invalid port: %sPort out of range: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/hashstatvmstat -H/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -c -p priority path %s -D dumpdev|none %s -d path %s -l|-s [-k|-m|-g|-h] [-p priority] %s -q %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the worldswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: removing %s as swap device %s: failed to remove %s as swap device %s: umount failed%s: adding %s as swap device at priority 0 %s%s%cswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: no swap or dump devices in /etc/fstab %s: there are swap or dump devices defined in /etc/fstab KBytesGBytesMBytesno swap devices configuredSWAP_STATSDevice%-*s %*s %*s %*s %8s %s PriorityCapacity%-*s %*ld %*ld %*ld %5.0f%% %3d %-*s %*s %*s %*s %5.0f%% %3d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %*s %*s %5.0f%% %-*s %*ld %*ld %*ld %5.0f%% Usage: %s [-fR] special | node fR%s: not currently mountedumount_%s%s: execvp%s: unknown mode. TYPE %s %sTYPE %sContinue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20260208NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4 KiB buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbufSocket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptsslnoverifyaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottleusage'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]Receiving HTTP reply: %sparse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Invalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s' ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'$initCan't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestContent-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving fileImproper response from `%s:%s'already done Size of `%s' differs from save file `%s'Unexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sUnsupported URL scheme `%.*s' remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! Passive mode address mismatch. %c%c%c%d%cparse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionPORT %d,%d,%d,%d,%d,%dEPRT |%u|%s|%s|Can't poll waiting before acceptPoll timeout waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. Reading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-b BUFSIZE] [-H HEADER] [-N NETRC] [-o OUTPUT] [-P PORT] [-q QUITTIME] [-r RETRY] [-s SRCADDR] [-T DIR,MAX[,INC]] [-x XFERSIZE] [[USER@]HOST [PORT]] [[USER@]HOST:[PATH][/]] [file:///PATH] [ftp://[USER[:PASSWORD]@]HOST[:PORT]/PATH[/][;type=TYPE]] [http://[USER[:PASSWORD]@]HOST[:PORT]/PATH] ... %s -u URL FILE ... %s -? ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. ftpgateFTPSERVERPORTNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad buflen value: %sBad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s-%c: unknown option-%c: missing argumentunimplemented option -%c:46Aab:defgH:iN:no:P:pq:Rr:s:T:tu:Vvx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTFTPSSLNOVERIFYRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4 KiB macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. lostpeer due to signal %dftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Option %s must be boolean (1 or 0) Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failedAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstreamInput line is too long (specify -b > 16384) disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! timed out at eol chars transferred in can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingbad parity settingmore than one line specifiedConversion of `%s' to a baud rate failed, using %ldmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedphonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numberprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.3.1failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of filecan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %sopen: %s%s is not a regular fileusage: %s [-123456789cdhlVn] [ [ ...]] 123456789cdhlVn.gzLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %g@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionPress RETURN to continue LESS_TERMCAP_%s$<LESS_LINESLESS_COLUMNSkrklkukdkPkNkh@7kDkb[?1000h[?1006h[?1006l[?1000lLESS_TERMCAP_DEBUGhcxndaNR@8MOUSE_STARTMOUSE_ENDtiso|^[%dm[38;5;%dm[48;5;%dmNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETinvalid hex number(s) in LESSUTFCHARDEFmissing colon in LESSUTFCHARDEFLESSCHARDEFLC_ALLLC_CTYPELANGutf-8UTF8utf8LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIlatin1iso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bXDG_STATE_HOME.lesshst.local/stateXDG_DATA_HOMELESSHISTFILE.less-history-file:.search.shell.mark"%s LESSSEPARATORInteger is too bigLESSHISTSIZEPattern not found!done#done|done(P)Non-match First-file EOF-ignore Keep-pos Regex-off Wrap Sub-%d &/less %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionSub-pattern (1-%d):Examine: Command not availableCannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such fileset mark: clear mark: goto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableXDG_CONFIG_HOME.config/usr/bin/.sysless/etc/syslesskeyLESSKEYIN_SYSTEM/etc/syslessLESSKEY_SYSTEM.lesskeyLESSKEYIN.lessLESSKEYpcloseInput preprocessor failed (status %d)Input preprocessor terminated: %sInput preprocessor exited with status %xWarning: "%s" exists; Overwrite, Append, Don't log, or Quit? Overwrite, Append, Don't log, or Quit? (Type "O", "A", "D" or "Q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? %s is a terminal (use -f to open it)set Missing filename ("less --help" for help)ts=tabstop=less:vim:vi:ex:; *? '"()<>[]|&^`#\$%=~{},LESSMETACHARSLESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*LESSOPEN ignored: must contain exactly one %%sLESSCLOSELESSCLOSE ignored; must contain no more than 2 %%s...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileCannot seek to end of buffersDetermining length of fileDon't know length of file%s: line %d: \x%02xinvalid escape sequence "\k%s"#line-edit#command#env#stop#versioninvalid operator '%s' in #version linenon-numeric version number in #version linemissing = in variable definitionmissing actionunknown action: "%s"back-completeforw-completehomeinsertkill-lineliteralword-backspaceword-deleteword-leftword-rightback-bracketback-lineback-line-forceback-screenback-searchback-windowclear-markdisplay-flagdisplay-optionend-scrollexaminefirst-cmdfirstcmdflush-repaintforw-bracketforw-foreverforw-until-hiliteforw-lineforw-line-forceforw-screenforw-screen-forceforw-searchforw-windowgoto-endgoto-end-bufferedgoto-linegoto-markindex-fileleft-scrollnext-filenext-tagnoactionno-scrollpercentprev-fileprev-tagremove-filerepaint-flushrepeat-searchrepeat-search-allreverse-searchreverse-search-allright-scrollset-markset-mark-bottompshelltoggle-flagtoggle-optionundo-hiliteclear-searchvisual]8;;\LESSANSIENDCHARSLESSANSIMIDCHARS0123456789:;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letter %cMark not setMark not in current filem %c %d %s %s log file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06ldPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthCannot use lesskey file "%s"Cannot use lesskey source file "%s"tags support is not availableTags file "%s"less regular expressions) Copyright (C) 1984-2023 Mark Nudelman ** This is an EXPERIMENTAL build of the 'less' software, ** and may not function correctly. ** Obtain release builds from the web page below. less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Home page: https://greenwoodsoftware.com/less Invalid color specifier '%c'Set --use-color before changing colorsInvalid color string "%s"Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %srscroll character is %sUse "h" for helpLine number width must not be larger than %dStatus column width must not be larger than %dinterrupt character is %sinvalid number of linesinvalid number of columnsheader (lines,columns) is %sinvalid search option '%c'search options: %sValue is required after %s--%s-%c (--%s)Number too large in '%s'Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalcolor desc: Don't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directly (not recommended)Display ANSI sequences directly, other control characters as ^XDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersrscroll character: Allow duplicates in history listRemove duplicates from history listIgnore mouse inputUse the mouse for scrollingUse the mouse for scrolling (reverse)Lines to scroll on mouse wheel: Scroll %d line(s) on mouse wheelDon't save marks in history fileSave marks in history fileLine number width: Line number width is %d charsStatus column width: Status column width is %d charsIncremental search is offIncremental search is onDon't use colorUse colorDon't get size of each fileGet size of each fileDon't color each line with its status column colorColor each line with its status column colorHeader lines: Number header linesDon't number header linesSearch includes header linesSearch does not include header linesDon't redraw screen when quittingRedraw last screen when quittingSearch options: Don't exit F command when input closesExit F command when input closesDisplay visual bellDon't display visual bellLines to read looking for modelines: Read %d lines looking for modelinesinterrupt character: Wrap lines at any characterWrap lines at spacesDon't show error message if preprocessor failsShow error message if preprocessor failsBackspace handling is specified by the -U optionDisplay underline text in underline modePrint backspaces as ^HTab handling is specified by the -U optionExpand tabs to spacesPrint tabs as ^ICarriage return handling is specified by the -U optionDelete carriage return before newlinePrint carriage return as ^Mproc-returnproc-tabproc-backspaceshow-preproc-errorswordwrapno-vbellexit-follow-on-closesearch-optionsredraw-on-quitno-search-headersno-number-headersstatus-linefile-sizeuse-colorincsearchstatus-col-widthline-num-widthsave-markswheel-linesmouseno-histdupsrscrolluse-backslashfollow-nameold-botno-keypadtildequotesmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-srclesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenLESS_DATA_DELAYSignal %d0123456789ABCDEF... (interrupt to abort)... ( or interrupt to abort)Invalid patternPOSIXNo previous regular expressionPlease re-enter search patternNothing to searchLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileTag not found%lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: invalid command code %c%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: extra characters after \ at the end of %c commandw command%lu: %s: filename expectedread commandbranch%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aEGglnru] command [file ...] %s [-aEGglnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EGI::ae:f:gi::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-i/bin/ksh/bin/cshmdnsd+nsswitchNoaes-xtsaes-cbc3des-cbcblowfish-cbcencblkno1encblkno8pkcs5_pbkdf2/sha1pkcs5_pbkdf2storedkeyurandomkeyshell_cmdre-enterAdditional packages.tgz/sbin/halt -q/bin/sh -i -E/sbin/reboot -q%c: <: page up, >: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >Exitrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6)Zeroconf [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffDelete?reinstall sets forupgradeNetBSD/evbarm 11.99.5 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? The most common disk types are: - wd: SATA, ATA, or IDE - sd: SCSI or removable USB disk - ld: NVMe (e.g. M.2 card), SD/MMC card, or virtual disk Available disksExisting "wedges"mount point (or '-')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point (empty to cancel)?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodCould not convert all partitionsWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-11.99.5 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-11.99.5 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-11.99.5 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media type (empty to autoconfigure)Wi-Fi SSID?Wi-Fi passphrase?The following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ---------------------------------- -------- BaseBase 32-bit compatibility librariesBase 64-bit compatibility librariesConfiguration files (/etc)Compiler toolsDevicetree hardware descriptionsGamesGraphics driver firmwareManual pagesManual pages (HTML)MiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-11.99.5 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-11.99.5 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryFile extensionTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshd (Secure Shell daemon)Enable ntpd to sync time over networkRun ntpdate to set time over network at bootEnable multicast DNS supportEnable xdm (X Display Manager)Enable cgd (cryptographic disk configuration)Enable lvm (Logical Volume Manager)Enable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioning (software RAID, etc...)Edit partitionsPreconfigured "wedges" dk(4)AddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue Username to add (maximum 8 characters)Do you wish to add this user to group wheel? This will allow them to use 'su' to become the superuser.Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSv2eaFFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)GPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is?Cannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation not supported!Switch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Safe eraseUndo changesUnconfigureEditForce umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.Log ended at: %s # Script ended at: %s sysinst terminated. sysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-C bg:fg] [-Dp] [-f definition_file] [-m message_catalog_dir] where: -C bg:fg use different color scheme -D run in debug mode -f definition_file override built-in defaults from file -m msg_catalog_dir use translation files from msg_catalog_dir -p only run the partition editor, no installation Dr:f:C:m:p/etc/openssl/cert.pem/etc/openssl/certssysinst: screen too small /usr/share/sysinst/catalog11.99.5xfer dir/usr/INSTALLext dirext src dirftp hostnyftp.NetBSD.orgnycdn.NetBSD.orgftp dirpub/NetBSD-daily/HEAD/latestftp prefix/evbarm-earmv5/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earmv5/11.0/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script file/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s sysinst: failed to allocate output window. fork() failedopenpty() failed executing: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?Dynamic menu creation failed. %s: failed to open %s %s: failed for %s vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.net.inet.ip.stats/sbin/route get -inet defaulthw.%s.accept_eula%s=1/usr/sbin/wpa_supplicantcat <>%s/etc/wpa_supplicant.conf # # Added by NetBSD sysinst network={ ssid="%s" psk="%s" key_mgmt=NONE scan_ssid=1 } EOF /sbin/ifconfig %s up/usr/sbin/wpa_supplicant -B -s -i %s -D bsd -c /etc/wpa_supplicant.confmanual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" wpa_supplicant=YES wpa_supplicant_flags="-B -s -i %s -D bsd -c /etc/wpa_supplicant.conf" https/libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s/sbin/fsck_%s%s -p -q %s %s [%llu @ %llu] %s [%llu @ %llu]%s (%s@%s)disk-info%s (%s, %.*s)%s (%s, %s)%s (%s, %s %s)-t -o /usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.c:854: internal errordisk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tffs -o log-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs/dev//r%s/sbin/newfs -V2 -O2ea %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %s %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m1777,-sram%%%llu tmpfs /tmp tmpfs rw,-m1777,-s%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-40s %s dd if=/dev/random bs=32 count=1 | openssl base64 /dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%skern.entropy.needed/sbin/umount /mnt2UTC/etc/localtimezoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.crndctl -S /tmp/entropy-filedd if=/dev/random bs=32 count=1 of=/tmp/random.tmp/tmp/entr.%06x %s /usr/bin/ftp %s -o %s %s/tmp/ent-mnt.XXXXXXmount -t nfs -r %s:/%s %smount -t %s -r /dev/%s %srndctl -L %sdd if=%s of=/dev/random/etc/rc.d/random_seed stopraidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/usr/sbin/certctl rehash/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICbase32dtbgamesgpufwmanhtmlrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcdebug32xdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi./netbsd.ub./netbsd.img%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s files dnsfiles multicast_dns dnssetting hosts: %s s/^hosts:.*/hosts: %s//etc/nsswitch.confsource for 3rd-party packages/bin/sh /etc/rc.d/certctl_init onestartpkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10spasswd -l rootchpass -s %s rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu sshdntpdntpdatexdm/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:547: internal error/dev/%s%c/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype%s (%u)parts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictious/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'disklabel -r %s%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %u %-56s (%s) %-56s %s%-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%llilvol%.2dvg%.2dpartmanlvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %spartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d Partman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.cparts != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.cgpt destroy %sgpt %s %s -b %llu %s%s_%lli@%llip->gp_flags & GPEF_WEDGEparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/null-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1106: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1153: internal errorstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullsysvv71kv8otherhpfshfsjfs2minixfs3vmwresvvmresered/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2101: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2068: internal errorparts->geo_sec != 0t != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1744: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1774: internal errorinfo->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2199: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI system partitionusage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %sreading inputwriting %u bytes to output pipe.unprivunpriv./var/run/dhcpcd/%s%s%s%ssock%s: no terminator%s: no arg buffer%s: no args%s: unexpected event 0x%04x%s: write%s: eloop_event_add%s: connected to Access Point: %sNOCARRIERPREINITDUID %spid %d failed to exitdup2 %dSTOPPED%s: removing interface%s: waiting for an %s addressexiting due to oneshot%s: no profile %s%s: selected profile %s%s: config file changed, expiring leasesEXPIRE%s: waiting for carrier%s: IAID %s%s: IAID conflicts with one assigned to %s%s: carrier lost - roamingNOCARRIER_ROAMING%s: carrier lost%s: carrier unknown, assuming up%s: carrier acquiredRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2logopenreceived signal %d but don't know what to do with it%s: dhcpcd manager hungup%s: truncated read %zd (expected %zu)forked to background%s: interface departedDEPARTED%s: interface updated%s: interface added%s: getsockoptroute socket overflowed (rcvbuflen %d) - learning interface statedrained %zu messages%s: hardware address type changed from %d to %d%s: old hardware address: %s%s: new hardware address: %s--version10.2.3--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[manager] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 10.2.3 %s Compiled in features: INET/etc/dhcpcd.confInterface options: DHCPv4 options:/var/run/dhcpcd/%s%s%spid%s: chdir: /%s: eloop_init%s: eloop_signal_masksending signal %s to pid %dwaiting for pid %d to exitsending commands to dhcpcd processsend OK%s: control_send%s: dhcpcd_readdump%s: control_opendhcpcd is not running/var/db/dhcpcd%s: mkdir: %s/var/run/dhcpcd%s: pidfile_lock: %sdhcpcd already running on pid %d (%s)dhcpcd-10.2.3 startingsocketpair%s: setsidspawned manager process on PID %d[launcher]%s: pidfile_lock %d%s: control_start%s: if_opensocketsdhcp_vendor%s: if_discover%s: interface not found%s: interface has an invalid configurationno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/libexec/dhcpcd-run-hooks/var/db/dhcpcd/duidDUID too big (max %u): %s%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware address%s: cannot write duideloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.ccb != NULL && cb_arg != NULLcallback != NULLnseconds <= NSEC_PER_SEC%s: hardware address randomised to %s%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_initinvalid CIDR: %sinvalid IP address: %s%s: no assignment: %s%s: per interface scripts are no longer supported%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sunknown option: %sfailed to convert timeout %suserclass%s: vendor options not compiled ininvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%slltptrbothdisableinvalid FQDN value: %sclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=no inet6 support for option: %sINET6 has been compiled outoption does not take an IPv4 address: %sIAID must belong in an interface blockinvalid IAID %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type: %signoring array for stringsmissing bitflag assignmenttype %s requires a variable nameno authentication supportcontrolgroup: %s: not foundstableprivatetemptemporarymudurlinvalid request time: %sinvalid fallback time: %sinvalid ipv4ll time: %soption %d requires an argument%s: embedded config too bigarpingreconfigureleasetimerebindpersistentinforminform6vsiovsio6waitipallowinterfacesnoarpnobackgroundnohooklastleasefqdnnogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyrandomise_hwaddrfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasiaidia_naia_taia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufnoconfigurearp_persistdefencerequest_timefallback_timeipv4ll_timenosyslogrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %srt != NULL&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingkeepingif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleted%s: if_initrtif_missfilterif_missfilter_applydeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'/usr/bin:/usr/sbin:/bin:/sbinPATH=%spid=%dTESTreason=%sUNKNOWNinterface=%sprotocol=%sif_configured=%sifcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%difssid=%sprofile=%sinterface_order=if_up=%sif_down=%sif_afwaiting=%daf_waiting=%dsyslog_debug=truenew_DUMP%s: executing: %s %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex uri rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%sdhcp6_nd_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudst != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.csrc != NULL%s: SO_RERROR%s: SO_USELOOPBACK%s: socket(PF_LINK)ifadata != NULL%s: SIOCGIFALIASepairfwefwiptapvetherxvif/dev/bpf/dev/bpf%dBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %s%s: if_getmtu%s: interface mtu is too small (%d<%zu)Duplicate address detected%s: DHCP message too big%s not foundbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.c%s: using ClientID %s%s: using hwaddr %sreading standard input%s: reading lease: %s%s: %s: truncated leaseNAK:%s: %s %s %s %s%s: %s %s %s %s %s%s: %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_mask=%s%s_subnet_cidr=%d%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease: %sdhcp_writefile: %s%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: failed to request the lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test modeia != NULL%s: DAD detected %s%s: waiting for DAD on %s%s: timed out contacting a DHCP server, using last lease%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: DHCP lease expired, extending lease%s: DHCP lease expired%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sIPv6-Only Preferred received (%u seconds)no address offeredreject invalid addressdeclined duplicate addressignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: blacklisted DHCP packet from %s%s: non whitelisted DHCP packet from %s%s: packet exceeded frame length (%zu) from %s%s: redirecting DHCP message to %s%s: %s: short frame header %zu%s: checksum failure from %s%s: truncated packet (%zu) from %s%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/etc/group/etc/master.passwd: (malloc) Error in munmap(): JPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperA value for the PATH environment variable that finds all the standard utilitiesUnknown error numberUnknown signal number[:<:]][:>:]]NULSOHSTXETXEOTENQalertBSHTVTvertical-tabFFform-feedcarriage-returnSODC1DC2DC3DC4SYNETBCANSUBIS4IS3IS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoptwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDELshut up gccSuccessYP FAKE error %d /KS @0{ \5lT8X>AMRtLELlKlH < OU: D[4La#G 08g=G ?\ dDrKS{V,0 l]ddG dddAe8e`eƲ`e< xx]= TLx n0@{0@ѲвI<1(ٲ)$ `) rTT`   | E  j lֱ$// //////////"'+16!**33 $(*,. pushdnepopdnex;<n,wj`@@s*w@@}܅  @@ L@@unblock and -DNO_CONV? `<##0X|llll%,l2llllll8lllllllllll l"(/ll5ll;100 0prtstatTTT(IT@TTTI(1TITTT1vHY|#Gp(f#>|UjUsage: %s [-] [-ESsx] [-p string] [name] 49;9?ACEG9?@NI$2Vkks{PATH=G   6:> vtjPED[[[[>0>&*->>>7;W[_cccc $/:EN%% &{ qk {x2dpK<]& U\ @E 7 0  H Ln#2UR R  "!q3 UG                  4s' mo d l̯fj t_ LLD z T-J|! ?td<L<q x& <q#)  l{ ܜ/ ܜ3 l9 F lPPA }F I &L  &P=PLH4whT MR@e[ 2' h2hz tb 0mi ,jo VTIw $ %%%%%""%% """"""&"" $$++BBBBB99BB>IKMOQS    2.*0(, 4`h pnra$ w}S F E i zY0Z:A $Ox&V$$[H$G#b$ %mL% % &@$:S &&t8'Mwd'{ &{$oH$0D& X&o&#3#3233#I#*2 :@@AQZb @z C$CC$C< &-4V<D@@M   ai@qy   @ ====0==0=9 % /"&),FBXi|~~!!!@d @!@!@!@!@!@!@!@!@!@  @!@!@!@!@p!v!!!!" ""#E#J#KR#]QW#`#k# p#t#x#˪##########\ d "j o v }                   ! !!!(!1!#E#J#KR#]QW#`#k# p#t#x#˪##########CXCXXSXCXXKXXXXC###EP#####$p# $$ )wt##˪$f$ӘQ"###"#1#8#>#E#J#KR#]QW#`#k# p#t#x#˪##########2./147:&@)SLO,0  ,=GGGGGH5H\H H H I I >INIeIHzIIII JJ4JJJbJ~J J!f#f$J&f1f2J3f4f5J6f8J9J9J:J;K<7K=OK@^KArKBKCKDLELF,LG,LH,LJBLL_LMpLNwLOLPLQLRLSLTLULVMWM\%Ma@McJMdMeMfMgMhMiMpMqfsftfuMvfwMxN!N2N\N{NNNNNNNO;OSOpOOOOOOPP:PJPfPPPPPPPPPx#PPQ*Q9QLQWQffffaQyQQQSQQQQRR2RTRTRTRmRRSRRRR S+SFSbSjSSSSST#E#J#KR#]QW#`#k# p#t#x#˪##########returning to single-user after filesystem check readDosDirSectionreturning to single-user after filesystem check `gw*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~? wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_read a @5%@$:$%p?(%A,%@@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-՚ CLuL+lh0%KKKEKK*i4%@Әx$9K_mGG,,,",>,,V,,P, @ T h  8 T h | ,  (   ӘQ"###"#1#8#>#E#J#KR#]QW#`#k# p#t#x#˪##########pz<%@=GGGGGH5H\H H H I I >INIeIHzIIII JJ4JJJbJ~J J!f#f$J&f1f2J3f4f5J6f8J9J9J:J;K<7K=OK@^KArKBKCKDLELF,LG,LH,LJBLL_LMpLNwLOLPLQLRLSLTLULVMWM\%Ma@McJMdMeMfMgMhMiMpMqfsftfuMvfwMxN!N2N\N{NNNNNNNO;OSOpOOOOOOPP:PJPfPPPPPPPPPx#PPQ*Q9QLQWQffffaQyQQQSQQQQRR2RTRTRTRmRRSRRRR S+SFSbSjSSSSST;fK a|nQn- q+lx|nQn- q+|nQn- q+|nQn- q+ê|nQn- q+Ѫ#=rGy=iG}ժ;Mt?mWC 3KOO yD<#*=(!YbBRuoqr+:3Dh&IQ\ M}-du@Mjy֬-чHp#-чH#ZIчHG ׫IчHB IчH2IчHQL6 %?a!S'@ )Ѹ.5*1@ )ѸO#1x )ѸT_ST.qBHo6֯iozԬ|%@%backupstore_gptstore_tblѲP%@in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps*9[$+-/E[[[[[[[[setifflagssetifprefixlensetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandsetifmetricsetifmtusetifnetmaskusagestatusb printallmaindo_setifpreferencedo_setifcapsziH%yiq q q %˰4%q q %e{ %#~ %ðX%ֹ%%%vd% %%%(%(%;FQ]i u@ »0˻@Իݻt ?  @b init_current_mediasetmediamodesetmediaoptsetmediasetmediainst̽G׽̽v ׽v ̽v `@׽v media_statusmedia_constructor%ż%l%ýý%½%%1+ paddr_matchdxxL Pxx8settunnelH%8%print_link_addressessetvlansetvlanif%%q(GN^kmoqsuwy{}setifpowersavesetifssidsetifpowersavesleepsetifnwkeysetifbssidsetifchansethidessidsetapbridgesetiffragsetifrtsX%<%@%%%h * %0 p%%t%%"x %"x * %xo %%,ttTff4 ,V4invalid major numberinvalid minor numbertoo many fields for format' !ffs@MZ fo`{Nc = = @= = =  N x!4w C@O`n@= G lB < G u= Ѫ(U_-= / = jx  ZLM p@qx} bnorripbgensbextattbnojolietbnocasetransbrrcaseinsU_-= / = jx  Z< @< LM Up@= @U_-= / = jx  Zf o< @< LM = @UNc p@{`U_-= / = jx  Zp@ & 2U_-= / = jx  Z< @< LM p@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirror &)<##03CFI !U_-= / = jx  ZULM p@& xv   @#).: 2 R@)` 8 @bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv $vLM U_-= / = jx  Zp@. 2 0 #:NSao}>(IWlT{S )Pd=b0Uz%s: can't read disk label; disk type must be specified%s partition type is not `%s' WTWTbSS /+-$ ")7IKWco| -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinit  #'+3;CKSW_goy@BCFILNOSab(c3eGfYhikmnorsu@:NB:C:F:I:L:O:S:a:b:c:e:f:h:i:k:m:n:o:r:s:T:u:!@@@h  pp pp {` @ $ $1м|^t0 Non-system disk Press any key to reboot go"&FUX[lru@Ig{  "$&(*,.     @=1&)-191J1[^1a      &C]u,95/ fũ©)+S QJN!YYY!YYY!YY|Y %!%%%#   &8808Yy8QI8y6A8 888ymeq*,y"yyy8y4888882($88.%"DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARY++++,<,f,,,,,-L-t----.UPBROADCASTDEBUGLOOPBACKPOINTOPOINTUNNUMBEREDRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdef       " % ( +8/& PFPF0* XXX,,x<< vO  " "&bitmask_print'<l7<LC<M<LY<_<Lt<LY<<L<<L<<<<<L<=L==0=J=X=Lh=p=Lh==Lh==Lh==L===L==L==L>>L6>:>LV>a>Lt>{>L>>L>>L>>L>?L>*?LB?G?((m?L??L????L?L?L?Lbitmask_scanzb ;;;; !&ADGINPSV]bg9?LhLLL2hw.disknamesaaa2?\x "*.;MQag|q8hplEt9Vx'1HBHHHP ,:EMT]eit| NetBSD gzip 20260107 0000000)  " $#!%Z^\`[_]a.CH @j18RnMkkk=kkkk>ddddddd+1Y  2I'7+5 +n+ _r !Yi}>MPd{++h/J;#'++++SY+i++++++++++++++++++++++++++++++Qty ty : SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Right one half screen width (or _N positions). ESC-( LeftArrow * Left one half screen width (or _N positions). ESC-} ^RightArrow Right to last column displayed. ESC-{ ^LeftArrow Left to first column. F Forward forever; like "tail -f". ESC-F Like F but stop when search pattern is found. r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. ESC-U Clear search highlighting. &_p_a_t_t_e_r_n * Display only matching lines. --------------------------------------------------- A search pattern may begin with one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. ^S _n Search for match in _n-th parenthesized subpattern. ^W WRAP search if no match found. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_>. --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current top line with . M_<_l_e_t_t_e_r_> Mark the current bottom line with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. ESC-m_<_l_e_t_t_e_r_> Clear a mark. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. #_c_o_m_m_a_n_d Execute the shell command, expanded like a prompt. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. s _f_i_l_e Save input to a file. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D xx_c_o_l_o_r . --color=xx_c_o_l_o_r Set screen colors. -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K ........ --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n ......... --line-numbers Suppress line numbers in prompts and messages. -N ......... --LINE-NUMBERS Display line number at start of each line. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces, tabs and carriage returns. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Set horizontal scroll amount (0 = one half screen width). --exit-follow-on-close Exit F command on a pipe when writer closes pipe. --file-size Automatically determine the size of the input file. --follow-name The F command changes files if the input file is renamed. --header=[_N[,_M]] Use N lines and M columns to display file headers. --incsearch Search file as each pattern character is typed in. --intr=_C Use _C instead of ^X to interrupt a read. --line-num-width=_N Set the width of the -N line number field to _N characters. --modelines=_N Read _N lines from the input file and look for vim modelines. --mouse Enable mouse input. --no-keypad Don't send termcap keypad init/deinit strings. --no-histdups Remove duplicates from command history. --no-number-headers Don't give line numbers to header lines. --no-search-headers Don't search in header lines or columns. --no-vbell Disable the terminal's visual bell. --redraw-on-quit Redraw final screen when quitting. --rscroll=_C Set the character used to mark truncated lines. --save-marks Retain marks across invocations of less. --search-options=[EFKNRW-] Set default options for every search. --show-preproc-errors Display a message if preprocessor exits with an error status. --proc-backspace Process backspaces for bold/underline. --SPECIAL-BACKSPACE Treat backspaces as control characters. --proc-return Delete carriage returns before newline. --SPECIAL-RETURN Treat carriage returns as control characters. --proc-tab Expand tabs to spaces. --SPECIAL-TAB Treat tabs as control characters. --status-col-width=_N Set the width of the -J status column to _N characters. --status-line Highlight or color the entire line containing a mark. --use-backslash Subsequent options use backslash as escape char. --use-color Enables colored text. --wheel-lines=_N Each click of the mouse wheel moves _N lines. --wordwrap Wrap lines at spaces. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ..................... ESC-l ... Move cursor right one character. LeftArrow ...................... ESC-h ... Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w ... Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b ... Move cursor left one word. HOME ........................... ESC-0 ... Move cursor to start of line. END ............................ ESC-$ ... Move cursor to end of line. BACKSPACE ................................ Delete char to left of cursor. DELETE ......................... ESC-x ... Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE ........... Delete word to left of cursor. ctrl-DELETE .... ESC-DELETE .... ESC-X ... Delete word under cursor. ctrl-U ......... ESC (MS-DOS only) ....... Delete entire line. UpArrow ........................ ESC-k ... Retrieve previous command line. DownArrow ...................... ESC-j ... Retrieve next command line. TAB ...................................... Complete filename & cycle. SHIFT-TAB ...................... ESC-TAB Complete filename & reverse cycle. ctrl-L ................................... Complete filename, list all. 2&*.)/35;!#%'+-1]8;2"$&(*, " $ & 1!4]W$F -7=QSd+AHddddddddddddddddddddddddd dDMdVdd_qddvddddd--More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataq0    {m$ b$*-5?B5}}}}}}>}}[g}}}}}F}b}}}}}}}}}}}}}}}}K}}Ubn}}s}*}R}}}\  . ' &26: #&/)  #&- ),/ $     "2( &" / . i"0-. . , / q,/ q, / )/ ,0 :/ ,K/ S/ ,p/ {/ ,/ / ,/ ) ,/ q,/ q,/ q ,/ / ,/ 6,/ / ,0 qh,0 G ,0 / ,!0 20 ,>0 ,K0 ,\0 +/ ,e0 #E#J#KR#]QW#`#k# p#t#x#˪##########NAME=< B l= mount_disks>    "#$%      "#$%&'()*+. str_arg_substget_available_cds"-ӘQ"###"#1#8#>#E#J#KR#]QW#`#k# p#t#x#˪########## edit_fs_type_ext9 Pa g " " " T6 7 M N 1L" eH# u8# edit_and_check_label ӘQ"###"#1#8#>#E#J#KR#]QW#`#k# p#t#x#˪##########disklabel_freedisklabel_set_part_infodisklabel_write_to_diskijzt 8 < @ P ` l P t  l d H ,  t L disklabel_change_geomQ!<8W!^! %7outer_fill_part_menu_optsedit_outer_partsselect_part_schemerD----------------------------------- - --------------------/boot@//tmp/usr/var  normalize_clonesreplace_by_default " %2RAHXblv%/9#AJPV\bhck<258 7:=@C  %0VPS[^agl"'6;Cir{/=O_o %(5%;fK a|nQn- q+lx|nQn- q+|nQn- q+|nQn- q+ê|nQn- q+Ѫ#=rGy=iG}ժ;Mt?mWC 3KOO yD<#*=(!YbBRuoqr+:3Dh&IQ\ M}-du@Mjy֬-чHp#-чH#ZIчHG ׫IчHB IчH2IчHQL6 %?a!S'@ )Ѹ.5*1@ )ѸO#1x )ѸT_ST.qBHo6֯iozP ^ ^ ^ P{N ^ k#A^ sNS^ ^ ^ _ _ mbr_get_generic_part_typembr_init_default_alignmentsmbr_create_newQ!_!|_!l<,0Dxh< \D` $@|tT|mbr_get_part_devicembr_read_from_diskwrite_mbrmbr_write_to_diskinside_ext_partadjust_ext_partmbr_add_partmbr_free!***************************************************************************************************************************************************************************************************************************************q8hj/ k|t le{ mt not pqXrt st {zto ut t ?vt wfj xt zn0yt At Bt Cm Dt Et Ft Gt Hp I˰Ju K u LSMu Nu O%u P2u Q&S2' T:u UDu VNu WXu Xbu Za 1qu 4zu 6fu it |~u }u u u u u u u u u u u u u u v / = Kr v v { /r !v )v 3v @v Jv [v Yv bv `v hv uv /`w {v v v v v s v rt v v v v v v default_configread_configrt_compare_protorr@p@prt_disposert_new0rt_setifrt_newrt_freert_headclear0rt_proto_addrt_recvrtqqrt_buildrt_delete p psa_addroffsetsa_addrlensa_is_unspecifiedsa_is_allonessa_is_loopbacksa_addrtopsa_cmpsa_toprefixsa_fromprefixsa_in_initɸR{ i Y{ c{ l{ ܰxo /w{ script_buftoenv[v u %bv J{ make_envscript_runreasonscript_runscript_status0123456789abcdefdhcp_envoptiondefine 1 request ipaddress subnet_mask define 121 rfc3442 classless_static_routes define 3 request array ipaddress routers define 6 array ipaddress domain_name_servers define 12 dname host_name define 15 array dname domain_name define 26 uint16 interface_mtu define 28 request ipaddress broadcast_address define 33 request array ipaddress static_routes define 50 ipaddress dhcp_requested_address define 51 request uint32 dhcp_lease_time define 52 byte dhcp_option_overload define 53 byte dhcp_message_type define 54 ipaddress dhcp_server_identifier define 55 array byte dhcp_parameter_request_list define 56 string dhcp_message define 57 uint16 dhcp_max_message_size define 58 request uint32 dhcp_renewal_time define 59 request uint32 dhcp_rebinding_time define 60 string vendor_class_identifier define 61 binhex dhcp_client_identifier define 80 norequest flag rapid_commit define 81 embed fqdn embed bitflags=0000NEOS flags embed byte rcode1 embed byte rcode2 embed optional domain fqdn define 119 array domain domain_search define 249 rfc3442 ms_classless_static_routes definend 1 binhex source_address definend 2 binhex target_address definend 3 index embed prefix_information embed byte length embed bitflags=LAH flags embed uint32 vltime embed uint32 pltime embed uint32 reserved embed array ip6address prefix definend 5 embed mtu embed uint16 reserved embed uint32 mtu definend 25 index embed rdnss embed uint16 reserved embed uint32 lifetime embed array ip6address servers definend 31 index embed dnssl embed uint16 reserved embed uint32 lifetime embed array domain search define6 1 binhex client_id define6 2 binhex server_id define6 3 norequest index embed ia_na embed binhex:4 iaid embed uint32 t1 embed uint32 t2 encap 5 option encap 13 option define6 4 norequest index embed ia_ta embed uint32 iaid encap 5 option encap 13 option define6 5 norequest index embed ia_addr embed ip6address ia_addr embed uint32 pltime embed uint32 vltime encap 13 option define6 7 byte preference define6 12 ip6address unicast define6 13 norequest embed status_code embed uint16 status_code embed optional string message define6 18 binhex interface_id define6 19 byte reconfigure_msg define6 20 flag reconfigure_accept define6 23 array ip6address name_servers define6 24 array domain domain_search define6 39 embed fqdn embed bitflags=00000NOS flags embed optional domain fqdn define6 82 request uint32 sol_max_rt define6 83 request uint32 inf_max_rt if_copysaif_opensockets_osv} } } } } } if_carrierif_routeif_initrtif_ifa ( PT@P HEPT$ @CDHDdhcp_openbpfget_leasedhcp_initread_leaselog_dhcpG R ^ m dhcp_boundy Ʌ   T} )  m dhcp_informdhcp_start1dhcp_handledhcpdhcp_packetdhcp_readbpfdhcp_recvmsgdhcp_readudpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifa OOOOOOO OOOO'O4O>COHOMOOOOOOOOOOOOO OOOO!O.O;@OEOJCC$C$CCCVUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\B fd f f$ f*g* ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~E &I X!`!R X!h! d  $ ** L n0 @U 6 tg"pe"lc"cs_pathX[  bc_base_maxq bc_dim_maxq bc_scale_maxq bc_string_maxq coll_weights_maxq expr_nest_max q line_maxq  re_dup_maxq  posix2_version q  posix2_c_bindq  posix2_c_devq  posix2_char_termq posix2_fort_devq posix2_fort_runq posix2_localedefq posix2_sw_devq posix2_upeq stream_maxq tzname_maxq atexit_maxqaaaaae%JaaaaaaT[ \d  $ D** L 0n0 xU 6 d B 1 A:lhd  pT$`y^v E8% E&&cmvvo !"#$',.:,      ./ , /    :.       .    .. =                                  BA9)*./%'(,-0;1234&5( < =>?$DEFHGIJC &346786@8 !"#$((((((((((($$$$$$$$$$$ &&&&&&3&&&333444444444,2/ +0-*1. )#'"%56! UO+Gc9c   +: -o %s: option not supported`]ZWTQNKHEB?<96 0-*'$!c3 d38- sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU HeNKmakech    #$@[\]^`{|}~0123456789ABCDEF0123456789abcdef'++9L.DDα;15MS7) x;l%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;#$ ! bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$    YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws rL Qj= ^.N 88Z ._v}J( g1m~j.>2s+gM$7-DZ|~iol)a&9i*+euX3":=A 'ekx9g2ch2&f4/Vv"qDBSZl\Z8K{AcZ8DVT8%, 8J5Jn3kv/ otm*<C x7Qz G"a[\/{|:rGk4%H6&!02d)e$_BJXuKI(6<S1A~Mxi{V\oh[3Y;Z] ]=)]zgUs5lKReYh#[Fm%Jb nacS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9,1nn|:pZnF$n31RLHD@;75+)++#+/'++ansi@P bG[?%[;0123456789]c [%i%d;%dR* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL}BC' G%p1%c[%p2%{1}%-%dbU(BV)BW*BX+BO [%i%p1%dd1 [%p1%dS7 [%p1%dT ![%i%p1%d;%p2%dH#'(kHvR { AXfbsfdumbP  R vt100 $P rK [%i%p1%d;%p2%drODOBOC OApf1pf2pf3pf4@BCN8T[?7l[?1l>K<>[?3;4;5l[?7;8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>2[?7h[?1h=J $<2>[?%[;0123456789]cZ [%i%d;%dR3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> 3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {E $<2>SM$<5>S`$<2>c$<2>U $<2>1N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P Ma[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfwsvt25 $ @Pgo [3~[8~[11~[12~[13~[14~[15~[7~*JcZ [4%p1%dm[ [3%p1%dm[?25l [?25h3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [21~[23~[24~[25~[26~[31~[32~[33~[34~[17~[18~[19~[20~[28~[29~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN[1~[2~[6~[5~[4~@BC[?%[;0123456789]c [%i%d;%dR bsfxterm P @1 [%p1%dS7 [%p1%dTG%p1%c[%p2%{1}%-%dbODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[3~[2~[6~[5~}'E[?69le[?69h[%i%p1%dsf[?69h[%i%p1%d;%p2%dsj[?69h[%i;%p1%ds[<Z<|OExOwyOyzOu~OqOsOM5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMS(BT[?7lY[?1l>`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B1(02[?7h;[?1h=JNO [%i%p1%dd@BC{V[?1049l5[?1049h[?%[;0123456789]c [%i%d;%dR[?25l [?12l[?25h$ [?12;25h [?1034l [?1034h0\rvs\[41;[1-6][0-9][0-9];0cxrsP>\|XTerm\([1-9][0-9]+\)\\rmxxssmxxskDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~XFffds [?1004lfes [?1004hkxINskxOUTsXMs [?1006;1000%?%p1%{1}%=%th%el%;xms%[<%i%p3%d;%p1%d;%p2%d;%?%p4%tM%em%;Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qkp5sOEkpADDsOkkpCMAsOlkpDIVsOokpDOTsOnkpMULsOjkpSUBsOmkpZROsOpka2sOxkb1sOtkb3sOvkc2sOrbsfAXfXTfmemlslmemusmE3sBDs [?2004lBEs [?2004hPEs[201~PSs[200~XRs[>0qRVs[>ca'''''''''''''''''''''''''''gm''aj'''''X'X'''dspbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon  # "  !""$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl  acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczeromb A1jbWBw|SV, bfM=`cGG#*!}p-4R]:lfx ucY4 Esm!}2mod'cru 5z  )J=]r+YLxf4(~|$>KytRFbN?Dt`Z7v Dn>t++1SyAh\3`n"m2K)4@|eH*ilOi_*IB! xPr?? ETA,JDoNfhrm-Wq^iF6e@#FMBE @}y,S}6iD&2*bK Ve\T2our(xy2{A>q`#s k<uY:2][cRe2Kn,X` %Ktr`+NbP>r`G 2)9'=tr`+NbP>r`G 2)9'= 0C0,8M(*w\m:j kP`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     @@ !1Aa  0@`M #+3;CScs inflate 1.3.1 Copyright 1995-2024 Mark Adler deflate 1.3.1 Copyright 1995-2024 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-@  풰%j}bgDшjDp~'dGMT -/60ÜZ{i1*lMNz_7ٺ^N.NrB*0Ц <,F;gevMYNЊ+՝#D۝>Wxr2=6ӭQgK!p|%c*oO|@+:{L6d }}Fz ӷ]0Ζ3VB>Y PMk&2URTv1ߞ'@5Msˎ(mɦVl* cf.:h]0䶓Uw״1+f~]~-g[/V`H )kLI5PP6QOK{ pr=۱Ԥv#MD(bn;滦q,7gI3 >u0Y}Fzjӛ,۴Qz4H- +KL6 ocT@{/[cJ׽Da m'V@ί&߲#Pxekv2Uz6[P&kA&pm Vwi<z B'e3#T: ^|n;ǔc %0u}*کFM6 @ B{{l?X]G"KϾYpۓ=tfF"E:_#sF!gнvmMx7>;P1Dw!;\h[ .`o-f.]II+vڍ×V ]j83R TmnV M ˹ wE9\*&lA&wbsP˽5kXtV h麍> ܝK>J ݝCt},g?+7}ΖC ;BR=g6*-0A|Y&צ~ Wn&m+5i$-?ĭPv&Lfp0R҅{Ϯ}X_lk%/`m[8ssfM+`eM5F$KrAː@ܤL FUPg<ЅjVH21y]![Yv(Mpl9j^`as;cg6DqK\0wO|#zuz"J^zW*Q"Z`1ܖi\tWJ V_#LEǃGai7AҸ(8 Nׯ5xc F]] 2ˈvq:b )Oq؃;Hx4 2ѲOt9q>¹k?J3')ޥZ / T}$7G2"dCr[* ۉ g3-ȂaY9eͯN^n$Mp&PćlB4&D)ROIAl'ɣ_=5kAt Uur-d~<bʟJ(HiYov@Rkb݆ר a䅼|d . QŅns yϫ-h\.7w+z% %=Yʝ |V9D֗&QbP~ӣ2M Vc췩1t4\f N>Z2`8lHhɩ":&*I#NC¯-(,F(D:9ޥk1Q&4Bգ[:E 0?k`P9A;D1åfJZEOH:lhV#Sj)]FBXȀx ogNjm`~2datxM}1rucsv^-P25ӃV?4QT|\F. >-'Z8LRH2*iZ7&Nct9,R mDYduu.e67Av$F}%gۢ,Io:auV2.=~i9}5]v 򅗉N1d}'O&)Z;BN.xr}j*V)"am v6%6ˌ*=/[nl'd'"N|v\5O:۱/h2~3=|Rݭ֙{*Ry GZusY .O KHk̍FW:8c@a_k/Q2i@'`N3Y?r}K&!C7Z ʭRo`~,BW;РGvwgJ$$/ne6Rut6>f}ZºSE_el`>3PӉ”Bd@WXǂ*|Eq@RMr tVɝH!a7"=w$l5iW*K x-8{#E0_es%Ͽ6iɥWN! Ub)ajp=+]nxy/;ߨCE|q\?pdM38ΞY\ ^T"0* yyJ(8Fkm K N6   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c_prop_string_rb_compare_key_prop_string_rb_compare_nodesprop_string_create_cstringprop_string_create_nocopyprop_string_create_formatprop_string_append_cstring_prop_number_externalize_prop_number_alloc2;85_prop_xml_intern_find_tag_prop_intern_decode_string_prop_dict_lookup_prop_dictionary_iterator_next_object_locked_prop_dictionary_free_prop_dictionary_internalize_body_prop_dictionary_iterator_next_object_prop_dict_keysym_externalize_prop_dictionary_emergency_free_prop_dict_keysym_put_prop_dict_keysym_allocprop_dictionary_set_prop_dictionary_iterator_reset_locked_prop_dictionary_externalize_prop_dictionary_get_prop_dictionary_equals_prop_dictionary_internalize_continue_prop_dictionary_remove6_prop_data_externalizeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/_prop_data_equalsprop_data_data_prop_data_internalizetruefalse_prop_bool_internalize_prop_array_iterator_next_object_locked_prop_array_equals_prop_array_free_prop_array_add_prop_array_internalize_body_prop_array_iterator_reset_locked_prop_array_externalize_prop_array_emergency_free_prop_array_iterator_next_object_prop_array_iterator_reset_prop_array_internalize_continueprop_array_getprop_array_setprop_array_removeprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_error_prop_extern_append_char_prop_extern_append_encoded_cstring_prop_extern_append_start_tag_prop_extern_append_end_tag_prop_extern_append_empty_tag _prop_stack_push_prop_stack_pop_tcsetpgrp_tcgetpgrp_tcflush_tcdrain_cfsetspeed_cfsetospeed_cfsetispeed_cfmakeraw_cfgetospeed_cfgetispeedstrmode_unsetenv_int_strtouq_l_int__strtoull_l_int__strtou_l ` F g n t__strsuftollxpermute_args_getopt_longgetopt_internalunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s_getoptatolatofmemstream_seeksetbuffersetlinebufsetbufmkdtempfwidefsetposfpurgefgetposfgetc_regerror__icheckhost__gethostlooprshrcmdrresvport_af_addrrresvportresrcmdorcmd_afrcmd_af__ivaliduser_sairuserok_saruseroklink_addr0123456789abcdef_ether_ntoa_ether_aton_ether_line %x:%x:%x:%x:%x:%x %256s _ether_ntohost_ether_hostton_MD5End0123456789abcdef_MD5File_MD5Data_SHA1End0123456789abcdef_SHA1Data_SHA1Transform_SHA1Init_SHA1Update_SHA1Final_RMD160End0123456789abcdef_RMD160Data_uname_ttyname_r_times   +(&_DB?\\\addcmd_getmodecompress_mode_sethostname_popenpopenve_pclose_initgroupskMGTPEBKMGTPEKMGTPEBkMGTPEhumanize_numbermatchcompareglobextendg_Ctocg_lstatglob3g_opendirglob2g_statglob0globtildeglobexp2globexp1_glob_globfree%%%%%%%%%%%%%%%%%%%%%%%/_getttyent_getttynam_getpassfd_getmntinfo##: _getfsspec_getfsfilefnmatchxgettype_getdiskbyname/$$$$)$$$-$+creatTLS allocation failed, terminating <Q5vf9.z4 }Q5H@5UCmm};Zx0Nm<[y1OnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_tcsetattrwcscmp_stresep_setenv_vdprintf_lsetvbuf_regfree_inet_networkCof\$u0LDD????????J^YaTO|wrmhcG unvisAEligAacuteAcircAgraveAringAtildeAumlCcedilETHEacuteEcircEgraveEumlIacuteIcircIgraveIumlNtildeOacuteOcircOgraveOslashOtildeOumlTHORNUacuteUcircUgraveUumlYacuteaacuteacircacuteaeligagraveampåatildeaumlbrvbarccedilcedilcentcopycurrendegdivideeacuteecircegraveetheumlfrac12frac14frac34gt>iacuteicirciexcligraveiquestiumllaquolt()|{}]\$!^~fts_pallocfts_sortfts_statfts_allocfts_build_fts_openfts_maxarglen_fts_close_fts_read_fts_set_fts_children_closedir  khwcschr_strcoll_l_int__strtoumax_l_opendir_initdir_alphasortinsertionsort_mergesort_rsetup_seekdir_unlocked_getdomainname @_strncasecmp_initstate_setstate?getenv_getenv_r__freeenvvar__canoverwriteenvvarauthunix_destroyauthunix_marshalmarshal_new_authauthunix_validate_authunix_create_xdr_authunix_parms_xdr_array _xdr_rejected_reply_xdr_opaque_auth_xdr_accepted_reply_xdr_des_block_xdr_replymsg_xdr_callhdr_seterr_replyacceptedrejected_strtok_ry P ip6_parsenumeric_filenoØŘstr2numberget_canonnameres_queryNres_querydomainNget_aigetanswergethostby*.getanswer: asked for "%s", got "%s"res_searchNexplore_numericget_portmatch_freeaddrinfo_getaddrinfoaddrconfigip6_str2scopeid)&_yphostent_gethtent_getservbyname_r_MD5Init_MD5Update_MD5Final @_vasprintf_l_getifaddrs"_freeifaddrsNBCDB atoi**!!**!!SPDGJM d'@Bʚ;__dn_count_labels@sJ}J@7r)E@&?ջ-$charstraddname0123456789ABCDEFGHIJKLMNOPQRSTUV=0123456789abcdefghijklmnopqrstuv__ns_sprintrrf__ns_skiprr__b64_ntopABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/__b64_pton _inet_nsap_addr_inet_nsap_ntoa__ns_format_ttl>ox54ؗҜ<3#I9=D2[%Cod(h4)$ _posix1e_acl_entry_compare_acl_differs_acl_brand_as_sl_add_sl_find  5_strsep_int_strtoul_l_int__strtoll_lfgetsrewindmap_v4v6_addressmap_v4v6_hostentgethostbyname_internal_yp_hostent_yp_gethtbyaddr_yp_gethtbynamegetanswergethostby*.getanswer: asked for "%s", got "%s"_dns_gethtbyname_dns_gethtbyaddrgethostbyname_rgethostbyaddr_rinet_pton40123456789abcdef0123456789ABCDEF_inet_ptoninet_pton6inet_ntop4_inet_ntopinet_ntop6_fseeko_fparseln__fgetstr_xdr_int_xdr_u_int_xdr_long_xdr_u_long_xdr_int32_t_xdr_u_int32_t_xdr_short_xdr_u_short_xdr_int16_t_xdr_u_int16_t_xdr_char_xdr_u_char_xdr_bool_xdr_enum_xdr_opaque_xdr_bytes_xdr_netobj_xdr_union_xdr_string_xdr_wrapstring_xdr_int64_t_xdr_u_int64_t_xdr_hyper_xdr_u_hyper_xdr_longlong_t_xdr_u_longlong_t__dn_skipname0123456789__ns_name_ntop  __ns_name_ntol__ns_name_unpack2dn_find__ns_name_pack_int_strtol_l_vsprintf_l__getdelim_nsdbtaddsrc_nsdbtdump_nsdbtput_nsdispatchbVRZ:{fkkmO=8^%02d%d%2d%02d%2d%d%2d%02d%03d%d%3d%03d%04d%d%4d%04d-00mn /usr/share/zoneinfo/Etc/UTC_strcasecmpbsearch__cxa_atexit_internal__cxa_atexit_vsnprintf_lfreadfopenferror__swbuf222222222IhII xXYIiIIIiyYY  &OOOOOOOOOe@Ce7:I\{~#Y0123456789abcdef0123456789ABCDEF__vfprintf_unlocked_l__sbprintfexponentbk]wznQ_strndup_strdup_gethostname" !#&(*-/14}?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDؗҜ<3#I9=D2[%Cod( 7yACnF?O8M20HwZm1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxq؞|6p09Y1 XhdOɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~["(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl؞]|6*)bp0ZY9Y/1 g&3gXhJd . ۤOHGA$e  a]YUQMIEiea]BJ|xtDD0*m:31HB;\\9############9ZZ99Z#########################o^_getpagesizeqsort_r__sfvwrite__sflush__swsetup,#,#__swhatbuf__smakebuf_tcgetattr_int__strtoi_l__sread__swrite__sseek__sclose_int__strtoimax_lCisalnumisalnum_lisalphaisalpha_lisblankisblank_liscntrliscntrl_lisdigitisdigit_lisgraphisgraph_lislowerislower_lisprintisprint_lispunctispunct_lisspaceisspace_lisupperisupper_lisxdigitisxdigit_ltouppertoupper_ltolowertolower_lc  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~BBBBB@(((((((((((((((          ((((((((((((((((( ((((( AAAAAABBBBBB _citrus_NONE_stdenc_mbtowc_citrus_NONE_stdenc_mbtocs# dl_iterate_phdr_setup333333333O << 0123456789ABCDEF0123456789abcdef_vsnprintf_ss_fwalk {__res_nmkquery__res_nopt__res_nopt_rdata/&_hf_gethtbyname2_hf_gethtbyname_hf_gethtbyaddrD!*07 _nsaddsrctomap ]:[=             WEEEdg          DEAE216+-.99+&%/ /E!()*!!# E;<;53210/-,+*)('&%$#"!  :::::::::::::::::::::::::::::;<<<<<<<::;<<<<<<<:<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<::   9876543210/.-,+*)('&%$#"! ::::::::::::::::::::::::clearerrF7Z77<7O__rec_dleafNEXTINDEXNEXTINDEXputpair__delpair__get_page__add_ovflpagesqueeze_key__free_ovflpageugly_split__split_page__big_insert__big_delete__big_splitN??S??E?NEXTINDEX JJQ@RRSd%'''''''' ' ( ( ( $(,(0(8(<(D(L(P(\(d(l(p(|((,'((((% |''N'`''<''' ' &&`&&& && & T~ & & & & & & '  ' ' '  ' (' 0' 8'  @'  H'  P'  T'  `'  h'  p'  x'< <@l x` Ě  ,< hT ,N L% @ X@^ h 2 ) 7 LP% 4 $^ @ \0u  T% X% Z l& 0ؘ % \% `% d% h%l% <А xp% t% x%|% %(i ,%,% h%h% %% %% %% X%X% X% XI % % % % %% %% %% % Ld1 .% % $~ % & \&  &  & & $&  (&  ,&  0& 4& <& D&L&T& \& d&l&t& x& 0|& 0&0& 0 %8%<% D% <8@8D8H8L8T8X8\8`8T8d8h8l8h8t8T8|889!P7!9:!:!:L!:$!U@`[[ [ V V V  V  V  V@AAA,A8ALA\Ax""""""4JJgntsHBPrbmntcidT t d    tJJyekdT CFFCatad+)D+loobP55X5'"'"'"'"yaral;A?9 9BICLSXStSSSSSSSSTT~ /b:jjc+ fBhNk]lmmooppLpqrLM u0 tvxwwxbHx` zzBqCJOPST+ V3 V'X6Z4Z?FU\q }  (i'dkXi'mLixi|j(hqXq8rXi`qlvLixi|= }q \/dev/rst8/dev/rst7/dev/rst5/dev/rst4/dev/rst1/dev/rst0PATH=/usr/bin:/bin:/usr/sbin:/sbinL[(}-+?=###%%%}(a(,a(aEVe(1FIxi(L?0l5m=C= nGfNTp[bbujs~q{shvVVx\c(@=%%d D pY+*N3|[;*`^f*ø4[*\t`*0[*Z*Z*SY+LZ4+2222{3 3x.qv-q v3q${3&3/qPyRY q/383t2Q3wX3b3ttG%Gy qW ... ...i({-{ < ŒqܜqW3D''ި9OW38  %= %AabCdhlNsuvW:w:z% %(%0%8% [T%% p%*4 - .* U@%*4 -4 - k %% $4%4% /\%D% F%T% P % &( % Lܰ%= % % @%%%T% 8%$(x% ?%$(% x%%%%%%%%@%%%%%%%T%%% %, v%v %˰ֲ˰ %ֲֲ Ǻ%ð _%$(%, 0% )%˰ lð%ֲ$ ֹ% ֹ$ % $ #~ % #~ $ e{ % e{   d%, T%, ý%ý, ½%$ % , b%b P 0% 9\%9 @%@  % %$ %%  % $%  P%, %, $%$ |% , xo %xo $ h %* $ "x %* "x $ %  %0 %/K550756Q55N3>K 45!5h655h65y qW  '@@U_-= / = jx  Z< @LM p@...... ...... lost+founddA.##.8 a &'-&'J+& 0 / s+ bH 0 &.++8 &q &5#~ vð& &!&"&#`w $&%&&&'&()&*&+&,&-&/&1'1 '2'3!'4*5V6%2؆&#<E ;;;;;;;< <<<. (prog_root)`{ N3UG\O\Qø\GP,QQQQQ`KQQ!! !D< (!] R!F !l { !4 Ο!- UG! R!`F 2!|I q#!3 R!P /!$D 4!F g!D !I ?!1 !4 / !7 R!F : !- R!TM #R!L )R!M fj !`F /R![ 8R!x+ t ! ) !D W+!00 bH!P( I!1 F !<. ՗!| =R!0E O! BR!4 !W FR!V LR!H@ l!7 QR!R XR!t5 F!9 `R!|( 8!@ |K!9 R!7 eR!@\ ! jR!DU !W rR!! _H!|( wR!! }R!lV ZK!7 R!J R!I Ŕ!D GR!W R!K R!7 "'!7 R!7 L!1 !/ !0 V!G sR!l MR!? S!`F R!LC y!O v !Y R!P( `H!$( R!\ R!6 R! R!P R!E E!A R!$V R!M \!l R!/ D !Z R!C 0!xT P!Y !, 8!$ R!tM !Q \G!d R!O !. !t i !D d!4[ R!|  != !t/ P!Y  !| @$!?0| Ɉ Ri QRob a d <<;qq!p% <rd: > r< t9r ; pTr< |lr, $}r2 Cr3 +r3 cr4' .r( r( r7 r7 ssD6 ?slO #/s7 ՗h., EzFP;wcRaJl sAwhLwl., !"$'(+-.03569:!,4,D4,<4,04,@4,84,44,3,3,(4,4, 4,4,4,4,$4,tip.record  /etc/phonesy+;yd$y2,y$y<yay84,yaz44,na@4, ~zaL 4,U zdy4,0 a"4,za3,x $z%*zG  a4z4,vwa 4,8zR?zIzQ&NzRa"x(4,u Xzdbz3,izdsz3,zzdcH3,z{ Awzza$4,z /bin/shqlL{ [{ dksk~kkkkkkǃkЃkۃ"k)k4k;kGkNkZkakmkukQĄτڄ߄xI { $D,4kJ]؅)0Ąaڄ}x؆%QG$!&b\& & &z  * . ` d f o 04?4sz _##)#*#######%%&&H&S&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '('('L'L'N'N'S'U'W'W'''''''++P+P+U+U+....////000>0A00001/11111112 2G2P2MNƤ`|0RTfhk`oooopՌ"22PRUUdgp;@HPQ`e -57|~>@@B=KNPgzzO :<EGp| ( ( ) ) oK_pp0J#%')-Y[ : : < < A H M M Q W b c   < < A B G H K M Q Q p q u u   < < ? ? A D M M U V b c   < < > @ F H J M U V b c  ; < A D M M b c 114:GN557799q~-0279:=>XY^`qt`]_23RSrs   "'(229;VVX^``bbels|446:<<BBks,367 ,,----*0-000ooprt} %&,,ĨŨ&-GQ).1256CCLL|| /vz      8 : ? ?   $ ' FP8Fppst'+-4ss/14467>>AA;<@@flpt8?BDFF^^3:==?@"%'+/79:;<>>CC 38;>GGQVY[068=??16::<=?EGG6:@@BB@4@4G4U4jj0k6kOoOooooo-0Fgi{BD6;luu!#$&*06DJ4,&4,&4,&H,&H,&H,&p,&4,&""H,&p,&p,&p,& e j    ky ( JKYdu@[<D f    bv z!w" (F2F8R r u'UFg <<p%[)]*())*{:}; * ) ; :{{}}{}(())()[[]][]#$GG9>> P30123456789.=:f/?/*?*n+n,N-N.&7mM?m>'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !#E+ Hh VqQ:q:QZZ    l h b  w  i x X       0  $  k  j [<  is a directory is not a regular file (use -f to see it)/&/& (4$AK[;gs">?*; ߞ7 Ð ̐ ڐ#28   ,(4>J!V_9q{՗&+:f)5e:‘%ʑԑ6Sݑ4Ґ +,-&.9*FO?_Ef/r/'F* ʏ Bz؏ +:f_$.b   )WmkRkRkYcWbkCkc kG ky wb YMYrWca(@&\s,}b @&@ s,w B@&$s,#Hc@&Xs,sd@&@s,ś@&ALs,D@&( x 'e?&Hs,4Nbf?&s,F?&Ds,g?&xr,#Nh?&4s,i?&,s,w ܝj?&p *J?&!r,7Uk?&Hs ?&Ht K?&r,mL?&r,Ξm?&Ts,n?&"(s, $5o?&Po UO?&xp `px?&Hu Pp?&v 5q`?&ds,krX?&"s,ӟ*sP?&!&{ ~~>&!r,?>&p} #>&r ɢܢ>&As,>&r,0>&r,Rt>&r,£>&(| >&r,/>&r,} Sf>&r,} ɤ>&r, >&$r,} &:>&$r,@~ Xn>&r,x>&!r,ѥp>&!r,~ ۥh>&!r, @`>&(< mX>&!r,|P>&r,ǦH>&r,@>&< /8>&r,@g(>&`s,0>&r,ܧ >&~ >&!s,2>&r,Gv>&r,Ш>&r,;Q=&|r,b۩%:IXj+|ƪѪݪ ՗#)x0@H*Vh*qh?& ƫӫ߫+7GUUhեdetot, (press RETURN)H!H!:I!h@&h@&t@&tags643{}abcdDgGhHilnNpPqrs tw xy !:#=L,(,-e^H-i^C-k^UK,X&W&4 \W&0F % W&qV&$ qV&|F q V&$ (V&% }lV&\%  U& |U&( qF T&t1 > qFLT&D1 A  T& S&S&qF|S&( A qFS&1 B qFR&1 B qF\R&0 C   R&# Q&( Q&qF Q&L( < qF |P&N( = $ LP&;  P&O& J q2$\O&I/ q2$E ?E V& &  ' * ) ) 6 X5 G 0H & SE * * * l* 7 5 L* 0 t& T& N8& ]L& `& V% & $&  E 0E ܺ@E PE !`E + `+ <+ + D + + + F 8G G D , F G G jE kD (, G H D l% G % F E D % E |D l, H, F F \G XF pD p- L- ,- - , , l7 @6 , x0 4F HD 2 1 1  2 2 2 2 2 2 p2 X2 @2 % % % h% ut% 3 `3 43  3 `D  ]       3       > Z [  % 5 HuQcR = V      s  Q 6 : D \ (   * 7 ? R s s F 0Y @% 6 A b j _ n  S }  * F Z (      D   \: D P Pk ^ t T      . > T _    //) J n    c j     O  w  p  v   _ ! J s   "   3 U e {    "       " 5 B J T Y c l }      : ( 4 : A L S Z c m ~ ! ! #! *! 4! E! O! d! u! ! ! ! ! ! ! ! ! " " " (" 5" D" X" d" n" s" x" " " " " " " " s" E! # # # -# 5# I# a# r# z# # " ! # # # # # # # % $ .$ =$ N$ \$ g$ t$ $ $ $ $ $ & & ' /' 7' \' ( E) ) ) ) ) ) * * '* =* x* + .+ + + G, Y, { tz ; ; %; ); /; 2; 6; :; A A A @ 3/̳ u8 G [  G G =  H G G U H P H H 0H H %H *H 0H 108H &'?H (HH )OH *?+TH ,\H .1/ftp=K @= BXG VG G DB @D G G G G A} 6>|~ #L ?~ 7@4} QD| AWN y B\N y CaN y D { E iN y F #y G y H  y Iy qYy qx q  H 1u\ 1eT u\ }S S S S S S S S S S T T $T ]U\]4V\8l } 4D mo qqqqqqqqqC     T} JD         9 % 5 GP(M8 < @ D ) H L P T DX #\ ` =d  h !y " # $ % & 'Œ (ӌ ) * + , - - . ./ /0 1# 2' 3- 42 567 7= 8C 9L :H ;R <a =m > ? @ [\ \ ]ԍ ^ߍ ^ _ _ ` { {0 |> }J }#~^   -dd-ddTdd:dd:dd 2 2@2@2`222))))#)#)#*#*#*$*$$*$,*$0*$8*%@*%H*%-%T*%\*&d*&p*&x*'*'*'*(*(*(*)*)*)*******++++++,(+,4+,8+,@+-L+-X+-\+-d+.p+.|+.+/+/+/+6+;+;+0+0+0+1+1,< ,<,=$,=0,><,>H,?P,2X,2d,2l,3x,3,3,9,7,8,:,4,4,4,5,5- -! -" $-# 0-$ <-% H-& T-' `-( l-) x-* -. -+ -, -- -/ -0 -1 -2 -3 -4 .5  .6 .7 $.8 0.9 <.: H.; T.< `.= l.> x.? . @.!@."@.#@.$@.%@.&@.'@.)@.*@.+@/&`/'`$/,@4/-@D/.@T//@d/0@p/(`/1@/2@/3@/)`/4@/5@/6@/7@/8@09@0:@(0*`80;@H0<@X0=@h0>@x0?@0 `0!`0+`0,`0"`0#`0-`0$`1.`1/`(1%`81CH1CT1D\1Dh1Ep1E|1F1F1c1c1d1d1e*e1#1#1&1&101 22222 2(20282@2H2P2X2`2h2p2x2222222))33 3333$3(( ( (@(@x())))() 0) 8) @)@H)@\)@`)@p)@x)@)`)`)))))) )@) 4833333333TRpRRRR3333`` ```L7`UTC33 % %@TB(;<A|;@P;33.@T339㼥ͤtgQ>PNaPqk,jj6HT7qYIσ7 qR>)OqN9NL(K@K箂CAk[Sž&&&& (% 33UU33UU33UU(&dt&&dtX& ؆&dt&<&(&- aa7<22D2$x   @ 333333333333333333333333333333333333 33 33܊&33 33TO"TO"p/. 0000000000000000 .3333,3333<33@&H&P& (root)`33x%CHb"Hb"Hb"Hb"Hb"Hb"Hb"X|!%%4%%,%lc"pe"tg"xi"(&D`hH$4 48@|dd0<XService unavailableLvA*aeabi 5TE  ;ȩ7xܭoAYr+\`u(4$!!A"MP(onѽ,~y;c%וRʟ_2^Ʃ  vvDhq"a}w=[][<;IQ܊9&5w'bl ,|mO.5ry͋!Í<(b3>uZOs|8x|{V ;vU+ramdiskbin.debug.shstrtab.note.netbsd.ident.note.netbsd.pax.note.netbsd.march.text.rodata.tbss.init_array.jcr.data.rel.ro.got.data.persistent.bss.noinit.ARM.attributes.SUNW_ctf.gnu_debuglink /B"H##VP0%0~!V0%0~!$bT%T~!gX%X~!tt%̜!\y(%(!p&N"&N"HX.N"pN"+N"|Q"Q"MSGTXTS627 5032 5057 5074 5096 5099 5104 5112 5119 5127 5135 5138 5141 5144 5148 5160 5169 5182 5211 5226 5769 5803 6486 6774 7482 7538 7612 7708 7883 7906 7929 7935 7944 7966 7970 7974 7977 7980 8085 8288 8527 8968 9406 9441 9456 9468 9474 9486 9535 9555 9595 9612 9629 9644 9691 9729 9777 9859 9983 10119 10160 10198 10235 10270 10280 10329 10479 10485 10490 10494 10514 10624 10644 10650 10664 10676 10687 10724 10758 10782 10884 10921 10943 11042 11097 11155 11166 11182 11234 11402 11609 11780 11844 11896 12167 12716 13244 13675 14013 14346 14459 14474 14483 14643 14814 14964 15128 15151 15175 15190 15265 15405 15582 15737 15749 15829 15930 15976 16002 16072 16083 16092 16105 16131 16146 16162 16175 16230 16241 16256 16460 16693 16722 16737 16806 16880 16953 16983 17021 17075 17494 17520 17549 17653 17759 17944 18056 18171 18275 18962 19221 19361 19397 19567 19608 19744 19767 19804 19849 20100 20196 20250 20349 20360 20397 20434 20461 20470 20504 20511 20536 20563 20598 20612 20626 20655 20669 20686 20695 20717 20735 20752 20763 20782 20808 20826 20849 20866 20881 20896 20914 20941 20968 20990 21029 21047 21079 21307 21381 21424 21470 21617 21773 21817 22096 22123 22482 22666 22818 22999 23146 23304 23325 23373 23383 23391 23402 23413 23423 23430 23445 23457 23494 23524 23563 23616 23674 23695 23702 23721 23742 23749 23771 23793 23813 23835 23866 23903 23925 23939 23985 24014 24048 24088 24123 24151 24199 24208 24217 24222 24231 24240 24257 24261 24266 24272 24276 24314 24323 24350 24370 24393 24412 24439 24461 24493 24509 24514 24524 24547 24569 24586 24603 24616 24625 24634 24640 24667 24674 24698 24719 24743 24756 24775 24800 24823 24839 24845 24857 24887 24895 24935 24946 24957 24968 24985 25002 25016 25033 25249 25553 26001 26217 26481 26753 26805 26841 26877 26928 26945 26983 26997 27004 27021 27024 27029 27038 27050 27061 27070 27091 27133 27171 27187 27218 27243 27278 27334 27374 27395 27415 27456 27485 27533 27766 27801 28008 28027 28064 28125 28163 28202 28358 28373 28419 28467 28490 28526 28536 28546 28557 28562 28625 28673 28717 28778 28811 28912 28930 29069 29091 29214 29228 29238 29261 29366 29422 29538 29569 29574 29600 29639 29649 29692 29702 29718 29733 29751 29774 29804 29825 29851 30048 30091 30095 30101 30107 30112 30123 30137 30166 30198 30210 30257 30307 30347 30374 30390 30399 30442 30448 30456 30460 30480 30497 30509 30540 30796 30845 31421 31448 31480 31508 31560 31566 31572 31577 31598 31614 31636 31665 31806 31940 31953 32089 32091 32093 32095 32112 32125 32143 32170 32174 32180 32185 32193 32199 32239 32241 32251 32266 32283 32317 32349 32387 32416 32445 32467 32510 32536 32580 32716 32718 32798 32844 32892 32997 33099 33138 33205 33212 33273 33337 33341 33348 33470 33539 33827 33965 34106 34187 34234 34240 34263 34309 34312 34338 34381 34446 34508 34578 34646 34739 34958 34983 34987 35023 35041 35069 35111 35155 35219 35269 35345 35367 35419 35463 35502 35536 35566 35597 35622 35631 35643 35651 35662 35674 35693 35717 35766 35783 35807 35850 36172 36175 36189 36202 36214 36221 36232 36239 36246 36255 36265 36282 36298 36348 36356 36364 36374 36385 36403 36420 36441 36463 36472 36482 36509 36515 36525 36544 36560 36578 36598 36607 36618 36625 36642 36661 36682 36692 36709 36715 36731 36746 36761 36782 36804 36823 36833 36838 36843 36861 36880 36899 36905 36924 36944 36964 36982 36987 36993 37010 37026 37047 37060 37068 37088 37112 37129 37137 37148 37169 37175 37187 37209 37223 37232 37253 37271 37280 37314 37337 37364 37396 37419 37439 37450 37482 37498 37509 37522 37545 37567 38075 38105 38136 38164 38178 38379 38601 38768 38855 38872 38890 38907 38936 38983 38994 39013 39035 39114 39306 39334 39452 39474 39615 39634 Installation auf Deutschde_DE.ISO8859-15Nicht genug Speicher!JaNeinAlle(s)EinigeKein(e)kein(e)OKokAnAusunverndertLschen?installierenSets erneut installieren frAktualisierungWillkommen bei Sysinst, dem Installationsprogramm von NetBSD-11.99.5. Dieses Programm hilft Ihnen, NetBSD auf eine Festplatte zu installieren oder aber eine bereits bestehende Installation von NetBSD zu aktualisieren. In den folgenden Mens knnen Sie mit den Buchstaben (a, b, c, ...) die verschiedenen Meneintrge whlen oder durch Drcken von Strg-N/Strg-P die Markierung auf- oder abbewegen. Die Cursor- und Bildlauftasten (Seite vor/zurck) sollten ebenfalls funktionieren. Mit der Eingabetaste besttigen Sie die gegenwrtige Auswahl. Danke, dass Sie NetBSD benutzen! Sie haben sich dazu entschieden NetBSD auf Ihre Festplatte zu installieren. Dieser Vorgang verndert Informationen auf Ihrer Festplatte. Zu diesem Zeitpunkt sollten Sie sicherheitshalber eine vollstndige Datensicherung gemacht haben! Die Installation durchluft die folgenden Schritte: a) Partitionieren Ihrer Festplatte b) Erstellen eines neuen BSD Dateisystems c) Laden und Installieren der Distribution (Kernel+Basissystem) d) Grundlegendes Konfigurieren des Systems (Nachdem Sie Angaben zur Partitionierung Ihrer Festplatte gemacht haben - aber noch bevor die Festplatte verndert wird - erhalten Sie die Mglichkeit die Installation abzubrechen.) Wollen Sie fortfahren? Sie mchten das auf der Festplatte befindliche NetBSD-System aktualisieren. Zu diesem Zeitpunkt sollten Sie bereits eine vollstndige Datensicherung durchgefhrt haben! Wollen Sie NetBSD wirklich aktualisieren? (Dies ist die letzte Warnung, bevor Ihre Festplatte(n) modifiziert werden.) Im folgenden werden die NetBSD Distributionssets (Kernel + Basissystem) auf eine vorbereitete Festplatte ausgepackt. Dieser Vorgang ldt und entpackt die Sets auf eine im Vorfeld partitionierte und bootfhige Festplatte. Es werden weder Festplatten gelabelt, Bootblcke aktualisiert noch bestehende Konfigurationen gesichert. Beenden Sie jetzt und whlen Sie dann 'Installation' oder 'Aktualisierung', falls Ihre Festplatte nicht entsprechend vorbereitet ist oder Sie das System neu installieren oder aber ein bestehendes aktualisieren mchten! Wollen Sie die NetBSD-Distributionssets wirklich erneut installieren? (Dies ist die letzte Warnung, bevor die Inhalte Ihres Dateisystems berschrieben werden!) Versuch, %s zu mounten ist fehlgeschlagen. Fortfahren? Keine fr NetBSD nutzbaren Festplatten gefunden. Zurck zum Hauptmen... Es wurde nur eine Festplatte, %s, gefunden. Wahrscheinlich mchten Sie NetBSD daher darauf %s. Auf welcher Festplatte mchten Sie NetBSD %s? - wd: SATA, ATA oder IDE - sd: SCSI oder USB-Speicher - ld: NVMe (z.B. M.2-Karte), SD/MMC-Karte oder virtueller Speicher Verfgbare FestplattenVordefinierte "wedges"KpfeSektorenMountpoint (oder '-')ZylSekMBGBSie knnen die Gre der NetBSD-Partitionen neu definieren oder aber die Standard-Partitionen verwenden.Falls Sie die bestehenden Partitionen nicht mehr weiterverwenden mchten, knnen Sie die Gre der NetBSD-Partitionen neu definieren oder aber alle verwerfen und die Standard-Partitionsgren verwenden. Sie haben gleich die Mglichkeit, alle Details der Partitionen zu verndern. Der NetBSD-Teil Ihrer Festplatte ($0) ist $3 gro. Eine volle Installation bentigt mindestens $4 und $5 Megabyte bei Installation der X-Windows Komponenten.Wenn Sie Mega- oder Gigabytes whlen, werden effektive Partitionsgren festgesetzt, die nahe Ihrer Grenangabe liegen. Bei modernen Festplatten spielen Zylindergren keine Rolle. Bei lteren Festplatten dagegen ist es am effizientesten, sich Partitionsgren auszusuchen, die exakt ein Vielfaches der aktuellen Zylindergre ausmachen. Bei der Auswahl mit Sektoren knnen Sie die Partitionsgre exakt definieren. Whlen Sie die EinheitSie knnen jetzt die Gren der Systempartitionen verndern. Standardmig wird der gesamte Speicherplatz der Rootpartition zugeordnet. Wenn Sie mchten, knnen Sie separate Partitionen definieren, z.B. /usr (zustzliche Systemdateien), /var (Log- bzw. Protokolldateien und anderes) oder /home (Verzeichnis fr die persnlichen Dateien der Anwender). Verbleibender freier Speicherplatz wird der mit '+' markierten Partition hinzugefgt.Andere Markierungen: $0 Partition.'=' bestehende'@' externeGreDateisystemMount-Verzeichnis (leer lassen, um abzubrechen)?Gre fr %s in %s?Greneinheit (Sektoren/Zylinder/MB/GB)NetBSD-PartitionGanze FestplatteBoot-PartitionHinzufgen einer benutzerdefinierten PartitionWeiter. Freier Speicherplatz: $0 $1.Abbrechen. Nicht genug Platz, es fehlen $0 $1!Der Startwert, den Sie angegeben haben, liegt jenseits des Endes der Festplatte. Mit diesem Wert liegt das Ende der Partition jenseits des Endes der Festplatte. Die Gre Ihrer Partition wurde verringert. Diese Platte ($0) ist zu gro ($3) fr eine $2-Partitionstabelle (max. $4). Sie knnen daher nur den Anfang der Festplatte verwenden. Mchten Sie die aktuelle Partitionierungbeibehalten (nur einen Teil benutzen)lschen (alle Daten gehen verloren!)in ein anderes Schema konvertierenabbrechenNicht alle Partitionen konnten bernommen werdenNachfolgend sehen Sie Ihre $2-Partitionen fr $0. Dies ist die letzte Chance, diese zu ndern. Flags: $3(F)ormatieren$4. Gesamtgre: $5, frei: $6StartEndeTypPartitionsgren OKDie aktuellen Werte fr diese Partition werden unten angezeigt. Whlen Sie das Feld, das Sie ndern mchten:Formatieren (newfs)MountMountoptionenVerzeichnisWhlen SieUrsprngliche Werte wiederherstellenWhlen Sie den Dateisystemtyp ausAndere DateisystemtypenSpezielle Werte, die fr die Grenangaben eingegeben werden knnen: -1: bis zum Ende / Maximum $0: bis zur angegebenen PartitionGre (maximal $1 $2)Spezielle Werte, die fr den Start angegeben werden knnen: -1: Am Anfang / Minimum beginnen $0: direkt hinter der angegebenen Partition starten $1: am Anfang des angegebenen freien Bereiches startenStart ($2)Ungltiger WertBitte geben Sie Ihrer NetBSD-Festplatte einen NamenNetBSD wird nun auf die Festplatte (%s) installiert. Noch wurde nichts geschrieben. Dies ist Ihre letzte Chance, diesen Vorgang abzubrechen. Mchten Sie fortfahren? Der erste Teil der Installation ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und auf allen von Ihnen gewhlten Partitionen ein Dateisystem initialisiert und geprft. Der erste Teil des Ablaufs ist nun abgeschlossen. Sysinst hat das von Ihnen gewhlte Ziellaufwerk partitioniert und und alle gewhlten Dateisysteme auf Fehler berprft. %s konnte nicht geffnet werden, die Fehlermeldung lautet: %s. Das Gert $0 konnte nicht auf $1 gemountet werden. Das Extrahieren der ausgewhlten Sets fr NetBSD-11.99.5 ist abgeschlossen. Das System ist damit bereit, von der ausgewhlten Partition zu starten. Um die Installation zu vervollstndigen, gibt Ihnen Sysinst die Mglichkeit, eine grundlegende Konfiguration vorzunehmen. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Das System sollte von der Festplatte starten knnen. Beachten Sie die INSTALL-Anleitung, um sich ber die weitere Konfiguration zu informieren. Auch die afterboot(8) Manpage ist weiterzuempfehlen; Sie enthlt eine Liste mit Punkten, die nach dem ersten vollstndigen Start geprft werden sollten. Zumindest aber sollten Sie die /etc/rc.conf entsprechend Ihren Bedrfnissen konfigurieren. Werfen Sie einen Blick in /etc/defaults/rc.conf rein, wo Sie die Vorgaben fr diese Datei finden. Die Installation von NetBSD-11.99.5 ist jetzt abgeschlossen. Sie mssen nun die Anweisungen im INSTALL-Dokument beachten, damit Ihr System - entsprechend Ihrer Situation - neu konfiguriert werden kann. Lesen Sie (erneut) die afterboot(8) Manpage, da diese seit Ihrer letzten Aktualisierung bzw. Installation zustzliche Angaben enthalten kann. Sie sollten wenigstens rc.conf ndern; dort gilt es rc_configured=NO auf rc_configured=YES umzustellen, da das System sonst nur bis zum Single User Modus (Einbenutzermodus) startet. Das Entpacken der zustzlichen Releasesets von NetBSD-11.99.5 ist nun beendet. Sie sollten nun die Anweisungen im INSTALL-Dokument beachten, um Ihr System Ihrer Konfiguration entsprechend einzurichten. Die afterboot(8) Manpage kann ebenfalls ntzlich sein. Zumindest mssen Sie die Datei rc.conf editieren, so da die gewnschten Dienste gestartet werden. Vergessen Sie nicht, rc_configured=NO auf rc_configured=YES umzustellen. Ihre Festplatte ist nun bereit fr die Installation der Kernel- und Distributionspakete. Wie im INSTALL-Dokument beschrieben, haben Sie nun mehrere Optionen. Fr FTP oder NFS mssen Sie mit einem Netzwerk verbunden sein und Zugriff auf die entsprechenden Server haben. Insgesamt %d Pakete ausgewhlt, %d installiert. Nchstes Set: %s. Die NetBSD-Distribution ist in verschiedene Pakete (Sets) aufgeteilt. Es gibt einige grundlegende Pakete, die auf jeden Fall bentigt werden, sowie optionale. Es bleibt Ihnen berlassen, ein Basissystem (Minimale Installation) oder alle Pakete (volle Installation) zu installieren bzw. einen benutzer- definierten Satz auszuwhlen. Dies sind die Daten zum Aufbau einer $1-Verbindung. Falls der Benutzer "ftp" ist, bentigen Sie kein Passwort. E-Mail-AdresseLaufwerkGeben Sie den NFS-Server samt Verzeichnis an, auf dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten und ber NFS mountbar sein.) Geben Sie das Diskettenlaufwerk und das Transfer-Verzeichnis auf dem Zieldateisystem an. Das Installationspaket muss direkt im obersten Verzeichnis der Diskette liegen. Geben Sie das CD-Laufwerk und das entsprechende Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Kein CD Laufwerk enthlt eine CD mit den Distributions-Dateien! Geben Sie die korrekten Daten manuell ein, oder legen Sie eine CD ein und versuchen Sie es erneut. Installation abbrechenZurck zur QuellauswahlVerfgbare CDsEs wurden mehrere CDs gefunden. Bitte whlen Sie die Installations-CD aus.Die Installationsdateien wurden auf der ausgewhlten CD nicht gefunden. Bitte prfen Sie den Gertenamen und Pfad der Installationsdateien.Geben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) Geben Sie das Verzeichnis des bereits gemounteten lokalen Gerts an, in dem die Distribution zu finden ist. (Das Verzeichnis muss $0-Dateien enthalten.) DateisystemNetBSD hat keinen bekannten Netzwerkadapter gefunden. Zurck zum vorigen Men. Die folgenden Netzwerkadapter sind verfgbar: %s Hat einer davon Zugriff auf die bentigten Server?Welchen Netzwerkadapter mchten Sie benutzen?Verfgbare SchnittstellenUm das Netzwerk nutzen zu knnen, werden folgende Angaben bentigt: DNS-DomainHostnameIPv4-AdresseIPv4-Adressse des ServersIPv4-NetzmaskeIPv4-NameserverIPv4-GatewayArt der Netzwerkverbindung (fr Automatik leer lassen)WLAN-SSID?WLAN-Passwort?Nachfolgend sehen Sie die aktuellen Netzwerkeinstellungen. DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s Netzmaske: %s IPv4-Gateway: %s Sie haben die folgenden Daten gewhlt. Sind diese Daten OK? DNS-Domain: %s Hostname: %s Nameserver: %s Netzwerkadapter: %s Verbindungstyp: %s IP-Adresse: %s IP-Adresse des Servers: %s Netzmaske: %s IPv4-Gateway: %s IPv6-Autokonfiguration: %s Sind diese OK? Bitte warten Sie, whrend die Netzwerkgerte initialisiert werden. /etc/resolv.conf konnte nicht erstellt werden. Installation abgebrochen. Fehler beim Wechseln in das Verzeichnis $0: $1 Installation abgebrochen.Nach der Installation lschenDas Release-Paket $0 existiert nicht.Alle Distributionspakete wurden erfolgreich entpackt.Beim Entpacken der Distributionspakete sind Probleme aufgetreten. Ihre Installation ist daher unvollstndig. Sie haben %d Distributionssets ausgewhlt. %d davon wurden nicht gefunden und %d wegen eines Fehlers bersprungen. Von %d zu entpackenden Paketen sind %d erfolgreich und %d mit Fehler entpackt worden. Bitte prfen Sie die Bezugsquellen Ihrer Distribution und installieren Sie gegebenfalls die Pakete erneut.Installation abgebrochen.Partitionierung abgebrochen.Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Installation abgebrochen. Die Distribution konnte nicht geladen werden. Sie mssen manuell fortfahren. Aktualisierung abgebrochen. Das Entpacken der zustzlichen Pakete ist fehlgeschlagen. Sie mssen entweder manuell fortfahren oder eine andere Bezugsquelle fr die Release- Pakete angeben und es erneut versuchen. Unberwindliches Problem! Die Datei /mnt/etc/fstab konnte nicht erstellt werden. Der Vorgang wird abgebrochen. Hilfe! Die Datei /etc/fstab konnte im Ziellaufwerk %s nicht gefunden werden. Die Aktualisierung wird abgebrochen. Hilfe! Es besteht eine fehlerhafte /etc/fstab im Ziellaufwerk %s. Die Aktualisierung wird abgebrochen. Der alte X-Server %s/bin/X kann nicht als %s/bin/X.old gesichert werden, da eine Datei mit diesem Namen bereits existiert. Bitte korrigieren Sie dies, bevor Sie fortfahren. Eine Mglichkeit ist es, im Extras-Men eine Shell zu starten, wodurch Sie %s/bin/X.old berprfen knnen. Gehrt diese Datei zu einer frheren Aktualisierung, so knnen Sie diese mit rm -f %s/bin/x.old lschen und danach die Aktualisierung neu starten. Gehrt die Datei %s/bin/X.old aber zu einer aktuellen, abgebrochenen Aktualisierung, so knnen Sie die Datei %s/bin/X mit mv %s/bin/X.old %s/bin/X wieder herstellen und die unvollstndige Aktualisierung fortsetzen. %0s%0s%0s Aktualisierung wird abgebrochen.Beim Testen des Netzwerks ist ein Problem aufgetreten. Entweder Ihr Gateway oder Ihr Nameserver hat nicht auf "ping" reagiert. Mchten Sie Ihre Netzwerkkonfiguration berarbeiten? ("Nein" ermglicht Ihnen die Fortsetzung oder den Abbruch der Installation.) Mchten Sie die Installation dennoch fortsetzen? Sie knnen sich auch spter um das Netzwerk kmmern. ("Nein" bricht die Installation ab.) Erstelle Gertedateien in /dev ... Das Dateisystem auf $0 scheint kein $1-Dateisystem zu sein, die Prfung des Dateisystems (fsck) ist fehlgeschlagen (Fehler $2). Die Aktualisierung trotzdem fortsetzen? Das Zielverzeichnis %s existiert nicht. Das neu installierte root-Dateisystem scheint unvollstndig zu sein. Sind Sie sicher, dass Sie alle bentigten Sets installiert haben? Floppy Dateisystem-TypDatei konnte nicht gefunden werden. Die Diskette konnte nicht gemountet werden. Bitte legen Sie die Diskette mit der Datei "%s.%s" ein. Falls das Paket keine weiteren Disketten enthlt, whlen Sie "Paket fertig", um das Paket zu installieren. Whlen Sie "Holen abbrechen", um zur Auswahl des Installationsmediums zurckzukehren. Mchten Sie die aktuellen Netzwerkeinstellungen fr den allgemeinen Gebrauch in /etc speichern?Die folgenden Distributionspakete werden verwendet: Distributionspaket Ausgewhlt ---------------------------------- ---------- BasispaketBasispaket f?r 32-Bit-Kompatibilit?tBasispaket f?r 64-Bit-Kompatibilit?tSystemkonfiguration (/etc)CompilerGertebaum-HardwarebeschreibungenSpieleGraphics driver firmwareHandbuchseiten (man pages)Handbuchseiten (man pages) in HTMLVerschiedenesKernel-ModuleWiederherstellungs-WerkzeugeTestprogrammeTextverarbeitungX11-SetsX11 Basis und ClientsX11 KonfigurationX11 SchriftartenX11 ServerX11 ProgrammierungQuelltexte und Debug-InfoKernel-QuelltexteBasissystem-QuelltexteShare-QuelltexteGNU-QuelltexteX11-QuelltexteDebug-InformationDebug-Information (32-Bit)Debug-Information (64-Bit)X11 Debug-InformationAlle oben angezeigten Pakete auswhlenKein Paket whlenAusgewhlte Pakete installierenBeim Extrahieren der Datei %s ist ein Fehler aufgetreten. Das bedeutet, dass nicht alle Dateien korrekt extrahiert wurden und Ihr System somit nicht vollstndig sein wird. Mchten Sie mit dem Extrahieren der Pakete fortfahren?Fr eine der Partitionen muss als Mountverzeichnis '/' festgelegt werden.Die Partitionen $0 und $1 berlappen sich.Kein Bootcode fr die Rootpartition vorhandenLeider existiert fr diese Maschine kein Bootloader fr FFSv2 Dateisysteme, daher kann das Root-Dateisystem nicht im FFSv2 Format angelegt werden. Sie knnen entweder die Partitionstabelle noch einmal editieren oder aber zum Hauptmen zurckkehren. Wollen Sie die Partitionstabelle erneut editieren?Konnte Konfigurationsdatei $0 nicht ffnen.Bitte whlen Sie die fr Sie passende Zeitzone aus der folgenden Liste aus. Drcken Sie die Eingabetaste, um einen Eintrag anzuwhlen. Bettigen Sie danach die Taste 'x' gefolgt von der Eingabetaste, um das Men zu verlassen. Vorgabe: %s Ausgewhlt: %s Lokale Zeit: %s %s Zurck zum Zeitzonenmen.Das Laufwerk, das Sie ausgewhlt haben, verfgt ber eine Swappartition, die gegenwrtig auch benutzt wird. Da Sie dabei sind, dieses Laufwerk erneut zu partitionieren, wird diese Swappartition jetzt deaktiviert, weshalb eventuell Speicherprobleme auftreten knnen. Sollte solch ein Fehler auftreten, starten Sie bitte Ihr System neu und probieren es erneut.Beim Versuch, die Swappartition des Laufwerks, das Sie fr die Installation von NetBSD ausgewhlt haben, zu deaktivieren, ist ein Fehler aufgetreten. Bitte starten Sie das System neu.Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt und ist somit leer. Mchten Sie jetzt ein Rootpasswort fr das System setzen?Das Rootpasswort fr das neu installierte System wurde noch nicht gesetzt. Geben Sie es jetzt ein. Falls Sie kein Rootpasswort setzen mchten, geben Sie ein leeres Passwort ein.Sie knnen jetzt die Standardshell fr Benutzer "root" auswhlen. Die Vorgabe dafr ist /bin/sh, aber vielleicht bevorzugen Sie eine andere Shell. Fr kein Dateisystem ist '/' als Mountverzeichnis gewhlt. Sie mssen ein Dateisystem als '/' konfigurieren. Drcken Sie die Eingabetaste um fortzufahren. Flags fr slattach Whlen Sie eine an- oder abzuschaltende Option.SkriptingLogging Status: Kommando: ausfhrenfertigfehlgeschlagenabgebrochenNetBSD-11.99.5 InstallationsprogrammInstallationsprogramm beendenNetBSD auf die Festplatte installierenAktualisierung einer bestehenden NetBSD-InstallationErneute Installation oder zustzliche Pakete installierenComputer neu startenExtrasKonfigurationsmenZurck zum HauptmenZurckNetBSD-11.99.5 ExtrasAusfhren von /bin/shSetzen der ZeitzoneNetzwerkkonfigurationPartitionieren eines LaufwerksProtokollierungsfunktionen (Logging)System herunterfahrenJa oder Nein?Drcken Sie die Eingabetaste um fortzufahren.Whlen Sie Ihre InstallationAktuelle $1-Partitionen verwendenGren der NetBSD-Partitionen festlegenStandard-Partitionsgen verwendenPartitionen frei definierenAlles lschen, anders partitionieren (statt $1)GigabyteMegabyteByteZylinderSektorenMedium auswhlenFTPHTTPHTTPSNFSCD-ROM / DVD / Medium mit AbbilddateiDisketteUngemountetes DateisysytemLokales VerzeichnisWhlen Sie Ihre PaketeVolle InstallationGrundinstallation ohne X11Minimale InstallationBenutzerdefinierte Installation** versteckt **HostBasispfadBinrpaket-VerzeichnisQuelltext-VerzeichnisDateierweiterungZwischenspeicherDownload viaBenutzerPasswortProxyDistribution herunterladenWeiterMchten Sie fortfahren?Was mchten Sie tun?Versuchen Sie es erneutPaket fertigPaket berspringenPaketgruppe berspringenInstallation abbrechenHolen abbrechenGertDateisystem Auswhlen eines DNS Serversandere Automatische Konfiguration durchfhren?Root-ShellUser-ShellFarbschemaWei auf schwarzSchwarz auf weiWei auf BlauGrn auf schwarzDas Verzeichnis, in das die alten a.out-Bibliotheken gesichert werden sollten, konnte nicht erstellt werden. Bitte starten Sie die Aktualisierung erneut und stellen Sie sicher, dass alle Dateisysteme gemountet sind.Eins der Verzeichnisse /emul/aout oder /emul war ein symbolischer Link, der auf ein nicht-gemountetes Dateisystem verwies. Der Link wurde mit einer '.old' Erweiterung versehen. Sobald Ihr aktualisiertes System gestartet ist, mssen Sie das neu erstellte /emul/aout mit dem alten Verzeichnis abgleichen. Sendmail ist nicht lnger integrierter Bestandteil von NetBSD. Der Standard-MTA ist nun Postfix. Ihr System benutzt derzeit eine Konfiguration in /etc/mailer.conf, die auf das nicht mehr vorhandene Sendmail-Programm verweist. Mchten Sie /etc/mailer.conf automatisch auf eine Version fr Postfix umstellen? Falls Sie "Nein" whlen, mssen Sie anschlieend manuell /etc/mailer.conf korrigieren, um funktionierende Mailauslieferung zu gewhrleisten.Um den Netzwerkadapter %s zu benutzen, mssen Sie der Lizenz in der Datei %s zustimmen. Um den Lizenztext zu lesen, geben Sie ^Z ein, schauen den Inhalt der Datei an und kehren mit dem Befehl "fg" zu sysinst zurck.Um Binrpakete zu installieren, muss erst eine Netzwerkverbindung konfiguriert werden, ber die die Pakete heruntergeladen werden. Nach einem ersten Start in das installierte System knnen Sie mit dem Befehl 'pkgin' zustzliche Pakete installieren oder entfernen.Zur Konfiguration von pkgin muss zuerst das Repository konfiguriert werden. Welches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. rc.conf-Backup fehlgeschlagen. Trotzdem fortfahren?rc.conf-Backup nach %s gespeichert.rc.conf-Restore ist fehlgeschlagen.Lschen des alten %s-Eintrages ist fehlgeschlagen.PaketverzeichnisBestehende Installation konfigurierenKonfigurierenndernPasswort gesetztJANEINERLEDIGTAbgebrochen***LEER***Zeitzoneroot-Passwort setzenInstallation von Binrpaketen vorbereitensshd (Secure Shell daemon) aktivierenntpd aktivierenntpdate beim Starten ausfhrenMulticast DNS aktivierenxdm (X Display Manager) aktivierencgd aktivieren (kryptografische Laufwerkskonfiguration)lvm (Logical Volume Manager) aktivierenraidframe aktivierenBenutzer hinzufgenZustzliche Einstellungen konfigurieren.Konfiguration abgeschlossen.pkgin installieren und Datenbank initialisierenDas System kann nun Binrpakete mittels pkgin installieren. Um ein Paket zu installieren, fhren Sie den folgenden Befehl in einer root-Shell aus: pkgin install Weitere Informationen finden Sie in der pkgin(1)-Manpage.pkgsrc herunterladen und entpackenWelches Protokoll, welcher Host, welches Verzeichnis und welcher User/Passwort sollen zum Herunterladen von pkgsrc verwendet werden? Wenn der User auf "ftp" gesetzt wird, dann wird kein Passwort bentigt. pkgsrc-Verzeichnispkgsrc herunterladen und extrahierenNetzwerkkonfiguration fehlgeschlagen. Noch einmal versuchen?Ohne Installation von pkgsrc beenden.Installation von Binrpaketen beenden.Die Installation von pkgin ist fehlgeschlagen, evtl. weil keine Binrpakete vorhanden sind. Bitte den Pfad der Pakete berprfen und noch einmal versuchen.FehlgeschlagenMountpoint oder 'raid' oder 'cgd' oder 'lvm'?Erweiterte Partitionierung (Software-RAID, ...)Partitionen bearbeitenBereits existierende "wedges" dk(4)ENTFERNENEntfernenHinzufgenautoSie lschen alle existierenden Partitionen auf der Festplatte!Speichern Sie die nderungen vor dem Abschluss?nderungen knnen nicht gespeichert werden.Fortsetzen unmglich, da keine Root-Partition definiert ist Benutzername (maximal 8 Zeichen)Diesen Benutzer der Gruppe 'wheel' hinzufgen? So knnen Sie 'su' verwenden, um Superuser zu werden.Partition lschenDie ausgewhlte Zielpartition scheint kein gltiges Dateisystem zu enthalten. Mchten Sie ein neues erstellen (die Partition formatieren)?AuslagerungspartitionEine Auslagerungspartition (mit Namen $1) scheint bereits auf der Festplatte $0 zu existieren. Mchten Sie diese benutzen?BSD disklabeldisklabeldisklabel (nur NetBSD)Dieses Gert wurde anscheinend noch nicht partitioniert. Bitte whlen Sie ein Partitionierungsverfahren.Bitte whlen Sie ein anderes Partitionierungsverfahren.Einige Verfahren knnen nur den Anfang einer groen Festplatte verwalten, die Grenbegrenzung ist unten angegeben.Dieses Gert ($0) ist $1 gro.Max:Neue Partition hinzufgen (noch keine Partition definiert)UnbekanntUngltiger Dateisystem-Typcode (0 bis 255)AbbrechenUngltiger WertUngltige GUIDErneut bearbeitenInstallation abbrechenDateisystem-Typcode (bis 255)Zu viele Partitionen$0 ist bereits vorhanden!Diese Partition besteht bereits. Um die Gre zu ndern, mssen Sie die Partition lschen und spter neu erstellen. Alle vorhandenen Daten gehen dabei verloren! Mchten Sie die Partition lschen?Diese Partition kann nicht gelscht werdenTypStartGreEndeBlockgreFragmentgreDurchschnittliche Dateigre$0 Bytes (zur Inode-Bestimmung)4 FragmenteWhlen Sie die Blockgre des Dateisystems ausWhlen Sie die Fragmentgre des Dateisystems ausDurchschnittliche Dateigre (in Bytes)Kein freier Speicherplatz.Ungltige Zahl!Zu gro!Speicherplatz bei $0..$1 $3 (Gre $2 $3) FFSv2FFSv2eaFFSEFI SystempartitionLinux Ext2 (alt)Anderer TypNamen der Festplatte festlegenDer Name der Festplatte kann frei definiert werden. Er dient der Unterscheidung verschiedener Festplatten durch den Anwender. Er wird aber auch benutzt, wenn automatisch dk(4) "wedges" fr Partitionen dieser Platte erzeugt werden. Geben Sie den Namen einWollen Sie die $1-Partitionen erneut bearbeiten?NetBSD wird auf die Festplatte $0 installiert. NetBSD bentigt eine eigene Partition im $1. Diese Partition wird spter durch das $2 weiter aufgeteilt. NetBSD kann auch auf Dateisysteme in anderen $3-Partitionen zugreifen. 'Die ganze Festplatte nutzen' lscht alle vorhandenen $3-Partitionen. Um auch andere Betriebssysteme zu nutzen, erstellen Sie eine $3-Partition. Etwa $5 reichen fr eine Basisinstallation, aber Sie sollten zustzlichen Platz fr Erweiterungen und Benutzerdateien einrechnen. Reservieren Sie mindestens $6, wenn Sie NetBSD selbst compilieren mchten.Wie mchten Sie verfahren?$1-Partitionstabelle bearbeitenDie ganze Festplatte nutzen Gesamtkapazitt von $0: $1 - noch verfgbar: $2StartGreFlagPartitionstabelle OKNicht verndernAnderer PartitionstypKeine NetBSD-Partition im $1Es befinden sich mehrere NetBSD-Partitionen im $1. Sie sollten das Flag 'hier installieren' auf die Partition setzen, die Sie nutzen wollen.Ihre Festplatte verfgt gegenwrtig ber eine Nicht-NetBSD-Partition. Mchten Sie diese Partition wirklich mit NetBSD berschreiben? Partition OKHier sehen Sie die aktuellen $2-Partitionen auf $0. Flag: hier (I)nstallieren$3. Whlen Sie die Partition, die Sie verndern mchten: IFC, (C) fr KlonenInstallation(I)nstalllieren, Guid Partition Table (GPT)GPTLabelUUIDGPT-TypStartDiese Partitionierung dennoch verwendenS, (S)tart(Sonstige: $0)aktuelles SystemExterne Partition(en) duplizierenWhlen Sie eine Quellpartition:Zur Zeit ausgwhlte Quellpartitionen:Auch die Inhalte duplizierenWeitere Partition hinzufgenAls letzte hinzufgenEinfgen der duplizierten Partitionen vor:duplizierte Partition(en)Quellauswahl OK, weiter mit der ZielauswahlIhr Netzwerk scheint bereits zu funktionieren. Mchten Sie die Konfiguration berspringen und die bisherigen Einstellungen verwenden? Wenn Sie von einer Diskette gebootet haben, knnen Sie diese jetzt entfernen. Kann den Bootblock des Filecores nicht lesen Kann die RISCiX Partitionstabelle nicht lesen Keine NetBSD Partition in der RISCiX Partitionstabelle gefunden - erstellen eines Labels nicht mglich. Keine NetBSD Partition gefunden (eine Nur-Filecore Platte?) - erstellen eines Labels nicht mglich. Installiere die Bootblcke auf %s ... Dies sind die NetBSD Partitionen auf %s (Gre und Offset in %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypOrdnerSie haben keine Partition als aktive Startpartition markiert. Das System wird nicht von dieser Festplatte starten knnen. Soll die NetBSD-Partition der Festplatte als aktiv markiert werden? Geben Sie die Geometrie der Festplatte ein. Bitte geben Sie die Anzahl Sektoren je Spur (maximal 63) und die Anzahl der Kpfe (maximal 256) an, die das BIOS dazu verwendet, auf die Festplatte zuzugreifen. Die Zahl der Zylinder wird dann automatisch aus der Festplattengre berechnet. Sysinst konnte die BIOS-Geometrie der Festplatte nicht ermitteln. Die physische Geometrie betrgt %d Zylinder, %d Sektoren und %d Kpfe. Den auf der Festplatte befindlichen Informationen zufolge betrgt die BIOS- Geometrie schtzungsweise %d Zylinder, %d Sektoren und %d Kpfe Reale Geometrie: %d Zyl, %d Kpfe, %d Sektoren (rein informativ; zum Vergleich) BIOS-Geometrie: %d Zyl, %d Kpfe, %d Sektoren AktivPartitionstyp (0..255)Es ist nur eine erweiterte Partition mglich.as, (A)ktive Startpartition$0: schreibe die $2 Partitionstabelle ... Schreiben des MBR fehlgeschlagen. Sysinst kann nicht fortfahren.Die Partition muss innerhalb der Extended Partition beginnen.Die Extended Partition muss alle darin enthaltenen Partition umfassenDie Extended Partition kann nur gelscht werden, wenn sie leer ist!Die partition liegt nicht in der Extended Partition und im primren Bootblock ist kein PlatzKein Platz im primren Bootblock. Sie knnen eine Partition entfernen und eine Extended Partition fr den restlichen freien Platz erstellen, dann die gelschte Partition wieder innerhalb der Extended Partition einfgenMaster Boot Record (MBR)MBRUngltiger Partitionstyp (0 .. 255)Fllen mit NullenFllen mit zuflligen Daten0 - Keine Paritt, nur einfache Striping.1 - Mirroring. Die Paritt ist der Spiegel.4 - Striping mit Paritt auf die letzte Komponente gespeichert.5 - Striping mit Paritt an den alle Komponenten.Das Gert ist gespert. Wollen Sie es zwangsweise entsperren und fortsetzen?Wollen Sie probieren?Erstellen eines kryptographische Datentrgers (CGD)Erstellen eines virtuelle Disk-Images (VND)Erstellen einer Volume-Gruppe (LVM VG)Erstellen eines logischen VolumesErstellen eines Software-RAIDAktualisieren der Gerte-ListeSpeichern der nderungenGESPERRTUNVERNDERTBENUTZT(montiert)(unbenutzt)Festplatte mit GPTPartitionierung beendenGrenze fr die Anzahl der Gerte erreicht wurde!Ungltige Gert!Verfgbare Festplatten:Kann nicht zugewiesen werden Gerteknoten!Partitions-Manager. Alle Festplatten, Partitionen usw. sind unten aufgefhrt. Um RAID, LVM oder CGD zu verwenden: 1) Erstellen der Partitionen mit dem jeweiligen Typ; 2) Erstellen des RAID / LVM VG / CGD mit diesen Partitionen; 3) Speichern; 4) Erstellen der Partitionen fr das RAID / CGD oder Logical Volumes fr LVM.on$0 (Ebene $1)LEERES RAID!FestplattenErsatzRAID EbenenumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMehrdimensionale Arrays werden nicht untersttzt!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Festplatten im RAID:Pfad nicht definiert!ZUWEISENDateipfadNeue Image-Datei erstellenGreNur lesenManuelle GeometrieByte pro SektorSektoren pro SpurSpuren pro ZylinderZylinderDateipfad?Gre?Byte pro Sektor?Sektoren pro Spur?Spuren pro Zylinder?Zylinder?NICHT DEFINIERT!GertVerschlsselungSchlsselgreIV-AlgorithmusSchlsselgenerierungVerifikations-MethodeFestplatten im VG:LEERE VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logisches VolumenNameGreSchreibgeschtztZusammenhngendLogicalExtentsNumberMinor-NummerMirrorsMirrorLogRegionSizePersistent Minor-NummerReadAheadSectorsStripesStripeSizeNullen des ersten KBName?Gre (MB)?LogicalExtentsNumber?Minor-Nummer?Spiegel?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operation wird nicht untersttzt!Partitionen bearbeitenSwitch partitioning schemeAls RAID Komponente formatierenAls LVM-PV formatierenVerschlsseln (CGD)Safe EraseRckgngigmachen von nderungenDekonfigurierenBearbeitenForce-umountEntropie konfigurierenJetzt nicht - weiter!Dieses System verfgt momentan nicht ber genug Entropie um kryptografisch starke Zufallszahlen zu generieren. Falls Sie diese Installation produktiv verwenden mchten und z.B. ssh host keys generieren werden, empfehlen wir dringend die Entropie-Konfiguration zu vervollstndigen! Sie knnen Zufallszahlen von einem anderen Computer verwenden oder manuell zufllige Zeichen eingeben. Falls Sie einen USB-Zufallsgenerator haben, verbinden Sie diesen jetzt und whlen dann die Option "Erneut testen".Zufallsdaten manuell eingebenRohe binre Zufallsdaten ladenNetBSD-Entropie-Datei ladenErneut testenGeben Sie bitte zufllige Zeichen ein, in denen genug Entropie enthalten sein sollte, die 256 Mnzwrfen, 100 Wrfen mit einem sechsseitigen Wrfel oder 64 zuflligen hexadezimalen Zeichen entspricht.Falls Sie Daten von einem anderen System per Kopieren & Einfgen in dieses Installationsprogramm bertragen knnen, knnen Sie die Ausgabe des folgenden Befehls (auf einem System, dessen Entropie Sie vertrauen) verwenden:Sie knnen eine Zeile mit beliebiger Lnge eingeben. Wenn die Eingabe nicht mindestens 256 zufllige Bits enthlt, ist das installierte System eventuell nicht sicher.Whlen Sie, auf welche Art Sie die Zufallsdaten auf diesen Computer bertragen wollen:Download per ftpDownload per httpDownload startenVon einer NFS-Freigabe ladenVon einem lokalen Dateisystem laden (z.B. USB)Pfad/DateiZufallsdatei ladenPfad der ZufallsdateiWhlen Sie Server, Freigabe und Dateipfad, von dem die $0 geladen werden kann.Da derzeit auf diesem System nicht genug Entropie vorhanden ist, sind alle kryptographischen Operation durch Replay-Attacken angreifbar. Verwenden Sie nur lokale vertrauenswrdige Netzwerke.Binrdatei mit ZufallsdatenAuf einem System mit kryptographisch starkem Zufallszahlengenerator knnen Sie zufllige Binrdaten z.B. so erzeugen:NetBSD-Entropie-DateiAuf einem NetBSD-System mit kryptographisch starkem Zufallszahlengenerator knnen Sie einen Entropie-Schnappschuss folgendermaen erstellen:Pfad und DateinameGeben Sie das noch nicht gemountete lokale Gert und dessen entsprechendes Verzeichnis an, in dem die Zufallsdatei zu finden ist. . .. cat chgrp chmod cp dd df ed ln ls mkdir mv pax pwd rm rmdir sh stty sync . .. dhcpcd.confgroup master.passwd netconfig protocolsservicesMSGTXTS627 5032 5070 5087 5102 5105 5108 5113 5121 5129 5137 5140 5143 5152 5164 5176 5185 5194 5220 5231 5766 5793 6359 6659 7300 7347 7460 7553 7587 7606 7624 7632 7641 7666 7670 7674 7677 7680 7802 7987 8215 8735 9086 9115 9128 9141 9146 9166 9185 9206 9265 9282 9296 9318 9363 9389 9430 9508 9626 9740 9794 9823 9855 9894 9900 9933 10056 10063 10067 10075 10099 10181 10187 10194 10206 10220 10229 10262 10281 10293 10403 10465 10484 10603 10654 10706 10718 10737 10789 10993 11201 11392 11452 11501 11767 12225 12890 13312 13634 14059 14191 14223 14235 14413 14610 14771 14905 14925 14958 14972 15041 15154 15326 15461 15481 15593 15685 15708 15731 15790 15805 15826 15841 15862 15882 15907 15921 15945 15957 15975 16185 16435 16456 16472 16525 16593 16666 16703 16729 16805 17262 17288 17310 17417 17524 17725 17798 17882 17982 18477 18715 18866 18900 19035 19079 19218 19259 19304 19351 19595 19728 19790 19884 19889 19923 19957 19972 20000 20033 20040 20065 20083 20109 20116 20131 20146 20166 20206 20223 20243 20264 20286 20301 20321 20343 20358 20371 20385 20397 20409 20423 20446 20469 20487 20530 20581 20618 20803 20866 20902 20951 21042 21172 21225 21485 21532 21893 22043 22212 22352 22472 22604 22644 22691 22701 22709 22719 22727 22738 22749 22763 22788 22829 22862 22895 22930 22984 23009 23028 23050 23055 23061 23090 23107 23134 23152 23173 23195 23214 23224 23254 23280 23307 23356 23384 23411 23464 23474 23484 23490 23500 23509 23529 23533 23538 23544 23548 23583 23592 23623 23640 23667 23688 23708 23727 23753 23766 23774 23790 23821 23852 23873 23899 23912 23920 23931 23937 23961 23971 23983 24001 24012 24032 24048 24074 24096 24112 24124 24144 24170 24176 24206 24220 24234 24257 24276 24295 24313 24331 24554 24860 25278 25479 25719 25903 25981 26036 26103 26143 26166 26200 26211 26219 26242 26245 26248 26254 26265 26277 26290 26320 26364 26377 26390 26427 26441 26452 26463 26474 26491 26502 26549 26572 26621 26862 26895 27150 27171 27204 27257 27283 27310 27466 27472 27515 27535 27554 27583 27590 27597 27604 27609 27658 27696 27730 27787 27815 27860 27877 27978 27983 28060 28074 28084 28108 28231 28312 28422 28450 28455 28471 28500 28508 28549 28556 28570 28583 28591 28610 28643 28663 28683 28899 28930 28935 28942 28949 28953 28967 28979 28994 29027 29040 29095 29153 29189 29207 29225 29243 29280 29286 29294 29298 29319 29336 29347 29369 29547 29591 30293 30317 30351 30370 30415 30422 30429 30433 30457 30468 30473 30536 30657 30780 30793 30927 30929 30931 30933 30943 30952 30965 30992 30996 31002 31007 31016 31021 31048 31050 31063 31075 31090 31118 31162 31209 31225 31247 31258 31291 31311 31360 31460 31462 31527 31576 31625 31729 31827 31868 31959 31966 32027 32091 32096 32102 32211 32270 32521 32662 32789 32857 32894 32901 32928 32974 32977 32998 33043 33094 33153 33222 33269 33374 33517 33542 33546 33580 33597 33621 33673 33724 33796 33862 33960 33977 34008 34044 34078 34102 34126 34159 34179 34189 34197 34205 34215 34226 34240 34266 34314 34337 34357 34398 34697 34700 34714 34726 34733 34752 34766 34773 34780 34789 34799 34816 34832 34880 34888 34896 34906 34917 34935 34952 34971 34991 34998 35015 35032 35039 35052 35087 35104 35123 35143 35153 35169 35182 35200 35220 35241 35251 35271 35291 35304 35323 35336 35360 35383 35396 35407 35412 35419 35437 35456 35475 35483 35502 35522 35547 35565 35572 35579 35592 35601 35622 35635 35643 35663 35691 35708 35714 35725 35756 35764 35777 35799 35821 35830 35851 35869 35876 35899 35918 35945 35963 35983 35996 36011 36032 36046 36053 36067 36082 36101 36646 36679 36707 36736 36744 36781 37093 37270 37347 37364 37382 37397 37419 37469 37479 37496 37518 37577 37735 37759 37889 37914 38040 38058 Mensajes de instalacion en castellanoes_ES.ISO8859-15Out of memory!SNoTodoAlgunosNingunoningunoOKokActivadoDesactivadosin cambiosBorrar?instalarreinstalar conjuntos paraactualizarBienvenido a sysinst, la herramienta de instalacin de NetBSD-11.99.5. Esta herramienta guiada por mens est diseada para ayudarle a instalar NetBSD en un disco duro, o actualizar un sistema NetBSD existente con un trabajo mnimo. En los siguientes mens teclee la letra de referencia (a, b, c, ...) para seleccionar una opcin, o teclee CTRL+N/CTRL+P para seleccionar la opcin siguiente/anterior. Las teclas de cursor y AvPg/RePg puede que tambin funcionen. Active la seleccin actual desde el men pulsando la tecla Intro. Gracias por usar NetBSD! Ha escogido instalar NetBSD en su disco duro. Esto cambiar informacin de su disco duro. Debera haber hecho una copia de seguridad completa antes de este procedimiento! Este procedimiento realizar las siguientes operaciones: a) Particionar su disco b) Crear nuevos sistemas de ficheros BSD c) Cargar e instalar los conjuntos de distribucin d) Algunas configuraciones iniciales del sistema (Despus de introducir la informacin de las particiones pero antes de que su disco sea cambiado, tendr la oportunidad de salir del programa.) Desea continuar? Se va a actualizar NetBSD en su disco duro. Sin embargo, esto cambiar informacin de su disco duro. Debera hacer una copia de seguridad completa antes de este procedimiento! Realmente desea actualizar NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) Se va a desempaquetar los conjuntos de distribucin de NetBSD a un disco duro marcado como arrancable. Este procedimiento solamente descarga y desempaqueta los conjuntos en un disco arrancable preparticionado. No pone nombre a los discos, ni actualiza los bloques de arranque, ni guarda ninguna informacin de configuracin. (Salga y escoja `instalar' o `actualizar' si quiere esas opciones.) Ya debera haber hecho un `instalar' o `actualizar' antes de iniciar este procedimiento! Realmente quiere reinstalar los conjuntos de la distribucin NetBSD? (ste es su ltimo aviso antes de que el programa empiece a modificar sus discos.) No se ha podido montar %s. Desea continuar? No se ha podido encontrar ningn disco duro para ser usado por NetBSD. Se le volver a llevar al men original. Solamente se ha encontrado un disco, %s. Por tanto se entiende que quiere %s NetBSD en l. En cul disco quiere %s NetBSD? Discos disponiblesExisting "wedges"cabezassectorespunto de montaje (o '-')cilsecMBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Seleccionar mega/gigabytes producir tamaos de particin cercanos a su eleccin, pero alineados a los limites de los cilindros. Seleccionar sectores le permitir especificar los tamaos de manera ms precisa. En discos ZBR modernos, el tamao real del cilindro vara a lo largo del disco y no hay mucha ventaja real en el alineamiento de cilindros. En discos ms viejos, lo ms eficiente es seleccionar tamaos de particin que sean multiples exactos del tamao real del cilindro. Escoja su especificador de tamaoAhora puede cambiar los tamaos de las particiones del sistema. Por omisin se asigna todo el espacio al sistema de archivos raz, sin embargo usted podra querer separar /usr (ficheros de sistema adicionales), /var (ficheros de registro, etc) o /home (directorios de usuario). El espacio libre sobrante ser aadido a la particin marcada con +.Other markers: $0 partition.= existing@ externalSizeSistema de archivosPunto de montaje?Tamao de %s en %s?Cambiar las unidades de entrada (sectores/cilindros/MB/GB)Particin NetBSDTodo el discoParticin de arranqueAadir una particin definida por el usuarioGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!El valor del comienzo que ha especificado est mas all del final del disco. Con este valor, el final de la particin est mas all del final del disco. El tamao de la particin se ha truncado. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsSus particiones estn ahora as. sta es su ltima oportunidad para cambiarlas. Flags: $3(N)ewfs$4. Total: $5, free: $6InicioFinTipo FSTamaos de particin okLos valores actuales de la particion son. Seleccione el campo que desee cambiar:newfsmontaropc montajepunto montajeConmutarRestaurar los valores originalesSeleccione el tipootros tiposValores especiales que se pueden introducir para el valor del tamao: -1: usar hasta el final del disco $0: terminar esta particin donde empieza la particin XTamao (max $1 $2)Valores especiales que se pueden introducir para el valor del desplazamiento: -1: empezar al principio del disco $0: empezar al final de la particin anterior $1: start at the beginning of given free spaceinicio ($2)Nmero mal formadoPor favor entroduzca un nombre para el disco NetBSDBien, todo est preparado para instalar NetBSD en su disco duro (%s). Todava no se ha escrito nada. sta es su ltima oportunidad para salir del proceso antes de que se cambie nada. Desea continuar? De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y ha formateado y comprobado las nuevas particiones que ha indicado para el disco objetivo. De acuerdo, la primera parte del procedimiento ha terminado. Sysinst ha escrito una etiqueta en el disco objetivo, y comprobdo las nuevas particiones que ha indicado para el disco objetivo. No se ha podido abrir %s, el mensaje de error ha sido: %s. el montaje del dispositivo $0 en $1 ha fallado. La extraccin de los conjuntos seleccionados para NetBSD-11.99.5 ha finalizado. El sistema es ahora capaz de arrancar desde el disco duro seleccionado. Para completar la instalacin, sysinst le dar la oportunidad de configurar antes algunos aspectos esenciales. La instalacin de NetBSD-11.99.5 ha finalizado. El sistema debera arrancar desde el disco duro. Siga las instrucciones del documento INSTALL sobre la configuracin final del sistema. La pagina de manual de afterboot(8) es otra lectura recomendada; contiene una lista de cosas a comprobar despes del primer arranque completo. Como mnimo, debe editar /etc/rc.conf para que cumpla sus necesidades. Vea en /etc/defaults/rc.conf los valores predefinidos. Actualizacin a NetBSD-11.99.5 completada. Ahora tendr que seguir las instrucciones del documento INSTALL para hacer lo que necesite para conseguir tener el sistema configurado para su situacin. Recuerde (re)leer la pgina de manual de afterboot(8), ya que puede contener nuevos apartados desde su ultima actualizacin. Como mnimo, debe editar rc.conf para su entorno local y cambiar rc_configured=NO a rc_configured=YES o los reinicios se detendrn en single-user, y copie de nuevo los ficheros de contraseas (teniendo en cuenta las nuevas cuentas de sistema que se hayan podido crear para esta versin) si estuviera usando ficheros de contraseas locales. Finalizado el desempaquetamiento de conjuntos adicionales de NetBSD-11.99.5. Ahora necesitar seguir las instrucciones del documento INSTALL para tener su sistema reconfigurado para su situacin. La pgina de manual de afterboot(8) tambin puede serle de ayuda. Como mnimo, debe editar rc.conf para su entorno local, y cambiar rd_configure=NO a rc_configured=YES, o los reinicios se detendrn en modo de usuario nico. Su disco est ahora preparado para la instalacin el nucleo y los conjuntos de la distribucin. Como se apunta en las notas INSTALL, tiene diversas opciones. Para ftp o nfs, tiene que estar conectado a una red con acceso a las maquinas apropiadas. Conjuntos seleccionados: %d, procesados: %d. Siguiente conjunto: %s. La distribucin NetBSD est dividida en una coleccin de conjuntos de distribucin. Hay algunos conjuntos bsicos que son necesarios para todas las instalaciones, y otros conjuntos que no son necesarios para todas las instalaciones. Puede escoger para instalar slo los conjuntos esenciales (instalacin mnima); instalar todos ellos (Instalacin completa) o seleccionar de entre los conjuntos de distribucin opcionales. Lo siguiente son el sitio $1, directorio, usuario y contrasea que se usarn. Si usuario es ftp, no se necesita contrasea.. direccin de correo electrnicodispositivoIntroduzca el servidor nfs y el directorio del servidor donde se encuentre la distribucin. Recuerde: el directorio debe contener los archivos $0 y debe ser montable por nfs. Introduzca el dispositivo de disquete a usar y el directorio destino de la transferencia en el sistema de archivos. Los archivos del conjunto han de estar en el directorio raz de los disquetes. Introduzca el dispositivo de CDROM a usar y el directorio del CDROM donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDsMultiple CDs found, please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check device and path name.Introduzca el dispositivo local desmontado y el directorio de ese dispositivo donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. Introduzca el directorio local ya montado donde se encuentre la distribucin. Recuerde, el directorio debe contener los archivos $0. sistema de archivosNo se ha podido encontrar ninguna interfaz de red para ser usada por NetBSD. Se le devolver al men anterior. Las siguientes interfaces estn activas: %s Conecta alguna de ellas al servidor requerido?Cul interfaces usar?Interfaces disponiblesPara poder usar la red, necesita responder lo siguiente: Su dominio DNSSu nombre de mquinaSu nmero IPv4Nmero servidor IPv4Mscara de red IPv4Servidor de nombres IPv4Pasarela IPv4Tipo de medio de la redWi-Fi SSID?Wi-Fi passphrase?Ha introducido los siguientes valores. Dominio DNS: %s Nombre de mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s Mscara de red: %s Pasarela IPv4: %s Ha introducido los siguientes valores. Son correctos? Dominio DNS: %s Nombre de la mquina: %s Serv de nombres: %s Interfaz primaria: %s Tipo de medio: %s IP de la mquina: %s IP del servidor: %s Mscara de red: %s Pasarela IPv4: %s IPv6 autoconf: %s Son correctos? Espere mientras las interfaces de red se levantan. No se ha podido crear /etc/resolv.conf. Instalacin interrumpida. No se ha podido cambiar el directorio a $0: $1 Instalacin interrumpida.A eliminar despus de la instalacinEl conjunto $0 no existe.Todos los conjuntos de distribucin han sido desempaquetados correctamente.Ha habido problemas al desempaquetar los conjuntos de la distribucin. Su instalacin est incompleta. Ha seleccionado %d conjuntos de distribucin. %d conjuntos no han sido encontrados, y %d han sido omitidos despus de que ocurriera un error. De los %d que se han intentado, %d se han desempaquetado sin errores y %d con errores. Por favor, compruebe de nuevo su fuente de distribucin y considere el reinstalar los conjuntos desde el men principal.Instalacin interrumpida.Partitioning aborted.La distribucin no ha sido cargada correctamente. Necesitar proceder a mano. Instalacin interrumpida. La distribucin no ha sido correctamente cargada. Necesitar proceder a mano. Instalacin interrumpida. El desempaquetamiento de los conjuntos adicionales no ha sido satisfactorio. Necesitar proceder a mano, o escoger una fuente diferente para los conjuntos de esta distribucin y volver a intentarlo. Hay un gran problema! No se puede crear /mnt/etc/fstab. Desistiendo. Ayuda! No hay /etc/fstab del disco objetivo %s. Interrumpiendo la actualizacin. Ayuda! No se puede analizar /etc/fstab en el disco objetivo %s. Interrumpiendo la actualizacin. No se puede guardar %s/bin/X como %s/bin/X.old, porque el disco objetivo ya tiene un %s/bin/X.old. Por favor, arregle esto antes de continuar. Una manera es iniciando una shell desde el men Utilidades, y examinar el objetivo %s/bin/X y %s/bin/X.old. Si %s/bin/X.old es de una actualizacin completada, puede rm -f %s/bin/X.old y reiniciar. O si %s/bin/X.old es de una actualizacion reciente e incompleta, puede rm -f %s/bin/X y mv %s/bin/X.old a %s/bin/X. Interrumpiendo la actualizacin.Ha habido un problema configurando la red. O su pasarela o su servidor de nombres no son alcanzables por un ping. Quiere configurar la red de nuevo? (No le permite continuar de todos modos o interrumpir el proceso de instalacin.) Le gustara continuar el proceso de instalacin de todos modos, y suponer que la red est funcionando? (No interrumpe el proceso de instalacin.) Creando nodos de dispositivo ... Parece ser que $0 no es un sistema de archivos $1 o bien el fsck ha fallado. Desea montarlo de todos modos? (Cdigo de error: $2.) el directorio raz objetivo no existe %s. El nuevo sistema de archivos raz no ha pasado la comprobacin bsica. Est seguro de que ha instalado todos los conjuntos requeridos? Tipo de sistema de archivos del disqueteNo se ha encontrado el fichero en el disco. El disquete no ha sido montado correctamente. Por favor, inserte el disquete que contiene el fichero %s.%s. Si el conjunto no est en ms discos, seleccione "Conjunto finalizado" para instalarlo. Seleccione "Abortar lectura" para regresar al men de seleccin de medios de instalacin. La informacin de red que ha introducido, es la adecuada para el funcionamiento normal de esta mquina y desea instalarla en /etc? sta es la lista de conjuntos de distribucin que se usar. Conjunto de distribucin Selecc. ---------------------------------- -------- BaseBase de compatibilidad de 32 bitsBase de compatibilidad de 64 bitsSistema (/etc)Herramientas del compiladorDevicetree hardware descriptionsJuegosGraphics driver firmwarePaginas de manualPaginas de manual en HTMLVariosKernel ModulesRecovery toolsProgramas de pruebaHerramientas de procesamiento de textosConjuntos de X11X11 base y clientesConfiguracin de X11Tipos de letra de X11Servidores X11Programacin de X11Source and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsDebug symbols (32-bit)Debug symbols (64-bit)X11 debug symbolsSeleccionar todos los conjuntos anterioresNo seleccionar ninguno de los conjuntos anterioresInstalar los conjuntos seleccionadosHa habido un error al extraer el fichero %s. Esto significa que algunos ficheros no han sido extraidos correctamente y su sistema no estar completo. Continuar extrayendo conjuntos?Debe haber una sola particin marcada para ser montada en /.las particiones $0 y $1 se solapan.No hay cdigo de arranque para la particin rootSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. Puede editar la tabla de particiones a mano, o dejarlo y retornar al men principal. Editar la tabla de particiones de nuevo?No se ha podido abrir el fichero de configuracin $0Por favor, escoja de la siguiente lista la zona horaria que le convenga. Presione RETURN para seleccionar una entrada. Presione x seguido de RETURN para salir de la seleccin de la zona horaria. Predefinida: %s Seleccionada: %s Hora local: %s %s Volver a la lista principal de zonas horariasEl disco que ha seleccionado tiene una particin de intercambio (swap) que puede que est en uso actualmente si su sistema tiene poca memoria. Como se dispone a reparticionar este disco, esta particin swap ser desactivada ahora. Se advierte de que esto puede conducir a problemas de swap. Si obtuviera algun error, reinicie el sistema e intntelo de nuevo.Sysinst ha fallado en la desactivacin de la particin swap del disco que ha escogido para la instalacin. Por favor, reinicie e intntelo de nuevo.La contrasea de root del nuevo sistema instalado no ha sido asignada todava, y por tanto est vaca. Quiere establecer ahora una contrasea de root para el sistema?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Ahora puede seleccionar que shell quiere usar para el usuario root. Por omisin es /bin/sh, pero podra preferir otra. No hay un sistema de archivos raz definido. Necesitar al menos un punto de montaje con /. Presione para continuar. Introduzca los parmetros de slattach Seleccione una opcin para activar/desactivar.ScriptingLogging Estado: Orden: EjecutandoAcabado Orden fallidaOrden terminada en sealSistema de instalacin de NetBSD-11.99.5Salir del sistema de instalacinInstalar NetBSD en el disco duroActualizar NetBSD en un disco duroReinstalar conjuntos o instalar conjuntos adicionalesReiniciar la computadoraMen de utilidadesMenu de configuracinExitatrsUtilidades de NetBSD-11.99.5Ejecutar /bin/shEstablecer la zona horariaConfigurar la redParticionar un discoFunciones de registroDetener el sistemas o no?Presione intro para continuarSeleccione su instalacinUse existing $1 partitionsEstablecer los tamaos de las particiones NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigabytesMegabytesBytesCilindrosSectoresSeleccione el medioFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisqueteSistema de archivos desmontadoDirectorio LocalSeleccione su distribucinInstalacin completaInstalacin sin X11Instalacin mnimaInstalacin personalizada** oculto **MquinaDirectorio baseDirectorio de conjuntos sourceDirectorio de conjuntos binaryExtensin de archivoDirectorio a transferir aDownload viaUsuarioContraseaProxyObtener la distribucinContinuarContinuar?Qu desea hacer?ReintentarConjunto finalizadoOmitir conjuntoOmitir grupo de conjuntosAbandonar instalacinAbortar lecturaDispositivoSistema de archivos Seleccione servidor DNSotro Realizar autoconfiguracin ?Shell de rootShell de userCombinacin de coloresBlanco sobre negroNegro sobre blancoBlanco sobre azulVerde sobre negroNo se ha podido crear el directorio al que deberan moverse las bibliotecas compartidas a.out antiguas. Por favor, intente el proceso de actualizacin de nuevo y asegrese de que ha montado todos los sistemas de ficheros.El directorio /emul/aout o /emul de su sistema era un enlace simblico que apuntaba a un sistema de archivos desmontado. Se le ha dado la extension '.old'. Cuando vuelva a arrancar su sistema actualizado, puede que necesite preocuparse de fundir el directorio /emul/aout nuevamente creado con el viejo. Sendmail ya no est disponible en esta versin de NetBSD; el MTA por defecto es ahora postfix. El fichero /etc/mailer.conf an est configurado para usar el sendmail eliminado. Desea actualizar el fichero /etc/mailer.conf automticamente para que apunte a postfix? Si escoge "No" tendr que actualizar /etc/mailer.conf usted mismo para asegurarse de que los mensajes de correo electrnico se enven correctamente.Para usar la interfaz de red %s, debe de aceptar la licencia en el archivo %s. Para ver este archivo ahora, pulse ^Z, mire el contendido del archivo, y luego teclee "fg" para continuar la instalacin.Para configurar el sistema de paquetes binrios, por favor escoja el sitio de red desde el cual descargar los paquetes. Una vez el sistema arranque, puede usar 'pkgin' para instalar paquetes adicionales, o eliminar paquetes ya instalados.Las siguientes entradas representan el protocolo, la mquina, el directorio, el usuario y la contrasea que se usarn. Si el "usuario" es "ftp", entonces la contrasea es opcional. Error al intentar hacer una cpia de seguridad de rc.conf. Desea continuar?La cpia de seguridad de rc.conf se ha guardado en %s.La recuperacin de rc.conf desde su cpia de seguridad ha fallado.La eliminacin del viejo %s ha fallado.Directorio del paqueteconfigure a prior installation ofConfigurarCambiarContrasea configuradaSINOHECHOAbandonado***VACO***Zona horariaCambiar la contrasea de rootActivar la instalacin de paquetes binariosActivar sshdActivar ntpdEjecutar ntpdate durante el arranqueActivar mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigurar elementos adicionales bajo demanda.Terminar configuracinInstalar pkgin y actualizar la lista de paquetesEl sistema se ha configurado para usar pkgin para instalar paquetes binarios. Para instalar un paquete, ejecute: pkgin install desde una lnea de comandos de root. Lea la pgina de manual pkgin(1) para ms detalles.Descargar y desempaquetar pkgsrcLa instalacin de pkgsrc necesita desempaquetar un archivo descargado desde la red. Las siguientes entradas corresponden a la mquina, directorio, usuario y contrasea a usar para la conexin. Si "usuario" es "ftp", entonces la contrasea es opcional. Directorio de pkgsrcDescargar y desempaquetar pkgsrcLa configuracin de la red ha fallado. Reintentar?Salir sin instalar pkgsrcSalir sin instalar bin pkgLa instalacin de pkgin ha fallado, posiblemente porque no existen paquetes binarios. Por favor verifique el camino a los paquetes y reintntelo de nuevo.ErrorPunto de montaje o 'raid' o 'CGD' o 'lvm'?Particin extendidaEditar particionesPreconfigured "wedges" dk(4)QUITARQuitarAadirautoEsta eliminar todas las particiones en el disco!Guarde los cambios antes de terminar?Los cambios no se pueden guardar.No hay una particin raz definida, no puede continuar 8 character username to addDo you wish to add this user to group wheel?Borrar particinThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitiontipoiniciotamaofintamao bloquetamao fragtam prom archi$0 bytes (para nmero de inodos)4 fragmentosSeleccione el tamao de bloque del sistema de archivosSeleccione el tamao de fragmento del sistema de archivostamao promedio del fichero (bytes)Sin espacio libreNmero no vlido!Demasiado grande!Espacio en $0..$1 $3 (tamao $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameQuiere reeditar la tabla de particiones $1Se va a instalar NetBSD en el disco $0. NetBSD requiere una sola particin en la tabla de particiones $1 del disco, que es subsiguientemente dividida por el $2. NetBSD tambin puede acceder a sistemas de ficheros de otras particiones $3. Si selecciona 'Usar todo el disco', se sobreescribir el contenido anterior del disco, y se usar una sola particin $3 para cubrir todo el disco. Si desea instalar ms de un sistema operativo, edite la tabla de particiones $3 y cree una particin para NetBSD. Para una instalacin bsica bastan unos pocos $5, pero deber dejar espacio extra para programas adicionales y los ficheros de usuario. Proporcione al menos $6 si quiere construir el propio NetBSD.Que le gustara hacer?Editar la tabla de particiones $1Usar todo el disco Tamao total del disco $0: $1 - libre: $2InicioTamaoOpcTabla de particiones OKNo cambiarOtraNo hay ninguna particin NetBSD en la tabla de particiones $1.Hay varias particiones NetBSD en la tabla de particiones $1. Debera marcar la opcin "instalar" en la que quiera usar. Su disco tiene actualmente una particin que no es de NetBSD. Realmente quiere sobreescribir dicha particin con NetBSD? Particin OKSe muestra a continuacin la tabla de particiones $2 actual. Opcn: I => Instalar aqu$3. Seleccione la particin que desee editar: INC, (C)loneinstalar(I)nstalar, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si ha iniciado desde disquette, ahora debera retirar el disco. No se puede leer el bloque de arranque filecore No se puede leer la tabla de particiones RISCiX No se ha encontrado ninguna particin NetBSD en la tabla de particiones RISCiX - No se puede etiquetar No se ha encontrado ninguna particion NetBSD (disco solo de filecore?) - No se puede etiquetar Instalando bloques de arranque en %s... Ahora tenemos nuestras particiones NetBSD en %s como sigue (Tamao y Compensacin en %s): NcleoThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TipoMountNo ha marcado ninguna particin como activa. Esto podra provocar que su sistema no arrancase correctamente. Debe marcarse como activa la particin NetBSD del disco? Se le va a preguntar por la geometra. Por favor, introduzca el nmero de sectores por pista (mximo 63) y el nmero de cabezas (mximo 256) que usa el BIOS para acceder al disco. El nmero de cilindros se calcular a partir del tamao del disco. sysinst no ha podido determinar automticamente la geometra BIOS del disco. La geometra fsica es de %d cilindros %d sectores %d cabezas Usando la informacin ya en disco, mi mejor estimacin para la geometra de la BIOS es de %d cilindros %d sectores %d cabezas geom real: %d cil, %d cabezas, %d sec (NB: solo para comparacin) geom BIOS: %d cil, %d cabez, %d sec activaTipo de particin (0..255)Solamente puede haber una particin extendidaap, Particin (a)ctivaConfigurando la tabla de particiones $2 ... Reescritura de MBR fallida. No se puede continuar.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Llenar con cerosLlene los datos al azar0 - Sin paridad, creacin de bandas slo es simple.1 - Creacin de reflejos. La paridad es el espejo.4 - Striping con paridad almacenada en el ltimo componente. component.5 - Striping con paridad en los componentes de todos. components.El dispositivo est bloqueado. Quiere forzar a desbloquear y continuar? unblock it and continue?Quieres probar?Crear cifrado de volumen (CGD)Crear imagen de disco virtual (VND)Crear grupo de volmenes (LVM VG)Crear volmenes lgicosCrear RAID por softwareActualizar lista de dispositivosGuardar los cambiosBLOQUEADOSIN USOUTILIZA(montado)(sin usar)Disco con GPTFinalizar el particionadoLmite para el nmero de dispositivos se lleg!No vlido dispositivo!Discos disponibles:No se puede asignar nodo de dispositivo!Partition Manager. Todos los discos, particiones y etc muestra all. Si desea utilizar RAID, LVM o CGD, siga estos pasos: 1) Crear particiones con el tipo necesario; 2) Crear RAID / LVM VG / CGD el uso de estas particiones; 3) Gurdalo; 4) Crear particiones de volmenes RAID / CGD o lgico de LVM.on$0 (nivel $1)RAID VACIO!DiscosPiezas de recambioRAID de nivelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMatrices multidimensionales no son compatibles!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Los discos en RAIDCAMINO NO DEFINIDO!ASSIGNRuta del archivoCreate new imageTamaoSlo lecturaEstablecer la geometra de la manoBytes por sectorSectores por pistaPistas por cilindroCilindrosRuta de acceso?Tamao (MB)?Bytes por sector?Sectores por pista?Pistas por cilindro?CilindrosDISCO NO SE DEFINE!Dispositivo de baseEncriptacinTamao de la claveAlgoritmo IVLa generacin de clavesMtodo de verificacinDiscos en VGVACIAR VG!PV'sNombreMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNombre?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?El volumen lgicoNombreTamaoSlo lecturaContiguaLogicalExtentsNumberMenor nmeroEspejosMirrorLogRegionSizeNmero de persistente menorReadAheadSectorsRayasStripesizePuesta a cero de la primera KBNombre?Tamao (MB)?LogicalExtentsNumber?Nmero menor de edad?Espejos?MirrorLogRegionSize?ReadAheadSectors?Rayas?Operacin no admitida!Editar particionesSwitch partitioning schemeFormato como RAIDFormato como LVM PVCifrar (CGD)Borrado seguroDeshacer los cambiosDesconfigurarEditarFuerza umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located. umountSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.MSGTXTS627 5032 5068 5085 5100 5104 5108 5113 5124 5130 5136 5139 5142 5145 5149 5161 5173 5183 5213 5225 5654 5681 6257 6617 7302 7363 7441 7536 7576 7598 7616 7622 7631 7657 7661 7665 7668 7671 7793 7978 8206 8735 9153 9182 9195 9208 9215 9235 9254 9277 9320 9340 9359 9382 9426 9455 9496 9562 9674 9788 9842 9871 9903 9942 9948 9981 10059 10065 10069 10074 10115 10252 10262 10270 10289 10303 10312 10344 10385 10398 10523 10581 10600 10719 10775 10827 10838 10854 10893 11143 11315 11487 11542 11577 11826 12229 12527 12794 13155 13335 13654 13674 13687 13876 14020 14216 14350 14370 14403 14422 14523 14678 14866 15053 15073 15152 15250 15288 15311 15401 15422 15445 15464 15488 15518 15562 15595 15618 15630 15648 15916 16235 16266 16301 16365 16440 16510 16541 16571 16663 17154 17184 17201 17341 17482 17679 17798 17945 18112 18670 18966 19147 19192 19355 19409 19544 19580 19640 19690 19981 20090 20147 20244 20249 20284 20319 20334 20358 20391 20396 20421 20437 20460 20467 20484 20499 20518 20550 20554 20574 20592 20604 20617 20635 20659 20677 20696 20723 20750 20762 20783 20813 20843 20868 20901 20936 20974 21227 21296 21351 21412 21530 21689 21743 22004 22055 22431 22586 22730 22870 22978 23163 23193 23236 23246 23254 23264 23276 23297 23306 23312 23344 23384 23420 23458 23495 23543 23567 23579 23593 23601 23609 23636 23653 23682 23703 23726 23735 23754 23766 23810 23848 23875 23919 23947 23974 24027 24038 24049 24056 24066 24075 24109 24113 24118 24124 24128 24163 24173 24203 24226 24255 24277 24299 24321 24348 24360 24372 24391 24425 24458 24479 24503 24516 24528 24541 24547 24573 24583 24594 24618 24628 24648 24668 24685 24711 24735 24748 24768 24802 24809 24838 24861 24884 24900 24915 24930 24945 24959 25147 25452 25883 26074 26309 26497 26539 26589 26643 26691 26713 26754 26765 26773 26797 26801 26805 26814 26825 26836 26851 26882 26928 26941 26954 26984 26998 27010 27022 27034 27052 27075 27120 27143 27203 27455 27482 27744 27762 27789 27838 27868 27899 28031 28038 28087 28110 28134 28163 28171 28181 28189 28194 28247 28296 28336 28402 28435 28479 28502 28603 28608 28685 28699 28709 28733 28856 28937 29047 29075 29080 29096 29125 29133 29174 29182 29196 29209 29217 29236 29269 29289 29309 29525 29556 29576 29582 29589 29593 29608 29627 29653 29662 29674 29728 29786 29821 29840 29857 29869 29904 29910 29918 29922 29943 29960 29971 29996 30174 30228 30919 30938 30973 31003 31049 31055 31062 31066 31090 31106 31112 31187 31337 31456 31469 31537 31539 31541 31543 31553 31566 31583 31610 31614 31620 31625 31634 31639 31666 31668 31681 31693 31708 31736 31780 31827 31843 31865 31876 31909 31929 31978 32078 32080 32156 32211 32261 32360 32455 32503 32593 32600 32661 32725 32730 32736 32839 32891 33137 33298 33453 33524 33577 33584 33611 33661 33664 33685 33731 33786 33845 33914 33961 34066 34209 34234 34238 34272 34289 34327 34380 34420 34496 34561 34655 34676 34714 34754 34790 34814 34837 34876 34906 34913 34922 34930 34938 34952 34968 34996 35048 35065 35086 35130 35472 35476 35491 35502 35510 35529 35541 35548 35555 35564 35574 35591 35607 35661 35669 35677 35687 35698 35716 35733 35749 35767 35774 35792 35809 35816 35826 35857 35876 35895 35915 35925 35944 35957 35977 35997 36018 36028 36047 36066 36076 36093 36107 36130 36154 36167 36177 36182 36186 36204 36223 36242 36247 36266 36286 36311 36326 36330 36337 36347 36356 36377 36391 36399 36419 36445 36462 36470 36481 36512 36517 36530 36552 36567 36576 36597 36615 36624 36668 36692 36719 36734 36751 36765 36796 36820 36851 36858 36872 36887 36906 37451 37484 37512 37541 37549 37586 37898 38075 38152 38169 38187 38202 38224 38274 38284 38301 38323 38382 38540 38564 38694 38719 38845 38863 Messages d'installation en franaisfr_FR.ISO8859-15Out of memory!OuiNonTousUne partieAucunaucunOKokOnOffnon-modifiSupprimer ?installerrinstaller des composants demise jourBienvenue dans Sysinst, l'outil d'installation de NetBSD-11.99.5. Cet utilitaire a t conu pour vous aider installer ou mettre jour NetBSD sur votre disque dur avec un minimum de travail. Dans les menus suivants, vous pourrez changer de slection, soit en tapant la lettre en rfrence (a, b, c, d, ...) soit en utilisant les touches flches du clavier. La slection courante est active en appuyant sur la touche Entre. Merci d'utiliser NetBSD ! Vous avez choisi d'installer NetBSD sur votre disque dur. Ceci va changer les informations contenues sur ce dernier. Vous devriez faire une sauvegarde complte de son contenu avant de poursuivre cette installation. Cette procdure va effectuer les actions suivantes : a) Partitionner votre disque dur. b) Crer de nouveaux systmes de fichiers BSD. c) Installer les diffrents composants. (Une fois le partitionnement configur, le systme d'installation vous demandera de confirmer avant d'appliquer toute modification sur votre disque dur.) Souhaitez-vous continuer ? Mise jour de NetBSD sur votre disque dur. Cela implique des modifications aux informations contenues sur votre disque dur. Vous devriez faire une sauvegarde complte de celui-ci avant de continuer la procdure de mise jour. Voulez-vous vraiment mettre jour NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne modifie votre disque.) Les composants de NetBSD seront maintenant decompresss sur un disque dur dmarrable. Cette procdure va rapatrier et dcompresser les composants sur un disque dmarrable dj partitionnn. Elle n'inscrit pas de "label" sur le disque, n'installe pas de nouveaux secteurs d'amorage et ne modifie pas les fichiers de configuration existants. (Quittez et choisissez `installer' ou `mettre jour' si vous dsirez ces options.) Vous devriez dj avoir fait une installation ou une mise jour avant de dmarrer cette procdure ! Voulez-vous rellement rinstaller les composants NetBSD ? (Ceci est le dernier avertissement avant que cette procdure ne commence modifier vos disques.) Le montage du systme de fichiers %s a chou. Continuer ? Aucun disque utilisable par NetBSD n'a t trouv. Retour au menu prcdent. Un seul disque a t trouv : %s. Nous supposons que vous souhaitez %s NetBSD sur ce dernier. Sur quel disque voulez-vous %s NetBSD ?Disques disponibles :Existing "wedges"ttessecteurspoint de montage (ou '-')cylsecMoGoYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Si vous choisissez "Mgaoctets" ou "Gigaoctets", la taille sera le plus proche de votre choix possible, arrondi au cylindre-prs. Si vous choisissez "Secteurs", vous pourrez choisir prcisment les tailles. Sur les disques modernes, la taille relle des cylindres est variable et il y a peu d'intrt aligner les partitions sur les cylindres. Pour les disques plus anciens, il est recommand de choisir des tailles de partitions arrondies au cylindre-prs, pour plus de performance. Choisissez l'unit d'espace disque dsireVous pouvez dsormais modifier la taille des partitions systme. Par dfaut, tout l'espace sera allou la partition racine principale, mais vous pouvez sous-diviser celle-ci en plusieurs systmes de fichiers. Exemples : /usr (fichiers systme additionnels), /var (fichiers des journaux, etc.) et /home (regroupant les rpertoires utilisateurs). L'espace libre restant sera ajout la partition marque par un '+'.Other markers: $0 partition.'=' existing'@' externalTailleSystme de fichiersPoint de montage ?Taille pour %s en %s ?Changer d'unit (secteurs/cylindres/Mo/Go)Partition de NetBSDTotalit du disquePartition de dmarrageAjouter manuellement une nouvelle partitionValider. Espace libre $0 $1.Abort. Not enough space, $0 $1 missing!La valeur que vous avez spcifie dpasse les limites du disque. Avec cette valeur, la fin de la partition excde la limite du disque. La taille de la partition a t tronque. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodabortCould not convert all partitionsVos partitions sont les suivantes: Flags: $3(N)ewfs$4. Total: $5, free: $6DbutFinTypeTaille et options des partitions validesVous devez d'abord prciser le type de systme de fichiers (FS), puis les autres valeurs. Les valeurs actuelles pour la partition sont:formatagemontageoptions de montagePt de montageBasculerRestaurer les valeurs initialesSlection du type de systme de fichiersautres typesValeurs spciales pouvant tre utilises pour dfinir la taille de la partition : -1 : Utiliser jusqu' la fin du disque $0 : Terminer cette partition o la partition X dbuteTaille (max $1 $2)Valeurs spciales pouvant tre utilises pour dfinir le dbut de la partition : -1 : Commencer au dbut du disque $0 : Commencer la suite de la partition prcdente $1: start at the beginning of given free spaceDbut ($2)nombre invalideVeuillez donner un nom votre disque.Nous sommes prts installer NetBSD sur votre disque (%s). Aucune modification n'a t effectue pour l'instant. Ceci est votre dernire opportunit pour quitter cette procdure en laissant votre disque intact. Souhaitez-vous vraiment continuer ? La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). La premire partie de la procdure est termine. Sysinst a crit vos nouvelles partitions sur votre disque, puis a procd la vrification de leur intgrit (via fsck). Impossible d'ouvrir %s. Message d'erreur obtenu : %s. Le montage de $0 sur $1 a chou. L'extraction des composants slectionns de NetBSD-11.99.5 est complte. Le systme peut dsormais dmarrer directement depuis le disque. Pour complter l'installation, Sysinst va maintenant vous permettre d'effectuer quelques rglages essentiels. L'installation de NetBSD-11.99.5 est termine. L'ordinateur va redmarrer depuis le disque dur. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Nous vous recommandons au minimum de configurer le mot de passe du compte root et de paramtrer /etc/rc.conf selon vos besoins. Consultez les manuels rc.conf(5), afterboot(8) et security(7) au besoin. L'installation des composants supplmentaires de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. La mise jour de NetBSD-11.99.5 est termine. Veuillez consulter le document d'installation (INSTALL) pour apprendre bien configurer votre systme. Vous devez diter /etc/rc.conf et ajouter la ligne "RC_CONFIGURED=yes" pour redmarrer en mode multi-utilisateur. Votre disque est maintenant prt recevoir le coeur du systme et ses diffrents composants annexes. Comme indiqu dans le document d'installation, vous avez plusieurs possibilits. Pour une installation via NFS ou FTP, vous devez tre connect un rseau et avoir accs au serveur requis. Composant slectionn : %d, trait : %d. Prochain composant : %s. La distribution de NetBSD est divise en plusieurs composants. Certains sont indispensables. Trois types d'installations vous sont proposs : complte, minimale ou personnalise. Voici la configuration actuelle pour : nom du site ($1), rpertoire, nom d'utilisateur et mot de passe. Si vous utilisez le mode FTP, le mot de passe n'est pas requis. Le rpertoire contenant les composants doit tre dfini par rapport au rpertoire de base, et contenir chaque composant sous la forme de fichiers $0 adresse de courrielpriphriqueVeuillez indiquer le nom du serveur NFS ainsi que le rpertoire contenant les fichiers d'installation. Ce rpertoire doit tre export via NFS, et contenir ces fichiers sa racine mme. Veuillez spcifier le nom du lecteur de disquette utiliser. Les fichiers d'installation devront se trouver la racine de chaque disquette. Veuillez spcifier le nom du lecteur CD-ROM utiliser, ainsi que le nom du rpertoire contenant les fichiers d'installation. Ils doivent tre placs sa racine, sous la forme de fichiers tgz. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryCD-ROM disponiblesPlusieurs CD-ROM ont t trouvs. Slectionnez celui contenant le systme d'installation de NetBSD.Les archives d'installation ne peuvent tre trouves l'emplacement spcifi sur ce CD-ROM. Assurez-vous que le priphrique et le chemin sont les bons.Veuillez spcifier le nom du priphrique local (qui ne doit pas tre mont) utiliser. Ce dernier doit contenir les fichiers d'installation sa racine, sous la forme de fichiers tgz. Veuillez spcificer le nom du rpertoire local (dj mont) o se trouvent les fichiers d'installation. Ils doivent se trouver la racine du rpertoire, sous la forme de fichiers tgz. systme de fichiersAucune interface rseau utilisable n'a t trouve. Retour au menu prcdent. Les interfaces rseau suivantes sont utilisables : %s Quelle interface souhaitez-vous utiliser ? Quelle interface doit tre utilise ?Interfaces disponiblesVeuillez rpondre aux points suivants afin de pouvoir utiliser votre interface rseau : Votre nom de domaineVotre nom d'ordinateurVotre adresse IPv4Adresse IPv4 du serveurVotre masque de rseau (IPv4)Adresse IPv4 de votre serveur de noms (DNS)Adresse IPv4 de votre passerelleType de rseau (mdia)Wi-Fi SSID?Wi-Fi passphrase?Vous avez spcifi les valeurs suivantes : Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) %s Adresse IPv4 : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Vous avez spcifi les valeurs suivantes. tes-vous d'accord ? Nom de domaine (DNS) : %s Nom d'ordinateur : %s Adresse du serveur de noms : %s Interface rseau : %s Type de rseau (mdia) : %s Adresse IPv4 : %s Adresse IPv4 du serveur : %s Masque de sous-rseau : %s Adresse IPv4 de la passerelle : %s Auto-configuration IPv6 : %s Les valeurs sont-elles correctes ? Veuillez patienter pendant la configuration de l'interface... Impossible de crer le fichier /etc/resolv.conf chec de l'installation. Impossible de dplacer le rpertoire $0: $1 chec de l'installation. Effacer aprs l'installation Le composant $0 n'existe pas. Tous les composants sont installs. Veuillez appuyer sur la touche Entre pour continuer. L'installation des composants est termine. Toutefois, un ou plusieurs problmes sont survenus au cours de leur extraction. Vous avez slectionn %d composants. %d n'ont pu tre installs, et %d ont t ignors la suite d'erreurs. Sur les %d composants traits, %d ont pu tre installs et %d ont provoqu une erreur. Veuillez vrifier l'intgrit des fichiers d'installation et leur emplacement, puis essayez nouveau via une rinstallation de composants, depuis le menu principal. Annulation de l'installation.Install aborted. L'instalation des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. La mise jour des composants de NetBSD n'est pas complte. Vous allez devoir recommencer, ou terminer la main. chec de l'installation. L'installation des composants supplmentaires n'est pas complte. Vous allez devoir recommencer, ou terminer la main. Essayez de choisir une source diffrente pour les fichiers d'installation. Impossible de crer /mnt/etc/fstab Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Le fichier /etc/fstab n'est pas prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de lire le contenu du fichier /etc/fstab prsent sur le disque cible %s Ceci est une erreur majeure : nous ne pouvons continuer. chec de l'installation. Impossible de sauvegarder %s/bin/X : le disque contient dj un fichier %s/bin/X.old et nous devons renommer le fichier actuel ce nom. Veuillez supprimer ou renommer le fichier X.old avant de recommencer. Vous pouvez dmarrer un shell depuis le menu "Utilitaires" afin de faire cette modification. Ce fichier provient probablement d'une ancienne mise jour et il est possible de le supprimer. S'il provient d'une mise jour incomplte, vous pouvez effacer %s/bin/X et renommer %s/bin/X.old jusqu' %s/bin/X.%0s%0s%0s%0s%0s%0s Arrt de la mise jour. Un problme est survenu lors de la configuration de votre interface rseau. Votre serveur de noms ou votre passerelle ne semblent pas rpondre aux pings. Souhaitez-vous configurer nouveau les paramtres de votre connexion rseau ? (un refus provoquera l'arrt de la procdure d'installation) Souhaitez-vous poursuivre malgr tout le processus d'installation et supposer que le rseau fonctionne correctement ? (un refus provoquera l'arrt de la procdure d'installation) Cration des fichiers des priphriques ... $0 ne semble pas tre un systme de fichiers $1, ou la vrification de son intgrit par fsck a chou, code d'erreur $2. Souhaitez-vous continuer mise jour? Impossible de trouver la racine du disque cible %s. La vrification de l'intgrit du nouveau systme de fichiers a chou. Avez-vous bien install tous les composants indispensables ? Systme de fichiers de la disquette Impossible de trouver un fichier requis sur la disquette. Impossible de monter la disquette correctement. Veuillez insrer la disquette contenant le fichier "%s.%s". Si le jeu de disquettes ne comprend aucun autre disque, veuillez choisir "Ensemble termin" pour mettre un terme ce traitement. Slectionnez "Annuler la rcupration" pour revenir au menu de slection du mdia d'installation. Souhaitez-vous conserver les rglages rseaux aprs le redmarrage du systme que nous venons d'installer ? Slectionnez les composants dans la liste ci-dessous : Composant Installer? ------------------------------------ ---------- BaseBase pour la compatibilit? 32 bitsBase pour la compatibilit? 64 bitsSystme (/etc)Outils de dveloppementDevicetree hardware descriptionsJeuxGraphics driver firmwarePages de manuelPages de manuel (HTML)DiversModules du noyauRecovery toolsProgrammes de testOutils de manipulation de texteX11X11 base et clientsX11 configurationX11 policesX11 serveursX11 dveloppementCode source et dbogageSources du noyeauSources de la BaseSources de partage (Share)Sources des composants GNUSources X11Symboles de dbogageSymboles de dbogage (32-bit)Symboles de dbogage (64-bit)Symboles de dbogage X11Slectionner tous les composantsDselectionner tous les composantsInstaller les composants slectionns Une erreur est survenue lors de l'installation du fichier %s. Certains fichiers n'ayant pu tre extraits correctement, le systme n'est pas complet et pourrait ne pas fonctionner correctement. Souhaitez-vous continuer l'installation des composants ? Une seule partition peut tre monte en tant que racine, dite "/". Les partitions $0 et $1 s'empitent l'une sur l'autre.Pas de programme de dmarrage trouv sur la partition racineLe systme de fichiers de la partition racine ne peut pas tre FFSv2 car le chargeur de dmarrage ne le supporte pas. Vous pouvez diter la table de partitions la main, ou abandonner et retourner au menu principal. Souhaitez-vous diter nouveau la table de partitions ? Impossible d'ouvrir le fichier de configuration $0. Veuillez slectionner votre zone horaire dans la liste suivante. Appuyez sur la touche Entre pour confirmer votre choix. Appuyez sur "x" puis sur Entre pour valider la slection en cours. Par dfaut : %s Slection actuelle : %s Heure locale : %s %s Retour la liste principale des fuseaux horaires Le disque slectionn dispose d'une partition d'change (swap) qui est peut-tre en cours d'utilisation, en particulier si votre systme dispose de peu de mmoire. Le repartitionnement de votre disque requiert la dsactivation de cette partition. Prenez garde ! Cette opration peut entraner des erreurs. Si cela survient, vous devrez alors redmarrer et tenter nouveau. Sysinst n'a pas pu dsactiver la partition d'change (swap) prsente sur le disque cible pour l'installation. Vous devez redmarrer et tenter nouveau. Aucun mot de passe pour le compte "root" n'a t dfini. Nous vous recommandons de spcifier un mot de passe maintenant. Le souhaitez-vous ? The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line. Spcifiez le shell par dfaut qui sera utilis par l'utilisateur "root". Par dfaut, il s'agit de /bin/sh Aucune partition racine n'est actuellement dfinie. Vous devez au moins dfinir le point de montage de cette partition racine, dite "/". Appuyez sur la touche Entre pour continuer. Entrez les "flags" slattach Choisissez une option activer/dsactiverScriptingJournalStatut : Commande : En cours d'excutionTerminechecCommande termine par un signalNetBSD-11.99.5 Programme d'installationQuitter le programme d'installationInstallation de NetBSD sur disque durMise jour de NetBSD sur disque durRinstaller ou installer de nouveaux composantsRedmarrer l'ordinateurUtilitairesConfigurationQuitterQuitterUtilitaires NetBSD-11.99.5Excuter /bin/shConfigurer le fuseau horaireConfigurer le rseauPartitionner un disqueJournauxArrter le systmeOui ou non?Appuyez sur la touche Entre pour continuerChoisir le type d'installation dsirUse existing $1 partitionsSpcifier les tailles des partitions NetBSDUse default partition sizesManually define partitionsDelete everything, use different partitions (not $1)GigaoctetsMgaoctetsOctetsCylindresSecteursSlection du mdia d'installationFTPHTTPHTTPSNFSCD-ROM / DVD / install image mediaDisquetteSystme de fichiers non-montRpertoire local montSlection de la distributionInstallation complteInstallation sans X11Installation minimaleInstallation personnalise** cach **Serveur FTPRpertoire de baseRpertoire des composants binaireRpertoire des composants sourceExtension de fichierRpertoire de transfertDownload viaUtilisateurMot de passeProxyRcuprer la distributionContinuerContinuer?Que voulez-vous faire ?RessayerExtraction termineSauter cet ensembleSauter ce groupeAbandonner l'installationAnnuler la rcuprationPriphriqueSystme de fichiers Choisissez un serveur de noms :autre Configurer automatiquement ?Shell du compte "root"Shell du compte "user"Jeu de couleursBlanc sur noirNoir sur blancBlanc sur bleuVert sur noir Le rpertoire o se situent les anciennes librairies a.out doit tre dplac. Veuillez suivre la procdure de mise jour et bien vrifier que tous les systmes de fichiers sont monts. Le rpertoire /emul/aout ou /emul est prsent sur le disque mais pointe vers un rpertoire non mont. Nous l'avons renomm en lui ajoutant l'extension ".old". Lorsque vous aurez termin l'installation ou la mise jour, vous devrez fusionner manuellement le nouveau rpertoire avec l'ancien /emul/aout. Sendmail n'est plus distribu dans cette version de NetBSD, le MTA par dfaut tant maintenant postfix. Toutefois, le fichier /etc/mailer.conf est toujours configur pour utiliser sendmail. Voulez-vous mettre jour le fichier /etc/mailer.conf automatiquement pour utiliser postfix la place ? Si vous choisissez "Non", vous devrez mettre jour /etc/mailer.conf manuellement afin que vos courriels soient traits correctement. Afin d'utiliser l'interface rseau : %s, vous devez accepter la licence contenue dans le fichier %s. Pour afficher ce fichier, tapez ^Z (Ctrl-Z). Aprs l'avoir lu, tapez "fg" pour continuer.Afin de configurer le systme de paquetages binaires, choisissez l'emplacement rseau o les paquetages se trouvent. Une fois le systme redmarr, vous pourrez utiliser 'pkgin' pour installer et amnager des paquetages additionnels.Voici les configurations actuelles pour : protocole, serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. La copie de rc.conf a chou. Continuer ?La copie de rc.conf a t sauvegarde jusqu' %s.La restauration de la sauvegarde de rc.conf a chou.La suppression de l'ancien fichier %s a chou.Dossier de paquetagesconfigurer une installation existante deconfigurerchangerDfinir le mot de passeOUINONTERMINERAbandonne***VIDE***Fuseau horaireChanger le mot de passe "root"Activer l'installation de paquetages binairesActiver sshdActiver ntpdExcuter ntpdate au dmarrageActiver mdnsdActiver xdmActiver cgdActiver lvmActiver raidframeAjouter un utilisateurConfigurer les items suivants si ncessaire.Configuration termineInstaller pkgin et mettre jour le sommaire des paquetagesVotre systme est maintenant configur pour utiliser pkgin afin d'installer des paquetages binaires. Pour installer un paquetage, utilisez : pkgin install partir d'un shell "root". Consultez le manuel pkgin(1) pour plus de dtails.Obtenir et extraire pkgsrcL'installation de pkgsrc ncessite l'extraction d'une archive obtenue par le rseau. Voici les configurations actuelles pour : serveur, rpertoire, utilisateur et mot de passe qui seront utiliss. Si "utilisateur" est "ftp", un mot de passe n'est pas requis. Rpertoire pkgsrcObtenir et extraire pkgsrcLa configuration du rseau a chou. Ressayer ?Quitter sans installer pkgsrcQuitter sans installer bin pkgL'installation de pkgin a chou, peut-tre parce que son paquetage binaire n'existe pas. Vrifiez le chemin et essayez nouveau.chouPoint de montage ou de 'raid' ou 'cgd' ou 'lvm'?Partitionnement tenduModifier les partitionsPreconfigured "wedges" dk(4)ENLEVERSupprimerAjouterautoCette supprimer toutes les partitions sur le disque!Enregistrer les modifications avant de terminer?Aucune modification ne peut tre sauv.Aucune partition racine dfini, ne peut pas continuer continue Nom d'utilisateur (8 caractres)Ajouter cet utilisateur au groupe "wheel" ?Supprimer la partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?swapA swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)AnnulerInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionsystme de fichiersDbuttaillefintaille de bloctaille de fragmenttaille moyenne de fichier$0 bytes4 fragmentsSlectionnez la taille de bloc du systme de fichiersSlectionnez la taille de fragment du systme de fichierstaille moyenne de fichier (octets)Pas d'espace libreNombre invalide!Trop grand!Espace $0..$1 $3 (taille $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Other typeChanger le nom du disqueThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameVoulez-vous diter de nouveau la table des partitionsNous allons maintenant installer NetBSD sur votre disque $0. Vous devez choisir si vous voulez installer NetBSD sur la totalit du disque ou seulement sur une partie de celui-ci. Une installation sur une partie du disque cre une partition, ou `slice', pour NetBSD dans le secteur de dmarrage ($1) de votre disque. Une installation sur la totalit du disque est `dangereusement ddie' : elle rinitialise compltement le $3, ce qui efface tout systme d'exploitation ou donnes existants sur le disque. Cela rend galement impossible l'installation ultrieure d'un deuxime systme d'exploitation, sauf si vous rinstallez compltement NetBSD en utilisant uniquement une partie du disque.Faites votre choixUtilisation d'une partie du disqueUtilisation de tout le disque Taille totale du disque $0: $1 - libre: $2DbutTailleFlgTable des partitions OKNe pas modifierAutreIl n'y a pas actuellement de partition NetBSD dans la table de partitions.Il y a plusieurs partitions NetBSD dans la table de partitions du secteur de dmarrage. Positionnez l'indicateur 'installation' sur celle utiliser.Votre disque a actuellement une partition autre que NetBSD. Voulez-vous vraiment l'craser par une partition NetBSD ? Partition OKditez votre table de partitions $2. La table de partitions est : INC, (C)loneinstallation(I)nstallation, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayB, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Si vous avez dmarr sur une disquette, vous pouvez maintenant la retirer. Impossible de lire le contenu du secteur de dmarrage Impossible de lire la table de partitions RISCiX Aucune partition NetBSD trouve dans la table de partitions RISCiX. Impossible de crer un label. Aucune partition NetBSD trouve (disque filecore uniquement ?). Impossible de crer un label. Installation des blocs de dmarrage sur %s ... Nous avons maintenant vos partitions NetBSD sur %s comme suit (taille et Offset en %s) : KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?TypeMountVous n'avez pas choisi de partition active. Cela peut empcher votre systme de dmarrer correctement. Dois-je marquer la partition NetBSD comme active ? La gomtrie du disque doit tre prcise. Veuillez entrer le nombre de secteurs par piste (maximum 63) et le nombre de ttes (maximum 256) que le BIOS utilise pour accder au disque. Le nombre de cylindres sera dduit de la taille du disque. Sysinst n'a pas pu dterminer automatiquement la gomtrie utilise par le BIOS pour votre disque. La gomtrie physique est %d cylindres %d secteurs %d ttes En utilisant les informations dj prsentes sur le disque, il semble que la gomtrie utilise par le BIOS soit de %d cylindres, %d secteurs et %d ttes gom relle : %d cylindres, %d ttes, %d secteurs (pour information) gom fdisk : %d cylindres, %d ttes, %d secteurs activeType de partition (0..255)Il ne peut y avoir qu'une seule partition tenduead, (A)ctive partitionConfiguration de la table de partition $2... L'criture du MBR a chou. Nous ne pouvons continuer.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Remplir de zrosRemplissez par des donnes alatoires0 - Pas de parit, l'entrelacement seulement simple.1 - Mirroring. La parit est le miroir.4 - Entrelacement avec parit stockes sur le dernier composant. component.5 - Entrelacement avec parit tous les composants. components.L'appareil est bloqu. Voulez-vous forcer le dbloquer et continuer? unblock it and continue?Voulez-vous essayer?Le volume cryptographique Crer (CGD)Crer une image de disque virtuel (VND)Crer un groupe de volumes LVM (VG)Crer un volume logiqueCrer un RAID logicielMettre jour la liste des dispositifsEnregistrer les modificationsBLOQUEINCHANGUTILIS(mont)(non utilis)Disque avec GPTTerminer le partitionnementLimite pour le nombre de dispositifs a t atteint!Blancs appareil!Disques disponibles:Impossible d'allouer noeud de priphrique!Gestionnaire de partition. Tous les disques, les partitions et etc affich. Si vous souhaitez utiliser RAID, LVM ou DMC, procdez comme suit: 1) Crer les partitions de type de besoin; 2) Crer un systme RAID / LVM VG / DMC utilisation de ces partitions; 3) la sauver; 4) Crer des partitions pour les volumes RAID / DMC ou logique par LVM.sur$0 (niveau $1)RAID VIDE!DisquesPices de rechangeNiveau RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTableaux multi-dimensionnels sont pas pris en charge!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disques en RAIDPATH NOT DEFINED!ASSIGNChemin du fichierCreate new imageTailleRead-onlyDfinir la gomtrie la mainOctets par secteurSecteurs par pistePistes par cylindreCylindresChemin du fichier?Taille (MB)?Octets par secteur?Secteurs par piste?Pistes par cylindre?CylindresDISQUE NON DEFINI!Dispositif de baseChiffrageTaille de la clAlgorithme IVLa gnration des clsMthode de vrificationDisques VGVIDER VG!PV'sNomMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNom?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Logique volumeNomTailleRead-onlyContiguLogicalExtentsNumberNombre mineurMiroirsMirrorLogRegionSizePersistante numro mineurReadAheadSectorsRayuresStripesizeRemise zro de la KB d'abordNom?Taille (MB)?LogicalExtentsNumber?Numro mineur?Miroirs?MirrorLogRegionSize?ReadAheadSectors?Stripes?Le fonctionnement n'est pas pris en charge!Modifier les partitionsSwitch partitioning schemeFormat en RAIDFormat de LVM PVCrypter (CGD)Fonction d'effacement scurisAnnuler les changementsAnnulation de la configurationditerGroupeMSGTXTS627 5032 5073 5089 5107 5111 5115 5125 5134 5140 5146 5149 5152 5161 5171 5184 5192 5203 5228 5240 5748 5780 6272 6561 7106 7152 7256 7342 7378 7393 7411 7419 7427 7454 7458 7462 7465 7468 7579 7764 7992 8468 8802 8831 8846 8861 8869 8883 8901 8922 8973 8989 8999 9019 9065 9095 9148 9205 9316 9437 9481 9514 9553 9587 9594 9627 9704 9710 9717 9724 9753 9865 9871 9882 9899 9916 9925 9954 9966 9976 10077 10139 10159 10279 10316 10372 10386 10407 10444 10654 10829 10978 11013 11065 11281 11594 12117 12478 12768 13161 13296 13309 13320 13466 13645 13776 13910 13930 13963 13982 14065 14180 14321 14446 14460 14568 14661 14690 14710 14786 14803 14821 14837 14856 14876 14893 14905 14931 14943 14961 15162 15401 15428 15445 15501 15563 15623 15654 15678 15737 16083 16113 16130 16238 16348 16488 16562 16638 16716 17208 17428 17539 17570 17697 17733 17861 17888 17928 17974 18190 18314 18382 18482 18487 18523 18559 18573 18596 18629 18633 18658 18677 18703 18708 18723 18738 18757 18782 18794 18816 18833 18846 18858 18876 18900 18915 18932 18945 18956 18967 18987 19016 19045 19069 19104 19139 19166 19353 19402 19434 19482 19579 19712 19758 19950 19980 20302 20431 20571 20711 20828 20963 21007 21050 21058 21068 21080 21092 21100 21111 21138 21172 21207 21238 21273 21309 21356 21376 21393 21411 21416 21423 21448 21464 21485 21502 21519 21537 21554 21567 21598 21623 21654 21685 21720 21747 21800 21810 21820 21826 21835 21843 21858 21862 21867 21873 21877 21912 21922 21951 21967 21993 22010 22029 22050 22066 22079 22084 22092 22107 22133 22152 22180 22198 22209 22215 22221 22242 22252 22263 22281 22303 22320 22333 22354 22374 22394 22405 22418 22440 22447 22472 22487 22507 22519 22536 22553 22573 22592 22769 23053 23363 23543 23754 23942 24008 24055 24110 24154 24174 24203 24215 24221 24237 24241 24245 24253 24263 24275 24290 24309 24345 24356 24367 24406 24418 24428 24438 24448 24464 24482 24531 24552 24597 24841 24867 25121 25136 25162 25219 25253 25288 25430 25447 25496 25517 25533 25562 25567 25572 25578 25583 25622 25657 25687 25742 25775 25821 25835 25914 25919 25973 25987 25997 26021 26107 26155 26261 26295 26302 26317 26344 26353 26392 26399 26421 26440 26456 26474 26506 26525 26542 26699 26730 26737 26746 26754 26761 26775 26793 26812 26822 26834 26875 26920 26949 26970 26993 27012 27050 27056 27064 27068 27089 27106 27115 27134 27280 27322 27832 27840 27864 27882 27926 27931 27936 27940 27971 27984 27993 28039 28165 28256 28268 28332 28334 28336 28338 28348 28362 28377 28404 28408 28414 28419 28428 28433 28460 28462 28477 28488 28503 28531 28575 28622 28638 28660 28671 28704 28724 28773 28873 28875 28943 28983 29028 29103 29169 29204 29285 29292 29353 29417 29424 29430 29529 29585 29861 29985 30096 30158 30196 30204 30226 30275 30278 30299 30344 30399 30458 30527 30574 30679 30822 30847 30851 30885 30901 30926 30974 31010 31071 31125 31206 31228 31267 31304 31336 31360 31387 31413 31427 31435 31445 31453 31467 31480 31492 31516 31557 31583 31600 31629 31953 31956 31970 31982 31988 32004 32016 32023 32030 32039 32049 32066 32082 32125 32133 32141 32151 32162 32180 32197 32210 32236 32243 32251 32268 32276 32293 32317 32336 32355 32374 32384 32395 32409 32427 32447 32467 32476 32499 32519 32530 32545 32557 32576 32595 32606 32616 32621 32627 32645 32664 32683 32690 32709 32729 32754 32771 32777 32785 32795 32807 32828 32844 32852 32872 32892 32914 32922 32933 32956 32963 32977 32999 33016 33025 33046 33064 33073 33104 33120 33147 33166 33186 33204 33225 33239 33259 33266 33285 33300 33319 33864 33897 33925 33954 33962 33999 34311 34488 34565 34582 34600 34615 34637 34687 34697 34714 34736 34795 34953 34977 35107 35132 35258 35276 Komunikaty instalacyjne w jezyku polskimpl_PL.ISO8859-2Zabraklo pamieci!TakNieWszystkieNiektoreZadnezadneOKokWlaczoneWylaczoneniezmienioneUsunac?zainstalujprzeinstaluj pakiety dlazaktualizujWitaj w sysinst, systemie instalacyjnym NetBSD-11.99.5. To oparte na menu narzedzie (sysinst) zostalo zaprojektowane w celu ulatwienia instalacji NetBSD na dysku twardym, lub uaktualnienia istniejacego systemu NetBSD przy minimalnym nakladzie pracy. W ponizszych menu, aby wybrac pozycje wpisz litere (a, b, c, ...). Mozesz tez uzyc CTRL+N/CTRL+P, aby wybrac nastepna/poprzednia pozycje. Klawisze strzalek i Page-up/Page-down takze moga dzialac. Aby aktywowac biezacy wybor z menu, nacisnij klawisz Enter. Dziekujemy za wybranie NetBSD! Zdecydowales sie zainstalowac NetBSD na twardym dysku. Spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem tej procedury! Zostana wykonane nastepujace czynnosci: a) Podzial dysku twardego b) Stworzenie nowych systemow plikow BSD c) Wgranie i zainstalowanie pakietow dystrybucji (Po wprowadzeniu informacji o partycjach, ale jeszcze zanim twoj dysk zostanie zmieniony, bedziesz mial mozliwosc przerwac te procedure.) Czy kontynuowac? Ok, zaktualizujmy NetBSD na twoim dysku. Jak zawsze, spowoduje to zmiane informacji na twoim dysku. Powinienes zrobic pelny backup danych przed rozpoczeciem! Czy napewno chcesz zaktualizowac NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Ok, rozpakujmy pakiety dystrybucyjne NetBSD na bootowalny twardy dysk. Ta procedura tylko sciaga i rozpakowuje pakiety na pre-partycjonowany bootowalny dysk. Nie nazywa dyskow, aktualizuje bootblokow, lub zapisuje istniejacej konfiguracji. (Wyjdz i wybierz `instaluj' lub `aktualizuj' jesli chcesz to zrobic.) Powinienes wykonac `instaluj' lub `aktualizuj' przed rozpoczeciem tej procedury! Czy napewno chcesz przeinstalowac pakiety dystrybucjne NetBSD? (Jest to ostatnie ostrzezenie zanim zacznie sie modyfikacja danych na twoich dyskach.) Montowanie %s nie powiodlo sie. Kontynuowac? Nie moge znalezc zadnych twardych dyskow do uzycia z NetBSD. Zostaniesz przeniesiony do menu glownego. Znalazlem tylko jeden dysk, %s. Stad przyjmuje, ze chcesz %s NetBSD wlasnie na nim. Na ktorym z nich chcesz %s NetBSD? Dostepne dyskiExisting "wedges"glowicesektorypunkt montowania (lub '-')cylsekMBGBMozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub uzyc domyslnych rozmiarow i zawartosci.Jezeli nie chcesz uzywac instniejacych partycji, mozesz uzyc prostego edytora aby ustawic rozmiary partycji NetBSD, lub usunac istniejace partycje i uzyc domyslnych rozmiarow partycji. Bedziesz mial szanse zmienic wlasciwosci partycji. Czesc NetBSD (lub wolna) twojego dysku ($0) to $3. Pelna instalacja wymaga co najmniej $4 bez Xorg, oraz co najmniej $5 jezeli zainstalujesz z pakietami instalacyjnymi Xorg.Wybranie Mega/Gigabajtow nada partycji rozmiar bliski twojemu wyborowi, ale dopasowany do granic cylindrow. Wybranie sektorow pozwoli ci na bardziej dokladne okreslenie rozmiarow. Na nowych dyskach ZBR rozmiar cylindra zmienia sie w zaleznosci od miejsca na dysku, jest wiec niewielka korzysc z dopasowania cylindrow. Na starszych dyskach bardziej wydajne jest podawanie rozmiaru dysku, ktore sa wielokrotnoscia aktualnego rozmiaru cylindra. Wybierz specyfikator rozmiaruMozesz teraz zmienic rozmiary partycji systemowych. Domyslne ustawienia alokuja cala przestrzen na glowny system plikow, aczkolwiek mozesz zdefiniowac osobne partycje /usr (dodatkowe pliki systemowe), /var (dane systemowe i logi) lub /home (katalogi domowe uzytkownikow). Wolna przestrzen zostanie dodana do partycji oznaczonej '+'.Inne znaczniki: partycja $0.'=' istniejacy'@' zewnetrznyRozmiarSystem plikowPunkt montowania?Rozmiar dla %s w %s?Zmien jednostki wejsciowe (sektory/cylindry/MB/GB)partycja NetBSDCaly dyskpartycja rozruchowaDodaj partycje zdefiniowana przez uzytkownikaDalej. Wolne miejsce: $0 $1.Anulowano. Niewystarczajace miejsce, brakuje $0 $1!Wartosc poczatkowa ktora podales jest poza koncem dysku.Przy tej wartosci, koniec partycji znajduje sie poza koncem dysku. Rozmiar twojej partycji zostal zmniejszony. Ten dysk ($0) jest zbyt duzy ($3) na tablice partycji $2 (maks. $4), wiec tylko poczatek dysku jest mozliwy do uzycia. Co chcesz zrobic z istniejacymi partycjami?zostaw (uzyj tylko czesci dysku)skasuj (wszystkie dane beda utracone!)uzyj innego typu tablicy partycjianulujCould not convert all partitionsTwoje partycje sa ustawione jako: Flags: $3(N)ewfs$4. Total: $5, free: $6StartKoniecTyp SPRozmiary partycji w porzadkuPowinienes najpierw ustawic rodzaj systemu plikow (SP). Pozniej inne wartosci. Aktualne wartosci dla partycji:newfsmontowanieopcje montowaniapunkt montowaniaPrzelaczOdzyskaj oryginalne wartosciWybierz typinne typySpecjalne wartosci, ktore moga byc podane jako wartosci rozmiaru: -1: az do konca czesci dysku $0: zakoncz ta partycje tam gdzie partycja X sie zaczynaRozmiar (max $1 $2)Specjalne wartosci, ktore moga byc podane jako wartosci przesuniecia: -1: zacznij na poczatku czesci dysku NetBSD $0: zacznij na koncu partycji X $1: zacznij na poczatku podanego wolnego fragmentuPoczatek ($2)Nieprawidlowa liczbaPodaj nazwe dla swojego dysku NetBSDJestesmy teraz gotowi zainstalowac NetBSD na twoim dysku (%s). Nic nie zostalo jeszcze zapisane. Masz teraz ostatnia szanse na przerwanie tego procesu poki nic nie zostalo jeszcze zmienione. Czy kontynuowac? Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk doceloway, oraz utworzyl system plikow i sprawdzil nowe partycje, ktore podales jako docelowe. Pierwsza czesc procedury zostala zakonczona. Sysinst zapisal disklabel na dysk docelowy, oraz sprawdzil nowe partycje, ktore podales jako docelowe. Nie moglem otworzyc %s, blad: %s. zamontowanie urzadzenia $0 na $1 nie powiodlo sie. Rozpakowywanie wybranych pakietow dla NetBSD-11.99.5 zakonczone. System moze sie teraz uruchomic z wybranego twardego dysku. Aby zakonczyc instalacje, sysinst da ci mozliwosc skonfigurowania kilku istotnych rzeczy. Instalacja NetBSD-11.99.5 zostala zakonczona. System powinien uruchomic sie z twardego dysku. Wykonaj polecenia zawarte w pliku INSTALL o koncowej konfiguracji systemu. Powinienes przynajmniej zedytowac /etc/rc.conf aby odpowiadal twoim potrzebom. Zajrzyj do /etc/defaults/rc.conf aby poznac domyslne wartosci. Aktualizacja NetBSD-11.99.5 zostala zakonczona. Bedziesz teraz musial wykonac polecenia zawarte w pliku INSTALL, aby skonfigurowac system odpowiadajacy twoim potrzebom. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES, inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika, oraz skopiowac z powrotem pliki z haslami (biorac pod uwage nowe konta systemowe ktore mogly zostac utworzone dla tej wersji), jesli uzywales lokalnych plikow hasel. Rozpakowywanie dodatkowych pakietow NetBSD-11.99.5 zostalo zakonczone. Musisz teraz wykonac polecenia zawarte w pliku INSTALL aby przekonfigurowac system do swoich potrzeb. Musisz przynajmniej dostosowac rc.conf do swojego lokalnego srodowiska i zmienic rc_configured=NO na rc_configured=YES inaczej start systemu zatrzyma sie na trybie jednego-uzytkownika. Twoj dysk jest teraz gotowy na zainstalowanie jadra oraz pakietow dystrybucyjnych. Jak napisano w pliku INSTALL masz tez kilka opcji. Dla ftp lub nfs, musisz byc podlaczony do sieci z dostepem do odpowidnich maszyn. %d wybranych pakietow, %d zainstalowanych. Nastepnym pakietem jest %s. Dystrybucja NetBSD jest rozbita w kolekcje pakietow dystrybucyjnych. Czesc z nich to pakiety podstawowe wymagane przez wszystkie instalacje, a czesc nie jest przez wszystkie wymagana. Mozesz zainstalowac je wszystkie (Pelna instalacja) lub wybrac z opcjonalnych pakietow. Mozesz takze zainstalowac tylko podstawowy zestaw (minimalna instalacja), lub wybrac te, ktore chcesz (Inna instalacja) Ponizej masz site $1, katalog, uzytkownika, oraz haslo gotowe do uzycia. Jesli "uzytkownik" to "ftp", wtedy haslo nie jest wymagane. adres e-mailurzadzenieWprowadz hosta NFS oraz katalog gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0, oraz musi byc dostepny przez NFS. Podaj urzadzenie bedace stacja dyskietek oraz katalog pomocniczy w docelowym systemie plikow. Pliki z pakietami instalacyjnymi musza znajdowac sie w glownym katalogu dyskietki. Podaj urzadzenie CDROM oraz katalog na CDROMie, w ktorym znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryDostepne napedy CDZnaleziono kilka napedow CD, prosze wybrac ten, ktory zawiera nosnik instalacyjny.Zbiory instalacyjne nie zostaly znalezione w domyslnym polozeniu na tym CD. Prosze sprawdzic urzadzenie i sciezke.Podaj niezamontowane lokalne urzadzenie oraz katalog na nim, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. Podaj aktualnie zamontowany lokalny katalog, gdzie znajduje sie dystrybucja. Pamietaj, ze katalog musi zawierac pliki $0. system plikowNie znalazlem zadnych interfejsow sieciowych do uzycia z NetBSD. Zostaniesz przeniesiony do glownego menu. Nastepujace interfejsy sieciowe sa aktywne: %s Czy ktorys z nich jest podlaczony do serwera?Ktorego urzadzenia mam uzyc?Dostepne interfejsyAby mozna bylo uzywac sieci, potrzebujemy odpowiedzi na ponizsze pytania: Twoja domena DNSTwoja nazwa hostaTwoj adres IPv4Adres IPv4 serweraMaska podsieci IPv4Serwer nazw IPv4bramka IPv4Typ interfejsu sieciowegoWi-Fi SSID?Wi-Fi passphrase?Ponizej sa wartosci, ktore wprowadziles. Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Maska podsieci: %s Bramka IPv4: %s Ponizej sa wartosci, ktore wprowadziles. Czy sa poprawne? Domena DNS: %s Nazwa hosta: %s Serwer nazw: %s Podstawowy interfejs: %s Medium sieciowe: %s Twoj adres IP: %s Adres IP serwera: %s Maska podsieci: %s Bramka IPv4: %s Autkonfiguracja IPv6: %s Czy sa poprawne? Poczekaj, az interfejs sieciowy zostanie uaktywniony. Nie moglem utworzyc /etc/resolv.conf. Instalacja przerwana. Nie moglem przejsc do katalogu $0: $1 Instalacja przerwana.Usun po zakonczeniu instalacjiPakiet $0 nie istnieje.Wszystkie wybrane pakiety dystrybucji zostaly rozpakowane.Wystapil blad w trackie rozpakowywania pakietow. Twoja instalacja jest niekompletna. Wybrales %d pakietow dystrybucyjnych. %d pakiety nie zostaly znalezione i %d zostalo pominietych z powodu bledow. Z %d docelowych, %d rozpakowalo sie bez bledow i %d z bledami. Sprawdz zrodlo swojej dystrybucji i rozwaz reinstalacje pakietow z glownego menu.Instalacja zostala przerwana.Install aborted.Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Instalacja zostala przerwana. Dystrybucja nie zostala pomyslnie wgrana. Bedziesz musial zrobic to recznie. Aktualizacja zostala przerwana. Rozpakowanie dodatkowych pakietow nie udalo sie. Bedziesz musial to zrobic recznie, albo wybrac inne zrodlo pakietow i sprobowac ponownie. Pojawil sie powazny problem! Nie mozna utworzyc /mnt/etc/fstab. Spadamy! Pomocy! Na dysku docelowym %s nie ma /etc/fstab. Przerywamy aktualizacje. Pomocy! Nie moge przeczytac /etc/fstab na dysku %s. Przerywamy aktualizacje. Nie moge zapisac %s/bin/X jako %s/bin/X.old, poniewaz na docelowym dysku jest juz %s/bin/X.old. Napraw to przed kontynuacja. Jedyny sposob to uruchomic powloke z menu Narzedziowego i sprawdzic docelowe %s/bin/X oraz %s/bin/X.old. Jesli %s/bin/X.old pochodzi z zakonczonej aktualizacji, mozesz usunac %s/bin/X.old i zrobic restart. Albo jesli %s/bin/X.old pochodzi z aktualnej niekompletnej aktualizacji, mozesz usunac %s/bin/X i przeniesc %s/bin/X.old na %s/bin/X. Przerywamy aktualizacje.Pojawil sie problem z konfiguracja twojej sieci. Albo twoja bramka albo serwer nazw nie byl osiagalny przez ping. Czy chcesz skonfigurowac siec jeszcze raz? (Wybor "Nie" pozwala ci kontynuowac lub przerwac instalacje.) Czy chcesz kontynuowac proces instalacji i zalozyc, ze twoja siec dziala? ("Nie" przerywa proces instalacji.) Tworzenie plikow urzadzen ... Wyglada na to, ze $0 nie jest systemem plikow $1 lub fsck dysku nie powiodlo sie. Zamontowac dysk pomimo tego? (Kod bledu $2.) Nie moge znalezc docelowego / %s. Utowrzony nowy system plikow nie przeszedl podstawowych testow. Jestes pewien, ze zainstalowales wszystkie wymagane pakiety? System plikow na dyskietceNie moglem znalezc pliku na dyskietce. Dyskietka nie zostala pomyslnie zamontowana. Wloz dyskietke zawierajaca plik "%s.%s". Jezeli nie masz juz wiecej dyskietek, wybierz "Pakiet kompletny" aby rozpoczac proces jego instalacji. Wybierz "Przerwij pobieranie" zeby wybrac inne zrodlo oprogramowania. Czy informacje o sieci, ktore podales sa prawidlowe dla tej maszyny w reguralnej pracy i czy chcesz aby je zapisac w /etc? Ponizej jest lista pakietow dystrybucyjnych, ktore zostana uzyte. Pakiet dystrybucyjny Uzyc? ------------------------------------------- ----- BaseBaza dla kompatybilno?ci 32-bitowejBaza dla kompatybilno?ci 32-bitowejSystem (/etc)Narzedzia KompilacyjneDevicetree hardware descriptionsGryGraphics driver firmwareStrony PodrecznikaStrony Podrecznika (HTML)InneModuly kernelaRecovery toolsProgramy testujaceNarzedzia przetw. tekstuPakiety X11X11 base oraz klienciKonfiguracja X11Czcionki X11Serwery X11Programowanie X11Pakiety zrodel i debug.Zrodla kernelaZrodla pak. BaseZrodla ShareZrodla GNUZrodla X11Symbole debugowaniaSymbole debugowania (32-bit)Symbole debugowania (64-bit)Symbole debugowania X11Wybierz wszystkie powyzsze pakietyOdznacz wszystkie powyzsze pakietyZainstaluj wybrane pakietyPojawil sie blad w trakcie rozpakowywanie pliku %s. To znaczy, ze pewne pliki nie zostaly prawidlowo rozpakowane i twoj system nie bedzie kompletny. Kontynuowac rozpakowywanie pakietow?Musi byc jedna partycja do zamontowania pod '/'.partycje $0 i $1 pokrywaja sie.Brak programu rozruchowego dla glownej partycjiGlowny system plikow nie moze byc FFSv2 poniewaz nie ma programu rozruchowego dla tej platformy. Mozesz albo zedytowac tablice partycji recznie, albo poddac sie i powrocic do glownego menu. Edytowac tablice partycji ponownie ?Nie moglem otworzyc pliku konfiguracyjnego $0Wybierz strefe czasowa, ktora najlepiej ci odpowiada z ponizszej listy. Nacisnij ENTER aby wybrac. Nacisnij 'x' a potem ENTER aby wyjsc. Domyslna: %s Wybrana: %s Lokalny czas: %s %s Powroc do glownej listy strefDysk, ktory wybrales posiada partycje wymiany, ktora moze byc aktualnie w uzyciu jesli twoj system ma malo pamieci. Poniewaz chcesz zmienic uklad partycji, partycja wymiany zostanie teraz wylaczona. Moze to spowodowac pojawienie sie bledow. Jesli zuwazysz takie bledy zrestartuj komputer, a nastepnie sprobuj jeszcze raz.Sysinst nie mogl deaktywowac partycji wymiany na dysku, ktory wybrales do instalacji. Zrestartuj komputer i sprobuj jeszcze raz.Haslo root'a w nowo zainstalowanym systemie nie zostalo jeszcze ustawione, i dlatego jest puste. Czy chcesz teraz ustawic haslo dla root'a?The root password of the newly installed system has not yet been initialized. If you do not want to set a password, enter an empty line.Mozesz teraz wybrac, ktorej powloki ma uzywac uzytkownik root. Domyslnie jest to /bin/sh, ale moze preferujesz inna. Nie zdefiniowano glownego systemu plikow. Musisz zdefiniowac przynajmniej jeden mountpoint z "/". Nacisnij aby kontynuowac. Podaja parametry dla polecenia 'slattach' Wybierz opcje aby je wlaczyc lub wylaczyc.SkryptyLogowanie Status: Polecenie: PracujeZakonczonePolecenie nie powiodlo siePolecenie zakonczylo sie sygnalemSystem Instalacyjny NetBSD-11.99.5Wyjdz z Systemu InstalacyjnegoZainstaluj NetBSD na twardym dyskuZaktualizuj NetBSD na twardym dyskuPrzeinstaluj albo zainstaluj dodatkowe pakietyZrestartuj komputerMenu NarzedzioweMenu konfiguracjiExitWsteczNarzedzia NetBSD-11.99.5Uruchom /bin/shUstaw strefe czasowaSkonfiguruj siecSkonfiguruj dyskFunkcje logowaniaZatrzymaj systemtak lub nie?Nacisnij enter aby kontynuowacWybierz swoja instalacjeUzyj istniejacych partycji MBRUstaw rozmiary partycji NetBSDUzyj domyslnych rozmiarow partycjiManually define partitionsDelete everything, use different partitions (not $1)GigabajtyMegabajtyBajtyCylindrySektoryWybierz nosnikFTPHTTPHTTPSNFSCD-ROM / DVD / nosnik instalacyjnyDyskietkaNiezamontowany system plikowLokalny katalogWybierz swoja dystrybucjePelna instalacjaInstalacja bez X11Minimalna instalacjaInna instalacja** ukryte **HostKatalogKatalog pkgsrcKatalog pakietow binarychRozszerzenie plikuKatalog z plikami pobranymiSposob pobieraniaUzytkownikHasloProxySciagnij DystrybucjeKontynuujKontynuuj?Co chcesz zrobic?Sprobowac jeszcze razPakiet kompletnyPomin pakietPomin grupe pakietowPrzerwij instalacjePrzerwij pobieranieUrzadzenieSystemPlikow Wybierz serwer nazwinny Wykonac autkonfiguracje?Powloka root'aPowloka uzytkownikaKolorystykaBialy na czarnymCzarny na biaymBialy na niebieskimZielony na czarnymDocelowy katalog na biblioteki wpsoldzielone a.out nie mogl zostac utworzony Sproboj jeszcze raz procedury aktualizacji i upewnij sie, ze zamontowales wszystkie systemy plikow.Albo /emul/aout albo /emul w twoim systemie byl symbolicznym linkiem wskazujacym na niezamontowany system. Zostalo mu dodane rozszerzenie '.old'. Kiedy juz uruchomisz swoj zaktualizowany system, mozliwe ze bedziesz musial zajac sie polaczeniem nowo utworzonego /emul/aout ze starym. Sendmail nie jest dostepny w tym wydaniu NetBSD. Domyslnym MTA jest postfix. Plik /etc/mailer.conf ciagle wskazuje usuniety program sendmail. Chcesz automatycznie uaktualnic /etc/mailer.conf dla postfix? Jesli wybierzesz "Nie", trzeba bedzie recznie zmienic /etc/mailer.conf, aby dzialalo dostarczanie poczty.Aby uzywac interfejsu sieciowego %s, musisz zgodzic sie na licencje zawarta w pliku %s. Aby obejrzec ten plik, mozesz wpisac ^Z, przejrzec jego zawartosc, a nastepnie wpisac "fg".Aby skonfigurowac binarny system pakietow, wybierz lokalizacje siecowa, z ktorej nalezy pobrac pakiety. Gdy system wstanie, mozesz wykorzystac 'pkgin' do zainstalowania albo odinstalowania dodatkowych pakietow.Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". Stworzenie kopii zapasowej rc.conf nie powiodlo sie. Kontynuowac?Kopia zapasowa rc.conf zostala zapisana do %s.Przywracania kopii zapasowej rc.conf nie powiodlo sie.Usuwanie starego wpisu %s nie powiodlo sie.Katalog z pakietamiskonfiguruj przed instalacjaskonfigurujzmienustawiono hasloTAKNIEZAKONCZPorzucony***PUSTE***Strefa czasowaZmien haslo root'aWlacz instalacje pakietow binarnychWlacz sshdWlacz ntpduruchom ntpdate podczas startu systemuWlacz mdnsdWlacz xdmWlacz cgdWlacz lvmWlacz raidframeDodaj uzytkownikaSkonfiguruj dodatkowe elementy w razie potrzeby.Zakoncz konfiguracjeZainstaluj pkgin i uaktualnij liste pakietowSkonfigurowales system tak aby wykorzystywal pkgin do instalacji pakietow binarnych. Aby zainstalowac pakiet, wykonaj: pkgin install z powloki root'a. Jesli potrzebujesz wiecej informacji przeczytaj strone podrecznika pkgin(1).Pobierz i rozpakuj pkgsrcInstalacja pkgsrc wymaga rozpakowania archiwum pobranego z sieci. Ponizej wyszczegolniono protokol, hosta, katalog, nazwe uzytkownika oraz haslo, ktore beda wykorzystane do nawiazania polaczenia. Haslo nie jest wymagane gdy nazwa uzytkownika to "ftp". katalog pkgsrcPobierz i rozpakuj pkgsrcKonfiguracja sieci nie powiodla sie. Sprobowac ponownie?Zakoncz bez zainstalowania pkgsrcZakoncz bez zainstalowania bin pkgInstalacja pkgin nie powiodla sie, prawdopodobnie dlatego ze nie znaleziono pakietow binarnych. Sprawdz sciezke pakietow i sprobuj ponownie.Nie powiodlo siePunkt montowania (lub "raid", "cgd" albo "lvm")?Partycje rozszerzoneEdytuj partycjePreconfigured "wedges" dk(4)USUNUsunDodajautoTo usunie wszystkie partycje na dysku!Zapisac zmiany przed zakonczeniem?Zmiany nie moga byc zapisane.Brak zedfiniowanej partycji /. Nie mozna kontynuowac. Nazwa nowego uzytkownika (8 zn.)Chcesz dodac tego uzytkownika do grupy wheel?Usun partycjeNa wybranej partycji nie znaleziono systemu plikow. Czy chcesz ja sformatowac?swapPartycja swap ($1) istnieje na $0. Chcesz jej uzyc?disklabel BSDdisklabeldisklabel (NetBSD only)Ten dysk nie byl wczesniej partycjonowany. Wybierz typ tablicy partycji z ponizszych.Wybierz inny typ tablicy partycji z ponizszych.Niektore typy tablic moga byc uzywane tylko na poczatkach duzych dyskow. Ponizej przedstawione sa limity.To urzadzenie ($0) ma rozmiar $1.Maks.:Dodaj partycje (brak zdefiniowanej)NieznaneNieznany typ systemu plikow (0 .. 255)AnulujNieprawidlowa wartoscNieprawidlowa GUIDEdytuj ponownieAnuluj instalacjeID typu systemu plikow (do 255)Zbyt duzo partycji$0 juz istnieje!Ta partycja juz istnieje. Aby zmienic jej rozmiar, trzeba ja skasowac i stworzyc ponownie. Wszystkie dane zostana utracone Chcesz ja skasowac i kontynuowac?Nieusuwalna partycja systemowarodzajpoczatekrozmiarkoniecrozmiar blokurozmiar fragmentuSredni rozm. pliku$0 bajtow4 fragmentyWybierz rozmiar bloku dla systemu plikowWybierz rozmiar fragmentu dla systemu plikowsredni rozmiar pliku (bajty)Brak wolnego miejscaNieprawidlowa wartosc!Zbyt duza wartosc!Miejsce od $0..$1 $3 (rozmiar $2 $3) FFSv2FFSv2eaFFSEFI system partitionLinux Ext2 (old)Inny typEdytuj nazwe dyskuNazwa dysku jest dowolna. Sluzy rozroznieniu roznych dyskow od siebie. Moze tez sluzyc do tworzenia "wedges" dla tego dysku Wprowadz nazwe dyskuCzy chcesz zmienic tablice partycji ($1)?Zainstalujemy teraz NetBSD na dysku $0. Mozesz wybrac, czy chcesz zainstalowac NetBSD na calym dysku, czy tylko na jego czesci. Instalacja na czesci dysku, tworzy partycje, lub 'plaster', dla NetBSD w tablicy partycji $3 twojego dysku. Instalacja na calym dysku jest `zdecydowanie polecana': zabiera ona caly $3. Spowoduje to calkowita utrate danych na dysku. Uniemozliwia ona take pozniejsza instalacje kilku systemow na tym dysku (chyba, ze nadpiszesz NetBSD i przeinstalujesz uzywajac tylko czesci dysku).WybierzUzyj tylko czesci dyskuUzyj calego dysku Calkowity rozmiar dysku $0: $1 - wolna: $2PoczRozmFlgTablica partycji jest poprawnaNie zmieniajInny typNie ma partycji NetBSD w tablicy partycji $1.W tablicy partycji $1 znajduje sie kilka partycji NetBSD. Powinienies oznaczyc jedna z nich jako przeznaczona do instalacji. Twoj dysk aktualnie posiada partycje nie-NetBSD. Czy napewno chcesz ja nadpisac z NetBSD? Partycje OKEdytuj DOSowa tablice partycji. Tablica partycji wyglada tak: INC, (C)lonedo instalacji(I)nstalacja, Guid Partition Table (GPT)GPTLabelUUIDGPT TypeBootUse this partitions anywayR, (R)ozruchowa(Inna: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionYour network seems to work fine. Should we skip the configuration and just use the network as-is? Jesli uruchomiles komputer z dyskietki, mozesz ja teraz wyciagnac. Nie moge przeczytac bootbloku filecore Nie moge przeczytac tablicy partycji RISCiX Nie znalazlem partycji NetBSD w tablicy partycji RISCiX - Nie moge nazwac Nie znalazlem partycji NetBSD (dysk filecore?) - Nie moge nazwac Instalowanie bootblokow na %s.... Partycje NetBSD na dysku %s wygladaja teraz tak (Rozmiary i Przesuniecia w %s): KernelThere is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?RodzajMountNie zaznaczyles aktywnej partycji. Moze to spowodowac, ze twoj system nie uruchomi sie prawidlowo. Czy partycja NetBSD ma zostac zaznaczona jako aktywna? Zostaniesz poproszony o podanie geometrii dysku: Podaj ilosc sektorow na sciezce (maksimum 63) oraz ilosc glowic (maksimum 256) ktore BIOS ustalil jako wlasciwe parametry dysku. Ilosc cylindrow zostanie obliczona automatycznie na podstawie podanych danych i rozmiaru dysku. Sysinst nie mogl automatycznie rozpoznac geometrii dysku z BIOS. Fizyczna geometria to %d cylindrow %d sektorow %d glowic Uzywajac informacji z dysku, najlepsze parametry geometrii dysku z BIOS to %d cylindrow %d sektorow %d glowic praw. geo: %d cyl, %d glowic, %d sek (tylko dla porownania) BIOS geom: %d cyl, %d glowic, %d sek aktywnaTyp partycji (0..255)Moze byc tylko jedna partycja typu rozszerzonegoad, (A)ctive partitionKonfigurowanie DOSowej tablicy partycji ... Nadpisanie MBR nie powiodlo sie. Nie moge kontynuowac.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)MBRInvalid partition type (0 .. 255)Wypenij zeramiWypenij losowymi danymi0 - brak parzystoci, tylko proste rozkadanie.1 - Mirroring. Parytet jest lustro.4 - Malowanie z parytetu przechowywanych w ostatniej czci.5 - Malowanie z parytetu w tych wszystkich elementw.Urzdzenie jest zablokowane. Czy chcesz, aby zmusi go odblokowa i kontynuowa?Czy chcesz sprbowa?Utwrz wolumen kryptograficznych (CGD)Utwrz wirtualnego obraz dysku (VND)Utwrz grup woluminw (LVM VG)Utwrz wolumin logicznyUtwrz oprogramowania RAIDAktualizuj list urzdzeZapisz zmianyZABLOK.BEZ ZMIANUYWANE(zamontowany)(nieuywany)Dysku z GPTZakocz partycjonowanieLimit liczby urzdze zosta osignity!Nieprawidowy urzdzenie!Dostpne dyskw:Nie mona przydzieli wze!Partition Manager. Wszystkie dyski, partycje oraz itp. tam wywietlane. Jeli chcesz korzysta z RAID, LVM lub CGD, wykonaj nastpujce kroki: 1) Tworzenie partycji z potrzebnego typu; 2) Utwrz RAID / LVM VG / CGD korzystania z tych partycji; 3) Zapisz go; 4) Tworzenie partycji dla RAID / CGD lub Logical Volumes dla LVM.on$0 (level $1)EMPTY RAID!DyskiCzci zamiennePoziom RAIDnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitTablice wielowymiarowe nie s obsugiwane!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Dyski w RAIDCIEKA NIE ZDEFINIOWANE!ASSIGNciekaCreate new imageRozmiarTylko do odczytuUstaw geometri rcznieBajtw na sektorwSektory na ciekiUtwory na cylinderSiownikiFile Path?Rozmiar (MB)?Bajtw na sektor?Sektory na ciek?Utwory na cylinder?CylindryDISK NIE ZDEFINIOWANE!Urzdzenie podstawyEncryptionRozmiar kluczaAlgorytm IVGenerowanie kluczyMetoda weryfikacjiDyski w VGEMPTY VG!PV'sNazwaMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeNazwa?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize (MB)?Wolumin logicznyNazwaRozmiarRead-onlySsiadujcyLogicalExtentsNumberMniejsza liczbaMirrorsMirrorLogRegionSizeTrwae drobne numerReadAheadSectors cenyStripesStripeSizeZerowanie pierwszej KBNazwa?Rozmiar (MB)?LogicalExtentsNumber?Mniejsza liczba?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Operacja nie jest obslugiwana!Edytuj partycjeSwitch partitioning schemeFormatuj jako RAIDFormatuj jak LVM PVSzyfrowanie (CGD)Bezpieczne kasowanieCofanie zmianCofnij konfiguracjeEdytujWymus odmontowanieSet up entropyNot now, continue!This system seems to lack a cryptographically strong pseudo random number generator. There is not enough entropy available to create secure keys (e.g. ssh host keys). If you plan to use this installation for production work and will for example have ssh host keys generated, we strongly advise to complete the entropy setup now! You may use random data generated on another computer and load it here, or you could enter random characters manually. If you have a USB random number device, connect it now and select the "Re-test" option.Manually input random charactersLoad raw binary random dataImport a NetBSD entropy fileRe-testEnter one line of random characters.They should contain at last 256 bits of randomness, as in 256 coin tosses, 100 throws of a 6-sided die, 64 random hexadecimal digits, or (if you are able to copy & paste output from another machine into this installer) the output from running the following command on another machine whose randomness you trust:A line of any length and content will be accepted and assumed to contain at least 256 bits of randomness. If it actually contains less, the installed system may not be secure.Please select how you want to transfer the random data file to this machine:Download via ftpDownload via httpStart downloadLoad from a NFS shareLoad from a local file system (e.g. a USB device)Path/fileLoad random dataRandom data file pathSelect a server, a share and the file path to load the $0.Since not enough entropy is available on this system, all crytographic operations are suspect to replay attacks. Please only use trustworthy local networks.random data binary fileOn a system with cryptographically strong pseudo random number generator you can create a file with random binary data like this:NetBSD entropy seed fileOn a NetBSD system with cryptographically strong pseudo random number generator you can create an entropy snapshot like this:Path and filenameEnter the unmounted local device and directory on that device where the random data is located.wheel:*:0:root daemon:*:1:daemon kmem:*:2:root sys:*:3:root tty:*:4:root operator:*:5:root mail:*:6: bin:*:7: wsrc:*:9: maildrop:*:11: postfix:*:12: games:*:13: named:*:14: ntpd:*:15: sshd:*:16: _pflogd:*:18: _rwhod:*:19: staff:*:20:root _proxy:*:21: _timedc:*:22: _sdpd:*:23: _httpd:*:24: _mdnsd:*:25: _tests:*:26: _tcpdump:*:27: _tss:*:28: _gpio:*:29: _rtadvd:*:30: guest:*:31:root _unbound:*:32: _nsd:*:33: nvmm:*:34:root _dhcpcd:*:35: nobody:*:39: utmp:*:45: authpf:*:72: users:*:100: dialer:*:117: nogroup:*:32766:  . ..zerowd3pwd3owd3nwd3mwd3lwd3kwd3jwd3iwd3hwd3g wd3f!wd3e"wd3d#wd3c$wd3b%wd3a& wd3'wd2p(wd2o)wd2n*wd2m+wd2l,wd2k-wd2j.wd2i/wd2h0wd2g1wd2f2wd2e3wd2d4wd2c5wd2b6wd2a7 wd28wd1p9wd1o:wd1n;wd1m<wd1l=wd1k>wd1j?wd1i@wd1hAwd1gBwd1fCwd1eDwd1dEwd1cFwd1bGwd1aH wd1Iwd0pJwd0oKwd0nLwd0mMwd0lNwd0kOwd0jPwd0iQwd0hRwd0gSwd0fTwd0eUwd0dVwd0cWwd0bXwd0aY wd0Zurandom[ttypf\ttype]ttypd^ttypc_ttypb`ttypaattyp9bttyp8cttyp7dttyp6ettyp5fttyp4gttyp3httyp2ittyp1jttyp0ktty01ltty00m ttynstdoutostdinpstderrq st1r st0ssd3ptsd3ousd3nvsd3mwsd3lxsd3kysd3jzsd3i{sd3h|sd3g}sd3f~sd3esd3dsd3csd3bsd3a sd3sd2psd2osd2nsd2msd2lsd2ksd2jsd2isd2hsd2gsd2fsd2esd2dsd2csd2bsd2a sd2sd1psd1osd1nsd1msd1lsd1ksd1jsd1isd1hsd1gsd1fsd1esd1dsd1csd1bsd1a sd1sd0psd0osd0nsd0msd0lsd0ksd0jsd0isd0hsd0gsd0fsd0esd0dsd0csd0bsd0a sd0rwd3prwd3orwd3nrwd3mrwd3lrwd3krwd3jrwd3irwd3hrwd3grwd3frwd3erwd3drwd3crwd3brwd3arwd3rwd2prwd2orwd2nrwd2mrwd2lrwd2krwd2jrwd2irwd2hrwd2grwd2frwd2erwd2drwd2crwd2brwd2arwd2rwd1prwd1orwd1nrwd1mrwd1lrwd1krwd1jrwd1irwd1hrwd1grwd1frwd1erwd1drwd1crwd1brwd1arwd1rwd0prwd0orwd0nrwd0mrwd0lrwd0krwd0jrwd0irwd0hrwd0grwd0frwd0erwd0drwd0crwd0brwd0arwd0rst1rst0rsd3prsd3orsd3nrsd3mrsd3lrsd3krsd3jrsd3irsd3hrsd3grsd3frsd3e rsd3d rsd3c rsd3b rsd3a rsd3rsd2prsd2orsd2nrsd2mrsd2lrsd2krsd2jrsd2irsd2hrsd2grsd2frsd2ersd2drsd2crsd2brsd2arsd2rsd1p rsd1o!rsd1n"rsd1m#rsd1l$rsd1k%rsd1j&rsd1i'rsd1h(rsd1g)rsd1f*rsd1e+rsd1d,rsd1c-rsd1b.rsd1a/rsd10rsd0p1rsd0o2rsd0n3rsd0m4rsd0l5rsd0k6rsd0j7rsd0i8rsd0h9rsd0g:rsd0f;rsd0e<rsd0d=rsd0c>rsd0b?rsd0a@rsd0Armd1cBrmd1aCrmd1Drmd0cErmd0aFrmd0Grld7pHrld7oIrld7nJrld7mKrld7lLrld7kMrld7jNrld7iOrld7hPrld7gQrld7fRrld7eSrld7dTrld7cUrld7bVrld7aWrld7Xrld6pYrld6oZrld6n[rld6m\rld6l]rld6k^rld6j_rld6i`rld6harld6gbrld6fcrld6edrld6derld6cfrld6bgrld6ahrld6irld5pjrld5okrld5nlrld5mmrld5lnrld5korld5jprld5iqrld5hrrld5gsrld5ftrld5eurld5dvrld5cwrld5bxrld5ayrld5zrld4p{rld4o|rld4n}rld4m~rld4lrld4krld4jrld4irld4hrld4grld4frld4erld4drld4crld4brld4arld4rld3prld3orld3nrld3mrld3lrld3krld3jrld3irld3hrld3grld3frld3erld3drld3crld3brld3arld3rld2prld2orld2nrld2mrld2lrld2krld2jrld2irld2hrld2grld2frld2erld2drld2crld2brld2arld2rld1prld1orld1nrld1mrld1lrld1krld1jrld1irld1hrld1grld1frld1erld1drld1crld1brld1arld1rld0prld0orld0nrld0mrld0lrld0krld0jrld0irld0hrld0grld0frld0erld0drld0crld0brld0arld0rflash7rflash6rflash5rflash4rflash3rflash2rflash1rflash0rfd1prfd1orfd1nrfd1mrfd1lrfd1krfd1jrfd1irfd1hrfd1grfd1frfd1erfd1drfd1crfd1brfd1arfd1rfd0prfd0orfd0nrfd0mrfd0lrfd0krfd0jrfd0irfd0hrfd0grfd0frfd0erfd0drfd0crfd0brfd0arfd0rdk7rdk6rdk5rdk4rdk3rdk2rdk1rdk0rcd1crcd1arcd1rcd0crcd0arcd0randomptypf ptype ptypd ptypc ptypb ptypaptyp9ptyp8ptyp7ptyp6ptyp5ptyp4ptyp3ptyp2ptyp1ptyp0nullnst1nst0nrst1nrst0 memmd1cmd1a  md1!md0c"md0a# md0$ld7p%ld7o&ld7n'ld7m(ld7l)ld7k*ld7j+ld7i,ld7h-ld7g.ld7f/ld7e0ld7d1ld7c2ld7b3ld7a4 ld75ld6p6ld6o7ld6n8ld6m9ld6l:ld6k;ld6j<ld6i=ld6h>ld6g?ld6f@ld6eAld6dBld6cCld6bDld6aE ld6Fld5pGld5oHld5nIld5mJld5lKld5kLld5jMld5iNld5hOld5gPld5fQld5eRld5dSld5cTld5bUld5aV ld5Wld4pXld4oYld4nZld4m[ld4l\ld4k]ld4j^ld4i_ld4h`ld4gald4fbld4ecld4ddld4celd4bfld4ag ld4hld3pild3ojld3nkld3mlld3lmld3knld3jold3ipld3hqld3grld3fsld3etld3duld3cvld3bwld3ax ld3yld2pzld2o{ld2n|ld2m}ld2l~ld2kld2jld2ild2hld2gld2fld2eld2dld2cld2bld2a ld2ld1pld1old1nld1mld1lld1kld1jld1ild1hld1gld1fld1eld1dld1cld1bld1a ld1ld0pld0old0nld0mld0lld0kld0jld0ild0hld0gld0fld0eld0dld0cld0bld0a ld0ksymskmemklogfullflash7flash6flash5flash4flash3flash2flash1flash0fd1pfd1ofd1nfd1mfd1lfd1kfd1jfd1ifd1hfd1gfd1ffd1efd1dfd1cfd1bfd1a fd1fd0pfd0ofd0nfd0mfd0lfd0kfd0jfd0ifd0hfd0gfd0ffd0efd0dfd0cfd0bfd0a fd0est1est0erst1erst0enst1enst0enrst1enrst0dty01dty00drvctldrum dk7 dk6 dk5 dk4 dk3 dk2 dk1 dk0consttyconsolecd1ccd1a cd1cd0ccd0a cd0 bpf0 bpf ...# A sample configuration for dhcpcd. # See dhcpcd.conf(5) for details. # Allow users of this group to interact with dhcpcd via the control socket. #controlgroup wheel # Inform the DHCP server of our hostname for DDNS. #hostname # Use the hardware address of the interface for the Client ID. #clientid # or # Use the same DUID + IAID as set in DHCPv6 for DHCPv4 ClientID as per RFC4361. # Some non-RFC compliant DHCP servers do not reply with this set. # In this case, comment out duid and enable clientid above. duid # Persist interface configuration when dhcpcd exits. persistent # vendorclassid is set to blank to avoid sending the default of # dhcpcd-::: vendorclassid # A list of options to request from the DHCP server. option domain_name_servers, domain_name, domain_search option classless_static_routes # Respect the network MTU. This is applied to DHCP routes. option interface_mtu # Request a hostname from the network option host_name # Most distributions have NTP support. #option ntp_servers # A ServerID is required by RFC2131. require dhcp_server_identifier # Generate SLAAC address using the Hardware Address of the interface #slaac hwaddr # OR generate Stable Private IPv6 Addresses based from the DUID slaac private root::0:0::0:0:Charlie &:/root:/bin/sh toor:*:0:0::0:0:Bourne-again Superuser:/root:/rescue/sh daemon:*:1:1::0:0:The devil himself:/:/sbin/nologin operator:*:2:5::0:0:System &:/usr/guest/operator:/sbin/nologin bin:*:3:7::0:0:Binaries Commands and Source:/:/sbin/nologin games:*:7:13::0:0:& pseudo-user:/usr/games:/sbin/nologin postfix:*:12:12::0:0:& pseudo-user:/var/spool/postfix:/sbin/nologin named:*:14:14::0:0:& pseudo-user:/var/chroot/named:/sbin/nologin ntpd:*:15:15::0:0:& pseudo-user:/var/chroot/ntpd:/sbin/nologin sshd:*:16:16::0:0:& pseudo-user:/var/chroot/sshd:/sbin/nologin _pflogd:*:18:18::0:0:& pseudo-user:/var/chroot/pflogd:/sbin/nologin _rwhod:*:19:19::0:0:& pseudo-user:/var/rwho:/sbin/nologin _proxy:*:21:21::0:0:Proxy Services:/nonexistent:/sbin/nologin _timedc:*:22:22::0:0:& pseudo-user:/nonexistent:/sbin/nologin _sdpd:*:23:23::0:0:& pseudo-user:/nonexistent:/sbin/nologin _httpd:*:24:24::0:0:& pseudo-user:/var/www:/sbin/nologin _mdnsd:*:25:25::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tests:*:26:26::0:0:& pseudo-user:/nonexistent:/sbin/nologin _tcpdump:*:27:27::0:0:& pseudo-user:/var/chroot/tcpdump:/sbin/nologin _tss:*:28:28::0:0:& pseudo-user:/var/tpm:/sbin/nologin _rtadvd:*:30:30::0:0:& pseudo-user:/var/chroot/rtadvd:/sbin/nologin _unbound:*:32:32::0:0:& pseudo-user:/var/chroot/unbound:/sbin/nologin _nsd:*:33:33::0:0:& pseudo-user:/var/chroot/nsd:/sbin/nologin _dhcpcd:*:35:35::0:0:& pseudo-user:/var/chroot/dhcpcd:/sbin/nologin uucp:*:66:1::0:0:UNIX-to-UNIX Copy:/nonexistent:/sbin/nologin nobody:*:32767:39::0:0:Unprivileged user:/nonexistent:/sbin/nologin  . .. dhcpcd-hooksdhcpcd-run-hooks# $NetBSD: netconfig,v 1.1 2000/06/02 22:54:10 fvdl Exp $ # # The network configuration file. This file is currently only used in # conjunction with the (TI-) RPC code in the C library, unlike its # use in SVR4. # # Entries consist of: # # \ # # # The and fields are always empty in NetBSD. # udp6 tpi_clts v inet6 udp - - tcp6 tpi_cots_ord v inet6 tcp - - udp tpi_clts v inet udp - - tcp tpi_cots_ord v inet tcp - - rawip tpi_raw - inet - - - local tpi_cots_ord - loopback - - - # $NetBSD: protocols,v 1.1 2008/05/01 22:02:54 garbled Exp $ # Shaved down /etc/protocols for installation media hopopt 0 HOPOPT icmp 1 ICMP igmp 2 IGMP ggp 3 GGP ip 4 IP st 5 ST tcp 6 TCP cbt 7 CBT egp 8 EGP igp 9 IGP bbn-rcc-mon 10 BBN-RCC-MON nvp-ii 11 NVP-II pup 12 PUP argus 13 ARGUS emcon 14 EMCON xnet 15 XNET chaos 16 CHAOS udp 17 UDP mux 18 MUX dcn-meas 19 DCN-MEAS hmp 20 HMP prm 21 PRM xns-idp 22 XNS-IDP trunk-1 23 TRUNK-1 trunk-2 24 TRUNK-2 leaf-1 25 LEAF-1 leaf-2 26 LEAF-2 rdp 27 RDP irtp 28 IRTP iso-tp4 29 ISO-TP4 netblt 30 NETBLT mfe-nsp 31 MFE-NSP merit-inp 32 MERIT-INP dccp 33 DCCP 3pc 34 3PC idpr 35 IDPR xtp 36 XTP ddp 37 DDP idpr-cmtp 38 IDPR-CMTP tp++ 39 TP++ il 40 IL ipv6 41 IPv6 sdrp 42 SDRP ipv6-route 43 IPv6-Route ipv6-frag 44 IPv6-Frag idrp 45 IDRP rsvp 46 RSVP gre 47 GRE dsr 48 DSR bna 49 BNA esp 50 ESP ah 51 AH i-nlsp 52 I-NLSP swipe 53 SWIPE narp 54 NARP mobile 55 MOBILE tlsp 56 TLSP skip 57 SKIP ipv6-icmp 58 IPv6-ICMP ipv6-nonxt 59 IPv6-NoNxt ipv6-opts 60 IPv6-Opts cftp 62 CFTP sat-expak 64 SAT-EXPAK kryptolan 65 KRYPTOLAN rvd 66 RVD ippc 67 IPPC sat-mon 69 SAT-MON visa 70 VISA ipcv 71 IPCV cpnx 72 CPNX cphb 73 CPHB wsn 74 WSN pvp 75 PVP br-sat-mon 76 BR-SAT-MON sun-nd 77 SUN-ND wb-mon 78 WB-MON wb-expak 79 WB-EXPAK iso-ip 80 ISO-IP vmtp 81 VMTP secure-vmtp 82 SECURE-VMTP vines 83 VINES ttp 84 TTP nsfnet-igp 85 NSFNET-IGP dgp 86 DGP tcf 87 TCF eigrp 88 EIGRP ospfigp 89 OSPFIGP sprite-rpc 90 Sprite-RPC larp 91 LARP mtp 92 MTP ax.25 93 AX.25 ipip 94 IPIP micp 95 MICP scc-sp 96 SCC-SP etherip 97 ETHERIP encap 98 ENCAP gmtp 100 GMTP ifmp 101 IFMP pnni 102 PNNI pim 103 PIM aris 104 ARIS scps 105 SCPS qnx 106 QNX a/n 107 A/N ipcomp 108 IPComp snp 109 SNP compaq-peer 110 Compaq-Peer ipx-in-ip 111 IPX-in-IP vrrp 112 VRRP pgm 113 PGM l2tp 115 L2TP ddx 116 DDX iatp 117 IATP stp 118 STP srp 119 SRP uti 120 UTI smp 121 SMP sm 122 SM ptp 123 PTP isis 124 ISIS fire 125 FIRE crtp 126 CRTP crudp 127 CRUDP sscopmce 128 SSCOPMCE iplt 129 IPLT sps 130 SPS pipe 131 PIPE sctp 132 SCTP fc 133 FC rsvp-e2e-ignore 134 RSVP-E2E-IGNORE mobility 135 Mobility udplite 136 UDPLite mpls-in-ip 137 MPLS-in-IP use 253 Use use 254 Use fi done # $NetBSD: services,v 1.4 2009/09/20 19:41:35 abs Exp $ # Minimal /etc/services file for install ftp-data 20/tcp ftp-data 20/udp ftp 21/tcp ftp 21/udp bootps 67/tcp bootps 67/udp bootpc 68/tcp bootpc 68/udp tftp 69/tcp tftp 69/udp http 80/tcp sunrpc 111/tcp sunrpc 111/udp sftp 115/tcp sftp 115/udp mftp 349/tcp mftp 349/udp shell 514/tcp kshell 544/tcp kshell 544/udp dhcpv6-client 546/tcp dhcpv6-client 546/udp dhcpv6-server 547/tcp dhcpv6-server 547/udp ftp-agent 574/tcp ftp-agent 574/udp dhcp-failover 647/tcp dhcp-failover 647/udp ftps-data 989/tcp ftps-data 989/udp ftps 990/tcp ftps 990/udp tftp-mcast 1758/tcp tftp-mcast 1758/udp nfs 2049/tcp nfs 2049/udp tftps 3713/tcp tftps 3713/udp kftp-data 6620/tcp kftp-data 6620/udp kftp 6621/tcp kftp 6621/udp mcftp 6622/tcp mcftp 6622/udp  . ..20-resolv.conf 30-hostnamen $? fi if [ -n "$new_domain_name" ]; then set -- $new_domain_name if valid_domainname "$1"; then conf="${conf}domain $1$NL" else syslog err "Invalid domain name: $1" fi # If there is no search this, make this one if [ -z "$new_domain_search" ]; then new_domain_search="$new_domain_name" [ "$new_domain_name" = "$1" ] && warn=true fi fi if [ -n "$new_domain_search" ]; then new_domain_search=$(uniqify $new_domain_search) if valid_domainname_list $new_domain_search; then conf="${conf}search $new_domain_search$NL" elif ! $warn; then syslog err "Invalid domain name in list:" \ "$new_domain_search" fi fi new_domain_name_servers=$(uniqify $new_domain_name_servers) for x in ${new_domain_name_servers}; do conf="${conf}nameserver $x$NL" done if $have_resolvconf; then [ -n "$ifmetric" ] && export IF_METRIC="$ifmetric" printf %s "$conf" | "$resolvconf" -a "$ifname" return $? fi if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" printf %s "$conf" > "$resolv_conf_dir/$ifname" build_resolv_conf } remove_resolv_conf() { if $have_resolvconf; then "$resolvconf" -d "$ifname" -f else if [ -e "$resolv_conf_dir/$ifname" ]; then rm -f "$resolv_conf_dir/$ifname" fi build_resolv_conf fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_domain_name_servers="$new_dhcp6_name_servers" new_domain_search="$new_dhcp6_domain_search" ;; esac if $if_configured; then if $have_resolvconf && [ "$reason" = NOCARRIER_ROAMING ]; then # avoid calling resolvconf -c on CARRIER unless we roam mkdir -p "$nocarrier_roaming_dir" echo " " >"$nocarrier_roaming_dir/$interface" "$resolvconf" -C "$interface.*" elif $have_resolvconf && [ "$reason" = CARRIER ]; then # Not all resolvconf implementations support -c if [ -e "$nocarrier_roaming_dir/$interface" ]; then rm -f "$nocarrier_roaming_dir/$interface" "$resolvconf" -c "$interface.*" fi elif $if_up || [ "$reason" = ROUTERADVERT ]; then add_resolv_conf elif $if_down; then remove_resolv_conf fi fi #!/bin/sh # dhcpcd client configuration script # Handy variables and functions for our hooks to use ifname="$interface${protocol+.}$protocol" from=from signature_base="# Generated by dhcpcd" signature="$signature_base $from $ifname" signature_base_end="# End of dhcpcd" signature_end="$signature_base_end $from $ifname" state_dir=/var/run/dhcpcd/hook-state _detected_init=false : ${if_up:=false} : ${if_down:=false} : ${syslog_debug:=false} # Ensure that all arguments are unique uniqify() { result= for i do case " $result " in *" $i "*);; *) result="$result${result:+ }$i";; esac done echo "$result" } # List interface config files in a directory. # If dhcpcd is running as a single instance then it will have a list of # interfaces in the preferred order. # Otherwise we just use what we have. list_interfaces() { ifaces= for i in $interface_order; do for x in "$1"/$i.*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done done for x in "$1"/*; do [ -f "$x" ] && ifaces="$ifaces${ifaces:+ }${x##*/}" done uniqify $ifaces } # Trim function trim() { var="$*" var=${var#"${var%%[![:space:]]*}"} var=${var%"${var##*[![:space:]]}"} if [ -z "$var" ]; then # So it seems our shell doesn't support wctype(3) patterns # Fall back to sed var=$(echo "$*" | sed -e 's/^[[:space:]]*//;s/[[:space:]]*$//') fi printf %s "$var" } # We normally use sed to extract values using a key from a list of files # but sed may not always be available at the time. key_get_value() { key="$1" shift if command -v sed >/dev/null 2>&1; then sed -n "s/^$key//p" $@ else for x do while read line; do case "$line" in "$key"*) echo "${line##$key}";; esac done < "$x" done fi } # We normally use sed to remove markers from a configuration file # but sed may not always be available at the time. remove_markers() { m1="$1" m2="$2" in_marker=0 shift; shift if command -v sed >/dev/null 2>&1; then sed "/^$m1/,/^$m2/d" $@ else for x do while read line; do case "$line" in "$m1"*) in_marker=1;; "$m2"*) in_marker=0;; *) [ $in_marker = 0 ] && echo "$line";; esac done < "$x" done fi } # Compare two files. comp_file() { [ -e "$1" ] && [ -e "$2" ] || return 1 if command -v cmp >/dev/null 2>&1; then cmp -s "$1" "$2" elif command -v diff >/dev/null 2>&1; then diff -q "$1" "$2" >/dev/null else # Hopefully we're only working on small text files ... [ "$(cat "$1")" = "$(cat "$2")" ] fi } # Compare two files. # If different, replace first with second otherwise remove second. change_file() { if [ -e "$1" ]; then if comp_file "$1" "$2"; then rm -f "$2" return 1 fi fi cat "$2" > "$1" rm -f "$2" return 0 } # Compare two files. # If different, copy or link depending on target type copy_file() { if [ -h "$2" ]; then [ "$(readlink "$2")" = "$1" ] && return 1 ln -sf "$1" "$2" else comp_file "$1" "$2" && return 1 cat "$1" >"$2" fi } # Save a config file save_conf() { if [ -f "$1" ]; then rm -f "$1-pre.$interface" cat "$1" > "$1-pre.$interface" fi } # Restore a config file restore_conf() { [ -f "$1-pre.$interface" ] || return 1 cat "$1-pre.$interface" > "$1" rm -f "$1-pre.$interface" } # Write a syslog entry syslog() { lvl="$1" if [ "$lvl" = debug ]; then ${syslog_debug} || return 0 fi [ -n "$lvl" ] && shift [ -n "$*" ] || return 0 case "$lvl" in err|error) echo "$interface: $*" >&2;; *) echo "$interface: $*";; esac if command -v logger >/dev/null 2>&1; then logger -i -p daemon."$lvl" -t dhcpcd-run-hooks "$interface: $*" fi } # Check for a valid name as per RFC952 and RFC1123 section 2.1 valid_domainname() { name="$1" [ -z "$name" ] || [ ${#name} -gt 255 ] && return 1 while [ -n "$name" ]; do label="${name%%.*}" [ -z "$label" ] || [ ${#label} -gt 63 ] && return 1 case "$label" in -*|_*|*-|*_) return 1;; *[![:alnum:]_-]*) return 1;; "$name") return 0;; esac name="${name#*.}" done return 0 } valid_domainname_list() { for name do valid_domainname "$name" || return $? done return 0 } # With the advent of alternative init systems, it's possible to have # more than one installed. So we need to try to guess what one we're # using unless overridden by configure. detect_init() { _service_exists="" _service_cmd="" _service_status="" [ -n "$_service_cmd" ] && return 0 if $_detected_init; then [ -n "$_service_cmd" ] return $? fi # Detect the running init system. # As systemd and OpenRC can be installed on top of legacy init # systems we try to detect them first. status="" : ${status:=status} if [ -x /bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/bin/systemctl --quiet is-enabled \$1.service" _service_status="/bin/systemctl --quiet is-active \$1.service" _service_cmd="/bin/systemctl \$2 --no-block \$1.service" elif [ -x /usr/bin/systemctl ] && [ -S /run/systemd/private ]; then _service_exists="/usr/bin/systemctl --quiet is-enabled \$1.service" _service_status="/usr/bin/systemctl --quiet is-active \$1.service" _service_cmd="/usr/bin/systemctl \$2 --no-block \$1.service" elif [ -x /sbin/rc-service ] && { [ -s /libexec/rc/init.d/softlevel ] || [ -s /run/openrc/softlevel ]; } then _service_exists="/sbin/rc-service -e \$1" _service_cmd="/sbin/rc-service \$1 -- -D \$2" elif [ -x /usr/sbin/invoke-rc.d ]; then _service_exists="/usr/sbin/invoke-rc.d --query --quiet \$1 start >/dev/null 2>&1 || [ \$? = 104 ]" _service_cmd="/usr/sbin/invoke-rc.d \$1 \$2" elif [ -x /sbin/service ]; then _service_exists="/sbin/service \$1 >/dev/null 2>&1" _service_cmd="/sbin/service \$1 \$2" elif [ -x /usr/sbin/service ]; then _service_exists="/usr/sbin/service \$1 $status >/dev/null 2>&1" _service_cmd="/usr/sbin/service \$1 \$2" elif [ -x /bin/sv ]; then _service_exists="/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/bin/sv \$2 \$1" elif [ -x /usr/bin/sv ]; then _service_exists="/usr/bin/sv status \$1 >/dev/null 2>&1" _service_cmd="/usr/bin/sv \$2 \$1" elif [ -e /etc/slackware-version ] && [ -d /etc/rc.d ]; then _service_exists="[ -x /etc/rc.d/rc.\$1 ]" _service_cmd="/etc/rc.d/rc.\$1 \$2" _service_status="/etc/rc.d/rc.\$1 status >/dev/null 2>&1" else for x in /etc/init.d/rc.d /etc/rc.d /etc/init.d; do if [ -d $x ]; then _service_exists="[ -x $x/\$1 ]" _service_cmd="$x/\$1 \$2" _service_status="$x/\$1 $status >/dev/null 2>&1" break fi done if [ -e /etc/arch-release ]; then _service_status="[ -e /var/run/daemons/\$1 ]" elif [ "$x" = "/etc/rc.d" ] && [ -e /etc/rc.d/rc.subr ]; then _service_status="$x/\$1 check >/dev/null 2>&1" fi fi _detected_init=true if [ -z "$_service_cmd" ]; then syslog err "could not detect a useable init system" return 1 fi return 0 } # Check a system service exists service_exists() { if [ -z "$_service_exists" ]; then detect_init || return 1 fi eval $_service_exists } # Send a command to a system service service_cmd() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi eval $_service_cmd } # Send a command to a system service if it is running service_status() { if [ -z "$_service_cmd" ]; then detect_init || return 1 fi if [ -n "$_service_status" ]; then eval $_service_status else service_command $1 status >/dev/null 2>&1 fi } # Handy macros for our hooks service_command() { service_exists $1 && service_cmd $1 $2 } service_condcommand() { service_exists $1 && service_status $1 && service_cmd $1 $2 } # We source each script into this one so that scripts run earlier can # remove variables from the environment so later scripts don't see them. # Thus, the user can create their dhcpcd.enter/exit-hook script to configure # /etc/resolv.conf how they want and stop the system scripts ever updating it. for hook in \ /etc/dhcpcd.enter-hook \ /libexec/dhcpcd-hooks/* \ /etc/dhcpcd.exit-hook do case "$hook" in */*~) continue;; esac for skip in $skip_hooks; do case "$hook" in */"$skip") continue 2;; */[0-9][0-9]"-$skip") continue 2;; */[0-9][0-9]"-$skip.sh") continue 2;; esac done if [ -f "$hook" ]; then . "$hook"# Generate /etc/resolv.conf # Support resolvconf(8) if available # We can merge other dhcpcd resolv.conf files into one like resolvconf, # but resolvconf is preferred as other applications like VPN clients # can readily hook into it. # Also, resolvconf can configure local nameservers such as bind # or dnsmasq. This is important as the libc resolver isn't that powerful. resolv_conf_dir="$state_dir/resolv.conf" nocarrier_roaming_dir="$state_dir/roaming" NL=" " : ${resolvconf:=resolvconf} if command -v "$resolvconf" >/dev/null 2>&1; then have_resolvconf=true else have_resolvconf=false fi build_resolv_conf() { cf="$state_dir/resolv.conf.$ifname" # Build a list of interfaces interfaces=$(list_interfaces "$resolv_conf_dir") # Build the resolv.conf header= if [ -n "$interfaces" ]; then # Build the header for x in ${interfaces}; do header="$header${header:+, }$x" done # Build the search list domain=$(cd "$resolv_conf_dir"; \ key_get_value "domain " ${interfaces}) search=$(cd "$resolv_conf_dir"; \ key_get_value "search " ${interfaces}) set -- ${domain} domain="$1" [ -n "$2" ] && search="$search $*" [ -n "$search" ] && search="$(uniqify $search)" [ "$domain" = "$search" ] && search= [ -n "$domain" ] && domain="domain $domain$NL" [ -n "$search" ] && search="search $search$NL" # Build the nameserver list srvs=$(cd "$resolv_conf_dir"; \ key_get_value "nameserver " ${interfaces}) for x in $(uniqify $srvs); do servers="${servers}nameserver $x$NL" done fi header="$signature_base${header:+ $from }$header" # Assemble resolv.conf using our head and tail files [ -f "$cf" ] && rm -f "$cf" [ -d "$resolv_conf_dir" ] || mkdir -p "$resolv_conf_dir" echo "$header" > "$cf" if [ -f /etc/resolv.conf.head ]; then cat /etc/resolv.conf.head >> "$cf" else echo "# /etc/resolv.conf.head can replace this line" >> "$cf" fi printf %s "$domain$search$servers" >> "$cf" if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >> "$cf" else echo "# /etc/resolv.conf.tail can replace this line" >> "$cf" fi if change_file /etc/resolv.conf "$cf"; then chmod 644 /etc/resolv.conf fi rm -f "$cf" } # Extract any ND DNS options from the RA # Obey the lifetimes eval_nd_dns() { eval rdnsstime=\$nd${i}_rdnss${j}_lifetime if [ -n "$rdnsstime" ]; then ltime=$(($rdnsstime - $offset)) if [ "$ltime" -gt 0 ]; then eval rdnss=\$nd${i}_rdnss${j}_servers if [ -n "$rdnss" ]; then new_rdnss="$new_rdnss${new_rdnss:+ }$rdnss" fi fi fi eval dnssltime=\$nd${i}_dnssl${j}_lifetime if [ -n "$dnssltime" ]; then ltime=$(($dnssltime - $offset)) if [ "$ltime" -gt 0 ]; then eval dnssl=\$nd${i}_dnssl${j}_search if [ -n "$dnssl" ]; then new_dnssl="$new_dnssl${new_dnssl:+ }$dnssl" fi fi fi # Break when we don't have either [ -z "$rdnsstime" ] && [ -z "$dnssltime" ] && return 1 j=$(($j + 1)) return 0 } add_resolv_conf() { conf="$signature$NL" warn=true # Loop to extract the ND DNS options using our indexed shell values i=1 j=1 while true; do eval acquired=\$nd${i}_acquired [ -z "$acquired" ] && break eval now=\$nd${i}_now [ -z "$now" ] && break offset=$(($now - $acquired)) while true; do eval_nd_dns || break done i=$(($i + 1)) j=1 done [ -n "$new_rdnss" ] && \ new_domain_name_servers="$new_domain_name_servers${new_domain_name_servers:+ }$new_rdnss" [ -n "$new_dnssl" ] && \ new_domain_search="$new_domain_search${new_domain_search:+ }$new_dnssl" # Derive a new domain from our various hostname options if [ -z "$new_domain_name" ]; then if [ "$new_dhcp6_fqdn" != "${new_dhcp6_fqdn#*.}" ]; then new_domain_name="${new_dhcp6_fqdn#*.}" elif [ "$new_fqdn" != "${new_fqdn#*.}" ]; then new_domain_name="${new_fqdn#*.}" elif [ "$new_host_name" != "${new_host_name#*.}" ]; then new_domain_name="${new_host_name#*.}" fi fi # If we don't have any configuration, remove it if [ -z "$new_domain_name_servers" ] && [ -z "$new_domain_name" ] && [ -z "$new_domain_search" ]; then remove_resolv_conf retur# Set the hostname from DHCP data if required # A hostname can either be a short hostname or a FQDN. # hostname_fqdn=true # hostname_fqdn=false # hostname_fqdn=server # A value of server means just what the server says, don't manipulate it. # This could lead to an inconsistent hostname on a DHCPv4 and DHCPv6 network # where the DHCPv4 hostname is short and the DHCPv6 has an FQDN. # DHCPv6 has no hostname option. # RFC4702 section 3.1 says FQDN should be prefered over hostname. # # As such, the default is hostname_fqdn=true so that a consistent hostname # is always assigned. : ${hostname_fqdn:=true} # If we used to set the hostname, but relinquish control of it, we should # reset to the default value. : ${hostname_default=} # Some systems don't have hostname(1) _hostname() { if [ -z "${1+x}" ]; then if [ -r /proc/sys/kernel/hostname ]; then read name /dev/null 2>/dev/null; then hostname elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -n kern.hostname elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -n kernel.hostname else return 1 fi return $? fi if [ -w /proc/sys/kernel/hostname ]; then echo "$1" >/proc/sys/kernel/hostname elif [ -n "$1" ] && command -v hostname >/dev/null 2>&1; then hostname "$1" elif sysctl kern.hostname >/dev/null 2>&1; then sysctl -w "kern.hostname=$1" >/dev/null elif sysctl kernel.hostname >/dev/null 2>&1; then sysctl -w "kernel.hostname=$1" >/dev/null else # May fail to set a blank hostname hostname "$1" fi } is_default_hostname() { case "$1" in ""|"$hostname_default"|localhost|localhost.localdomain) return 0;; esac return 1 } need_hostname() { # Always load the hostname variable for future use hostname="$(_hostname)" is_default_hostname "$hostname" && return 0 case "$force_hostname" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) return 0;; esac if [ -n "$old_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then [ "$hostname" = "$old_fqdn" ] else [ "$hostname" = "${old_fqdn%%.*}" ] fi elif [ -n "$old_host_name" ]; then if ${hfqdn}; then if [ -n "$old_domain_name" ] && [ "$old_host_name" = "${old_host_name#*.}" ] then [ "$hostname" = \ "$old_host_name.$old_domain_name" ] else [ "$hostname" = "$old_host_name" ] fi elif ${hshort}; then [ "$hostname" = "${old_host_name%%.*}" ] else [ "$hostname" = "$old_host_name" ] fi else # No old hostname false fi } try_hostname() { [ "$hostname" = "$1" ] && return 0 if valid_domainname "$1"; then syslog info "Setting hostname: $1" _hostname "$1" else syslog err "Invalid hostname: $1" fi } set_hostname() { hfqdn=false hshort=false case "$hostname_fqdn" in [Yy][Ee][Ss]|[Tt][Rr][Uu][Ee]|1) hfqdn=true;; ""|[Ss][Ee][Rr][Vv][Ee][Rr]) ;; *) hshort=true;; esac need_hostname || return 0 if [ -n "$new_fqdn" ]; then if ${hfqdn} || ! ${hshort}; then try_hostname "$new_fqdn" else try_hostname "${new_fqdn%%.*}" fi elif [ -n "$new_host_name" ]; then if ${hfqdn}; then if [ -n "$new_domain_name" ] && [ "$new_host_name" = "${new_host_name#*.}" ] then try_hostname "$new_host_name.$new_domain_name" else try_hostname "$new_host_name" fi elif ${hshort}; then try_hostname "${new_host_name%%.*}" else try_hostname "$new_host_name" fi elif ! is_default_hostname "$hostname"; then try_hostname "$hostname_default" fi } # For ease of use, map DHCP6 names onto our DHCP4 names case "$reason" in BOUND6|RENEW6|REBIND6|REBOOT6|INFORM6) new_fqdn="$new_dhcp6_fqdn" old_fqdn="$old_dhcp6_fqdn" ;; esac if $if_configured && $if_up && [ "$reason" != ROUTERADVERT ]; then set_hostname fi ... ... . .. chown dhcpcd  disklabel dkctl drvctl fdisk fsck fsck_ffs  fsck_msdos gpt halt ifconfig init mknod mount  mount_cd9660  mount_ext2fs  mount_ffs  mount_kernfs  mount_mfs  mount_msdos  mount_nfs  mount_tmpfs newfs  newfs_ext2fs  newfs_msdos ping reboot restore route rrestore shutdown slattach swapctl sysctl dumount ... ... . .. binmdecsbinshare . .. cu ftp gunzip gzcat gzip less more progress sed tar tip Htset ... . .. chroot . ..misc ... . .. db log  run spool ... ...  ...  . .. lock  . ..